4M0HA

Crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
216
structure length
216
Chain Sequence
SDHLLTEISVNHGEHKQVTLPDGTVVHLNAGTVMRYPTEFTSDIRLVEMEGEAFFNVMRDEGKPFIVRTRQADVKVLGGSFNVKAYQEDELMAVSVRTGKVEVDMPESVMRLLPNEQIIVNNTNGEILKKNEDAQKVTAWLQGGLYFNRTPISSVIHDLERMYNQEIVLDPNVVFDDYIYGEHDNKSLEAVLNAIQYSTGIRYRKEESRIVLYKTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a conserved hypothetical protein, putative anti-sigma factor (BDI_1681) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Signaling protein
molecule keywords Conserved hypothetical protein, putative anti-sigma factor
total genus 57
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04773 FecR FecR protein
A PF16344 DUF4974 Domain of unknown function (DUF4974)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1440 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m0hA01
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 4m0hA02
2O5PA 2W75A 2D1UA 2W78A 4JTMA 4M0HA 4M0NA 2W76A 2M5JA 4AR0A 3GR5A 2W16A 3EZJA 2W77A 2IAHA 2A02A 2W6TA 4G08A 2W6UA 1ZZVA
chains in the Genus database with same CATH superfamily
1YHFA 1W8HA 5FWJA 4BK4A 2OQ6A 2RVAA 2GDFA 3AJYA 5DAQA 3BODA 5APAA 4AVAA 2JKBA 1O91A 1RHI3 1VLNA 3EBRA 3VKLA 4Q0PA 5KHGA 1ZZCA 2R7EB 4AW7A 3GM8A 2ZX0A 4LHKA 3N9MA 4OZOA 4CDUB 2OW4A 3WP3A 1PM7A 1R093 4QX5A 4XOGA 1RC6A 3B02A 4OI2A 3VGIA 4BXFA 2R32A 1QQP3 4OMCA 4FTBA 3WHUA 1UWWA 2P3JA 2ZBJA 3I3EA 2W3JA 3GZUC 1CPMA 3WR0A 1GICA 4RGGA 2WBKA 3JXSA 3VLBB 4OUMA 1NCRA 3ZXEA 4BM8A 4CEYA 4CCKA 1ODMA 2W47A 5DZFA 1ULDA 3FFQA 3BIWE 3VBSA 4A6OA 4AVCA 4Q4V1 3DPRC 4BU2A 3M4FA 2YC0A 3MF6A 4QU2A 3THCA 3UGFA 4F8AA 4Y20B 4QPIB 4KWKA 4L11A 4L8QA 4MADA 4DRRA 3ZPOA 1LJ7A 2QE3A 1JOPA 2C26A 2BYVE 2EXKA 4EN7B 4X6QB 1LHVA 2Y64A 3HBZA 4QAWA 2HWF1 4NHXA 3NV2A 3T30A 2XJRA 4NE9A 4HOOA 5J96B 4XXPA 5EYYA 4QM9A 5DABA 2XJQA 1O3RA 1H4GA 5G04L 3VKNA 5EIYB 2YDEA 4LHLA 3FMGA 5KXEA 1O3QA 4CUAA 3C2UA 3ZR5A 2D7FA 2KD7A 1JW6A 2H0VA 5FXWA 5FTTC 2D43A 4E8DA 2L4WA 4AQTA 4Q4W2 2HWE1 1KDKA 1CAWA 4C0HA 1W9WA 4N43B 1HW5A 3GBFA 1W6PA 2A70A 5FPXA 2CAVA 2RV9A 5C4WA 3EQEA 1KFUL 1L7LA 3EHKA 3Q8EA 2FMDA 2VZQA 4N9HA 1X9TA 4UFMA 5C3PA 1CAWB 1SBDA 1R081 1XC6A 1ZA4A 3A0NA 4LO4B 3WLUA 5BNOC 4AQSA 1OKOA 3LDKA 5T54A 5A7NA 3IWZA 1JU3A 1V9U3 3CZUA 4G08A 3THTA 3RYRA 3D5OA 1LB2A 1WUVA 3RJRA 3LA7A 1G8WA 2R0FA 4BMEA 4KI5M 1EPZA 1LKNA 5ABJA 3W59A 5LCWL 2XWJB 2VY0A 4JZRA 1B35A 2ZHKA 1BBT3 3OUIA 4QKBA 5CU1A 3JBG3 1HRV3 5CA6A 4N43A 2IVIB 5DAWA 4I2OA 2HWB3 4NRPA 2C4XA 3UNPA 1TME1 2VQUA 3OGJA 2WNVB 4FAGA 3GHNA 3TEWA 3R0RA 3BB6A 4UFJA 5I8SA 3ZYIB 3ZFFB 4XF3A 3LCPA 5HCAA 2I74A 3RDIA 4Q1RA 2DV9A 1H8TC 1QH7A 1JOJA 4DXRA 3KHBA 4EQVA 1X50A 3B69A 1HRI2 4K1YA 5C4WC 3OBAA 3O7OA 3K77A 1MZEA 4RFRB 3T2PA 2CSGA 1AR61 1LESA 2VZSA 4QQHA 4JTMA 2C6SA 2L9LA 4BXSV 4BYYA 4Q4X3 2A1XA 4DUVA 4XFCA 1AHSA 4Q8LA 3I8TA 4GULA 5T5JA 4IE5A 3UKTA 4ISRA 4Q4Y2 3SMHA 1R64A 2QKDA 4YW1A 3VD7A 1RJ8A 1ZREA 4PLNA 4Z8BA 2W91A 3USUA 1H8VA 3AFGA 4CZSA 3ALQA 3HIFA 1LOBA 2VUDA 2VAUA 4R52A 5IK8A 1GP6A 2ZGQA 3WP4A 1J3RA 1S4CA 3J9SA 3KGZA 4IV3A 5E6HA 2H6BA 4LORA 3H8UA 2A02A 2VZTA 1CAVA 4Q26A 1W9SA 4PIXA 5FMOS 1Q8OA 2GU9A 2VR4A 3CZJA 5C9AA 2WSVA 1QJX1 4GWNA 5AC91 3IN9A 1R1A1 4I3PA 2ARAA 3UJOA 2DCYA 1F5JA 2RS33 3Q8CA 3ZFEA 5KXCA 1W2NA 2QQIA 2WNUA 3B93A 2GC0A 5E16A 5FO7B 5FXZA 3U75A 4H7LA 3RJ2X 1POV1 5ABJC 3NW4A 3NNFA 1DFQA 5HCHA 3DEMA 4JQTA 3VBRC 2VG9A 2PAKA 3M3EA 4YW5A 1YEWA 1COV3 2X5IB 2FCUA 5GLUA 1JYIA 4Y1XA 4MVTA 1S0EA 1O4ZA 4CEYB 2D97A 2B8MA 4YG0A 1S0JA 3LDRA 4LO6B 4AAPA 3BPZA 4UI9L 4C91A 2IWGB 4QGLA 1RUH1 4KWJA 4BA6A 4PDWB 1NCQA 5F7UA 3RZJA 1W6NA 1W8FA 3PTYA 1TVGA 1VRBA 3I2KA 5CIRA 5D8AA 1YXWA 4WM7B 2DCZA 2Y26A 2WDBA 4BQ3A 4AXOA 1ZBA1 5FOBB 5A3TA 2WAOA 4Y22B 3CMGA 2Z79A 4GD4A 4Q0SA 3WNNA 1DBNA 5SV5A 2RS51 3DXTA 1RUC1 1Y9MA 3I3QA 4LITA 4XTPA 5F6KA 3WQ0A 1NA1A 1Y9GA 1NY71 2GNMA 4IESA 3AP9A 3M2MA 2WZPR 3IMMA 3WF2A 3ZYRA 3VD3A 2VZRA 4XCBA 1LHWA 1SBEA 5BNNA 2VNRA 4MXVA 2DVGA 3NRUA 2B5HA 1DQ4A 1ZBE3 3IIIA 4YVWA 1W9TA 1ULCA 2UY8A 2OZ6A 1TZOA 3DF0A 5LK7B 3VBSC 2DFBA 3O5SA 3A23A 4PCRA 3LAGA 5FKCA 2FDKA 4YG6A 4DRVA 2C24A 1J3PA 5KWRA 1YIFA 4IV3B 1Z0HA 3RWKX 2D98A 4YW3A 1OXCA 3ZXDA 3VZMA 5IT6A 4ZS3A 1ZRRA 2QVSB 2X09A 2E32A 1QMJA 3ENRA 2ZEYA 2ZTNA 3QACA 2VU9A 4YZ3A 5DQ0A 5F39A 5FYZA 4IE4A 1K28D 2QQWA 3FLPA 3UYJA 2VCMA 5L7OB 2ZGLA 2VVEA 2WINB 2R071 1QKQA 1WCUA 4IDZA 1WCKA 3ZKYA 2EALA 2IXCA 4XURA 3A4UA 5F8PA 4ZY9A 4XAAA 2MHFA 4RGKA 3ZYJB 5LA9A 1LGCA 3PHMA 5I8TA 5KXDA 2DBIA 3VBUA 1L7RA 4UW5A 4E4ZA 2D40A 5H9QA 1QJY2 2F4LA 2HEYF 4PIZA 4UOJA 5T55A 5J7MA 5F9TA 1PMIA 1UZ0A 1PVC3 2C0ZA 1G86A 3JD71 3ACIA 3OD4A 3M7AA 2W5FA 4ZZ8A 4K7JA 4QX0A 5JSPA 4CDWA 4CCMA 1UMZA 2J1AA 3VKMA 1G9BA 2HKXA 5LB6A 1O3TA 1O5LA 1Z7S1 2CWSA 3RI8A 4PDWC 5FBJA 3DN7A 1J83A 2R063 5IVCA 1G9DA 1RMU3 4FPLA 4S2FA 2Q8DA 5ACA3 1SPPB 3TEZA 5F3GA 3FLRA 2WZ8A 5EHDA 4JKKA 4YZ5A 3NVCA 5CNAA 5JIUA 3SCHA 2DVBA 4D3WA 4HKWA 4XZPA 3NKGA 2JEMA 1HQWA 3NO8A 4YLZA 3ZFFA 5FYHA 3VL9A 2HEWF 1SDDB 3J8F3 3LSDA 3EO6A 4O9GA 4QGMA 2RS52 4CCNA 3FHQA 4UFIA 1FV2A 3KF3A 1DCSA 3LSEA 5IJRA 4D94A 1Q8PA 1BZWA 