4M0PA

Crystal structure of human prs1 m115t mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
304
Chain Sequence
b'NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANTLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
molecule tags Transferase
source organism Homo sapiens
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
total genus 93
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA02
4X45A 1TC1A 2IGBA 4P80A 1P18A 4LYGA 1GPH1 2VFAA 3M3HA 4F8EA 1ZN8A 1J7JA 2DY0A 1CJBA 4LYYA 1ECFA 5IPFA 1BZYA 1IBSA 1A3CA 4WN3A 1XTTA 4RANA 4PFQA 3N2LA 1A98A 4RABA 2GEBA 4KN6A 1U9YA 4RHTA 4RACA 1QK3A 4JLSA 4LZNA 4P3KA 3DEZA 4P84A 4P86A 4M0UA 5HIAA 1A4XA 2HCRA 5EUCA 2PS1A 1OPRA 4RAQA 5KAMA 1ECJA 4IJQA 5KAPA 2C4KA 1WD5A 1DBRA 4M0KA 5BRNA 2YZKA 5BSKA 1GRVA 1XZNA 3QW4B 1D6NA 4JITA 1I13A 4RHUA 4MB6A 3MJDA 2JBHA 1A95A 1Z7GA 4X44A 4RADA 1P4AA 1ECBA 1O5OA 3HVUA 1L1QA 3DMPA 1NONA 4P81A 5BQPA 3DAHA 1XTUA 4PAWA 1QCCA 4RHXA 2JKYA 1G2PA 1XTVA 1OREA 1V9SA 1XZ8A 3O7MA 1QK5A 3LRTA 1ECGA 3OZFA 1PZMA 3KB8A 1OROA 3OHPA 1UFRA 2XBUA 4QYIB 1VSTA 1ECCA 1P19A 5JSQA 1DKRA 1ZN9A 1STOA 2P1ZA 4P83A 3G6WA 2H07A 5BQOA 3GGCA 3NAGA 1QB8A 4Z1OA 1L1RA 1QCDA 1QK4A 4TWBA 4RAOA 1BD4A 2EHJA 2WNSA 5E38A 1VCHA 1DQNA 1VDMA 1DKUA 4S2UA 1YFZA 1TC2A 1G2QA 1W30A 4RHYA 5ESWA 2H08A 4QRIA 1UPUA 2PRZA 1HMPA 5JV5A 3GGJA 4LZOA 4RV4A 3GEPA 3MBIA 4M0PA 2H06A 2PRYA 3H83A 1NULA 1I0IA 1G9SA 1UPFA 1ZN7A 4FYMA 4RQBA 1A97A 2JKZA 1P17A 2AEEA 2E55A 4P82A 3ACCA 1FSGA 5K51A 1I0LA 1JLSA 1LH0A 1MZVA 4RQAA 3ACDA 4LZAA 1I14A 3OZGA 4WMLA 1O57A 2JI4A 1G9TA 3EFHA 1HGXA 5ESXA 1A96A 1DQPA 5IAOA 1R3UA 4OHCA 1BD3A 4ZFNA 2FXVA 1AO0A 1I5EA 3LPNA 3S5JA 3ACBA 4QYIA 1Y0BA 5HKLA 1JLRA 1U9ZA 1QB7A
chains in the Genus database with same CATH superfamily
2DFLA 3BAZA 1MQAA 4LYGA 4XUEA 2FR0A 3M3HA 1EX9A 1QHHA 3OP1A 4HMOA 3DZDA 4MQMA 4RK6A 3PEUA 4TV9F 4JDPA 4H9GA 1HKUA 4GOJA 1IBSA 1T5OA 2CF5A 4UTVA 3M81A 3ZDYB 1L7NA 2FZVA 2WWXA 4EP1A 3EUEA 2RHJA 3AR8A 1CNEA 1X3LA 1Z68A 2Z8YM 4R1UA 3CU5A 4MB0A 1DUIA 4BVEA 2AB0A 4IOJA 3RIXA 1J21A 2JJ8A 5CA0B 3FNBA 4KUHA 2UKDA 4PM4A 4YP6A 4I14A 5CRIA 3U80A 2JFHA 4PFKA 2G09A 5EA2A 3K71B 2CJPA 3IUBA 4L0DA 3NXSA 1P31A 5BNWA 1FZTA 1J7KA 1IZ8A 1ODCA 2B25A 3JD4A 4Q47A 4QGFA 5K3FB 2BY4A 3UYLA 1V0JA 2P2GA 4H6WA 5AI6A 2ZPAA 4RIFA 1XPRA 4L27A 3KTAB 4JX8A 3IIIA 1VP9A 1XVUA 1KMHA 3IQGX 4OAQA 2Q0XA 1L5LA 1ZHOA 5GY7A 2IA5A 1NKVA 4WZBA 1Q3KA 4AURA 4HJRA 5B7GA 1L9KA 1QF7A 3I73A 2ORIA 4UHCA 5HS6A 3DLHA 4N48A 4OUDB 1S8OA 4BQEA 1DDOA 5U9CA 4IJUA 4QICA 1P9WA 2FA9A 2QLJA 3FDZB 1AE1A 1JZQA 1XTRA 3PQEA 1J25A 3T15A 5FORA 4HDAA 3BH6A 3HCFA 5JSFA 2ZP1A 4DRXA 2YW2A 4GI2A 3UHPA 3TRFA 2JJ2A 2IBSA 2HLDA 3PQ4A 4B83A 2RGAA 3GB9A 3M82A 2XXAB 3VSEA 1N1DA 2VTKA 1UXJA 4F6CA 4O29A 5E9AA 3TMAA 2Q1UA 1UFQA 4IGEA 2PAAA 5IBQA 6NULA 1CY0A 2OUIA 4IRXA 3RK4A 4MWCA 4B3DA 1WCIA 4CM8A 5HP4A 4EFLA 1AQUA 1MVNA 4J16C 2HM7A 1P72A 1T1JA 3EUWA 3V42A 2WJHA 3MGAA 4BQFA 1P75A 1ZICA 5CA0A 2VLIA 1CX9B 1SCAA 5JSHA 4ITRC 5LD2C 3FKJA 4RWEA 7ADHA 1G291 2X0KA 5T64A 4TTTS 1YCDA 1C80A 3QXCA 4OQEA 3KKLA 1HXHA 1ZD1A 4B7UA 1JEQA 4RJ2A 2AXPA 2CLLB 5ERGB 4BBAA 3I8SA 1Q95A 1KEWA 1OGYA 2X8AA 3HP4A 3R6DA 4D3SA 4Z51A 5I9TA 3DGFC 2JEOA 4PWZA 1LNQA 1T9CA 4FBLA 4OHKA 1U0FA 4N7MA 2AD5A 2GCOA 3SS9X 4YASA 5TV2A 3BG5A 1EXDA 6ADHA 3OQOA 2CBGA 3ESQA 2PEZA 4PXYA 3SM9A 2C78A 4ZTUB 2BELA 2EVWX 3AG6A 4D7AA 1GT91 3F7TA 4YRIA 1AQLA 1GYQA 1TJNA 1H2FA 2XJ4A 2Z5FA 3HM2A 3I3SR 4ML3A 4O4LF 2BBWA 2IVZA 3UPTA 3EFHA 1GR1A 3DFFA 1ODJA 4HNRA 3EGCA 3B53X 3OCJA 3PVZA 4MDHA 4YQYA 3HU1A 3FMOB 5E1DA 3I8OA 3M5CA 1XB2A 1BWPA 4F7WA 4Q16A 2IBMA 4EKDA 3PKJA 3EA0A 3FFWA 4I9NA 4ZCLA 5F98A 2AYXA 1ZRMA 3ESCA 1E3SA 4UHKA 2E5LB 1EVQA 1NNI1 3HJHA 4Q3CA 4II2A 2YC2C 2Y67A 3KCQA 3PXEA 3RSLA 4YYZA 5J2UA 1MO2A 1T5HX 4ND7A 4BUZA 4F9FA 3MHTA 5JPCA 4XYBA 1T1IA 2X41A 2B0JA 2C5BA 3A3PA 5D5PA 3ZHTA 1TMGE 1U63A 2NMVA 3H5TA 3OFJA 1TU3A 2Z1NA 1SUCA 1VKHA 4DPKA 4A9AA 1BRTA 4QDXA 4XGIA 2TMDA 3CX4A 2VQFB 2EV9A 4BLOA 5H80A 4NOKA 4B45A 1TAGA 5M04A 1OXBB 1Q77A 1G60A 2XZPA 1WBDA 2PH7A 4QBTA 1L7AA 2OP1A 3OLXA 5EWLB 4CCYA 2F8TA 5AVZA 2WPDA 4X71A 1KOFA 3T12A 4CEJB 2NZ2A 4ZC8A 2V4UA 4I7EA 2BR5A 1LKZA 2BL4A 2FUCA 2A1IA 2GETA 3NWBA 3GZNB 2BFAA 5GM1A 4J4BA 1MT3A 1K75A 4C43A 4B6PA 4JMLA 2GSWA 2B6HA 1VE1A 3DH0A 1PKXA 4DNPA 5I01A 1XF9A 2DWPA 1GRVA 1PUXA 1NN5A 1Q1GA 1ZITA 2F90A 3CR7A 3OZSA 4Z9AA 4ZREA 5LOVF 4GR4A 3WMXA 3P0JA 1E7WA 5DIFA 4QDUA 1KTVA 4H31A 2FEWB 4HT3B 3CZRA 4ND6A 3JCZA 1CU1A 2PBZA 3RRBA 2FRXA 1T9KA 3BM5A 1Z6ZA 1FPMA 2PKQP 3IOMA 2ZJAA 3DVAA 6PFKA 3ZE9A 1O1YA 3B1FA 4Z9XA 4MSUA 2EF1A 4YMHA 1IXSB 3OQHA 5ALYA 2NLOA 4EDHA 4ER5A 3LRXA 5CNKA 3DV0A 2NGRA 3X1XA 1SBNE 1A8SA 5EWLA 1GNQA 4HGRA 2QB5A 1T5DX 1DRVA 3RTDA 1TCVA 2FZWA 4RETA 4X95A 2AFHE 1GN9A 5IVHA 5F21A 3WDSA 2I71A 2SBTA 3DZIA 1BXRB 1A9OA 