4M0HA

Crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
216
structure length
216
Chain Sequence
SDHLLTEISVNHGEHKQVTLPDGTVVHLNAGTVMRYPTEFTSDIRLVEMEGEAFFNVMRDEGKPFIVRTRQADVKVLGGSFNVKAYQEDELMAVSVRTGKVEVDMPESVMRLLPNEQIIVNNTNGEILKKNEDAQKVTAWLQGGLYFNRTPISSVIHDLERMYNQEIVLDPNVVFDDYIYGEHDNKSLEAVLNAIQYSTGIRYRKEESRIVLYKTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a conserved hypothetical protein, putative anti-sigma factor (BDI_1681) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
molecule keywords Conserved hypothetical protein, putative anti-sigma factor
molecule tags Signaling protein
source organism Parabacteroides distasonis
total genus 57
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04773 FecR FecR protein
A PF16344 DUF4974 Domain of unknown function (DUF4974)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1440 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m0hA01
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 4m0hA02
2W16A 4M0NA 1ZZVA 2O5PA 4M0HA 4JTMA 2A02A 2W77A 2W75A 2IAHA 2D1UA 2M5JA 2W6TA 2W78A 2W76A 3EZJA 3GR5A 2W6UA 4G08A 4AR0A
chains in the Genus database with same CATH superfamily
2XR4A 1QU0A 2LS6A 2ET1A 1UMZA 3WDYA 2YC2A 4Q4W3 1PO22 4N9HA 4RFRB 5LY1A 2LM3A 3ZDVA 2VMGA 1CAXA 1XE0A 1F4AA 2ZGMA 3WP3A 1GQGA 3GALA 1L7RA 1RIRA 1BVVA 5FZLA 2XBO2 3IT8A 1PNGA 3A7QA 3WINE 4EROA 2CWMA 3PTYA 5FZMA 1GBGA 1W6MB 2MEV3 3R05A 4FTSA 3EJKA 5C6CA 2UWCA 1RITA 2VCCA 5JI9A 4QKNA 1W6QA 4XVHA 1RUE1 2H0VA 4TZDA 2P37A 3NRUA 3CJXA 3SCFA 5T54A 4OQ8A 4B4RA 3WG2A 3APBA 1F9KA 2DUPA 3L9JT 3UKNA 3O1UA 3N9MA 4AEMA 1ZNPA 5FZBA 4NAOA 2E31A 1LB2A 1E5SA 3NNLA 3FLTA 1RVF2 2YBSA 4WVVA 2JG9C 4ZZ8A 4NHLA 3G7DA 1VMJA 5FZHA 4YZ1A 5DUUA 1W9WA 1H4GA 5DAQA 1VIWB 1UYYA 5IVJA 2YHJA 2HWE3 4LPLA 4I01A 1H2MA 2EALA 2EAAA 4X6QB 2W52A 1MVQA 5FP4A 4CEWB 4MO3M 4NJ4A 3SXWA 3JB4C 4I3GA 1CAUB 1IOAA 1DQ0A 4BQWA 3AP6A 4ZZ5A 1H0BA 3RG0A 2DDUA 3ZSKA 3GZAA 3RSJA 1MEC2 5I8TA 2DUQA 1XSRA 2HEWF 4H3WA 1FOD2 3AYCA 4OUSA 2A3YA 3U75A 4A45A 2H6CA 4AAXA 1ODMA 1UOBA 1PO13 2FDGA 3AZZA 4J1WA 1JZ2A 1O5LA 2D3RA 1DFQA 3LIGA 5F7UA 4JVAA 4N7IA 5BXXA 3ZXEA 4BDVB 4NRMA 1RUC3 1UX6A 5CBLA 1UF2C 3HQRA 3IDCB 4XFIA 3OPTA 3ZFEC 4LUMA 3H50A 1O91A 4QU2A 3MF6A 1M4WA 1I5ZA 4OZOA 3PMSA 1EV13 1K5MB 4SBVA 4COVA 2GP3A 2W94A 1SZBA 2FCVA 3KSCA 4JHTA 5FPAA 2YFUA 2FZ2A 5FMOL 5F32A 1XOYA 5T5JA 4O7XA 4XFHA 1X8EA 2FQPA 3D82A 2AYHA 1O6UA 2XDVA 4I30A 4S2DA 5FZOB 4IDZA 2XH6A 1GU3A 2YGLA 2JG9A 5F2SA 5JZGB 2B9UA 4OHWA 5ACA2 1ASJ3 1GZTA 1JS9A 2BGOA 3QH7A 2N7GA 4Q1RA 3JBG1 4RR3B 1QJY1 3RJ2X 2XG3A 1HB4A 3BTZA 1W99A 3KF3A 4AI1A 5FY8A 5IVYA 5BNNB 2D6MA 3MI8A 3SMHA 5HI0A 3U07A 4NWWA 3OBZA 1QQP2 3VD7A 5A3LA 3JUUA 4O65A 3LEIA 1BMV1 4P9IA 4PBPA 4DUXA 3HN3A 4HBNA 5FZIA 5E6HA 4CDUB 1X82A 2GNTA 2RS12 1FYUA 2P34A 3ZN4A 4FFGA 3GNEA 2WDBA 3O1MA 5J3UA 4FXKB 1SDDB 3K4ZA 2E7AA 5JMOA 3KV5A 1NUKA 4MGIE 5KHKA 4Y20A 4DXZA 2GC0A 2XQRA 4HSJA 3WCSA 4QX5A 3ZFEA 1E57A 5LBCA 4KBBA 1J58A 4JDOA 3VBHC 1RMU2 1XPWA 4LLFA 2ZMKA 3U11A 4DY5A 3IAPA 1VPHA 2JKBA 4OI2A 3ZYFA 5M0TA 3K75B 3KM5A 4ZPIA 5C3OA 2OKXA 5L7OA 2Y60A 5EXOA 1AXKA 1US3A 1RHI1 1OA2A 1UCXA 3MICA 5FPVA 2JDNA 2ZX0A 4LBQA 4UF0B 5LATA 1UYPA 2A70A 4XF0A 5EYXA 3HVDA 3POEA 2YBPA 3GJBA 2JECA 3PUIA 4TYSA 4NIAA 4JCKA 3ZR6A 2JDYA 1ACCA 1RL3A 2PLV3 2RS32 3AMNA 1UYXA 3RNSA 3THTA 3ZSMA 5E16A 5L36A 5LA0A 4LUKA 5FIXA 3VDDB 2QQWA 4W8JA 5F39A 4D3WA 3KQRA 4MX3A 3WDTA 1SLIA 1ZBE3 1COV2 2VZSA 4YSFA 1AXYA 1K42A 4CP1A 1R081 4B8EA 3WG1A 5C3PA 3NKTA 1XJAA 2ARXA 3CJIB 4YRDA 4D6QA 1W6OA 4WM7A 5LWBA 5J7MA 4QX8A 4AR2A 3HQXA 2QQKA 3ALQA 3USSA 4L9BA 3WDUA 3ZFFC 3LF7A 4CEYC 5A3PA 4TN7A 3RZGA 2VNOA 1QKQA 1SCSA 4KG8A 2NLRA 3MZHA 2LW8A 2XJVA 1UY3A 1AR61 5ABJC 1SG3A 4ES8A 3E6DA 3KV9A 3I2DA 2JEMA 4FCAA 5FV3A 2YB7A 3WNMA 5C8WA 5FP8A 2Y8KA 4EWEA 4NIDA 3PDQA 4LO6B 3FWEA 2RE9A 5DDJ2 5JCTA 4I09A 3B69A 4M00A 5C33A 4RS5C 2Y6GA 4QDQA 4ES9A 5CISA 1JOBA 4FPJA 2KXLA 5JR7B 3ACLA 2R0FA 2RMU1 1E5RA 4N53B 4AW7A 2V73A 2W1SA 3OG2A 3HBKA 1YRZA 1S2BA 3LPGA 1N3PA 4AAPA 3U1XA 4F7ZA 2QZ3A 1PO23 3D0JA 4GB32 2VTXJ 3E5UA 2RJKA 1NE6A 1YNAA 2WKKA 2JDAA 1RUOA 4LO5B 4BK4A 1H9PA 3VDCA 2B39A 4JGYC 1UZ0A 2XBO3 2I45A 1LHVA 2ZAHA 3IKWA 4GJYA 3VBSA 3HNYM 1PGSA 5FZ1A 3I2IA 5FMOS 1WLCA 4YM1A 1K3IA 3HR9A 4D6SA 4Q4X1 1S0CA 1C8NA 1CAWB 3VBFB 3LFMA 1BHGA 1FPN1 4PDWC 4LNVA 4WBBA 1MZFA 3VLBB 3GHMA 5JSRA 4HFSA 4CDQA 2D93A 2CGNA 3QH6A 3OYWB 5KC5A 3KVBA 5FLIA 3WQBA 1GZCA 3ZFFA 1W2NA 4XFGA 2RS53 5FYBA 3UGFA 4OLLA 2BGPA 3VZNA 4YM3A 4BIOA 5FREA 4BQ5A 1YJLA 2QJVA 2W2IA 1LOGA 5ABJA 5JPMB 3R6SA 2VZTA 5FYCA 1H30A 3V56A 5IFPA 5JMCA 5A70A 1AR71 1H8TC 4DXTA 4FBFA 1VBB3 3SCHA 1YQ6A 2A6YA 4RHV1 4WM8C 4P08A 4RS5A 3S30A 2RDRA 3WW4A 2VG9A 5DMYA 4JC1A 4HXCA 3EO6A 4LMFA 3VBOC 4Z1VA 3K4DA 1MEC3 1MVEA 3BU0A 1FOD3 1S0DA 3WF1A 2YROA 2X8KA 2MNGA 3NV3A 4Q0SA 5K7PA 2OX0A 3ZIWA 2D6NA 1WMXA 2WL1A 5F5IA 5A1FA 4FT8A 4JGYA 2JWPA 2OYZA 3WD5A 5L9RA 3AXEA 5K4LA 1SBDA 2W68A 3AZYA 1NG0A 2WT0A 3OTFA 3OGVA 4FO9A 5BNOB 4P9GA 3OY8B 4XUPA 5KHJA 2XJSA 3GR5A 2WSUA 3MYXA 1IKPA 3Q8AA 4PDWA 3ABZA 5FPUA 3K46A 3VUOA 3BB6A 3WEZA 1SBEA 3V0BB 