3ZYBA 2O8QA 3AYAA 1G6NA 5FZBA 2IXKA 4HKLA 4M4PA 3E97A 4AHZA 4AZZA 4LIUA 4RS5C 4NIAA 2V5DA 5A6QA 4LBQD 2BDRA 2QBXA 4MG2A 3CF6E 3H1YA 4XUOA 4BWOA 4ATEA 4BMBA 1UU6A 4MGKE 3JB8A 4PI0A 4XQWA 3MGUA 1RYYA 1UF2C 2RS31 2VNGA 4S2HA 3WDUA 1WCSA 3OBRA 3WW3A 2W6TA 5I0RA 4WVWA 1QEXA 2V73A 1GSLA 1U12A 3QCWA 5G05L 1MS9A 3ZN6A 2VQAA 3V56A 3O14A 1HJGA 2BOIA 1H9PA 1BXHA 2WFF3 4GKYA 1AR93 1JZ4A 3OOXA 2WR9A 4B7EA 4UBHA 5ACA2 1MS5A 3OYWA 1ZZ6A 1CONA 1WA6X 1RUD1 4IEXA 1Y9QA 1ASJ1 5IK7A 4QB2A 5FKBA 5L19A 4QXCA 3ACLA 4DXSA 4F83A 4NN0A 1MZ6A 3HR9A 3HN1A 5A33A 4Q29A 1AJOA 1WKYA 3KVBA 2VMFA 2EVXA 1DQ6A 3IZOA 1JBCA 1OF3A 2XQXA 5CFDA 1W3XA 1VP6A 4K6BA 3WW2A 4QQLA 2ZCWA 4XTMA 1A6CA 4LOSA 3T08A 3LA3A 3UL2A 1CR7A 3W21A 3POWA 4ARXA 3FN9A 3AMPA 1CIWA 4CE8A 3I49A 4A41A 3ILRA 2PHRA 5FYUA 5C3QA 2OYZA 2PHTA 4HMZA 1RUF3 3V0BA 2AR6A 2DUOA 1W0PA 3EXUA 2M5JA 2FHRA 2TNFA 1JUHA 4RHV1 5GZGA 5CG8A 2E26A 2JB8A 3M3QA 2JB4A 1RIRA 1HX6A 1WBLA 5FYVA 4LE4A 3HBKA 2BFUS 3VKOA 4AE2A 3S57A 2DYCA 1TMF1 3FHAA 3M8LA 1NT0A 4CCEA 1CZVA 1AXZA 2YXSA 5I93A 2VZVA 4JGZB 3O1TA 3ILNA 3ME2A 5I0SA 5FY4A 1C3HA 5IWFA 1QJFA 3C7HA 1Q56A 1LODA 3KQ4B 5IK4A 3VHNA 1JYNA 3S5QA 1UY0A 1FV3A 4GMP1 3PU8A 4KGGA 4P5YA 5FY9A 2CGPA 1KGYA 1B35C 3AKPA 3RMYA 5FYBA 1HB2A 1PIV3 2W94A 1HRI1 5FFOC 2C9AA 5C9AC 4LBJA 4CDWC 4FBFA 3SNMA 1PGL1 3H0OA 4Q4Y3 1UIKA 2LALA 3I3BA 4LBOA 1DGWX 1ZBE1 3SCGA 4EZ4A 3CL1A 4MH0E 5FY0A 3DECA 4E8CA 2A7AA 3OUJA 4HVOA 5FREA 4Q4X2 4Q1PA 4ISQA 4ASLA 2BBVA 2XLAA 4CXYA 1HDKA 5FY8A 2RMU1 2DWRA 2VZ3A 4BQ5A 3SC7X 2BP6A 3HN3A 2PHDA 1VBD2 3CEWA 5BYNA 1HQLA 4JRLA 4DY3A 1D2QA 2QCSB 3VZNA 3U0ZA 3U78A 3MPPG 5FYSA 4C8DA 3DKQA 5FO8B 2JG8A 5CBLA 3N4MA 3ASIA 2I45A 3Q9OA 5FZ4A 2E7AA 2LROA 1FYUA 3QD6A 5GLVA 5L7OA 1X7NA 3VBOA 4WM8C 1AR92 4EN8B 2W1WA 3ZSKA 1VB2A 2HWD2 1UY3A 5LBEA 4XE9A 3IIAA 2P1BA 3I2JA 3VHRA 2D5HA 2R043 3NL1A 4A4AA 2PHLA 3H1MA 4L97A 2VMGA 1UCXA 3POIA 4H2AA 4EZHA 5CFDB 5A3LA 2IZWA 2NPIA 3AM2A 4IUGA 4D6SA 3HQRA 3PVBB 1PVXA 1UX7A 1HV0A 3TN93 1DGRA 1PX3A 2VBPA 2X53S 2YGMA 4LIVA 2VMEA 1YLLA 1IG0A 4BIOA 1YI7A 3WW4A 2BOJA 1BYHA 3MFCA 1WW5A 4F3JA 1XSRA 5LZ6A 2EA7A 3OY8A 5BNQA 5JUVA 4X8PA 5J37A 5FZFA 4KGQA 5FZ1A 3ROUA 1NAEA 4WZFA 2HWB1 1OBNA 3U10A 2GP3A 2WO1A 2NLRA 1V6JA 1VRH3 4D7TA 2BWAA 1R1A3 3RMXA 2GNDA 2WS93 5JR2A 4NAOA 4KNCA 3BKZA 2FCTA 4LEJA 4AFCA 1YWKA 1H2KA 2UWAA 4KWLA 4U36A 1UOBA 1T2XA 4LR4A 3WQ7A 2QQJA 3OCPA 4WV8A 2JE8A 4FOVA 3SXWA 4M01A 3TNPB 1XQNA 1NCQC 4Q8KA 3LIHA 4HXCA 4OHVA 1GZ9A 1RB8G 5C9AB 3NV1A 5HCFA 1PGL2 3AP4A 2ZEZA 3POSA 3NAPB 2R042 4QB6A 5FZDA 5JDBA 1W39A 1O4TA 5DN2A 1RUC2 1VBC2 3A0KA 5CVRA 2VMIA 4KU8A 4YM1A 4TLGA 2AYHA 3GZTB 1ZNPA 4CP2A 5HCBA 2XKOA 3WNXA 2UU8A 1Q8QA 3BGAA 2AEZA 3U07A 1PGW1 3I2GA 1OLMA 4ITCA 3T1MA 3AMHA 1SFPA 1SQ4A 1QJU2 3K4AA 4XHXA 2JDHA 3VB9A 1F31A 1KS4A 2ZEXA 4DPNA 5IVYA 4FXGB 3K46A 2XBO1 1AXKA 5EPAA 2Z69A 4FOYA 1LOAA 2VMHA 1XB9A 3UKVA 3OG2A 5BNNC 5F5CA 1JYWA 5GLTA 1F4AA 2JECA 1RVF1 2LS6A 4B4QA 5K0UA 1VRH2 5FPAA 1RUF1 4C0BA 3AYCA 3GZAA 3H50A 4WM7A 3I2IA 3KS7A 3FBMA 1NA1C 4FPGA 1UY4A 4FFFA 4RHV3 2DBNA 4DUWA 2WQ8A 1H2NA 3ATGA 4PIYA 1ONAA 1CZTA 1BBT2 3OUHA 3A7QA 4OMDA 2DCKA 1BVVA 3I59B 3N7LA 3PMSA 4E2QA 5A32B 2XHNA 4IV1B 2DU1A 4HKOA 1QOSA 5JCTA 1U5ZA 5ANNA 2VOWA 5LEJA 4L2NA 2IUWA 1JN2P 1PMJX 1ST8A 3G7DA 3LGRA 3LQCA 3RNSA 3VD4A 1XXNA 1IZ3A 1OHFA 4HK9A 5DPNA 2XOMA 4Z2WA 1QJY1 1ENXA 3ZSMA 4DNYA 2GC2A 5CZKA 3MLLA 2PHUA 3LIGA 4JVAA 3ON7A 5I0UA 2JXAA 3K3NA 2KM2A 2R1DA 4DQAA 1ASJ3 4XPVA 2OT7A 1OFNA 4Y20A 3ZDSA 1JI6A 4B7KA 1EV13 1R091 2OPKA 5H9SA 4AF9A 4DB5A 1PO23 4IE0A 4E2GA 2HWF3 4ZKTB 2EIGA 2R062 4I3GA 1XOYA 2WZR3 4MGIE 4XMIA 4ZS2A 4JKLA 4XZUG 1PK6B 1XYPA 2V09A 1E5HA 4JKMA 3JQWA 2W95A 1DGLA 4NWVA 4B8EA 1NYWA 1YFUA 5J48A 2VGDA 5CKMA 2HWC2 1KD7A 4OZXA 1CX1A 3I2HA 2Y6HA 5JLVA 3WNLA 2YPDA 1SFYA 1KS5A 4XFFA 4D7SA 1WW7A 1KEXA 1H0BA 2ZAHA 4XVHA 5FZOA 4M3CA 2Q4SA 2IAHA 1YO8A 1Q8VA 2B9UA 4IV3C 4M4RA 5CFCA 1JXNA 3GBGA 4OQ9A 4EN0A 3IT8A 3VDBA 4QX8A 1MR5A 1DQ2A 3AZYA 3OGGA 4K8RB 3MZHA 1JTZX 1REEA 4QHBA 1DYOA 2RS32 1FPN1 2YHJA 3CO2A 3ZN4A 5C71A 2XPJA 4LLFA 2RMU3 4R9DA 4XF1A 1D4M1 2E9QA 4ZPIA 3FE5A 2ATFA 3WCRA 3LWCA 4RQPB 3WDVA 3KV5A 4Q27A 3ZYPA 1V6IA 1V9U2 1OQ1A 1YC61 3ZDVA 4XIKA 5J98B 1DQ5A 3J7LA 1YYNA 4Q4Y1 4QT6A 3HQXA 3BIEA 3GBWA 1EUUA 2EAKA 4XEZA 5DAPA 2P17A 1N47A 2YBKA 1ENRA 4GJZA 2NN8A 2JG8C 1AR63 1GOFA 2RDNA 1BBT1 3MF9A 5ACA1 5C8WA 1RUD2 4LTAA 4PF1A 1GYKA 1XU2A 1AX1A 2WLQA 4TYSA 3I2OA 1CX4A 3AMMA 2ORXA 4Q2FA 1HB1A 5CYYA 4I0AA 3I2FA 2BQPA 1OC1A 1ZZ9A 5C3RA 1WZXA 3JD73 4WVVA 5A7WA 3IAQA 4KBBA 3D8CA 2D44A 3N9NA 3N36A 3WEZA 3J8F2 2PQQA 3RYKA 5CEHA 1CAUB 2BVVA 5KHHA 1W0NA 3PVOA 4FFGA 1Q3EA 1SLIA 2LTNA 2FBEA 3PIJA 2HWE3 5FZMA 4DINB 1YQCA 2VUJA 2WN3A 4FVVA 2ZGRA 3JB4C 4Y3OA 1HJFA 2TEPA 1GOGA 5F37A 3BU7A 1IS3A 4M3CB 1W9FA 1HRV1 2H0BA 1EPWA 2GSYA 3N3HA 4A7ZA 3LOBA 2YC4A 4EN6B 1LNSA 2W9XA 3LA2A 3MV11 4OYUA 3SKVA 3ZSJA 3WF0A 1AYM2 1OFSA 3ETQA 3OBTA 4CUGA 3H8RA 1ND3B 1L7QA 5JXHA 2A75A 2Y6GA 4N53C 1DDLA 4FOQA 5HBAA 3S6PA 4NOTA 3O0XA 2B42B 4KG0A 5FXVA 1PO11 5FPBA 3WV6A 2VVFA 4FCAA 4XBNA 2VBBA 1AR62 1H2MA 2XLFA 2A6XA 5FK8A 5IATA 5F5IA 1QF3A 