4M0PA

Crystal structure of human prs1 m115t mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
304
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANTLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
total genus 93
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA02
1I5EA 1P17A 5K51A 3S5JA 1P4AA 1HGXA 3MJDA 2YZKA 5BQPA 2H08A 5HKLA 3H83A 5JSQA 1ECJA 4LZOA 4PFQA 3KB8A 1FSGA 2P1ZA 1W30A 2PRZA 2GEBA 1A98A 2DY0A 4P80A 2JKYA 5E38A 4M0KA 1I13A 4MB6A 1ECGA 4RV4A 2EHJA 1ECBA 1QCCA 1QK3A 4S2UA 2C4KA 1J7JA 1JLSA 2JKZA 1U9ZA 1VCHA 1A4XA 1P19A 1PZMA 3OZGA 4WMLA 5BQOA 1XTVA 4IJQA 4JLSA 1VSTA 1R3UA 5JV5A 4ZFNA 2JBHA 4QYIA 1MZVA 1YFZA 3DMPA 3LPNA 1ECFA 1OREA 4LYGA 4PAWA 4X45A 4RQAA 3LRTA 3ACDA 4QYIB 2VFAA 1ZN7A 4QRIA 4OHCA 1DQPA 3M3HA 3HVUA 4F8EA 1L1QA 2PS1A 4LZAA 4RHTA 1V9SA 1L1RA 4RQBA 1G2PA 4RHYA 4P81A 1TC1A 4X44A 5EUCA 1OROA 1IBSA 1ECCA 4TWBA 1A95A 3OZFA 2AEEA 1QK5A 4Z1OA 1O57A 3MBIA 2H07A 4P3KA 1DBRA 5ESXA 3ACBA 2FXVA 4RAQA 4FYMA 1OPRA 4LYYA 2HCRA 3O7MA 1DQNA 1HMPA 4WN3A 1BD3A 1DKUA 3QW4B 3ACCA 5KAPA 1U9YA 5IPFA 1GPH1 1BZYA 1UPFA 1A97A 1LH0A 1A3CA 4RHUA 4RHXA 1GRVA 3DAHA 5BRNA 5IAOA 1XTUA 1G9TA 1ZN8A 1I0LA 3DEZA 4P83A 1CJBA 4P86A 1ZN9A 2H06A 1XTTA 1VDMA 1Z7GA 1UPUA 1I14A 2E55A 3OHPA 3EFHA 1QCDA 1JLRA 1I0IA 1XZNA 3GGJA 4M0UA 2PRYA 1NULA 1QK4A 4RACA 1DKRA 4LZNA 1QB8A 4JITA 3GGCA 1AO0A 1BD4A 1G9SA 1WD5A 3GEPA 4P82A 4RABA 1O5OA 5KAMA 1TC2A 4P84A 1A96A 2XBUA 3NAGA 4M0PA 4RANA 3G6WA 1XZ8A 3N2LA 1G2QA 1D6NA 5BSKA 1QB7A 1NONA 4RAOA 1UFRA 4KN6A 1P18A 5ESWA 5HIAA 4RADA 2JI4A 2WNSA 1STOA 1Y0BA 2IGBA
chains in the Genus database with same CATH superfamily
1U1EA 2AK2A 4BMNA 2HRZA 3O03A 3NNSA 4ZZ0A 2HOQA 4P5DA 2JKVA 3E81A 3KQSA 1TCCA 2BZSA 2CNLA 3AKEA 4Y2PA 1Z2PX 2FJ0A 1KFCB 1VZ3A 2H0AA 2G17A 2RAUA 2CNBA 1ZC4A 3CT6A 4TL6A 2OQVA 4CNQA 4P2BA 2HRBA 3ZHVA 2J3EA 3U9LA 4EMSA 3K9FC 3FIUA 3T9EA 5FOXA 1C14A 4V0NA 2V7EA 1MC5A 1O9GA 1EX7A 1VGQA 2D2EA 2JH8A 2YQ4A 2FW7A 4CMKA 1MJFA 2QVLA 4GXNA 1KK3A 4H3VA 4MS4A 5KKCA 3FOZA 3GRVA 2J87A 1JWAB 3DZCA 4HMOA 4MUBA 2GPBA 4Z4HA 4WMLA 3BEDA 3FWHA 4IR7A 1N2OA 3RSQA 1J0DA 5EIFA 2FMUA 3PNMA 4C14A 1EZZA 4BLOA 2BV3A 2F2TA 5FAKA 3GROA 4MDHA 3HU3A 2P6NA 5HFAA 1U2DA 3FHTA 2L82A 3NGMA 2IS2A 1YCFA 5I5EA 3PDIA 4YUWA 2PL1A 4AP9A 4H27A 1VLVA 2HMUA 2NZWA 3FG9A 3HSKA 1ULBA 1UPCA 4BP1A 3COJA 3U4DA 1Z29A 4EMTA 3TZHA 4NCXA 1WXEA 3LWNA 3N58A 4R2JA 2NO1A 1P5FA 2XY4A 3T94A 3ZE0B 2A8YA 4PAOA 4NJEB 3T06B 3DO8A 1HL7A 4GSLA 4LUCA 3V7UA 1Q20A 1N6HA 2IITA 1Z26A 3BA6A 4UNRA 5JU6A 1F38A 4XX0B 3BYZA 3JQCA 3KQVA 3QI2A 5BV8A 3SR3A 3M4NA 1E99A 2DQKA 1ADYA 1LDMA 1REQB 1FUKA 1C0EA 5FDFA 4FU0A 4PYOA 4DY6A 4CGZA 3L0ZA 3MBIA 4AZWA 1DRUA 1Y6FA 2DBZA 3FAZA 4TTQA 2E87A 3DKPA 5HGJA 2FZCA 4RGQA 3V6MA 3EODA 1J99A 2ZJBA 3FYSA 3K6JA 4QOGA 4LCJA 1M0SA 4YAOA 2GHIA 3PYLA 1XEWY 1V7ZA 4OHWA 3O8OA 2AR9A 2CXSA 4HLUC 1MX5A 4IEFB 2I66A 3LM8A 1VP9A 4UVHA 4Y6RA 3STTA 4M55A 3UMCA 3K53A 3QLTA 4I8XA 1QQ6A 1J39A 1SA0B 4MV4A 4OP1A 3EARA 2FEAA 3LKBA 1UBFA 2HK6A 4BNZA 4MYDA 4L76A 1TW2A 3KVVA 5AKHA 1R4MA 1OU4A 4ML3A 2CBGA 3HEMA 4KI0A 4LPKA 4JNCA 3U7HB 4PRYA 4L6IA 4Y2UA 4EA8A 1UP6A 3DYIA 4LNUB 4UU1A 3RVBA 3JARA 1FVOA 3BSSA 1GUYA 1G8JA 1M33A 3HM2A 3KZOA 1ZICA 1IAQA 1VB5A 1IN6A 1BXZA 1HE5A 2Q3MA 3KE8A 4Q15A 4EY4A 5DK4A 1KJ9A 2QRNA 1VPVA 3TSCA 2SECE 3U1VA 4BB5A 4LPSA 4NLLA 5JY1A 2WJWA 1ID1A 4NICA 2B25A 1F3OA 2HZBA 1Q2XA 3WFZA 3Q1LA 2F43A 1Z36A 2OSVA 3LCVB 4UMFA 5A5GA 3I6ZA 1AQLA 2CSXA 1P1KA 1KO1A 2VJOA 3I37X 4V02A 1BWPA 4FVTA 4RJLA 3NZEA 3TJMA 5FBKA 3CMMA 1Y0BA 1OA0A 3EAQA 2J67A 3OJCA 2R96A 4RFLA 2DCMA 4ZT3A 1OFTA 3V4SA 2YKGA 2BHTA 3QBDA 4GG1A 1P17A 1MP0A 3OQNA 3NHKA 2XA2A 2AC7A 3AM5A 1E8NA 3HCEA 1OZAA 5IM5A 2CWDA 5FIUA 2RAPA 1NMSA 3O5AA 1QF9A 2V7QD 3PL5A 1JA1A 4NIMA 2EL9A 1KS9A 4XYBA 3VDQA 4D8XA 1LBQA 1S3FA 3D59A 4PS1A 3KUUA 4BE7B 4TXLA 5ALXA 5A62A 3A1DA 4MWDA 4TYPA 3ZI4A 4DVGA 5J4KA 4JXZA 2OK7A 4DG8A 4DMGA 2CHQA 3UAXA 3NO4A 3K1TA 2F55A 1PJZA 2QAGB 1YVPA 1GRRA 2XUGA 4WPGA 4BB9A 1F14A 3OIUA 3PQEA 1UMBB 3QVOA 3T3MB 4D4HA 1LBSA 1JXQA 1U3FA 1RAFA 4QUGA 4JDPA 1MNAA 4G85A 4QGGA 1U9CA 5LQKA 1EWQA 2Z2XA 5EKXA 4BNXA 4N8EA 4YWHA 3M6UA 5J59A 3IV7A 1JPJA 2NUTA 6REQB 4ZCSA 4ITUA 5IKEA 2VQEB 4G37A 5AW5A 1SWWA 4PIMA 3ET4A 3L0IB 3LZCA 4BMDA 5DM0A 5AHOA 1NE7A 4REQA 3L0YA 2AG1A 1YOVB 4RK4A 1ZOSA 3I1IA 5UKDA 1RPTA 3I76A 3BHJA 3UJCA 4HX9A 1G2PA 3PITA 1W1WA 1B42A 1FEZA 1G8SA 1MX9A 3TXXA 1OASA 4JU8A 4FDLA 4QUBA 1PX0A 1EVQA 1AY0A 5CT9A 1ZD5A 3IT0A 5IW8A 4CYMA 4DQUA 1XU4A 1SRRA 2QLFA 3GO4A 3KFXA 3NYIA 3RVLA 4QZVA 3KXIA 2JCBA 5JRJA 4PV7A 1R0BA 1VA5A 1HMPA 2OZKA 5CLFA 3H7IA 3OEEA 1E7QA 5HKKA 1TYEB 4S0ZA 4G1CA 4LXGA 3LX5A 5JO9A 4CKWA 1IEXA 1UJ6A 1X1CA 2CKMA 3HB0A 3KKKA 3TNJA 4GX0A 5IH3A 1XZHA 1RYNA 2VJLA 3KD3A 4TVSA 3W5AA 4AP5A 1FFCA 3V97A 5A2GA 3U44B 2CDCA 4YAJA 5ERXA 5THXA 2LZ0A 3UQZA 1W59A 3VR5H 4G5XA 1FP7A 4WHMA 2HRDA 1G4UR 1WG8A 5EMJA 4I5EA 4OU4A 2EGGA 3RVPA 1CC1S 3BH7A 4OTZA 4EG0A 2O2XA 3I30X 1GQRA 5EZYA 1SCAA 4RETA 1KFBB 3N5KA 4GZ3A 1JSRA 1LK5A 2NQ2C 