4LZUA

Bovine beta-lactoglobulin crystallized in the presence of 2 mm zinc chloride
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
VTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Non-Classical Pathways of Protein Crystallization in the Presence of Multivalent Metal Ions
rcsb
molecule tags Transport protein
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4lzuA00
3WVMA 1ACDA 4GETA 5C0NA 4KIIA 1GXAA 3FR5A 2A3FX 4NP1A 4TJZA 4DQ4A 1A3YA 1LIBA 3VG4A 5BVTA 5JR8A 3HWGA 2OFMX 3OJYC 3EYCA 4A1HA 3P6CA 4BVMA 1SA8A 4NNSA 5F6ZA 4ORWA 3F8AA 4MVKA 1FELA 1LNMA 1AQBA 2GJ5A 1ALBA 2G7BA 3FA6A 1VYFA 4I9RA 3P6EA 3TGBA 2CZUA 4TKHA 2HMBA 4XMEA 5LJCA 1Z24A 1HBPA 1OPBA 3NX1A 5LKFA 1IFBA 5EEEA 4WBKA 2WSJA 5D45A 4QAEA 4RUNA 5F6BA 3FW5A 1UREA 1JZUA 3K3LA 3U9PC 3D95A 1CBQA 4AZQA 4ZH6A 3B2IA 3FEKA 1RLBE 2FTBA 4GE1A 1EUOA 2AMMX 1OEKA 1B0OA 1SY0A 1ICMA 4TQ2A 4YFRA 3O2YA 2CBRA 1U17A 1BRPA 3FMZA 5FENA 5KICA 2G78A 3P6DA 1L6MA 1EPAA 2KTDA 1EW3A 1HMTA 3P6HA 3Q6LA 3NP1A 4N7DA 5HTEA 2MO5A 2MJIA 5B29A 2OVAA 4HPBA 4MVLA 5EDBA 3PP6A 1O1UA 1D2UA 2Q9SA 1LIEA 1FEMA 2RD7C 3PPTA 2GC9A 4YCEA 1KT4A 1MDCA 3ELXA 4QZTA 4N7CA 2F73A 3C76X 1KOIA 1DZPA 3CBCA 2L5PA 4NLJA 1VYGA 3BS2A 1BJ7A 4IAWA 1EPBA 4AZOA 1GT4A 1E5PA 5DG4A 1HN2A 1QY0A 4YGHA 3TF6A 1EIOA 5EDCA 4QYNA 1ERXA 4QGXA 1PM1X 5IO7A 4OMWA 5EEDA 3D96A 4ZJ0A 3G7XA 2E4JA 3TGAA 1MX7A 5HZ6A 4EDEA 4Y0QA 3FELA 2HNXA 1DFVA 2R56A 4Y0SA 1XCAA 1YIVA 3KFGA 1T8VA 1T68X 4IMNA 5LJKA 4ZHDA 2X46A 2OVDA 1GKAB 2AT3X 5LJDA 1ZNHA 4A1YA 4OMXA 4I9SA 1I4UA 1OPAA 3GAQA 1S2PA 3NADA 1NP4A 2FRSA 4M7MA 5IO6A 4OS8A 1CBIA 4ORYA 3BLGA 3U03A 3B2LA 1BSOA 3RSWA 4AZPA 3HWFA 3S26A 1P6PA 1X71A 1SY3A 1SXYA 1PMPA 4XMHA 5CE4A 3TGCA 2RCQA 3IA8A 1KT6A 1QY2A 4BQUA 1LIDA 5FFHA 2W2AA 4YFQA 2FS6A 1ICNA 2ANSA 4QGWA 5EPQA 2LKKA 4QYPA 4ZHCA 2L68A 3BY0A 4M6SA 1AB0A 4Y0PA 1CJ5A 3I0AA 3WJCA 5K06A 4ES7A 3NQ3A 2L9CA 1KZXA 5H9AA 1E00A 1B8EA 4YGZA 5H9NA 1BSYA 2CM4A 2R74A 3CWKA 1BSQA 2LBVA 2N93A 4UU3A 1YWCA 5H8TA 3BX8A 3UEWA 2ALLX 4GH7A 4TKJA 1KQXA 1I04A 2AT6X 1KGLA 1X8QA 3I17A 3BDRA 2ASNX 2FT9A 4GKCA 5HZ8A 1HBQA 5LJBA 2JU3A 2QOSC 1X89A 1SXUA 1I05A 1SXXA 4ZR2A 1NGLA 3EMMA 3BX7A 1DV9A 3FEPA 3KFIA 4PSQA 3MBTA 1UZ2X 2L67A 5HCEC 3STKA 5KIDA 4IAXA 4DQ3A 1OBQA 2LFOA 3P6GA 4AZNA 3EBWA 2DM5A 3BU1A 3RZYA 1EALA 1TOWA 5L8NA 3ELZA 1U0XA 1BEBA 1NP1A 2XSTA 3VG3A 2WWPA 5L8OA 1MX8A 1ZNKA 3O19A 4A8ZA 4ORSA 2IFBA 2YG2A 2AT5X 4I3CA 1A2DA 2PY1A 2G79A 2XKLA 4ODDA 3O22A 1SY2A 2K23A 1GM6A 1SXWA 1TW4A 4AW8A 1D3SA 3UEXA 4ZHHA 1KT5A 4LKPA 4TNNA 4TLJA 2QO6A 3DSZA 1LF7A 4A60A 5F7GA 4QZUA 1GT3A 1JV4A 3APWA 1R0UA 5HBSA 4UU2A 4ZH9A 1DZMA 5H9LA 2WUTA 2WQ9A 1ML7A 3WJBA 4OS0A 4XMFA 1BWYA 3NQ9A 1GGLA 3JSQA 3APUA 4MVIA 3HWEA 3P6FA 1ZNEA 1IFCA 3BRNA 1DF3A 1PEEA 1B4MA 1SY1A 5HZ5A 4ORUA 4R0BA 1EXSA 3L4RA 4AZRA 2O62A 3FA9A 4IB7A 1CBSA 3EBKA 4EFGA 1EIIA 2WEWA 1GX8A 4XMCA 3VG5A 3VG7A 5HA0A 5EZ2A 4YDAA 4CK4A 5DPQA 1OEJA 1HMRA 4YMYA 1CRBA 4EEJA 4LZVA 3APXA 2CM9A 2OVEA 4I3BA 4HFOA 5BVQA 1DC9A 3STNA 1KT3A 3VG6A 1AELA 3F9DA 1X8PA 4O9SA 4YDBA 4D6AA 3TZSA 5BVSA 1G74A 4ZHGA 3AKMA 5HCCC 2AL0X 1VPRA 1LFOA 5AQ6A 1MVGA 2Q39A 3PH5A 1OBUA 3CMPA 4ZFXA 1H91A 1ZNDA 2CBSA 1JYDA 4XMGA 1KQWA 2AKQA 1G5WA 4Y0RA 1FE3A 1O8VA 2A2GA 4EXZA 2RCTA 3WJGA 2FWVA 4ARHA 3PECA 1HMSA 1IW2A 1QQSA 2AH7X 2NNDA 3C78X 1IKJA 1IIUA 4NYRA 1U18A 1X8NA 3APVA 4YBUA 5HZQA 2EU7X 3U0DA 4NNTA 2A2UA 2AT0X 2HYSA 4HPDA 1TOUA 3FW4A 4YCHA 1YP7A 4I3DA 1KT7A 1DZJA 4ORRA 1ADLA 4NYQA 3IFBA 3KZAA 2K62A 2A0AA 3WJDA 3ZUOA 1OEEA 2WQAE 1GKAA 4ZGUA 4LKTA 2JU8A 1G85A 1FDQA 1YWDA 2HLVA 2NNQA 3B2HA 4YKMA 1S44A 3KQ0A 1A57A 3WJEA 3JS1A 1HQPA 1QFTA 2ACOA 1X8OA 3HWDA 5D4AA 3SAOA 4WFUA 4IB9A 5HCDC 1QWDA 1ZNLA 1GX9A 3ZQ3A 3NX2A 1O1VA 1JJJA 1KZWA 4D6BA 2NNEA 2AT8X 2WEXA 3ZUIA 2KT4B 3FR4A 5HZ9A 2OFRX 2GTFX 2JOZA 1S7DA 1QFVA 1PBOA 3UEVA 4AZMA 1BLRA 1N0SA 1YWAA 2HZRA 1FENA 2HZQA 3VG2A 2JN3A 4HPAA 3EM0A 1GT1A 2W2BA 5FAZA 5L8IA 1ZRYA 2Q2PA 4NLIA 1AVGI 2NP1A 3WXQA 3UEUA 5F58A 3FA7A 3WJFA 5LJHA 1BM5A 2LB6A 1YP6A 2OZQA 5D8JA 3WBGA 3D97A 3FENA 2QM9A 3FR2A 5IO5A 4IB8A 2JU7A 3NR3A 3CBSA 1A18A 5F1EA 4ALBA 1E06A 1JYJA 3FIQA 1YUPA 2FR3A 4ORXA 3STMX 4GNWA 5LJGA 1QG5A 1YWBA 4OS3A 3KFHA 4LZUA 3BSZE 3CQNA 2RA6A 1RBPA 2QO5A 1ERBA 3B2JA 2R73A 3CR6A 3PEDA 5H9KA 4YBPA 1E02A 3FLLA 3HK1A 2POAA 1TVQA 5B27A 5HTDA 1LIFA 1OBPA 3FA8A 1I06A 1TXLA 1LPJA 3KFFA 3PH6A 1CBRA 2QO4A 3CQRA 1LICA 2X45A 5D48A 5HA1A 4HPCA 4AYHA 2A13A 4GRJA 3T1DA 4QGVA 4XMDA 2WR6A 1LKEA 3BU9A 1B56A 1XKIA 5D47A 5LJEA 4IB6A 1GT5A 1QY1A 3AKNA 2Q4NA 4GNYA 3QKGA 4IBAA 1KXOA 1QABE 5HAEA 4IMOA 4TKBA 3NPOA 5HWZA 1MUPA 4YKOA 1ZNGA 2CZTA 2Q2MA 1JBHA 5KHPA 2LBAA 1JJXA 2FS7A 3B2KA 1T0VA 1EQDA 3DTQA 1IKEA 2BLGA 1X8UA 4K19A 4ZCBA 2W2FA 1DZKA 4YH0A 4RUUA 4ALOA 2RQ0A 2FR2A 4BOEA 4WFVA 3MVFA 2P8GA 1G7NA 5LKEA 1BBPA 1FTPA 2ACPX 1BRQA 4YFPA 2FLJA 2MM3A 4YGGA 3C77X 4ZHFA
chains in the Genus database with same CATH superfamily
