4LZRA

Crystal structure of brd4(1) bound to colchicine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
127
structure length
127
Chain Sequence
AMNPPPPETSNPNKPKRQTNQLEYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLEDNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALESLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title 4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 39
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lzrA01
3P1DA 4LC2A 4QR5A 3HMHA 4J1PA 4GPJA 4YAXA 4NXJA 4HXLA 5EWDA 2RO1A 4PCEA 5LVRA 2KTBB 5BT4A 5DW2A 5HFRA 3DAIA 4NR8A 4QSSA 4O70A 5CQ6A 5HRVA 5ENCA 4A9MA 5ENEA 2YEKA 3AADA 2DVQA 3S92A 4A9NA 5I7YA 5FB1A 2OO1A 4XYAA 3NXBA 5ENJA 3HMEA 2DATA 4TZ8A 3UW9A 3UVYA 4QSWA 5DKHA 4KV4A 3P5OA 3U5KA 5C7NA 1F68A 5D3PA 4YYHA 4BW2A 2F6NA 4HXRA 5HM0A 4QEUA 5ENIA 5IBNA 3P1EA 5EWCA 4QUUA 3LQJA 4HXOA 3P1CA 3AQAA 4HXMA 4QC3A 5II2A 5C89A 5KTUA 2R0VA 4UYHA 5F25A 5FE0A 5KTXA 2YW5A 4J3IA 5AD3A 4A9IA 5F1LA 5FH6A 5FBXA 5CQ8A 5CQAA 5F3AA 5IG6A 2OUOA 4ALGA 4NYXA 5FFVA 5DFCA 2G4AA 5AD2A 4DONA 4CUUA 5HFQA 5EA1A 3UVDA 4YYIA 4YATA 5EICA 4LZRA 4XY8A 5D3JA 4PY6A 4QSVA 4CFLA 2RS9B 5JWMA 4OGIA 5H85A 5EM3A 5FE1A 2E7NA 5FE7A 5LKXA 5K29A 5I86A 5FDZA 4UIYA 3FKMX 3QZSA 2D9EA 5A83A 4Q0NA 4CFKA 5DLZA 2DVRA 4LRGA 4UIUA 5I29A 1JSPB 5CQ4A 1WUGA 4TYLA 4UYEA 3HMFA 4Z1SA 5EPSA 4YY4A 2YDWA 4CUTA 5HQ6A 4PCIA 4N4GA 4BW1A 3Q2EA 4HXPA 4QR3A 4LYSA 5EGUA 5D7XA 5L8TA 4LDFA 4TU6A 5ACYA 5A5PA 4ZW1A 5I89A 4TZ2A 4O7AA 4O7FA 4O75A 5EWWA 4LYWA 2D82A 5KO4A 5F2PA 5DKDA 5D0CA 5IGNA 5HQ7A 4HBWA 5FE8A 4QBMA 5FH8A 4CUQA 3LQIA 4YADA 5FG6A 4O77A 4F3IA 5E9IA 4UIXA 4KCXA 3U5PA 4AKNA 5LKUA 5DY7A 3G0LA 5DYCA 5LJ1A 4YK0A 4Y03A 5D24A 5H1TA 3LQHA 2R0SA 2H60A 5L96A 4NRCA 4O78A 4A9JA 5FFWA 3DWYA 3LJWA 4QEWA 5COIA 5EWVA 5IGMA 5ETDA 4O7BA 5EWHA 2I8NA 5HJCA 3JVLA 5C85A 2RNWA 4TQNA 4YBSA 5EISA 5C8GA 5I88A 4CUPA 4O72A 2E7OA 3Q2FA 2YEMA 4TS8A 4NS5A 4Z6HA 5JI8A 5LKZA 1X0JA 4A9KA 5A5SA 3MB4A 5DX4A 4UIWA 4A9HA 5HQ5A 5FG4A 4ZQLA 2N9GA 4HXNA 2RI7A 5I7XA 5CUEA 3UV4A 4YYMA 2L5EA 5FE4A 4UITA 5EP7A 5CY9A 4NUEA 5LUUA 4QY4A 2R0YA 3D7CA 2WP1A 4IORA 5FG5A 2DKWA 4RVRA 4TU4A 5CUDA 5CUCA 2YYNA 4QR4A 4QSUA 2RNXA 4BHWA 4PTBA 5FE9A 4NR5A 4QSQA 5EV9A 5DYXA 5ENGA 5H1UA 3U5LA 5L99A 5F1HA 4YABA 4ZC9A 5HELA 4UYFA 3P1FA 4BW4A 3K2JA 5KHMA 5A5NA 5CGPA 4MR3A 4HBXA 4TTEA 4YC9A 4MR5A 4CLBA 5E7DA 4IOQA 4C67A 4KV1A 1N72A 5D3TA 5KU3A 4NYVA 5CZGA 5BT5A 4IR4A 5D26A 3QZTA 4MEQA 3MXFA 4NRBA 4CL9A 4UIZA 5DBMA 5BT3A 3MB3A 4UYFB 3U5JA 4NR4A 4UYDA 5L97A 2FSAA 4QUTA 4YYNA 5EQ1A 4YY6A 4NYWA 4QYDA 4IR3A 4HBYA 2YELA 5DYUA 4N4FA 5AMEA 5HRWA 3I3JA 3QZVA 4XUAA 5CPEA 5A5QA 5D3SA 5C4QA 3GG3A 4QB3A 4N3WA 3MUKA 5CFWA 5HLSA 4PS5A 4YBTA 4QSTA 4OGJA 4UIVA 5F5ZA 5DYAA 5CQTA 4E96A 4O76A 3UVWA 4BJXA 5D3LA 5I40A 5IGLA 3U5OA 4LZSA 4YYGA 4MR6A 5A82A 5FFYA 4A9EA 5E74A 3U5MA 5FE2A 4Z93A 4OUFA 4X2IA 4NUCA 3JVJA 5EK9A 4J0SA 5FE5A 3MULA 1ZS5A 5D3NA 3UV2A 1JM4B 2E3KA 4HXKA 5E9LA 5CS8A 3O37A 5EVAA 3ZYUA 4C66A 5E9YA 4CURA 2WP2A 4IR5A 3IU5A 2GRCA 4QYLA 5KTWA 5ENFA 4LR6A 4QSPA 2L85A 4O71A 5CRZA 4WHWA 5A85A 4XY9A 3JVKA 5ETBA 4QNSA 3O35A 5II1A 5E9MA 5D25A 3UV5A 5EPRA 4NUDA 2RNYA 3RCWA 4MEOA 5H1VA 4QSXA 4Q0OA 4LZ2A 5G4RA 5E73A 4A9LA 5D3HA 5F61A 4TT2A 3S91A 4QEVA 3O36A 4NR9A 5I83A 5EPBA 5IGKA 4MENA 5TB6A 4MR4A 5DFBA 4NR7A 4A9FA 4Z6IA 5E3DA 4QC1A 4IOOA 4QSRA 5IIDA 3O33A 3SVFA 5AMFA 2F6JA 4O7CA 5D3RA 5E0RA 5CTLA 2RFJA 5DKCA 5CU8A 4CUSA 5DW1A 5FE6A 5LJ0A 3LXJA 4FLPA 4QZSA 4YH3A 5LJ2A 2OSSA 5FH7A 5LVQA 3JVMA 