1Z2AA 1ONPA 3GFFA 3O82A 4C04A 4OOFA 4DYHA 1CYDA 1U1DA 3MBKA 2Q9UA 3UXYA 3ETGA 2RGWA 3WYGA 3B6IA 1OX6A 3OM0A 2B98A 3AV3A 3L6OO 3DD1A 4NJOA 4ZPXA 2X9QA 2FWIA 4D57A 3W4JA 3NAQA 1WPXA 3N8GA 4FZVA 1D07A 5JAIA 3T1YB 1XB2A 2PXHA 2ZJ1A 1VPLA 4P9NA 1FFYA 1R00A 3F3SA 3UMMA 4PLTA 2IYNA 2AXPA 3IV9A 4TM8A 3GFOA 4B3HA 2WWFA 1K0FA 1G8KA 2O6HA 5EJEA 1FFDA 2A0XA 3IS3A 4AZ0B 4BV8A 4OUKX 2XV1A 3VR3A 3MJSA 2E6KA 4B6FA 4IY1A 1QQAA 1YUBA 4ACBA 2BZ0A 2WW8A 3IE1A 1O87A 1VKNA 1TQ2A 3CLSD 5FADA 3RBVA 1KHTA 4DPLA 1JH9A 4IW3B 5K51A 4AY3A 4ZCRA 1X13A 4FQ5A 3DV2A 1YS4A 1P2BA 2J7PA 1GCOA 4PWZA 4LZLA 1ABFA 2C07A 3LHFA 1ECJA 4E09A 3VU0A 3BPSA 3F3KA 3MJHA 4QGHA 3L9XA 2BKLA 3FDIA 4QYMA 4TXNA 4MB6A 2Y99A 4Y7DA 4BFLA 2GD0A 4H17A 1Z16A 1DXQA 1VP3A 4K8RB 5ALGA 5KOHB 1IY2A 3CGWA 4RKQA 4C6HA 3NWEA 4I7EA 4E6PA 4JYPA 3I9JA 2Q3LA 1J7JA 3ET5A 2N1MA 3KKZA 2X9GA 3VR2D 4QPJC 4CG3A 1KJJA 1SK9A 1FOEB 3CJTA 4KBFA 1CEEA 4L0QA 5KWIA 1QBGA 4JJ8A 4DUPA 4HX5A 1DTSA 2OO3A 1R3UA 3GCGA 1UKYA 5B2ZA 3OZIA 3NVAA 4G9GA 2XZTA 4I46A 1GGVA 5B64A 4RWEA 3TZKA 1MGOA 2JAUA 2QRZA 1KJWA 1WZIA 2H51A 3AWDA 1PWEA 2VRWA 3DO6A 3O8LA 3IIJA 2WSBA 4LRSB 3WICA 4HDRA 2GF9A 4JOCA 1AS2A 1PTKA 1GPNA 3E3LA 2NPFA 3QU4A 1EHIA 3PRKE 1J1ZA 4IVNA 3PUYA 2ONJA 4A16A 3GAAA 1RT9A 1N7HA 1MEOA 1HDGO 1OBFO 2QP9X 4RFVA 1T9KA 1M1XB 2CDRA 4WZAE 4EX6A 3EPRA 3LG2A 1MNQA 1MCZA 4BS9A 5KVSA 1PT9A 2QLNA 1FNBA 3I5XA 5KVQA 3F8WA 3Q88A 2J7KA 4IPTA 3QTLA 4I2NA 1IHYA 1ORDA 4ZAZA 1L1EA 4EY7A 3G9ZA 3I2JA 1B6RA 1WY5A 2ADOA 2VLIA 1NLMA 2EW1A 3IUSA 4RHCA 4X94A 4YJFA 2P2SA 1OY1A 5CLHA 3ABIA 1RRPA 1QGYA 1HSZA 1ZUNA 4XPIB 5AKLA 2JZCA 1UZAA 4XWYA 2WPNA 1CIPA 3ZE1B 2OE2A 2X5JO 1V4BA 4R2IA 5DGIA 2OYRA 3IOMA 2G07A 3I2FA 1Q7TA 3S27A 3ILHA 3F5SA 1FCJA 2Q3DA 3CLHA 2XITA 1RD4A 4DLRA 3CNLA 1FUYB 2C3PA 4J6FA 4A0SA 4D8TA 3O2NA 1M7HA 4IDGA 4E08A 4L5YA 3L5KA 1RWOA 1JLKA 1OR8A 3H3XA 4KEAA 1M6WA 1K66A 2FQQA 2PSDA 4P08A 4S1NA 1IMJA 1UK9A 2Q3FA 3OA0A 2ZVJA 4Q0MA 2PYDA 4PQFA 4Q7LA 4TKZA 4U7WA 4DFDA 5KEIA 3IKVA 3W4KA 4BV2A 1T9CA 3GEPA 3H4MA 2A78A 2WTMA 1RM3A 3VJLA 3VSCA 2AFRA 3AF3A 1IUPA 2H6EA 5K6AC 1D4FA 2H85A 1YRWA 1RWKA 3Q7EA 5J2UA 2ZOSA 4LGMA 2O8DA 1Y6ZA 2I29A 5CM9C 3O1IC 2OLJA 4DTIA 4R2XA 3ZHSA 3J80A 1E7MA 1HEIA 1XTPA 2O2EA 2ZBFA 2ZVQX 1IOZA 1GPWB 2HQOA 2JRLA 3IXQA 2XMPA 1V3QE 3U2QA 3T3OA 3ZS8A 4C6TB 1LTQA 1MC1A 1DNPA 1F9EA 3R8XA 3BJMA 3PLNA 4R8VA 1SO8A 3VTFA 4F06A 2C2WA 4YWJA 2XYHA 2H65A 3WBBA 2AN3A 1TCAA 3AUXA 2V6GA 4RS4A 3WYCA 2HHAA 3PFKA 1E9SA 2CVOA 3QYPA 4CMBA 3RUIA 3RYHA 3VX3A 3T35A 1Z4PX 1KETA 1E1DA 1ZDMA 4KVFA 4R5MA 3WIDA 3WK4A 4C2BA 4O2BA 4GUDA 4EL5A 4JV5B 3HKBA 3I4LA 1FPMA 4QFCA 1A4UA 3FR8A 2QN9A 3BD6A 2GFHA 2W2PA 4F1KA 2EBUA 1LU9A 1VFPA 1DTWA 2BEJA 3GQBA 5K3FA 3PZBA 4GRIA 2AI2A 2Q50A 2B8EA 1U2PA 2V7BA 4OXQA 1MC8A 1H23A 3M4XA 4FKMA 2AKAB 3FI0A 4GH5A 3TI9A 2WSIA 2FFRA 1Z56C 3ND5A 4L6CA 3UJAA 1JLMA 3CUVA 5ICMA 3H16A 4KC0A 5DZSA 2R8RA 1SH7A 3KX2A 4TLAA 1IBMB 1IPHA 5FPHA 1QNLA 3M6LA 1N0VC 4U9IS 2PR2A 4CDMA 1LFAA 5AM3A 2P4EA 2GK4A 1SULA 4C4TA 3RSLA 1XCJA 1OX5A 2EDAA 1E5DA 1USGA 1QIEA 2FN9A 3VVCA 1NY6A 2AJCA 2OCIA 2XAAA 1PJBA 4I5DA 1SCIA 2GWRA 3SQWA 1GDTA 3T54A 5F3WB 2FW8A 3BXPA 5TEWA 1ORWA 1ECCA 1LSSA 2VDKB 4UJ3A 1C4XA 3QFCA 1AS0A 1QGUA 3E8SA 3PGA1 1QK5A 3FNGA 4Q34A 3X1KA 4B3FX 2JIDA 3B38A 4ZVOA 1KI6A 4UOEA 1FFXA 2C3UA 3VYVA 1S0UA 2H07A 5CNMA 2F6RA 2R6R1 1EJBA 1GAQA 2PFGA 2PBLA 3OLVA 4JWKA 4PHTA 1A8QA 2I67A 4KO1S 2Q7DA 3ZEAA 4CMHA 5H4GA 3LNCA 2LNDA 2FRDC 4OK5A 4D56A 5A4KA 2PUEA 5TY0A 1B7GO 1H6AA 1NXXA 3N5CA 5FQOA 4BKMA 4DSZA 4ENSA 4YT8A 1JE0A 3R3WA 4QJ5A 2A5GA 4KACA 4XD7D 2YYYA 3PEWA 2HNBA 1VL5A 3AVOA 4ZTZB 4MIOA 2IHZA 1RZVA 3LCCA 3QUAA 5IMSA 1A88A 1O2DA 1U9IC 3NS7A 3R6GA 4KAXA 1Q0UA 2Y2UA 2YR0A 2MHCA 1Q0HA 1ZRNA 2IVZA 2QWXA 2G9NA 1DKNA 3UTCA 1FK8A 4F4IA 4W5TA 4LCEA 3GGJA 2Q3HA 4WW0A 3AJAA 5GJVC 2ZS8A 3FWZA 4ETWA 4D3XA 3CSSA 3EAFA 3GN1A 1XVTA 3CPEA 4YH1A 1MPXA 3LRPA 1G16A 3QSYA 3H86A 3C6ZA 1ZCJA 4EK9A 4A36A 1G8MA 2BMWA 3MWJA 4FR2A 3CONA 4YP1A 5KX5B 1SB8A 2VXYA 2XWBF 1DQRA 4UCXA 5JNWA 2GZMA 2NSHA 2WE8A 1TT7A 1D1QA 2FN3A 3P5BA 4JLAA 3ADDA 5KSPA 3DAPA 5TARA 1E9CA 3OIFA 1U98A 5F1YA 2IUUA 3E53A 2ZANA 2ZWPA 4NZPA 4CLRA 4D99A 4G8BA 1NKSA 3G2PA 4KX5A 2RI6A 4RIEA 1OXVA 3B3JA 2R44A 3CF2A 2BBOA 4MW2A 4BGVA 2Q5QA 4EHBA 2GTPA 2OFOA 4B6PA 4CPDA 2AV6A 4DUYB 2FPRA 4MPJA 3WIEA 4LJ4A 2BUCA 2W83A 3K1AA 1NTRA 1QAMA 1E9FA 2G71A 2GI4A 1CE8A 1FNSA 1J1IA 3NT2A 1L8LA 1SB9A 1BS2A 2F64A 2CLMB 4H35A 4NJMB 5EZ6B 4RH1A 4TTAA 1V16A 2Q6IA 3P9PA 1G6KA 2L2QA 5CK5A 1R0WA 1ZM3A 3GWZA 3TMKA 2IDMA 5E6UB 4RDCA 3TAXA 5JSFA 3W7BA 3WNZA 4I55F 1VL6A 1KE1A 5EWMB 2NYAA 1ECBA 4N3NA 3UGKA 4PTZA 3UUEA 4PY2A 1IB6A 1L7PA 3WYBA 4A6PA 3O92A 4IDNA 4Y1FA 4Z7QB 1MENA 4DOMA 4FM9A 5L3SB 2PK3A 1IEWA 2IYWA 3EISA 4M6WA 3IBCA 3NIBA 2X7JA 4YJ2A 2FP4B 4Q7JB 4RJTA 4IWNA 1MZVA 5COBA 2OOKA 4D9MA 3PQ8A 4MA5A 4DXDA 5BPFA 2PUFA 5JDIA 1ZZGA 1XL1A 1JNYA 2W2NA 3PRHA 4RZXA 4XJTA 3MTGA 1KDZA 5LKRA 3AUYA 3EIOA 2FVYA 2JCSA 3EOZA 4GEKA 4JDUA 5EWLA 4DMMA 5ESDA 4B4OA 2B94A 1E5LA 1FUEA 2CV0A 3KDPA 