3SITA 2VW2A 1LR5A 4B3NA 1L3JA 1Q5OA 2QNKA 3CJIA 5A1FA 1X36A 3PMEA 5FLIA 3HMYA 3IDAA 3PJYA 5F2WA 2VUAA 4MXWB 3UK9A 4ONUA 1O5UA 2D5FA 1OOPB 1D4M2 3VUOA 1COV1 2O5PA 4BH9A 1TE1B 3H3ZA 1RGSA 3HVDA 5CISA 2BNOA 2WNUC 2PAEA 4MLOA 1OF4A 2X5IA 2PAMA 1MACA 1H1IA 1QWRA 4HSJA 4YGCA 2WJSA 5FZ6A 3D37A 1BEV3 2ZX1A 1OKQA 1C5HA 1D7PM 1UPSA 3KMHA 4YM3A 1JZ2A 1UU4A 4MYEA 1ENSA 1OUXA 2X8KA 1QJX3 2J1EA 1MS8A 3IAPA 5L9RA 4WZCA 1RHI1 4JCKA 1KDMA 5JWPA 3WQBA 4AGGA 3FWEA 5FPUA 3FUOA 1BK1A 1PZ9A 3AXDA 3U11A 5A1AA 1GQHA 1F4HA 1W04A 3UGHA 5T5OA 2J1VA 3U1XA 1OLRA 1RUG1 4P00B 4COVA 2GC1A 3VZKA 1OA4A 4CYDA 5DG2A 5FYMA 3OPZA 4LA2A 2QUOA 1R082 1LHOA 5KR7A 1K12A 2VW0A 1GOHA 1PVC2 1YRZA 5A1LA 2Y6LA 1UYXA 3T2TA 4K20A 3LPFA 3GYDA 4D6RA 1C1LA 3E6DA 1EAH3 1LRHA 4Y5SA 3NSTA 5HV0A 3A22A 4W6WA 1AX2A 5JSOA 1GKBA 3UV9A 1S0DA 3JD72 5FCCA 5CB7A 1FXZA 4LKDA 3LEGA 1W03A 4YRDA 2ADEA 1XNTA 1QJZA 1ZBA2 2XVLA 3J7HA 5EP9A 2FMYA 1FT9A 4XQDA 4JGYA 5FZ7A 4CCJA 4A7KA 2B7YA 4YZ2A 4H3WA 1ZZBA 3K4DA 3IDBB 2GC3A 3ZXFA 1ULOA 4GB32 1V6LA 3N7JA 2JDAA 5JR7B 2BBAA 1S55A 1BCXA 2CGNA 2BW8A 4I0BA 4PDWA 2VBDA 1CWPA 1MQTC 1WMFA 4FFHA 2WWJA 4RL7A 1PIV1 1MS4A 4UFLA 1SFNA 1PMHX 3AKTA 4IV1C 4E9KA 3L2HA 2BU9A 4OULA 1UO9A 2Y6FA 1YI9A 3T0AA 4HK8A 4SLIA 4RR3A 5FZGA 5C4WB 3B9IA 1QH6A 4HFSA 5KHJA 1B09A 1GZWA 3ZFGA 1NUKA 1VBB3 3NV3A 1AYN2 1XSQA 3IKWA 1GP4A 4C90A 4K1ZA 4ZONA 4L0PA 1GZTA 1S0BA 2IVJA 4WM8B 5A70A 1GWKA 2XG3A 5T5LA 2VECA 4LUMA 2OUHA 1BKZA 2HBTA 4AQ6A 3GGLA 4W50A 1F35A 2PHXA 4N7UA 1M4WA 2W08A 1AR82 1ULPA 2R073 5FZ8A 1QJU1 2SLIA 3IPVB 5GZDA 3AXEA 5C8CA 2WUHA 4IGPA 5C7GA 1LHNA 4ZU7A 2VXRA 5KHKA 4FTEA 1H6YA 1D0GA 1VBB1 4YVSB 3RI9A 1IPSA 3OTFA 1O3SA 1E5SA 2X29A 1LU1A 1LOFA 1NLRA 4CUBA 3KSCA 3K4ZA 1T6BX 4MV2A 2XWBB 4ATFA 1R1A2 5BNPC 4FFIA 4AVSA 1DHKB 2RJKA 1Y43B 2MPFA 5KBFA 3B9CA 3KT4A 1A3KA 1ENQA 3N9OA 2VW1A 3AYDA 1W8WA 1ASJ2 4H14A 3NMBA 3SISA 3UETA 3ZR6A 4XJZA 2VULA 4Y1ZA 2VE1A 4AEMA 3NAPA 2Q1ZB 3NJVA 3KD4A 4XW3A 3GS9A 3MLJA 1WGPA 2VH9A 2ZAAA 4QQOA 2XR4A 2ZX4A 4YM0A 2K0GA 1UZWA 1AL22 1RXFA 4BE3A 1H1MA 5DG1A 4AI3A 1FOD3 4BK5A 4FPCA 1K45A 1CIYA 4XFBA 1J1LA 1VALA 5EJZB 3BPSA 4CEYC 4DIQA 1C8M1 1FX5A 1S2EA 1HN1A 5K8SA 1W6NB 5J36A 4NPRA 4QXKA 3N9PA 1OT5A 1R092 3GZEA 5ERLA 4TTGA 5FJKA 1W28A 2EIEA 2JKXA 2Z4FA 3P6BA 1HB4A 4FOWA 5FYTA 1ZBA3 5LATA 2W1QA 1PZ7A 2D3SA 2WNVA 5T50A 5A3WA 2AENA 1VE0A 3MIBA 3T3YA 3W5NA 3M70A 2ZKNA 3HJRA 4DXZA 3AKQA 4MZUA 4Y22A 4AL9A 4ZHNA 1FNZA 1UKGA 2W39A 2ZA9A 4P9WA 3RWNA 5FR3A 3J7MA 5FLJA 3MBWA 3IBMA 4HN0A 4XDOA 4YARA 3BUCA 2D93A 3O1SA 4RSUA 1GZWB 4MHRA 1WLWA 2P2KA 1AYN1 1DIWA 3L2YA 1VB4A 1VAMA 2XJUA 5A7WB 3D0JA 4ET7A 2B9VA 5FZIA 1F9KA 3WP5A 1QY4A 3POBA 4TXWA 4CCLA 4XF9A 1NX9A 3ZSLA 2P6CA 5JPMB 5D1IA 2RR11 2RDQA 3RZHA 5HPOA 1YQ6A 5FQ0B 3VKFC 2Y0OA 4HLTA 4QHZA 4N7IA 5BY5A 1LGBA 1N1SA 4N53A 4XXAA 3WT3A 3A21A 1WMEA 4XC9A 3N35A 4XUTA 5E89A 4B1LA 2WT2A 2BJSA 4GMP3 2O8OA 3VBOB 4NWWA 4LBQB 2F4PA 4ES9A 3HQUA 4P9LA 2RJLA 1BK0A 1NE4A 1C8M3 2UYAA 2VMDA 3M3OA 3BTYA 2DCTA 2RM21 4R9CA 4LHSA 1ACCA 2O14A 4KU7A 4BISA 2ARXA 4XFGA 1OOPC 2KR2A 4AFAA 3V64A 4QX2A 1TMF3 4LJHA 3JQXA 5EZWA 2GN3A 3O1OA 1W6OB 1WMDA 1U5IA 2J1RA 5KC6A 2NP0A 4LT5A 3SH4A 3VD9A 3RZMA 1LOGA 2Q1FA 4OHYA 5T5PA 4NROA 4EWEA 1TNRA 2AEYA 3KGLA 2B45X 2UY9A 1NXD1 1H8TB 1OLQA 2MEV3 4LA3A 2YGLA 4QGNA 1QXJA 2W1UA 3VDAA 4EYUA 4R4ZA 5H9PA 5HI0A 5EQUA 4URAA 4XUPA 4O65A 5M0TA 4HPKA 3O1PA 1ZRIA 2G9FA 4RHV2 3IDEA 5D8AB 5KHIA 5ISLA 1WW4A 2ES3A 4ORFA 3DCQA 2CDPA 2WA4A 4Y24A 1DQ0A 2GMPA 3W5MA 2WNUB 4QPIC 4QPYA 2HLEA 3VBFC 4BQYA 1QXPA 2RE9A 1NLSA 3QH7A 2G19A 4PQ9A 4WVMA 5FK7A 4E2SA 1NKGA 4CP9B 2XDVA 5LA0A 1XNAA 3UKNA 1AYM1 2VTXJ 4AFBA 1HN0A 2FDJA 2WQ4A 4NAMA 2FQPA 2G9ZA 3RPQA 5FRAA 3WNPA 1LULA 4XFHA 2Q1MA 3T1LA 2GN7A 2ZX3A 1LENA 4LK7A 3VBHB 3V0BB 3JCIA 2ADDA 2VOTA 5GZFA 1KFXL 5JMOA 1GBGA 3WVJA 1YFYA 3DV8A 1LHUA 1ULFA 1UN1A 4NHMA 3C7FA 2D6NA 2ET7A 2C1FA 3BCWA 4O9EA 1ND2B 2JG9A 4URTA 3T4VA 4JTNA 3WUCA 3WNMA 2FD8A 2P3YA 4PF5A 3CJIB 5CFCC 1GQPA 4CPBA 3MW2A 1CPNA 3LE0A 1M06G 1REFA 5FPVA 4RQPC 1BVP1 1J3QA 4IV1A 2AGSA 1TEIA 1JYTA 3ETPA 3KT7A 2UWCA 4LBLA 4MX3A 2E31A 3WZ1A 4YVWB 3FHIB 5FP3A 2VQTA 2NZ9A 3O1MA 1SACA 2D6PA 1UAIA 4XMAA 1SG3A 3OF1A 5GZEA 4YNIA 1GUIA 2RG4A 5FUNA 4BZ4A 3IMNA 2WABA 3K2OA 5DZEA 1AR91 1ULGA 1O7FA 2Q0AA 1N1YA 1IGOA 2BGPA 3HEIA 3URFA 1X8MA 3BOPA 3MIEA 2ZX2A 5FUPA 2YY1A 2VTFA 3AKRA 1MVEA 3ORJA 1NZCA 1YUDA 2CDOA 5F1RA 3TEYA 1VAKA 2XJTA 1MS0A 3E5UA 5FOJB 5T3NA 3Q8BA 2LRPA 3RZKA 5JIAA 3TN92 5A6ZA 2ZS6B 1N1TA 4META 3EYPA 4XBQA 2VZ1A 4IETA 5LA1A 5I0TA 3AZXA 5JZGA 3FZ3A 1CAXB 4J6GA 1XNBA 4UT5A 1TG7A 2CU5A 4IE7A 3U37A 4Z1VA 2ZMLA 4QPGA 1SPPA 3GCXA 3KZ4C 1US3A 3I97A 1VBE2 4AI2A 4V2WA 4TLFA 3DPRA 3WG3A 1FOD1 1RUI2 2NQYA 2OPWA 3ZVXA 3PVNA 1K5MB 4N90A 3ZYHA 5E1RA 4LE3A 4KQ7A 1VR3A 1KITA 4AGVA 1ND3C 2QQPA 1X8EA 3IDCB 2E51A 1EY2A 5F2SA 3ZN5A 1OMIA 3R4SA 3GJBA 1J84A 1YQ8A 3NAPC 5DAXA 4QPGC 3KCCA 4IEUA 4COZA 1JODA 2WNOA 4FO9A 2YB7A 4AFDA 3HAGA 3VDDC 4JV4A 2KXLA 2V4VA 4R8HA 2Q8OA 3VBHA 4A3ZA 1SLBA 3MYXA 2W78A 2VZOA 4YG3A 2X5IC 3HNMA 3VZOA 3MLKA 2W68A 3KVAA 4CP1A 1PZ8A 1WLCA 2VTXA 3D6EA 1BEV2 3ES1A 4AI8A 3PIGA 