2B92A 3EFOA 3HGMA 3PC2A 4JSRA 1CEXA 3AI2A 1SBZA 2ZS7A 4U39A 3OIYA 5BOSB 3G2LA 1QIFA 5B36A 1VPEA 2IYWA 4H3SA 1IHYA 1WSAA 2IEBA 1LK0A 1DX6A 4RPKA 3RJTA 2KQUA 4OIFA 1V3TA 3E3OA 1T6NA 2FMIA 5HMLA 4IYRA 3QIVA 3FYHA 3ND8A 4I3FA 3Q5EA 2QVLA 3EXG1 1AN9A 3FAKA 4N3NA 4XUGB 3VZQA 4D45A 4GZ3A 5FDFA 3GLUA 3HO1A 2FP4A 1Y33E 1DWPA 5DM1A 4JKIA 1IOZA 4DDVA 4PX3A 3IURA 2J9XB 4PLYA 5I9MA 4CT4B 1XTIA 4EHNA 4LDAA 1U99A 4X1KB 1M6YA 5FBLB 1P9LA 2VIIA 1OAOC 1OI7A 2HPVA 4HQKA 1JEQB 1Y48E 2X77A 3GZTB 4TVSA 3TW8B 1QO9A 3I72A 4HYTA 5K6RA 3O4IA 1AV7A 3V2UA 4C0QC 2X0RA 2WPDD 4W9RA 4FMBB 3QWIA 4K03A 2O7RA 3EVGA 2NUAA 4DCSA 4KN8A 1X14A 4O1MA 5SV2A 2AJCA 2FFJA 3MB5A 4NJEB 4BUJA 4NVRA 1Q0RA 3WSVA 4GM1A 1Z29A 3ZXXA 3D64A 5JAMA 2I7TA 3KKMA 3N87A 4PPNA 4BZPA 2XCTB 3B6KA 5M29A 1PK8A 1XYVA 2HYDA 3DV9A 4ESVA 4XVQA 2WE8A 1CVRA 1J5PA 4IXDA 2BKAA 2NSJA 1K63A 1SQ6A 1VSVA 1XCLA 2A9PA 3UJCA 3T1QA 4DAEA 3BRWD 2XQJA 1TXGA 2BM1A 1GFIA 3C70A 3MJRA 4CUKA 2Y77A 1EE9A 4KN6A 2AFVA 1R0KA 5IMBA 2CXUA 4ER3A 2J08A 1QQ6A 3KR9A 5G0UA 3LYUA 2OBXA 2MSDB 4LRTB 1F7UA 4M1EA 4BATA 1Z5VA 2GK3A 4TV9A 4H1TA 3K31A 1NVAA 4KWIA 4AC9A 4EI7A 3TTTA 4F6RB 4YMGA 1RWPA 2JH9A 4WY8A 5C2JB 4F4CA 5PNTA 5JZOA 1MA3A 1XNHA 2ZB7A 4AF8A 1UZMA 1PJLA 1Y1TA 1AHPA 1H9CA 2XD9A 4BX2A 3H2GA 2AE1A 2O7QA 2Y99A 4CMEA 1WV0A 2NW6A 3ASYA 3LBFA 4D9MA 1K5GA 3MG9A 4KXMA 4B7CA 4HYEA 1YFLA 4N8EA 1DKPA 2ID4A 1MX1A 1SA0A 3CG4A 3GD5A 1T3LA 1XO1A 3JS5A 3KSZO 3SSAA 1BGWA 1FMLA 1MABA 2JVJA 3F5DA 4GW3A 4NBWA 5AO9A 2QROA 2EZ8A 5JPDA 2BH2A 1UM9B 4I1PA 1L4BA 1OSNA 1IUNA 1O97C 2QU7A 4Y9UA 5E1MA 4ZVUA 2B4YA 1VKZA 4IMJB 5EUBA 5LQDA 1EGAA 1E1QD 2WU1A 3HLYA 2QTTA 1F8UA 2OP0A 2I62A 1FSFA 4YUXA 2JJ1D 3BSFA 1IPHA 1LI5A 3A1UA 3O9VA 3P4UA 3RWOA 1XXHA 4RVSA 1KRWA 3KOYA 1G1MA 2ZUUA 4G2NA 2HJGA 1PFGA 4ZOBA 1XP5A 1KPHA 2V5VA 4I1RA 4PC1A 1Z0ZA 3CX8A 1DVRA 2NAFA 3RDPA 3RFTA 3E6AA 1Q19A 1X80A 3DMTC 3HU2A 1C3OB 2CB0A 4I4LA 3L41A 4V3CA 2B8JA 3E7DA 3NNNA 3NRJA 5CT5A 2ZBRA 2IPLA 3EARA 3V46A 3QMMA 4NFSA 4P98A 2IX9A 2G9NA 2X0EA 4YB8A 4D9KA 1NMEA 5GIOE 2H1SA 4HQ0A 2ODPA 3QUAA 3UMSA 2KPOA 1DQZA 1LSSA 4CN8A 2G83A 1EJ0A 5KYNA 1EK2A 1M76A 3GJRA 3WFJA 4ZKDA 5FPKA 1SOVA 4M0PA 3OICA 4AG3A 4C88A 4DUPA 2R47A 5C18A 4CLOB 3EG9A 4D2IA 1QXSA 4Z2AA 1YAJA 4MVJD 5AW9A 2LV8A 1WMEA 4F11A 2ZBEA 1VYTA 2R8EA 1GGKA 2A8YA 1VHQA 5IAJA 2C1ZA 3ZDQA 2P9FA 1ZM7A 3B1VA 4QAJA 5BQXA 3D3EA 2GVDC 4NNOA 1X9GA 1II8B 3QENA 4GECA 1NYLA 2PT5A 3F6EX 1U8AA 1TI7A 3QMVA 3F8TA 4WJZA 5ARDA 4IVNA 2Z9DA 1S89A 3ZK9A 2F55A 1OAOA 1FFDA 1Z0SA 2HGSA 4GM0A 1LBEA 1ZC4A 2QRPA 3OCZA 2O8BB 2Z9CA 5H3HA 2V9PA 3H86A 5TC4A 3ZGLA 3HKBA 1XR3A 3W4KA 5JCPA 1P4SA 2W2XA 5L51A 2UYCA 4JLUA 4RNDB 3MJEA 5IZCA 3JQ6A 3I32A 1RW4A 4RD6A 2XHZA 1ZGJA 2JK0A 1JYSA 4KMOA 3C3YA 4BMYA 1QKJA 5ICEA 2VTDA 4LOHA 4Z0NA 3NJ4A 4ZYYA 3T5CA 5FOQA 2Z3VA 3RYCA 4A8JC 4RJTA 2ODBA 3PVCA 2VXOA 1FDWA 1G5HA 4RLHA 4TMVA 4C4YA 3R9WA 2GESA 2PMKA 4ARSA 1KYXA 4ZO6A 3PL5A 4G0VA 3EDRA 4BFYA 3HFGA 1KGDA 4FLFA 2IIPA 4YT2A 4NZNA 3NV7A 4Q03A 1LLQA 2G06A 2IEAA 1DB3A 5F7XA 3O3OB 2VL7A 4P2BA 5HIAA 3NBYC 2PQMA 1RC1A 1IRXA 4YGXB 1UFOA 1WIWA 2PL5A 1CIVA 4ZALA 3OZUA 1FMTA 4M8SA 1R5BA 4IV8A 5C9ZA 3AKYA 4NAHA 2NSLA 3NYIA 4TQGA 4KLRA 4B3CA 5GOZA 4YAUA 2RKOA 3U7HB 1S4MA 4B17A 1I7DA 4BTVA 1VRCA 3QX7A 1VBKA 3H6HA 1J8QA 3TTUA 3VKWA 4EJ2A 4QIHA 4GR9A 3COVA 1BDMA 3LUGA 3Q5GA 121PA 3UCEA 4B31A 3TIGA 2GJ8A 4CMIB 4E3WA 4FT2A 4ZVNA 3PEVA 5CLIA 3ZCVA 4LPSA 1ZCBA 1BCRA 3LH5A 4MUNA 3DL0A 3G5AA 3B9BA 1NBMA 2Y1OA 2ZAIA 3MCZA 4L95C 1L1EA 4N6NA 5EMHA 4F2GA 5BMVB 5CFZA 3I12A 2O8EA 5JZSA 4GM4A 3F6PA 4FXOA 4LDQA 4NC9A 2OT3B 3IVMA 3B2NA 4J8PA 2A9QA 3UPUA 1GNRA 1MGPA 1PGOA 4G8BA 4BE4A 1XNQB 4UE6A 1TJ3A 4G8DA 4L5BA 4FFVA 5TY0A 1WF3A 4TWJA 1JXMA 3IR6A 4L9WA 4Q93A 5C34B 4WOCA 4D0LB 1BX3A 1WTCA 3IMGA 1NM5A 1ZH0A 2JW5A 4D6YA 4XQGA 3K20A 1SBQA 2DSNA 2W2KA 1F8YA 4HQRA 4J07A 2V9CA 1M1YB 3QVGA 1LNZA 2HK6A 1SOMA 4CNBA 1DWOA 1H0KA 5KO2A 1EP2B 5FUWA 5LLTA 4FNGA 2JGKA 1OR8A 4KE6A 2CGEA 3N8KA 4GFDA 1NXOA 3WGLA 1ZD9A 5HJ5A 2FQQA 2G6BA 3BERA 4XDHA 3WHLA 3W8DA 1I2ZA 3PDIA 1PIWA 4WFIA 2NZXA 4D9GA 3BB4A 3LLUA 3AUTA 2Y1WA 4M38A 4PQYA 2KM1A 3OLVA 4BS9A 4KIJA 1U8ZA 2VR1A 4JLVA 4ZT6A 2R5FA 5FNZA 4F86A 1TDJA 5BUCA 3DLBA 3P32A 1CJVC 2QMUA 1WOYA 1LI4A 4RQAA 2PWZA 3V34A 3R6LA 4ZQHA 2OK8A 1P1CA 4FGWA 2YBDA 4Q3NA 4XEUA 1H6CA 1ZO8A 4XVRA 2IU4A 4LFBB 2N1BA 2YN0A 5LM3A 4UM9D 3IXLA 4O2BF 1EUDA 1NASA 2UZ1B 4MKFA 4YCAA 1K2WA 4D5EA 1G3MA 4ZAGA 1ZH8A 2I4MA 2AN5A 2JHFA 5L6MB 2G1KA 1GZ4A 1UZAA 2P4SA 2YINC 4JBYA 3PX7A 4Z53A 1MA0A 4XB1A 2V0NA 5JRJA 2WP0A 1XKQA 1JBQA 2WJIA 2VVTA 1ZA1A 5EMKA 4YA6A 4AXBA 1L8OA 5TQVA 1FX1A 4K5QA 5AM3A 1GV1A 3LF1A 4FJ2A 1JP7A 1PR5A 1UAGA 2PM8A 2RGWA 4PSKA 1Y4DE 2OGWA 2APJA 4OJQA 4OATA 4DJFC 3C43A 1FTQA 1TUGA 4WN3A 3OFSA 4R8RA 1VZ2A 2Q07A 4NIMA 1ZNYA 4FCWA 3H2KA 1ZRNA 1B2LA 2VQ3A 3RODA 2YIDA 3T95A 