4YMSA 4HPWA 2ZYAA 4MPPA 4OMDA 4LWPA 4TYNA 3WL3A 5KTSA 1KP2A 1QWSA 2PVCA 2J0UB 3RS3A 1V9CA 2IPAB 4B7CA 3VR0A 3U40A 2HA3A 3MT8A 2NU8A 2R6GA 5AH0A 2JCGA 5IVHA 1NVFA 2J30A 3QEKA 4AG5A 1HDCA 1SQFA 4AAYA 4F45A 3C1TA 2ZT6A 4Q6BA 4POAA 3WLFA 2ZI4A 5B57C 3I5YA 4JEMA 3WDSA 3EZ7A 5BNFA 4BWGA 1GSAA 3LF1A 4R8KA 1DPFA 3BD8A 2WICA 5J47A 1LWOA 2QTTA 4HQLA 5HP4A 3QOWA 4BMSA 4MV1A 1N2GA 4I5FA 3D6VA 4Z9BA 4XLTA 1CUJA 4BVKA 3KQUA 2FZWA 3LECA 2PXXA 4OSOA 1BD3A 2C2MA 1DKUA 4ZGBA 1D4OA 3BQMB 3TLMA 1TKBA 1GL7A 2BFWA 4GLJA 1RMTA 2ZUBA 3QMPA 1PDOA 2MSWA 4NV3A 2OENG 4JIGA 4X1KB 5ARDA 5D6OA 1FRVA 5AT1A 4B81A 4BMVA 1O97C 1U2ZA 5GM1A 2EFJA 4MCAA 1XPJA 4DQ0A 2NLOA 2ODQA 4KPGA 4EENA 5L51A 4RNCA 3EVCA 2VJYA 5HKAA 5CNJA 4XDYA 4B3SB 4UNQA 2TS1A 4KH1A 3E7XA 4J3FA 2JGJA 1RBYA 3GCZA 5NLLA 2ZP1A 3AEUA 3SLRA 5J63A 4CKZA 4EJSA 1U2GA 5ICEA 2I2CA 3MQ4A 1NA5A 4OQXA 1DBIA 3SM9A 1YR3A 2XCTB 2DUJA 5DHTA 1AUPA 1SU6A 4F9TA 3HA7A 3OTOB 3WSVA 2AR0A 2AWNA 2MR6A 4H6VA 4R2LA 1ADGA 3K0CA 4E2ZA 1YRBA 3TCKA 2R6CA 1SCNE 4D96A 3C7DB 3PPIA 4GS5A 4IV0A 1NAHA 4LIPD 4QBKA 3SS9X 4A10A 5C18A 2BKUA 5HUJA 4RF2A 2BGKA 2WE7A 3W5DA 4IUBS 3I6IA 4M49A 2HDWA 4DCGA 1B2LA 3M6VA 1ZXXA 3S5JA 1VBNA 3PJGA 4IL5A 5THQA 2CL7X 2PGDA 3PDWA 4ND4A 4ARVA 2QVGA 3USES 4AQ7A 2DY1A 1S2NA 2D6FA 3L4KA 1X74A 3ETLA 5F7ZA 3VMFA 2BRUC 1TPYA 2GXSA 3CLTD 3N6RA 3ELDA 5B1IA 4OX9Y 2X3YA 4BV9A 4DREA 2FKNA 4HEA6 3ENZA 4RV4A 3T7SA 2EHJA 5HDQA 1QO0A 3LLMA 2OCGA 2XD4A 1WOMA 3PFWO 2IPXA 1Z4KA 4L22A 1I2AA 1NKTA 1PTJC 2OO7A 4MVJI 2O2YA 3Q7PA 5A05A 1EINA 1C1DA 3QVTA 3QEMB 2GNOA 3VKUA 3KJGA 1KOJA 3MTJA 3SYTA 1UPAA 4BQNA 4IF6A 2Q1XA 1USVA 1YS1X 1OFHA 3OE4A 4LISA 4EPWA 3LL7A 4YYZA 5I48A 2HV9A 4TOIA 4QA9A 1XDBA 1TK3A 1GGJA 1QHFA 1U2DC 4F93B 1UODA 3HMQA 4GUAA 4INPA 4QEKA 4N0QA 5C5IA 3G8CA 3WGKA 2P75A 1KYVA 3FN4A 4YACA 3L6RA 2ZJ6A 2GDJA 5CXQA 3UHJA 4ASUA 5CBKA 2ZJ7A 5C1BA 5KINB 3AR2A 1ULHA 1X0XA 5AKYA 4K1XA 3ETJA 3HY4A 2EIHA 3ZIAA 4WGFA 1R8XA 1XO1A 2WUEA 4HUQA 4X1YA 1SZPA 2OLKA 2V8BA 4LZJA 4I99A 8ATCA 4FZJA 5BR4A 3V8EA 4UMEA 4WT7A 3OQVA 1TIKA 4GX5A 4KQXA 3LPCA 2CNDA 1QHSA 1PEAA 1Q1AA 2FXVA 4PSVA 4RAQA 3AU9A 3ZCPA 4ZHQA 1QGZA 2ZPUA 3I34X 3SZLA 2QT9A 1GUAA 4BYMA 4DVJA 3FYTA 5TEVA 1GCIA 3W9YA 2ZI9A 3ZD8A 2Y1XA 2QRLA 3LUHA 4MA0A 1V39A 1NQOA 1ELOA 3O73A 1UWKA 5HTOA 1S3GA 2CLKB 3BJRA 3DEZA 4EUNA 1E5XA 2ZUUA 5E0KB 5CDFA 3TR6A 1KQPA 4QPNA 5CFOA 4DEVA 3J81A 2JJQA 1PJRA 4IOMA 4RS3A 1KMHB 3IUBA 5B4VA 2O0KA 4G0QA 1SU7A 2CHFA 5CTJA 1N5IA 2ZULA 1K9VF 2G6BA 3HY3A 4R05A 4U2FA 4J0KA 2DPGA 3R0JA 3JWGA 3NKVA 1LZKA 3THRA 4BVGA 2BI7A 2W42A 3QYJA 4D4IA 2VDWA 1FFWA 3DNFA 3LYAA 3OTHA 3WO0A 3T3NA 3G8DA 1M1NA 1X8LA 1NATA 3PF9A 1TC2A 3FR7A 1HYBA 4MVWA 4PZLA 4CM3A 3U09A 5DTIA 3REGA 3LGAA 1VL1A 1Z07A 2ODNA 3T7IA 2Y4OA 4FGSA 2XDQB 3W5SA 2R2AA 1BCSB 3HB7A 1XZDA 2B8NA 3P2OA 4DQKA 4EEKA 4C4YA 5IDWA 3QX9A 3ZPXA 1NVVR 3QNMA 1X8KA 4BNGA 4D82A 2H7CA 5EC8A 5L3RA 3LT4A 4OHFA 3Q6IA 2ZJZA 4KTTE 2YV5A 3VPHA 4BVJA 4HUJA 2WFLA 1PUXA 2YN0A 3H87A 5GM2A 4N0EA 3WMRA 3IELA 1BYIA 1OBOA 2BCJQ 3P0EA 3OOYA 3VFDA 3GLIB 1E3MA 3I9OA 1UBJS 3LY8A 4CW7A 2VYFA 4RZ3A 1TVMA 3RU9A 1SVIA 2JC3A 1FU8A 1N6NA 1HQDA 1UBLS 5DNCA 1QDEA 5EMHA 1Z34A 1GHTA 2IP4A 2ZYIA 3IDZA 4WN9B 1NQAO 1KKMA 4FSHA 3IODA 2Y2VA 1BRTA 5HF8A 5E2IA 5JBIA 1NUTA 4MR9A 2ZR9A 5PNTA 2H3EA 4V0OA 2Y0DA 4TV8B 4WFKA 1P0MA 1GQYA 1X38A 3K5WA 4LQLA 4RA9A 2YJ5A 4DE5A 3GT0A 1R74A 4HAVA 4L16A 2BUAA 3BGDA 3FETA 3WBFA 4EA6A 3R3JA 1RP7A 1EFKA 1ZU5A 3L8GA 1X7WB 1XLTC 2QNRA 3QF7A 4G4IA 2IOFA 5BSEA 4IHQA 1VSTA 1OI2A 2VUSA 4ZKEA 2HU5A 1RXEA 4Y6GB 1KO8A 4N3BA 5I4IA 1MX1A 1NPDA 5K8TA 1IULA 1E3WB 2WSLA 2GOYA 4QUDA 1MQ9A 3OJLA 1E6UA 3TW8A 3QELA 4Q4JA 1H5NA 1KP3A 3DE1X 1EFPB 2QX7A 1JR3E 1QC5B 1R7RA 4ZJPA 2B3TA 5C2JB 1P73A 1XTZA 2H5JA 3H84A 1IFXA 2OCLA 5DT2A 3SQOA 1FFAA 3M8KA 2Z8YA 3E05A 2D59A 2VPPA 3OIYA 3VNRA 4CG2A 5CLIA 3BZWA 4TMZA 2EXXA 1TQ6A 4X0EA 5ALKA 2Y1GA 3WNVA 3IYLW 2J5XA 5LJLA 1JI3A 2WYWA 1EM8A 4DGQA 2CVPA 4CM4A 4LQCA 3U4GA 3C74A 4R9VA 4QSMA 5HR5A 1ABEA 4MPTA 3H42B 1G8HA 2WEKA 3TRIA 4RZHA 5KTNA 1IG3A 1QSGA 1VE7A 5U9CA 3TTTA 4WXRA 1RDFA 1JBEA 2CXTA 1OBCA 3IALA 3RC8A 3N28A 2HCRA 3PC8A 4LDPA 2V03A 2E4ZA 3ECAA 4WN3A 4AMUA 1OLUB 1LNQA 2VJPA 4PANA 1GNRA 2NNLD 4YRTA 3WMXA 3OD5A 4QUKA 1EBUA 2AOUA 3DBVO 1V1JA 2YHUA 3BFVA 3DMRA 3ONDA 3W5VA 1PJ8A 5ILQA 5JCJD 4UAUA 3PFCA 3TW8B 3H9GA 3P0HA 1XDSA 1N5LA 3MUFA 1KJQA 3D3KA 5DP2A 5CUQA 3L0DA 2RHCA 4IXMA 5BNWA 5KOYA 3WGJA 5JVDA 3AX6A 1QF6A 2WHQA 4ER5A 3SFZA 3ICOA 2MIIA 1F4PA 1OX4B 1HKUA 2R8OA 1L4HA 2P40A 4LV6A 2JPDA 5GZ3A 1UM9A 1S2IA 1YB6A 4YS6A 1Y89A 4GEGA 4PLFA 1B43A 3TCNA 3OZDA 4YAKA 2O8FB 2JFOA 2MYTA 2Q2OA 1S2OA 2WNHA 4RIIA 1JKIA 1XPOA 3P0JA 3CNHA 1TCVA 4GVXA 5AVOA 4FYVA 2UZAA 4OA8A 4B85A 1ZO8A 3DF9A 1BU5A 3PUHA 4GPZA 5AD1A 2PX0A 3KAPA 2I6TA 1BXGB 3R24A 1A72A 2FH5B 3LP8A 1VL0A 4BB6A 2I5PO 3WHPA 3AFNA 2HMYB 3L01A 3MQ2A 4E4YA 3ZWMA 4KWHA 4DG5A 2WZQA 2VSFA 3PFIA 4H08A 3WK8A 2W6PA 1K8ZB 3NM6B 4HL6A 3G7SA 4CXMA 2GR9A 3DYBA 2BIFA 2MYPA 3NHBA 4QUJA 4JVOA 4PC3A 2AEFA 4LXYA 5GZ6A 1RXVA 1NF3A 