3FBYA 1UD1A 1NQJA 3OGSA 2ZPXA 2OKXA 4CDQB 2PLV3 5L73A 4ASKA 4C1XA 3C8XA 3MDPA 4ES8A 2JX9A 2E53A 2GMMA 4HSLA 1BLZA 3ZN6B 1CVNA 1S0IA 2E6VA 3NV4A 4CDQA 4CEWB 1RUOA 2HWC1 3TNQA 3USUB 4KBZA 3VBUB 1ZBE2 3HT1A 1XRUA 1QDCA 3LEIA 1WD4A 4O61A 2YROA 3T2QA 2PHWA 1OPOA 1GANA 1SCRA 4IEOA 3LEKA 2QJVA 2BPA2 2XUMA 2XBO2 3ST7A 2D6MA 4COUA 1RUNA 2BTVC 3AP5A 4P9YA 3SKJE 4LQRA 1JYCA 1C57A 1OA3A 1RVF2 1W6MB 3ACHA 3HNYM 4MSVA 2ZJCA 3VDCA 1FI2A 2WKKA 4W4ZA 1MVQA 5FP8A 1QHDA 4F7ZA 4IEWA 4UF0A 1G7YA 1OA2A 1GMMA 3TWIA 4FP2A 4GWMA 1SLTA 2RS11 2HBUA 1KRIA 5CKNA 4QB1A 1DP0A 5DUXA 2QZ2A 4LBMA 1LGNA 2ZGUA 4NMIA 2WC2A 4LO5B 3ZPYA 3ZMNA 2W87A 3OSDA 1R083 3OPWA 2VOVA 2ZKLA 1NE6A 4AK3A 2BNNA 4FQZA 4Y1VA 3ZYFA 4AEJA 1UOGA 4RGAA 4NPLA 1VBE1 3PUAA 2CL2A 1K42A 4YW4A 5LWBA 1V0AA 1RUC3 5FP4A 3VBFA 5IHRA 2GH8A 3OY8B 2R49A 1OVSA 4YFZA 4JQRA 5LY2A 1DGRN 2JD9A 2ZZJA 2GNTA 3E6CC 1LOFC 2WO3A 1DZRA 3APBA 2JIGA 3DXUA 4K21A 4D0QA 4YSFA 1AL21 2ENRA 4GWJA 5GKAC 5BXXA 1UOFA 1UU5A 4YGEA 1RUJ3 3WXPA 2HWB2 2OUJA 5EYXA 5IVJA 3S0MA 4BJ0A 1SBFA 2FZ1A 2WO7A 4W6YA 4XETA 5FZAA 2VOXA 5GJ6A 3VBOC 3U4XA 2SBAA 4YYOA 1X9PA 2OVUA 2A3YA 3PUQA 3OGVA 1GFF2 1ZRCA 3K3OA 3V0AB 1KXGA 1D4M3 4G4FA 3EMRA 1NY72 1P8JA 4XILA 5FQ0A 1HRV2 3ZXLA 2IXHA 4DOUA 2W77A 2R0HA 2VQ0A 1IS6A 3RZGA 4LK6A 4PHZA 2XHKA 4H55A 3OYWB 1J58A 3B7MA 4XUQA 3PTRB 5SV8A 2FZ2A 2B4KA 4QDSA 5FJHA 1C5IA 1CD3G 3NWKA 4BHPA 1SLCA 3CDDA 4GWIA 2R30A 2JDYA 2R041 5IW0A 1TME2 5DDJ2 1DF0A 1WWYA 3CU7A 4CP9A 2DVFA 2XLGA 3SEEA 4NHYA 1W8OA 4JGZA 4XABA 4COWA 1JOBA 5LA2A 1ODNA 1POQA 1YFWA 2C9KA 1DQ1A 2IFWA 1W6QB 1H30A 3THPA 3ZXKA 3V0AA 1HLCA 4UAPA 2RR12 3M3IA 4P9GA 5BPXA 4EWDA 2OXBA 4JGYC 1FMD1 3NQHA 4YFWA 1NXMA 4L9BA 3KQRA 2BFUL 3CBNA 5BNPB 3CJIC 5CFCB 1UW8A 4WVMB 1GP5A 2QZ3A 1RUJ2 2P3IA 4B4RA 1XJAA 1IQDC 3FLTA 4LMFA 2W75A 1W8TA 4D7YA 4ZU5A 2UYBA 4PLOA 4JGZC 2QDRA 1ZYBA 1NA1B 4HT1T 4RA0A 5EV7A 2D3PA 4A45A 2WWSA 5I91A 3EZJA 1GNZA 3B94A 5F6LB 3RSJA 2NMNA 3ECQA 1CGPA 3HOBA 1I5PA 4EV0A 3KHCA 4CXXA 4G9SB 4UW6A 4UYBA 2OIIA 4DUXA 3O1RA 4QX3A 4OHZA 2QQUA 1HKDA 3I3MA 2XVKA 1HB3A 4MGQA 1XBFA 4AHWA 1RVF3 4AYUA 3ZMOA 3ZFGB 1XYNA 2B46X 3H1WA 2P6HA 4YW7A 3BOWA 5LW9A 2XMLA 4GIQA 2VZPA 4QXBA 1ND2A 2JG9B 1KJRA 2QQMA 3OV5A 2UURA 1DG6A 1MEC2 4HVRA 5E8AA 3ZSEA 4DMIA 5FO9B 2DDUA 3AX4A 3BTZA 5H9RA 3W58A 5IK5A 4QKFA 2CHHA 2IFRA 4NRQA 3ILFA 4M00A 5A7QA 4BQ2A 2PMWB 3UESA 2JDUA 3ZXJA 4NIHA 2RS53 4J1WA 1V00A 3OEBA 3T0BA 4V1PA 1U5YA 4RN5A 3S5AA 4CU8A 4Q5OA 2X10A 3DYMA 3KM5A 3PUIA 4K9SA 3MEPA 4P9XA 1BJQA 2XQRA 4KG8A 1RXGA 4FPKA 5FMOL 3ZIXA 5IAXA 1JZ8A 3I54A 3I7DA 5AC93 3POYA 5DAVA 3B01A 1CAXA 3MV01 1WRUA 1RUE1 5FLHA 2RS13 3AVRA 1XYOA 4NVPA 3VDDB 1W05A 2CV6A 4I01A 1C28A 3UT0A 4I02A 1K5MC 4BOWA 1XNKA 5FXXA 4KMQA 2GNBA 4M0NA 3NKTA 4YW6A 3BN6A 3ZKUA 4YZ4A 5JXGA 1LECA 1EV11 2JIJA 4I09A 1A78A 1B35B 3G6JB 2Z6BD 1AZDA 4CTEA 2W76A 4QPGB 4UXAA 4CDWB 3MICA 1V6NA 2JE7A 4AI0A 2VD7A 4D69A 1ULEA 4CPBD 1S2BA 2XL7A 1AUYA 4RD7A 4BCUA 1UX6A 1QNWA 1K5MA 3TB0A 2FDFA 2K46A 1PK6A 4DS0A 5DDJ3 5AC92 3MUZ1 1J59A 1PGSA 4EWAA 2GALA 4HZFA 4XJUA 1VBE3 3TN91 4NR1A 3ACFA 1QXRA 1RJ7A 4CDQC 1Y4WA 1VIWB 5DMYA 5IVBA 4FP3A 4TZDA 4AR0A 1ZX5A 3R4UA 3VBFB 4A44A 3WDWA 4Q4V3 3VN4A 1YNAA 3VBUC 4NIDA 3GR5A 2XJVA 4Q0VA 2A73B 4CEWA 1AJKA 1AVBA 2Q30A 4JHTA 5AFEA 1DZQA 5LRRA 1POV3 1TMF2 1XPWA 2ZGSA 4QPWA 1QQP1 1SLAA 3OD0A 2ETEA 3F2ZA 1AL23 4O7XA 4TSVA 5C8CB 4L92A 4MTKA 4AHYA 3O0WA 3MUY1 1LU2A 1EP0A 1ZVFA 1ZZ8A 1C1FA 4XJAA 3HD8B 1N3OA 4B4PA 4XACA 2WQZC 3FC0A 4YM2A 1LAJA 3ZM8A 1ND2C 2BNMA 1QNYA 2BZDA 2GZWA 4J1XA 3AFKA 4FPHA 1D0HA 4ZU4A 2ZZQA 1ND3A 3WDYA 1BMV1 4B1MA 3GXUA 2XL9A 5LBFA 2PXJA 4Q0UA 2C5DA 4AQ2A 5IFTA 5EJ3A 5A3NA 3AZWA 2AH2A 2HYXA 3MIDA 2JJ6A 4DEQA 1MZ5A 2DTYA 5KC5A 4M3CE 4ZXKA 1NLQA 2YFUA 1E57A 4RR3B 4UFKA 4XJ8A 2H6CA 4Y1YA 4AEDC 1WBFA 3CJXA 1KJLA 3WY6A 3D82A 4ARYA 3L9JT 3I59A 2J7MA 4BPZA 2IXIA 1BQPA 1U5XA 2WWUA 2ZXQA 3O12A 5FPLA 4BLJA 3VHOA 4P5HA 4JC1A 3BTXA 4K8FA 4JDNA 4XF0A 2JE9A 3B5LB 2J1TA 2VVDA 4LO8A 2K2SA 1EV12 4S2DA 1AR73 1NQDA 1COV2 5FP9A 2WFF2 1AR81 2CY6A 4U2AA 1H4HA 4JX0A 2CWMA 4FPFA 3ZX7A 1W6MA 2HWF2 1Z78A 3POGA 4E27A 4GQ7A 4IL7A 1IPJA 1OQDA 2P3KA 3POFA 4XJWA 1IPKA 5LASA 4LOTA 3TAYA 4IW3A 5JOWA 3RFRA 1O6UA 2D6KA 2VCAA 1GQGA 4YVSA 4UW4A 5HXVA 4R4XA 2YUEA 1FPN3 2ID4A 4NRMA 2HYKA 2JDKA 1CQ9A 3GNEA 2ZGKA 4HBNA 3JU9A 5FMDA 4XFAA 2JICA 4BQWA 5A3MA 3LPGA 2W6UA 1RUF2 3GJAA 4X6RB 1JHNA 4Q4W1 4RQPA 2RM22 4BQXA 1YIPA 2DFCA 2Y6KA 1UYPA 3PL0A 1OSGA 2XJPA 4AEKA 4YGDA 3W9AA 1F15A 2V4AA 3MFAA 4AVTA 5I0DA 4CP0A 2AACA 1MQTA 1W2UA 4PI2A 3IM0A 2IC1A 1LEDA 2JENA 4QMAA 3H7YA 2EXHA 4NPMA 5EJ1B 3WF4A 3WF1A 1VBA1 4CDXA 4HETA 3KT1A 5L36A 3PU3A 1UZZA 1CZSA 5L9VA 4LPLA 3AZZA 4CDXB 1OQEA 3R4DB 4CRQA 2A6ZA 2WZPP 5BNPA 3BI3A 4J25A 3BU0A 3TEXA 1RMU1 2VMCA 3LFIA 1V6KA 2VUCA 4TWTA 2QQVA 4GB31 5FZ3A 1JYVA 4AVVA 4OUSA 1GV9A 5JPNB 1IS4A 1UMHA 1QDOA 4AG4A 2HJIA 4A42A 5B4NA 5A7OA 1W0OA 3SCFA 2WZEA 3PUHA 5JSRA 2Y34A 2Q5TA 2FDIA 4UWDA 5FZEA 2ZHMA 1N1VA 1HQNA 4YGBA 4OLLA 2GAUA 3KCXA 3R05A 2MNGA 5F3EA 5HXMA 4FXKB 5DDJ1 1H2LA 1UMIA 1K5JA 3C7OA 4FSJA 5FAXA 1GNHA 2I07B 5TSWA 3J4UH 2OX0A 1T6GC 1SLLA 