2K46A 1Q5OA 2AEZA 5JOYA 1GP5A 4C8DA 3NVCA 5ACA3 5JLVA 2C1FA 2EIDA 4YGCA 3RI9A 2XJPA 5J37A 4CCNA 4Y5TA 2E51A 4UW5A 3PIJA 4HLTA 5DAVA 3GF6A 2AUYA 2CTVA 4E4DX 1H8TA 2A3WA 1KXGA 1NT0A 1FMD2 1Z0HA 1ENSA 2WZR3 3ZSEA 2XVGA 2HWB2 3KT4A 1LGNA 2ATFA 3TN93 2XUEA 5EFUA 4EN9B 1JYCA 2LRPA 4HVQA 4OFGA 1QQP3 5FY9A 4AZZA 4DFSA 3VBOA 1YQCA 1EPWA 2J1TA 4Q4W1 1UY4A 3GCWA 2WS92 1W6PB 1W9SA 2ZHMA 4NHKA 3CIHA 3B9IA 2HBUA 3ON7A 2RS13 5A6QA 3M3EA 1H9WA 4RL7A 2C4XA 1JZ7A 1IHMA 2VTXA 3QOPA 1GWKA 1LR5A 5FPXA 1MS3A 5LA2A 1V6MA 5EIYB 1ZZ8A 4FAGA 2MEV1 2JDKA 1PGL1 2FMDA 3EBRA 4IETA 1V6OA 1UOFA 1JHJA 1KQRA 2YMZA 4FSJA 3O1TA 1RMU3 1IGOA 5BNQA 5KWRA 4FAHA 2IVJA 2B4KA 4LKEA 3ROUA 4BM8A 3CL1A 3B7MA 1BVP1 1QNYA 2VNRA 4MGSA 3TRSB 2QKDA 1ZREA 1W6MA 3POWA 5F3GA 5FBJA 5JUVA 2L9LA 1WA4A 1XQNA 5IT6A 3IPVB 3OB8A 5T55A 5FO7B 4CUGA 5AC93 3MO4A 5GZCA 4QB6A 4JAAA 2HWE1 1QH7A 1XYNA 3I49A 4JRAA 2TUNA 2FCUA 4GWJA 2YPJA 2OQ6A 4YNIA 1AVBA 4BLIA 1W9FA 4ZS2A 4GALA 4A7KA 3LQCA 1COV3 3R4DB 2ARAA 3WNLA 3KQ4B 2XL7A 4MXVA 4N43B 4IE6A 1ENQA 2DVAA 4YVWC 2UWAA 1PO11 2YC4A 4AFBA 5LK5A 1U5ZA 1SPPB 5FPZA 1OPOA 4LBJA 3VZMA 3WF0A 4BCUA 1HB1A 1V6IA 1RUJ2 3DKWA 3ES4A 1OQ1A 4BQ3A 5D8AB 3L2HA 4ZHNA 2WNUB 2HYXA 1RUC1 3TOJA 3ZXJA 1H2KA 1NLQA 3VN4A 4KL1A 3VHRA 1POV3 2HWF3 3ITQA 1G9BA 1UZZA 2JJ6A 4ASMB 1AYM2 1WWYA 4QHZA 4CDUC 5CKNA 3S5QA 1OOPB 1IS3A 3KT7A 4IEVA 4PLNA 3HNBM 2W1QA 1JUHA 1LOAA 1UZWA 5F6LB 1DF0A 1CPMA 2AGSA 2NPIA 1EV11 4OHVA 4OUEA 4Q5OA 3W9AA 1D4M3 4E27A 4Z8BA 3B3QE 4ISRA 4OHXA 3BPSA 4YPJA 3VD5A 5LW9A 2Y0IA 1AL22 5FZGA 2WZ8A 4E4SA 2VNVA 3AP4A 1DP0A 1SMVA 1W3VA 3PJYA 1N3OA 1PX4A 4W6WA 4XF9A 4FOVA 4GB33 1K5MA 4UFHA 1GP6A 1ASJ1 2R1DA 2RDNA 2Z42A 1SFNA 3AMPA 3POSA 5A7OA 3UJOA 4CCOA 3BTXA 3ACHA 4FPEA 3VKFC 3QLQA 1V9U2 1IG0A 4QDSA 3CZUA 4BB3A 2HWC2 5KHHA 2QQMA 2F4LA 2W3JA 4WZCA 1C8M2 3HN1A 1R1A2 2ZS6B 2X5IB 5ANNA 2GZWA 2VZPA 5DG2A 5FZOA 1LESA 3JXSA 1DZQA 4A2UA 1PK6B 5JZGA 2BW8A 4Q26A 4CYDA 4YVSC 4RR3A 4IXLA 4J1XA 3TEZA 3SHRA 3HD8B 4CA9A 1AHSA 1SLAA 1O7FA 2ZABA 4U36A 4YVWA 5A7WB 3EYPA 2FCTA 5K0UB 2G4IA 4A44A 4EQVA 4XUTA 5BNNA 1JI6A 5G05L 2RV9A 5CA6A 3NAPB 3ADYA 1H1IA 4MADA 1ODNA 1JXNA 2JG8B 2EXIA 4W4ZA 1LTEA 1ND2B 1XRUA 2ADEA 4AVBA 4ASKA 2WWJA 3G6JB 2C24A 1D2SA 2OUHA 2VCBA 3T2PA 3OEAA 2FDKA 4E2SA 4IV3B 2G9FA 2IC1A 3KCYA 1UY0A 3POFA 4CDUA 4F83A 4ZU7A 4TTGA 4QPWA 4C90A 4DXSA 1C1FA 4IUGA 4RFT0 5JI7A 2HWD3 1HJGA 4LE4A 2W1WA 1QOTA 2ARCA 2EXJA 4KI5M 3ST7A 3URFA 3RPQA 1MZ6A 1EAH3 5IK8A 4PQQA 3GBGA 2VUDA 3Q8BA 2R1BA 3CLPA 1VRH3 1D0GA 2FDJA 2IXIA 1SQ4A 2GNDA 3AYDA 4XF3A 2WO1A 5A3NA 4FTEA 4HK8A 5FYIA 3USUB 1NZCA 5ERLA 5FAXA 2OZJA 5IATA 3MPBA 5A7SA 5JPNB 4Q29A 2PLV1 3FZ3A 3T3YA 1XNCA 2WN3A 1ZZBA 1OVPA 1HB3A 2ZX3A 1Q43A 4KNCA 2QUOA 1S0FA 1Z78A 3A0NA 2Y64A 3M3QA 4I02A 1XYPA 3GM8A 4LA3A 4YZ2A 3IIIA 4A3XA 4GA9A 4XQWA 1V6JA 4UF0A 1ZBE1 4GIQA 5FLJA 3VDAA 2DUOA 4WZFA 1XXNA 4XTMA 2ZMLA 3NMBA 2WSVA 4UT5A 4YW1A 2X05A 2UWBA 4IEUA 4YVSA 4A3ZA 5FZEA 3OF1A 1H4HA 4YZ3A 2KR2A 3AKPA 4IV1B 2ZEXA 4C0HA 4EWDA 1W28A 1PM7A 4BQ1A 5K8SA 4L2NA 1ZRDA 2Z79A 4BU2A 1UOJA 4J25A 4JGZB 4YLZA 4GD4A 1ULFA 1KRIA 3VBFC 1C5IA 2DURA 5C4WC 2R49A 5FY4A 3HBZA 4UI9L 5FZAA 2Y0OA 1ZX5A 5FY0A 3HWJA 4Z92B 2ZEYA 4DRVA 4GH4C 4FP2A 3ZYHA 1QJX3 2Q8DA 1TNRA 2D43A 1PVC2 2VL4A 2BBAA 4HONA 2VZQA 4XTPA 4Z07A 5F6KA 2VMDA 3A22A 1H6XA 1N1YA 3J8F2 4PF1A 1O3QA 1J59A 1NA1B 1OURA 2HWB3 4E4ZA 4MGTA 2F17A 3RS6A 3T1LA 3AX4A 3O1SA 3GDBA 1H2NA 4Y1XA 1NE4A 4R9CA 2TEPA 2WS93 1PO21 4AVCA 3C7FA 3CKHA 3T0DA 2SBAA 4Q4V2 2VVFA 4XDQA 3AKQA 4ATFA 4YWAA 1MZ5A 1LHUA 1KS4A 4N53A 4UFKA 2D40A 3CMGA 3JCIA 1UMHA 4TLGA 2XBO1 4LIUA 2ORZA 4QQLA 3O0VA 1UY2A 2DCYA 3CEWA 4YW6A 4M01A 4XCBA 3PVBB 5C3QA 1AYN3 4Q4Y2 1G9DA 4EYUA 2DV9A 1FV2A 3B02A 1WMFA 4OZXA 4XIKA 4DS0A 4EZHA 2OUJA 2UYBA 5HCFA 3KHCA 3K3NA 3VD4A 4DRRA 3LEMA 4HKLA 4XFBA 1HRI3 2J1VA 2OS2A 3IM0A 5FBZA 3BPZA 5EYYA 3ZKUA 1DIWA 5JXJA 5KXCA 1WLWA 3INAA 3Q8FA 2RS51 4ITCA 4NMIA 4YZ4A 1YQ5A 1CAWA 4N8MA 3VBFA 4FOQA 2DVBA 3ETPA 2D3PA 3LSDA 5C4WA 1I5PA 1RUNA 1GANA 3U37A 1HXS3 2C6SA 2E33A 3AYEA 1VB2A 3NNGA 5APAA 1W8NA 4DNYA 2VAUA 4GH4A 4S2FA 3KF5A 5EJ3A 4XJ8A 1CJPA 2R043 3OYWA 1VBB1 5FZ4A 2XWJB 4PI0A 4KGGA 3T0BA 5JAXA 1IQAA 2P1BA 1GLHA 1U0AA 5GALA 4Y4RA 2D6LX 2VZVA 5FZFA 3L2YA 3POGA 1MEC1 1FOD1 5FZ6A 2QFEA 1Z7S2 4IERA 1WW4A 3ASIA 4EJRA 3ENRA 2E6VA 4XMAA 3W20A 5CFDC 1ST8A 2JDUA 3O14A 4U2AA 4NAMA 3UETA 2BERA 2CV6A 5DXDA 3C7OA 1LHOA 1MQTB 1Y43B 1UQXA 1ZVFA 3GZUC 4NWVA 3AJYA 1NYWA 1JBCA 2VW1A 1US2A 3POYA 1YIFA 2GMPA 3N7JA 1UU5A 3KWVA 1K12A 2XVLA 1DYKA 1ZRIA 3F95A 4ASLA 1LU2A 2OIIA 3LOIA 4CCCA 2GDFA 5DN2A 4F3JA 1J1TA 5DAWA 4QQ2A 2VNGA 2PTMA 1SLCA 4GJZA 1X36A 4LBLA 3VZOA 4B1MA 1AL23 1OA3A 1BEV3 2VBDA 3OY8A 4QWNA 4YM2A 3RI8A 4DOUA 3OSDA 4DUWA 2J1UA 3Q8EA 1RUF3 5ACA1 1WLDA 1R092 3PVNA 2QQPA 4NPLA 3MLKA 2VCMA 4V2VA 5HCAA 1HKDA 4KWJA 2HWC3 3M8LA 1S0BA 3CBNA 4KMQA 4CTEA 3FFZA 4WVZA 1R1A3 1CZVA 2WZR1 3OBTA 3NQHA 5BNPC 5IK4A 4FP3A 2D6KA 2WT1A 3TN91 5J09A 3V0BA 2PELA 5SV8A 4COYA 4CU9A 2X29A 1QJZA 1TMF3 1RUI2 1QQP1 3WXPA 1ZBA2 3LB9A 3QCWA 2D5FA 1ONAA 3WW2A 1NOVA 4B4PA 2ZHNA 4URAA 1WCKA 4XXPA 2VECA 3DGTA 1POV0 1NCQB 