1UXHA 2EC5A 3ZNOA 3TN7A 1F8YA 4G5GA 3H1GA 2OZVA 4NECA 4H0CA 3VI4B 3EIXA 1A5BB 1F8UA 2P1ZA 2PJUA 1XD2B 1KRXA 3UENA 3T4XA 1AMNA 1R8JA 2JI9A 3P4XA 5CCXA 4PIPA 1R88A 3U62A 3IGFA 3F73A 4N01A 3DWFA 5HS4A 5L7WA 4EQ6B 4YFVA 1KBZA 2ZBDA 3QPVA 1EFUA 1KJZA 4Y3UA 3V32A 1TTQB 1ZK2A 3OQHA 4L1KA 4M76B 1RLTA 2DHDA 5KYVA 1MFPA 2WD7B 5EUMA 2ZRDA 4N5LA 2RK4A 4ERXA 1I6WA 3DSRA 2GCNA 3RKUA 1OTHA 2ZUTA 1XEWX 2ZB4A 4UDXX 2GSDA 2PYIA 1U4OA 4J03A 4ZVQA 5JDIC 1PR3A 3PSAA 2Q5CA 2D1QA 2D2FA 3FCXA 3ZNPA 1LW6E 4D9JA 3PCTA 2D1YA 2PSFA 1YFJA 5EXDA 2PV0A 2DECA 4IH1A 2C0CA 1ZP6A 3F6CA 3LIPA 3PR1A 4DMLA 4Y9SA 4EB6B 4Z86A 2OHIA 2OHXA 2FPKA 2WINI 4D4LA 3KT8A 4YYEA 2I71A 2HXYA 4RTRA 3NC4A 1F8GA 2WA1A 1JHVA 3LVFO 3OIWA 3C3BA 1K7CA 3GPIA 2IYRA 1F3LA 1HT0A 1XQWA 2V9CA 1HRKA 3FMFA 4IIHA 4XARA 3RYTC 4DM7A 1M6VB 1K68A 4W6ZA 5K0CA 5LNK6 1JEDA 1NF8A 2ATXA 2QLTA 3OESA 2ORED 4B35A 4X54A 2GN0A 3LOUA 3T41A 3HS3A 3IEUA 2ZSDA 5IYZA 4WEQA 2CXPA 2WD8A 3FLAA 4KDFA 2VTBA 5IPFA 1TU0A 3NGXA 2R7NA 3Q7SA 3HWRA 1KI9A 3HXTA 4C01A 4Z9AA 3O3OB 2P2DA 3AEKA 1BH2A 5LD2C 1OYWA 3EGXB 1ORRA 3DTVD 4TLMB 4AZ0A 5M04A 4IZHA 2AN4A 3PG5A 1L5RA 1TJPB 3K1ZA 4LVCA 3TNYA 3KUDA 5AR1A 4DQDA 3HJCA 4HNGA 1UAYA 3A1FA 3H1AA 1HYEA 4ILKA 3AERA 3VC3A 1OPXA 4K3UA 4ZC1A 4WK0B 4JJAA 4QBGB 1IL0A 3F71A 5CCDA 1JNXX 4FEEA 2XB4A 1IHXA 3C8MA 3O26A 2WU4A 3AFOA 4PF1A 2VYCA 2Y68A 3TOZA 1R50A 1HG0A 2XB9A 1XMVA 1ZEMA 1KEEB 3KPUA 3ROMA 3MOSA 3NPAA 1AM4D 4LHZA 4QXRA 1X1QA 1GCUA 4DSOA 2UVPA 2O3SA 3IPLA 1D6NA 1PJQA 4MW6A 3WWDA 2IE8A 4BRWA 4Y8VA 2Q6LA 5ALJA 3ENNA 2DF8A 1RZRD 2H5IA 2FPIA 3FYUC 4B3IA 1JXAA 4Q3DA 1CVIA 1PT5A 3OU7A 1KBOA 2WYHA 3O7WA 4PBTA 5CYOA 1BGWA 3QXHA 2ECOA 1RIFA 1KY2A 3NT4A 5T4BA 5DI3B 4B5LA 1L5GB 1JIUA 2OQ2A 3NC0C 5LP6B 3JQ8B 1AUVA 2IEDA 2CXQA 5GPBA 4R8MA 3GMTA 4PFQA 3WOVA 3F4LA 2Y1OA 4ZGGA 1XDWA 2VEDA 3L2OB 3PQFA 3KAQA 3AKYA 2B36A 4PG5A 2UUBB 1A4RA 3NH6A 3WKDA 2C4WA 2VSNA 3FUUA 3H2SA 4J9VA 2XZDA 1BE8A 5CW1A 2R97A 4EZEA 5TF0A 4C29A 2V54A 3EZNA 3AUTA 1MAUA 2RAVA 3QH4A 5CM2Z 2SCUA 3NV9A 2ONZA 3AF1A 1JTFA 2XRZA 1QLWA 3EXEA 2G5CA 5A4FS 1ONSA 2ONCA 4KN8A 4JIMA 5EEGA 1QE0A 1I51A 2VK1A 3L0SA 2F1IA 1B73A 4MAMA 5I01A 1UR5A 1H8HD 1VL8A 5I8ZA 3RSCA 3CUTA 3KWJA 1Y6QA 3O21A 4RSGA 3OOJA 3WISA 4ARUA 3IUMA 5LVAA 3V8MA 2NV0A 4O6VA 1D9ZA 3ESDA 3PV0A 2AW3A 4PG8A 2I65A 5K3EA 1DQPA 1XTSA 4M0DA 4JU9A 3PT5A 3U3JA 3E15A 4I4CA 5D3MB 3EPJA 3WKEA 1L1RA 1UJMA 4FILA 1NW4A 4E3WA 2FWMX 5K3AA 1XLTA 3Q8XB 5DF1A 3W1VA 3CMCO 3OT4A 2BFBB 3CLTC 1OGIA 2CHGA 2O2CA 4Q9KA 2HQ1A 3PL1A 3TIVA 4OU5A 3D54D 3RKRA 1VHTA 2HSZA 1VA4A 1Z74A 1W34A 2OVFA 2XYGA 4CKBA 2QR5A 1NYLA 3COYA 3KXDA 4FYMA 1XEFA 4IGAA 4J0DA 1JJVA 3G2QA 4G41A 1A9YA 1YRHA 3GR6A 1X1RA 1PSZA 4QU8A 2GF2A 2GT1A 4WERA 2DWPA 5BN1A 1Y9AA 4NL4H 2OPBA 1NQUA 4KYVA 3W79A 2ACEA 2VWPA 1J9ZA 3HDGA 3SLGA 5DNYB 3AFIA 2CMDA 1O54A 1CYEA 1Z8FA 2XXJA 3DZJA 3IXMA 4N54A 4DIOA 1W1UA 1E79A 5FBRB 4MKRA 2VHCA 1E2PA 3BE8A 3BT7A 4M60A 4R54A 3BERA 3OLQA 1JHUA 1GNSA 1PTJA 3K96A 3OHPA 3DKVA 4EUHA 4RVUA 5H8WA 3GCWA 3ZY3A 3VTZA 4BBPA 2Z4TA 3C8HA 1DQZA 3U49A 1ABBA 2Z95A 3O4RA 4KO4S 4Z0NA 2GHRA 3KQLA 2X0KA 3KYBA 2ASVA 4DEYA 1KEWA 2BKEA 5B4UA 1EBBA 1OXUA 3ZE8A 4RTMA 1FMFA 4OHMA 4E2XA 1JAIA 4F2DA 2HTFA 5DNVA 4J1QA 5E1BA 1OI7A 5HIAA 5HJEA 1BWRA 4DPKA 2OP1A 3KKOA 4TQGA 3QQ5A 1ZKDA 2VATA 4E4RA 2PUTA 3B85A 1YZHA 2JCVA 4UCWA 3WRYA 3ZE6A 3V1KA 1CZLA 1LBEA 5A6SB 4ZJUA 2IXEA 2YMQA 1MABA 1SOMA 3MBOA 1Q0ZA 2I8AA 3T3DA 4CMGA 2V1XA 5TVKA 2H08A 3G0CA 3SQMA 1IZYA 1KYXA 2IL1A 2J0VA 4TWJA 4WKOA 2BL4A 3AHIA 3D6JA 1I5RA 1M2OB 2ZUCA 3KV1A 1YNOA 4KKVA 1H9CA 1OIWA 4P80A 4KRXA 3NRBA 3OWOA 2YJ3A 4H7KA 2HHJA 1RLOA 1VXOA 2QN8A 4OF4A 1F4VA 2YJNA 3P9SA 4ZAXA 1VPEA 1VZ2A 3KU1A 2JCXA 2VI5A 3LMKA 2DWCA 1H8ED 1NG1A 3C98A 4IIJB 4OH7A 3E9ZA 3SVZA 1TAUA 5DJ5A 1PQPA 1UZMA 4G0WA 1IQPA 3IP6A 1WP4A 1W4BA 2Q6VA 1PW7A 1JDJA 3GLKA 4PM4A 4R1OA 2IOHA 4UBOA 3E1SA 2QS9A 4FLEA 2AIRA 5F1PA 4DM4A 1H6DA 3Q2KA 3FUVA 4LK2A 3Q12A 4A8JA 2DLDA 3T3EA 4OFWA 2HB6A 4I50F 3KTDA 4CCYB 4HGPA 5G1NA 2QN6A 4F3NA 2ZRPA 3T6KA 1QM5A 4FX5A 4IDQA 4MV9A 4TYWA 4TS9A 3NCTA 4ZOEA 3S8EA 2ZUFA 2FWNA 3KQQA 1FYDA 2J9GA 1XQVA 2FPPB 2O5RA 1V47A 4PEVA 3K71B 3K0SA 2JB9A 4JBWA 2GZHA 3MHTA 2DWOA 5DNUA 1E1RA 1Z6GA 2QD4A 4JJ7A 2WF6A 1CDEA 5KQLA 1KYWA 1ZHHA 5KMGA 2H00A 3PVCA 2QSJA 3MTQA 5BR7A 4WJKB 2C78A 4DSNA 1Z0SA 4DA8A 1XJQA 3KD2A 3UEOA 1ONOA 4KJZA 3ACBA 4BU1A 4NDNE 2I76A 3W05A 5A0VA 2E4VA 2D5AA 2VDLB 1CSEE 4JHLA 3NEJA 3CKYA 4V0QA 4WBNF 1QQTA 3IAM6 4Q9HA 1Y4SA 2RHRA 3A28A 3BSWA 2GN8A 4NCBA 4O25A 3VUEA 4BN4A 4C0HA 5JMPA 1LSOA 1EIWA 4BFCA 2XOKA 4YCAA 3ED1A 3F0TA 2D3WA 3CVJA 3NUZA 4C06A 4DCUA 1AIPA 4G4GA 5D87A 1GEGA 3B8EA 5LDDC 3L92A 3ASYA 3AQ4A 1VJDA 2JFHA 4YDSA 1XX6A 1M8FA 2Q07A 4ZDWA 1CRLA 1S8FA 4HAIA 3P52A 1W47A 1Z75A 1JBQA 3PUKA 1JAHA 2Q5JA 4U00A 4LW8A 5AK4A 2X58A 1RCFA 3PD7A 1ZBQA 2B2CA 2RHBA 1Y8AA 3CY6A 4OSPA 1DRJA 4URFA 5EQDA 1DEHA 2IS1A 1Z0JA 2VJBA 1XALA 3C6MA 4JLUA 1O94A 4L50A 5CXXA 4YRZA 5AJHA 2NVWA 3HKBB 2PFKA 1ST3A 2RE8A 5LQNA 3F90A 4KXLA 4HGNA 3BDVA 5FBWB 2FXIA 