3SZHA 3WVMA 1ACDA 2ZAIA 4QNIA 4GETA 5C0NA 4KIIA 1VWGB 2RTMA 1GXAA 1EI5A 3FR5A 2A3FX 2OFAA 1PBYA 4MEEA 4NP1A 1SWTA 3D9WA 1A3YA 4TJZA 4DQ4A 1Y53X 2F09A 1LIBA 1SWKA 3VG4A 5BVTA 5JR8A 3HWGA 1VWHB 2OFMX 3OJYC 3EYCA 4TQ2A 4JGLA 4A1HA 3P6CA 4BVMA 1VWLB 1SA8A 4O3YA 4NNSA 5F6ZA 2CAMA 4O3XB 4ORWA 3F8AA 3CKGA 3FYFA 1E2TA 4FBVA 4MVKA 1FELA 1LNMA 4GK9A 1AQBA 2GJ5A 1ALBA 2G7BA 3FA6A 1SWAA 1VYFA 4I9RA 3P6EA 3TGBA 2CZUA 4TKHA 2HMBA 2JMBA 3ZW2A 4XMEA 4I60A 1VWOB 1MOYA 5LJCA 1Z24A 1HBPA 5B2AO 1OPBA 3NX1A 5LKFA 1IFBA 5EEEA 4WBKA 2WSJA 5D45A 4QAEA 3SLJA 2IZAA 4RUNA 5F6BA 3FW5A 3WZOA 1UREA 1JZUA 1UYNX 3K3LA 3U9PC 3WZQA 3D95A 1CBQA 4AZQA 1NQMA 2AVIA 4ZH6A 3B2IA 2IZJA 3FEKA 1RLBE 2FTBA 4HWMA 3SZIA 4KCAA 1N43A 4GE1A 3RDUA 1EUOA 2RTKA 2AMMX 1OEKA 1B0OA 1SY0A 1ICMA 2RTEB 3FIDA 3OD9A 2ZAGA 3S60A 4YFRA 3O2YA 1VWKB 3GE2A 2CBRA 1U17A 1BRPA 3FMZA 5FENA 5KICA 2G78A 2DJGA 1Y9LA 3P02A 3P6DA 1L6MA 1BLRA 1EPAA 2KTDA 3SZJA 4GD9A 1EW3A 2UZ2A 2I5VO 1HMTA 3P6HA 4NV8A 3Q6LA 3VE1A 2MWHA 1OSPO 3NP1A 4N7DA 1AVEA 2MO5A 5HTEA 2MJIA 5B29A 2OVAA 4HPBA 4MVLA 5EDBA 2OYBO 2MF6A 3PP6A 1O1UA 1D2UA 2Q9SA 1LIEA 1FEMA 2RD7C 1JIWI 1SLDB 2GC9A 3PPTA 1KT4A 4YCEA 3HOEA 3MG5A 1MDCA 1NQNA 3ELXA 3HOLA 5K67A 4QZTA 2Y3EA 4N7CA 2F73A 3C76X 1KOIA 1DZPA 2X8FA 3CBCA 2L5PA 5CYBA 2RN4A 3S5XA 2A8GA 2OL7A 4NLJA 4Y5DA 1VYGA 3T2XA 3ZW0B 3ZW1B 3BS2A 1BJ7A 4IAWA 1EPBA 4AZOA 1SWRA 4U8UO 1GT4A 1KL4A 1E5PA 5DG4A 1HN2A 2OF9A 1QY0A 4YGHA 3TF6A 1EIOA 1RSTB 4GDZA 5EDCA 4QYNA 1ERXA 4QGXA 3RDSA 1PM1X 5IO7A 3PDFA 2WPUA 4OMWA 5EEDA 3D96A 4BX6B 4ZJ0A 2BHVA 3G7XA 4U3QA 2E4JA 3TGAA 1MX7A 1SWSA 4MIRA 5HZ6A 4COTA 4EDEA 4Y0QA 3FELA 2KW1A 2HNXA 1DFVA 2G8CO 2R56A 1XCAA 1YIVA 4O3WA 4Y0SA 5AJCA 4BBOA 3KFGA 1VWRB 1T8VA 1T68X 4I95A 1WBIA 2ZSCA 4IMNA 5LJKA 4O4UA 4ZHDA 2X46A 2OL6O 5B3MO 2OVDA 1GKAB 3MX7A 2AT3X 2X55A 5LJDA 1UYOX 1ZNHA 4FBOA 4A1YA 1SWOA 4GU8A 4OMXA 2DJFA 4I9SA 1I4UA 1OPAA 2JW1A 1S2PA 3GAQA 3NADA 3ZI8A 1NP4A 4ZGFA 2FRSA 4GGZA 4M7MA 4ZHFA 3RDOA 5IO6A 4OS8A 1CBIA 4ORYA 3BLGA 3U03A 1VWEB 1BSOA 3B2LA 3HPEA 3RSWA 5AJBA 4AZPA 3HWFA 1VWMB 3CKFA 3S26A 1P6PA 1X71A 1SY3A 1SXYA 2A5BA 1PMPA 4L1NA 4XMHA 5CE4A 3TGCA 2RCQA 3IA8A 1KT6A 1QY2A 4BQUA 1LIDA 5FFHA 1VYOA 2W2AA 4YFQA 2FS6A 1ICNA 2ANSA 4QGWA 2OVSA 5EPQA 2LKKA 4QYPA 4ZHCA 4GDAA 2L68A 3BY0A 3PQSA 4JNJA 4M6SA 1AB0A 3RDXA 4Y0PA 1CJ5A 2FHLA 3I0AA 4ON1A 3WJCA 1LUQA 5K06A 5F2BA 3NQ3A 4ES7A 2L9CA 5IXGA 1KZXA 3MM0A 4I6SA 5H9AA 1E00A 2OL8O 5AEOA 1B8EA 4U46A 1KL5A 4YGZA 3HTYA 3RE5A 5JD2A 3ZWEA 4C5PA 5H9NA 1BSYA 2CM4A 2R74A 1SWCA 3CWKA 1BSQA 2IZHB 4CPFA 2LBVA 1VWCB 2N93A 3H3IA 1YWCA 4UU3A 5H8TA 3BX8A 3UEWA 2ALLX 4GH7A 4TKJA 1KQXA 4MISA 2LA7A 1I04A 2AT6X 3N91A 3VE2A 5B5GA 1KGLA 4OEMA 1X8QA 2MHDA 3I17A 3BDRA 2ASNX 2FT9A 4GKCA 5HZ8A 1HBQA 5LJBA 2JU3A 5L3YA 2QOSC 1Y52X 4Y59A 1X89A 1SXUA 2FKJA 1I05A 2IZFB 4U8UN 1SXXA 4ZR2A 1NGLA 4ZFXA 4QGVA 3EMMA 3BX7A 4O3ZA 1DV9A 3FEPA 1SREA 3D4RA 3KFIA 4PSQA 3SLTA 3MBTA 5IRUA 1UZ2X 1LCVA 2L67A 5HCEC 3STKA 3WOVA 4IAXA 5KIDA 4DQ3A 2IZDB 4IABA 3VPJE 1OBQA 1DF8A 2I5ZO 2LFOA 3P6GA 3WZPA 4AZNA 4BX5A 3EBWA 2DM5A 3BU1A 3RZYA 2OY5O 1W6FA 4FBRA 4AYHA 1EALA 1TOWA 3T2WA 5L8NA 3ELZA 4Z2OA 1U0XA 1BEBA 1NP1A 2XSTA 3VG3A 2WWPA 2RTCB 1MX8A 1ZNKA 2PI3O 3O19A 4ORSA 4A8ZA 2IFBA 2YG2A 5CHKA 2AT5X 4I3CA 1A2DA 3OBLA 2PY1A 2G79A 1RXHA 2XKLA 4ODDA 4NW4A 3PQUA 3O22A 1SY2A 2BSZA 2K23A 2X32A 3RY2A 1GM6A 1SXWA 1TW4A 4AW8A 3SLOA 1D3SA 3UEXA 3PK2A 4ZHHA 1KT5A 4KT5A 4LKPA 4TNNA 2RTRB 2QO6A 4TLJA 3DSZA 2RTJA 1LF7A 4A60A 1SLFB 2RTLA 5F7GA 4QZUA 4CSBA 1GT3A 1JV4A 3APWA 1R0UA 5HBSA 2X56A 4UU2A 4ZH9A 1DZMA 1VWQB 2G5LA 5H9LA 2WUTA 2WQ9A 2BC3A 1ML7A 4LQZA 3WJBA 4OS0A 4XMFA 1BWYA 3NQ9A 1GGLA 1HXZA 3VHMA 2BT9A 2IZBA 3APUA 3HWEA 3JSQA 1ZNEA 1IFCA 3P6FA 3BRNA 4MVIA 2C1QA 1DF3A 1I9HA 1PEEA 1B4MA 1SY1A 5HZ5A 4ORUA 1JMZA 4R0BA 5B11O 4CPHB 1EXSA 3L4RA 4AZRA 2O62A 3FA9A 4IB7A 1CBSA 2OY7A 3EBKA 3F6ZB 4GJVA 1VWAB 4EFGA 4CV7A 1EIIA 3RE6A 2WEWA 1GX8A 4O4OA 4XMCA 3VG5A 1VWNB 3VG7A 5HA0A 3RDMA 2IZIA 5EZ2A 3RBYA 4YDAA 2F01A 4CK4A 1SRJA 5DPQA 4BX7B 5FQ6E 1OEJA 2IZKA 1HMRA 4YMYA 1W5RA 2QMIA 4WHIA 3VU1A 1CRBA 4EEJA 4LZVA 3APXA 1NBXA 2CM9A 2OVEA 2RTQB 4I3BA 4HFOA 1VWIB 2C4IA 5BVQA 1DC9A 3STNA 4EKVA 4GUZA 1SWUA 2OFBA 1KT3A 4QQ1A 3VG6A 1AELA 3F9DA 1X8PA 1Y9TA 2KTSA 3LHNA 4O9SA 4YDBA 4D6AA 3TZSA 5BVSA 1G74A 4ZHGA 3AKMA 3SOTA 5HCCC 2AL0X 1VPRA 2FGSA 4EQAC 4ML7B 1LFOA 5AQ6A 4KC7A 1JJUA 1I78A 1LDQA 1MVGA 1OBUA 2Q39A 1H91A 2IZLB 1ZNDA 2CBSA 1JYDA 2VFCA 3CMPA 4XMGA 1KQWA 1VWPB 1SWDA 2IZEB 3RY1A 2AKQA 1SRFA 1G5WA 4Y0RA 1FE3A 1O8VA 2A2GA 4CPIA 2RCTA 3WJGA 4EXZA 5FQ7E 2FWVA 4L3RA 1SWGA 1MEPA 1VWFB 2GH7A 4ARHA 4CPEA 3PECA 1HMSA 4Z2VA 1IW2A 1QQSA 2AH7X 3E3CA 3ZW0A 3ZW1A 2NNDA 3OE3A 3RDQA 3C78X 4KC8A 1NDJA 4MVEA 1IKJA 3KVNA 5FQ8E 2Y32A 1IIUA 4NYRA 1U18A 4CDDA 2AF5A 1X8NA 3APVA 4KH8A 2Z4IA 4YBUA 4NV7A 1K3BA 2RTDB 5B10O 2EU7X 5HZQA 3U0DA 2BS6A 4NNTA 2A2UA 2AT0X 2HYSA 4HPDA 1TOUA 2VFBA 3FW4A 4YCHA 4O4SA 1YP7A 4I3DA 1KT7A 1DZJA 1AVDA 1ADLA 3FDCA 4ORRA 2RTPB 4NYQA 1N4JA 3IFBA 3KZAA 2K62A 1W4TA 2X8TA 4BGFA 2A0AA 1SWJA 1SWPA 3ZZVA 1KFFA 3WJDA 3ZUOA 1OEEA 2A5CA 2WQAE 1GKAA 4ZGUA 5B5FA 4LKTA 3RWXA 2JU8A 2Z4HA 3T6LA 1G85A 1KL3A 4Z28A 1FDQA 1YWDA 3LV4A 2HLVA 2NNQA 3B2HA 3LTWA 4YKMA 2IZGB 1SWBA 1STPA 1MM9A 4BJ8A 1S44A 2GTLO 3KQ0A 1VWJB 3WJEA 1A57A 3QQ2A 3S5VA 1GX3A 2X4MA 3EW1A 1HQPA 1QFTA 2ACOA 1X8OA 3HWDA 3JS1A 4O49A 4OKAA 5D4AA 1PTSA 4WFUA 3SAOA 2IZCB 1N9MA 4IB9A 4PJ2A 5HCDC 4Z2PA 1SRIA 1QWDA 1SLEB 1ZNLA 2FKGA 1GX9A 3ZQ3A 3NX2A 1O1VA 3X00A 1SMPI 1JJJA 1SRGA 3P24A 1KZWA 4D6BA 1LCWA 2NNEA 1RXJA 3EW2A 2OY1O 1SWQA 3AEHA 2AT8X 3NBXX 1HQQA 2WEXA 4GGTA 3WYQA 3UAQA 3ZUIA 1RAVA 2KT4B 3FR4A 5HZ9A 2OFRX 2GTFX 2JOZA 1SWHA 1S7DA 2OF8A 2X34A 3AUMO 4OELA 1LCZA 1PBOA 1QFVA 1RXKA 4U9CA 4QRLA 3UEVA 4AZMA 5IRWA 1STSB 1N0SA 1YWAA 2HZRA 4U8UM 1FENA 2HZQA 1HXLA 3VG2A 2BS5A 2JN3A 4HPAA 1MK5A 1VWDB 3NQKA 3EM0A 1GT1A 2W2BA 5FAZA 2VDFA 2RTGB 4CDFA 4FQBB 5L8IA 4CDEA 1JQPA 1K24A 1ZRYA 2OY8A 1AVGI 2NP1A 2Q2PA 4NLIA 3UEUA 3WXQA 5F58A 