4C7MA 3O4HA 1ZMTA 5AI4A 1LX7A 3NV9A 4MI9A 1O54A 3OEHD 2QBYB 4QD3A 2AMYA 3D31A 3ZWAA 4ALMA 1GGVA 3GGSA 3OM9A 3NM4A 2QXTA 2JGRA 1XVTA 1KY4A 1X38A 1ZU5A 2X0NA 4GD3Q 4TS4A 5FO1A 4YR7A 3RS2A 3ANMA 2JI6A 3DE3X 5GVSA 3F1LA 3ZBPA 3KZMA 4CQNA 4QM6A 2I6FA 1CCWA 3PYLA 3AUSA 2IDJA 2RAFA 3L0BA 4YCNA 3H5LA 1BKYA 3BD9A 1ES9A 2G4LA 3MTEA 4FMCF 3VVCA 1A5ZA 1GKIA 1QCZA 2FG6C 1MJFA 3B6JA 3PHBE 1TD9A 4TN1A 1O5OA 1YZQA 1RYZA 5K20A 1N7GA 3TRDA 2GO1A 1E3EA 3T99A 2NZWA 4KQIA 4KXUA 4AZ3A 1SHKA 4I9GA 4IH9A 1YD7A 1POXA 2CUZA 3CFYA 4LF8B 2I7CA 3OD1A 4IKOA 3ZGYA 4QJ5A 5FTJA 3H5IA 4K9RA 4LSMA 1T3SA 3U13A 3L1VA 2DQYA 1AK2A 1HE2A 1XZQA 3GLRA 2CNLA 4FWBA 4RJLA 1A4UA 3EZ9A 1AA6A 1I2BA 3IUYA 3G0GA 3OBIA 3H97A 1FYXA 3GCGA 3OM0A 2KS6A 4YJ2F 4GZ5A 4BVLA 2P1ZA 3PU6A 2C7QA 2QT9A 5B30A 4M21A 2R85A 3HA5A 1JNXX 3ME5A 3ML1A 3F73A 3MWKA 3IA2A 1BE1A 2V7XA 4PZYA 4Q39A 5LP1A 5HSGA 2AK2A 1U0HC 1MOSA 2FFAA 1RWKA 1YS9A 3QXHA 4R40A 1LW7A 3P9QA 1HFJA 3RRNA 1BOOA 5I4CA 1E98A 3I2JA 3IV6A 2WY2D 1IN8A 3MB8A 3OE1A 1AXEA 4N65A 3PXCX 2B4QA 2Q27A 4G1BA 3RADC 1CIPA 4HLDA 3D6HA 2VJNA 4ZOLF 1QO7A 2FRDA 2XOKD 1MH9A 1TK3A 3Q3IA 1C29B 3G0IA 1S7GA 2HSZA 4MS3B 4PN3A 4ZCMA 4UOQA 2WDZA 1NVGA 3IO5A 2GFQA 1DZ3A 3AHIA 2Q3BA 1S4QA 2O6HA 3V4PB 2GAAA 3GJSA 1FVOA 1MOZA 3I9NA 4A2QA 3KJNA 1AQ6A 2IXBA 3R77A 1ISJA 3QF4B 1DJNA 3UB2A 3HJFA 4LYJA 1QQ7A 5E3JA 2ES4A 4BO0A 2QIOA 4CHTA 1XYYA 5ALHA 4CN9A 2GLUA 3K92A 1W4ZA 1ZUHA 4KPUA 5CX4A 4KQCA 3FHTA 2FN9A 1V9CA 2PD4A 3RARA 2I2AA 1KEKA 3G9TA 1P2BA 1K7CA 1N5KA 2AUMA 2NU9B 4KQKA 1DRKA 4YPOA 1SEPA 1W5EA 2FLKA 3SKVA 4LZWA 2AOUB 1UPCA 1O8CA 1YQ9A 3D3WA 3ROKA 3TEJA 1QGED 3QELB 5DXJA 2VDRB 3A8TA 1FDIA 1TM5E 2HC9A 5HRAA 3MJSA 4Q4HB 5BN1A 3C3DA 2BC9A 2PQ0A 1KI9A 5I8PA 1HDIA 1YZVA 1D4OA 2O23A 4MWGA 1SELA 1BFDA 4JKOA 3RE1A 4REOA 2FDRA 1OMOA 4R2XA 1GEGA 1NXXA 1WMFA 1TZBA 1N2CB 1V8ZA 1WVGA 4JJ6A 1KO8A 3JYQA 3KQMA 4L9SA 3RM3A 2QG4A 4B76A 2D2FA 2J9FA 2G04A 3RHFA 3A1EA 3WLIA 2W58A 2Y3IA 1DV1A 3NIFB 5FF9A 1UT8A 1ZVQA 1L5MA 1D1QA 3PC3A 3V1KA 3IXQA 5ALEA 4V1CB 5EIOA 1G2OA 1EESA 3UUFA 2I1WA 4I4NA 5BYBA 2A2ZA 4GMFA 2XE7A 4AYTA 3PIIA 3UKOA 2GRJA 3GBVA 4NQZA 1U31A 3FWPA 4ND8A 4BP9A 1KTIA 5J1SB 4IJQA 1GFWA 3WJAA 3ZW8A 3KOUA 4WKPA 5CBPA 3HDJA 1Y42X 4REQA 3WYBA 2IYPA 3OOWA 2MINB 3BIOA 2VAXA 2Q8QA 3QG5A 1GAQA 3ROQA 3TNLA 1M3SA 1R9GA 2WI8A 3ZLUA 4C5BA 1UADA 4DLKA 2J0VA 3VPDA 1B76A 1TVCA 2Q1YA 3A4TA 4GU5A 5ILOA 5IDXA 2OV3A 1P1IA 4ARIA 1KZ9A 1QFSA 4JP5A 3W8EA 1BVHA 3UW1A 1Z6YA 4MV7A 4DXAA 3FDIA 3GW8A 1QK5A 1RLMA 1JJIA 2O7SA 3IP5A 1T2VA 2FNAA 4MVJF 1E5QA 1HE8B 2NTNA 2VBIA 4FCVA 1IBLB 4MKGA 1DE0A 4TSFD 4XUDA 1C8LA 3DW1X 2XR1A 5DGTA 3F78A 3NI2A 5JXGA 2IXGA 3IDOA 1PJQA 3N2GB 3T7TA 1AQJA 5DBHX 2M6SA 1T2UA 5DB4A 4WNYA 3PC7A 1ORHA 4N12A 1H8HA 3OIUA 1ZM4A 4R0NA 1XDDA 1IONA 3K6JA 5B12A 4O3MA 3LT1A 3JAKB 4L57A 5DNUA 1GPNA 3GZ4A 3VC3A 1WEHA 4V3BA 2CK3A 1VBMA 2NWQA 3GC6A 1CB0A 721PA 1A0OA 2DOKA 4LGVA 2DVMA 1NFFA 2AFHB 2QPOA 5HQTA 3EEOA 2CCJA 4GXRA 1NLFA 3BCUA 1HSZA 4QYMA 2REQB 4EUNA 1JDJA 3X1JA 3VMMA 3U44B 3LBHA 3RAFC 3MTIA 3L7AA 2PKYX 3R0QA 3SI7A 3WYNA 1A9SA 5KYWA 4A36A 3C3BA 4MNTA 2BM0A 2JBAA 2PTGA 4MYCA 2OCIA 3A6ZA 3B6EA 5EC8A 1XU4A 2ZI7A 5AJXA 1U6IA 5IM5A 4PSCA 3S2SA 3ZDRA 4CMKA 4EMUA 2JEZA 2QX6A 1VLHA 2H54A 2WUEA 5IS2A 8OHMA 4YV7A 3KQLA 2VP6A 3QOXA 2HB6A 4UUQA 5CX1B 4D6XA 1C30A 3PKIA 4Y1FA 5KMGA 1G20E 1VJDA 2Y1XA 4KYTA 4LF7B 4ESHA 4AP6A 5HEKA 3GAFA 4KDEA 1VM6A 1U1EA 3H1BA 1OFTA 1OYWA 2DRIA 3ED5A 5G0SA 4HNVA 1HOTA 2QZZA 3RBXA 1D2RA 2PQ6A 3LT2A 1UPBA 5FWNA 1O0BA 4XI9A 4U7PB 1U3GA 3ILYA 3HHPA 3PJEA 3LCVB 1NJ1A 1W1UA 1JFVA 2A5JA 3AJ8A 1U9ZA 2BV3A 4YNBA 1USIA 2H3HA 4KDFA 5CIQA 5CPFA 4S1NA 5AK5A 4ZANA 2QTZA 3PJGA 1MB0A 3KT3A 4EI2A 3J7AC 2OM2A 3ICWA 4MV0A 4NMWA 2VA8A 3M9XA 4QXAA 4ARZA 2VWQA 2CD9A 16PKA 3FOAA 3C16C 1SXQA 2IHNA 3AU8A 1TKBA 1Z4IA 1XTTA 4IUYA 2XMSA 2FJPA 3TRIA 4CIWA 4WLFA 3A06A 1CUIA 3H5WA 3LPDA 4ZQGA 3RSFA 4ZMSA 4G5HA 3QA9A 2CNOA 4KGZA 1BXGA 5FT9A 3ZZTA 4EGAA 4OHYA 3F90A 1QFYA 2QZJA 2FPKA 3WLTA 3LUPA 1QG6A 2C96A 4DLPA 1SULA 4JVOA 3ZVLA 1C9JA 1T29A 4BP8A 4BIIA 4D79A 2DUJA 1N57A 1U02A 3MOGA 3CX3A 1DRWA 1QMPA 1VMDA 3K1JA 1TT7A 2P4QA 1W76A 3TFOA 1BNCA 3H9CA 2XA9A 1NR5A 2H0RA 3R3HA 1I6LA 3A6DA 5CEEA 3UCFA 4G84A 5DU2A 2V58A 3G5LA 3VVMA 5TMEA 3ETCA 3R23A 2VUHB 4YFYA 2I03A 4YRBA 1V41E 3S68A 3AEQB 2FUG6 3UVEA 1FPQA 2YMPA 4FLMA 5LP6A 3DAHA 4HDRB 1GA6A 4LDRA 4PTZA 2YJTD 2YHIB 5AYVA 3S4YA 3MCTA 4D25A 2HWKA 3K0BA 4ZDWA 3GLKA 4MRNA 1NXPA 3EQ8A 4UD6A 4NDNE 2YWGA 1ECGA 1Z2EA 3NHYA 3NJRA 3OA0A 4HADA 2F7SA 3S40A 4DSNA 5ARCA 3KR2A 3AEKB 1J2TA 1YH3A 1KRHA 3U4MA 1UF9A 4CT5A 2EKLA 2O1WA 3L7LA 1IN6A 1XL0A 3EGOA 4KWCA 3RTBA 5HQ3A 2HWUA 3UUGA 3CUEF 5K8IA 4LSGA 3AVQA 4AWXA 4NSNA 4B48A 3EA5A 3KKOA 1KBQA 4KMRA 3YASA 4AJ4A 1Q3TA 1VJ1A 3FAZA 1YZLA 4HWOA 1UWLA 2PMCA 4BKMA 4AF6A 1T3ZA 5L95A 4Z3DA 1OASA 1TZ2A 