5JXIA 1GQHA 4JZRA 2RS11 3SH3A 1SFYA 2R062 5FZKA 5I0DA 2B45X 4ONUA 3GBWA 5CFDA 3OGSA 3LZZA 3VHPA 3WW1A 4Q0VA 5SV5A 2Z4FA 3D3AA 3U14A 2VOTA 3C7EA 1BXHA 1JYNA 5FR3A 4L97A 5LB6A 1RMU1 5D8AC 4HSLA 4LO4B 5FP3A 3WHTA 2WLPA 2WFF2 2VOWA 2ORXA 4MVTA 1ULGA 3MIFA 4R9BA 2EIGA 2IXCA 4HPKB 3BALA 4RQPB 3SCGA 3BTYA 2B8MA 2G1MA 2WQ4A 3DPRC 1CAVA 3MLLA 1QNWA 3S6PA 3TEYA 4RGKA 5CU1A 5AC91 5CFCB 4AFCA 2JDMA 4QGNA 1AJKA 4UW4A 3ACFA 3E1F1 1HDKA 2OPKA 4AVVA 2DU1A 4FI9A 1VP6A 1EPZA 4NROA 1U5IA 5FY7A 3P5BA 2HJIA 5LBBA 1A8DA 5FWEA 1J3RA 1S0JA 2WZPP 5FQ0A 5BNPA 3HMYA 3UK9A 4LKFA 1COV1 3BVCA 2VOXA 1OLMA 4LULA 1UL9A 3T4HB 2CDOA 3HAGA 4NPRA 1YXWA 4LT5A 1QEXA 1YFXA 2OXBA 3WZ1A 5GM0A 3AMQA 2Q8OA 2X5IC 1C28A 3ZOIA 3P6BA 1YHFA 1WUVA 4LJHA 2QZ2A 4EN6B 3NKGA 3MHZA 1ENXA 1PK6C 2DVFA 4YW3A 3BKZA 1MS8A 3RVHA 1LECA 2BV4A 4KBZA 4K7JA 3THCA 4EWAA 5JOZA 1POV1 2HWF1 5L7OC 4OULA 2VCAA 2R30A 2X53S 3V0AB 1BZWA 4RN5A 5A3TA 3BUCA 2OZ6A 1PVC3 3AKTA 3NAPC 3WQ0A 5D8AA 3CHXA 4QX0A 1D4M1 2WNVB 4IESA 1NLRA 4SLIA 3EQEA 2A3XA 3J8F3 4BMBA 4CZSA 1T6GC 5DABA 3GBFA 3TWIA 1WW7A 2BP6A 4QPIB 2VMHA 3DPRA 3RZJA 1TME2 4V1PA 5FPBA 1OLRA 3K2OA 4P02B 4Y5Z0 4AQTA 2WYFA 1UOGA 2ET7A 2R072 2W9XA 4GB31 3ZPYA 5H9QA 1GNYA 3C7HA 4XUQA 1RJ7A 5FP7A 2ZJCA 4QHBA 1DQ5A 3O1VA 1LHWA 1STMA 4XILA 4WM7C 1Q8VA 5DZGA 1ZZCA 1OUSA 2AZ5A 1HRV2 5EP9A 1AF9A 1V00A 5HV0A 1QOSA 2P6CA 2NYYA 4JHZA 5FZ8A 2PFWA 3AXDA 4Q4Y3 1YI7A 5KXBA 1CVNA 1UNBA 3CDDA 4A6SA 2QQJA 3NNFA 5T52A 2JDPA 4BMEA 2X5IA 2ZEWA 1W05A 1VBE2 3M2MA 4AI8A 3TEWA 3D37A 1PK6A 1PMHX 2F6BA 2ZA9A 1UIKA 3PVEA 3PUHA 3O7OA 3NO8A 3O5SA 4NR1A 3ZYPA 5IAXA 5JDBA 3ZFGC 3DECA 1GOGA 3OJBA 5E89A 1REEA 5K0UA 1GMMA 1AX2A 1LODA 4IV1C 3KMHA 1DQ2A 2GH8A 1WMEA 3HIFA 5F8PA 3SEPA 5JWPA 1RUE2 2XB6C 2HWD1 2IFWA 3T1MA 4JGZC 1GKBA 2YUEA 3NAPA 1V70A 2C9AA 3MFCA 4ARXA 1VBD3 3DYOA 2JG8A 1EAH1 1F15A 4AXOA 1UD1A 4IEWA 2WBKA 4CDXB 5A6XA 2D1UA 2J1RA 3RRDA 4BHPA 5FUPA 2OW4A 1VRH1 1HLCA 4IV3A 3VBSC 1U5YA 4O9EA 4PQ9A 4TLFA 3LCPA 1Z7S3 2WRAA 4QQOA 4E2QA 3D6EA 2W78A 4QQHA 2O8QA 5FCCA 4HKOA 5FYUA 2VBPA 3EXUA 5C9AB 1NA1C 2R0HA 2ZGPA 3WOGA 4BJ0A 1W3XA 1YJKA 1Q3EA 4XETA 3ZDSA 1JODA 1U12A 3OGGA 2EAKA 3MIEA 3IN9A 4CDQC 4UYBA 1EP0A 3A4UA 1YFYA 4KQ7A 4HZFA 3USUA 2QQVA 1N1VA 1PGW1 1XU2A 1PVXA 1NCRC 4AG4A 3BOWA 5I0RA 3AL5A 2IAHA 5GLUA 3PUQA 3BIEA 2NM1A 4P9LA 5T50A 3GZTB 4MOAA 2FDFA 5AVPA 3VL8A 2EIBA 4YFZA 2W6UA 5LEKA 2Q8EA 5A7NA 1OF4A 3ZFGA 4CCEA 4CP0A 3PU8A 1WLTA 4K8FA 4D6RA 3RZLA 1R093 2WAAA 5FYTA 5GZDA 1NKGA 3T2QA 1QJX1 3AZVA 4IV1A 3HNMA 3M7AA 2JX9A 1FATA 4OI4A 2IXKA 2W5FA 5EZWA 1OF3A 4DQAA 4LTAA 5LZ6A 1AX1A 4JGZA 2A6VA 1CZSA 1A34A 1IS5A 2HWB1 2ZGSA 3OPWA 2V4VA 1RUI3 4XUOA 1ZRCA 1ZBA3 2WUHA 3FUOA 3PIGA 2WS91 3RZZA 3OD0A 3DCQA 5DZEA 2JB4A 1PZ9A 2ZGKA 1YFUA 2VUAA 1VBC2 1S1AA 2B42B 1NA1A 1W8ZA 1MZEA 1MS0A 4Q27A 3IBMA 1JH5A 1F31A 1B35B 1QF3A 5C3RA 4LBQD 4CXXA 3JQXA 1QGLA 2W16A 4XE9A 4DINB 3J7HA 4DPNA 3I59B 3ES1A 3IMMA 2W47A 3J4UH 1ULPA 4OVEA 1AYN1 1CONA 1BMV2 2UU8A 1RVF3 4XPVA 3RWNA 4HG6B 3PMEA 4KU7A 4QDRA 2WFF3 3NWKA 1NCRA 4HANA 2RG4A 1HRI1 3KD4A 3LEKA 1ALYA 2EXKA 2YG0A 5FTTC 1D2QA 4Y4YA 2PXJA 2VUJA 2FD8A 2ZX2A 1WW5A 2B5HA 4QPGC 4MYEA 1SFPA 4NPMA 1HXS1 2P17A 3CZJA 3QBQA 4OQ9A 3VV1A 3NNJA 1OD5A 2PHRA 2AC1A 3AYAA 2R041 1DGLA 2BZDA 2H6BA 2YY1A 5GLVA 5DUWA 3OGRA 3ZYIB 1G7YA 3TNPB 4CU7A 4EN0A 2A6ZA 2I74A 2PQQA 3ZN6A 1SHWB 3PHMA 5CG8A 1SDWA 1T6BX 4KH9A 4Y22B 3ILFA 3LFIA 3NV1A 4KWLA 2B9VA 3IZOA 4UAPA 3M3CA 1EUTA 4ZU5A 5FYSA 1OFNA 4LHSA 4MGZE 2XJRA 3H42B 1IS4A 3DL3A 2VULA 2XHNA 3N3HA 5F3EA 3W5MA 1IZ3A 2VTFA 3I3DA 2VMIA 4WVMB 4XF4A 4E9KA 3VL9A 3AMHA 3GYDA 3N7MA 4LORA 5CKMA 1NXD1 3WP5A 1HN0A 1NZIA 2K9ZA 3UKTA 3LIHA 4EV0A 4RYDA 3BI3A 1TG7A 4JDMA 4CCLA 1LOFC 5EV7A 1GV9A 2DVGA 3O1OA 4XJ9A 5A33B 1A8MA 1YC61 1FX5A 1W6NB 2VY0A 4PIZA 5IVFA 5HBAA 4L8QA 2AACA 1TME3 1AL21 2Y6HA 5GZEA 3K4AA 1BEV1 2VJXA 5C8CB 1RUF1 2JICA 3IWZA 4QPGA 4AQSA 1SEFA 1UO9A 2BVVA 2WC2A 3E5QA 4RQPC 1SLTA 4K1YA 4XEZA 4XJUA 5CYYA 2P3KA 1QDCA 2PN5A 4OI1A 2HWC1 3DF0A 2BUKA 4AWDA 4CEWC 1JZ6A 1CAXB 2VC9A 4LK6A 1R1A1 5CFCC 2RMU2 5C71A 3H3ZA 4MGQA 3C7GA 3MIGA 1SACA 1TMF1 4QT6A 4QMAA 4OMCA 1LULA 1RUH2 2IXLA 4AHWA 4QX1A 4MHRA 5IVCA 2DFBA 5AFBA 1IG3A 2YU2A 3AZXA 1XNDA 1ZYBA 2RM22 5DQ0A 3OCPA 2PHWA 1JYTA 3MBWA 1XNKA 3PL0A 1VBE3 4QU1A 1S0IA 3MW3A 1W8FA 4EN7B 4NIHA 3R4SA 4QM9A 4XXAA 5FZ9A 3FL7A 3UKVA 4X8PA 5D21A 2CDPA 3MW2A 2ERFA 3HPNA 4JDNA 4XURA 4HN0A 4XAEA 4RGGA 4MZUA 3NSTA 1RINA 1FV3A 1HJFA 4Q4X2 4W6XA 4XZUG 4AEJA 4BIFA 3ZXKA 3ZYBA 1K5MC 1JTZX 2NN8A 4UFLA 4M0HA 2UY9A 1X33A 3OUHA 1LOFA 5FO9B 5LBFA 1VJ2A 2RJLA 5IUQA 5A1LA 2BJSA 1ND3B 3I3BA 2JKXA 1I9RA 2RS33 4NRPA 2ID4A 3OV5A 4AI3A 3J26N 2ZEZA 2LALA 5FWJA 4W6YA 5JIAA 4AHXA 1LCLA 3C2UA 2Y38A 4FPGA 1KDKA 3MUY1 5JZGC 1VALA 3I2JA 3E97A 4RR3C 3ZSLA 3UNPA 1O3TA 1N3QA 2BOIA 4HPKA 1M06G 4RQPA 5FYZA 2OA2A 1DLCA 2YZ4A 4CEWA 2VH9A 2VM9A 4IEZA 5BNNC 5CFCA 5FP9A 1CAUA 5FDBA 1C3HA 3KLSA 4Q0UA 4XJZA 2AREA 2P2KA 4B1LA 4BXFA 4M3CB 2HYKA 2VQTA 5FYHA 5E88A 2QQUA 1NY72 3T2OA 4MSVA 1XSQA 4MXWB 3ZO0B 4OHYA 5F5CA 3E6CC 4P9XA 1Q56A 2UURA 5CVRA 2XVKA 1REDA 1W2UA 2GMMA 4PLOA 3IIAA 4P5HA 2XQXA 5DDJ3 1UIJA 