3FA7A 2RTFB 3WJFA 5LJHA 1BM5A 4Z6JA 2LB6A 1LDOA 1YP6A 3VHIA 2QCBA 2OZQA 5D8JA 3WBGA 2X8SA 3D97A 1VWBB 3FENA 2QM9A 3FR2A 2UYWA 4FGIB 4IB8A 4ID2A 2JU7A 5IO5A 5CSEA 3NR3A 3CBSA 1A18A 5F1EA 4ALBA 1E06A 2YMSA 1JYJA 3FIQA 1YUPA 2FR3A 4ORXA 3STMX 4GNWA 5L8OA 5LJGA 1QG5A 1YWBA 4O4XA 4OS3A 3KFHA 4LZUA 3BSZE 2C1SA 2RA6A 1RBPA 1SLGB 3CQNA 4GZVA 2QO5A 4YVBA 1ERBA 3B2JA 2R73A 3T6FA 3CR6A 3PEDA 5H9KA 4YBPA 3Q34A 1E02A 3FLLA 3HK1A 2POAA 1TVQA 5B27A 4B55A 4GJSA 1LIFA 5HTDA 1OBPA 4DCBA 3FA8A 1I06A 1TXLA 1LPJA 3KFFA 3PH6A 1CBRA 1SWNA 2QO4A 1LICA 1JMXA 2RTNB 2M4LA 2X45A 3CQRA 2A13A 4GRJA 4HPCA 5D48A 4XMDA 2WR6A 5HA1A 3T1DA 1LKEA 2RTAA 4BCSA 3BU9A 3V8UA 1B56A 1XKIA 5D47A 2RTOB 4Z27A 5LJEA 4IB6A 2Y3FA 1GT5A 3JQOA 1QY1A 3VGWA 2GTLN 3AKNA 4DNEA 2Q4NA 4GNYA 4INNA 3QKGA 3WZNA 4IBAA 1SRHA 1KXOA 1QABE 3PH5A 1IJ8A 5HAEA 1HY2A 3RKGA 4IMOA 5IRAA 1N9YA 4TKBA 3NPOA 5HWZA 1MUPA 4YKOA 1ZNGA 2CZTA 2Q2MA 1JBHA 3VHHA 2QOMA 2LBAA 5KHPA 1JJXA 2FS7A 1WUBA 2KD2A 1N7YA 3B2KA 4CDCA 1FJ1E 1STRB 1Y0GA 1RSUB 1EQDA 1T0VA 3DTQA 5K68A 1IKEA 2BLGA 2RTBB 2RTHB 4CPHA 1X8UA 4K19A 4ZCBA 1LELA 2W2FA 1NC9A 1DZKA 4JO6A 2HKDA 4IRWA 4YH0A 2JGSA 4RUUA 2RQ0A 2FHNX 3WYPA 4ALOA 1SWLA 2FR2A 4BOEA 4BX5B 2RTIB 4WFVA 4BX6A 3EC5A 1SWFA 2P8GA 1G7NA 3MVFA 5LKEA 5BYPA 1SWEA 1BBPA 1FTPA 2ACPX 1BRQA 4YFPA 2GTLM 1Y55X 4BX7A 4JHQA 2FLJA 2MM3A 4YGGA 3C77X 4GGRA
chains in the Genus database with same CATH topology
3WVMA 1ACDA 2ZAIA 4QNIA 4GETA 5C0NA 4KIIA 1GXAA 1EI5A 3FR5A 2A3FX 4NP1A 4TJZA 4DQ4A 1A3YA 2F09A 1LIBA 3VG4A 5BVTA 5JR8A 3HWGA 2OFMX 3OJYC 3EYCA 4JGLA 4A1HA 3P6CA 4BVMA 1SA8A 4O3YA 4NNSA 5F6ZA 4O3XB 4ORWA 3F8AA 3FYFA 4FBVA 4MVKA 1FELA 1LNMA 4GK9A 1AQBA 2GJ5A 1ALBA 2G7BA 3FA6A 1VYFA 4I9RA 3P6EA 3TGBA 2CZUA 4TKHA 2HMBA 2JMBA 3ZW2A 4XMEA 5LJCA 1Z24A 1HBPA 1OPBA 3NX1A 5LKFA 1IFBA 5EEEA 4WBKA 2WSJA 5D45A 4QAEA 4RUNA 5F6BA 3FW5A 1UREA 1JZUA 3K3LA 3U9PC 3D95A 1CBQA 4AZQA 4ZH6A 3B2IA 3FEKA 1RLBE 2FTBA 4HWMA 4KCAA 4GE1A 1EUOA 2AMMX 1OEKA 1B0OA 1SY0A 1ICMA 3OD9A 3S60A 4TQ2A 2ZAGA 4YFRA 3O2YA 3GE2A 2CBRA 1U17A 1BRPA 3FMZA 5FENA 5KICA 2G78A 3P02A 1Y9LA 3P6DA 1L6MA 1EPAA 2KTDA 1EW3A 1HMTA 3P6HA 3VE1A 3Q6LA 2MWHA 3NP1A 4N7DA 5HTEA 2MO5A 2MJIA 5B29A 2OVAA 4HPBA 4MVLA 5EDBA 3PP6A 1O1UA 1D2UA 2Q9SA 1LIEA 1FEMA 2RD7C 1JIWI 3PPTA 2GC9A 4YCEA 1KT4A 3HOEA 1MDCA 3ELXA 3HOLA 4QZTA 4N7CA 2F73A 3C76X 1KOIA 1DZPA 2X8FA 3CBCA 2L5PA 5CYBA 2RN4A 3S5XA 4NLJA 1VYGA 3ZW0B 3ZW1B 3BS2A 1BJ7A 4IAWA 1EPBA 4AZOA 4U8UO 1GT4A 1E5PA 5DG4A 1HN2A 1QY0A 4YGHA 3TF6A 1EIOA 4GDZA 5EDCA 4QYNA 1ERXA 4QGXA 1PM1X 5IO7A 4OMWA 5EEDA 3D96A 4ZJ0A 2BHVA 3G7XA 4U3QA 2E4JA 3TGAA 1MX7A 4MIRA 5HZ6A 4COTA 4EDEA 4Y0QA 3FELA 2KW1A 2HNXA 1DFVA 2R56A 4O3WA 1XCAA 1YIVA 4Y0SA 5AJCA 3KFGA 1T8VA 1T68X 4I95A 4IMNA 5LJKA 4O4UA 4ZHDA 2X46A 2OVDA 1GKAB 3MX7A 2AT3X 5LJDA 1ZNHA 4FBOA 4A1YA 4GU8A 4OMXA 4I9SA 1I4UA 1OPAA 2JW1A 1S2PA 3GAQA 3NADA 3ZI8A 1NP4A 4ZGFA 2FRSA 4M7MA 5IO6A 4OS8A 1CBIA 4ORYA 3BLGA 3U03A 3B2LA 1BSOA 3RSWA 5AJBA 4AZPA 3HWFA 3S26A 1P6PA 1X71A 1SY3A 1SXYA 4L1NA 1PMPA 4XMHA 5CE4A 3TGCA 2RCQA 3IA8A 1KT6A 1QY2A 4BQUA 1LIDA 5FFHA 2W2AA 4YFQA 2FS6A 1ICNA 2ANSA 4QGWA 2OVSA 5EPQA 2LKKA 4QYPA 4ZHCA 2L68A 3BY0A 3PQSA 4M6SA 1AB0A 4Y0PA 1CJ5A 3I0AA 4ON1A 3WJCA 5K06A 4ES7A 3NQ3A 2L9CA 1KZXA 4I6SA 5H9AA 1E00A 5AEOA 1B8EA 4YGZA 3HTYA 3ZWEA 5H9NA 1BSYA 2CM4A 2R74A 3CWKA 1BSQA 2LBVA 2N93A 3H3IA 1YWCA 4UU3A 5H8TA 3BX8A 3UEWA 2ALLX 4GH7A 4TKJA 1KQXA 2LA7A 1I04A 2AT6X 3N91A 3VE2A 1KGLA 1X8QA 2MHDA 3I17A 3BDRA 2ASNX 2FT9A 4GKCA 5HZ8A 1HBQA 5LJBA 2JU3A 2QOSC 1X89A 1SXUA 1I05A 4U8UN 1SXXA 4ZR2A 1NGLA 3EMMA 3BX7A 4O3ZA 1DV9A 3FEPA 3D4RA 3KFIA 4PSQA 3MBTA 1UZ2X 2L67A 5HCEC 3STKA 3WOVA 4IAXA 5KIDA 4DQ3A 4IABA 1OBQA 2LFOA 3P6GA 4AZNA 3EBWA 2DM5A 3BU1A 3RZYA 4FBRA 4AYHA 1EALA 1TOWA 5L8NA 3ELZA 1U0XA 1BEBA 1NP1A 2XSTA 3VG3A 2WWPA 5L8OA 1MX8A 1ZNKA 3O19A 4A8ZA 4ORSA 2IFBA 2YG2A 2AT5X 4I3CA 1A2DA 3OBLA 2PY1A 2G79A 2XKLA 4ODDA 4NW4A 3PQUA 3O22A 1SY2A 2K23A 1GM6A 1SXWA 1TW4A 4AW8A 1D3SA 3UEXA 4ZHHA 1KT5A 4KT5A 4LKPA 4TNNA 4TLJA 2QO6A 3DSZA 1LF7A 4A60A 4CSBA 5F7GA 4QZUA 1GT3A 1JV4A 3APWA 1R0UA 5HBSA 4UU2A 4ZH9A 1DZMA 5H9LA 2WUTA 2WQ9A 4LQZA 1ML7A 3WJBA 4OS0A 4XMFA 1BWYA 3NQ9A 1GGLA 2BT9A 3APUA 3JSQA 3HWEA 3P6FA 1ZNEA 1IFCA 4MVIA 3BRNA 1DF3A 1PEEA 1B4MA 1SY1A 5HZ5A 4ORUA 4R0BA 1EXSA 3L4RA 4AZRA 2O62A 3FA9A 4IB7A 1CBSA 3EBKA 3F6ZB 4CV7A 4EFGA 1EIIA 2WEWA 1GX8A 4O4OA 4XMCA 3VG5A 3VG7A 5HA0A 3RBYA 5EZ2A 4YDAA 4CK4A 5DPQA 5FQ6E 1OEJA 1HMRA 4YMYA 2QMIA 4WHIA 3VU1A 1CRBA 4EEJA 4LZVA 3APXA 2CM9A 2OVEA 4I3BA 4HFOA 5BVQA 1DC9A 3STNA 1KT3A 4QQ1A 3VG6A 1AELA 3F9DA 1X8PA 1Y9TA 2KTSA 3LHNA 4O9SA 4YDBA 4D6AA 3TZSA 5BVSA 1G74A 4ZHGA 3AKMA 3SOTA 5HCCC 2AL0X 1VPRA 4EQAC 4ML7B 1LFOA 5AQ6A 4KC7A 1MVGA 2Q39A 3PH5A 1OBUA 3CMPA 4ZFXA 1H91A 1ZNDA 2CBSA 1JYDA 4XMGA 1KQWA 2AKQA 1G5WA 4Y0RA 1FE3A 1O8VA 2A2GA 4EXZA 2RCTA 3WJGA 5FQ7E 2FWVA 4L3RA 4ARHA 3PECA 1HMSA 1IW2A 1QQSA 2AH7X 3E3CA 3ZW0A 3ZW1A 2NNDA 3OE3A 3C78X 4KC8A 4MVEA 1IKJA 5FQ8E 1IIUA 4NYRA 1U18A 1X8NA 3APVA 4KH8A 2Z4IA 4YBUA 5HZQA 2EU7X 3U0DA 2BS6A 4NNTA 2A2UA 2AT0X 2HYSA 4HPDA 1TOUA 3FW4A 4YCHA 4O4SA 1YP7A 4I3DA 1KT7A 1DZJA 4ORRA 1ADLA 4NYQA 3IFBA 3KZAA 2K62A 2X8TA 2A0AA 3ZZVA 3WJDA 3ZUOA 1OEEA 2WQAE 1GKAA 4ZGUA 4LKTA 3RWXA 2JU8A 2Z4HA 1G85A 1FDQA 1YWDA 3LV4A 2HLVA 2NNQA 3B2HA 4YKMA 1S44A 2GTLO 3KQ0A 1A57A 3WJEA 3JS1A 1HQPA 1QFTA 2ACOA 1X8OA 3HWDA 5D4AA 4O49A 3SAOA 3VPJE 4WFUA 4IB9A 4PJ2A 5HCDC 1QWDA 1ZNLA 1GX9A 3ZQ3A 