4DJFC 4LOHA 3BZUA 3M3PA 3KR0A 3A9CA 5IS2A 1BN6A 1TRKA 1E2MA 4URYR 2X22A 4ME6A 4AX8A 1XNRB 3O0DA 1EGVB 4EGQA 4NU5A 4O02B 1NVXQ 2WB4A 5EP2A 2YXEA 4AJNA 4E4TA 4YIKA 1CLEA 1YZLA 3NHPA 3VR6D 3NH9A 4B4DA 3ZIUA 1ZEJA 2I22A 5JZSA 2VF7A 2ZE6A 3JZIA 3P27A 3K5HA 3CXRA 4X1IA 3X0DA 2RH8A 2WWTA 1GYQA 4EJ6A 1ZVJA 3L8ZA 4Q24A 4WKNA 2JLCA 1J8MF 4JJGA 1ZXLA 4GBJA 4TMVA 5TS2A 3VPSA 2GZDA 1M76A 2D1TA 3LD9A 4LG1A 4PC7A 4RF5A 4U6QA 5EMNA 1HA3A 3JQQA 1VCOA 2MSDB 3KPJA 4YGXB 3RE1A 1Z8DA 4M1OA 5AVWA 3A6PC 1RJFA 1WNFA 3HVRA 4DBZA 3DBLB 4OI4A 4UUAA 2RHDA 4BNYA 2PMCA 3U7IA 1YQXA 2H1RA 3N2GA 4FS8A 1Y34E 2Q6OA 4DR5B 1CS0B 4Q18A 4ZT4A 4ZC8A 4RKWA 1JMVA 4LWOA 3NTQA 4HRVA 1SOVA 4KIGA 4UNPA 3AVPA 1SPBS 5E6UA 2B9VA 1L4GA 1XAHA 1J25A 1UKZA 2LGJA 2R7MA 3ISTA 3PXEA 4PO3X 2V45A 3P0RA 3RFTA 4JC5A 4DCTA 1H42A 1J49A 4G26A 2Q5LA 3HCPA 4QXOA 2H4FA 1QDUA 4LF5B 1V8FA 3CF4A 1YS2X 2QLMA 2H2HA 3FPEA 3FUTA 1QO7A 3GZ4A 3I8XA 3QWHA 5HMLA 2AOTA 5LB4A 4R1NA 3FPKA 1N2CA 1NRXA 1T9BA 4D46A 1G18A 3LBHA 1UKCA 2WD7A 3EBLA 4CF7A 2W6ZA 2YQ5A 2A5JA 3N0TA 2GJ4A 1WF6A 2QAJA 3NWJA 2FUG6 3OBBA 2DWQA 1ZGAA 3JXEA 3W3AD 1U0BB 3KJZA 1L3IA 1NNUA 3C70A 1C7FA 3D8BA 1IM5A 3LW8A 4KIFA 4N7RA 2WRZA 4U2DA 3SJCA 4BNIA 4BZXA 4YRRA 2RI1A 3PJDA 1XCGB 3RO7A 3UMYA 3GDHA 3SZRA 3TZQA 4B6JA 1EVJA 2MR5A 2ODPA 2TMYA 2WZCA 2VAXA 2E4WA 4KU4A 5HCNA 1WQ1R 1CVRA 1VE1A 3RC9A 3OQMA 1VJCA 3KJQA 4GI3A 3PEEA 4NARA 3RS8A 2HJ9A 3G5UA 5A0FA 3AR7A 5FWXB 4R9SA 4RTKA 2VH5R 4MKHA 2B7CA 1E3IA 4QREA 4WKBA 5HEKA 3RUEA 5KYYB 3DUFB 3LBYA 1HNXB 4I08A 1YHYA 4HATA 4B45A 3KCQA 1Y5RA 3RRNA 1Z5VA 3CO5A 3D6TB 4O8CA 3T3HA 5IRCD 4MUKA 3EG9A 1O1YA 4O2AA 3LLSA 4MRNA 4UARA 1AQIA 1I01A 4PG4A 4A73A 4Q9AA 3S2IA 3C5EA 5JZOA 2KM1A 2PVSA 4IHJA 1M10A 3I58A 4QGBA 2EKLA 3NHYA 4S1VA 4E31A 4O08A 3ITEA 2Q41A 1E58A 4RD1A 4UXHA 2CJFA 2PWYA 5C5CA 3LBFA 1PF7E 4OHXA 4H7DA 1VPTA 2ZIZA 4GYYA 2P9EA 2RI0A 1DCMA 2Q45A 3SDBA 1II8B 3SS7X 4HSGA 2CFOA 4BGDA 3GGCA 3AEXA 4RIFA 1UXJA 5IF9A 2YHIA 3EQ8A 4MS4B 1O5OA 2AVDA 2H59A 4B2PA 3S2FA 4CLHA 2DEUA 3CWQA 1GVHA 3A06A 1A50B 3WA6A 3VU3A 2ACWA 4QLAA 2IELA 4XLLA 5J2UB 3OFKA 3PDCA 3EEOA 4RTQA 4YV2A 1QGUB 1LI7A 2XHEA 3LC7O 1OI4A 4M6WB 3BGOS 2L0XA 3ZC3A 4CLEA 4L4SA 4OHYA 1GG8A 1YDMA 1K6JA 3A9RA 3NAZA 2NVUA 2NZXA 4M98A 2FPGA 2HSEA 2QTWB 3THSA 3C3DA 5AUQA 3VHQA 2AJLI 1K3UB 3L4JA 4UKDA 3GU3A 3LSYA 4RXUA 2LWIA 4MUAA 1T6NA 1C4OA 3MJTA 4MRPA 1WETA 5DYYA 4XD7A 3B1WA 1CBUA 4KBGA 1DAFA 2X2OA 3ES9A 3OJXA 4IOKA 3DW3X 1CFZA 2A33A 3EW7A 3I8SA 3D43A 2KLBA 2PH7A 2M1XA 2VHXA 4RCVA 5F7XA 3RSGA 1ISIA 3OJ0A 5KWJA 4XQEA 3RYHB 1N32B 1XNJA 2P2GA 3S28A 3S2GA 2WVAA 4MCJA 3WYFA 5ENDA 1GRCA 3DL7A 3PEVA 1PWYE 5B3LA 3GVIA 3WYEA 2WTUA 1P3Y1 4YPOA 2C4VA 5AOAA 2NXEA 1LY1A 3BWVA 2P9FA 2VKTA 3FRHA 3K0FB 4FT4A 3PF8A 4RMGA 5AKXA 5L6LB 4P53A 2I6UA 3GJXC 3PA8A 3HUEA 3LXXA 4GOND 4YXWD 5TQ0A 4GDFA 4C5AA 4G86A 5TVGA 3BORA 3HBFA 3KPYA 1SG0A 4NY1A 4HYTA 1TZ2A 1I1OA 1P39A 4K6KA 4PPNA 3QXSA 4JQSA 1UKBA 3QJYA 3CRNA 3AY0A 1GPJA 4IINA 5IDXA 1GV0A 1YRLA 3G7UA 3COVA 5E1DA 5JCPA 1K97A 2DB3A 1Y9EA 2FFJA 1IWPB 4K03A 2WFMA 4CU5A 1GZHB 1X1AA 3CB4A 3HFGA 4RTSA 2J48A 2XYVA 2N42A 1E4EA 1ICEA 2IZ5A 1UBTS 3EXFB 5J1TB 5B6PA 3OO1A 3S40A 5C1IA 1TK9A 1W5FA 4LXTA 3KYJB 3DMYA 1EAMA 4MHOA 2ZKLA 3OPQA 1GOTA 5DHQA 3QJGA 1EVKA 1UMDB 2CJWB 2H1LA 1H4TA 1M6HA 1P1JA 4PLVA 4X6UA 1OF1A 5BYAA 3RJ5A 1BXRA 3LKZA 2D62A 2EJVA 1IHUA 3BA1A 4IHJB 5AVUA 2PGXA 1DWOA 1V5WA 5KSYA 4OBBA 1SXIA 3RVKA 4UU7A 4B2LA 2MINA 3HXQA 2I4IA 1JMYA 4L7VA 1P5RA 4BN0A 1WCV1 3PXAA 3NU1A 1DEOA 3IUJA 1YCDA 2QTRA 2CC2A 4R40A 2R11A 3K05A 3NBFA 1FP4B 2NUPA 4PZYA 2A67A 1WSDA 3R7WA 1XZJA 3JAWB 4OUDA 4K1LA 3SIPA 1H0KA 5BT9A 2JK1A 3L06A 3NHMA 5IMBA 3NFRA 2NO9A 1R6XA 3KXLA 2IVFA 1YS9A 3B1KA 1KAOA 1CQZA 1BOOA 1JG6A 1ZK4A 2ZT8A 3DVSX 3LA6A 1PYGA 1P45A 1UPUA 2XMQA 3AJ8A 3MLAA 4GECA 1FFEA 4PFJA 2LCQA 2C96A 4DKXA 6Q21A 3EWNA 1Y1TA 3ZNNA 3NJRA 4Z9YA 2OMKA 3E22A 3ZXSA 3QUCA 5F2EA 4PYLA 3R40A 3PDJA 4RFSA 3QWAA 5EJ9A 4AMYA 1PKEA 4MV5A 2FE4A 4US1R 4AXBA 4MUFA 4DZTA 1SD5A 5KJ1A 4QNMA 1YI8A 2HD4A 3V1YA 1PR5A 3O8NA 4I9GA 2GPJA 1TYCA 2C00A 2OAQ1 3EULA 4HDRB 3QXXA 4TGLA 5FOUA 5KKNB 3BJEA 4KTVE 4NS1A 5CFNA 4PCVA 4I4LA 5FPTA 4PYRA 4DCJA 2ILTA 4HY3A 4ZK6A 1ODCA 4JD5A 4RMNA 3EH1A 3WHLA 3UMFA 1CEQA 2WJPA 1S4MA 2ID4A 3TEMA 3RSFA 1KO5A 2X6TA 1S7CA 2GBPA 3LX8A 3R5HA 5ESWA 3LUAA 4D3YA 1D4AA 3FMGA 4E5NA 1YQQA 3DR5A 3DLIA 3IE2A 4L8GA 4XIJA 4UFPA 5EHGA 4CMCA 2Z83A 3IHKA 4EFDA 4CT4B 1E3WA 1WXDA 4GP7A 3QIVA 3UCFA 1HL3A 1SK8A 2DTXA 3KELA 3D4BA 3VR6A 1XJ5A 4XRGA 2WMYA 5HDBB 1BMTA 3KSRA 5GTDA 3U6BA 1D3AA 5IABA 3L4BC 3T7EA 4PYJA 1FDWA 2QL7A 2RG7A 3K0KA 3IP8A 4MTLA 3C3MA 4CHGA 4G0XA 3BFKA 1AMOA 2OGTA 1G55A 2OV1A 4C87A 5JEDA 2DG2A 4Q7EA 4K86A 4YJ3F 3QBTA 4H7HA 3U16A 1D9XA 4C07A 1WNTA 3QVLA 4QQFA 1MW9X 2JATA 5PGMA 1BS1A 5DBFA 4M1EA 3VYRB 2Q9AA 4QYIA 2YVQA 4JUBA 3PGKA 4U4AA 1HEYA 4RCYA 2QNIA 3F97A 3FMVA 3N75A 4GDMA 4YMLA 5JCXA 2YWFA 1W4RA 4M1WA 5AOCA 1MXHA 3GLFE 2BAGA 2XMRA 1Y48E 2BDUA 2ZTHA 1VYHA 2W8ZA 3DOOA 4H1UA 4Q00A 5AVRA 4Q3CA 1EX6A 3DS8A 3ZV6A 