2AK3A 3BHNA 1FFYA 1E6EA 3HUUA 3HLKA 4ENVA 3KXKA 3DCNA 3FPEA 1DJQA 4J29A 5GAJA 3EDCA 5DHTA 4FN5A 4TUYB 4KR9A 3VUEA 4FFBA 2GNOA 2VBCA 4U0KA 2A0UA 1ZQ9A 2P90A 5AJVB 4OMFG 1CUXA 3P71T 3G68A 2WTMA 1HNNA 3BCRA 4GX1A 3Q8LA 1USVA 2O2JA 2XYQA 1HNZB 3ZKAA 2QD1A 3KFXA 4DR1B 4ACBA 3P97A 3RVLA 3QW2A 4R9UC 2PLFA 4PC6A 5GVRA 1E3QA 1Z83A 4YWHA 2EX1A 2R8OA 2O0KA 4L4SA 2YXBA 3SKYA 1BA2A 3IE1A 4OUDA 5T8KA 5B6IA 1WXIA 2RI1A 4CKEB 3C74A 3KLMX 3KHUA 4M1SA 1PV1A 1QZTA 4RM3A 3R0XA 2VF5X 3WYCA 1SQGA 5KDDA 2QY6A 3FRIA 4HAVA 5IAOA 4L9RA 1R0ZA 4CI0B 3AEKA 3OIDA 4IWNA 4MCHA 3LPLA 2AHOA 3DMDA 3HL0A 3SHOA 3M5DA 1HF3A 1PAUA 1MW9X 3JRNA 1ZH6A 3OF5A 1EFPB 2IH4A 4CV2A 5LC1A 1XD2A 2PFGA 2YZ2A 3ASUA 5KNCH 5I4BA 4HNUA 4TWZA 4UAVA 4V1CI 4HEHA 4Y6PA 3JQCA 4OHZA 1PW7A 4DV5B 3M6XA 3N8DA 1EXWA 1QHSA 3CVXA 1I2CA 1KAQA 4M9RA 1E7YA 2R4TA 5EPOA 2F2TA 2VPZA 3FGZA 2JFGA 3QFRA 2WTNA 4C22A 5C7OO 4E4TA 5F3DA 5LQMA 2ZCUA 1E2PA 3ELBA 2W0SA 3H1AA 1F2DA 3A9WA 4PX5A 1F1JA 1FQWA 1I3NA 3ASVA 4UBOA 3ECAA 1Z17A 2GM5A 3TQTA 2FPSA 2ZANA 5K01A 1KYWA 3IS3A 1CUCA 4U63A 4XH9B 4B74A 4CKCA 4DE5A 5CVDA 4KNWA 2X15A 3AR3A 4RDIA 1EP3B 1JU4A 4EKGA 1AKUA 1C4KA 1R50A 4R01A 3GVHA 3IVXA 1E1CA 1NMQA 3V8QA 3AL0C 1BOFA 4B81A 5HG0A 3T4UA 2HWWA 2B4RO 4UU1A 2GXUA 5F9FA 1UANA 2GNPA 3K94A 1SIWA 1O95A 2XUOA 2I3BA 2PL3A 2OCGA 1ACLA 3H84A 3MCWA 3QEJA 2I6TA 3R75A 4GUDA 3IODA 3GGGA 4H08A 4JVLA 3QBTA 5G40A 2W6NA 4FE7A 4R9SA 4FR0A 4AMBA 3JQBC 1S8NA 5LYYA 1P7VA 1WDMA 3U3JA 2H2WA 2IIQA 2P6PA 1YRBA 1EFUA 1M6HA 1WUYA 3RS4A 1XCMA 4BNGA 4DCOA 1AQNA 1MG5A 3LBNA 4S1VA 4OQQA 3N0RA 4FWIB 1ZH4A 5DNYB 1S6YA 1GU7A 4ZGGA 1RSZA 2X58A 3EOBI 4C4AA 4IP0A 1I30A 4RY2A 2QRKA 1TF2A 2X0IA 1EDDA 3RVOA 3KT8A 3LIIA 4RORA 3EODA 5C8YF 1KDTA 3K2IA 3TO5A 3C3MA 5J43A 4AU1A 2BMJA 3ZE0B 3QHPA 4NJMB 4RCVA 5DYGA 4B33A 3ZS8A 4TZTA 3PGXA 4PGGA 4EG5A 5F7OA 1SXJB 2ODNA 8ADHA 4LN1A 1JKJA 1JEJA 4PRLA 2X42A 1TUBA 2RD2A 2QTGA 1G9TA 3X1WA 3CC8A 2BVNA 3UMCA 1XMOB 5CDGA 1XRNA 4HS9A 4OK5A 4B3MB 1T9BA 2OSBA 2ZVQX 1TT5B 4LK3A 4ZVLA 4RTMA 1GUZA 4LRUA 1Z9BA 3DVQX 2HBQA 3HG7A 1GCAA 4FOOA 4I1IA 2NG1A 1WXQA 4FHGA 1HYGA 2IOFK 3DFIA 1GUFA 3O90A 2JZCA 2SECE 4GP6A 1BXZA 2CHFA 3Q0IA 2BR3A 2OYCA 3FROA 2CK3D 3UXMA 2BFCB 2G0NA 1H2WA 4KQ2A 4HVTA 2ZI5A 5FBHA 4XSVA 3H05A 1VE6A 2D0DA 3FCYA 4B1FA 1HYQA 5HJ2A 2YOHA 3LXMA 4NE2A 3D8RA 1FRNA 1FVXA 5HIKA 4NBTA 2H1LA 4KC0A 4ZRNA 4D4MA 4YI3A 3CF6R 4Z54A 4IF4A 3ONDA 2OAGA 3WS7A 2ZB8A 3CX7A 3IE0A 1GKUB 2W70A 1BG6A 1W48A 3MPOA 3O2QB 4IGKA 1Q83A 4D4LA 5CURA 5E7MA 1Y3IA 3IHTA 5E6RB 4H4CA 4NNJA 2VPQA 1AF4A 2AR7A 3DDCA 1NPYA 2UZAA 3ORHA 1C9YA 1LDMA 4GC9A 4YFVA 1UM9A 4X94A 1E2KA 2H5LA 3P2OA 4BQPA 2VNAA 1UJ6A 3DNMA 3UB3A 2N75A 2I8AA 4J3JA 1PEKE 1T8UA 2I3GA 2Z08A 2C4KA 5H83A 3AILA 4PTYA 1OTHA 3RASA 2YTZA 3EY4A 3KXLA 3W04A 5A06A 5FWYA 1NE7A 5HMMA 4XCXA 1F7VA 1H0SA 3CLRC 2QTBA 2AKEA 1MZPA 3AEYA 4MVJA 1ID1A 3AP3A 3ADPA 4I36A 1ISGA 2CLFB 3MRXA 1P1RA 1P0FA 2MIIA 3OTIA 1ICEA 4YRFA 5HNKA 1MFZA 4YJ3B 3FI9A 5TARA 5BNTA 4JQOA 1H2RS 2O7NA 5GQSA 1S1CA 4WSOA 4PYNA 4POAA 4QOJA 2H7VA 4CKBB 3V4LA 2WG1A 4UUNA 13PKA 4CETA 3GA0A 1Z08A 4IFEA 3V8BA 1Q7GA 4IDHA 3KYIB 4MLPA 3Q9NA 1A9TA 3W2HA 2W2KB 3HNOA 5EE9A 3BHJA 5DT9A 1JDNA 1K5PA 2NO6A 4MK4A 4NFYA 3CURA 4R7TA 2JD2A 5IN5A 4ZZ0A 2CVQA 4R9RA 1T10A 3BWCA 1N6RA 1ONNA 2Q6KA 4K9NA 3DEHA 1GADO 3LX8A 1JFFA 2Q3LA 3BXOA 4GKVA 1JQ3A 1SQFA 3R0ZA 2PRJA 1CUVA 2DGDA 3PP8A 4MPJA 4NR0A 2OXIA 1N33B 1IJEA 2OM6A 2P2ZA 3GJ4A 2VJLA 2AFIB 5A03A 3DBRA 4J1NA 4W5NA 1D2CA 1S2NA 3FVRA 2X2FA 5K3EA 221PA 1YTLA 4F60A 4R4JA 2QTLA 5COBA 3EGVA 3L84A 4Z3KA 4RU1A 3I9JA 1C14A 2JFBA 2PLAA 5ALSA 3TAHA 2ZIEA 4P93A 5T41A 2GFIA 5C81A 4AJHA 1C3VA 4WLUA 4C3UA 5FWYB 2W5UA 4QQFA 4U2FA 4UQOA 1FTWA 4WBXC 1YJAA 3WA7A 1RWVA 1H3FA 1COWD 3THYB 2FUNB 4EGSA 4JP1A 1USWA 2JKVA 3OAAA 4AT1A 1KSHA 5CLHA 3PWZA 1QYRA 2FMUA 4HAWA 1UUFA 2D5LA 1S9HA 3N76A 2Y68A 3TNJA 2NVUA 4P3OA 4AO6A 4Y2GA 2PUFA 3DFMA 3EA4A 4KXVA 1DC6A 2IGTA 5EJMA 1ISPA 2C5LA 4TV8A 4YRKA 3WZLA 5KU1A 1RM0A 6YASA 5HKLA 3AX6A 3EDMA 1VRWA 3KWFA 2O3SA 1B8VA 1VCOA 3KS9A 3PNSA 2CFIA 4KX3A 4CMCA 1XTKA 3H3XA 3RAGA 2IT1A 2OB2A 4HWSA 1GPYA 1VE9A 4JR0A 3V55A 1NZFA 2GTPA 1J7JA 3ONFA 3I2HA 5K3OA 2F8SA 2W2LD 5C8YB 3F0TA 3BTUA 1A3CA 3ZH9B 4AY3A 4S35A 2ZEJA 3PGVA 3S28A 1FZQA 5JLAA 1GPJA 3DS8A 4F5YA 1F5SA 2QN2A 3GFSA 3OVMA 4P6VF 2FEOA 4YJ2A 3LP6A 3TAUA 1L6RA 3BX1A 3ZE6A 1I7NA 2PUWA 4BBPA 3AVPA 3SLRA 5AXCA 2PZEA 1Z26A 3GMSA 1PJAA 4DMUB 1RPZA 2ZVDA 4UVDA 1TQ4A 4D5GA 4L6AA 1II0A 1XOIA 2DH6A 5JFOA 4ECEA 3F67A 3AY6A 1TCAA 2W6MA 2H2GA 1JTEA 2KX7A 1IM8A 5D1NA 4MQEB 4FXPA 3SXUA 2DSTA 5KCZA 4UEJA 3JSXA 1D1PA 2NPFA 3UH1A 3ESZA 2H4YA 5A5GA 2AJLI 1W96A 1I1HA 1CRPA 5LU8A 1XZNA 2G1JA 2AJ8A 2I2WA 3GUVA 4PHCA 3MJDA 2BI4A 4F3TA 4TZ0A 2PX2A 3ICPA 4QPDA 5DF1A 4I5DA 4KPUB 3ESAA 4DXHA 1YDFA 3V00A 1T9DA 1LQUA 1G63A 1I7QB 1QX4A 3MOSA 1W5AA 