3NX2A 1O1VA 1JJJA 1SMPI 3P24A 1KZWA 4D6BA 2NNEA 2AT8X 3NBXX 2WEXA 3UAQA 3ZUIA 2KT4B 3FR4A 5HZ9A 2OFRX 2GTFX 2JOZA 1S7DA 1QFVA 1PBOA 4U9CA 3UEVA 4AZMA 4QRLA 1BLRA 1N0SA 1YWAA 2HZRA 4U8UM 1FENA 2HZQA 3VG2A 2BS5A 2JN3A 4HPAA 3NQKA 3EM0A 1GT1A 2W2BA 5FAZA 4FQBB 5L8IA 1ZRYA 2Q2PA 4NLIA 1AVGI 2NP1A 3WXQA 3UEUA 5F58A 3FA7A 3WJFA 5LJHA 1BM5A 2LB6A 1YP6A 2OZQA 5D8JA 3WBGA 2X8SA 3D97A 3FENA 2QM9A 3FR2A 4ID2A 4FGIB 4IB8A 5IO5A 2JU7A 3NR3A 3CBSA 1A18A 5F1EA 4ALBA 1E06A 2YMSA 1JYJA 3FIQA 1YUPA 2FR3A 4ORXA 3STMX 4GNWA 5LJGA 1QG5A 1YWBA 4O4XA 4OS3A 3KFHA 4LZUA 3BSZE 3CQNA 2RA6A 1RBPA 4GZVA 2QO5A 1ERBA 3B2JA 2R73A 3CR6A 3PEDA 5H9KA 4YBPA 1E02A 3FLLA 3HK1A 2POAA 1TVQA 5B27A 5HTDA 1LIFA 1OBPA 3FA8A 1I06A 1TXLA 1LPJA 3KFFA 3PH6A 1CBRA 2QO4A 3CQRA 1LICA 2X45A 4MISA 2M4LA 4HPCA 5D48A 2A13A 4GRJA 5HA1A 3S5VA 4XMDA 2WR6A 3T1DA 4QGVA 1LKEA 3BU9A 3V8UA 1B56A 1XKIA 5D47A 5LJEA 4IB6A 3JQOA 1GT5A 1QY1A 2GTLN 3AKNA 2Q4NA 4GNYA 4INNA 3QKGA 4IBAA 1KXOA 1QABE 5HAEA 3RKGA 4IMOA 4TKBA 3NPOA 5HWZA 1MUPA 4YKOA 1ZNGA 2CZTA 2Q2MA 1JBHA 5KHPA 2LBAA 1JJXA 2FS7A 2KD2A 3B2KA 1T0VA 1EQDA 3DTQA 1IKEA 2BLGA 1X8UA 4K19A 4ZCBA 2W2FA 1DZKA 4YH0A 4RUUA 4ALOA 2RQ0A 2FR2A 4BOEA 4WFVA 3MVFA 2P8GA 1G7NA 5LKEA 5BYPA 1BBPA 1FTPA 2ACPX 1BRQA 4YFPA 2GTLM 2FLJA 2MM3A 4YGGA 3C77X 4ZHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVM A;  1ACD A;  4GET A;  5C0N A;  4KII A;  1GXA A;  3FR5 A;  2A3F X;  4NP1 A;  4TJZ A;  4DQ4 A;  1A3Y A;  1LIB A;  3VG4 A;  5BVT A;  5JR8 A;  3HWG A;  2OFM X;  3OJY C;  3EYC A;  4A1H A;  3P6C A;  4BVM A;  1SA8 A;  4NNS A;  5F6Z A;  4ORW A;  3F8A A;  4MVK A;  1FEL A;  1LNM A;  1AQB A;  2GJ5 A;  1ALB A;  2G7B A;  3FA6 A;  1VYF A;  4I9R A;  3P6E A;  3TGB A;  2CZU A;  4TKH A;  2HMB A;  4XME A;  5LJC A;  1Z24 A;  1HBP A;  1OPB A;  3NX1 A;  5LKF A;  1IFB A;  5EEE A;  4WBK A;  2WSJ A;  5D45 A;  4QAE A;  4RUN A;  5F6B A;  3FW5 A;  1URE A;  1JZU A;  3K3L A;  3U9P C;  3D95 A;  1CBQ A;  4AZQ A;  4ZH6 A;  3B2I A;  3FEK A;  1RLB E;  2FTB A;  4GE1 A;  1EUO A;  2AMM X;  1OEK A;  1B0O A;  1SY0 A;  1ICM A;  4TQ2 A;  4YFR A;  3O2Y A;  2CBR A;  1U17 A;  1BRP A;  3FMZ A;  5FEN A;  5KIC A;  2G78 A;  3P6D A;  1L6M A;  1EPA A;  2KTD A;  1EW3 A;  1HMT A;  3P6H A;  3Q6L A;  3NP1 A;  4N7D A;  5HTE A;  2MO5 A;  2MJI A;  5B29 A;  2OVA A;  4HPB A;  4MVL A;  5EDB A;  3PP6 A;  1O1U A;  1D2U A;  2Q9S A;  1LIE A;  1FEM A;  2RD7 C;  3PPT A;  2GC9 A;  4YCE A;  1KT4 A;  1MDC A;  3ELX A;  4QZT A;  4N7C A;  2F73 A;  3C76 X;  1KOI A;  1DZP A;  3CBC A;  2L5P A;  4NLJ A;  1VYG A;  3BS2 A;  1BJ7 A;  4IAW A;  1EPB A;  4AZO A;  1GT4 A;  1E5P A;  5DG4 A;  1HN2 A;  1QY0 A;  4YGH A;  3TF6 A;  1EIO A;  5EDC A;  4QYN A;  1ERX A;  4QGX A;  1PM1 X;  5IO7 A;  4OMW A;  5EED A;  3D96 A;  4ZJ0 A;  3G7X A;  2E4J A;  3TGA A;  1MX7 A;  5HZ6 A;  4EDE A;  4Y0Q A;  3FEL A;  2HNX A;  1DFV A;  2R56 A;  4Y0S A;  1XCA A;  1YIV A;  3KFG A;  1T8V A;  1T68 X;  4IMN A;  5LJK A;  4ZHD A;  2X46 A;  2OVD A;  1GKA B;  2AT3 X;  5LJD A;  1ZNH A;  4A1Y A;  4OMX A;  4I9S A;  1I4U A;  1OPA A;  3GAQ A;  1S2P A;  3NAD A;  1NP4 A;  2FRS A;  4M7M A;  5IO6 A;  4OS8 A;  1CBI A;  4ORY A;  3BLG A;  3U03 A;  3B2L A;  1BSO A;  3RSW A;  4AZP A;  3HWF A;  3S26 A;  1P6P A;  1X71 A;  1SY3 A;  1SXY A;  1PMP A;  4XMH A;  5CE4 A;  3TGC A;  2RCQ A;  3IA8 A;  1KT6 A;  1QY2 A;  4BQU A;  1LID A;  5FFH A;  2W2A A;  4YFQ A;  2FS6 A;  1ICN A;  2ANS A;  4QGW A;  5EPQ A;  2LKK A;  4QYP A;  4ZHC A;  2L68 A;  3BY0 A;  4M6S A;  1AB0 A;  4Y0P A;  1CJ5 A;  3I0A A;  3WJC A;  5K06 A;  4ES7 A;  3NQ3 A;  2L9C A;  1KZX A;  5H9A A;  1E00 A;  1B8E A;  4YGZ A;  5H9N A;  1BSY A;  2CM4 A;  2R74 A;  3CWK A;  1BSQ A;  2LBV A;  2N93 A;  4UU3 A;  1YWC A;  5H8T A;  3BX8 A;  3UEW A;  2ALL X;  4GH7 A;  4TKJ A;  1KQX A;  1I04 A;  2AT6 X;  1KGL A;  1X8Q A;  3I17 A;  3BDR A;  2ASN X;  2FT9 A;  4GKC A;  5HZ8 A;  1HBQ A;  5LJB A;  2JU3 A;  2QOS C;  1X89 A;  1SXU A;  1I05 A;  1SXX A;  4ZR2 A;  1NGL A;  3EMM A;  3BX7 A;  1DV9 A;  3FEP A;  3KFI A;  4PSQ A;  3MBT A;  1UZ2 X;  2L67 A;  5HCE C;  3STK A;  5KID A;  4IAX A;  4DQ3 A;  1OBQ A;  2LFO A;  3P6G A;  4AZN A;  3EBW A;  2DM5 A;  3BU1 A;  3RZY A;  1EAL A;  1TOW A;  5L8N A;  3ELZ A;  1U0X A;  1BEB A;  1NP1 A;  2XST A;  3VG3 A;  2WWP A;  5L8O A;  1MX8 A;  1ZNK A;  3O19 A;  4A8Z A;  4ORS A;  2IFB A;  2YG2 A;  2AT5 X;  4I3C A;  1A2D A;  2PY1 A;  2G79 A;  2XKL A;  4ODD A;  3O22 A;  1SY2 A;  2K23 A;  1GM6 A;  1SXW A;  1TW4 A;  4AW8 A;  1D3S A;  3UEX A;  4ZHH A;  1KT5 A;  4LKP A;  4TNN A;  4TLJ A;  2QO6 A;  3DSZ A;  1LF7 A;  4A60 A;  5F7G A;  4QZU A;  1GT3 A;  1JV4 A;  3APW A;  1R0U A;  5HBS A;  4UU2 A;  4ZH9 A;  1DZM A;  5H9L A;  2WUT A;  2WQ9 A;  1ML7 A;  3WJB A;  4OS0 A;  4XMF A;  1BWY A;  3NQ9 A;  1GGL A;  3JSQ A;  3APU A;  4MVI A;  3HWE A;  3P6F A;  1ZNE A;  1IFC A;  3BRN A;  1DF3 A;  1PEE A;  1B4M A;  1SY1 A;  5HZ5 A;  4ORU A;  4R0B A;  1EXS A;  3L4R A;  4AZR A;  2O62 A;  3FA9 A;  4IB7 A;  1CBS A;  3EBK A;  4EFG A;  1EII A;  2WEW A;  1GX8 A;  4XMC A;  3VG5 A;  3VG7 A;  5HA0 A;  5EZ2 A;  4YDA A;  4CK4 A;  5DPQ A;  1OEJ A;  1HMR A;  4YMY A;  1CRB A;  4EEJ A;  4LZV A;  3APX A;  2CM9 A;  2OVE A;  4I3B A;  4HFO A;  5BVQ A;  1DC9 A;  3STN A;  1KT3 A;  3VG6 A;  1AEL A;  3F9D A;  1X8P A;  4O9S A;  4YDB A;  4D6A A;  3TZS A;  5BVS A;  1G74 A;  4ZHG A;  3AKM A;  5HCC C;  2AL0 X;  1VPR A;  1LFO A;  5AQ6 A;  1MVG