2DTWA 1SHWB 4QQ2A 1UXXX 4QXHA 3LKJA 3D4KA 1O8PA 1R1ZA 1URXA 4IEPA 1WMXA 3CNAA 5F32A 5FWEA 1N3QA 1US2A 1YFXA 2B39A 5FY1A 2CTVA 3GDBA 3QBQA 2Y60A 2OS2A 1XE7A 3ZXGA 2ARBA 3N9QA 4OI1A 3WDTA 1RUG3 3POEA 5F5QA 2Z5WA 3OEAA 4QU1A 4YZ1A 4E4HA 3ZIWA 3WSOA 1LOEA 4JTOA 5FZHA 4YVSC 3MPBA 1XNCA 3AP6A 2BV4A 5EWSA 4JDMA 2BGOA 3PLQA 2WNEA 2E63A 2ZMKA 2O1QA 3K51A 5A7SA 3KV6A 3USSA 4FI9A 4OCTA 3ES4A 5BNOA 2BUKA 2ERFA 4QWNA 1W90A 1HRI3 4GJYA 2HWE2 4IGQA 4HL0A 2ZMNA 3GHMA 2W2IA 4QM8A 4SBVA 4NHKA 2CYFA 5EXOA 2ZGTA 5K4LA 1A34A 2F17A 3Q8AA 3K48A 2O0OA 1V6OA 2J1SA 4XYXA 4B29A 3N9LA 1S1AA 2W1SA 3RG0A 5LEKA 2WZR2 1A8MA 1WD3A 2Q8EA 3PURA 4UHVA 4ASMB 3RQ0A 5C70A 3E5XA 2QQLA 2ZACA 3QOPA 1MEC1 2JWPA 3WDXA 4I0WB 3GF6A 1F2NA 4QKNA 1IOAA 2G4IA 4FPEA 4OI0A 4Y4RA 1FATA 1WTHD 2V72A 2EAAA 1JH5A 4M0HA 3DYOA 4FQ4A 4QDQA 4AVBA 4OUEA 3RZZA 1TME3 3MHZA 4JDOA 3RRDA 4XUNA 4GA9A 2PQSA 1O4YA 4Q4V2 3M1HA 2E33A 4FAHA 4CCOA 1PO12 5A3OA 5CADA 5JZGC 1EYBA 1HXS1 2MEV2 4QKDA 2P34A 5IAVA 2TUNA 1XE8A 4C1WA 4CU7A 4CVUA 2Z42A 1XNDA 5FY5A 2VPVA 4LKEA 1RUE2 1N3PA 2VNOA 4GZ9A 1V9U1 3H42B 1I9RA 3JUUA 1QJU3 2RMU2 2HWD3 1C4RA 3KCYA 3ZXAC 1H6XA 3CIHA 3GALA 2J1UA 1CESA 3U14A 3ITQA 3WW1A 2D3RA 5A80A 1UOJA 4QD2A 4W65A 1VBC1 2IXJA 4IEYA 1RL3A 3HT2A 4H7MA 2A6VA 4AHXA 2Y8KA 1GWLA 1VBD3 4Z2AA 3AVSA 2EIBA 3WQ1A 2CGOA 4HONA 4R9AA 3SLIA 2NMOA 5J3UA 3LDBA 4IGOA 2PTMA 3HPNA 2A5ZA 2DUQA 4WVZA 1YQ5A 5FUIA 4X8NA 2DURA 2P5BA 2CNAA 1QOOA 2PYTA 3J8F1 1DGWA 4LHNA 4LKFA 5IFPA 1Q8SA 5AFBA 3PVEA 1NG0A 3LOIA 4LO7A 4XHBA 2FDGA 4NIIA 4RR3C 5C3OA 2EICA 5CG9A 5IYYA 1ZM1A 4XAEA 4IEZA 4BB3A 2R1BA 3KF5A 1CN1A 5JI7A 4BDVB 3RS6A 3P1IA 1JZ3A 1BMV2 1RUG2 4NUBA 4HANA 3MIGA 5DZGA 1QJX2 1UY2A 1DLLA 4EE2A 1GWMA 2ORZA 5FYCA 1W3VA 2G9GA 4Q0QA 5C33A 2CAUA 1GLHA 3TBDA 1S0CA 1UKRA 4DFSA 1PVC1 1TQ5A 2A6WA 5LBBA 1YJLA 2WZR1 1DZTA 3BVCA 1VBA3 3AJZA 1GR3A 2BWCA 3VZLA 5FY7A 2VCCA 1QQP2 2ILMA 2WS92 3BTAA 2WYSA 4MOAA 3O1VA 2XUEA 2AZ5A 2XVGA 3MIHA 4K3UA 2WFPA 4OHWA 4UFHA 4A3XA 1ZRDA 2V5YA 3WCSA 4E4DX 4FPYA 5FDBA 4QPIA 1STMA 2W16A 1BEV1 4NO4A 5ABJB 3O0VA 1OH3A 1VJ2A 1W9YA 3KLSA 4GB33 5C3SA 1RUH2 1QGLA 1IG3A 3HWJA 3JZVA 4AI1A 1JMUB 1WA4A 2DCJA 2DVDA 3VBHC 4UF0B 4FPOB 5KXBA 4WBBA 1W2OA 4WM8A 4YW2A 3B3QE 1UNBA 3I3DA 4XQ4A 1I3HA 1UYYA 4N8MA 3AB0A 4CDXC 1AR72 2LW8A 4JHZA 1PHMA 3RYPA 3P3NA 1VMHA 2WN2A 4QX1A 1OI6A 1D4VB 3MW4A 2WO2A 3DL3A 5FYIA 1AYM3 1S0FA 2PFWA 3WG1A 1POV0 2PA7A 2YPJA 2VM9A 2YYOA 2K9ZA 2P4EA 1TNFA 4YVWC 5K0UC 1J1TA 3H3UA 3K75B 4EROA 5T52A 3LFMA 2QDNA 5DXDA 2P37A 3H7JA 4KH9A 4DXTA 5GALA 2WT0A 1AF9A 2RS12 5FZ0A 3E5QA 3TOJA 4GKXA 4LUKA 3Q8FA 5GZCA 1O59A 2BRTA 5IVVA 3CLPA 3OGRA 1GZCA 5FP7A 5J09A 2EIDA 3S7EA 1FMD2 2YC2A 3BYWA 1ZRFA 1JZ6A 1FNYA 2VJXA 3OBZA 1SZBA 1PX4A 3SH3A 4CU6A 2AUYA 3SHRA 1NOVA 1W2TA 4MGYE 5JI9A 4NHLA 4INDA 1V70A 3M3CA 5FZOB 2JDMA 2W92A 3B00A 1RUD3 1JYXA 4CU9A 3VBSB 3QLQA 3HNBM 3FFZA 4W8JA 1OUSA 1YCIA 2GMEA 2RM23 4N9IA 5A33B 4MXWA 5A6XA 1O8SA 5JOZA 5FZCA 2XB6C 5AVPA 4FT8A 3JBG1 4BQ4A 1ZZ7A 5AVAA 1MS3A 2WRAA 2ZGMA 3C7GA 1FOD2 3J7NA 4KWUA 3U4SA 2WS91 3VDDA 4MGSA 2X531 2GH2A 3I2DA 2UWBA 3H8OA 5L7OC 2JDZA 4Y5TA 4AEDA 1VBA2 3KV4A 3CQOA 4UBGA 5LK5A 3TRSB 3WNKA 3FJSA 4CA9A 4XDPA 5DUUA 1X33A 1VPHA 4AEDB 1C8M2 5BNNB 2ZGPA 3VV1A 3P3PA 5GLZA 4S2GA 5DUVA 5BNOB 5J1XA 3NNGA 1CAVB 1Y7BA 2YV8A 3DUIA 3BALA 1XU1A 4W6XA 4D8MA 1UYZA 1RMU2 4A7YA 5JAXA 4HVQA 1G9AA 5FZLA 4ZXEA 2ET1A 4P9IA 2G1MA 5CKQA 1WLTA 4AR2A 4DO0A 1S0GA 1IHMA 1AX0A 4AGRA 4DZGA 1F8VA 4FTSA 2DUPA 1QOTA 4AI9A 4A2UA 3POJA 5DUWA 1E5IA 3T0DA 4LULA 1APNA 4P14A 3AP7A 1WLDA 1REDA 5JXIA 4CEWC 1AXYA 2YG0A 1HV1A 1NCRC 4GALA 4GXLA 1CJDA 4COYA 3MI8A 1SMVA 4OQ8A 3WINE 2AC1A 3T4HB 4IE6A 5D2AA 3RGBA 4BQ1A 4Q4X1 2W46A 3NNLA 5FYYA 4XIOA 1Z7S3 4QDRA 5D8AC 1VBB2 2WLPA 4MGZE 5FMBA 2WAAA 2P5ZX 4GMP0 1VBD1 2X05A 3N7KA 4RS5A 4K40A 5A3UA 3AL6A 4CSWA 5JZGB 3DYPA 2Y38A 4XJ9A 4YWAA 3THDA 1OLME 2VO5A 1PK6C 1PO22 3ACGA 3AK0A 4CCCA 5A32A 1JZ5A 2Y0IA 3NJZA 3LF7A 1OOPA 4RS5B 5FMCA 1H8TA 4LNVA 3ABZA 1C8NA 1XE0A 3GCWA 3TYJA 3V65A 2WT1A 1UZVA 1YJKA 3EB7A 3SEPA 4D6QA 1PO13 4HG6B 2HWD1 3O1UA 1PNGA 4P02B 2VCBA 3PNAA 3MIFA 1UQXA 2JDPA 4PBPA 4PLMA 2XBO3 1GU3A 5BUVA 5CFDC 1LCLA 3IPVA 4XBLA 4E4SA 3RZLA 4BLIA 5K9YA 2OZJA 2HH9A 3KWVA 3R6SA 3VZJA 4Z82A 2LM3A 1RHI2 4Y1UA 4GH4C 4CDUA 2BEOA 1RTVA 3NJXA 2XKPA 3ZFEC 1PNFA 1U0AA 2A3WA 4GH4A 4CDUC 3CKHA 1QIQA 4YPJA 1IKPA 1Z7S2 1HXS3 5IVFA 2FDHA 4DY5A 2QQKA 2WA3A 5F5AA 2ZGOA 2OA2A 2HWC3 2VNVA 1EUTA 2QFEA 1MPXA 1LOCA 3RVHA 3S7IA 3D3AA 1I5ZA 1IKQA 3VL8A 5IUQA 3WG2A 3WF3A 1I6XA 2E7TA 4OHXA 1OPMA 3AL5A 1MS1A 4DEVA 3ZLIA 4UW3A 1LEMA 1HIXA 4Y33A 3AZVA 1V6MA 1W8UA 4PT6A 3P5BA 3DPRB 1WW6A 5ANQA 2VXJA 4Y5Z0 2YU2A 3PJQA 3J26N 4IXLA 5D21A 4CUCA 2EXJA 1OD3A 2ZEWA 2RHPA 4R9BA 3WUDA 4LLOA 1JZ7A 1ZA7A 5F3CA 3LB9A 5IVEA 2J22A 4Z92B 3WX5A 2ARCA 2A6YA 5B2GB 5I8YA 2R6QA 3QH6A 1CJPA 4HN1A 1UZYA 5FPZA 1I1EA 4NJ4A 2QQOA 2MEV1 1HXS2 3CDZB 1IQAA 3MW3A 4JAAA 1W06A 1NCRB 2HEVF 3KB5A 1RUH3 3H3LA 1F5FA 1JHJA 2R16A 4AFMA 2IXLA 3OB8A 2DVAA 2PLV1 5LBCA 1G9CA 4IEQA 4AAXA 1AYN3 3AC0A 1BHGA 1PIV2 4OVEA 2Y33A 3WOGA 2J42A 1UL9A 3D0SA 5C6CA 4Z07A 1PO21 4N43C 