5A81A 5I1QA 2DVVA 5CUBA 3ONIA 4NR6A 5C87A 5I80A 5HEMA 1EQFA 3IU6A 5A7CA 2L84A 3TLPA 2DVSA 4LYIA 3SVHA 5HENA 5G4SA 5F62A 2MJVB 5EU1A 1WUMA 5CP5A 5DFDA 2YQDA 3O34A 5F63A 3SVGA 5CQ5A 4YYKA 4MEPA 4TT4A 5ENBA 3G0JA 5CQ3A 4O7EA 4A9OA 1E6IA 5CUAA 4UYGA 4NQNA 5L98A 4NRAA 5J0DA 4ALHA 5TCMA 4PKLA 2I7KA 2DWWA 5A5OA 3MQMA 3UVXA 5A5RA 5CRMA 4N4IA 2R10A 4WIVA 5F36A 5ENHA 5L8UA 5HRXA 5F60A 5E9VA 4HBVA 4XUBA 5EI4A 4J0RA 2NXBA 5FE3A 4YYJA 5LKTA 4YYDA 4NQMA 4HXSA 2LSPB 4TT6A 4WHUA 5E3GA 4BW3A 4YH4A 4YBMA 5E9KA 4IR6A 5CQ7A 5DLXA 5CUGA 4N4HA 5HCLA 4Z1QA 4O74A 3U5NA 5FB0A
chains in the Genus database with same CATH superfamily
3P1DA 4LC2A 4QR5A 3HMHA 4J1PA 4GPJA 4YAXA 4NXJA 4HXLA 5EWDA 4AKIA 2RO1A 4PCEA 5LVRA 2KTBB 5BT4A 5DW2A 5HFRA 3DAIA 4NR8A 4QSSA 4O70A 5CQ6A 5HRVA 4AKGA 5ENCA 4A9MA 5ENEA 2YEKA 3AADA 2DVQA 3S92A 4A9NA 5I7YA 5FB1A 2OO1A 4XYAA 3NXBA 5ENJA 3HMEA 2DATA 4TZ8A 3UW9A 3UVYA 4QSWA 5DKHA 4KV4A 3P5OA 3U5KA 5C7NA 1F68A 5D3PA 4YYHA 4BW2A 2F6NA 4HXRA 5HM0A 4QEUA 5ENIA 5IBNA 3P1EA 5EWCA 4QUUA 3LQJA 4HXOA 3P1CA 3AQAA 4HXMA 4QC3A 5II2A 5C89A 5KTUA 2R0VA 4UYHA 5F25A 5FE0A 5KTXA 2YW5A 4J3IA 5AD3A 4A9IA 5F1LA 5FH6A 5FBXA 5CQ8A 5CQAA 5F3AA 5IG6A 2OUOA 4ALGA 4NYXA 5FFVA 5DFCA 2G4AA 5AD2A 4DONA 4CUUA 5HFQA 5EA1A 3UVDA 4YYIA 4YATA 5EICA 4LZRA 4XY8A 5D3JA 4PY6A 4QSVA 4CFLA 2RS9B 5JWMA 4OGIA 5H85A 5EM3A 5FE1A 2E7NA 5FE7A 5LKXA 5K29A 5I86A 5FDZA 4UIYA 3FKMX 3QZSA 2D9EA 5A83A 4Q0NA 4CFKA 5DLZA 2DVRA 4LRGA 4UIUA 5I29A 1JSPB 5CQ4A 1WUGA 4TYLA 4UYEA 3HMFA 4Z1SA 5EPSA 4YY4A 2YDWA 4CUTA 5HQ6A 4PCIA 4N4GA 4BW1A 3Q2EA 4HXPA 4QR3A 4LYSA 5EGUA 5D7XA 5L8TA 4LDFA 4TU6A 5ACYA 5A5PA 4ZW1A 5I89A 4TZ2A 4O7AA 4O7FA 4O75A 5EWWA 4LYWA 2D82A 5KO4A 5F2PA 5DKDA 5D0CA 5IGNA 5HQ7A 4HBWA 5FE8A 4QBMA 5FH8A 4CUQA 3LQIA 4YADA 4AI6A 5FG6A 4O77A 4F3IA 5E9IA 4UIXA 4KCXA 3U5PA 4AKNA 5LKUA 5DY7A 3G0LA 5DYCA 5LJ1A 4YK0A 4Y03A 5D24A 5H1TA 3LQHA 2R0SA 2H60A 5L96A 4NRCA 4O78A 4A9JA 5FFWA 3DWYA 3LJWA 4QEWA 5COIA 5EWVA 5IGMA 5ETDA 4O7BA 5EWHA 2I8NA 5HJCA 3JVLA 5C85A 2RNWA 4TQNA 4YBSA 5EISA 5C8GA 5I88A 4CUPA 4O72A 2E7OA 3Q2FA 2YEMA 4TS8A 4NS5A 4Z6HA 5JI8A 5LKZA 1X0JA 4A9KA 5A5SA 3MB4A 5DX4A 4UIWA 4A9HA 5HQ5A 5FG4A 4ZQLA 2N9GA 4HXNA 2RI7A 5I7XA 5CUEA 3UV4A 4YYMA 2L5EA 5FE4A 4UITA 5EP7A 5CY9A 4NUEA 5LUUA 4QY4A 2R0YA 3D7CA 2WP1A 4IORA 5FG5A 2DKWA 4RVRA 4TU4A 5CUDA 5CUCA 2YYNA 4QR4A 4QSUA 2RNXA 4BHWA 4PTBA 5FE9A 4NR5A 4QSQA 5EV9A 5DYXA 5ENGA 5H1UA 3U5LA 3ERRA 5L99A 5F1HA 4YABA 4ZC9A 5HELA 4UYFA 3P1FA 4BW4A 3K2JA 5KHMA 5A5NA 5CGPA 4MR3A 4HBXA 4TTEA 4YC9A 4MR5A 4CLBA 5E7DA 4IOQA 4C67A 4KV1A 1N72A 5D3TA 5KU3A 4NYVA 5CZGA 5BT5A 4IR4A 5D26A 3QZTA 4MEQA 3MXFA 4NRBA 4CL9A 4UIZA 5DBMA 5BT3A 3MB3A 4UYFB 3U5JA 4NR4A 4UYDA 5L97A 2FSAA 4QUTA 4YYNA 5EQ1A 4YY6A 4NYWA 4QYDA 4IR3A 4HBYA 2YELA 1PUOA 5DYUA 4N4FA 5AMEA 5HRWA 3I3JA 3QZVA 4XUAA 5CPEA 5A5QA 5D3SA 5C4QA 3GG3A 4QB3A 4N3WA 3MUKA 5CFWA 5HLSA 4PS5A 4YBTA 4QSTA 4OGJA 4UIVA 5F5ZA 5DYAA 5CQTA 4E96A 4O76A 3UVWA 4BJXA 5D3LA 5I40A 5IGLA 3U5OA 4LZSA 4YYGA 4MR6A 5A82A 5FFYA 4A9EA 5E74A 3U5MA 5FE2A 4Z93A 4OUFA 4X2IA 4NUCA 3JVJA 5EK9A 4J0SA 5FE5A 3MULA 1ZS5A 5D3NA 3UV2A 1JM4B 2E3KA 4HXKA 5E9LA 5CS8A 3O37A 5EVAA 3ZYUA 2EJNA 4C66A 5E9YA 4CURA 2WP2A 4IR5A 3IU5A 2GRCA 4QYLA 5KTWA 5ENFA 4LR6A 4QSPA 1ZKRA 2L85A 4O71A 5CRZA 4WHWA 5A85A 4XY9A 3JVKA 5ETBA 4QNSA 3O35A 5II1A 5E9MA 5D25A 3UV5A 3D1DA 5EPRA 4NUDA 2RNYA 3RCWA 4MEOA 5H1VA 4QSXA 4Q0OA 4LZ2A 5G4RA 5E73A 4A9LA 5D3HA 5F61A 4TT2A 3S91A 4QEVA 3O36A 4NR9A 5I83A 5EPBA 5IGKA 3D1BA 4MENA 