4HAXA 3UENA 4BB9A 4CHGA 4P3NA 1M2NA 5FTMA 2Q50A 3QX3A 1UIMA 3HDHA 3QI2A 4MICA 1JPNA 3KB8A 4KLAA 2A1TS 3NWEA 4DIDA 4HUTA 1NI3A 1VIMA 2IIBA 2OGUA 3ZUPA 1MJGM 3H87A 3U9SA 5F4ZA 2I0FA 3ZE2B 2V97A 1ECCA 2VT6A 1NN3A 4ZVSA 2NM0A 1I9CA 3B6MA 2EJTA 3PCTA 2PO7A 3QEKA 1KI1A 3L04A 1FX0B 4OLJA 2G7MC 1TX4B 1P0MA 2MSCB 3KUCA 3PR3A 4FJ1A 4IDGA 4JR1A 1M6NA 1DC8A 4KR0A 2OZVA 1MTZA 1WLSA 3ADKA 3DNFA 2C4NA 4QNNA 2POQX 2XVZA 2HHHB 2QHXA 1J99A 4O1IA 2H8GA 1A1VA 4WCVA 4DIEA 1JR6A 1ADJA 4BJ5A 1JFSA 4XIJA 1LDNA 2WZBA 3BXGA 5KYGA 2JLBA 2W7TA 3BFVA 3LC1O 3EZFA 1JT9A 4AN0A 1V1JA 4V0LA 4BMPB 2OKCA 4CODB 2BTOA 4RBNA 2BZ1A 1XK6A 4IIYA 1W52X 4XB6B 2VHTA 4C6HA 3DXYA 4UD2A 1PO7A 2J45A 3JWGA 4HGYA 3AF0A 1UBSB 4L9AA 4M1YA 1VMAA 5H7XA 2DR3A 2CDAA 2EARA 3I9LA 3CVVA 2ONYA 4D8YA 4KDCA 3UWOA 5H3CA 2W6ID 1TAUA 4B8ZA 3K15A 2J6HA 3P2KA 3N8NA 3PF8A 4ZT3A 5HZMA 2WHQA 4B84A 1PT9A 1C0KA 2DYKA 3R5FA 1PSWA 2P69A 3LBYA 5FPYA 4IVRA 2P2YA 5A1TA 3V48A 3BPSA 1M7BA 4U7WA 4F91B 5F2KA 5I9NA 3EVAA 3C7TA 3MINA 4F21A 4N82A 4P7GA 1L7MA 2X5XA 2J9ZB 1J8VA 3NWOA 4MUFA 5FA6A 2XUGA 4DG8A 2YWFA 3IPXA 1U6KA 4PLTA 4XUCA 3T5AA 1L3CA 3GNTA 5CGZA 1QHEA 4G25A 2R8ZA 5IK2A 1EFPA 2GZ3A 1XQVA 3B82A 4HWPA 4NBVA 3Q7SA 4W5JA 5TPWB 5FX2A 4IDBA 4F4JA 3KOWA 5K3DA 5BR7A 1XWIA 5GZ6A 2IEIA 5EKSA 1CYDA 2AR9A 1US8A 3A4IA 4B5KA 1M8FA 2JFFA 3G1UA 1AHIA 1RLOA 4FE4A 4QNMA 2H11A 3R7NA 4PGMA 4A92A 4BLUA 1FMFA 1O96A 5K6AA 1KU6A 1U3VA 5BVHA 2QPLA 2GBPA 2WU0A 4GNRA 1E5VA 4NCBA 2Q8NA 3RT1A 1A8UA 4RZQA 3MQFA 5ED0A 3KUUA 1ULZA 5IAEA 2VNIA 2I7XA 4IIDA 1MXHA 1ISFA 4ETNA 2RAUA 2KWIA 3R3UA 4K87A 1QLWA 8GPBA 3RHSA 1Y4SA 4YPVA 5BQFA 2ZWIA 4F2WA 4RMJA 1RKVA 1IWPB 1BYIA 3DEJA 2E4ZA 2JLXA 4MMYB 3ZCXA 2AKYA 1Q7EA 5LWHA 2WNIA 3LUHA 2VDMB 4RZSA 4K9OA 1MEJA 5AHOA 1FBNA 3IOCA 5EAIA 5JHGB 1OX4A 3FCCA 3D6NB 4J9VA 2ZTUA 4L78A 4NCIA 3T4EA 4JROA 3Q3GE 1YZKA 2W6PA 2X14A 4F12A 4YAEA 1KNQA 2O0LA 4BNXA 1COZA 1T0UA 3V7NA 1H1DA 2ZUBA 2RCYA 1P3Y1 4ZYWA 2V54A 2XB6A 3FKQA 4ALLA 1F4PA 4RGQA 1X7WA 1D7OA 3R5XA 4EL0A 3JASA 2YZGA 5HR5A 4G5FA 4J2OA 3UJ6A 2O3TA 1ST3A 3TZLA 1G7CA 1H3NA 5A3SA 5LKAA 1JFRA 2SKEA 5A4FS 5FPPA 1OUMA 2IW1A 3VBEA 3ABSB 5ALGA 2HHCA 1U7XA 2DY1A 2ZDQA 5CJPA 3NUGA 1VB3A 3F9RA 4B3TB 1Z8HA 1L5ZA 4GQIA 1W9MA 1JQEA 4NH0A 4Z5XA 3VZSA 3O4JA 5BN4A 9MHTA 2JCYA 3NBUA 2E2WA 4AYXA 3DBIA 2WIKA 4I4TA 5D01A 2CLKB 3QELA 2GN1A 1EU1A 4D9JA 1KP2A 2V9ZA 4Q4HA 4UBMA 3H04A 4ZZ3A 2O8DA 2WAAA 4FFPA 3MUOA 1UMCB 3VR2D 3JD3A 3OF3A 3P9ZA 1VGQA 3KPYA 2W8BB 5JQGA 1R9JA 3DO5A 3TUZC 3TNYA 5JAQA 5LQRA 1RXVA 4JBHA 4FYXA 5KQGA 3TKAA 3LHSA 4I1UA 1CSEE 1ESCA 4LOAA 3IHLA 4O0MA 2IU0A 6AT1A 4PNPA 1LBIA 4W1PA 1JIJA 3VSAA 4R8LA 3G8BA 4B3JA 3QOFA 4F71A 1WA5A 1MDBA 4FFOA 4HBZA 4Q1EA 4MHSA 1GZDA 4PBTA 5LMCA 2QORA 3H5NA 2C84A 1R0WA 1YNOA 3HA3A 4GX0A 4PINA 3ZBQA 5JI3E 3X1YA 1NHWA 2GYVA 1FYFA 1L5WA 4AW9A 5JXWA 2AZXA 5HGJA 3VPAA 2OXEA 5DBGA 1M6WA 1G3UA 3HO8A 1EQAA 1H2AS 3MINB 4H3VA 3GNQA 4XYLA 5JSYA 1M6VA 4TWAA 3AERA 2R8PA 5CT9A 3O9ZA 1TU0A 2FEAA 4YRDA 2JJ1A 1F51E 1QFXA 1QV7A 2V7UA 2XQVA 3DD5A 3LT4A 4RACA 4ZQEA 3RVSA 3WYDA 2NVBA 5IN4A 1MPTA 2QRLA 3L8MA 1CUHA 1DIBA 1E7MA 1NI5A 1SD2A 4JVMA 4KUEA 4YP9A 2B8NA 2ZDGA 1Q91A 4Y9DA 3VQTA 3REOA 1H2YA 1G8KA 1Y5LA 3WGVA 1CEYA 5LN1A 1J0XO 3U7QB 3VR6H 2P65A 1SUWA 3JD1A 3ZY5A 5DGDA 5BUZA 4ZU6X 3LPMA 2CBZA 1LC3A 2QAGB 4D4HA 1BSVA 1AB5A 4H7HA 4NECA 5LMUB 5CU7A 4UASA 4HEA1 1D9XA 2XCOA 1B2RA 2PO5A 2NTEA 2TMKA 1EBUA 1L1QA 1KDRA 1PBNA 1I3OA 2UUOA 5BQPA 2ZVJA 3WDLA 4A91A 2OD2A 1YVEI 4UBKA 3SHTA 5HXAA 1RU3A 4JLNA 1SU8A 2DCUA 4IO1A 5HBGA 3H3JA 2BRUA 3QX9A 2OFWA 1L8QA 4KAFA 1TQ6A 2O57A 5EHNA 2IZ0A 4UZSA 2J0EA 3KD2A 1J2UA 4JK3A 2NV6A 3AC0A 4YIKA 3STUA 4FSDA 3VH4A 3VU9A 2AL7A 3K1AB 1AGPA 5HYVA 1H6BA 2FLVA 1JWLA 3VPXA 3VZPA 1D0SA 1F0PA 3Q5DA 4BFVA 1RZRA 4BX0A 1L5KA 1QTQA 1VHTA 3PUVA 4JI6B 3DQZA 3EVZA 1UKCA 5IASA 2G5PA 1TMYA 4ENSA 1W36C 3M6IA 1ZN9A 2QJRA 1ISHA 2AOWA 4Q7JB 4QJ4A 3OLYA 1NP3A 3TVYA 4YROA 4PVCA 3W5SA 3A04A 1GNSA 4ZGBA 3Q7RA 2VP2A 4P35A 2XNDA 5B4VA 3UJ8A 2ZR0A 4UDNA 5KJ1A 4F84A 1K27A 3KKZA 3I34X 3U9LA 4DJAA 2A3NA 4EQ6B 1L4FA 2GVZC 2ZUTA 3I0ZA 1YJXA 2IIVA 4J03A 5FI5A 3WOHA 4EX7A 3ADBA 3KWMA 1B23P 4LF9B 4RV4A 1VLQA 3BMCB 1MW8X 4EPXA 1YB1A 3PE6A 5J4LA 3LLMA 5DW0A 3AXTA 4WV3A 3PRKE 5DM4A 4YRNA 4MVJG 1GN8A 1YO6A 2DTEA 2GGSA 3QYJA 4HHEA 3QVWA 3T6KA 3TBFA 5I47A 3BSWA 4CNQA 2Q7XA 4KNYA 3JAWA 1A9RA 1OY1A 4DKXA 3DOJA 4ZPJA 3LG2A 5AW4A 1R6UA 3QX8A 4HC4A 3PDWA 3EXEB 4J0GA 2AW3A 1Z36A 2XYRA 4WNAA 4HPXB 3RK1A 4I4CA 2OCYC 2VDKB 3HYTA 4RD2A 4OI0A 1HGXA 2PPVA 4Q82A 4HLNA 4KXFB 3TE7A 1I80A 5J2TA 1R3UA 1UKVY 1C7JA 1T34A 1DADA 1XZGA 2FKNA 1UL1X 4S2EA 5ALMA 4TROA 1ZU4A 2OORC 3OQVA 4JP3A 5IH3A 5K4AA 5LA6B 3TKYA 4D8VA 2JLYA 1VHWA 1E4EA 1OZFA 1RRPA 1V16B 3AF1A 5AUOB 1P5JA 1G38A 3GLGE 4BXOB 1YA8A 1CY8A 1F2VA 3CIOA 2VZEA 3AFOA 4BVKA 4C3VA 4CQMD 2GCNA 5TX7A 