2PJZA 3JRWA 4IMPA 1DHTA 4KN9S 3I3SR 3EPLA 5LOVB 1M54A 2XNDD 4KAJA 5CDTA 5KHLB 2OV2A 1IY9A 1HE3A 1LPSA 2HPZA 1PT7A 5EJ2A 1DAIA 1UFKA 1RYHA 5B1HA 1XJWA 2DGDA 3UAGA 1GTSA 1IQ0A 3W8DA 3I3OA 2XXAB 2Y1CA 4DXHA 1E32A 4X3OA 4YBZA 3WMGA 1HC7A 5D01A 1JDPA 2PQMA 4ALKA 2W4QA 4ZEVA 2Q2QA 1RE1A 4GP9A 2PPVA 3M5PA 2HCBA 1G5PA 2EOAA 2XKJE 2X4LA 3ZBPA 3ON5A 5C37A 3FOEC 4HAUA 1YU6A 3IKLA 4KK3A 2R25B 1S9DA 4IRUB 1AT1A 1Q6YA 1ZISA 4IUCS 3ESYA 3X2EA 2LRHA 5L7TA 3ND6A 3O8QA 3EYAA 2Q5EA 1ODIA 1QORA 3AUSA 2PYZA 2IEYA 1G3IA 2ORYA 3RANA 5CIWA 2IXGA 4MLPA 1E0JA 1FUIA 1LPPA 1XV5A 3HI4A 1Q3TA 3C3JA 3SF0A 2PMDA 4PHHA 3EXG1 5CLLA 3BAFA 5JPIA 4URXR 4HFRA 5BMOA 1Y8ZA 1XRQA 1QJCA 2PX6A 3MWFA 5LBUA 1E63A 4DSUA 4YEDA 3R9XA 2ADMA 1QMPA 1R8SA 3RVDA 4ZAVA 4W5NA 3B1XA 3EBOA 1RFGE 3Q5DA 4KSBA 1OJLA 3W2TA 2NU6A 4PX2A 4L4YA 4UFOA 3O8CA 1E2UA 1YACA 3MMNA 3W9BA 1BFKA 4D74A 3BTVA 4ZHQB 1JQJC 4KWCA 4M46A 3QLVC 4BNDB 3VOSA 3G5MA 3TUIC 2Y1LA 1BXRB 1YAHA 3ZJTA 4AKHA 1MVLA 4BJ5A 1CUIA 2A5DA 3DDUA 3CPJB 4CUJA 2ZRCA 1PUJA 2DFNA 3VU9B 3EXAA 1UBUS 2XQVA 4MIYA 5G4KA 5IF3A 1UQUA 4BNFA 4II2A 5FI1B 4RORA 2Q9CA 1NVAA 5K0NA 5L4NA 1KMIY 2AVNA 2H4ZA 1KVUA 4GOMD 1T1EA 3QY0A 5IAKA 4AUEA 5AESA 3KQKA 1RQRA 4LZZA 3KYIB 5HFJA 4P2GA 2WILA 2Z1NA 1R8QA 3A2MA 3F6RA 3NC1C 3REOA 2QM0A 4YN3A 5AVVA 2XF8A 4KXYA 4DY4A 1A5ZA 1TFUA 1IXKA 3NDRA 5TQVA 1C3EA 4MV6A 4DB2A 3RT1A 1T2NA 2A7XA 4Q9NA 3SR4A 1RRFA 4UM7A 4RENA 2GEBA 1CP3A 4KQ1A 4Q5IA 5BSHA 1N4DA 1GYRA 1NLZA 2P2CA 4KIWA 4D80A 1YMVA 5GOTA 1GDDA 3SNHA 1U31A 3ASUA 5CD9A 3WQSB 1U3CA 3R5SA 3C1OA 3ZZMA 1VI6A 2NAFA 1M2WA 1XWFA 4GGMX 1P2UA 1Y4AE 4O33A 3T9DA 5HQTA 2YW2A 2C2YA 2FZVA 1V7QA 3EQZA 2DLCX 4GWKA 5IC6A 2ZAIA 1Z3IX 2GN6A 4PNZA 4TKUB 3WXBA 2R7AA 3FOAA 3V4RA 1E77A 4DCMA 2H2FA 1ZJWA 4EGSA 1TLFA 1T4CB 3B3FA 2ZI3A 4ENUA 4RJJA 3ZK8A 3DAOA 5KTMA 4NJEA 1AUXA 2CFIA 4RPIA 5LM3A 1F20A 3CTMA 3V33A 1NVWQ 1GDHA 5A9SB 3HYNA 2IT1A 2TSYB 2V3WA 3OEHD 4N40A 3DBRA 3KB1A 1Z8NA 3G3EA 2ZSKA 2J3LA 2OG1A 4EO4A 3R0XA 3UOAB 4CIVA 3FSRA 2R5FA 1NVBA 4N3GA 1B2RA 1GRNA 2I8CA 5ERYA 2WY2D 3P2JA 1XE3A 5SY4A 1CUYA 4X7RA 3ILXA 2GVDC 4OJMX 4BMZA 4Q9DA 1EWYA 3J7TA 5A6VA 2JIBA 3H5OA 3EB9A 3AHEA 4YCNA 5J40A 1GWNA 5IU6A 1F6WA 3SE0A 4R1LA 1G6OA 3THXA 3KJFA 3UAOA 2DC1A 4W8HA 1ID8A 2GJKA 4F71A 1HR0B 4KSCA 3F7MA 4CTJA 4LXQA 3U4QA 1ZG3A 5EFZA 5IZCA 3MGAA 2PGIA 4OFBA 3VM6A 4M9ZA 2P5YA 4GFDA 4NU0A 4Q19A 4QOJA 3S68A 3AQIA 3EZYA 1PFYA 4J1TA 1T2FA 2KE5A 3LC1O 4KAAA 2G63A 2CJWA 2J3QA 2VAVA 3USZA 2FOXA 3A1CA 4CN9A 3TBKA 4D26A 4NQRA 3MJEA 1Q83A 2EGUA 3JAKB 4F72A 5DXFA 3HYLA 4IIEA 1K2WA 4NYMR 3BDIA 3OE7D 1JIXA 4BX3A 2OHFA 2PD4A 2CXXA 1J56A 2AOXA 1JEEA 1PV1A 1Q0RA 2Z5LA 3OPVA 1KNXA 1NVGA 3AI2A 1V43A 4GYKA 3ZJ4A 1O6BA 3W78A 2WTBA 4IIJA 3SIRA 1CY7A 1YQGA 2J3DA 1V48A 3ANTA 1FDSA 2J3KA 2J4DA 2ST1A 3UJ8A 3OZVA 5K3OA 2PE5A 3E18A 5CA0B 1A82A 4Z8XA 1XDGA 3M2PA 1BFUA 1MO5A 2IF2A 3UH1A 4UDYX 3KU4A 4IDCA 5F35A 2DU8A 3L02A 4FE3A 1VYTA 4K9QA 2JD2A 3E8MA 2XB2A 2AUMA 2C95A 4U8GA 4WE3A 1C8LA 1SIOA 1J23A 3OX1A 3WIBA 4CVNA 2ZSAA 1MQAA 4RVHA 4AYTA 5BVGB 5TPZD 1STOA 3RUFA 3BCHA 3DFKA 3K1YA 1CDOA 2WAXA 3EXEB 4JSRA 3A9SA 4MMXB 2WKPA 3L8HA 4C2AA 2C4HA 2Z5FA 2ZIGA 4TMWA 4Z4EA 1I3MA 1ANKA 3IBGA 1J2RA 2NXNA 2CKDA 4HHEA 3UJDA 3KK0A 1FW8A 2BTQA 1HGXA 1USKA 2IK8A 2RH4A 4PLWA 5CXSA 1ULUA 1U28C 4X93A 2GN2A 1A8SA 4C7MA 3BL6A 3B2EA 4EAAA 4OQ4A 2PLAA 4LZOA 4NYIQ 5CDHA 1KZ1A 1QRDA 4QT4A 3PUXA 2FP4A 1UXIA 3FZNA 1B8PA 1LPNA 1AZSC 4BC0A 3NEPX 5C46F 1J0CA 4HAZA 4MQ6A 1U0FA 4O5AA 2Q8NA 1SUAA 1KR2A 1YE5A 3GMIA 4LRUA 3BRSA 3JQ8A 3LUGA 4KWTA 1ORHA 4N5HX 3V8BA 4K6OA 2CE7A 3RGGA 5HOQA 4U2GA 4E13A 5JNLA 4RX1A 5KYNA 1MZPA 1TM7E 2GS9A 5BNIA 1FLNA 3GA0A 1OFVA 3GHHA 3ZWXA 3HK2A 1WPGA 5GONA 2PL5A 4FLMA 2COKA 4G5SA 4Q9IA 5FTNA 2HF2A 3AG5A 3H99A 3R7FA 4FZRA 2HRRA 4XGQA 1XYGA 1FVFA 2I0FA 5SY6A 3DCNA 3G79A 3GLIE 5JECA 4A0RA 1U7WA 3SHOA 3TDMA 2C7QA 1L0BA 1PS0A 2PZJA 3T5MA 5LWQA 4UBKA 5EMLA 4AJ9A 1ZN7A 3T61A 4D41A 2O2GA 2JRCA 4IDEA 4OHCA 3VZSA 5DI9A 3RRZA 2X0FA 2XDWA 1T8SA 4Q1AA 3W8FA 4HDKB 3R5JA 1BCRB 3LHDA 3OOWA 3DOUA 2E37A 3T5BA 5EIXA 1LNZA 4W9MC 1HYGA 5B3JA 3WP0A 1AV6A 1WP9A 2FR8A 4B32A 3VTAA 1SAYA 4OHZA 4YMGA 5KX5A 4KOEC 5T8KC 5KHAA 4BFYA 4BP3A 2XKBA 3OQIA 3VNAA 2GK6A 3N39C 4C4AA 1C5KA 1WV1A 3FF1A 4EKYA 4O4IB 3TTVA 5KWVA 3GFRA 3QXJA 2VRCD 3PC7A 1N5MA 4RPGA 5FUMA 1CJMA 1M72A 1RQ2A 3HBLA 5FI0B 3QXGA 3GLQA 4CIYA 1BE1A 2AUNA 4FCWA 3LGXA 3WTCA 1ZN8A 4RC9A 1ZCZA 5T4FA 1ATIA 5TPWA 2XMZA 4CODB 1AKNA 2VQFB 4KAFA 4WNAA 2O2DA 1R0SA 2Q1UA 2RGBA 4Y30A 5GMOA 1I4EB 2IZOA 4OQYA 4QRHA 1T15A 2F3SA 2BMJA 4J4TA 5F7JA 3T7AA 2HIMA 3QU2A 3DTVB 4ND7A 2DSNA 4LX8A 3A6DA 4GAEA 2BFOA 4BNUA 3FHOA 3J7AC 1PFQA 4M0UA 3GJ6A 1CB7A 1Y5LA 2GMWA 5AK0A 4CQMA 1XMPA 3IDFA 2X42A 1KI2A 2D0OB 4ZCLA 2VAMA 4PAGA 3RTAA 3F1KA 4EQZA 2B30A 3JQRA 4KMMA 5KTTA 2GEUA 3AR8A 4D9BA 4PRKA 4QUAA 5BQXA 1QAOA 3ROEA 2XRYA 4ABYA 4S1OA 4UW9A 1W5SA 3G8YA 1YKFA 1M2VB 1ND5A 4MKXA 4OJTA 3DEIA 1GTJ1 1ODJA 3C7CB 1Z5ZA 4G65A 4RK7A 2BHSA 2FSVC 1O5IA 1D1TA 1UT8A 3K2EA 3L0CA 2GZSA 3KB2A 3I23A 3EVNA 