5TB6A 4MR4A 5DFBA 4NR7A 4A9FA 4Z6IA 5E3DA 4QC1A 4IOOA 4QSRA 5IIDA 3O33A 3SVFA 5AMFA 2F6JA 4O7CA 5D3RA 5E0RA 5CTLA 2RFJA 5DKCA 5CU8A 4CUSA 5DW1A 5FE6A 5LJ0A 3LXJA 4FLPA 4QZSA 4YH3A 5LJ2A 2OSSA 5FH7A 5LVQA 3JVMA 5A81A 5I1QA 2DVVA 4AKHA 5CUBA 3ONIA 4NR6A 5C87A 5I80A 5HEMA 1EQFA 3IU6A 5A7CA 2L84A 3TLPA 2DVSA 4LYIA 3SVHA 5HENA 5G4SA 5F62A 2MJVB 5EU1A 1WUMA 5CP5A 5DFDA 2YQDA 3O34A 5F63A 3SVGA 5CQ5A 4YYKA 4MEPA 4TT4A 5ENBA 3G0JA 5CQ3A 4O7EA 4A9OA 1E6IA 5CUAA 3VKGA 4UYGA 4NQNA 5L98A 4NRAA 5J0DA 4ALHA 3VKHA 5TCMA 4PKLA 2I7KA 2DWWA 5A5OA 3MQMA 3UVXA 5A5RA 5CRMA 4N4IA 2R10A 4WIVA 5F36A 5ENHA 5L8UA 5HRXA 5F60A 5E9VA 4HBVA 4XUBA 5EI4A 4J0RA 2NXBA 5FE3A 4YYJA 5LKTA 4YYDA 4NQMA 4HXSA 2LSPB 4TT6A 4WHUA 5E3GA 4BW3A 4YH4A 4YBMA 5E9KA 4IR6A 5CQ7A 5DLXA 5CUGA 4N4HA 5HCLA 4Z1QA 4O74A 3U5NA 5FB0A
chains in the Genus database with same CATH topology
3P1DA 4LC2A 4QR5A 3HMHA 4J1PA 4GPJA 4YAXA 4NXJA 4HXLA 5EWDA 2RO1A 4PCEA 5LVRA 2KTBB 5BT4A 5DW2A 5HFRA 3DAIA 4NR8A 4QSSA 4O70A 5CQ6A 5HRVA 5ENCA 4A9MA 5ENEA 2YEKA 3AADA 2DVQA 3S92A 4A9NA 5I7YA 5FB1A 2OO1A 4XYAA 3NXBA 5ENJA 3HMEA 2DATA 4TZ8A 3UW9A 3UVYA 4QSWA 5DKHA 4KV4A 3P5OA 3U5KA 5C7NA 1F68A 5D3PA 4YYHA 4BW2A 2F6NA 4HXRA 5HM0A 4QEUA 5ENIA 5IBNA 3P1EA 5EWCA 4QUUA 3LQJA 4HXOA 3P1CA 3AQAA 4HXMA 4QC3A 5II2A 5C89A 5KTUA 2R0VA 4UYHA 5F25A 5FE0A 5KTXA 2YW5A 4J3IA 5AD3A 4A9IA 5F1LA 5FH6A 5FBXA 5CQ8A 5CQAA 5F3AA 5IG6A 2OUOA 4ALGA 4NYXA 5FFVA 5DFCA 2G4AA 5AD2A 4DONA 4CUUA 5HFQA 5EA1A 3UVDA 4YYIA 4YATA 5EICA 4LZRA 4XY8A 5D3JA 4PY6A 4QSVA 4CFLA 2RS9B 5JWMA 4OGIA 5H85A 5EM3A 5FE1A 2E7NA 5FE7A 5LKXA 5K29A 5I86A 5FDZA 4UIYA 3FKMX 3QZSA 2D9EA 5A83A 4Q0NA 4CFKA 5DLZA 2DVRA 4LRGA 4UIUA 5I29A 1JSPB 5CQ4A 1WUGA 4TYLA 4UYEA 3HMFA 4Z1SA 5EPSA 4YY4A 2YDWA 4CUTA 5HQ6A 4PCIA 4N4GA 4BW1A 3Q2EA 4HXPA 4QR3A 4LYSA 5EGUA 5D7XA 5L8TA 4LDFA 4TU6A 5ACYA 5A5PA 4ZW1A 5I89A 4TZ2A 4O7AA 4O7FA 4O75A 5EWWA 4LYWA 2D82A 5KO4A 5F2PA 5DKDA 5D0CA 5IGNA 5HQ7A 4HBWA 5FE8A 4QBMA 5FH8A 4CUQA 3LQIA 4YADA 5FG6A 4O77A 4F3IA 5E9IA 4UIXA 4KCXA 3U5PA 4AKNA 5LKUA 5DY7A 3G0LA 5DYCA 5LJ1A 4YK0A 4Y03A 5D24A 5H1TA 3LQHA 2R0SA 2H60A 5L96A 4NRCA 4O78A 4A9JA 5FFWA 3DWYA 3LJWA 4QEWA 5COIA 5EWVA 5IGMA 5ETDA 4O7BA 5EWHA 2I8NA 5HJCA 3JVLA 5C85A 2RNWA 4TQNA 4YBSA 5EISA 5C8GA 5I88A 4CUPA 4O72A 2E7OA 3Q2FA 2YEMA 4TS8A 4NS5A 4Z6HA 5JI8A 5LKZA 1X0JA 4A9KA 5A5SA 3MB4A 5DX4A 4UIWA 4A9HA 5HQ5A 5FG4A 4ZQLA 2N9GA 4HXNA 2RI7A 5I7XA 5CUEA 3UV4A 4YYMA 2L5EA 5FE4A 4UITA 5EP7A 5CY9A 4NUEA 5LUUA 4QY4A 2R0YA 3D7CA 2WP1A 4IORA 5FG5A 2DKWA 4RVRA 4TU4A 5CUDA 5CUCA 2YYNA 4QR4A 4QSUA 2RNXA 4BHWA 4PTBA 5FE9A 4NR5A 4QSQA 5EV9A 5DYXA 5ENGA 5H1UA 3U5LA 5L99A 5F1HA 4YABA 4ZC9A 5HELA 4UYFA 3P1FA 4BW4A 3K2JA 5KHMA 5A5NA 5CGPA 4MR3A 4HBXA 4TTEA 4YC9A 4MR5A 4CLBA 5E7DA 4IOQA 4C67A 4KV1A 1N72A 5D3TA 5KU3A 4NYVA 5CZGA 5BT5A 4IR4A 5D26A 3QZTA 4MEQA 3MXFA 4NRBA 4CL9A 4UIZA 5DBMA 5BT3A 3MB3A 4UYFB 3U5JA 4NR4A 4UYDA 5L97A 2FSAA 4QUTA 4YYNA 5EQ1A 4YY6A 4NYWA 4QYDA 4IR3A 4HBYA 2YELA 5DYUA 4N4FA 5AMEA 5HRWA 3I3JA 3QZVA 4XUAA 5CPEA 5A5QA 5D3SA 5C4QA 3GG3A 4QB3A 4N3WA 3MUKA 5CFWA 5HLSA 4PS5A 4YBTA 4QSTA 4OGJA 4UIVA 5F5ZA 5DYAA 5CQTA 4E96A 4O76A 3UVWA 4BJXA 5D3LA 5I40A 5IGLA 3U5OA 4LZSA 4YYGA 4MR6A 5A82A 5FFYA 4A9EA 5E74A 3U5MA 5FE2A 4Z93A 4OUFA 4X2IA 4NUCA 3JVJA 5EK9A 4J0SA 5FE5A 3MULA 1ZS5A 5D3NA 3UV2A 1JM4B 2E3KA 4HXKA 5E9LA 5CS8A 3O37A 5EVAA 3ZYUA 4C66A 5E9YA 4CURA 2WP2A 4IR5A 3IU5A 2GRCA 4QYLA 5KTWA 5ENFA 4LR6A 4QSPA 2L85A 4O71A 5CRZA 4WHWA 5A85A 4XY9A 3JVKA 5ETBA 4QNSA 3O35A 