3WR0A 1BK1A 3LAGA 2ZHLA 4Y1YA 5JOXA 1OFSA 1J3PA 1YI9A 1DCSA 5FPLA 3VBUB 4BE3A 5AVAA 2CAUA 2L4WA 3WP6A 1LOBA 4Q8KA 2JG9B 4UFIA 1PVC1 2R6QA 3PNAA 5DAXA 5IK5A 1KGYA 4G9SB 5BV6A 1QJU2 1R1ZA 4QXKA 1JYIA 4KWKA 1RJ8A 3FLPA 3J8F1 5CEHA 1H8VA 3IMNA 2DFCA 2JXAA 2BDRA 2VXJA 2LTNA 4FQ4A 5GKAC 3AJZA 4PJYA 4JX0A 3V0AA 4QQPA 3VKLA 5FZ3A 2VD7A 3FBMA 2Q4SA 3N7KA 1UAIA 1MS5A 2Z2SB 3S7EA 3VKNA 4C0BA 1O3SA 2XONA 4BYYA 5FJKA 4E4HA 2NP0A 4D8MA 1QH6A 3I8TA 1VBC3 2XUMA 2O14A 3P3NA 4ET7A 1SBFA 4X8NA 4CDXC 1W2AX 4DEVA 4QPIA 5C7GA 3CNAA 1JHNA 1S2KA 1W2OA 1W8UA 2VZ3A 3B94A 3VDDC 3I2GA 2GC3A 1GOFA 3WDVA 1RUD2 3E5XA 2F4PA 2FMYA 4Q4Y1 1BQPA 4Q4W2 1KD7A 2E53A 4Y20B 5JXGA 4PBOA 3RZKA 3ZFEB 3PTRB 3CJIC 5JR2A 1QXRA 2R16A 2ZTNA 1YWKA 2Z6BD 1BBT2 1QMJA 2FBEA 5EJ1B 1AXZA 1ULDA 1JZ8A 2E26A 3N4MA 4LBMA 1JZ5A 2BWAA 2MEV2 1PGL2 1CJDA 5GJ6A 1MPXA 4F8AA 2PHTA 2DCJA 2BRTA 4K8RB 3KHBA 3K51A 3WV6A 1FT9A 2GU9A 3EMRA 2QQNA 4P00B 1RC6A 3TYJA 1OQDA 1VBD1 1CD3G 1CX1A 4YGBA 5BPXA 3IAQA 4TSVA 2Y6LA 4HVRA 1QIQA 4LBNA 5EJZB 4AQ2A 2MHFA 3SLIA 3IB3A 1Z7S1 4IEPA 1ULEA 2JIJA 3WVJA 4A42A 4S2HA 2HWE2 2XXZA 5DAPA 1QXPA 3I97A 3CQOA 3NNMA 4IEXA 1OXCA 3WNOA 5B4NA 1NX9A 1DQ4A 1DBNA 2PAKA 3ZIXA 4QD2A 1DLLA 1MS1A 2GN3A 4CDXA 2FDHA 1UXXX 3H8UA 4XQ4A 1O8PA 3NL1A 3VDDA 5CIRA 4QX3A 4LOTA 4L11A 2A75A 2D3SA 4YGEA 3AKRA 5IW0A 4AF9A 3SH5A 2VPVA 1WCDJ 4LEJA 3WNPA 4I0WB 4Y24A 1OKQA 3ACIA 5FJHA 2B46X 4YW2A 2C26A 5HV4A 1AR92 4UBHA 1UZVA 1B35C 4ORFA 4OUMA 3VZKA 3CJIA 2X09A 1YFWA 4Y1ZA 2RDSA 3H7JA 5H9PA 3VBHB 2R7EB 1ZRFA 2DF7A 3ZR5A 4IE7A 5L9BA 3RYKA 3H9AA 1KJLA 2Q0AA 4XIOA 4ZS3A 1APNA 2CSGA 3WNXA 5F1RA 1FMD3 1OC1A 3C8XA 1WTHD 1P8JA 4D0QA 1OPMA 1NQDA 1R091 2ARBA 3J7MA 1W8HA 4TXWA 3U10A 2Q1MA 1Y7BA 3SISA 3H7YA 3B9CA 4AQ6A 3K77A 5HXVA 4DO0A 1JOPA 1OUXA 3N35A 5IVEA 1EY2A 1DQ1A 3RGBA 2VOVA 5KBFA 1RUI1 5I0TA 1ZBA1 1RUH3 4QXBA 4HETA 4D69A 2I07B 2RJ2A 4GKXA 1WBFA 3PUAA 3MLJA 2W1UA 4QGMA 1Y4WA 3AFKA 5T5PA 2RM23 1Q8OA 4IE4A 4XACA 5EPAA 4META 3CDZB 4M4RA 4A7ZA 2MPFA 4A4AA 5IVVA 3LOBA 1RGSA 2D5HA 2VUCA 4LIVA 4K3UA 5ANQA 5A80A 3I2FA 1HQLA 5A3UA 3J7NA 5A32B 2GAUA 2GC1A 3RQ0A 5IYYA 5FO8B 2WWUA 1S4CA 3HT2A 4JTNA 3BOPA 4B29A 3FJSA 1C1LA 2P6HA 3ZFFB 4CEYB 4D7YA 2PAMA 5BNOC 1KFUL 1QWRA 2UYAA 1SLLA 1ENRA 3H8RA 1RVF1 4GWIA 4HVOA 5ABJB 3A0KA 1WW6A 4XHXA 3SKVA 5A1AA 1D7PM 2KM2A 2WFF1 3WNKA 3NW4A 4URTA 1B35A 2AENA 2WAOA 3WW3A 1RUG2 1HQNA 4I2OA 2B7YA 5FKCA 1I1EA 2D6OX 2JDZA 4CCKA 4CSWA 4XJWA 1F2NA 3MIDA 1LNSA 3B5LB 3B01A 1OKOA 2WQZC 4P9WA 2QQOA 1ZZ9A 1OLME 1Y9GA 2ZXQA 1KJRA 3KV4A 4XJAA 3ZX7A 1UN1A 2VBBA 5F3CA 5KR7A 2VW0A 3AVRA 5FOJB 1FI2A 2WLQA 3H0OA 4FOWA 4MGKE 4AHYA 2WWSA 4PIXA 1WCUA 3GXUA 2DBNA 5TSWA 1W8WA 5LRSA 4IGOA 3AL6A 1AL0G 3DKQA 4MTKA 4C1XA 3GS9A 1WA6X 2E7TA 1RUJ3 3OUIA 2RHPA 2RR12 1TVGA 5C8CC 5D2AA 1PX3A 2BNOA 3ETQA 4JGYB 2EVXA 5A6ZA 4YARA 4NHMA 3DN7A 5LASA 4UW3A 1ZM1A 4GULA 5FZ0A 1YO8A 2VQUA 4H7MA 1G86A 2NZ9A 4HL0A 5EHDA 5F2WA 1XB9A 1AYM3 2CGPA 5HPOA 1O8SA 1WD4A 4C1WA 2D6PA 5HCBA 1QY4A 4YFWA 4XBQA 4IL7A 3SKJE 4PDWB 1VMHA 5F5QA 1Y9QA 1JYWA 2TNFA 4LKDA 4BQ4A 3GJAA 2ENRA 4BQXA 3FX3A 1A6CA 1VAKA 4CU8A 3N9LA 5BNOA 1W9TA 1ZA7A 2BEOA 4CPBA 2X10A 3O1RA 1QJU3 1YUDA 2VOKA 4QB2A 3PURA 3PLQA 4WV8A 4WVMA 5FFOC 3V64A 1GYKA 4ARYA 4P5YA 5JIUA 1GWMA 5A7PA 1PZ8A 4Z2WA 4DUVA 4OYUA 1H8TB 1G6NA 1V9U3 4XDPA 1RXGA 1TME1 3AM2A 4K9SA 4UBGA 3VD9A 4WM8B 5JSPA 1C8M3 3QACA 1L7LA 2W77A 1DYPA 1YQ8A 1JMUB 3M70A 2DVDA 4AE2A 2TBVA 5FUIA 3VBOB 1CR7A 3JD72 3VZLA 5KXEA 5DUXA 2JE7A 4AGVA 1W6NA 2ETEA 1K45A 4AGRA 2O0OA 3IDAA 4AVTA 2ZGRA 5FLHA 2ZGOA 3N9OA 1ZRRA 2GC2A 3P1IA 3TB0A 5KXDA 2WABA 4CCDA 1VMFA 3NV4A 1UX7A 4ZONA 2VZRA 1HQWA 1RUD3 2Y33A 3VKMA 5C8CA 2ZHKA 2C5DA 4QKFA 4GZ9A 4N43C 2P3YA 3K3OA 4RSUA 1S2EA 5FMCA 1UPSA 5T5LA 4YZ5A 4N53C 1RYYA 1ULOA 1W6PA 2I2SA 3O12A 4Q8LA 5FYVA 5LCWL 1DYOA 3AVSA 3THPA 1LJ7A 1VLNA 1YQ2A 3KS7A 1C57A 1BBT3 1W8TA 1OD3A 1VBE1 4FPOB 2J22A 4CUCA 1XU1A 2WNUC 3I3EA 5CADA 3GGLA 4LO8A 1UU6A 3KGZA 3Q9OA 2DCKA 3BCWA 4AVSA 5I0SA 4MH0E 3NJYA 5I0UA 2O8OA 3EZJA 4IEQA 1UWWA 1OOPC 3RYPA 4IEYA 1IPJA 1JW6A 1MR5A 4MGYE 4IE5A 4TWTA 4K21A 3GZEA 5D1IA 2BNNA 1O5UA 3M3OA 4KGQA 2JENA 5LY2A 3HOBA 2AH2A 1G9FA 5FXXA 3T08A 3VBUC 1HIXA 2CYFA 2RS31 3POJA 4NRQA 1D4VB 4LHKA 1PIV2 3NJVA 2GNBA 2RS52 1V0AA 1W0PA 1UZYA 1VBA2 3FHAA 3H3LA 5G04L 2P5ZX 2VR4A 3AB0A 4RGAA 2DTYA 1CIWA 3IPVA 2YXSA 2WA4A 2VMFA 5IWFA 4XFFA 2VVEA 2WYSA 5FMDA 5L73A 2GMEA 1WBLA 1ND3A 1VBB2 4NHYA 5DPNA 5I8SA 3CF6E 3W59A 5BY5A 4Q0QA 4UFMA 5J96B 4IW3A 1WCSA 1J1LA 4FFHA 4CPBD 5IK7A 5HCHA 3S7IA 3M3IA 2CHHA 2ZGUA 1V6LA 4CCMA 2IWGB 2BFUL 5FMBA 5FRAA 3AC0A 2IVIB 3P3PA 4I3PA 3FBYA 2ZGQA 2VQAA 4R4ZA 2K2SA 4XC9A 1F4HA 2W92A 4N43A 4AEKA 1AR93 5K0UC 1NXMA 1X50A 3FN9A 2KA3A 2ZPXA 5AFEA 1JYXA 3U4XA 1E5HA 1SPPA 2OT7A 3PVOA 4JTMA 3WDWA 1I3HA 1MS9A 5DDJ1 2PHDA 4BQYA 1AX0A 4ZU4A 2JE8A 1UMIA 2JG8C 2WNUA 1ND2C 3FE5A 4DEQA 4AI0A 4K6BA 3U0ZA 4M3CA 3A21A 5F5AA 2JB8A 4E2GA 4IV3C 3UGHA 2VZ1A 4MXWA 1OVSA 2ES3A 3TBDA 1OOPA 5J98B 1AR82 2WIIB 3N9NA 3QD6A 4IEOA 4JV4A 4PIYA 1N47A 4NHXA 3WCRA 1JU3A 4CDWB 3O0WA 3MV11 1G9CA 2WA3A 4Q4V3 2GN7A 3VBUA 3FMGA 4AOCA 3MFAA 3N36A 4R9AA 3SQOA 