5GM0A 4A6SA 4JGYB 4XDQA 1QJEA 3WNOA 1W6OA 3NNJA 2Q8CA 2YMZA 1RUJ1 4PJYA 4MO3M 2NM1A 3WP6A 5A3PA 3VD5A 2XJSA 3NNMA 4M3CF 2PHFA 4N53B 2EF6A 1E5RA 2YU1A 3I4IA 1CAUA 1QU0A 4MUVA 3SQOA 4XFIA 5C8CC 1GNYA 1DYKA 1JU4A 4P9JA 4PQQA 4CXWA 5JOXA 2VL4A 1UPIA 5GLWA 5K0UB 4CCDA 2WIIB 4LBQA 3FUQA 5EFUA 5F3IA 4GH4B 3OJBA 1DLCA 1WCQA 4LKSA 4OFGA 2A71A 3ZFEB 1LTEA 1VBC3 3CHXA 1W6PB 3IB3A 4XCAA 3AMNA 1EAH2 1OURA 2WSUA 2XONA 2PN5A 2YBSA 2VZUA 4OI4A 4GAZA 2WNVC 2RJ2A 3LD8A 4I30A 2YFZA 4IERA 2YZ4A 3FL7A 3H8XA 3VHPA 2FCVA 3ZFGC 1RUI1 1QJY3 3ZFFC 4BIFA 2JD4A 1K3IA 4L99A 3ELNA 1WCDJ 5K7PA 1RUI3 2WL1A 3SH5A 1OVPA 2JG9C 2KA3A 2RDSA 2D6OX 2AREA 2ZABA 1VMFA 2E7QA 2DF7A 1MQTB 4LXLA 3ADYA 3PUSA 2R061 1MZFA 3PDQA 4IQPA 4Y4YA 4HPKB 5JVVA 5JMCA 1UXZA 4ZZ5A 4EJRA 3OPTA 1JUIA 5A6YA 1RITA 5JOYA 2N7GA 2W0XA 2RDRA 3T2OA 3AKSA 1S2KA 5FZKA 2XH6A 1KQRA 1ALYA 3DGTA 4V2VA 2BVBA 2F6BA 3NJYA 2D6LX 1VAVA 2ZOEB 3FX3A 3WHTA 1AL0G 2QQNA 4MGTA 1RUE3 2TBVA 3WD5A 5LY1A 1MEC3 2BGCA 3C3VA 1A8DA 1AR71 2I2SA 1UY1A 3DKWA 4MHUA 5FIXA 5FV3A 1UIJA 2D1UA 1OD5A 1W99A 2WFF1 1Y3TA 2PLV2 4QX7A 3KV9A 4Q4W3 5E88A 5FZ9A 3VBRB 3E6BA 4AOCA 5FBZA 3WG4A 3S30A 3H9AA 2VC9A 2YBPA 5HV4A 1Q43A 4Y26A 2A3XA 2WYFA 1FPN2 1IS5A 1SEFA 3EJKA 5LRSA 1PM4A 1DU3D 4QQPA 4IEVA 1NCQB 4PBOA 3ZYGA 4FPJA 4LBNA 1G9FA 1D2SA 2W52A 1PGW2 4LBKA 5C5UA 2VOKA 3ZO0B 3F95A 5C5TA 2GP5A 2BERA 2NYYA 3E1F1 5BV6A 1W6QA 1ZZVA 1FAYA 4WM7C 1SCSA 1W8NA 2JG8B 1AR83 2EXIA 1YQ2A 1X82A 2DU0A 2R072 1NZIA 2XXZA 1FMD3 3T09A 1W2AX 3VBRA 2XGXA 2Z2SB 4RYDA 4EN9B 2Y6JA 2ZHLA 4TN7A 3INAA 3LZZA 4QHOA 2ZHNA 1JS9A 1VRH1 4NIGA 3UJQA 4G3YC 5B4XA 1EAH1 1H1AA 2PELA 3X29B 5CAZA 3N7MA 4RFT0 3ZOIA 3JBG2 2JDNA 4KL1A 5A7PA 5JXJA 4AWDA 1SDWA 3UGGA 4P08A 3C7EA 4XF4A 2OQ7A 3LEMA 5L9BA 2ZGNA 3MO4A 1W8ZA 3W20A 3AYEA 4JRAA 1DYPA 2QTWB 2RR13 1H9WA 1VMJA 1RINA 3AMQA 2LUWA 1OH4A
chains in the Genus database with same CATH topology
1YHFA 2GDFA 3AJYA 3BODA 4AVAA 2JKBA 1O91A 1RHI3 1VLNA 3EBRA 3VKLA 4Q0PA 5KHGA 1ZZCA 4AW7A 2ZX0A 4LHKA 4CDUB 2OW4A 3WP3A 1PM7A 1R093 4QX5A 4XOGA 1RC6A 3B02A 4OI2A 3VGIA 2R32A 1QQP3 4FTBA 3WHUA 2P3JA 2ZBJA 3GZUC 1CPMA 3WR0A 1GICA 4RGGA 3VLBB 4OUMA 1NCRA 3ZXEA 4BM8A 4CEYA 5DZFA 1ULDA 3FFQA 3BIWE 3VBSA 4AVCA 4Q4V1 3DPRC 3M4FA 2YC0A 3MF6A 4QU2A 4F8AA 4Y20B 4KWKA 4L11A 4L8QA 4DRRA 1LJ7A 2QE3A 2BYVE 2EXKA 4EN7B 4X6QB 1LHVA 3HBZA 2HWF1 3NV2A 2XJRA 5J96B 4XXPA 5EYYA 4QM9A 2XJQA 1O3RA 1H4GA 3VKNA 2YDEA 4LHLA 3FMGA 5KXEA 1O3QA 3C2UA 2D7FA 1JW6A 2H0VA 5FTTC 2D43A 2L4WA 4AQTA 4Q4W2 2HWE1 1KDKA 1CAWA 4C0HA 4N43B 1HW5A 3GBFA 1W6PA 2A70A 5FPXA 2CAVA 5C4WA 3EQEA 1KFUL 3EHKA 4N9HA 2FMDA 1CAWB 1SBDA 1R081 1ZA4A 3A0NA 4LO4B 3WLUA 5BNOC 4AQSA 5T54A 3IWZA 1V9U3 4G08A 3THTA 3RYRA 3D5OA 1LB2A 1WUVA 3RJRA 3LA7A 1G8WA 2R0FA 4BMEA 1EPZA 1LKNA 5ABJA 3W59A 2XWJB 2VY0A 1B35A 2ZHKA 1BBT3 5CU1A 3JBG3 1HRV3 5CA6A 4N43A 4I2OA 2HWB3 1TME1 3OGJA 2WNVB 4FAGA 3GHNA 3R0RA 3BB6A 5I8SA 3ZYIB 3ZFFB 4XF3A 3LCPA 5HCAA 2I74A 3RDIA 4Q1RA 2DV9A 1H8TC 1QH7A 1JOJA 1X50A 3B69A 1HRI2 4K1YA 5C4WC 3O7OA 1MZEA 1AR61 1LESA 4QQHA 4JTMA 4BYYA 4Q4X3 4XFCA 1AHSA 4Q8LA 3I8TA 4GULA 5T5JA 3UKTA 4ISRA 4Q4Y2 3SMHA 2QKDA 4YW1A 1RJ8A 1ZREA 4PLNA 4Z8BA 3USUA 1H8VA 3AFGA 4CZSA 3ALQA 3HIFA 1LOBA 4R52A 5IK8A 3WP4A 2ZGQA 1J3RA 3J9SA 3KGZA 4IV3A 2H6BA 3H8UA 2A02A 1CAVA 4Q26A 4PIXA 5FMOS 1Q8OA 2GU9A 5C9AA 2WSVA 1QJX1 4GWNA 5AC91 3IN9A 1R1A1 4I3PA 5KXCA 3UJOA 2DCYA 1F5JA 2RS33 3ZFEA 2WNUA 3B93A 2GC0A 5E16A 5FO7B 4H7LA 3RJ2X 1POV1 5ABJC 3NW4A 1DFQA 3VBRC 2VG9A 2PAKA 3M3EA 4YW5A 1COV3 2X5IB 5GLUA 1JYIA 4Y1XA 4MVTA 1S0EA 1O4ZA 4CEYB 2D97A 2B8MA 4YG0A 1S0JA 4LO6B 3BPZA 4C91A 2IWGB 4QGLA 1RUH1 4KWJA 4BA6A 4PDWB 1NCQA 1W6NA 3PTYA 5CIRA 5D8AA 1YXWA 4WM7B 2DCZA 2Y26A 4AXOA 1ZBA1 5FOBB 4Y22B 2Z79A 4Q0SA 1DBNA 5SV5A 2RS51 1RUC1 5F6KA 4XTPA 3WQ0A 1NA1A 2GNMA 1NY71 4IESA 3AP9A 3M2MA 2WZPR 3ZYRA 1LHWA 1SBEA 5BNNA 2VNRA 4MXVA 2DVGA 2B5HA 1DQ4A 1ZBE3 4YVWA 1ULCA 2UY8A 2OZ6A 3DF0A 5LK7B 3VBSC 2DFBA 3O5SA 4PCRA 3LAGA 4YG6A 4DRVA 5KWRA 1J3PA 1YIFA 4IV3B 1Z0HA 3ZXDA 2D98A 4YW3A 3VZMA 5IT6A 1ZRRA 2QVSB 1QMJA 3ENRA 3QACA 2ZTNA 4YZ3A 2VU9A 1K28D 3FLPA 5L7OB 2ZGLA 2VVEA 2WINB 2R071 1QKQA 1WCKA 2EALA 2IXCA 3A4UA 2MHFA 3ZYJB 1LGCA 3PHMA 5I8TA 5KXDA 3VBUA 4UW5A 4E4ZA 2D40A 5H9QA 1QJY2 2HEYF 4PIZA 5J7MA 5T55A 5F9TA 1PMIA 1PVC3 2C0ZA 1G86A 3JD71 3OD4A 3M7AA 4K7JA 5JSPA 4CDWA 1UMZA 3VKMA 1G9BA 2HKXA 1O3TA 1O5LA 1Z7S1 2CWSA 3RI8A 4PDWC 3DN7A 2R063 1G9DA 1RMU3 4FPLA 4S2FA 5ACA3 3FLRA 4YZ5A 3NVCA 5CNAA 5JIUA 3SCHA 2DVBA 4D3WA 4HKWA 4XZPA 3NKGA 2JEMA 1HQWA 3NO8A 4YLZA 3ZFFA 3VL9A 2HEWF 3J8F3 3LSDA 3EO6A 4O9GA 4QGMA 2RS52 1FV2A 3LSEA 4D94A 1Q8PA 1BZWA 2O8QA 3AYAA 1G6NA 2IXKA 4HKLA 3E97A 4AHZA 4RS5C 4LBQD 3CF6E 3H1YA 4BWOA 4ATEA 4BMBA 1UU6A 4MGKE 3JB8A 4XQWA 3MGUA 1UF2C 2VNGA 2RS31 3WDUA 4S2HA 1WCSA 3OBRA 3WW3A 2W6TA 5I0RA 4WVWA 2V73A 1GSLA 1U12A 3QCWA 1MS9A 3ZN6A 2VQAA 3V56A 3O14A 1H9PA 1BXHA 2WFF3 4GKYA 1AR93 4UBHA 5ACA2 1MS5A 3OYWA 1ZZ6A 1CONA 1RUD1 4IEXA 1Y9QA 1ASJ1 5IK7A 5L19A 3ACLA 4F83A 4NN0A 1MZ6A 3HR9A 3HN1A 5A33A 4Q29A 1AJOA 2EVXA 1DQ6A 1JBCA 5CFDA 3WW2A 1VP6A 4K6BA 4QQLA 2ZCWA 4XTMA 1A6CA 