5II1A 5E9MA 5D25A 3UV5A 5EPRA 4NUDA 2RNYA 3RCWA 4MEOA 5H1VA 4QSXA 4Q0OA 4LZ2A 5G4RA 5E73A 4A9LA 5D3HA 5F61A 4TT2A 3S91A 4QEVA 3O36A 4NR9A 5I83A 5EPBA 5IGKA 4MENA 5TB6A 4MR4A 5DFBA 4NR7A 4A9FA 4Z6IA 5E3DA 4QC1A 4IOOA 4QSRA 5IIDA 3O33A 3SVFA 5AMFA 2F6JA 4O7CA 5D3RA 5E0RA 5CTLA 2RFJA 5DKCA 5CU8A 4CUSA 5DW1A 5FE6A 5LJ0A 3LXJA 4FLPA 4QZSA 4YH3A 5LJ2A 2OSSA 5FH7A 5LVQA 3JVMA 5A81A 5I1QA 2DVVA 5CUBA 3ONIA 4NR6A 5C87A 5I80A 5HEMA 1EQFA 3IU6A 5A7CA 2L84A 3TLPA 2DVSA 4LYIA 3SVHA 5HENA 5G4SA 5F62A 2MJVB 5EU1A 1WUMA 5CP5A 5DFDA 2YQDA 3O34A 5F63A 3SVGA 5CQ5A 4YYKA 4MEPA 4TT4A 5ENBA 3G0JA 5CQ3A 4O7EA 4A9OA 1E6IA 5CUAA 4UYGA 4NQNA 5L98A 4NRAA 5J0DA 4ALHA 5TCMA 4PKLA 2I7KA 2DWWA 5A5OA 3MQMA 3UVXA 5A5RA 5CRMA 4N4IA 2R10A 4WIVA 5F36A 5ENHA 5L8UA 5HRXA 5F60A 5E9VA 4HBVA 4XUBA 5EI4A 4J0RA 2NXBA 5FE3A 4YYJA 5LKTA 4YYDA 4NQMA 4HXSA 2LSPB 4TT6A 4WHUA 5E3GA 4BW3A 4YH4A 4YBMA 5E9KA 4IR6A 5CQ7A 5DLXA 5CUGA 4N4HA 5HCLA 4Z1QA 4O74A 3U5NA 5FB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1D A;  4LC2 A;  4QR5 A;  3HMH A;  4J1P A;  4GPJ A;  4YAX A;  4NXJ A;  4HXL A;  5EWD A;  2RO1 A;  4PCE A;  5LVR A;  2KTB B;  5BT4 A;  5DW2 A;  5HFR A;  3DAI A;  4NR8 A;  4QSS A;  4O70 A;  5CQ6 A;  5HRV A;  5ENC A;  4A9M A;  5ENE A;  2YEK A;  3AAD A;  2DVQ A;  3S92 A;  4A9N A;  5I7Y A;  5FB1 A;  2OO1 A;  4XYA A;  3NXB A;  5ENJ A;  3HME A;  2DAT A;  4TZ8 A;  3UW9 A;  3UVY A;  4QSW A;  5DKH A;  4KV4 A;  3P5O A;  3U5K A;  5C7N A;  1F68 A;  5D3P A;  4YYH A;  4BW2 A;  2F6N A;  4HXR A;  5HM0 A;  4QEU A;  5ENI A;  5IBN A;  3P1E A;  5EWC A;  4QUU A;  3LQJ A;  4HXO A;  3P1C A;  3AQA A;  4HXM A;  4QC3 A;  5II2 A;  5C89 A;  5KTU A;  2R0V A;  4UYH A;  5F25 A;  5FE0 A;  5KTX A;  2YW5 A;  4J3I A;  5AD3 A;  4A9I A;  5F1L A;  5FH6 A;  5FBX A;  5CQ8 A;  5CQA A;  5F3A A;  5IG6 A;  2OUO A;  4ALG A;  4NYX A;  5FFV A;  5DFC A;  2G4A A;  5AD2 A;  4DON A;  4CUU A;  5HFQ A;  5EA1 A;  3UVD A;  4YYI A;  4YAT A;  5EIC A;  4LZR A;  4XY8 A;  5D3J A;  4PY6 A;  4QSV A;  4CFL A;  2RS9 B;  5JWM A;  4OGI A;  5H85 A;  5EM3 A;  5FE1 A;  2E7N A;  5FE7 A;  5LKX A;  5K29 A;  5I86 A;  5FDZ A;  4UIY A;  3FKM X;  3QZS A;  2D9E A;  5A83 A;  4Q0N A;  4CFK A;  5DLZ A;  2DVR A;  4LRG A;  4UIU A;  5I29 A;  1JSP B;  5CQ4 A;  1WUG A;  4TYL A;  4UYE A;  3HMF A;  4Z1S A;  5EPS A;  4YY4 A;  2YDW A;  4CUT A;  5HQ6 A;  4PCI A;  4N4G A;  4BW1 A;  3Q2E A;  4HXP A;  4QR3 A;  4LYS A;  5EGU A;  5D7X A;  5L8T A;  4LDF A;  4TU6 A;  5ACY A;  5A5P A;  4ZW1 A;  5I89 A;  4TZ2 A;  4O7A A;  4O7F A;  4O75 A;  5EWW A;  4LYW A;  2D82 A;  5KO4 A;  5F2P A;  5DKD A;  5D0C A;  5IGN A;  5HQ7 A;  4HBW A;  5FE8 A;  4QBM A;  5FH8 A;  4CUQ A;  3LQI A;  4YAD A;  5FG6 A;  4O77 A;  4F3I A;  5E9I A;  4UIX A;  4KCX A;  3U5P A;  4AKN A;  5LKU A;  5DY7 A;  3G0L A;  5DYC A;  5LJ1 A;  4YK0 A;  4Y03 A;  5D24 A;  5H1T A;  3LQH A;  2R0S A;  2H60 A;  5L96 A;  4NRC A;  4O78 A;  4A9J A;  5FFW A;  3DWY A;  3LJW A;  4QEW A;  5COI A;  5EWV A;  5IGM A;  5ETD A;  4O7B A;  5EWH A;  2I8N A;  5HJC A;  3JVL A;  5C85 A;  2RNW A;  4TQN A;  4YBS A;  5EIS A;  5C8G A;  5I88 A;  4CUP A;  4O72 A;  2E7O A;  3Q2F A;  2YEM A;  4TS8 A;  4NS5 A;  4Z6H A;  5JI8 A;  5LKZ A;  1X0J A;  4A9K A;  5A5S A;  3MB4 A;  5DX4 A;  4UIW A;  4A9H A;  5HQ5 A;  5FG4 A;  4ZQL A;  2N9G A;  4HXN A;  2RI7 A;  5I7X A;  5CUE A;  3UV4 A;  4YYM A;  2L5E A;  5FE4 A;  4UIT A;  5EP7 A;  5CY9 A;  4NUE A;  5LUU A;  4QY4 A;  2R0Y A;  3D7C A;  2WP1 A;  4IOR A;  5FG5 A;  2DKW A;  