1N1SA 5T5OA 2A1XA 3W5NA 1FXZA 2UY8A 4QPYA 2A73B 5E8AA 3JZVA 4E8CA 3I2HA 1MACA 2X531 2D97A 2ZAAA 1VBC1 3ZSJA 1W8OA 2VO5A 4PHZA 4YVWB 3ZN5A 2WZR2 3B93A 4QKBA 3TN92 2Q8CA 2WZEA 4BA6A 1LENA 3LDKA 1UKRA 5HXMA 3LE0A 5K9YA 5H9SA 4B7EA 3S57A 2WNOA 4BWOA 1C5HA 3A23A 4QB1A 2FHRA 4BK5A 1HB2A 1HW5A 5A7WA 4M0NA 4BXSV 1T2XA 1RUG3 3DXTA 2VQ0A 2LROA 1LU1A 4B7KA 3D4KA 2DYCA 4DY3A 4LE3A 2GNMA 2XLAA 4Q2FA 5C70A 1ND2A 5LK7B 2J1SA 2P3JA 2OQ7A 1CIYA 3ZMOA 1JZ3A 2BNMA 1FNZA 4FOYA 2RDQA 3SH4A 3MIHA 1TEIA 2FZ1A 3WQ7A 4BQ2A 4JQRA 4W65A 1F8VA 1W2TA 3LA2A 1J3QA 5KHIA 4KG0A 3GCXA 4JTOA 1GQPA 4FFFA 3H8OA 4QX2A 3LA7A 2DTWA 2RR13 4LO7A 5L19A 1UU4A 3N9PA 2YBKA 2ZX1A 1KS5A 5AC92 3D5OA 5LBEA 2WQ8A 4Y26A 2ILMA 3BN6A 3VBRB 4FPHA 5DUVA 1W04A 2HBTA 3HEIA 1GFF2 4CP9B 4YVSB 2Q1ZB 2NMOA 3WF4A 4K20A 2QQIA 4A41A 2G9ZA 5GZGA 1H6YA 5CKQA 4DZGA 2LUWA 4LQRA 5KHGA 1E5IA 1O4YA 2ZZJA 1TQ5A 4NE9A 4NO4A 3ZXAC 4LBOA 5DG1A 4P9YA 5GZFA 1NLSA 1ZA4A 1GR3A 2BU9A 4JQTA 1WMDA 4PT6A 5LRRA 4Y1VA 4BZ4A 3ZPOA 1QDOA 3BU7A 2J42A 4PF5A 5IJRA 2O1QA 1XNBA 2VE1A 3WP4A 1O4ZA 4YGDA 2QTWB 5LA9A 3R0RA 5FZDA 4H55A 4J6GA 1GICA 3V65A 1MS4A 1REFA 2RVAA 5L9VA 4R4XA 2O5PA 2PHUA 2ZGNA 5A6YA 3PU3A 4AI9A 1VAVA 1FMD1 2HWF2 2YPDA 3UV9A 3VZJA 5BUVA 2PYTA 3H8XA 1KEXA 3T0AA 5I91A 3GHNA 2BFUS 1WKYA 3JD73 3Q8CA 2Y34A 4AL9A 3VBHA 4AEDB 3LDRA 5B2GB 1D4M2 5BYNA 4I0AA 4M3CF 4QXCA 5A7QA 3I2OA 2Z69A 3NJXA 3OD4A 1X9TA 5FK8A 3KB5A 1BK0A 3JBG2 1QJY2 2R063 1XNTA 2V72A 2XWBB 3LDBA 4LHNA 3W58A 2YV8A 1O3RA 1PZ7A 4L92A 1A78A 1K28D 1RUH1 2VMCA 1CN1A 1WCQA 2A7AA 4AFMA 1QJEA 3DEMA 3KVAA 3LSEA 1GZWB 2HLEA 3WHUA 2IFRA 5C5TA 3RZMA 2CAVA 2RM21 2BBVA 4IE0A 3N9QA 3O0XA 1H1AA 2XHKA 4AK3A 1BLZA 1PHMA 3KV6A 1DGRN 4CUAA 2CGOA 2WR9A 1G8WA 2JD4A 4NIGA 4GQ7A 3VB9A 1LGCA 1LOEA 1MQTC 3JB8A 4XAAA 5C5UA 1IPSA 2QE3A 3E6BA 1S0EA 2W87A 1UKGA 1VAMA 2DU0A 1XYOA 5CZKA 4GAZA 4LXLA 5GLZA 5T3NA 5C4WB 2J7MA 2JIGA 4V2WA 5A32A 2XJQA 4GH4B 1U5XA 4NVPA 1CWPA 4IQPA 1DZTA 1Q8QA 4S2GA 2W08A 3FUQA 3ILRA 1PIV3 2H0BA 4CUBA 4CEYA 2YYOA 1VBA3 3LD8A 3C3VA 4XMIA 2C0ZA 4BOWA 5A3WA 1UYZA 4HN1A 1V6NA 4ZXEA 5FXVA 3ORJA 1RHI2 4G4FA 4FQZA 4FPFA 5I8YA 1N1TA 1V6KA 2HWD2 4Y1UA 3WG4A 5JXHA 3ZXDA 1W9YA 2Y26A 4YW4A 3ILNA 4XHBA 1W0NA 1EAH2 3WQ1A 3DYPA 3HQUA 4XABA 3JU9A 1RUJ1 1YEWA 4UW6A 1S55A 2EICA 1PM4A 1SCRA 1VRH2 2Y6KA 4GWNA 2WZPR 1IS6A 3T4VA 1F5JA 2PHLA 2W46A 3D8CA 2QQLA 1NCQC 1NY71 3KGLA 2Z5WA 4NOTA 1AYM1 3I54A 5J48A 3DV8A 1DZRA 5FY5A 1CGPA 1R082 1DU3D 4OCTA 4A6OA 1VB4A 1KDMA 2YC0A 2CL2A 1IKQA 4XQDA 2DWRA 3MV01 3OBRA 1WZXA 1XE8A 3VD3A 1OH3A 2CU5A 4XW3A 5H9RA 3MEPA 1MQTA 3RWKX 2W75A 3OEBA 5JOWA 4OHZA 3IDBB 1QXJA 2XJUA 2Y6JA 4MHUA 3RDIA 4GMP3 1PGW2 1LHNA 1AR83 4AFAA 1AR62 4LKSA 2R073 1QJU1 2EIEA 4XFCA 2WNEA 4YG0A 1DDLA 4YYOA 4Q1PA 4LBKA 3WG3A 1QOOA 4FPLA 4QGLA 5EQUA 4COUA 1F5FA 2E63A 2VZUA 3SITA 4LHLA 3WLUA 1UXZA 1FAYA 1V9U1 4QX7A 3O1PA 2P4EA 2VU9A 4RD7A 3SNMA 3S5AA 1C8M1 1HRV3 3H1YA 4GXLA 4MLOA 2QVSB 4Z82A 3WY6A 3ZVXA 3I7DA 5FK7A 2VZOA 1QJX2 4QXHA 2PHXA 2EA7A 2WN2A 1VE0A 2VXRA 4H2AA 1CX4A 4NUBA 3TNQA 4EZ4A 2ZKLA 1YYNA 2GALA 4WM8A 3EB7A 5CFDB 1W6QB 2ZOEB 2GH2A 4YM0A 5FUNA 1RUD1 3AMMA 4LITA 4L99A 5FYYA 1LOCA 3UYJA 3AZWA 4JRLA 4COWA 3AKSA 5LEJA 3FLRA 2XJTA 2XKPA 4H14A 4CP2A 1NCQA 1JZ4A 1YLLA 3ZLIA 3HT1A 1JUIA 2DBIA 2VGDA 3K48A 4HKWA 1BBT1 3ACGA 4A7YA 4CE8A 1RUE3 3U4SA 1FPN2 1OHFA 3LEGA 1AUYA 1KFXL 5FZCA 3AK0A 3ZM8A 1CAVB 4KU8A 3RZHA 3LA3A 1KITA 3PUSA 1AYN2 5A3OA 4H7LA 1ZZ6A 4ZXKA 3KZ4C 3WDXA 4L0PA 4JKLA 2WT2A 3VHNA 2W76A 1H2LA 2WNVC 3TAYA 2W91A 2JD9A 1HRI2 4YW7A 1VR3A 1X7NA 1YIPA 1W90A 3EHKA 1AR72 4QPIC 4D94A 4RHV2 5FQ0B 5BNPB 4ATEA 1GUIA 3SC7X 3MGUA 4AVAA 2NQYA 3VKOA 1JYVA 4QM8A 1HXS2 3ECQA 4CDWC 4P9JA 1CZTA 1GSLA 2A71A 4UXAA 3UL2A 1LEMA 3FC0A 2R042 1O4TA 2V5DA 3U78A 3POIA 2V09A 3F2ZA 4FXGB 1LRHA 2QNKA 2PMWB 3JQWA 5E1RA 4IGQA 1OLQA 2WO3A 3I3QA 4PCRA 3RMXA 4XFAA 3J7LA 2DCZA 4HOOA 3ELNA 2ZGLA 5J1XA 3I3MA 5FKBA 1JOJA 3NV2A 1NAEA 2EF6A 1AR91 3BGAA 3FHIB 3KCCA 3AP7A 3LKJA 1AZDA 3RMYA 1POQA 2FDIA 4P14A 4DMIA 2WO7A 1EUUA 2IXJA 1SLBA 5F37A 4QHOA 1I6XA 4Y3OA 5FOBB 4UHVA 2ZZQA 3ZXFA 3ZXGA 3VHOA 3H1WA 5DZFA 5EWSA 2BGCA 3W21A 1W06A 2QCSB 1DGWX 1OMIA 3AP9A 1GZ9A 2HEYF 3DPRB 4NN0A 5CAZA 1XE7A 4EE2A 4LR4A 2IZWA 1WD3A 3BTAA 4ZY9A 1LAJA 1J83A 3DUIA 3MF9A 4RA0A 1OT5A 3UGGA 2D98A 3CO2A 2WNVA 3JBG3 4Q4V1 1QJY3 3N7LA 3TEXA 3I4IA 3UESA 3VGIA 4CU6A 1RTVA 3T30A 3ME2A 3FHQA 2ZKNA 2BOJA 4K40A 1BEV2 4LOSA 1PNFA 2D7FA 2YFZA 3B00A 4DIQA 1W0OA 4UFJA 5GLTA 1RUF2 1WRUA 4AYUA 1IPKA 3WF3A 2J1EA 4CDWA 1CQ9A 5C9AC 1DQ6A 1LGBA 3POBA 3MIBA 1OSGA 3MPPG 4NIIA 3DXUA 3ZYRA 3VBRC 2C9KA 4FPCA 2ZMNA 2PA7A 1TMF2 2M5JA 3BIWE 4XUNA 1LKNA 2ZACA 3IDEA 5L7OB 3T2TA 2XLFA 4Y33A 2GP5A 1RUG1 2WINB 4LBQB 4YG3A 1GOHA 2ZX4A 2AEYA 1Y3TA 5JVVA 1WGPA 1BKZA 2AR6A 1W03A 2P3IA 4UOJA 1IQDC 4B4QA 4INDA 4QKDA 1RHI3 4W50A 2D44A 4X6RB 3ZXLA 1BYHA 3VDBA 1LEDA 2Y6FA 2SLIA 3SEEA 2W6TA 4GKYA 2RR11 4PLMA 2BVBA 1W6OB 2KD7A 4WM7B 4CCJA 4E8DA 4I0BA 4R9DA 4XBLA 3RYRA 4AEDC 5ISLA 1TZOA 2NMNA 3KT1A 3KCXA 5F9TA 4LLOA 5CNAA 5FYMA 5J36A 1R083 1W39A 4Q0PA 1ZZVA 5C9AA 1GWLA 1XNAA 2W0XA 4OI0A 1PO12 3MDPA 4B3NA 3OOXA 1R64A 