4MLZA 1IY0A 3OTGA 5JJKA 3B2QA 4LMRA 5E9WA 3BYZA 1CHNA 5B2FA 1SKYB 2IYFA 3T5PA 1CUJA 1JE1A 1U3FA 4OGFA 4BX3A 3N2LA 4K81B 5C31A 4NEQA 2EF0A 2G5GX 2SKCA 2E3JA 2QD3A 1G0NA 3GLIE 2JEYA 4R1LA 4P4LA 5FKJA 4B6OA 3OETA 3DO8A 4R2KA 4GL2A 4PAQA 4NBNA 3BE8A 4GPBA 2X9NA 2W6ZA 5JMTA 3SHVA 1M1XB 1N4AA 1CQIA 3FGOA 4G0YA 2PKXA 1FDSA 2QRUA 4EUSA 2CDCA 4NS1A 1FUYB 4ND5A 2JGNA 3M4YA 3IAAA 5LB2A 4IJ6A 1AZLA 2PGOA 1EK0A 2LGJA 3AH8A 1R00A 2GK4A 4A0FA 3T5DA 2B0CA 3MMXA 4A10A 2PYIA 2BMAA 3NHKA 2EZUA 1AMUA 2WHXA 2YDYA 3CONA 5HIMA 4CPDA 2FQ1A 4PPYA 5DTQA 3GLFA 1KP9A 2V45A 5FLYA 3L3BA 4LQDA 3ZH2A 4B6EA 5CLJA 1D03A 2ZBFA 3DV0B 1Q15A 1SBHA 2JANA 3IV9A 3LVBA 4UHJA 4RTRA 3U7GA 3X43A 4P0PB 3DSRA 2JLSA 1NW5A 1AKVA 1U1GA 2BBOA 4KBGA 2BE9A 2PV7A 5E2BA 4BLPA 2P2NA 3C6XA 1PFYA 3PTAA 3P0FA 1HYHA 3EW9A 1C7IA 1Q17A 4EYQA 2J3MA 4LY0A 4HATA 3FYUC 1Y1LA 1Z25A 5AM4A 1GL9B 1Q44A 1U5BB 3GJXC 3WWPA 1ZOIA 4GI1A 4TZ6A 3FVVA 3O8QA 2RGUA 2FPGA 4L5CA 4PGAA 4F4DA 3FUCA 1I24A 2OBNA 4BFWA 5I7AA 4YJGB 1E9EA 5KOJA 1MP0A 3B51X 3CMMA 3IRUA 1T4DA 4S24A 2R87A 3DW3X 1DAKA 5C8ZA 3HSKA 3JQBA 4I1VA 5ILQA 4Z1OA 3AFNA 4R81A 2UDPA 4G9EA 3PX2A 4JFAA 5LQUA 1U2RA 1E1QA 1PK9A 4EJ6A 2ZE6A 4AWAA 4RW0A 1B43A 3DB2A 1GL6A 2Q5IA 3HE3A 2H08A 3AI1A 3DE7X 2H00A 3OJXA 1VJCA 2OILA 3N28A 4QHYA 1UPUA 4BCDA 4Y0NA 2JZNA 2A59A 4HKTA 4PONA 3V6LA 9ATCA 4CIBA 5D2CA 2B98A 3QLVC 5LQCA 5F1YA 3BILA 1YS6A 3DE0X 3WJ7A 1I3LA 2GOYA 3QPCA 4JWKA 4PSDA 3ZDBA 4EGQA 2EL7A 1NJSA 3Q85A 3W6PA 3GPDG 3FCUB 4HUJA 4BNJA 4CEIB 3EZYA 3TTVA 4BEBA 1IVSA 1G8HA 5F33A 3WLEA 4E0BA 1BEUB 1RYBA 2A1TR 1GLNA 4IILA 3R7WA 1DOZA 2XOXA 2VDNB 2VDWA 2ZYRA 4RLSA 4J1SA 4XQ9A 4IIVA 4LC9A 3EVCA 2HU7A 3JPWA 4OMDA 4F38A 5EINA 3KYBA 1ZW1A 4KQHA 3T4XA 2IUTA 4E3ZA 3KUDA 1PT8A 4QUAA 5TPZA 3P0IA 4B7AA 5FWXB 4WUTA 3G13A 1UOQA 1LXCA 3UMJA 3AUKA 3PE4A 2E5WA 3CPHA 4K6GA 4M98A 2GEDA 4G8CA 3N7TA 4JJ8A 4MYDA 2PT9A 3FNHA 2BAGA 3GGPA 4O0LA 4NBLA 1KDVA 5CA1A 2A5GA 3GQVA 2Y27A 2IKQA 2UU9B 4PZPA 5G0VA 1SC1A 1M72A 4INPA 4HF7A 5KSWB 2ZWOA 3CGGA 3ETHA 4NHOA 3NB0A 3SEZA 1RYDA 2HT1A 2RHGB 4TMYA 2DUMA 4EVQA 4IZIA 3IVCA 1N5IA 3W1VA 1OB2A 2VJDA 3ZHQA 3CKLA 2XA2A 1ZVVA 5JVDA 1B8PA 1E59A 1JR3D 3VR4D 3VDNB 5BURA 1A98A 3QFHA 4GX5A 4JOCA 2D4AA 4IWYA 4O4HF 5TPWA 3NGLA 1NM5C 5D1HA 2C5SA 2OVBA 4YMSA 4ZVVA 5LVAA 1Z56C 2QVBA 3MCAA 2ZAMA 2QVYX 3MF4A 3EXAA 3N6RA 3ZUGA 3DOFA 4EJ0A 3KOOA 2FCAA 2JFYA 4NK4A 1INLA 2D74A 4MV6A 2Q3HA 3BL6A 2A88A 3UFXA 1YQUA 1QV9A 3VKVA 2YWEA 2HEGA 1C8KA 4GO1A 3WL6A 1Z4MA 1JLKA 1KU0A 5L3ZA 2C5AA 1C1YA 2I87A 3VAAA 3HKCA 1N3BA 1QYWA 1JMKC 1RMTA 4HV4A 4XD7A 4JYZA 4IH1A 3SJCA 2D0PB 3PR1A 4G0NA 3D0RA 3V7YA 1RQPA 1DEHA 4IIUA 3BTSA 2GASA 1L5QA 1P2DA 2VZLA 1SXIA 4L28A 1Z5UA 1M0WA 4CU5A 2NVUB 5LQAA 1O9HA 2VO1A 3HH8A 1JLLA 1SVMA 2ZIXA 1DIOB 1TW3A 3C0KA 1G17A 1ZI8A 2RFLA 2WMYA 3F9CA 4IQ4A 4WXPA 5DM70 4ZAVA 5KYTA 1MB3A 3NNSA 5CHYA 1IG0A 4DXDA 2CVHA 2YZ7A 3SD7A 4RTPA 1L8AA 1KEUA 4ENTA 2O3QA 2H9AA 5HFAA 5AW8A 4O2BB 4E03A 1LDGA 2M6RA 1M8GA 3A4NA 3P4XA 2B3DA 1Q0QA 4OSPA 5HHTA 3MAJA 1DO8A 4YRZA 3ABRB 4OMCA 2ZRJA 4EFNA 5E6UB 2CL5A 4D74A 3GPLA 3JARA 5ECGC 2XSZD 3SDZA 1G5RA 3O8OA 2ACWA 3FB4A 1UZLA 1MBZA 3BWDD 1E1CB 4LDJA 5BMOA 4G1EB 5JQGF 4E94A 5EQFA 3GDFA 2XXBA 4PAMA 5FL7D 2EWMA 1NVVR 1DINA 3MM4A 4HZIA 4JT8A 4O1HA 1NJ6A 3CYFA 4TXNA 1ULBA 2CLCX 5A4MS 5HKBA 3G2IA 5ALJA 1Y3DE 2AGVA 3WGMA 1IBMB 2EG9A 4F5DA 4GPD1 1O97D 3MERA 5JROA 1JYEA 1FYWA 1K8ZB 3I37X 5ALUA 3PFFA 4S0XA 3M0EA 1Y7IA 3FSRA 4Q9AA 4UXJA 4LJ8A 3ZCQA 4XRRA 1PK7A 2ZSIA 4CM9A 2IXTA 3MS7A 1IIBA 3K70D 3ACDA 3Q8KA 3RFFA 3ZNPA 5ADVA 5K3CA 3MWFA 2SCUA 1VLJA 1JX6A 3COSA 1HWYA 2BFCA 4KQ6A 4OHXA 4MQFA 4C5AA 2BDTA 4J3NA 3RBAA 3IESA 5LJLA 5LB4A 2PZFA 4AAYA 3IBFA 4ZYXA 3QFCA 2Y4OA 3TOVA 4NZYA 4TPKA 4W5QA 3KQUA 3AGQA 4UEQA 3QUQA 5D6NA 3VSDA 1ZRHA 2V3WA 2WFAA 7AT1A 2P6NA 4OYRA 2OFXA 2C4TA 5DLEA 3KAPA 3RUEA 3I5YA 1CUDA 1RVV1 1SO8A 1F2UB 1T26A 3FDJA 1YV9A 2ZBVA 3FOWA 3EH1A 4EELA 2Z58A 3FZYA 1F1BA 1NLMA 2AG8A 1RJDA 1VPTA 2WKPA 3HRIA 3PQCA 1G3IA 5L4LA 2D7DA 2DQ4A 2IQIA 3ZQJA 1V3QE 3OY2A 1MRNA 4N0MA 3LDFA 2X3UA 2Q2OA 2XUFA 3WYFA 4BDTA 2QS9A 1NBMD 1DKOA 2AA3A 1RI4A 2W48A 1P7PA 2Q1SA 5CYOA 4MUBA 5IUKC 2COUA 1LV7A 2GX6A 4OKSA 1E3JA 2WK1A 3T9EA 3FLEA 1WB4A 3CN7A 3HCDA 2MSEB 1V48A 2J4CA 3ND9A 1A72A 4HWGA 4RTLA 4F5ZA 2VYNA 3LPAA 1Q1QA 2BFFB 1V1RB 4ZT5A 2QPAA 2H17A 3B3QA 3GU3A 4UUAA 3DMGA 4FHEA 4RULA 1KAOA 3ZHBA 3E9MA 4IQGA 4B2LA 5FTLA 1EBBA 3U56A 2GCOB 4BV2A 2J0UB 2MHCA 2HA7A 4P4TA 4XJVA 1OJLA 2SICE 3E15A 4PF1A 1EHIA 2X1VA 3H1FA 1JBEA 4JN6B 4LHEA 4Z0PA 4U8GA 1KFBB 2H65A 4BO8A 3HFRA 1JMYA 3SK0A 1Z33A 1N2EA 1W88A 4RH1A 3ZWXA 3ZY3A 5U1PA 3JYPA 5FBZA 2Y0DA 3VYVA 1T5BA 1W46A 2WMDA 4ITVA 4G37A 4MO2A 1XDWA 4B73A 5C5EA 3KXPA 1SVKA 2ZUSA 5HBRA 4QYIB 2F9LA 5K2OA 3O2SB 4S3MA 1XZMA 4C0BA 1QS0A 3SIXA 4PQRA 4FZVA 3TG2A 2GM4A 1NUPA 5C5IA 3IAHA 3C14C 2C5GA 