3ID6C 2YQZA 3GRAA 3VTKA 5H02A 1P5ZB 1VG9B 3CX8A 4O63O 3OECA 3BF7A 4K2HA 1XK7A 4Y98A 1GGNA 4QAJA 3W5UA 5DOZA 1M2EA 3GUHA 1TF7A 3WLRA 4DG9A 4BLSA 3IMGA 3K30A 3QBEA 4MQFB 3U3MA 1DIOB 4EKGA 3TD6A 1CU1A 2CD9A 2GO1A 3HCOA 4U7HA 3OUUA 3JRXA 4RQTA 4JC0A 3PVZA 2V7PA 1BHJA 3OE5A 1W94A 3BXXA 3PI7A 4FQ8A 4XIGS 1KY5A 2ZBEA 1H1LB 4ZQIA 4KR2A 4EI8A 1IUNA 4LJ6A 1ZA1A 2AA3A 2YH2A 3C7AA 4MB0A 5ED4A 2Z6AA 4CIXA 1YMUA 5IT0A 2PNJA 3FWKA 1G5RA 4UCFA 1PE0A 2WIAA 4J07A 1C0KA 2WWXA 3W1EA 4YRBA 1E5TA 1F6BA 1XG5A 3FNEA 3HY6A 4HKTA 4JCOA 3O8BA 4DL9A 4IAOA 1LWNA 1SU8A 4Q66C 1I6KA 8ADHA 1WJGA 2Z8YM 1BJKA 2GLXA 4TMFA 1GG9A 5U4XA 3OX3A 4PCUA 3HTXA 2G9RA 5DIZA 1XEXB 1U80A 3H97A 1D2MA 3EN0A 3QPDA 5DVZA 3VJMA 1XJCA 4BDTA 4P4TA 2P9GA 3A8TA 4CMEA 1ZNQO 4HG2A 1K08A 1Q21A 1N0UA 3LY5A 3T5GA 3D3NA 4LXHA 3FWPA 1YVEI 4MP6A 1Y4UA 2VQDA 3LDFA 4FFSA 4LKOA 3RFXA 3G9UA 1WR8A 1J00A 2B9EA 4TRMA 4IJ6A 2ZJ2A 1U7ZA 3DOHA 4QDXA 5AMXA 5K8JB 4YTEA 2K6GA 1PNTA 4M1MA 3MINB 4KGDA 3AMVA 1D8TA 4N4AA 1XA4A 3O84A 2B1IA 2C99A 1X7HA 2AOUB 3C3WA 4WOJA 3W2HA 1BZYA 2VK4A 4BJHB 2QVCA 4M0FA 3WLLA 4P4GA 1XRNA 1GRVA 4YR7A 2AD5A 2FV8A 4XVQA 2E82A 3MCWA 2VDRB 1KI8A 3AZQA 3CINA 3SCZA 1A5TA 1XRLA 1CG6A 1M66A 2QUZA 3PUIA 1X7YB 1DKOA 3QTTA 4EUSA 3GFGA 3FFWA 4JBGA 1B8VA 4OMFG 4Z49A 4O1HA 3L41A 4G07A 5LIPA 1Z0IA 4L07A 3FB4A 4GI2A 2JF0A 4Q02A 2BHLA 3PUWA 3UJPA 1UZUA 2QV7A 1FW6A 2EG5A 4Q05A 1D6JA 5JALA 3VZDA 4YMWA 5BY2A 4NESA 2VYQA 1NAIA 2J85A 1U0HC 2V6BA 3VJRA 1YTLA 1DUIA 5AI4A 1XQ6A 3OKPA 2NU8B 5DTEA 2I1QA 3TXYA 4J16A 1QMGA 2VHEA 5G0UA 5IWCA 3S8MA 3NMUF 4BWYA 1BMFA 2CV1A 4OGLA 2ET6A 1T3LA 3DL2A 4JZYA 4O2BB 4TYQA 4YROA 1NN5A 4ZZ1A 3AF6A 4OQQA 4CQNA 1I7DA 1I80A 2Q9BA 1KI1A 2GBFA 1PFGA 4FHCA 4TVBA 4V1CI 5CG2A 3WLPA 4DJTA 1IB0A 5EVCA 2XIQA 3V1MA 1A8PA 3ZHXA 1H4QA 421PA 1ZRMA 2ENUA 4RADA 4PZAA 3DO5A 4AKEA 3D1JA 5JZBA 1U3WA 3EGXA 1K7XB 4ZCTA 1SCBA 3B6JA 4ZK2A 2AQIA 2X4IA 3ERCA 3FYHA 3SQXA 2VNJA 3RQIA 2OXEA 5DN9A 3KCNA 1HE2A 4JB2A 1G5FA 1PK9A 2Q46A 2RG1A 4MI1A 3OQOA 3H11B 4HNAA 4TROA 4N39A 5HVNA 1N7GA 1RJDA 4PC2A 1W85B 2WUDA 1X39A 4FYXA 1XNQB 5FPKA 3PBKA 3UOGA 3A3NA 2V4MA 2O2ZA 4ZU6X 1W5TA 1ZIPA 2QRUA 5T57A 5KNBD 4IZIA 2DOKA 4M0KA 4QU9A 4QG3A 1K92A 3EXHA 1ECGA 3F47A 3VHXB 4CI0B 1XVAA 3PR2B 4MI3A 3KZVA 1F51E 2AUTA 5DTMA 3X1MA 2L17A 5CEFA 5JOQA 1QGED 4Q3AA 2JIOA 2G67A 3BSYA 3F5MA 4M8KA 4C9BA 2ZU6A 1DB3A 4A2CA 7GPBA 3OFND 1SNYA 4GD3Q 3KEMA 3PYMA 1KQOA 3B6ZA 4NH4A 1OAOA 2H0RA 2ZTVA 2BF4A 4KMSA 3ZVNA 1AK9A 4R8RA 2IDJA 1IIRA 4J8PA 4AJ1A 4F5EA 1OC4A 2JGIA 5K8IA 1FDUA 1H93A 1HDEA 1WMDA 1NYQA 2D8AA 2IPMA 3U5ZB 1RXWA 1KYZA 5FP0A 4XM2A 4EO7A 2PCJA 3QU7A 5E8RA 4QM7A 3JZAA 2JFXA 1T43A 5ALOA 3HPRA 4O4JA 1BGXT 5HS6A 3VV3A 2CGEA 1K98A 3WBJA 4AQDA 4C7OA 2QSYA 3ADCA 1KMQA 3ZBQA 1Q7EA 5IT9A 4FI3C 3W8EA 2II6A 3RS5A 5K99A 4ESVA 1E18A 4AJOA 3GYBA 4QU0A 4RK1A 1U1FA 1X7XB 5IXYA 2BM9A 5DHSA 1JKJB 1W88A 2AG5A 1I4DD 4ZEOA 3UVEA 3RS2A 1Y7TA 5ABPA 1CZRA 2FU5C 2OCDA 1DJQA 2A0WA 2CYCA 3BIFA 3R0QA 5IARA 5LXTB 2JJ2A 5JAZA 1CRZA 3ZCVA 2NVBA 1V8OA 4QUIA 4FC7A 5CPBA 2AI1A 3ZU5A 3OP4A 2YY7A 4ND6A 2PUAA 5LC1A 1KQFA 5U4QA 3MN1A 1IK6A 4PYMA 5LZ8A 2C97A 5BOVA 4RHXA 2C4TA 3ZIAD 5FI3A 1GU0A 1PGQA 4HQNA 1UEJA 2BFNA 5JMOA 1O97D 3HLKA 5JSYA 2RCNA 1R16A 3Q6MA 1RC0A 1DE0A 1FFHA 1TQHA 2F1KA 1UWCA 5FPSA 1NLYA 3K31A 2OQRA 2GBCA 2QAIA 3N1UA 4KRYA 1FFXB 3EUFA 3CISA 1NC1A 2GKOA 3E1KA 2C94A 4FJ2A 3ZH2A 3TWOA 4BNKA 3FGOA 3KUKA 1M1YA 3PI6A 4HH4A 5IVDA 2IQ5A 1VMAA 2IIQA 2PKQP 4PHCA 4AMVA 3T38A 4BV3A 5CA1B 1JU9A 1U7OA 3OJFA 1EQUA 7AT1A 5KYKA 2VTBB 1PHPA 4BNWA 2P4HX 3TIXB 4TQ9A 1WD5A 3FSGD 4AUKA 3WA7A 3DMNA 2B4YA 3TQOA 3G6WA 1THZA 3I5UA 4M2LA 5HA5A 5A4IS 3FAKA 3HADA 1UC5B 4FPXA 1GUFA 4FINA 5BSKA 1M2HA 4MDEA 2HQBA 5C4GB 1H0HA 5HOEA 3EG5A 3RT7A 3LXUX 2H18A 2HWUA 2C3MA 4ZI5A 4JA0A 5H7XA 1P8JA 1CJCA 1MVNA 2J5RA 2OHGA 3NXSA 3P9QA 3WFJA 4AU1A 5JCJA 1WBBA 2H7VA 5EI5A 1HF3A 3H4IA 1V45E 4Z53A 3A70A 3QVXA 1U4NA 4KNWA 5L3QA 2XOKD 4L6AA 3P2KA 2IYSA 2ZWOA 3FD8A 1E2NA 5JSQA 2PKWA 2ODBA 4MDFA 2Q4OA 3DAGA 2VDQB 1A98A 1UCFA 2YXLA 3LFUA 2D2VA 3I6MA 1DJLA 2XCOA 3KKNA 5JYCA 2DR0A 1OH5A 2RGRA 1R0ZA 5E2BA 5IBQA 2Q1YA 5FB3A 3W3AH 1IN1A 1XXLA 1YH3A 3QKRB 2BPOA 1EEXB 3CR3C 2W00A 3D31A 2HJHA 3HKCA 4MZXA 3RIEA 3BF8A 3I9V6 3SHWA 3ZGYA 2PSSA 1SCUB 2W37A 3HZZA 3PE4A 1RVDA 5AHXA 1OHHA 3B2QA 1N5DA 1XU7A 3VO9A 2J0EA 3R9KA 2P4UA 3U80A 1D0VA 4FMDB 1UL1X 3UMGA 4BL5A 3L7OA 2IW3A 4LJAA 4QPDA 4S1PA 1WXQA 1WEHA 2VBFA 3GT7A 4N41A 3QWBA 3W0LB 1HFEL 2EWVA 1Z39A 2DUMA 2X76A 3H7AA 3RV3A 4WJLA 1VKRA 1U7HA 3NBAA 3M9XA 3SXPA 2HPHA 2PNFA 2IHBA 4OM7A 2FMHA 2OLEA 4LXUA 1RRGA 3RT9A 5A7HA 1J8YF 1UJ2A 2BZ1A 3K0BA 1D03A 3WI7A 3VSDA 3W6NA 4BVAA 5E9JA 2MT9A 2VUIB 3K0EA 5E7MA 3W6ZA 4FE4A 4L28A 4R0VA 2MJLA 3PHHA 3HM9A 3D4IA 3V3TA 1DBRA 3QK7A 4LJ7A 3GPCA 3NLLA 3PVSA 3UK0A 1YZTA 3QG1A 5EKDA 3UMJA 5C1DA 4K28A 2JLVA 2RIRA 1U8TA 4UM9B 3B3AA 4XR9A 4I1SA 3W90A 5JO0A 2RMKA 4UTZA 3SOPA 1HH4A 1KK0A 1LJUA 4YUVA 3S2UA 1TO2E 4BTVA 4ZOBA 2V59A 4CV0A 1USUA 1E6EA 5B5SA 4P0QB 3Q2OA 4C6SA 4ZYUA 4F7DA 5C1OA 