1B09A 1GNHA 4WVWA 4D7TA 3ZMNA 3LPFA 2A02A 3VBRA 1OBNA 1HV1A 1RUC2 1J84A 1DGWA 3OUJA 2A5ZA 2QDRA 2XKOA 4CP9A 3ZFGB 4Y5SA 1AR63 1NQJA 1HV0A 3DYMA 2OPWA 3X29B 4JKMA 1XC6A 3NJZA 2E9QA 2P5BA 4YG6A 1EV12 4ZKTB 2W39A 2HEVF 2XGXA 2CWSA 2WO2A 2G9GA 2PHFA 4AR0A 4G3YC 4BLJA 2IUWA 2RMU3 2CY6A 1JU4A 1ZZ7A 2Q30A 2K0GA 3JD71 3MUZ1 3VBSB 4AFDA 1GNZA 1QJFA 1TNFA 2E7QA 3OPZA 5FXZA 3WX5A 2BTVC 4XYXA 1Y9MA 2EXHA 2VMEA 2HKXA 1ASJ2 3D0SA 4HMZA 5F3IA 5JSOA 1X9PA 3WT3A 2R061 2XLGA 1RXFA 3ZYJB 2XOMA 1ULCA 4OMDA 3LWCA 4PI2A 2J1AA 1DG6A 2JDHA 2JE9A 2QBXA 3HJRA 4CDQB 1RB8G 3M4FA 4O61A 4AEDA 3ZYGA 3RFRA 2IXHA 3BODA 3OBAA 4Q4X3 3UJQA 3LGRA 4GMP0 2V5YA 1NCRB 2DCTA 3THDA 1FPN3 3OGJA 3ZKYA 2OVUA 2VW2A 1DHKB 3PJQA 5CB7A 4C91A 3FFQA 1AJOA 1S0GA 5IAVA 3T09A 4FPYA 4EN8B 2YDEA 1GZWA 1CPNA 4YW5A 4JKKA 3I59A 1TE1B 4RS5B 3ATGA 2ZGTA 1OA4A 2GSYA 3WSOA 5LA1A 3H1MA 4D7SA 2BWCA 4N90A 2R32A 1DGRA 1G9AA 5KC6A 5CG9A 3AFGA 1H1MA 1D0HA 1AR73 1PIV1 2QDNA 1BCXA 1L7QA 4FTBA 4RHV3 1VBA1 1L3JA 4XOGA 4AGGA 5I93A 2YU1A 4N9IA 3ZN6B 4MG2A 4CVUA 2XPJA 5B4XA 4Z2AA 1CESA 3S0MA 4XF1A 1UPIA 2ZCWA 1OQEA 4BPZA 2CNAA 4K1ZA 4DXRA 1VBD2 2ADDA 4CRQA 4MV2A 4UWDA 1OI6A 2PAEA 4FPKA 2PLV2 4XZPA 2YGMA 4XCAA 1Q8SA 2WJSA 5GLWA 4M3CE 3WUCA 5IVBA 1EYBA 4M4PA 4GWMA 1O59A 1F35A 1ZBE2 1GP4A 2G19A 1FNYA 1BJQA 3J9SA 4Y22A 3UT0A 4FVVA 1K5JA 3WF2A 4COZA 4R52A 4CXWA 3RJRA 2VVDA 5FZ7A 5FY1A 5A3MA 1UW8A 4HT1T 4AHZA 1QHDA 3CU7A 4IGPA 4O9GA 3H3UA 4MUVA 4ISQA 1XBFA 3R4UA 2BYVE 4DB5A 3WNNA 2ZBJA 5IHRA 5IFTA 1UY1A 1C4RA 1A3KA 2XL9A 4CXYA 1Q8PA 4KWUA 2HH9A 3MW4A 5FXWA 2W95A 3M1HA 4GMP1 1JN2P 1YCIA 1PMIA 1AR81 2PQSA 1OH4A 2R071 4LK7A 4BISA 2BQPA 4QAWA 4N7UA 4QPGB 1PMJX 4BH9A 2A6XA 5C3SA 4AI2A 3AP5A 5A33A 4XDOA 3BYWA 1ND3C 2Q5TA 2XMLA 4R8HA 1HN1A 2E32A 4HK9A 1VRBA 2WFPA 1HRV1 2A6WA 2V4AA 4XBNA 1URXA 4FFIA 1HX6A 4LA2A 2BPA2 1X8MA 4G08A 2Q1FA 3I2KA 3WUDA
chains in the Genus database with same CATH topology
1QU0A 2ET1A 1UMZA 3WDYA 4Q4W3 1PO22 4N9HA 2LM3A 2VMGA 1CAXA 2ZGMA 3WP3A 1GQGA 3GALA 1RIRA 1BVVA 2XBO2 3IT8A 1PNGA 3WINE 4EROA 2CWMA 3PTYA 1GBGA 1W6MB 2MEV3 3R05A 4FTSA 3EJKA 5C6CA 2UWCA 1RITA 5JI9A 1W6QA 1RUE1 2H0VA 4TZDA 2P37A 3CJXA 3SCFA 5T54A 4B4RA 3WG2A 3APBA 1F9KA 2DUPA 3L9JT 3UKNA 4AEMA 1ZNPA 1LB2A 3FLTA 1RVF2 4WVVA 2JG9C 4NHLA 3G7DA 4YZ1A 5DUUA 1H4GA 1VIWB 2YHJA 2HWE3 4I01A 1H2MA 2EALA 2EAAA 4X6QB 2W52A 1MVQA 4CEWB 3SXWA 3JB4C 4I3GA 1CAUB 1IOAA 1DQ0A 3AP6A 1H0BA 3RG0A 3ZSKA 3GZAA 3RSJA 1MEC2 2DUQA 2HEWF 5I8TA 4H3WA 1FOD2 3AYCA 4OUSA 2A3YA 2H6CA 1PO13 3AZZA 4J1WA 1O5LA 2D3RA 1DFQA 4JVAA 4N7IA 5BXXA 3ZXEA 1RUC3 1UX6A 5CBLA 1UF2C 3IDCB 4XFIA 3ZFEC 4LUMA 3H50A 1O91A 4QU2A 3MF6A 1M4WA 1I5ZA 3PMSA 1EV13 1K5MB 4SBVA 4COVA 3KSCA 2FZ2A 5FMOL 5T5JA 4XFHA 1X8EA 2FQPA 3D82A 2AYHA 4I30A 4S2DA 2XH6A 2YGLA 2JG9A 5JZGB 2B9UA 4OHWA 5ACA2 1ASJ3 4RR3B 3QH7A 3RJ2X 2N7GA 4Q1RA 3JBG1 1QJY1 2XG3A 4AI1A 5BNNB 2D6MA 3MI8A 3SMHA 5HI0A 3U07A 4NWWA 1QQP2 5A3LA 3JUUA 1BMV1 4P9IA 4PBPA 4HBNA 4CDUB 1X82A 2GNTA 2RS12 1FYUA 2P34A 3ZN4A 3GNEA 5J3UA 4FXKB 2E7AA 4MGIE 5KHKA 4Y20A 4DXZA 2GC0A 4HSJA 3WCSA 4QX5A 3ZFEA 1E57A 4KBBA 1J58A 4JDOA 3VBHC 1RMU2 4LLFA 2ZMKA 3U11A 4DY5A 2JKBA 4OI2A 3KM5A 5L7OA 5EXOA 1AXKA 1RHI1 1OA2A 1UCXA 3MICA 2ZX0A 4LBQA 2A70A 4XF0A 5EYXA 2JECA 4TYSA 4JCKA 1RL3A 3AMNA 2PLV3 2RS32 3RNSA 3THTA 3ZSMA 5E16A 5L36A 4LUKA 3VDDB 4D3WA 3KQRA 4MX3A 3WDTA 1SLIA 1ZBE3 1COV2 4YSFA 1AXYA 4CP1A 1R081 4B8EA 3WG1A 3NKTA 2ARXA 3CJIB 4YRDA 1W6OA 4WM7A 5J7MA 3HQXA 3USSA 3ALQA 4L9BA 3WDUA 3ZFFC 4CEYC 2VNOA 1QKQA 1SCSA 4KG8A 2NLRA 3MZHA 2XJVA 1AR61 5ABJC 4ES8A 3E6DA 3I2DA 2JEMA 4FCAA 5C8WA 4EWEA 4LO6B 3FWEA 2RE9A 5DDJ2 5JCTA 4I09A 3B69A 4M00A 5C33A 4RS5C 4ES9A 4FPJA 2KXLA 5JR7B 3ACLA 2R0FA 2RMU1 4N53B 4AW7A 2V73A 1YRZA 1S2BA 1N3PA 4F7ZA 2QZ3A 1PO23 3D0JA 4GB32 3E5UA 2RJKA 1NE6A 1YNAA 2WKKA 1RUOA 4LO5B 1H9PA 2B39A 4JGYC 2XBO3 2I45A 1LHVA 2ZAHA 3IKWA 3VBSA 1PGSA 5FMOS 1WLCA 4YM1A 3HR9A 4Q4X1 1S0CA 1C8NA 1CAWB 3VBFB 1FPN1 4PDWC 4LNVA 4WBBA 1MZFA 3VLBB 3GHMA 4HFSA 4CDQA 2D93A 2CGNA 3QH6A 3OYWB 5KC5A 5FLIA 1GZCA 3ZFFA 4XFGA 2RS53 4OLLA 3VZNA 4YM3A 4BIOA 5FREA 5ABJA 1YJLA 2QJVA 5JPMB 1LOGA 3R6SA 3V56A 1H30A 5JMCA 1AR71 1H8TC 4FBFA 1VBB3 3SCHA 4RHV1 2A6YA 4WM8C 4RS5A 3S30A 3WW4A 2VG9A 4JC1A 3VBOC 3EO6A 4Z1VA 1MEC3 1MVEA 1FOD3 1S0DA 2YROA 2X8KA 2MNGA 3NV3A 4Q0SA 5K7PA 3ZIWA 2D6NA 2WL1A 4FT8A 4JGYA 2OYZA 3WD5A 3AXEA 1SBDA 2W68A 3AZYA 1NG0A 2WT0A 3OTFA 4FO9A 5BNOB 4P9GA 3OY8B 5KHJA 2XJSA 3GR5A 2WSUA 3MYXA 1IKPA 4PDWA 3VUOA 3BB6A 1SBEA 3V0BB 1Q5OA 5JOYA 3NVCA 5ACA3 5JLVA 2C1FA 4YGCA 3RI9A 2XJPA 5J37A 2E51A 4UW5A 4HLTA 3GF6A 2AUYA 2CTVA 4E4DX 1H8TA 2A3WA 1KXGA 1FMD2 1Z0HA 1ENSA 2WZR3 3ZSEA 2XVGA 2HWB2 3KT4A 1LGNA 2ATFA 3TN93 4EN9B 5EFUA 1JYCA 4HVQA 4OFGA 1QQP3 4DFSA 3VBOA 1EPWA 4Q4W1 2WS92 1W6PB 2ZHMA 4NHKA 3B9IA 2RS13 3M3EA 1H9WA 4RL7A 1IHMA 3QOPA 5FPXA 1LR5A 1MS3A 1V6MA 1ZZ8A 4FAGA 2MEV1 1PGL1 2FMDA 3EBRA 4IETA 1V6OA 1KQRA 2YMZA 4FSJA 1RMU3 1IGOA 5BNQA 5KWRA 4FAHA 4BM8A 3ROUA 3CL1A 3B7MA 1BVP1 1QNYA 2VNRA 3TRSB 2QKDA 1ZREA 1W6MA 3POWA 1WA4A 1XQNA 5IT6A 3IPVB 5T55A 5AC93 5FO7B 5GZCA 4JAAA 1QH7A 2HWE1 1XYNA 4JRAA 2TUNA 