3UL2A 3LA3A 1CR7A 3POWA 3AMPA 1CIWA 3ILRA 2PHRA 2OYZA 2PHTA 4HMZA 1RUF3 3V0BA 2AR6A 2DUOA 1W0PA 3EXUA 2M5JA 2FHRA 2TNFA 1JUHA 4RHV1 5GZGA 5CG8A 3M3QA 1RIRA 1HX6A 1WBLA 3VKOA 4LE4A 2BFUS 4AE2A 2DYCA 1TMF1 3M8LA 2YXSA 1AXZA 5I93A 4JGZB 3ILNA 3ME2A 5I0SA 1C3HA 1Q56A 1LODA 5IK4A 3VHNA 1FV3A 4GMP1 2CGPA 4KGGA 3AKPA 1B35C 3RMYA 1PIV3 1HRI1 5FFOC 2C9AA 5C9AC 4LBJA 4CDWC 4FBFA 3SNMA 1PGL1 3H0OA 4Q4Y3 1UIKA 2LALA 4LBOA 1DGWX 1ZBE1 3SCGA 3CL1A 4MH0E 2A7AA 5FREA 4HVOA 4Q4X2 4Q1PA 4ISQA 4ASLA 2BBVA 2XLAA 1HDKA 2RMU1 2DWRA 2PHDA 1VBD2 3CEWA 5BYNA 1HQLA 4JRLA 4DY3A 1D2QA 2QCSB 3VZNA 3U0ZA 3MPPG 5FO8B 2JG8A 5CBLA 3N4MA 3ASIA 2I45A 3Q9OA 2E7AA 1FYUA 3QD6A 5GLVA 5L7OA 1X7NA 3VBOA 4WM8C 1AR92 4EN8B 3ZSKA 1VB2A 2HWD2 4XE9A 3IIAA 3VHRA 2D5HA 2R043 3NL1A 2PHLA 3H1MA 4L97A 2VMGA 1UCXA 5CFDB 5A3LA 2IZWA 2NPIA 3AM2A 3PVBB 1PVXA 1HV0A 3TN93 1DGRA 2X53S 2YGMA 1YLLA 4BIOA 1YI7A 3WW4A 1BYHA 3MFCA 1WW5A 2EA7A 3OY8A 5BNQA 4X8PA 5J37A 4KGQA 3ROUA 4WZFA 2HWB1 3U10A 2NLRA 1V6JA 1VRH3 4D7TA 2BWAA 1R1A3 3RMXA 2GNDA 2WS93 4KNCA 4LEJA 4AFCA 1YWKA 1H2KA 2UWAA 4KWLA 4U36A 4LR4A 3WQ7A 4WV8A 3OCPA 4FOVA 3SXWA 4M01A 3TNPB 1XQNA 1NCQC 4Q8KA 4OHVA 1GZ9A 1RB8G 5C9AB 3NV1A 5HCFA 1PGL2 3AP4A 3POSA 3NAPB 2R042 5JDBA 1W39A 1O4TA 1RUC2 1VBC2 3A0KA 5CVRA 2VMIA 4KU8A 4YM1A 2AYHA 3GZTB 1ZNPA 4CP2A 5HCBA 2XKOA 3WNXA 2UU8A 1Q8QA 3U07A 1PGW1 4ITCA 3T1MA 3AMHA 1SQ4A 1QJU2 4XHXA 4DPNA 1F31A 1KS4A 4FXGB 2XBO1 1AXKA 2Z69A 4FOYA 1LOAA 2VMHA 3UKVA 5BNNC 5GLTA 2JECA 1RVF1 4B4QA 5K0UA 1VRH2 4C0BA 1RUF1 3AYCA 3GZAA 3H50A 4WM7A 3KS7A 3FBMA 1NA1C 4FPGA 4RHV3 3ATGA 1H2NA 4PIYA 1ONAA 1BBT2 2DCKA 1BVVA 3I59B 3N7LA 3PMSA 4E2QA 5A32B 4IV1B 5JCTA 2DU1A 4HKOA 1QOSA 1U5ZA 5LEJA 2VOWA 4L2NA 1JN2P 3G7DA 3LGRA 3RNSA 1XXNA 1IZ3A 1OHFA 4HK9A 4Z2WA 1QJY1 1ENXA 3ZSMA 4DNYA 2GC2A 3MLLA 2PHUA 4JVAA 5I0UA 2JXAA 2KM2A 2R1DA 4DQAA 1ASJ3 4XPVA 4Y20A 1OFNA 3ZDSA 4B7KA 1EV13 1R091 2OPKA 5H9SA 4AF9A 4DB5A 1PO23 4E2GA 2HWF3 4ZKTB 2EIGA 2R062 4I3GA 2WZR3 4MGIE 4XMIA 1PK6B 1XYPA 2V09A 3JQWA 4B8EA 1DGLA 4NWVA 1NYWA 1YFUA 5J48A 2VGDA 2HWC2 1KD7A 4OZXA 5JLVA 4D7SA 1SFYA 1KS5A 4XFFA 1WW7A 2ZAHA 1H0BA 4M3CA 2Q4SA 2IAHA 1YO8A 1Q8VA 2B9UA 4IV3C 5CFCA 1JXNA 3GBGA 4EN0A 3IT8A 1MR5A 1DQ2A 3AZYA 3OGGA 3MZHA 1JTZX 1REEA 4QHBA 2RS32 1FPN1 2YHJA 3CO2A 3ZN4A 2XPJA 4LLFA 2RMU3 4R9DA 4XF1A 1D4M1 2E9QA 3FE5A 2ATFA 3WCRA 3LWCA 4RQPB 3WDVA 4Q27A 3ZYPA 1V6IA 1V9U2 1OQ1A 4XIKA 5J98B 1DQ5A 1YYNA 4Q4Y1 4QT6A 3HQXA 3GBWA 2EAKA 4XEZA 2P17A 1N47A 1ENRA 2NN8A 2JG8C 1AR63 3MF9A 1BBT1 5ACA1 5C8WA 1RUD2 4LTAA 4TYSA 1GYKA 1XU2A 1AX1A 2WLQA 1CX4A 3AMMA 4Q2FA 4I0AA 2BQPA 1ZZ9A 3JD73 4WVVA 4KBBA 3D8CA 2D44A 3N36A 3J8F2 2PQQA 3RYKA 1CAUB 2BVVA 5KHHA 3PVOA 1Q3EA 1SLIA 2LTNA 2FBEA 4DINB 2HWE3 2VUJA 4FVVA 2ZGRA 3JB4C 2TEPA 3BU7A 1IS3A 4M3CB 1HRV1 2H0BA 1EPWA 2GSYA 3N3HA 4A7ZA 3LOBA 4EN6B 3LA2A 3ZSJA 1AYM2 1OFSA 3ETQA 3OBTA 1ND3B 2A75A 4N53C 1DDLA 4FOQA 5HBAA 3S6PA 4NOTA 3O0XA 2B42B 4KG0A 1PO11 3WV6A 2VVFA 4FCAA 4XBNA 1AR62 1H2MA 2XLFA 2A6XA 1QF3A 3SITA 2VW2A 1LR5A 4B3NA 1L3JA 1Q5OA 2QNKA 3CJIA 1X36A 3PMEA 5FLIA 3HMYA 3PJYA 2VUAA 4MXWB 3UK9A 4ONUA 1O5UA 2D5FA 1OOPB 1D4M2 3VUOA 1COV1 2O5PA 4BH9A 1TE1B 3H3ZA 1RGSA 2BNOA 2WNUC 2PAEA 4MLOA 2X5IA 4QPIB 2PAMA 1MACA 1H1IA 1QWRA 4HSJA 4YGCA 2WJSA 1BEV3 2ZX1A 1OKQA 1C5HA 1UPSA 3KMHA 4YM3A 1UU4A 4MYEA 1ENSA 2X8KA 1QJX3 1MS8A 4WZCA 1RHI1 4JCKA 1KDMA 5JWPA 4AGGA 3FWEA 3FUOA 1BK1A 1PZ9A 3AXDA 3U11A 1GQHA 5T5OA 1OLRA 1RUG1 4COVA 2GC1A 3VZKA 1OA4A 4CYDA 5DG2A 3OPZA 4LA2A 2QUOA 1R082 1LHOA 2VW0A 1PVC2 1YRZA 3T2TA 4K20A 3GYDA 1C1LA 3E6DA 1EAH3 1LRHA 3NSTA 4W6WA 1AX2A 5JSOA 1GKBA 3UV9A 1S0DA 3JD72 5FCCA 5CB7A 1FXZA 4YRDA 1ZBA2 1QJZA 2XVLA 2FMYA 1FT9A 4XQDA 4JGYA 4A7KA 2B7YA 4YZ2A 4H3WA 1ZZBA 3IDBB 2GC3A 3ZXFA 4GB32 1V6LA 3N7JA 1S55A 1BCXA 2CGNA 2BW8A 4I0BA 4PDWA 1MQTC 1WMFA 4RL7A 1PIV1 1MS4A 1SFNA 4IV1C 3AKTA 4E9KA 3L2HA 4OULA 1YI9A 4HK8A 4SLIA 4RR3A 5C4WB 3B9IA 1QH6A 4HFSA 5KHJA 1B09A 1GZWA 3ZFGA 1VBB3 3NV3A 1AYN2 3IKWA 4C90A 4K1ZA 1S0BA 4WM8B 2XG3A 5T5LA 2VECA 4LUMA 2OUHA 1BKZA 4AQ6A 2PHXA 4N7UA 1M4WA 2W08A 1AR82 2R073 1QJU1 2SLIA 3IPVB 5GZDA 3AXEA 5C8CA 1LHNA 4ZU7A 2VXRA 5KHKA 4FTEA 1D0GA 1VBB1 4YVSB 3RI9A 3OTFA 1O3SA 2X29A 1LU1A 1LOFA 1NLRA 3KSCA 4MV2A 2XWBB 4ATFA 1R1A2 5BNPC 4AVSA 1DHKB 2RJKA 1Y43B 2MPFA 5KBFA 3B9CA 3KT4A 1A3KA 1ENQA 2VW1A 3AYDA 4H14A 1ASJ2 3SISA 4XJZA 2VULA 4Y1ZA 4AEMA 3NAPA 2Q1ZB 3KD4A 4XW3A 3GS9A 3MLJA 1WGPA 2VH9A 2ZAAA 4QQOA 2ZX4A 4YM0A 2K0GA 1AL22 4BE3A 1H1MA 5DG1A 4AI3A 1FOD3 4FPCA 4XFBA 1J1LA 1VALA 4CEYC 1C8M1 1FX5A 5K8SA 1W6NB 5J36A 4NPRA 4QXKA 1R092 4FOWA 1ZBA3 1PZ7A 2D3SA 2WNVA 5T50A 2AENA 3MIBA 3M70A 2ZKNA 4DXZA 3AKQA 4MZUA 4Y22A 1FNZA 1UKGA 2W39A 2ZA9A 4P9WA 3RWNA 5FLJA 3IBMA 4HN0A 4YARA 2D93A 4RSUA 1GZWB 1WLWA 1AYN1 2P2KA 1DIWA 3L2YA 1VB4A 1VAMA 2XJUA 3D0JA 3WP5A 1F9KA 1QY4A 4XF9A 3ZSLA 5JPMB 5D1IA 2RR11 5FQ0B 3VKFC 2Y0OA 4HLTA 4N7IA 5BY5A 1LGBA 1N1SA 4N53A 4XXAA 3WT3A 1WMEA 3N35A 5E89A 2WT2A 4GMP3 2O8OA 3VBOB 4NWWA 4LBQB 2F4PA 4ES9A 4P9LA 2RJLA 1NE4A 1C8M3 2UYAA 3M3OA 2DCTA 2RM21 4R9CA 4KU7A 2ARXA 4XFGA 1OOPC 4AFAA 3V64A 1TMF3 3JQXA 5EZWA 2GN3A 