A;  2Q39 A;  3PH5 A;  1OBU A;  3CMP A;  4ZFX A;  1H91 A;  1ZND A;  2CBS A;  1JYD A;  4XMG A;  1KQW A;  2AKQ A;  1G5W A;  4Y0R A;  1FE3 A;  1O8V A;  2A2G A;  4EXZ A;  2RCT A;  3WJG A;  2FWV A;  4ARH A;  3PEC A;  1HMS A;  1IW2 A;  1QQS A;  2AH7 X;  2NND A;  3C78 X;  1IKJ A;  1IIU A;  4NYR A;  1U18 A;  1X8N A;  3APV A;  4YBU A;  5HZQ A;  2EU7 X;  3U0D A;  4NNT A;  2A2U A;  2AT0 X;  2HYS A;  4HPD A;  1TOU A;  3FW4 A;  4YCH A;  1YP7 A;  4I3D A;  1KT7 A;  1DZJ A;  4ORR A;  1ADL A;  4NYQ A;  3IFB A;  3KZA A;  2K62 A;  2A0A A;  3WJD A;  3ZUO A;  1OEE A;  2WQA E;  1GKA A;  4ZGU A;  4LKT A;  2JU8 A;  1G85 A;  1FDQ A;  1YWD A;  2HLV A;  2NNQ A;  3B2H A;  4YKM A;  1S44 A;  3KQ0 A;  1A57 A;  3WJE A;  3JS1 A;  1HQP A;  1QFT A;  2ACO A;  1X8O A;  3HWD A;  5D4A A;  3SAO A;  4WFU A;  4IB9 A;  5HCD C;  1QWD A;  1ZNL A;  1GX9 A;  3ZQ3 A;  3NX2 A;  1O1V A;  1JJJ A;  1KZW A;  4D6B A;  2NNE A;  2AT8 X;  2WEX A;  3ZUI A;  2KT4 B;  3FR4 A;  5HZ9 A;  2OFR X;  2GTF X;  2JOZ A;  1S7D A;  1QFV A;  1PBO A;  3UEV A;  4AZM A;  1BLR A;  1N0S A;  1YWA A;  2HZR A;  1FEN A;  2HZQ A;  3VG2 A;  2JN3 A;  4HPA A;  3EM0 A;  1GT1 A;  2W2B A;  5FAZ A;  5L8I A;  1ZRY A;  2Q2P A;  4NLI A;  1AVG I;  2NP1 A;  3WXQ A;  3UEU A;  5F58 A;  3FA7 A;  3WJF A;  5LJH A;  1BM5 A;  2LB6 A;  1YP6 A;  2OZQ A;  5D8J A;  3WBG A;  3D97 A;  3FEN A;  2QM9 A;  3FR2 A;  5IO5 A;  4IB8 A;  2JU7 A;  3NR3 A;  3CBS A;  1A18 A;  5F1E A;  4ALB A;  1E06 A;  1JYJ A;  3FIQ A;  1YUP A;  2FR3 A;  4ORX A;  3STM X;  4GNW A;  5LJG A;  1QG5 A;  1YWB A;  4OS3 A;  3KFH A;  4LZU A;  3BSZ E;  3CQN A;  2RA6 A;  1RBP A;  2QO5 A;  1ERB A;  3B2J A;  2R73 A;  3CR6 A;  3PED A;  5H9K A;  4YBP A;  1E02 A;  3FLL A;  3HK1 A;  2POA A;  1TVQ A;  5B27 A;  5HTD A;  1LIF A;  1OBP A;  3FA8 A;  1I06 A;  1TXL A;  1LPJ A;  3KFF A;  3PH6 A;  1CBR A;  2QO4 A;  3CQR A;  1LIC A;  2X45 A;  5D48 A;  5HA1 A;  4HPC A;  4AYH A;  2A13 A;  4GRJ A;  3T1D A;  4QGV A;  4XMD A;  2WR6 A;  1LKE A;  3BU9 A;  1B56 A;  1XKI A;  5D47 A;  5LJE A;  4IB6 A;  1GT5 A;  1QY1 A;  3AKN A;  2Q4N A;  4GNY A;  3QKG A;  4IBA A;  1KXO A;  1QAB E;  5HAE A;  4IMO A;  4TKB A;  3NPO A;  5HWZ A;  1MUP A;  4YKO A;  1ZNG A;  2CZT A;  2Q2M A;  1JBH A;  5KHP A;  2LBA A;  1JJX A;  2FS7 A;  3B2K A;  1T0V A;  1EQD A;  3DTQ A;  1IKE A;  2BLG A;  1X8U A;  4K19 A;  4ZCB A;  2W2F A;  1DZK A;  4YH0 A;  4RUU A;  4ALO A;  2RQ0 A;  2FR2 A;  4BOE A;  4WFV A;  3MVF A;  2P8G A;  1G7N A;  5LKE A;  1BBP A;  1FTP A;  2ACP X;  1BRQ A;  4YFP A;  2FLJ A;  2MM3 A;  4YGG A;  3C77 X;  4ZHF A; 
#chains in the Genus database with same CATH topology
 3SZH A;  3WVM A;  1ACD A;  2ZAI A;  4QNI A;  4GET A;  5C0N A;  4KII A;  1VWG B;  2RTM A;  1GXA A;  1EI5 A;  3FR5 A;  2A3F X;  2OFA A;  1PBY A;  4MEE A;  4NP1 A;  1SWT A;  3D9W A;  1A3Y A;  4TJZ A;  4DQ4 A;  1Y53 X;  2F09 A;  1LIB A;  1SWK A;  3VG4 A;  5BVT A;  5JR8 A;  3HWG A;  1VWH B;  2OFM X;  3OJY C;  3EYC A;  4TQ2 A;  4JGL A;  4A1H A;  3P6C A;  4BVM A;  1VWL B;  1SA8 A;  4O3Y A;  4NNS A;  5F6Z A;  2CAM A;  4O3X B;  4ORW A;  3F8A A;  3CKG A;  3FYF A;  1E2T A;  4FBV A;  4MVK A;  1FEL A;  1LNM A;  4GK9 A;  1AQB A;  2GJ5 A;  1ALB A;  2G7B A;  3FA6 A;  1SWA A;  1VYF A;  4I9R A;  3P6E A;  3TGB A;  2CZU A;  4TKH A;  2HMB A;  2JMB A;  3ZW2 A;  4XME A;  4I60 A;  1VWO B;  1MOY A;  5LJC A;  1Z24 A;  1HBP A;  5B2A O;  1OPB A;  3NX1 A;  5LKF A;  1IFB A;  5EEE A;  4WBK A;  2WSJ A;  5D45 A;  4QAE A;  3SLJ A;  2IZA A;  4RUN A;  5F6B A;  3FW5 A;  3WZO A;  1URE A;  1JZU A;  1UYN X;  3K3L A;  3U9P C;  3WZQ A;  3D95 A;  1CBQ A;  4AZQ A;  1NQM A;  2AVI A;  4ZH6 A;  3B2I A;  2IZJ A;  3FEK A;  1RLB E;  2FTB A;  4HWM A;  3SZI A;  4KCA A;  1N43 A;  4GE1 A;  3RDU A;  1EUO A;  2RTK A;  2AMM X;  1OEK A;  1B0O A;  1SY0 A;  1ICM A;  2RTE B;  3FID A;  3OD9 A;  2ZAG A;  3S60 A;  4YFR A;  3O2Y A;  1VWK B;  3GE2 A;  2CBR A;  1U17 A;  1BRP A;  3FMZ A;  5FEN A;  5KIC A;  2G78 A;  2DJG A;  1Y9L A;  3P02 A;  3P6D A;  1L6M A;  1BLR A;  1EPA A;  2KTD A;  3SZJ A;  4GD9 A;  1EW3 A;  2UZ2 A;  2I5V O;  1HMT A;  3P6H A;  4NV8 A;  3Q6L A;  3VE1 A;  2MWH A;  1OSP O;  3NP1 A;  4N7D A;  1AVE A;  2MO5 A;  5HTE A;  2MJI A;  5B29 A;  2OVA A;  4HPB A;  4MVL A;  5EDB A;  2OYB O;  2MF6 A;  3PP6 A;  1O1U A;  1D2U A;  2Q9S A;  1LIE A;  1FEM A;  2RD7 C;  1JIW I;  1SLD B;  2GC9 A;  3PPT A;  1KT4 A;  4YCE A;  3HOE A;  3MG5 A;  1MDC A;  1NQN A;  3ELX A;  3HOL A;  5K67 A;  4QZT A;  2Y3E A;  4N7C A;  2F73 A;  3C76 X;  1KOI A;  1DZP A;  2X8F A;  3CBC A;  2L5P A;  5CYB A;  2RN4 A;  3S5X A;  2A8G A;  2OL7 A;  4NLJ A;  4Y5D A;  1VYG A;  3T2X A;  3ZW0 B;  3ZW1 B;  3BS2 A;  1BJ7 A;  4IAW A;  1EPB A;  4AZO A;  1SWR A;  4U8U O;  1GT4 A;  1KL4 A;  1E5P A;  5DG4 A;  1HN2 A;  2OF9 A;  1QY0 A;  4YGH A;  3TF6 A;  1EIO A;  1RST B;  4GDZ A;  5EDC A;  4QYN A;  1ERX A;  4QGX A;  3RDS A;  1PM1 X;  5IO7 A;  3PDF A;  2WPU A;  4OMW A;  5EED A;  3D96 A;  4BX6 B;  4ZJ0 A;  2BHV A;  3G7X A;  4U3Q A;  2E4J A;  3TGA A;  1MX7 A;  1SWS A;  4MIR A;  5HZ6 A;  4COT A;  4EDE A;  4Y0Q A;  3FEL A;  2KW1 A;  2HNX A;  1DFV A;  2G8C O;  2R56 A;  1XCA A;  1YIV A;  4O3W A;  4Y0S A;  5AJC A;  4BBO A;  3KFG A;  1VWR B;  1T8V A;  1T68 X;  4I95 A;  1WBI A;  2ZSC A;  4IMN A;  5LJK A;  4O4U A;  4ZHD A;  2X46 A;  2OL6 O;  5B3M O;  2OVD A;  1GKA B;  3MX7 A;  2AT3 X;  2X55 A;  5LJD A;  1UYO X;  1ZNH A;  4FBO A;  4A1Y A;  1SWO