2YPJA 4YNIA 1AVBA 4BLIA 4GALA 4A7KA 1COV3 3R4DB 2XL7A 4MXVA 4N43B 1ENQA 2DVAA 4YVWC 2UWAA 1PO11 4AFBA 5LK5A 1U5ZA 5FPZA 1OPOA 4LBJA 3VZMA 4BCUA 1V6IA 3DKWA 1RUJ2 3ES4A 1OQ1A 5D8AB 3L2HA 2WNUB 1RUC1 3TOJA 3ZXJA 1H2KA 3VN4A 4KL1A 3VHRA 1POV3 2HWF3 1G9BA 1UZZA 2JJ6A 4ASMB 1AYM2 4CDUC 1OOPB 1IS3A 3KT7A 4IEVA 4PLNA 1JUHA 1LOAA 5F6LB 1DF0A 1CPMA 2AGSA 2NPIA 1EV11 4OHVA 3W9AA 1D4M3 4E27A 4Z8BA 3B3QE 4ISRA 4OHXA 2Y0IA 1AL22 4E4SA 3AP4A 1SMVA 4W6WA 3PJYA 1N3OA 4XF9A 4FOVA 4GB33 1K5MA 2Z42A 1ASJ1 2R1DA 3AMPA 1SFNA 3POSA 3UJOA 4FPEA 3VKFC 3QLQA 1V9U2 2HWC2 5KHHA 4WZCA 1C8M2 3HN1A 1R1A2 2ZS6B 2X5IB 2GZWA 5DG2A 1LESA 1DZQA 4A2UA 1PK6B 5JZGA 2BW8A 4Q26A 4CYDA 4YVSC 4RR3A 4IXLA 4J1XA 3SHRA 3HD8B 1AHSA 1SLAA 1O7FA 2ZABA 4U36A 4YVWA 5K0UB 2G4IA 5BNNA 5CA6A 3NAPB 3ADYA 1H1IA 1JXNA 2JG8B 2EXIA 1LTEA 1ND2B 1XRUA 4AVBA 3G6JB 1D2SA 2OUHA 4E2SA 4IV3B 2G9FA 2IC1A 3KCYA 4CDUA 4F83A 4ZU7A 2QQPA 4C90A 1C1FA 4RFT0 5JI7A 2HWD3 4LE4A 1QOTA 2EXJA 3ST7A 3URFA 3RPQA 1MZ6A 1EAH3 5IK8A 3GBGA 2R1BA 3CLPA 1VRH3 1D0GA 2IXIA 1SQ4A 2GNDA 3AYDA 4XF3A 4FTEA 4HK8A 3USUB 1NZCA 5FAXA 2OZJA 3MPBA 5JPNB 4Q29A 2PLV1 3FZ3A 1XNCA 4N53C 1ZZBA 2ZX3A 4KNCA 1Q43A 2QUOA 1S0FA 1Z78A 3A0NA 3M3QA 4I02A 4YZ2A 1XYPA 4LA3A 4A3XA 4GA9A 4XQWA 1V6JA 1ZBE1 4GIQA 5FLJA 2DUOA 4WZFA 1XXNA 4XTMA 2ZMLA 2WSVA 4YW1A 2UWBA 4IEUA 4YVSA 3OF1A 1H4HA 4YZ3A 3AKPA 4IV1B 4C0HA 4EWDA 1PM7A 4BQ1A 5K8SA 4L2NA 1ZRDA 2Z79A 4JGZB 4YLZA 1ULFA 1KRIA 3VBFC 1C5IA 2DURA 5C4WC 2R49A 3HBZA 2Y0OA 1ZX5A 3HWJA 4Z92B 4DRVA 4GH4C 4FP2A 1QJX3 1TNRA 2D43A 1PVC2 4XTPA 4Z07A 5F6KA 1N1YA 3J8F2 1O3QA 1J59A 1NA1B 2HWB3 4E4ZA 3RS6A 3T1LA 3AX4A 1H2NA 4Y1XA 1NE4A 4R9CA 2TEPA 2WS93 1PO21 4AVCA 2SBAA 4Q4V2 2VVFA 4XDQA 3AKQA 4ATFA 1MZ5A 1LHUA 1KS4A 4N53A 2D40A 3JCIA 2XBO1 4QQLA 3O0VA 2DCYA 3CEWA 4M01A 1G9DA 3PVBB 1AYN3 4Q4Y2 2DV9A 1FV2A 3B02A 1WMFA 4OZXA 4XIKA 4DS0A 2OUJA 2UYBA 5HCFA 4DRRA 4XFBA 4HKLA 5FBZA 1HRI3 3IM0A 5KXCA 3BPZA 5EYYA 1DIWA 1WLWA 3INAA 2RS51 4ITCA 4YZ4A 1CAWA 3VBFA 4FOQA 2DVBA 3LSDA 2D3PA 5C4WA 1RUNA 1GANA 1HXS3 4DNYA 3AYEA 1VB2A 4GH4A 4S2FA 5EJ3A 4XJ8A 1CJPA 2R043 3OYWA 1VBB1 2XWJB 4KGGA 5JAXA 1IQAA 1GLHA 1U0AA 5GALA 2D6LX 3L2YA 1MEC1 1FOD1 2QFEA 1Z7S2 4IERA 1WW4A 3ASIA 4EJRA 3ENRA 2E6VA 4XMAA 5CFDC 3O14A 4U2AA 2CV6A 5DXDA 1LHOA 1MQTB 1Y43B 1ZVFA 3GZUC 4NWVA 3AJYA 1NYWA 1JBCA 2VW1A 3POYA 1YIFA 2GMPA 3N7JA 1UU5A 2XVLA 4ASLA 1DYKA 1LU2A 2OIIA 3LOIA 2GDFA 4F3JA 1J1TA 4QQ2A 2VNGA 2PTMA 1SLCA 1X36A 4LBLA 3VZOA 1AL23 1OA3A 1BEV3 3OY8A 4YM2A 3RI8A 4DOUA 5ACA1 1RUF3 1WLDA 1R092 3PVNA 3MLKA 5HCAA 1HKDA 4KWJA 2HWC3 3M8LA 1S0BA 4CTEA 3FFZA 4WVZA 1R1A3 3OBTA 2WZR1 5BNPC 5IK4A 3V0BA 4FP3A 2D6KA 2WT1A 3TN91 5J09A 2PELA 5SV8A 4COYA 2X29A 1QJZA 1TMF3 1RUI2 1QQP1 3WXPA 1ZBA2 3LB9A 3QCWA 2D5FA 1ONAA 3WW2A 1NOVA 4B4PA 2ZHNA 2W78A 1WCKA 4XXPA 2VECA 3DGTA 1POV0 1NCQB 1GQHA 2RS11 3SH3A 1SFYA 2R062 2B45X 4ONUA 3GBWA 5CFDA 3LZZA 3VHPA 3WW1A 4Q0VA 5SV5A 1BXHA 4L97A 1RMU1 5D8AC 4HSLA 4LO4B 3WHTA 2WLPA 2WFF2 2VOWA 4MVTA 1ULGA 3MIFA 4R9BA 2EIGA 2IXCA 4HPKB 3BALA 4RQPB 3SCGA 2B8MA 2WQ4A 3DPRC 1CAVA 3MLLA 1QNWA 3S6PA 5CU1A 5AC91 5CFCB 4AFCA 4QGNA 1AJKA 4UW4A 4AVVA 1HDKA 2OPKA 2DU1A 1VP6A 1EPZA 1U5IA 2HJIA 1A8DA 1J3RA 1S0JA 2WZPP 5FQ0A 5BNPA 3HMYA 3UK9A 1COV1 2VOXA 4LULA 1UL9A 3HAGA 4NPRA 1YXWA 4LT5A 1YFXA 3WZ1A 5GM0A 3AMQA 2Q8OA 2X5IC 1C28A 1YHFA 1WUVA 2QZ2A 4EN6B 3NKGA 4YW3A 1ENXA 1PK6C 2DVFA 1MS8A 1LECA 4K7JA 4EWAA 5JOZA 1POV1 2HWF1 5L7OC 4OULA 2R30A 2X53S 3V0AB 1BZWA 2OZ6A 1PVC3 3AKTA 3NAPC 3WQ0A 5D8AA 1D4M1 2WNVB 4IESA 1NLRA 4SLIA 3EQEA 2A3XA 3J8F3 4BMBA 4CZSA 1T6GC 3GBFA 3TWIA 1WW7A 4QPIB 2VMHA 3DPRA 1TME2 4V1PA 1OLRA 4AQTA 4Y5Z0 2R072 2ET7A 4GB31 3ZPYA 5H9QA 1RJ7A 2ZJCA 4QHBA 1DQ5A 1LHWA 4XILA 4WM7C 1Q8VA 5DZGA 1ZZCA 2AZ5A 1HRV2 1AF9A 1V00A 1QOSA 2NYYA 2PFWA 3AXDA 4Q4Y3 1YI7A 5KXBA 1CVNA 5T52A 4BMEA 2X5IA 1VBE2 3M2MA 4AI8A 1PK6A 2F6BA 2ZA9A 3PVEA 1UIKA 3O7OA 3NO8A 3O5SA 4NR1A 3ZYPA 5JDBA 3ZFGC 3OJBA 5E89A 1REEA 5K0UA 1AX2A 1LODA 4IV1C 3KMHA 1DQ2A 2GH8A 1WMEA 3HIFA 5JWPA 1RUE2 2XB6C 2HWD1 2IFWA 3T1MA 4JGZC 1GKBA 2YUEA 3NAPA 1V70A 2C9AA 3MFCA 1VBD3 2JG8A 1EAH1 4AXOA 1UD1A 4IEWA 4CDXB 2D1UA 3RRDA 4BHPA 2OW4A 1VRH1 1HLCA 4IV3A 3VBSC 1U5YA 4O9EA 4PQ9A 4TLFA 3LCPA 1Z7S3 4QQOA 4E2QA 3D6EA 4QQHA 2O8QA 5FCCA 4HKOA 3EXUA 5C9AB 1NA1C 2R0HA 2ZGPA 3WOGA 1YJKA 1Q3EA 4XETA 3ZDSA 1U12A 3OGGA 2EAKA 3MIEA 3IN9A 4CDQC 1EP0A 3A4UA 1YFYA 4KQ7A 4HZFA 3USUA 1N1VA 1PGW1 1XU2A 1PVXA 1NCRC 4AG4A 3BOWA 5I0RA 2IAHA 5GLUA 2NM1A 4P9LA 5T50A 3GZTB 5AVPA 3VL8A 4YFZA 2W6UA 5LEKA 3ZFGA 4CP0A 4K8FA 1WLTA 1R093 5GZDA 1QJX1 3AZVA 4IV1A 3M7AA 2JX9A 1FATA 4OI4A 2IXKA 5EZWA 4DQAA 4LTAA 1AX1A 4JGZA 2A6VA 1IS5A 2HWB1 2ZGSA 1RUI3 1ZRCA 1ZBA3 3FUOA 2WS91 3RZZA 3OD0A 5DZEA 1PZ9A 2ZGKA 1YFUA 2VUAA 1VBC2 1S1AA 2B42B 1NA1A 1MZEA 1MS0A 4Q27A 3IBMA 1JH5A 1F31A 1B35B 1QF3A 4LBQD 3JQXA 1QGLA 2W16A 4XE9A 4DINB 4DPNA 3I59B 3ES1A 3J4UH 4OVEA 1AYN1 1CONA 1BMV2 2UU8A 1RVF3 4XPVA 3RWNA 4KU7A 3PMEA 2WFF3 3NWKA 1NCRA 4HANA 1HRI1 3KD4A 1ALYA 2EXKA 5FTTC 1D2QA 4Y4YA 2VUJA 2ZX2A 1WW5A 2B5HA 4QPGC 4MYEA 1HXS1 2P17A 3QBQA 3VV1A 1OD5A 2PHRA 3AYAA 2R041 1DGLA 2H6BA 2YY1A 5GLVA 5DUWA 3ZYIB 1G7YA 3TNPB 4EN0A 2A6ZA 2I74A 2PQQA 3ZN6A 3PHMA 5CG8A 1SDWA 4KH9A 4Y22B 3ILFA 3NV1A 4KWLA 3M3CA 4ZU5A 1OFNA 4MGZE 2XJRA 1IS4A 3DL3A 2VULA 3N3HA 1IZ3A 4WVMB 2VMIA 4XF4A 4E9KA 3VL9A 3AMHA 3GYDA 3N7MA 1NXD1 3WP5A 2K9ZA 3UKTA 4EV0A 4JDMA 1LOFC 5EV7A 1GV9A 2DVGA 4XJ9A 5A33B 1A8MA 1FX5A 1W6NB 2VY0A 4PIZA 5HBAA 4L8QA 1TME3 1AL21 5GZEA 1BEV1 5C8CB 1RUF1 2JICA 3IWZA 4QPGA 4AQSA 1SEFA 2BVVA 2WC2A 3E5QA 4RQPC 1SLTA 4K1YA 4XEZA 4XJUA 4OI1A 2PN5A 1QDCA 2P3KA 4AWDA 2HWC1 3DF0A 2BUKA 4CEWC 1CAXB 5CFCC 1R1A1 2RMU2 3H3ZA 3MIGA 1SACA 1TMF1 4QT6A 4QMAA 1LULA 1RUH2 2IXLA 4AHWA 2DFBA 5AFBA 3AZXA 1XNDA 1ZYBA 2RM22 3OCPA 2PHWA 1XNKA 1VBE3 1S0IA 3MW3A 4EN7B 3R4SA 4QM9A 4XXAA 3UKVA 4X8PA 3MW2A 2ERFA 4JDNA 4HN0A 4RGGA 4MZUA 3NSTA 1RINA 1FV3A 4Q4X2 4W6XA 4BIFA 4AEJA 3ZXKA 1K5MC 1JTZX 2NN8A 4M0HA 2UY9A 1X33A 1LOFA 5FO9B 1VJ2A 2RJLA 5IUQA 1ND3B 1I9RA 2RS33 3OV5A 4AI3A 3J26N 2LALA 4W6YA 5JIAA 4AHXA 1LCLA 3C2UA 2Y38A 4FPGA 1KDKA 5JZGC 1VALA 3E97A 4RR3C 3ZSLA 1O3TA 1N3QA 4HPKA 1M06G 4RQPA 2OA2A 2YZ4A 4CEWA 2VH9A 4IEZA 5BNNC 5CFCA 1CAUA 5FDBA 1C3HA 3KLSA 4Q0UA 4XJZA 2AREA 2P2KA 4M3CB 2HYKA 5E88A 1NY72 4MSVA 4MXWB 3ZO0B 4OHYA 3E6CC 4P9XA 1Q56A 2UURA 5CVRA 2XVKA 1REDA 1W2UA 2GMMA 4PLOA 3IIAA 4P5HA 5DDJ3 1UIJA 3WR0A 1BK1A 3LAGA 2ZHLA 4Y1YA 5JOXA 1OFSA 1J3PA 1YI9A 3VBUB 4BE3A 5AVAA 2CAUA 2L4WA 3WP6A 1LOBA 4Q8KA 2JG9B 1PVC1 2R6QA 3PNAA 5IK5A 4G9SB 5BV6A 1QJU2 1R1ZA 4QXKA 1JYIA 4KWKA 1RJ8A 3FLPA 3J8F1 1H8VA 3IMNA 2DFCA 2JXAA 4FQ4A 5GKAC 2LTNA 3AJZA 4PJYA 3V0AA 4QQPA 3VKLA 3FBMA 2Q4SA 3N7KA 1UAIA 1MS5A 2Z2SB 3S7EA 3VKNA 4C0BA 1O3SA 4BYYA 2NP0A 1QH6A 3I8TA 1VBC3 2XUMA 3P3NA 1SBFA 4X8NA 4CDXC 4QPIA 3CNAA 1JHNA 1S2KA 3VDDC 3B94A 2GC3A 3WDVA 1RUD2 3E5XA 2F4PA 2FMYA 4Q4Y1 1BQPA 4Q4W2 1KD7A 2E53A 4Y20B 4PBOA 3ZFEB 3CJIC 1QXRA 2R16A 2ZTNA 1YWKA 2Z6BD 1BBT2 1QMJA 2FBEA 1AXZA 1ULDA 3N4MA 4LBMA 2BWAA 2MEV2 1PGL2 1CJDA 5GJ6A 4F8AA 2PHTA 2DCJA 3K51A 3WV6A 1FT9A 2GU9A 3TYJA 1RC6A 1OQDA 1VBD1 1CD3G 4YGBA 5BPXA 4TSVA 4HVRA 4LBNA 4AQ2A 2MHFA 3SLIA 1Z7S1 4IEPA 1ULEA 3WVJA 4S2HA 2HWE2 1QXPA 4IEXA 1DQ4A 1DBNA 2PAKA 3ZIXA 4QD2A 1DLLA 1MS1A 2GN3A 4CDXA 3H8UA 4XQ4A 3NL1A 3VDDA 5CIRA 4L11A 2A75A 2D3SA 4YGEA 3AKRA 4AF9A 3SH5A 2VPVA 1WCDJ 4LEJA 4I0WB 4Y24A 1OKQA 4YW2A 2B46X 1AR92 4UBHA 1B35C 4ORFA 4OUMA 3VZKA 3CJIA 1YFWA 4Y1ZA 5H9PA 3H7JA 3VBHB 1ZRFA 2DF7A 3RYKA 3H9AA 1KJLA 2Q0AA 4XIOA 3WNXA 1APNA 5F1RA 1FMD3 1WTHD 1OPMA 1NQDA 1R091 2ARBA 3U10A 2Q1MA 1Y7BA 3SISA 3H7YA 3B9CA 4AQ6A 5HXVA 3N35A 1EY2A 1DQ1A 2VOVA 5KBFA 1RUI1 5I0TA 1ZBA1 1RUH3 4HETA 4D69A 2I07B 4GKXA 1WBFA 3MLJA 4QGMA 3AFKA 5T5PA 2RM23 1Q8OA 4A7ZA 4META 3LOBA 2MPFA 1RGSA 2D5HA 4K3UA 1HQLA 5A32B 2GAUA 2GC1A 3RQ0A 5FO8B 3HT2A 4JTNA 3BOPA 4B29A 3FJSA 1C1LA 3ZFFB 4CEYB 4D7YA 2PAMA 5BNOC 1KFUL 1QWRA 2UYAA 1SLLA 1ENRA 1RVF1 4HVOA 5ABJB 3A0KA 1WW6A 4XHXA 2KM2A 2WFF1 3NW4A 4URTA 1B35A 2AENA 3WW3A 1RUG2 1HQNA 4I2OA 2B7YA 1I1EA 2D6OX 2JDZA 4XJWA 1F2NA 3MIDA 3B5LB 3B01A 2WQZC 4P9WA 1ZZ9A 1KJRA 4XJAA 3ZX7A 1UN1A 2VW0A 5FOJB 1FI2A 2WLQA 3H0OA 4FOWA 4MGKE 4AHYA 2WWSA 4PIXA 5TSWA 5LRSA 1AL0G 4C1XA 3GS9A 2E7TA 1RUJ3 5C8CC 2RHPA 2RR12 2BNOA 3ETQA 4JGYB 2EVXA 4YARA 4NHMA 3DN7A 4UW3A 1ZM1A 4GULA 1YO8A 4H7MA 1G86A 2NZ9A 4HL0A 2CGPA 1AYM3 1WD4A 4C1WA 2D6PA 5HCBA 1QY4A 4YFWA 4XBQA 4IL7A 4PDWB 5F5QA 1Y9QA 2TNFA 2ENRA 3FX3A 1A6CA 1VAKA 5BNOA 2BEOA 1QJU3 1YUDA 2VOKA 4WV8A 3PLQA 4WVMA 5FFOC 3V64A 1GYKA 5JIUA 4Z2WA 1PZ8A 1H8TB 1G6NA 1V9U3 3AM2A 1TME1 4K9SA 4UBGA 4WM8B 5JSPA 1C8M3 3QACA 2W77A 1DYPA 3M70A 2DVDA 4AE2A 2TBVA 3VBOB 3VZLA 1CR7A 3JD72 5KXEA 5DUXA 2JE7A 4AGVA 1W6NA 2ETEA 4AGRA 2O0OA 4AVTA 2ZGRA 5FLHA 2ZGOA 1ZRRA 2GC2A 3TB0A 5KXDA 3NV4A 1HQWA 1RUD3 5C8CA 3VKMA 2ZHKA 2C5DA 4N43C 4RSUA 5T5LA 1UPSA 4YZ5A 3O12A 1W6PA 2I2SA 4Q8LA 3THPA 1LJ7A 1VLNA 3KS7A 1C57A 1BBT3 4FPOB 1VBE1 1XU1A 2WNUC 5CADA 4LO8A 1UU6A 3KGZA 3Q9OA 2DCKA 3BCWA 4AVSA 5I0SA 4MH0E 5I0UA 2O8OA 3EZJA 4IEQA 3RYPA 1OOPC 4IEYA 1IPJA 1JW6A 1MR5A 4MGYE 4TWTA 4K21A 5D1IA 2BNNA 1O5UA 3M3OA 4KGQA 2JENA 2AH2A 1G9FA 3VBUC 1HIXA 2CYFA 2RS31 1D4VB 4LHKA 1PIV2 2RS52 2GNBA 1W0PA 1UZYA 1VBA2 3AB0A 4RGAA 2DTYA 1CIWA 3IPVA 2YXSA 2WA4A 4XFFA 2VVEA 5L73A 2GMEA 1WBLA 1ND3A 1VBB2 5BY5A 5I8SA 3CF6E 3W59A 4Q0QA 5IK7A 5J96B 1WCSA 1J1LA 3S7IA 3M3IA 2ZGUA 1V6LA 2IWGB 2BFUL 5FRAA 3P3PA 4I3PA 3FBYA 2ZGQA 2VQAA 4R4ZA 2K2SA 4N43A 4AEKA 1AR93 5K0UC 1NXMA 1X50A 3U4XA 2KA3A 2ZPXA 5AFEA 4JTMA 3PVOA 3WDWA 1I3HA 1MS9A 5DDJ1 2PHDA 1AX0A 4ZU4A 2JG8C 2WNUA 1ND2C 3FE5A 4AI0A 4K6BA 3U0ZA 4M3CA 4E2GA 4IV3C 4MXWA 2ES3A 3TBDA 1OOPA 5J98B 1AR82 2WIIB 3QD6A 4IEOA 4JV4A 4PIYA 1N47A 3WCRA 4CDWB 3O0WA 1G9CA 2WA3A 4Q4V3 2GN7A 3VBUA 3FMGA 3MFAA 3N36A 4R9AA 1N1SA 5T5OA 1FXZA 2UY8A 4QPYA 2A73B 5E8AA 3JZVA 1MACA 2X531 2D97A 2ZAAA 1VBC1 3ZSJA 4YVWB 3ZN5A 2WZR2 3B93A 3TN92 4BA6A 1LENA 1UKRA 5K9YA 5H9SA 4B7EA 4BWOA 1C5HA 2FHRA 1HW5A 4M0NA 1RUG3 2VQ0A 4B7KA 1LU1A 3D4KA 2DYCA 4DY3A 4LE3A 2GNMA 2XLAA 4Q2FA 1ND2A 5LK7B 2P3JA 3ZMOA 2BNMA 1FNZA 4FOYA 3SH4A 3MIHA 1TEIA 2FZ1A 3WQ7A 4JQRA 4W65A 1F8VA 3LA2A 1J3QA 5KHIA 4KG0A 4JTOA 3LA7A 2DTWA 2RR13 4LO7A 5L19A 1UU4A 2ZX1A 1KS5A 5AC92