4RVR A;  4TU4 A;  5CUD A;  5CUC A;  2YYN A;  4QR4 A;  4QSU A;  2RNX A;  4BHW A;  4PTB A;  5FE9 A;  4NR5 A;  4QSQ A;  5EV9 A;  5DYX A;  5ENG A;  5H1U A;  3U5L A;  5L99 A;  5F1H A;  4YAB A;  4ZC9 A;  5HEL A;  4UYF A;  3P1F A;  4BW4 A;  3K2J A;  5KHM A;  5A5N A;  5CGP A;  4MR3 A;  4HBX A;  4TTE A;  4YC9 A;  4MR5 A;  4CLB A;  5E7D A;  4IOQ A;  4C67 A;  4KV1 A;  1N72 A;  5D3T A;  5KU3 A;  4NYV A;  5CZG A;  5BT5 A;  4IR4 A;  5D26 A;  3QZT A;  4MEQ A;  3MXF A;  4NRB A;  4CL9 A;  4UIZ A;  5DBM A;  5BT3 A;  3MB3 A;  4UYF B;  3U5J A;  4NR4 A;  4UYD A;  5L97 A;  2FSA A;  4QUT A;  4YYN A;  5EQ1 A;  4YY6 A;  4NYW A;  4QYD A;  4IR3 A;  4HBY A;  2YEL A;  5DYU A;  4N4F A;  5AME A;  5HRW A;  3I3J A;  3QZV A;  4XUA A;  5CPE A;  5A5Q A;  5D3S A;  5C4Q A;  3GG3 A;  4QB3 A;  4N3W A;  3MUK A;  5CFW A;  5HLS A;  4PS5 A;  4YBT A;  4QST A;  4OGJ A;  4UIV A;  5F5Z A;  5DYA A;  5CQT A;  4E96 A;  4O76 A;  3UVW A;  4BJX A;  5D3L A;  5I40 A;  5IGL A;  3U5O A;  4LZS A;  4YYG A;  4MR6 A;  5A82 A;  5FFY A;  4A9E A;  5E74 A;  3U5M A;  5FE2 A;  4Z93 A;  4OUF A;  4X2I A;  4NUC A;  3JVJ A;  5EK9 A;  4J0S A;  5FE5 A;  3MUL A;  1ZS5 A;  5D3N A;  3UV2 A;  1JM4 B;  2E3K A;  4HXK A;  5E9L A;  5CS8 A;  3O37 A;  5EVA A;  3ZYU A;  4C66 A;  5E9Y A;  4CUR A;  2WP2 A;  4IR5 A;  3IU5 A;  2GRC A;  4QYL A;  5KTW A;  5ENF A;  4LR6 A;  4QSP A;  2L85 A;  4O71 A;  5CRZ A;  4WHW A;  5A85 A;  4XY9 A;  3JVK A;  5ETB A;  4QNS A;  3O35 A;  5II1 A;  5E9M A;  5D25 A;  3UV5 A;  5EPR A;  4NUD A;  2RNY A;  3RCW A;  4MEO A;  5H1V A;  4QSX A;  4Q0O A;  4LZ2 A;  5G4R A;  5E73 A;  4A9L A;  5D3H A;  5F61 A;  4TT2 A;  3S91 A;  4QEV A;  3O36 A;  4NR9 A;  5I83 A;  5EPB A;  5IGK A;  4MEN A;  5TB6 A;  4MR4 A;  5DFB A;  4NR7 A;  4A9F A;  4Z6I A;  5E3D A;  4QC1 A;  4IOO A;  4QSR A;  5IID A;  3O33 A;  3SVF A;  5AMF A;  2F6J A;  4O7C A;  5D3R A;  5E0R A;  5CTL A;  2RFJ A;  5DKC A;  5CU8 A;  4CUS A;  5DW1 A;  5FE6 A;  5LJ0 A;  3LXJ A;  4FLP A;  4QZS A;  4YH3 A;  5LJ2 A;  2OSS A;  5FH7 A;  5LVQ A;  3JVM A;  5A81 A;  5I1Q A;  2DVV A;  5CUB A;  3ONI A;  4NR6 A;  5C87 A;  5I80 A;  5HEM A;  1EQF A;  3IU6 A;  5A7C A;  2L84 A;  3TLP A;  2DVS A;  4LYI A;  3SVH A;  5HEN A;  5G4S A;  5F62 A;  2MJV B;  5EU1 A;  1WUM A;  5CP5 A;  5DFD A;  2YQD A;  3O34 A;  5F63 A;  3SVG A;  5CQ5 A;  4YYK A;  4MEP A;  4TT4 A;  5ENB A;  3G0J A;  5CQ3 A;  4O7E A;  4A9O A;  1E6I A;  5CUA A;  4UYG A;  4NQN A;  5L98 A;  4NRA A;  5J0D A;  4ALH A;  5TCM A;  4PKL A;  2I7K A;  2DWW A;  5A5O A;  3MQM A;  3UVX A;  5A5R A;  5CRM A;  4N4I A;  2R10 A;  4WIV A;  5F36 A;  5ENH A;  5L8U A;  5HRX A;  5F60 A;  5E9V A;  4HBV A;  4XUB A;  5EI4 A;  4J0R A;  2NXB A;  5FE3 A;  4YYJ A;  5LKT A;  4YYD A;  4NQM A;  4HXS A;  2LSP B;  4TT6 A;  4WHU A;  5E3G A;  4BW3 A;  4YH4 A;  4YBM A;  5E9K A;  4IR6 A;  5CQ7 A;  5DLX A;  5CUG A;  4N4H A;  5HCL A;  4Z1Q A;  4O74 A;  3U5N A;  5FB0 A; 
#chains in the Genus database with same CATH topology