4GKKB 1VL5A 2R5NA 3EXHA 1NI4B 3G2KA 3SE7A 5LQSA 2XE8A 4E5MA 2QQ5A 2LW7A 4WLEA 1RLIA 5B1HA 3V1NA 2REBA 1L7VC 4Q9KA 3H8JA 3WIDA 1B26A 1I5RA 1KORA 4LVNA 3GYBA 1WUHS 3AR6A 2ZSEA 3FNGA 5K8LA 5A1JA 3CBGA 1HMPA 2ENWA 4DJ5X 3O8OB 2AF3C 3WADA 1T36B 4HRVA 1AG9A 3MT9A 4JI7B 3VC1A 2Y1DA 2BFWA 4OK3A 3TL3A 1T2NA 1C8VB 1XJCA 3FMIA 2DFVA 4RVUA 1XTZA 1YQEA 1LGYA 2PGXA 1KJYA 2K2QB 5K8JB 3H8SA 3B48A 3OZCA 4QJBA 5L3RA 5JZ9A 1JEYA 1MEOA 3RC3A 4MAAA 3PUZA 4EB6A 3QEBZ 2AC7A 2WR8A 4AKHA 1F38A 2DFKB 1MJ5A 3KR0A 1UDBA 3ETNA 3NBAA 3M4NA 4HN9A 4K9MA 4ADSG 3TLBA 2RHDA 2CNWA 2FOLA 1QU2A 3LSTA 1KXJA 1BTOA 2CSXA 1YB4A 3VKUA 4MX8A 1TECE 3RJMA 3O3CA 4KU4A 1NPTO 1IAVA 1KR5A 4QA9A 2Q5CA 1TLTA 4DZZA 2C2YA 2FG5A 4CKCB 1RRCA 2Q4TA 3CUVA 1WJGA 3B5IA 1IZ9A 1ZJ4A 1TCCA 3F4BA 1EEHA 1LBTA 4GC5A 3ZVMA 4Q1AA 4ROTA 2H59A 4QEZA 5SZIA 2EFCB 2HCTA 4RZ3A 1NVBA 1P9OA 5DBIA 5M5BA 3ZDAA 1RJGA 4MARA 5FPSA 3VR5D 1IRIA 1B4DA 3RYFA 3EZ2A 3PCXA 4QU5A 1D4AA 1I3CA 4QPPA 4RH3A 3L8DA 2QTMA 4QYXA 5I9SA 1QTRA 3GY0A 4W7IA 3SJZA 4Z7JA 5TGZA 4QM7A 1QKKA 1YRLA 2DF8A 5I8ZA 4DTCA 4RTOA 5BNZA 3FMVA 1GZSA 3QSYA 1O5TA 1VTKA 2R8YA 1QAMA 3CLUC 3GYGA 3JVIA 1FP4B 2V7BA 1SHZA 4FGKA 2HOQA 4HDMB 3AZPA 4ZO8A 2C2MA 2OOSA 1W7AA 4LHWA 1YE5A 3IA7A 3S1SA 4KMSA 1RWQA 3AFIA 1TA4A 1Z7GA 4ZRMA 2ADMA 1WWKA 5LMNB 1SWWA 1T5TA 2PCJA 1RJEA 3AIKA 3ANXA 3OU2A 3UHFA 3HB9A 1WU7A 1PVDA 1QDEA 3HFJA 1M2WA 2VQ6A 3JQ9A 3T3NA 4EG7A 3JD2A 3HSYA 2TECE 3ETDA 3AJEA 3COZA 1X8JA 4ZAFA 2OQVA 3G0OA 3SVLA 1H3EA 2B8EA 2PJDA 2QT1A 3I58A 5CK5A 3ZK8A 5JNWA 2NPIA 4CQLA 1DC7A 3K0AB 4TV8F 1WP9A 3L6RA 3IE2A 1IY2A 4MWTA 1UH5A 4ABTA 1GQFA 3OG9A 2J0QA 1S2LA 5LMZA 3HJNA 4HNTA 2IOQA 5KQRA 4OHWA 3SMVA 5JSQA 1ODFA 3F4KA 5FR2A 3KQHA 1PL6A 3L79A 3TGPA 2ZR7A 2EFGA 3H13A 5A0TA 4I66A 2ID8A 4LGCA 4RVFA 5DASA 5A5VA 2VSYA 3ZZMA 3UHOA 2D5AA 3B5EA 4OHOA 4XARA 1IN1A 2OVFA 1OI4A 2YXDA 3C6MA 5C4MA 2OTCA 3K0SA 3ABQB 2IYTA 3BBLA 4H6VA 1RWMA 4IRMA 4WKGA 4LKOA 3OJOA 3AG5A 5KOHA 1WU8A 2WIAA 1ZD8A 1TM7E 2XTAA 2ZJBA 3WR5A 3WIUA 2BOVA 5BN5A 3GL9A 2NP7A 3NVMB 3PQ2A 1A82A 1TIPA 2W42A 3IERA 1XHFA 1E3WA 3JVVA 5NULA 2QX7A 3EVEA 1HV8A 4MKIA 1GPBA 1YFKA 1FSGA 2EW1A 2NO1A 2ZU0C 4MQ4A 4BTLA 4DC9A 5IYZA 1J20A 1RAHA 4Z2YA 3T0FA 4OI4A 4E88A 5AVQA 3FYCA 5U4QA 3ZKWA 2HHAA 1Y98A 4OV6B 4D4IA 4MW7A 1IN4A 3A14A 1C9KA 1NOJA 4MDEA 1YWGO 1R8YA 1NBAA 2VZ8A 3W3AA 4HO1X 2FSHA 1TJPB 4E2FA 4I55F 1N7IA 1HRDA 4RCZA 1ZUNB 2X8JB 4PCVA 5D3MB 1CNFA 3UT6A 3UQZA 1T4MA 1MR3F 1ZN2A 1WHSA 5THXA 2WUDA 5FEUA 1LRLA 1BMFD 2WINI 1KAGA 4BVHA 1E9FA 1MFPA 1SOUA 3NHPA 1XALA 1KKMA 5ENVA 3ZLBA 1ZNXA 2HBRA 3IEMA 2VC2B 5BSHA 4RTJA 3MJ4A 1IBKB 4YBRA 1KFKB 2L69A 5JD4A 3AM1A 3BRCA 2YXEA 1PKEA 1YOVB 3BGWA 1TYBE 2JASA 3HVIA 1LZKA 1QHNA 1EK6A 3Q41A 4EAAA 8MHTA 4MJXA 4TMWA 1Z0DA 3RC9A 3TXYA 4W8GA 2P4HX 4UTNA 1BMFA 3D3KA 3H3FA 1P4JA 1TO2E 2ZSAA 4H3KB 4KFRA 3FWHA 5C5CA 3TLAA 4F8JA 1PLJA 3QTLA 3GFTA 3QUBA 3ZX4A 4BNNA 2OCAA 2AXQA 2QTNA 4YUWA 3TSYA 4J2TA 3WB2A 1GRQA 1PS9A 2Q8PA 3KHSA 4NEGA 3C3AA 4UREA 4BGEA 3BMCA 4F3NA 4QQNA 1B74A 1YJ5A 4N5NA 5D3MA 3RJ9A 4CV1A 2GTIA 1WE2A 4UEKA 3E5NA 4MA5A 4YQZA 5TQ0A 3CT6A 5KX5A 1V8FA 1KFCB 2WYOA 3THWA 4KVFA 1KDZA 3L0SA 2R84A 3LFTA 1W6RA 2YUIA 5LOVB 4QOEA 3ZE8A 1E9CA 1FXUA 4Q01A 4KIFA 4Q3OA 2WABA 3CW2A 3M6FA 1MX9A 1W93A 3ONVA 2JRCA 2HA2A 1CJKC 1J8DA 4M89A 4OMUA 4X7PA 1E0KA 1WDTA 1LJLA 1E64A 2QRMA 1KE2A 3TM5A 4E31A 2I76A 5I9IA 4XTCS 1ANKA 1I6WA 3WQHA 3PGMA 1RAAA 5IWCA 4WVFA 5DX1A 3A32A 1YIOA 4NTZA 4N39A 5EKTA 3DE6X 1NUUA 2Y66A 1N77A 1E6KA 3KG2A 4P2GA 3PPYA 3BWXA 3GFGA 4J16A 4TV9B 1N6LA 3GA5A 2XBUA 1HPLA 4E5NA 2GPTA 1XLUA 1Y9ZA 3AWDA 4QPCA 3HZOA 2C5HA 3AVYA 3KJGA 4TL9A 4AL4A 2QUHA 1QYIA 3OFNA 1HTWA 1O2DA 4S05A 2E4XA 4ZV7A 4M76B 1ND6A 2UV8A 1RLTA 4RAOA 4KHPB 2Q5EA 4LI0A 1I51A 2VK8A 3AQ4A 1G2QA 2VG8A 4BWYA 1V6SA 1PGNA 2FB9A 2R6HA 1WOMA 1DT3A 2B83A 2DWOA 2PA3A 1OOEA 1G8MA 4QUEA 4XX1A 3TR6A 4A2PA 1OGJA 3RUFA 1VBFA 4JI2B 3S2EA 1LPBB 2II6A 3ZTWA 5DPMA 3AFHA 4MW6A 5BR1A 3TUIC 3QXJA 4UBLA 2JIMA 1FUUA 3RJ5A 1PYOA 3I53A 2BFMA 2VK4A 1LY1A 4ENQA 2Z6UA 3KXIA 3HI6A 3FPGA 4ZI2A 3M6MD 4CLEA 3RSZA 1NKTA 2OHJA 3G7SA 4PYMA 2RG7A 4RM2A 3AIMA 4BO6A 2C20A 3PC6A 5MHTA 3NDPA 3RKUA 1V26A 4GOND 3IUSA 1CRZA 2VHXA 2AV6A 1L7RA 3G88A 2V3VA 3MBKA 2R5WA 3GA7A 2IUYA 1XZAA 3I4LA 2PTHA 5K3SA 2PA0A 2NUPA 2VSFA 1DZIA 3C4VA 3IPRA 3GT0A 1NW8A 5HOEA 4EYOA 2C2OA 4RSGA 3UGJA 4JHLA 1QVAA 4YAGA 5I7FA 3L7DA 4M49A 2O8EB 1FBTA 1PJTA 1TKAA 1EDOA 2QJFA 1V5GA 3IOEA 4WECA 1HEUA 5K0ZA 5ITZA 5AHRA 3RNOA 4EI9A 1W9HA 2FW0A 2AZMA 1X2BA 4W9MC 3LX5A 2RGGA 1RRFA 2A35A 1JXOA 2QMOA 4OF4A 2ZETA 3WHPA 5JS6A 4RTNA 5F51A 3L1HA 2YHUA 1F2UA 3E8MA 4RENA 1U0SY 3HSSA 2HSDA 2J7KA 3B1WA 3SEAA 1ZOPA 4B2IA 4YAFA 4RHTA 3SMQA 4WX2B 1RDFA 1MAHA 4AJEA 1C50A 2G17A 2PYZA 4G81A 4HI0E 4X63A 5ABPA 4E09A 3LW7A 1D6SA 5B7QA 2XNHA 3V6MA 2IHKA 4G5GA 4ZV9A 4EVSA 3PQDA 5KNBH 