A;  4GU8 A;  4OMX A;  2DJF A;  4I9S A;  1I4U A;  1OPA A;  2JW1 A;  1S2P A;  3GAQ A;  3NAD A;  3ZI8 A;  1NP4 A;  4ZGF A;  2FRS A;  4GGZ A;  4M7M A;  4ZHF A;  3RDO A;  5IO6 A;  4OS8 A;  1CBI A;  4ORY A;  3BLG A;  3U03 A;  1VWE B;  1BSO A;  3B2L A;  3HPE A;  3RSW A;  5AJB A;  4AZP A;  3HWF A;  1VWM B;  3CKF A;  3S26 A;  1P6P A;  1X71 A;  1SY3 A;  1SXY A;  2A5B A;  1PMP A;  4L1N A;  4XMH A;  5CE4 A;  3TGC A;  2RCQ A;  3IA8 A;  1KT6 A;  1QY2 A;  4BQU A;  1LID A;  5FFH A;  1VYO A;  2W2A A;  4YFQ A;  2FS6 A;  1ICN A;  2ANS A;  4QGW A;  2OVS A;  5EPQ A;  2LKK A;  4QYP A;  4ZHC A;  4GDA A;  2L68 A;  3BY0 A;  3PQS A;  4JNJ A;  4M6S A;  1AB0 A;  3RDX A;  4Y0P A;  1CJ5 A;  2FHL A;  3I0A A;  4ON1 A;  3WJC A;  1LUQ A;  5K06 A;  5F2B A;  3NQ3 A;  4ES7 A;  2L9C A;  5IXG A;  1KZX A;  3MM0 A;  4I6S A;  5H9A A;  1E00 A;  2OL8 O;  5AEO A;  1B8E A;  4U46 A;  1KL5 A;  4YGZ A;  3HTY A;  3RE5 A;  5JD2 A;  3ZWE A;  4C5P A;  5H9N A;  1BSY A;  2CM4 A;  2R74 A;  1SWC A;  3CWK A;  1BSQ A;  2IZH B;  4CPF A;  2LBV A;  1VWC B;  2N93 A;  3H3I A;  1YWC A;  4UU3 A;  5H8T A;  3BX8 A;  3UEW A;  2ALL X;  4GH7 A;  4TKJ A;  1KQX A;  4MIS A;  2LA7 A;  1I04 A;  2AT6 X;  3N91 A;  3VE2 A;  5B5G A;  1KGL A;  4OEM A;  1X8Q A;  2MHD A;  3I17 A;  3BDR A;  2ASN X;  2FT9 A;  4GKC A;  5HZ8 A;  1HBQ A;  5LJB A;  2JU3 A;  5L3Y A;  2QOS C;  1Y52 X;  4Y59 A;  1X89 A;  1SXU A;  2FKJ A;  1I05 A;  2IZF B;  4U8U N;  1SXX A;  4ZR2 A;  1NGL A;  4ZFX A;  4QGV A;  3EMM A;  3BX7 A;  4O3Z A;  1DV9 A;  3FEP A;  1SRE A;  3D4R A;  3KFI A;  4PSQ A;  3SLT A;  3MBT A;  5IRU A;  1UZ2 X;  1LCV A;  2L67 A;  5HCE C;  3STK A;  3WOV A;  4IAX A;  5KID A;  4DQ3 A;  2IZD B;  4IAB A;  3VPJ E;  1OBQ A;  1DF8 A;  2I5Z O;  2LFO A;  3P6G A;  3WZP A;  4AZN A;  4BX5 A;  3EBW A;  2DM5 A;  3BU1 A;  3RZY A;  2OY5 O;  1W6F A;  4FBR A;  4AYH A;  1EAL A;  1TOW A;  3T2W A;  5L8N A;  3ELZ A;  4Z2O A;  1U0X A;  1BEB A;  1NP1 A;  2XST A;  3VG3 A;  2WWP A;  2RTC B;  1MX8 A;  1ZNK A;  2PI3 O;  3O19 A;  4ORS A;  4A8Z A;  2IFB A;  2YG2 A;  5CHK A;  2AT5 X;  4I3C A;  1A2D A;  3OBL A;  2PY1 A;  2G79 A;  1RXH A;  2XKL A;  4ODD A;  4NW4 A;  3PQU A;  3O22 A;  1SY2 A;  2BSZ A;  2K23 A;  2X32 A;  3RY2 A;  1GM6 A;  1SXW A;  1TW4 A;  4AW8 A;  3SLO A;  1D3S A;  3UEX A;  3PK2 A;  4ZHH A;  1KT5 A;  4KT5 A;  4LKP A;  4TNN A;  2RTR B;  2QO6 A;  4TLJ A;  3DSZ A;  2RTJ A;  1LF7 A;  4A60 A;  1SLF B;  2RTL A;  5F7G A;  4QZU A;  4CSB A;  1GT3 A;  1JV4 A;  3APW A;  1R0U A;  5HBS A;  2X56 A;  4UU2 A;  4ZH9 A;  1DZM A;  1VWQ B;  2G5L A;  5H9L A;  2WUT A;  2WQ9 A;  2BC3 A;  1ML7 A;  4LQZ A;  3WJB A;  4OS0 A;  4XMF A;  1BWY A;  3NQ9 A;  1GGL A;  1HXZ A;  3VHM A;  2BT9 A;  2IZB A;  3APU A;  3HWE A;  3JSQ A;  1ZNE A;  1IFC A;  3P6F A;  3BRN A;  4MVI A;  2C1Q A;  1DF3 A;  1I9H A;  1PEE A;  1B4M A;  1SY1 A;  5HZ5 A;  4ORU A;  1JMZ A;  4R0B A;  5B11 O;  4CPH B;  1EXS A;  3L4R A;  4AZR A;  2O62 A;  3FA9 A;  4IB7 A;  1CBS A;  2OY7 A;  3EBK A;  3F6Z B;  4GJV A;  1VWA B;  4EFG A;  4CV7 A;  1EII A;  3RE6 A;  2WEW A;  1GX8 A;  4O4O A;  4XMC A;  3VG5 A;  1VWN B;  3VG7 A;  5HA0 A;  3RDM A;  2IZI A;  5EZ2 A;  3RBY A;  4YDA A;  2F01 A;  4CK4 A;  1SRJ A;  5DPQ A;  4BX7 B;  5FQ6 E;  1OEJ A;  2IZK A;  1HMR A;  4YMY A;  1W5R A;  2QMI A;  4WHI A;  3VU1 A;  1CRB A;  4EEJ A;  4LZV A;  3APX A;  1NBX A;  2CM9 A;  2OVE A;  2RTQ B;  4I3B A;  4HFO A;  1VWI B;  2C4I A;  5BVQ A;  1DC9 A;  3STN A;  4EKV A;  4GUZ A;  1SWU A;  2OFB A;  1KT3 A;  4QQ1 A;  3VG6 A;  1AEL A;  3F9D A;  1X8P A;  1Y9T A;  2KTS A;  3LHN A;  4O9S A;  4YDB A;  4D6A A;  3TZS A;  5BVS A;  1G74 A;  4ZHG A;  3AKM A;  3SOT A;  5HCC C;  2AL0 X;  1VPR A;  2FGS A;  4EQA C;  4ML7 B;  1LFO A;  5AQ6 A;  4KC7 A;  1JJU A;  1I78 A;  1LDQ A;  1MVG A;  1OBU A;  2Q39 A;  1H91 A;  2IZL B;  1ZND A;  2CBS A;  1JYD A;  2VFC A;  3CMP A;  4XMG A;  1KQW A;  1VWP B;  1SWD A;  2IZE B;  3RY1 A;  2AKQ A;  1SRF A;  1G5W A;  4Y0R A;  1FE3 A;  1O8V A;  2A2G A;  4CPI A;  2RCT A;  3WJG A;  4EXZ A;  5FQ7 E;  2FWV A;  4L3R A;  1SWG A;  1MEP A;  1VWF B;  2GH7 A;  4ARH A;  4CPE A;  3PEC A;  1HMS A;  4Z2V A;  1IW2 A;  1QQS A;  2AH7 X;  3E3C A;  3ZW0 A;  3ZW1 A;  2NND A;  3OE3 A;  3RDQ A;  3C78 X;  4KC8 A;  1NDJ A;  4MVE A;  1IKJ A;  3KVN A;  5FQ8 E;  2Y32 A;  1IIU A;  4NYR A;  1U18 A;  4CDD A;  2AF5 A;  1X8N A;  3APV A;  4KH8 A;  2Z4I A;  4YBU A;  4NV7 A;  1K3B A;  2RTD B;  5B10 O;  2EU7 X;  5HZQ A;  3U0D A;  2BS6 A;  4NNT A;  2A2U A;  2AT0 X;  2HYS A;  4HPD A;  1TOU A;  2VFB A;  3FW4 A;  4YCH A;  4O4S A;  1YP7 A;  4I3D A;  1KT7 A;  1DZJ A;  1AVD A;  1ADL A;  3FDC A;  4ORR A;  2RTP B;  4NYQ A;  1N4J A;  3IFB A;  3KZA A;  2K62 A;  1W4T A;  2X8T A;  4BGF A;  2A0A A;  1SWJ A;  1SWP A;  3ZZV A;  1KFF A;  3WJD A;  3ZUO A;  1OEE A;  2A5C A;  2WQA E;  1GKA A;  4ZGU A;  5B5F A;  4LKT A;  3RWX A;  2JU8 A;  2Z4H A;  3T6L A;  1G85 A;  1KL3 A;  4Z28 A;  1FDQ A;  1YWD A;  3LV4 A;  2HLV A;  2NNQ A;  3B2H A;  3LTW A;  4YKM A;  2IZG B;  1SWB A;  1STP A;  1MM9 A;  4BJ8 A;  1S44 A;  2GTL O;  3KQ0 A;  1VWJ B;  3WJE A;  1A57 A;  3QQ2 A;  3S5V A;  1GX3 A;  2X4M A;  3EW1 A;  1HQP A;  1QFT A;  2ACO A;  1X8O A;  3HWD A;  3JS1 A;  4O49 A;  4OKA A;  5D4A A;  1PTS A;  4WFU A;  3SAO A;  2IZC B;  1N9M A;  4IB9 A;  4PJ2 A;  5HCD C;  4Z2P A;  1SRI A;  1QWD A;  1SLE B;  1ZNL A;  2FKG A;  1GX9 A;  3ZQ3 A;  3NX2 A;  1O1V A;  3X00 A;  1SMP I;  1JJJ A;  1SRG A;  3P24 A;  1KZW A;  4D6B A;  1LCW A;  2NNE A;  1RXJ A;  3EW2 A;  2OY1 O;  1SWQ A;  3AEH A;  2AT8 X;  3NBX X;  1HQQ A;  2WEX A;  4GGT A;  3WYQ A;  3UAQ A;  3ZUI A;  1RAV A;  2KT4 B;  3FR4 A;  5HZ9 A;  2OFR X;  2GTF X;  2JOZ A;  1SWH A;  1S7D A;  2OF8 A;  2X34 A;  3AUM O;  4OEL A;  1LCZ A;  1PBO A;  1QFV A;  1RXK A;  4U9C A;  4QRL A;  3UEV A;  4AZM A;  5IRW A;  1STS B;  1N0S A;  1YWA A;  2HZR A;  4U8U M;  1FEN A;  2HZQ A;  1HXL A;  3VG2 A;  2BS5 A;  2JN3 A;  4HPA A;  1MK5 A;  1VWD B;  3NQK A;  3EM0 A;  1GT1 A;  2W2B A;  5FAZ A;  2VDF A;  2RTG B;  4CDF A;  4FQB B;  5L8I A;  4CDE A;  1JQP A;  1K24 A;  1ZRY A;  2OY8 A;  1AVG I;  2NP1 A;  2Q2P A;  4NLI A;  3UEU A;  3WXQ A;  5F58 A;  3FA7 A;  2RTF B;  3WJF A;  5LJH A;  1BM5 A;  4Z6J A;  2LB6 A;  1LDO A;  1YP6 A;  3VHI A;  2QCB A;  2OZQ A;  5D8J A;  3WBG A;  2X8S A;  3D97 A;  1VWB B;  3FEN A;  2QM9 A;  3FR2 A;  2UYW A;  4FGI B;  4IB8 A;  4ID2 A;  2JU7 A;  5IO5 A;  5CSE A;  3NR3 A;  3CBS A;  1A18 A;  5F1E A;  4ALB A;  1E06 A;  2YMS A;  1JYJ A;  3FIQ A;  1YUP A;  2FR3 A;  4ORX A;  3STM X;  4GNW A;  5L8O A;  5LJG A;  1QG5 A;  1YWB A;  4O4X A;  4OS3 A;  3KFH A;  4LZU A;  3BSZ E;  2C1S A;  2RA6 A;  1RBP A;  1SLG B;  3CQN A;  4GZV A;  2QO5 A;  4YVB A;  1ERB A;  3B2J A;  2R73 A;  3T6F A;  3CR6 A;  3PED A;  5H9K A;  4YBP A;  3Q34 A;  1E02 A;  3FLL A;  3HK1 A;  2POA A;  1TVQ A;  5B27 A;  4B55 A;  4GJS A;  1LIF A;  5HTD A;  1OBP A;  4DCB A;  3FA8 A;  1I06 A;  1TXL A;  1LPJ A;  3KFF A;  3PH6 A;  1CBR A;  1SWN A;  2QO4 A;  1LIC A;  1JMX A;  2RTN B;  2M4L A;  2X45 A;  3CQR A;  2A13 A;  4GRJ A;  4HPC A;  5D48 A;  4XMD A;  2WR6 A;  5HA1 A;  3T1D A;  1LKE A;  2RTA A;  4BCS A;  3BU9 A;  3V8U A;  1B56 A;  1XKI A;  5D47 A;  2RTO B;  4Z27 A;  5LJE A;  4IB6 A;  2Y3F A;  1GT5 A;  3JQO A;  1QY1 A;  3VGW A;  2GTL N;  3AKN A;  4DNE A;  2Q4N A;  4GNY A;  4INN A;  3QKG A;  3WZN A;  4IBA A;  1SRH A;  1KXO A;  1QAB E;  3PH5 A;  1IJ8 A;  5HAE A;  1HY2 A;  3RKG A;  4IMO A;  5IRA A;  1N9Y A;  4TKB A;  3NPO A;  5HWZ A;  1MUP A;  4YKO A;  1ZNG A;  2CZT A;  2Q2M A;  1JBH A;  3VHH A;  2QOM A;  2LBA A;  5KHP A;  1JJX A;  2FS7 A;  1WUB A;  2KD2 A;  1N7Y A;  3B2K A;  4CDC A;  1FJ1 E;  1STR B;  1Y0G A;  1RSU B;  1EQD A;  1T0V A;  3DTQ A;  5K68 A;  1IKE A;  2BLG A;  2RTB B;  2RTH B;  4CPH A;  1X8U A;  4K19 A;  4ZCB A;  1LEL A;  2W2F A;  1NC9 A;  1DZK A;  4JO6 A;  2HKD A;  4IRW A;  4YH0 A;  2JGS A;  4RUU A;  2RQ0 A;  2FHN X;  3WYP A;  4ALO A;  1SWL A;  2FR2 A;  4BOE A;  4BX5 B;  2RTI B;  4WFV A;  4BX6 A;  3EC5 A;  1SWF A;  2P8G A;  1G7N A;  3MVF A;  5LKE A;  5BYP A;  1SWE A;  1BBP A;  1FTP A;  2ACP X;  1BRQ A;  4YFP A;  2GTL M;  1Y55 X;  4BX7 A;  4JHQ A;  2FLJ A;  2MM3 A;  4YGG A;  3C77 X;  4GGR A; 
#chains in the Genus database with same CATH homology
 3WVM A;  1ACD A;  2ZAI A;  4QNI A;  4GET A;  5C0N A;  4KII A;  1GXA A;  1EI5 A;  3FR5 A;  2A3F X;  4NP1 A;  4TJZ A;  4DQ4 A;  1A3Y A;  2F09 A;  1LIB A;  3VG4 A;  5BVT A;  5JR8 A;  3HWG A;  2OFM X;  3OJY C;  3EYC A;  4JGL A;  4A1H A;  3P6C A;  4BVM A;  1SA8 A;  4O3Y A;  4NNS A;  5F6Z A;  4O3X B;  4ORW A;  3F8A A;  3FYF A;  4FBV A;  4MVK A;  1FEL A;  1LNM A;  4GK9 A;  1AQB A;  2GJ5 A;  1ALB A;  2G7B A;  3FA6 A;  1VYF A;  4I9R A;  3P6E A;  3TGB A;  2CZU A;  4TKH A;  2HMB A;  2JMB A;  3ZW2 A;  4XME A;  5LJC A;  1Z24 A;  1HBP A;  1OPB A;  3NX1 A;  5LKF A;  1IFB A;  5EEE A;  4WBK A;  2WSJ A;  5D45 A;  4QAE A;  4RUN A;  5F6B A;  3FW5 A;  1URE A;  1JZU A;  3K3L A;  3U9P C;  3D95 A;  1CBQ A;  4AZQ A;  4ZH6 A;  3B2I A;  3FEK A;  1RLB E;  2FTB A;  4HWM A;  4KCA A;  4GE1 A;  1EUO A;  2AMM X;  1OEK A;  1B0O A;  1SY0 A;  1ICM A;  3OD9 A;  3S60 A;  4TQ2 A;  2ZAG A;  4YFR A;  3O2Y A;  3GE2 A;  2CBR A;  1U17 A;  1BRP A;  3FMZ A;  5FEN A;  5KIC A;  2G78 A;  3P02 A;  1Y9L A;  3P6D A;  1L6M A;  1EPA A;  2KTD A;  1EW3 A;  1HMT A;  3P6H A;  3VE1 A;  3Q6L A;  2MWH A;  3NP1 A;  4N7D A;  5HTE A;  2MO5 A;  2MJI A;  5B29 A;  2OVA A;  4HPB A;  4MVL A;  5EDB A;  3PP6 A;  1O1U A;  1D2U A;  2Q9S A;  1LIE A;  1FEM A;  2RD7 C;  1JIW I;  3PPT A;  2GC9 A;  4YCE A;  1KT4 A;  3HOE A;  1MDC A;  3ELX A;  3HOL A;  4QZT A;  4N7C A;  2F73 A;  3C76 X;  1KOI A;  1DZP A;  2X8F A;  3CBC A;  2L5P A;  5CYB A;  2RN4 A;  3S5X A;  4NLJ A;  1VYG A;  3ZW0 B;  3ZW1 B;  3BS2 A;  1BJ7 A;  4IAW A;  1EPB A;  4AZO A;  4U8U O;  1GT4 A;  1E5P A;  5DG4 A;  1HN2 A;  1QY0 A;  4YGH A;  3TF6 A;  1EIO A;  4GDZ A;  5EDC A;  4QYN A;  1ERX A;  4QGX A;  1PM1 X;  5IO7 A;  4OMW A;  5EED A;  3D96 A;  4ZJ0 A;  2BHV A;  3G7X A;  4U3Q A;  2E4J A;  3TGA A;  1MX7 A;  4MIR A;  5HZ6 A;  4COT A;  4EDE A;  4Y0Q A;  3FEL A;  2KW1 A;  2HNX A;  1DFV A;  2R56 A;  4O3W A;  1XCA A;  1YIV A;  4Y0S A;  5AJC A;  3KFG A;  1T8V A;  1T68 X;  4I95 A;  4IMN A;  5LJK A;  4O4U A;  4ZHD A;  2X46 A;  2OVD A;  1GKA B;  3MX7 A;  2AT3 X;  5LJD A;  1ZNH A;  4FBO A;  4A1Y A;  4GU8 A;  4OMX A;  4I9S A;  1I4U A;  1OPA A;  2JW1 A;  1S2P A;  3GAQ A;  3NAD A;  3ZI8 A;  1NP4 A;  4ZGF A;  2FRS A;  4M7M A;  5IO6 A;  4OS8 A;  1CBI A;  4ORY A;  3BLG A;  3U03 A;  3B2L A;  1BSO A;  3RSW A;  5AJB A;  4AZP A;  3HWF A;  3S26 A;  1P6P A;  1X71 A;  1SY3 A;  1SXY A;  4L1N A;  1PMP A;  4XMH A;  5CE4 A;  3TGC A;  2RCQ A;  3IA8 A;  1KT6 A;  1QY2 A;  4BQU A;  1LID A;  5FFH A;  2W2A A;  4YFQ A;  2FS6 A;  1ICN A;  2ANS A;  4QGW A;  2OVS A;  5EPQ A;  2LKK A;  4QYP