 3P1D A;  4LC2 A;  4QR5 A;  3HMH A;  4J1P A;  4GPJ A;  4YAX A;  4NXJ A;  4HXL A;  5EWD A;  4AKI A;  2RO1 A;  4PCE A;  5LVR A;  2KTB B;  5BT4 A;  5DW2 A;  5HFR A;  3DAI A;  4NR8 A;  4QSS A;  4O70 A;  5CQ6 A;  5HRV A;  4AKG A;  5ENC A;  4A9M A;  5ENE A;  2YEK A;  3AAD A;  2DVQ A;  3S92 A;  4A9N A;  5I7Y A;  5FB1 A;  2OO1 A;  4XYA A;  3NXB A;  5ENJ A;  3HME A;  2DAT A;  4TZ8 A;  3UW9 A;  3UVY A;  4QSW A;  5DKH A;  4KV4 A;  3P5O A;  3U5K A;  5C7N A;  1F68 A;  5D3P A;  4YYH A;  4BW2 A;  2F6N A;  4HXR A;  5HM0 A;  4QEU A;  5ENI A;  5IBN A;  3P1E A;  5EWC A;  4QUU A;  3LQJ A;  4HXO A;  3P1C A;  3AQA A;  4HXM A;  4QC3 A;  5II2 A;  5C89 A;  5KTU A;  2R0V A;  4UYH A;  5F25 A;  5FE0 A;  5KTX A;  2YW5 A;  4J3I A;  5AD3 A;  4A9I A;  5F1L A;  5FH6 A;  5FBX A;  5CQ8 A;  5CQA A;  5F3A A;  5IG6 A;  2OUO A;  4ALG A;  4NYX A;  5FFV A;  5DFC A;  2G4A A;  5AD2 A;  4DON A;  4CUU A;  5HFQ A;  5EA1 A;  3UVD A;  4YYI A;  4YAT A;  5EIC A;  4LZR A;  4XY8 A;  5D3J A;  4PY6 A;  4QSV A;  4CFL A;  2RS9 B;  5JWM A;  4OGI A;  5H85 A;  5EM3 A;  5FE1 A;  2E7N A;  5FE7 A;  5LKX A;  5K29 A;  5I86 A;  5FDZ A;  4UIY A;  3FKM X;  3QZS A;  2D9E A;  5A83 A;  4Q0N A;  4CFK A;  5DLZ A;  2DVR A;  4LRG A;  4UIU A;  5I29 A;  1JSP B;  5CQ4 A;  1WUG A;  4TYL A;  4UYE A;  3HMF A;  4Z1S A;  5EPS A;  4YY4 A;  2YDW A;  4CUT A;  5HQ6 A;  4PCI A;  4N4G A;  4BW1 A;  3Q2E A;  4HXP A;  4QR3 A;  4LYS A;  5EGU A;  5D7X A;  5L8T A;  4LDF A;  4TU6 A;  5ACY A;  5A5P A;  4ZW1 A;  5I89 A;  4TZ2 A;  4O7A A;  4O7F A;  4O75 A;  5EWW A;  4LYW A;  2D82 A;  5KO4 A;  5F2P A;  5DKD A;  5D0C A;  5IGN A;  5HQ7 A;  4HBW A;  5FE8 A;  4QBM A;  5FH8 A;  4CUQ A;  3LQI A;  4YAD A;  4AI6 A;  5FG6 A;  4O77 A;  4F3I A;  5E9I A;  4UIX A;  4KCX A;  3U5P A;  4AKN A;  5LKU A;  5DY7 A;  3G0L A;  5DYC A;  5LJ1 A;  4YK0 A;  4Y03 A;  5D24 A;  5H1T A;  3LQH A;  2R0S A;  2H60 A;  5L96 A;  4NRC A;  4O78 A;  4A9J A;  5FFW A;  3DWY A;  3LJW A;  4QEW A;  5COI A;  5EWV A;  5IGM A;  5ETD A;  4O7B A;  5EWH A;  2I8N A;  5HJC A;  3JVL A;  5C85 A;  2RNW A;  4TQN A;  4YBS A;  5EIS A;  5C8G A;  5I88 A;  4CUP A;  4O72 A;  2E7O A;  3Q2F A;  2YEM A;  4TS8 A;  4NS5 A;  4Z6H A;  5JI8 A;  5LKZ A;  1X0J A;  4A9K A;  5A5S A;  3MB4 A;  5DX4 A;  4UIW A;  4A9H A;  5HQ5 A;  5FG4 A;  4ZQL A;  2N9G A;  4HXN A;  2RI7 A;  5I7X A;  5CUE A;  3UV4 A;  4YYM A;  2L5E A;  5FE4 A;  4UIT A;  5EP7 A;  5CY9 A;  4NUE A;  5LUU A;  4QY4 A;  2R0Y A;  3D7C A;  2WP1 A;  4IOR A;  5FG5 A;  2DKW A;  4RVR A;  4TU4 A;  5CUD A;  5CUC A;  2YYN A;  4QR4 A;  4QSU A;  2RNX A;  4BHW A;  4PTB A;  5FE9 A;  4NR5 A;  4QSQ A;  5EV9 A;  5DYX A;  5ENG A;  5H1U A;  3U5L A;  3ERR A;  5L99 A;  5F1H A;  4YAB A;  4ZC9 A;  5HEL A;  4UYF A;  3P1F A;  4BW4 A;  3K2J A;  5KHM A;  5A5N A;  5CGP A;  4MR3 A;  4HBX A;  4TTE A;  4YC9 A;  4MR5 A;  4CLB A;  5E7D A;  4IOQ A;  4C67 A;  4KV1 A;  1N72 A;  5D3T A;  5KU3 A;  4NYV A;  5CZG A;  5BT5 A;  4IR4 A;  5D26 A;  3QZT A;  4MEQ A;  3MXF A;  4NRB A;  4CL9 A;  4UIZ A;  5DBM A;  5BT3 A;  3MB3 A;  4UYF B;  3U5J A;  4NR4 A;  4UYD A;  5L97 A;  2FSA A;  4QUT A;  4YYN A;  5EQ1 A;  4YY6 A;  4NYW A;  4QYD A;  4IR3 A;  4HBY A;  2YEL A;  1PUO A;  5DYU A;  4N4F A;  5AME A;  5HRW A;  3I3J A;  3QZV A;  4XUA A;  5CPE A;  5A5Q A;  5D3S A;  5C4Q A;  3GG3 A;  4QB3 A;  4N3W A;  3MUK A;  5CFW A;  5HLS A;  4PS5 A;  4YBT A;  4QST A;  4OGJ A;  4UIV A;  5F5Z A;  5DYA A;  5CQT A;  4E96 A;  4O76 A;  3UVW A;  4BJX A;  5D3L A;  5I40 A;  5IGL A;  3U5O A;  4LZS A;  4YYG A;  4MR6 A;  5A82 A;  5FFY A;  4A9E A;  5E74 A;  3U5M A;  5FE2 A;  4Z93 A;  4OUF A;  4X2I A;  4NUC A;  3JVJ A;  5EK9 A;  4J0S A;  5FE5 A;  3MUL A;  1ZS5 A;  5D3N A;  3UV2 A;  1JM4 B;  2E3K A;  4HXK A;  5E9L A;  5CS8 A;  3O37 A;  5EVA A;  3ZYU A;  2EJN A;  4C66 A;  5E9Y A;  4CUR A;  2WP2 A;  4IR5 A;  3IU5 A;  2GRC A;  4QYL A;  5KTW A;  5ENF A;  4LR6 A;  4QSP A;  1ZKR A;  2L85 A;  4O71 A;  5CRZ A;  4WHW A;  5A85 A;  4XY9 A;  3JVK A;  5ETB A;  4QNS A;  3O35 A;  5II1 A;  