1W6OB 1WMDA 1U5IA 5KC6A 2NP0A 4LT5A 3SH4A 1LOGA 4OHYA 5T5PA 4EWEA 1TNRA 3KGLA 2B45X 2UY9A 1NXD1 1H8TB 1OLQA 2MEV3 4LA3A 2YGLA 4QGNA 1QXJA 1BMV1 5HI0A 4R4ZA 5H9PA 4HPKA 2G9FA 4RHV2 3IDEA 5D8AB 5KHIA 1WW4A 2ES3A 4ORFA 2WA4A 4Y24A 1DQ0A 2GMPA 2WNUB 4QPIC 4QPYA 3VBFC 1QXPA 2RE9A 1NLSA 3QH7A 4PQ9A 4WVMA 4E2SA 3UKNA 1AYM1 4AFBA 2WQ4A 2FQPA 3RPQA 5FRAA 1LULA 4XFHA 2Q1MA 3T1LA 2GN7A 2ZX3A 1LENA 3VBHB 3V0BB 3JCIA 5GZFA 1KFXL 1GBGA 1YFYA 3DV8A 1LHUA 1ULFA 1UN1A 4NHMA 2D6NA 2ET7A 2C1FA 3BCWA 4O9EA 1ND2B 2JG9A 4URTA 3WUCA 4JTNA 4PF5A 3CJIB 5CFCC 3MW2A 1CPNA 1M06G 1REFA 4RQPC 1BVP1 1J3QA 4IV1A 2AGSA 1TEIA 3KT7A 2UWCA 4LBLA 4MX3A 3WZ1A 4YVWB 3FHIB 2NZ9A 1SACA 2D6PA 1UAIA 4XMAA 3OF1A 5GZEA 4YNIA 4BZ4A 3IMNA 5DZEA 1AR91 1ULGA 1O7FA 2Q0AA 1N1YA 1IGOA 3URFA 1X8MA 3BOPA 3MIEA 2ZX2A 2YY1A 3AKRA 1MVEA 1NZCA 1YUDA 5F1RA 1VAKA 2XJTA 1MS0A 3E5UA 5FOJB 5T3NA 5JIAA 3TN92 2ZS6B 1N1TA 4META 4XBQA 4IETA 5I0TA 3AZXA 5JZGA 3FZ3A 1CAXB 4J6GA 1XNBA 4Z1VA 2ZMLA 4QPGA 3KZ4C 1VBE2 4AI2A 4TLFA 3DPRA 3WG3A 1FOD1 1RUI2 2NQYA 3ZVXA 3PVNA 1K5MB 4N90A 5E1RA 4LE3A 4KQ7A 1VR3A 1KITA 4AGVA 1ND3C 2QQPA 1X8EA 3IDCB 2E51A 1EY2A 3ZN5A 1OMIA 3R4SA 3NAPC 4QPGC 3KCCA 4IEUA 4COZA 4FO9A 4AFDA 3HAGA 3VDDC 4JV4A 2KXLA 4R8HA 3VBHA 2Q8OA 2W78A 1SLBA 3MYXA 4YG3A 2X5IC 3VZOA 4CP1A 3MLKA 2W68A 1PZ8A 1WLCA 3D6EA 1BEV2 3ES1A 4AI8A 3FBYA 1UD1A 1NQJA 2ZPXA 4CDQB 2PLV3 5L73A 4C1XA 3MDPA 4ES8A 2JX9A 2E53A 2GMMA 4HSLA 3ZN6B 1CVNA 1S0IA 2E6VA 3NV4A 4CDQA 4CEWB 1RUOA 2HWC1 3TNQA 3USUB 3VBUB 1ZBE2 3HT1A 1XRUA 1QDCA 1WD4A 2YROA 2PHWA 1OPOA 1GANA 1SCRA 4IEOA 2QJVA 2BPA2 2XUMA 2XBO2 3ST7A 2D6MA 4COUA 1RUNA 2BTVC 3AP5A 4P9YA 1JYCA 1C57A 1OA3A 1RVF2 1W6MB 4MSVA 2ZJCA 1FI2A 2WKKA 1MVQA 1QHDA 4F7ZA 4IEWA 1G7YA 1OA2A 3TWIA 4FP2A 4GWMA 1SLTA 2RS11 1KRIA 5DUXA 2QZ2A 4LBMA 1LGNA 2ZGUA 3ZPYA 2WC2A 4LO5B 3ZMNA 1R083 2VOVA 2ZKLA 1NE6A 4AK3A 2BNNA 4FQZA 4Y1VA 4AEJA 4RGAA 1VBE1 2CL2A 4YW4A 1RUC3 3VBFA 2GH8A 3OY8B 2R49A 4YFZA 4JQRA 1DGRN 2ZZJA 2GNTA 3E6CC 1LOFC 1DZRA 3APBA 4K21A 4YSFA 1AL21 2ENRA 5GKAC 5BXXA 1UU5A 4YGEA 1RUJ3 3WXPA 2HWB2 2OUJA 5EYXA 3S0MA 1SBFA 2FZ1A 4W6YA 4XETA 5GJ6A 2VOXA 3VBOC 3U4XA 2SBAA 4YYOA 2OVUA 2A3YA 1GFF2 1ZRCA 3V0AB 1KXGA 1D4M3 4G4FA 1NY72 4XILA 5FQ0A 1HRV2 3ZXLA 2IXHA 4DOUA 2W77A 2R0HA 2VQ0A 1IS6A 2XHKA 4H55A 3OYWB 1J58A 3B7MA 5SV8A 2FZ2A 1C5IA 1CD3G 3NWKA 4BHPA 1SLCA 2R30A 2R041 1TME2 5DDJ2 1DF0A 3CU7A 2DVFA 2XLGA 4JGZA 4COWA 1YFWA 1DQ1A 2IFWA 1W6QB 1H30A 3THPA 3ZXKA 3V0AA 1HLCA 2RR12 3M3IA 4P9GA 5BPXA 4EWDA 4JGYC 1FMD1 4YFWA 1NXMA 4L9BA 3KQRA 2BFUL 5BNPB 3CJIC 5CFCB 1UW8A 4WVMB 2QZ3A 1RUJ2 2P3IA 4B4RA 3FLTA 2W75A 4D7YA 4ZU5A 2UYBA 4PLOA 4JGZC 2QDRA 1ZYBA 1NA1B 4HT1T 4RA0A 5EV7A 2D3PA 3EZJA 2WWSA 5I91A 1GNZA 3B94A 5F6LB 3RSJA 2NMNA 3ECQA 1CGPA 4G9SB 4UW6A 2OIIA 4OHZA 1HKDA 2XVKA 4AHWA 1RVF3 4AYUA 3ZMOA 3ZFGB 1XYNA 2B46X 3H1WA 3BOWA 4GIQA 1ND2A 2JG9B 1KJRA 3OV5A 2UURA 1DG6A 1MEC2 4HVRA 5E8AA 3ZSEA 4DMIA 5FO9B 3AX4A 5H9RA 3W58A 5IK5A 2IFRA 3ILFA 4M00A 3ZXJA 2RS53 4J1WA 1V00A 4V1PA 1U5YA 4K9SA 4F3JA 3KM5A 4B7EA 3MEPA 4P9XA 1BJQA 3ZIXA 4KG8A 5FMOL 4FPKA 3I54A 3I7DA 5AC93 3POYA 3B01A 1CAXA 1RUE1 5FLHA 2RS13 4NVPA 1XYOA 3VDDB 2CV6A 4I01A 1C28A 4I02A 1K5MC 4BOWA 1XNKA 2GNBA 4M0NA 3NKTA 4YZ4A 1LECA 1EV11 4I09A 1A78A 1B35B 3G6JB 2Z6BD 1AZDA 4CTEA 2W76A 4QPGB 4UXAA 4CDWB 3MICA 1V6NA 2JE7A 4AI0A 4D69A 1ULEA 1S2BA 2XL7A 1AUYA 4RD7A 4BCUA 1UX6A 1QNWA 1K5MA 3TB0A 1PK6A 4DS0A 5DDJ3 5AC92 1J59A 1PGSA 4EWAA 2GALA 4HZFA 4XJUA 1VBE3 3TN91 4NR1A 1QXRA 1RJ7A 4CDQC 1VIWB 4FP3A 4TZDA 4AR0A 1ZX5A 3R4UA 3VBFB 3WDWA 4Q4V3 3VN4A 1YNAA 3VBUC 3GR5A 2XJVA 4Q0VA 2A73B 4CEWA 1AJKA 1AVBA 2Q30A 5AFEA 1DZQA 5LRRA 1POV3 1TMF2 2ZGSA 1QQP1 1SLAA 3OD0A 2ETEA 1AL23 5C8CB 4TSVA 4L92A 4AHYA 3O0WA 1LU2A 1EP0A 1ZVFA 1ZZ8A 1C1FA 4XJAA 3HD8B 1N3OA 4B4PA 2WQZC 3FC0A 4YM2A 1ND2C 2BNMA 1QNYA 2GZWA 4J1XA 3AFKA 4FPHA 1D0HA 4ZU4A 2ZZQA 1ND3A 3WDYA 2XL9A 4Q0UA 2C5DA 4AQ2A 5EJ3A 3AZWA 2AH2A 3MIDA 2JJ6A 1MZ5A 2DTYA 5KC5A 4M3CE 4ZXKA 1E57A 4RR3B 4XJ8A 2H6CA 4Y1YA 4AEDC 1WBFA 3CJXA 1KJLA 3WY6A 3D82A 3L9JT 3I59A 4BPZA 2IXIA 1BQPA 1U5XA 3O12A 4BLJA 3VHOA 4P5HA 4JC1A 4K8FA 4JDNA 4XF0A 2JE9A 3B5LB 2VVDA 4LO8A 2K2SA 1EV12 4S2DA 1AR73 1NQDA 1COV2 2WFF2 1AR81 2CY6A 4U2AA 1H4HA 2CWMA 4FPFA 3ZX7A 1W6MA 2HWF2 1Z78A 4E27A 4GQ7A 4IL7A 1IPJA 1OQDA 2P3KA 3TAYA 4XJWA 1IPKA 3WVJA 5JOWA 2D6KA 1GQGA 4YVSA 4UW4A 5HXVA 4R4XA 2YUEA 1FPN3 2HYKA 1CQ9A 3GNEA 2ZGKA 4HBNA 3JU9A 4XFAA 2JICA 5A3MA 2W6UA 1RUF2 4X6RB 1JHNA 4Q4W1 4RQPA 2RM22 1YIPA 2DFCA 1OSGA 2XJPA 4AEKA 4YGDA 3W9AA 3MFAA 4AVTA 4CP0A 1MQTA 1W2UA 3IM0A 2IC1A 1LEDA 2JENA 4QMAA 3H7YA 2EXHA 1VBA1 4CDXA 4HETA 3KT1A 5L36A 1UZZA 3AZZA 4CDXB 1OQEA 3R4DB 4CRQA 2A6ZA 2WZPP 5BNPA 1RMU1 1V6KA 4TWTA 4GB31 4AVVA 4OUSA 1GV9A 5JPNB 1IS4A 1QDOA 4AG4A 2HJIA 1W0OA 3SCFA 5JSRA 2Q5TA 2ZHMA 1N1VA 1HQNA 4YGBA 4OLLA 2GAUA 3KCXA 3R05A 2MNGA 4FXKB 5DDJ1 1H2LA 4FSJA 5FAXA 1GNHA 2I07B 5TSWA 3J4UH 1T6GC 1SLLA 2DTWA 4QQ2A 3LKJA 3D4KA 1R1ZA 1URXA 4IEPA 3CNAA 1N3QA 2B39A 1YFXA 2CTVA 3QBQA 1XE7A 3ZXGA 2ARBA 4OI1A 3WDTA 1RUG3 5F5QA 2Z5WA 4YZ1A 3ZIWA 1LOEA 4JTOA 4YVSC 3MPBA 1XNCA 3AP6A