A;  4ZHC A;  2L68 A;  3BY0 A;  3PQS A;  4M6S A;  1AB0 A;  4Y0P A;  1CJ5 A;  3I0A A;  4ON1 A;  3WJC A;  5K06 A;  4ES7 A;  3NQ3 A;  2L9C A;  1KZX A;  4I6S A;  5H9A A;  1E00 A;  5AEO A;  1B8E A;  4YGZ A;  3HTY A;  3ZWE A;  5H9N A;  1BSY A;  2CM4 A;  2R74 A;  3CWK A;  1BSQ A;  2LBV A;  2N93 A;  3H3I A;  1YWC A;  4UU3 A;  5H8T A;  3BX8 A;  3UEW A;  2ALL X;  4GH7 A;  4TKJ A;  1KQX A;  2LA7 A;  1I04 A;  2AT6 X;  3N91 A;  3VE2 A;  1KGL A;  1X8Q A;  2MHD A;  3I17 A;  3BDR A;  2ASN X;  2FT9 A;  4GKC A;  5HZ8 A;  1HBQ A;  5LJB A;  2JU3 A;  2QOS C;  1X89 A;  1SXU A;  1I05 A;  4U8U N;  1SXX A;  4ZR2 A;  1NGL A;  3EMM A;  3BX7 A;  4O3Z A;  1DV9 A;  3FEP A;  3D4R A;  3KFI A;  4PSQ A;  3MBT A;  1UZ2 X;  2L67 A;  5HCE C;  3STK A;  3WOV A;  4IAX A;  5KID A;  4DQ3 A;  4IAB A;  1OBQ A;  2LFO A;  3P6G A;  4AZN A;  3EBW A;  2DM5 A;  3BU1 A;  3RZY A;  4FBR A;  4AYH A;  1EAL A;  1TOW A;  5L8N A;  3ELZ A;  1U0X A;  1BEB A;  1NP1 A;  2XST A;  3VG3 A;  2WWP A;  5L8O A;  1MX8 A;  1ZNK A;  3O19 A;  4A8Z A;  4ORS A;  2IFB A;  2YG2 A;  2AT5 X;  4I3C A;  1A2D A;  3OBL A;  2PY1 A;  2G79 A;  2XKL A;  4ODD A;  4NW4 A;  3PQU A;  3O22 A;  1SY2 A;  2K23 A;  1GM6 A;  1SXW A;  1TW4 A;  4AW8 A;  1D3S A;  3UEX A;  4ZHH A;  1KT5 A;  4KT5 A;  4LKP A;  4TNN A;  4TLJ A;  2QO6 A;  3DSZ A;  1LF7 A;  4A60 A;  4CSB A;  5F7G A;  4QZU A;  1GT3 A;  1JV4 A;  3APW A;  1R0U A;  5HBS A;  4UU2 A;  4ZH9 A;  1DZM A;  5H9L A;  2WUT A;  2WQ9 A;  4LQZ A;  1ML7 A;  3WJB A;  4OS0 A;  4XMF A;  1BWY A;  3NQ9 A;  1GGL A;  2BT9 A;  3APU A;  3JSQ A;  3HWE A;  3P6F A;  1ZNE A;  1IFC A;  4MVI A;  3BRN A;  1DF3 A;  1PEE A;  1B4M A;  1SY1 A;  5HZ5 A;  4ORU A;  4R0B A;  1EXS A;  3L4R A;  4AZR A;  2O62 A;  3FA9 A;  4IB7 A;  1CBS A;  3EBK A;  3F6Z B;  4CV7 A;  4EFG A;  1EII A;  2WEW A;  1GX8 A;  4O4O A;  4XMC A;  3VG5 A;  3VG7 A;  5HA0 A;  3RBY A;  5EZ2 A;  4YDA A;  4CK4 A;  5DPQ A;  5FQ6 E;  1OEJ A;  1HMR A;  4YMY A;  2QMI A;  4WHI A;  3VU1 A;  1CRB A;  4EEJ A;  4LZV A;  3APX A;  2CM9 A;  2OVE A;  4I3B A;  4HFO A;  5BVQ A;  1DC9 A;  3STN A;  1KT3 A;  4QQ1 A;  3VG6 A;  1AEL A;  3F9D A;  1X8P A;  1Y9T A;  2KTS A;  3LHN A;  4O9S A;  4YDB A;  4D6A A;  3TZS A;  5BVS A;  1G74 A;  4ZHG A;  3AKM A;  3SOT A;  5HCC C;  2AL0 X;  1VPR A;  4EQA C;  4ML7 B;  1LFO A;  5AQ6 A;  4KC7 A;  1MVG A;  2Q39 A;  3PH5 A;  1OBU A;  3CMP A;  4ZFX A;  1H91 A;  1ZND A;  2CBS A;  1JYD A;  4XMG A;  1KQW A;  2AKQ A;  1G5W A;  4Y0R A;  1FE3 A;  1O8V A;  2A2G A;  4EXZ A;  2RCT A;  3WJG A;  5FQ7 E;  2FWV A;  4L3R A;  4ARH A;  3PEC A;  1HMS A;  1IW2 A;  1QQS A;  2AH7 X;  3E3C A;  3ZW0 A;  3ZW1 A;  2NND A;  3OE3 A;  3C78 X;  4KC8 A;  4MVE A;  1IKJ A;  5FQ8 E;  1IIU A;  4NYR A;  1U18 A;  1X8N A;  3APV A;  4KH8 A;  2Z4I A;  4YBU A;  5HZQ A;  2EU7 X;  3U0D A;  2BS6 A;  4NNT A;  2A2U A;  2AT0 X;  2HYS A;  4HPD A;  1TOU A;  3FW4 A;  4YCH A;  4O4S A;  1YP7 A;  4I3D A;  1KT7 A;  1DZJ A;  4ORR A;  1ADL A;  4NYQ A;  3IFB A;  3KZA A;  2K62 A;  2X8T A;  2A0A A;  3ZZV A;  3WJD A;  3ZUO A;  1OEE A;  2WQA E;  1GKA A;  4ZGU A;  4LKT A;  3RWX A;  2JU8 A;  2Z4H A;  1G85 A;  1FDQ A;  1YWD A;  3LV4 A;  2HLV A;  2NNQ A;  3B2H A;  4YKM A;  1S44 A;  2GTL O;  3KQ0 A;  1A57 A;  3WJE A;  3JS1 A;  1HQP A;  1QFT A;  2ACO A;  1X8O A;  3HWD A;  5D4A A;  4O49 A;  3SAO A;  3VPJ E;  4WFU A;  4IB9 A;  4PJ2 A;  5HCD C;  1QWD A;  1ZNL A;  1GX9 A;  3ZQ3 A;  3NX2 A;  1O1V A;  1JJJ A;  1SMP I;  3P24 A;  1KZW A;  4D6B A;  2NNE A;  2AT8 X;  3NBX X;  2WEX A;  3UAQ A;  3ZUI A;  2KT4 B;  3FR4 A;  5HZ9 A;  2OFR X;  2GTF X;  2JOZ A;  1S7D A;  1QFV A;  1PBO A;  4U9C A;  3UEV A;  4AZM A;  4QRL A;  1BLR A;  1N0S A;  1YWA A;  2HZR A;  4U8U M;  1FEN A;  2HZQ A;  3VG2 A;  2BS5 A;  2JN3 A;  4HPA A;  3NQK A;  3EM0 A;  1GT1 A;  2W2B A;  5FAZ A;  4FQB B;  5L8I A;  1ZRY A;  2Q2P A;  4NLI A;  1AVG I;  2NP1 A;  3WXQ A;  3UEU A;  5F58 A;  3FA7 A;  3WJF A;  5LJH A;  1BM5 A;  2LB6 A;  1YP6 A;  2OZQ A;  5D8J A;  3WBG A;  2X8S A;  3D97 A;  3FEN A;  2QM9 A;  3FR2 A;  4ID2 A;  4FGI B;  4IB8 A;  5IO5 A;  2JU7 A;  3NR3 A;  3CBS A;  1A18 A;  5F1E A;  4ALB A;  1E06 A;  2YMS A;  1JYJ A;  3FIQ A;  1YUP A;  2FR3 A;  4ORX A;  3STM X;  4GNW A;  5LJG A;  1QG5 A;  1YWB A;  4O4X A;  4OS3 A;  3KFH A;  4LZU A;  3BSZ E;  3CQN A;  2RA6 A;  1RBP A;  4GZV A;  2QO5 A;  1ERB A;  3B2J A;  2R73 A;  3CR6 A;  3PED A;  5H9K A;  4YBP A;  1E02 A;  3FLL A;  3HK1 A;  2POA A;  1TVQ A;  5B27 A;  5HTD A;  1LIF A;  1OBP A;  3FA8 A;  1I06 A;  1TXL A;  1LPJ A;  3KFF A;  3PH6 A;  1CBR A;  2QO4 A;  3CQR A;  1LIC A;  2X45 A;  4MIS A;  2M4L A;  4HPC A;  5D48 A;  2A13 A;  4GRJ A;  5HA1 A;  3S5V A;  4XMD A;  2WR6 A;  3T1D A;  4QGV A;  1LKE A;  3BU9 A;  3V8U A;  1B56 A;  1XKI A;  5D47 A;  5LJE A;  4IB6 A;  3JQO A;  1GT5 A;  1QY1 A;  2GTL N;  3AKN A;  2Q4N A;  4GNY A;  4INN A;  3QKG A;  4IBA A;  1KXO A;  1QAB E;  5HAE A;  3RKG A;  4IMO A;  4TKB A;  3NPO A;  5HWZ A;  1MUP A;  4YKO A;  1ZNG A;  2CZT A;  2Q2M A;  1JBH A;  5KHP A;  2LBA A;  1JJX A;  2FS7 A;  2KD2 A;  3B2K A;  1T0V A;  1EQD A;  3DTQ A;  1IKE A;  2BLG A;  1X8U A;  4K19 A;  4ZCB A;  2W2F A;  1DZK A;  4YH0 A;  4RUU A;  4ALO A;  2RQ0 A;  2FR2 A;  4BOE A;  4WFV A;  3MVF A;  2P8G A;  1G7N A;  5LKE A;  5BYP A;  1BBP A;  1FTP A;  2ACP X;  1BRQ A;  4YFP A;  2GTL M;  2FLJ A;  2MM3 A;  4YGG A;  3C77 X;  4ZHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...