5E9M A;  5D25 A;  3UV5 A;  3D1D A;  5EPR A;  4NUD A;  2RNY A;  3RCW A;  4MEO A;  5H1V A;  4QSX A;  4Q0O A;  4LZ2 A;  5G4R A;  5E73 A;  4A9L A;  5D3H A;  5F61 A;  4TT2 A;  3S91 A;  4QEV A;  3O36 A;  4NR9 A;  5I83 A;  5EPB A;  5IGK A;  3D1B A;  4MEN A;  5TB6 A;  4MR4 A;  5DFB A;  4NR7 A;  4A9F A;  4Z6I A;  5E3D A;  4QC1 A;  4IOO A;  4QSR A;  5IID A;  3O33 A;  3SVF A;  5AMF A;  2F6J A;  4O7C A;  5D3R A;  5E0R A;  5CTL A;  2RFJ A;  5DKC A;  5CU8 A;  4CUS A;  5DW1 A;  5FE6 A;  5LJ0 A;  3LXJ A;  4FLP A;  4QZS A;  4YH3 A;  5LJ2 A;  2OSS A;  5FH7 A;  5LVQ A;  3JVM A;  5A81 A;  5I1Q A;  2DVV A;  4AKH A;  5CUB A;  3ONI A;  4NR6 A;  5C87 A;  5I80 A;  5HEM A;  1EQF A;  3IU6 A;  5A7C A;  2L84 A;  3TLP A;  2DVS A;  4LYI A;  3SVH A;  5HEN A;  5G4S A;  5F62 A;  2MJV B;  5EU1 A;  1WUM A;  5CP5 A;  5DFD A;  2YQD A;  3O34 A;  5F63 A;  3SVG A;  5CQ5 A;  4YYK A;  4MEP A;  4TT4 A;  5ENB A;  3G0J A;  5CQ3 A;  4O7E A;  4A9O A;  1E6I A;  5CUA A;  3VKG A;  4UYG A;  4NQN A;  5L98 A;  4NRA A;  5J0D A;  4ALH A;  3VKH A;  5TCM A;  4PKL A;  2I7K A;  2DWW A;  5A5O A;  3MQM A;  3UVX A;  5A5R A;  5CRM A;  4N4I A;  2R10 A;  4WIV A;  5F36 A;  5ENH A;  5L8U A;  5HRX A;  5F60 A;  5E9V A;  4HBV A;  4XUB A;  5EI4 A;  4J0R A;  2NXB A;  5FE3 A;  4YYJ A;  5LKT A;  4YYD A;  4NQM A;  4HXS A;  2LSP B;  4TT6 A;  4WHU A;  5E3G A;  4BW3 A;  4YH4 A;  4YBM A;  5E9K A;  4IR6 A;  5CQ7 A;  5DLX A;  5CUG A;  4N4H A;  5HCL A;  4Z1Q A;  4O74 A;  3U5N A;  5FB0 A; 
#chains in the Genus database with same CATH homology
 3P1D A;  4LC2 A;  4QR5 A;  3HMH A;  4J1P A;  4GPJ A;  4YAX A;  4NXJ A;  4HXL A;  5EWD A;  2RO1 A;  4PCE A;  5LVR A;  2KTB B;  5BT4 A;  5DW2 A;  5HFR A;  3DAI A;  4NR8 A;  4QSS A;  4O70 A;  5CQ6 A;  5HRV A;  5ENC A;  4A9M A;  5ENE A;  2YEK A;  3AAD A;  2DVQ A;  3S92 A;  4A9N A;  5I7Y A;  5FB1 A;  2OO1 A;  4XYA A;  3NXB A;  5ENJ A;  3HME A;  2DAT A;  4TZ8 A;  3UW9 A;  3UVY A;  4QSW A;  5DKH A;  4KV4 A;  3P5O A;  3U5K A;  5C7N A;  1F68 A;  5D3P A;  4YYH A;  4BW2 A;  2F6N A;  4HXR A;  5HM0 A;  4QEU A;  5ENI A;  5IBN A;  3P1E A;  5EWC A;  4QUU A;  3LQJ A;  4HXO A;  3P1C A;  3AQA A;  4HXM A;  4QC3 A;  5II2 A;  5C89 A;  5KTU A;  2R0V A;  4UYH A;  5F25 A;  5FE0 A;  5KTX A;  2YW5 A;  4J3I A;  5AD3 A;  4A9I A;  5F1L A;  5FH6 A;  5FBX A;  5CQ8 A;  5CQA A;  5F3A A;  5IG6 A;  2OUO A;  4ALG A;  4NYX A;  5FFV A;  5DFC A;  2G4A A;  5AD2 A;  4DON A;  4CUU A;  5HFQ A;  5EA1 A;  3UVD A;  4YYI A;  4YAT A;  5EIC A;  4LZR A;  4XY8 A;  5D3J A;  4PY6 A;  4QSV A;  4CFL A;  2RS9 B;  5JWM A;  4OGI A;  5H85 A;  5EM3 A;  5FE1 A;  2E7N A;  5FE7 A;  5LKX A;  5K29 A;  5I86 A;  5FDZ A;  4UIY A;  3FKM X;  3QZS A;  2D9E A;  5A83 A;  4Q0N A;  4CFK A;  5DLZ A;  2DVR A;  4LRG A;  4UIU A;  5I29 A;  1JSP B;  5CQ4 A;  1WUG A;  4TYL A;  4UYE A;  3HMF A;  4Z1S A;  5EPS A;  4YY4 A;  2YDW A;  4CUT A;  5HQ6 A;  4PCI A;  4N4G A;  4BW1 A;  3Q2E A;  4HXP A;  4QR3 A;  4LYS A;  5EGU A;  5D7X A;  5L8T A;  4LDF A;  4TU6 A;  5ACY A;  5A5P A;  4ZW1 A;  5I89 A;  4TZ2 A;  4O7A A;  4O7F A;  4O75 A;  5EWW A;  4LYW A;  2D82 A;  5KO4 A;  5F2P A;  5DKD A;  5D0C A;  5IGN A;  5HQ7 A;  4HBW A;  5FE8 A;  4QBM A;  5FH8 A;  4CUQ A;  3LQI A;  4YAD A;  5FG6 A;  4O77 A;  4F3I A;  5E9I A;  4UIX A;  4KCX A;  3U5P A;  4AKN A;  5LKU A;  5DY7 A;  3G0L A;  5DYC A;  5LJ1 A;  4YK0 A;  4Y03 A;  5D24 A;  5H1T A;  3LQH A;  2R0S A;  2H60 A;  5L96 A;  4NRC A;  4O78 A;  4A9J A;  5FFW A;  3DWY A;  3LJW A;  4QEW A;  5COI A;  