3D7SA 1EUCB 3K2IA 4JBNA 4CM5A 1CKEA 4KH0A 1YB4A 4MP3A 4DS3A 1ZM9A 3WQHA 3ZWAA 1XEXA 1XZNA 2DERA 3MWDA 5ANRB 1JYSA 4JJ6A 4LZNA 1C29B 1NXQA 1TYBE 1QB8A 2BEUB 4ZAWA 2HMVA 2GKSA 2XPCA 3AHGA 3DCJA 2XTAA 1G4AE 4HI0E 3AGQA 1TVKB 2ARKA 2W2LD 1JAXA 3NHZA 2QAGA 4UREA 2FRDA 5E6RB 3ZXIA 3ZZUA 4P84A 1J07A 1THGA 2XVXA 1G2OA 1PHRA 2G6TA 3AM3A 3LQQA 4B87A 3I9V1 3SVLA 3P32A 5EG5A 1NXWA 2JVKA 5DCWA 1KMHA 1ZLXA 1DHRA 2I2AA 3MRXA 4NBRA 4M21A 3R5FA 1E2GA 1Y9JA 1M83A 1L8QA 1SC1A 3IAEA 1H1LA 1Y3BE 3D4NA 3GXBA 1QGAA 3TIGA 3ZUGA 4DQLA 3O8RA 4U0JA 2QMEA 1P61B 4B1FA 4QVGA 2A2ZA 4LHXA 1FFGA 4L7QA 3PPVA 4FEYA 3VOBA 5K4HA 1POWA 3SYKA 2UAGA 3UAWA 3QA9A 5J2UF 2PX5A 1SVWA 3KDAA 4HTFA 1U1IA 1Z5WA 2QUBA 3HDHA 3L40A 4L8LA 4ZFNA 4ZGWA 5CLGA 4IDDA 1YJQA 4QOHA 1C4WA 4UM9D 4V1CB 1J2TA 4DPMA 8AT1A 1T9HA 2QLJA 3DNPA 4ZVRA 2QR3A 1UBEA 3ELWA 3QLUA 1P9WA 1FRFS 4C7JA 3V9PA 1KQGA 1C3JA 2IEGA 3GZTB 3JASA 3HHEA 1T8PA 4YJ2F 1RI4A 1SCKA 2KMLA 5LSAA 4EHLA 3QZUA 1NBOA 2OG2A 4BP9A 4DDWA 1XXHB 3A1SA 1P80A 1UOQA 3AEYA 3BWXA 5FPYA 3HU1A 2JKZA 2IBSA 5CH3A 3DT9A 4WWHA 3SYMA 2ZBQA 5B3JC 2F17A 2LBPA 3DTYA 5JNUA 5ICGA 2Y4NA 4X8MA 2HO5A 3JWEA 4EECA 3MRVA 4ZI3A 4RJKA 1E9VA 1FJXA 2ZB3A 3ESRA 4PAWA 3OX2A 1EUQA 2NU6B 4MUHA 3VNVA 4RIHA 1T8RA 1P7YA 1FSFA 4IV8A 3PIRA 4Q7KA 1IBLB 1LPMA 4MQEA 2G0AA 3HJTA 1KYYA 3NJ8A 3R3VA 4GO1A 4M7PA 4UD6A 1RQGA 1PJTA 1VGRA 5LQDA 2HFKA 1K6EA 4RJ2A 3GW8A 2X0NA 1E5VA 3TW0A 3M4YA 1PR1A 1GGKA 1G21E 3RF7A 2WK1A 3GRRA 2I1WA 4F84A 5EN4A 1X92A 3IVCA 2WWGA 4YRIA 1MTZA 2BUBA 2M2IA 2P2LA 3LQFA 5JAUA 1J42A 4PNEA 1F48A 3PNYA 3Q2IA 1VYUA 3HKCB 1KOFA 1MOSA 3VR1A 4HXEB 3ZWCA 4IUDS 1DO8A 2YC4C 1CR2A 5F9MA 5BMVF 2WV7A 3OQIB 2QPAA 4KYIB 4LSGA 1WMSA 1GCAA 3TQHA 3B9RA 4JT4A 3G0DA 3H9EO 4JSTA 4MS1B 1Q50A 1ZUWA 2RH9B 4CM4B 5IKXA 3VDMA 1W25A 4RWZA 1KP9A 1OLXB 2IZ7A 3HWSA 3I05A 4F6RB 3ONNA 4IKOA 1XRMA 5CCEA 3VXKA 4RL6A 5E0OA 4ZEWA 3ZHUA 4PLZA 3ZZNA 1O08A 1JDSA 2V5VA 1T9DA 1TZCA 5ALPA 3QENA 2Q7XA 4KQFA 1UEXC 2QGZA 3AEQB 4PNHA 3RYFA 1AN0A 1UBNA 4WAUA 3HCFA 3JQDA 1H2ZA 4TXJA 3U7QB 4KNVA 1Y6GA 3ICVA 2ERXA 5IN4A 4B2IA 2Z2ZA 1NW6A 1N8NA 5IVKA 4CQMB 2SKCA 2UUAB 3EASA 1CF9A 2XQIA 4GX2A 3F96A 1NV8A 3FPFA 1SR8A 1XZ8A 2I80A 4BVBA 2BFDB 2R1TB 1HE8B 2QZ4A 1TVEA 4G0UA 1GTL1 2V5AA 4MCIA 2R79A 2R1UA 2BJWA 2WLTA 3CH6A 3LC0A 3O1HB 4HDMA 4MKZA 1I3NA 2CK3A 2OCKA 1Q1NA 1EHYA 1KDRA 4INAA 3U61B 1SUEA 1DC4A 2PSEA 4GMFA 5D7NA 3H9QA 5HJ2A 4YCCA 5JADA 4MVYA 2Y67A 5I7HA 1ENOA 1RJ9B 2ZRLA 1UH5A 1VHJA 2A86A 2XJ9A 1FBNA 3HVKA 3CLRD 1TM5E 1RIIA 1XTQA 3GLFA 2CMKA 4JVLA 1KC3A 1UDWA 2RHMA 2CNWA 4DADA 2QVBA 3VA7A 1XRJA 2QUKA 3ZUPA 4CF5A 1NHGA 4K9MA 2VCYA 2C5FA 2XSZA 3KVYA 3Q3CA 4KN5A 4MO9A 2FZ4A 4OXYA 1ISJA 2G5PA 2DVMA 2R8EA 5J43A 4ZARA 3SR0A 2JA2A 5E38A 2DKFA 5K7SA 1Z0KA 1AA6A 4CJXA 4F38A 3DTTA 2PS9A 2I33A 4GPAA 1SKYB 3WGZA 1OV6A 2WYIA 3ADKA 4EEZA 2PLFA 4RBNA 4FMCB 1IIBA 1RQ7A 2WM2A 1EHCA 2AHRA 1XZFA 3KZMA 3LVBA 1KSHA 4EGJA 4NCNA 4YJGA 1JPUA 1KERA 2CDAA 1Z28A 3WRXA 4HMPA 3LTEA 4Z2AA 5B12A 1EUDA 1U2TA 1N0WA 1LEHA 2DFVA 3AXSA 4LHVA 2IY8A 4LJKA 1DQYA 2G0NA 3DWIA 3ANLA 4WLNA 2B4AA 2LKDA 1GUDA 3IC5A 4WBNB 5CVTA 4J1NA 4LYGA 1ONBA 1X9GA 2VP3A 3HJBA 4NVRA 4WK4B 4J6EA 1P9RA 1X1BA 3BWYA 4FZ5A 4G0PA 4UEOA 1YS6A 4YJ2B 4OKSA 5AJUA 1O58A 4PNPA 3ZHTA 4Z1MA 5EEHA 1GITA 3FUXA 2HQRA 4PC6A 1I7NA 4EUFA 4PONA 4Q82A 3N6VA 4TWZA 5K05A 2CD7A 3HUFA 1CR4A 1Z22A 3HNOA 1PEDA 1V71A 1N6RA 2FSUA 2OTCA 1ZZEA 4K6GA 4OQPA 4TSFA 1KMMA 2J32A 4WINA 4HLQB 2O8CB 5CA1F 5LQRA 1XLUA 2DUWA 4FBLA 2QT0A 1IBCA 3ELUA 1GY8A 3ZBUA 2E48A 1ZUD1 3L0PA 2J9RA 1W5EA 2P9YA 4JLPA 3PNSA 1EGAA 1YR2A 3C3PA 3OMWA 4JP1A 3JQ9C 3FVRA 3G8AA 2FPPA 4AROA 3DDZX 1FNCA 3HBNA 4B43A 4NK4A 4N0PA 3I32A 2QRQA 3H2GA 4XGNA 2W9XA 2GBLA 3DMTA 3DONA 3GLHB 3NEYA 3ZI7A 2VSXA 2DR2A 2GQ0A 4PZDA 3DF7A 3N2ZB 4G81A 2IX3A 4R9RA 4DCSA 4G25A 1TMYA 4IQGA 1D2EA 2O52A 3GLGE 2YMMA 3JZMA 2R6JA 3H05A 1R9JA 5BXQC 3N3BC 3JPWA 4BZZA 2MSLA 5JSKA 3VISA 3C97A 1COWA 2NWQA 2ODAA 2PJRA 4JP5A 3TINA 2PDAA 4E15A 3AOEA 1KWGA 2CCKA 3SE7A 3VNSA 5IG2A 1BN7A 1Q3KA 4PZ9A 1KAMA 2Z30A 2G1PA 3IT2A 1WB5A 4UOZA 1E9BA 4CKCB 3NYRA 3ER8A 4KFUA 2WHXA 1ESEA 2O1EA 4HYQA 5JAQA 4PXAA 2RJ3A 2YDXA 3WGVA 5DSXA 2AS0A 3G2OA 4G5RA 1T3TA 4JWTA 1M2OA 1NKVA 2WA2A 5B6JA 4C4ZA 4RXTA 1YRYE 3ZW8A 2ZIEA 4PGGA 4AUNA 4BO7A 2PZLA 3DXFA 2JLWA 3G0HA 3PXXA 1K8XB 4F2HA 4CM8A 1WB9A 1QOQB 4Q16A 2AG8A 3FKJA 1J9GA 4B9AA 4GKJB 3HMKA 3E3OA 3MS7A 3KIPA 2Q1SA 2VUTA 3A4IA 3QQPA 1P2DA 2C4UA 3A4VA 3LV8A 1WBDA 4R41A 4ATNA 4HO1X 3RDPA 2XZLA 2BGRA 2ZSBA 4WKPA 3HGMA 4G8CA 3MUOA 1X7ZA 3UAZA 3C3YA 2BFDA 1W8IA 3KYCA 2ACVA 3V4FA 2UYCA 5JI3E 3BXGA 3TOCA 3MT9A 5BV7A 2QOEA 4Y0NA 1NOJA 1A1VA 4JP2A 4O1IA 2QXTA 2OO5A 1H5UA 4HNHA 4B2YA 3GC6A 4EITA 3U7QA 3NTUA 2YY6A 4W63A 5IP5A 1A9XA 4NPCA 1KJ8A 2W6QA 1F2VA 5CLQA 3HCNA 4HEJA 5IKMA 3LA8A 3OZGA 1FTNA 2CLHB 2DBYA 2MYUA 2XVYA 3VU9A 1QFYA 5I9MA 4UUNA 1Y82A 5CCBA 2UYHA 3ZQ4A 1Y8CA 1OXTA 2I4OA 2QQ5A 1BRMA 2G9UA 3CM0A 1I4TD 1OAAA 1RQNA 2HDOA 3K9LA 3LPDA 4JLDA 4KO8A 2JJYA 3QVJA 4L4RA 3ZVKA 4BNLA 3TH5A 4YX9A 4A6EA 3LLCA