5EWV A;  5IGM A;  5ETD A;  4O7B A;  5EWH A;  2I8N A;  5HJC A;  3JVL A;  5C85 A;  2RNW A;  4TQN A;  4YBS A;  5EIS A;  5C8G A;  5I88 A;  4CUP A;  4O72 A;  2E7O A;  3Q2F A;  2YEM A;  4TS8 A;  4NS5 A;  4Z6H A;  5JI8 A;  5LKZ A;  1X0J A;  4A9K A;  5A5S A;  3MB4 A;  5DX4 A;  4UIW A;  4A9H A;  5HQ5 A;  5FG4 A;  4ZQL A;  2N9G A;  4HXN A;  2RI7 A;  5I7X A;  5CUE A;  3UV4 A;  4YYM A;  2L5E A;  5FE4 A;  4UIT A;  5EP7 A;  5CY9 A;  4NUE A;  5LUU A;  4QY4 A;  2R0Y A;  3D7C A;  2WP1 A;  4IOR A;  5FG5 A;  2DKW A;  4RVR A;  4TU4 A;  5CUD A;  5CUC A;  2YYN A;  4QR4 A;  4QSU A;  2RNX A;  4BHW A;  4PTB A;  5FE9 A;  4NR5 A;  4QSQ A;  5EV9 A;  5DYX A;  5ENG A;  5H1U A;  3U5L A;  5L99 A;  5F1H A;  4YAB A;  4ZC9 A;  5HEL A;  4UYF A;  3P1F A;  4BW4 A;  3K2J A;  5KHM A;  5A5N A;  5CGP A;  4MR3 A;  4HBX A;  4TTE A;  4YC9 A;  4MR5 A;  4CLB A;  5E7D A;  4IOQ A;  4C67 A;  4KV1 A;  1N72 A;  5D3T A;  5KU3 A;  4NYV A;  5CZG A;  5BT5 A;  4IR4 A;  5D26 A;  3QZT A;  4MEQ A;  3MXF A;  4NRB A;  4CL9 A;  4UIZ A;  5DBM A;  5BT3 A;  3MB3 A;  4UYF B;  3U5J A;  4NR4 A;  4UYD A;  5L97 A;  2FSA A;  4QUT A;  4YYN A;  5EQ1 A;  4YY6 A;  4NYW A;  4QYD A;  4IR3 A;  4HBY A;  2YEL A;  5DYU A;  4N4F A;  5AME A;  5HRW A;  3I3J A;  3QZV A;  4XUA A;  5CPE A;  5A5Q A;  5D3S A;  5C4Q A;  3GG3 A;  4QB3 A;  4N3W A;  3MUK A;  5CFW A;  5HLS A;  4PS5 A;  4YBT A;  4QST A;  4OGJ A;  4UIV A;  5F5Z A;  5DYA A;  5CQT A;  4E96 A;  4O76 A;  3UVW A;  4BJX A;  5D3L A;  5I40 A;  5IGL A;  3U5O A;  4LZS A;  4YYG A;  4MR6 A;  5A82 A;  5FFY A;  4A9E A;  5E74 A;  3U5M A;  5FE2 A;  4Z93 A;  4OUF A;  4X2I A;  4NUC A;  3JVJ A;  5EK9 A;  4J0S A;  5FE5 A;  3MUL A;  1ZS5 A;  5D3N A;  3UV2 A;  1JM4 B;  2E3K A;  4HXK A;  5E9L A;  5CS8 A;  3O37 A;  5EVA A;  3ZYU A;  4C66 A;  5E9Y A;  4CUR A;  2WP2 A;  4IR5 A;  3IU5 A;  2GRC A;  4QYL A;  5KTW A;  5ENF A;  4LR6 A;  4QSP A;  2L85 A;  4O71 A;  5CRZ A;  4WHW A;  5A85 A;  4XY9 A;  3JVK A;  5ETB A;  4QNS A;  3O35 A;  5II1 A;  5E9M A;  5D25 A;  3UV5 A;  5EPR A;  4NUD A;  2RNY A;  3RCW A;  4MEO A;  5H1V A;  4QSX A;  4Q0O A;  4LZ2 A;  5G4R A;  5E73 A;  4A9L A;  5D3H A;  5F61 A;  4TT2 A;  3S91 A;  4QEV A;  3O36 A;  4NR9 A;  5I83 A;  5EPB A;  5IGK A;  4MEN A;  5TB6 A;  4MR4 A;  5DFB A;  4NR7 A;  4A9F A;  4Z6I A;  5E3D A;  4QC1 A;  4IOO A;  4QSR A;  5IID A;  3O33 A;  3SVF A;  5AMF A;  2F6J A;  4O7C A;  5D3R A;  5E0R A;  5CTL A;  2RFJ A;  5DKC A;  5CU8 A;  4CUS A;  5DW1 A;  5FE6 A;  5LJ0 A;  3LXJ A;  4FLP A;  4QZS A;  4YH3 A;  5LJ2 A;  2OSS A;  5FH7 A;  5LVQ A;  3JVM A;  5A81 A;  5I1Q A;  2DVV A;  5CUB A;  3ONI A;  4NR6 A;  5C87 A;  5I80 A;  5HEM A;  1EQF A;  3IU6 A;  5A7C A;  2L84 A;  3TLP A;  2DVS A;  4LYI A;  3SVH A;  5HEN A;  5G4S A;  5F62 A;  2MJV B;  5EU1 A;  1WUM A;  5CP5 A;  5DFD A;  2YQD A;  3O34 A;  5F63 A;  3SVG A;  5CQ5 A;  4YYK A;  4MEP A;  4TT4 A;  5ENB A;  3G0J A;  5CQ3 A;  4O7E A;  4A9O A;  1E6I A;  5CUA A;  4UYG A;  4NQN A;  5L98 A;  4NRA A;  5J0D A;  4ALH A;  5TCM A;  4PKL A;  2I7K A;  2DWW A;  5A5O A;  3MQM A;  3UVX A;  5A5R A;  5CRM A;  4N4I A;  2R10 A;  4WIV A;  5F36 A;  5ENH A;  5L8U A;  5HRX A;  5F60 A;  5E9V A;  4HBV A;  4XUB A;  5EI4 A;  4J0R A;  2NXB A;  5FE3 A;  4YYJ A;  5LKT A;  4YYD A;  4NQM A;  4HXS A;  2LSP B;  4TT6 A;  4WHU A;  5E3G A;  4BW3 A;  4YH4 A;  4YBM A;  5E9K A;  4IR6 A;  5CQ7 A;  5DLX A;  5CUG A;  4N4H A;  5HCL A;  4Z1Q A;  4O74 A;  3U5N A;  5FB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...