3BRWA 4AX4A 1VLMA 2QAIA 2C2WA 4MVJP 3KP1A 1EB9A 3USES 4BO9A 3MZ0A 5BN5B 4B3GA 1QP4A 4RS3A 3VYWA 1P5FA 3ZWVA 2D06A 2DM6A 3LY7A 3OPVA 1PX2A 5DYWA 4EA6A 2V6FA 4J2HA 1LDBA 2XY4A 3DBHB 4DABA 1IHOA 2HU8A 3AVXA 3RYCB 3DBOB 3N1UA 2VXYA 1ZMXA 1XAHA 2NU8B 2BJWA 3O1IC 3NC1C 5KYYB 5EZYF 3W05A 3CW9A 3FB1A 3AM5A 1CQWA 3VR3A 3O31A 4EKNB 2BHRA 3KAKA 4AJJA 3RIMA 1IHUA 2JIBA 5IDQA 3B38A 4Q12A 1N6PA 5JE8A 1II9A 1RIIA 2QMYA 5IEJA 1V43A 5EYPA 4M1WA 1W0JA 1GTL1 1TM2A 1XFAA 2EJWA 3EN0A 3M49A 1PR6A 3R41A 4DEXA 1JB9A 3HYLA 4FI3F 3PDIB 5TMPA 2P9JA 3DZGA 3N86A 1D1TA 4IXMA 1JHPA 1NLYA 1E2UA 4RPLA 5A6VA 2AG5A 2JFUA 4KQXA 4BU0A 3MLEA 3NO4A 1BE0A 1YR1A 1E4EB 1G7SA 1RHKA 3N2GA 1Y5RA 5FUYA 2VQDA 4AO7A 5JYDA 4P54A 1YQXA 2GFHA 1CFZA 4LBVA 3HWSA 4MQUA 2JCXA 1QFMA 3UB4A 4LZOA 3RAPR 3PJRA 1AH2A 1P39A 2DLNA 3DOOA 4HSEA 4YO8A 4UTOA 3P27A 5J58A 2W00A 4MR7A 4Y2UA 3FHCB 3LPCA 2C77A 4B3HA 5AQ1A 1Q2UA 1V5WA 1G4HA 1PFVA 5CDTA 3QLVA 1PDOA 2XA1A 4C4OA 1JR2A 1YDEA 5LWQA 3NU1A 2BFEB 4O4IF 2JHPA 1NJGA 2CL6X 4RSHA 1X87A 2NZYA 2QYSA 5G3ZA 1H0HA 3GDOA 3RS3A 1XF1A 3KSUA 5TR9A 5EWMA 2DWCA 4MEBA 3OPXA 1OBFO 3F2VA 1GTMA 1RVDA 3CUYA 2Z6VA 4I50B 3TLYA 3RRYA 4DHEA 2MMCA 3AB3A 3KFLA 4Q4JB 5FFNA 1BX0A 1EIWA 4LOJA 2YWDA 2ZE7A 3DT6A 3I9MA 5AM0A 1AT1A 1N0WA 5F77A 5KMGB 2EBHX 2W2OA 2GKGA 2ID7A 4R9VA 3CR3C 3HGTA 3M83A 5B57C 1ZESA 3H6GA 1VJGA 2W4MA 3NHUA 4GAEA 4DV6B 2F1KA 1YRWA 2FWPA 4EK9A 2BUAA 4JLWA 5AXDA 1OHHD 5HWSA 5KKCA 1A9YA 5IJ9B 4TLMB 1YKFA 1Z2NX 4M86A 3U44A 2JFOA 2P9EA 4INOA 4EJFA 1NY5A 4FBMA 1KBOA 1XRJA 2ON6A 4Q1FA 1FVFA 3E0XA 3A9UA 3QKSB 1W0KA 4MYTA 2FQXA 5G4KA 4BEVA 4D4JA 5KS2A 2P27A 4ZTZB 2XXAA 4H6PA 1NMSA 3BXXA 4G56A 5CYGA 2WLSA 1T0HB 3C3CA 4HN4B 1Y37A 2HCRA 3ZR4B 2BEWA 2BGNA 3MTDA 3UWSA 4JI8B 4WBNB 2GAJA 3UANA 3VC2A 4CM7A 1Z35A 2ATVA 4RYLA 5BUSA 4E2XA 2J7PD 5ERYA 2Z5LA 1FF9A 2H8KA 3FFAA 3E9QA 4C4ZA 1NXTA 3M6AA 1XLTC 3CR8A 4DMHA 1OFGA 1JHDA 1LK5A 1U28A 4HDMA 4GE0A 4G1CA 3KB2A 2JATA 3EPRA 2OFOA 3GAZA 3I9FA 4LISA 1NWCA 1F2TA 2O2HA 2BHNA 2WYIA 1QORA 4JL5A 4MRVA 5EJFA 3OFKA 2YIMA 1GV0A 4Q15A 2R66A 4RIHA 3TB4A 4PC3A 1WNFA 1D4ZA 3K9NA 2VCHA 4UEOA 3PC8A 1PZMA 1HFWA 3KUXA 3PHCA 4HK4A 4M22A 4B5LA 3AESB 3K9HA 4DARA 3OMLA 1KI6A 3DFUA 3OX3A 4R05A 3UMBA 4G26A 3O4FA 2VJPA 2BRUC 3DZFA 1IEWA 3L4BC 2IP2A 3NETA 1KK0A 1UK6A 3IMEA 521PA 2TYSB 5HUHA 4RMIA 3O8DA 1W59A 1IJFA 3LQQA 1XLVA 1EWVA 4UCQA 5H81A 4IGFA 4YT5A 1JQKA 3D7KA 2I9KA 3ZYZA 4UHFA 4XPIB 3VSBA 4W82A 3NP7A 2J9FB 4OIMA 3OPYA 4C7XA 1CR6A 3CUTA 2QQEA 3AF5A 2FXIA 1P80A 3OE7A 3KQQA 4LCJA 4DG5A 3E23A 3RFUA 4B4OA 4A73A 4E21A 5J2UB 3OOYA 3AUFA 3QUCA 1E2QA 4I9HA 4RXMA 1V6AA 4E33A 2BFDA 4AQDA 1MRSA 5TGTA 4CF4A 2OPBA 4AKIA 1DUVG 1G4UR 1NV9A 3NVAA 4JVSB 3TQHA 2OFFA 4F4IA 1QG4A 1SCDA 5T57A 3K0CA 4QWWA 4TUYA 3UC5A 4C4RA 4BHTA 1KH2A 2NT3A 4RTKA 1E1DA 3GRUA 2E49A 1ZA2A 2OZLA 4NMLA 2O8CA 1ZM9A 3FA2A 5BSGA 3JYLA 5ALRA 4XLZA 1IXZA 3KOZA 4U00A 2OCBA 1DQPA 4GHWA 1JIKA 3OE5A 3R24A 3VGPA 3WAKA 4E11A 1ZR4A 1PFUA 4QVKA 2O8CB 3WK7A 2Z04A 5CVCA 2WWRA 1U8FO 4CT0A 5F9HA 1DNPA 3CZ9A 1JR3A 2CHUA 3TOXA 5KWEA 2IYQA 3NVDA 5KYYA 4TM7A 2IX3A 1FRZA 2Y92A 5LOVA 4NU5A 5EIBD 5C4IA 1EI9A 4MI6A 4P4SB 3MD9A 3OLCX 4KOAA 3FTDA 1I01A 2OAP1 1QHFA 4WFQA 3R3XA 4Z0HO 1HLFA 2R25B 1E89A 3ETGA 4FC6A 1FK8A 3SY8A 3TLCA 3PNOA 4FFSA 2DJ5A 2QMQA 3FUUA 2J07A 4JB2A 5SICE 4CUJA 4YMTA 4RWZA 3KZXA 3AVTA 1NY6A 5BPFA 4FMDF 4DR7B 3HS3A 4OCZA 3VPSA 1O6FA 4TYMA 1L7XA 5DHUA 3QHAA 5H8WA 2Y1FA 3HVJA 2VP5A 2XT6A 5JWOA 3AJAA 3BK1A 5A4JA 2Y1KA 4YJFB 3SWWA 1NT4A 1QIMA 1T15A 3JQDA 4O4HB 2GEVA 1ELOA 3T9AA 2FGJA 1DOHA 4BBZA 4Q3DA 1C1XA 1FFBA 3HZHA 3NOQA 3QU5A 3PF9A 3A58B 5CNJA 3TLMA 2PMBA 1FLNA 1H0RA 2GBFA 3OWOA 5EWJA 1W581 3W90A 3FYUA 3L01A 1CQJB 1Y6JA 2JVKA 2ZE5A 3BDIA 4AK9A 5AVTA 4JT2A 4BX9A 3G85A 4FKZA 2Q2NA 1F14A 4IHKA 4PBRA 5K03A 5I7UA 4BIMA 4N4AA 3BRSA 2GSDA 4UAUA 3S55A 4D9BA 3VNQA 4F5WA 5H02A 5H5JA 3MBOA 5MFPA 4GBMA 4NV3A 4P81A 1H94A 1DKMA 2I99A 2Z8ZA 4ZDKA 1KYQA 5F2EA 5HKAA 4FDVA 1TE2A 1XXHB 2EZ4A 5E6UA 1WKBA 1M67A 2NN3C 3ZZ0A 3UZUA 1DPGA 1JDSA 4OB6A 1K89A 4FFMA 4WBSA 1JDUA 4EQ6A 1UBMS 4Y2TA 5K09A 2XGMA 3MWEA 2VF7A 4Q6BA 5DM60 2RK6A 2GVNA 3O8BA 3BB1A 4URYR 3NRCA 3MWJA 4F93B 3GLHE 1E2MA 4JD5A 1R6AA 1W19A 4JBXA 3B7WA 1JA1A 1T4CB 3BGIA 1ZD5A 3GJYA 4MS4B 4NDAA 2VRCA 1GA4A 2OD9A 3LT5A 4NH4A 4X3PA 3PT9A 5DCWA 4KXYA 3LWNA 5K3AA 5I7SA 5IG2A 2HKIA 4FIZA 1MC8A 2GTHA 1DQRA 2COKA 3NEJA 2ECOA 1M5UA 3OZDA 5AWFC 4EHJA 1EX1A 4IZHA 4DUGD 2FRVA 3BXPA 4Q1DA 2BDEA 1XA0A 1GUDA 3K8QA 3DTTA 3LUDA 4UW9A 3I09A 7ABPA 3MOIA 1IU9A 4GRDA 5FH9A 3LL7A 5HKKD 2C54A 5B4TA 4FYYA 1YULA 2BJHA 4OL9A 5I3ZA 1QE3A 4LBZA 1M8KA 1ORTA 2W6CX 4OQFA 4XWWA 1DQSA 4OH1A 1R6BX 1BMTA 2A33A 2H06A 1AK9A 1U1FA 1W4LA 4JQYA 4PGHA 1WSBA 4PE5B 3QV2A 2IV2X 4AY6A 3ZGOA 3GHHA 5IKOA 3X1ZA 3KWJA 5TJHA 3R8CA 5SYNA 1BH6A 3HB1A 1RWBA 3IAXA 3PIDA 4LZAA 1RM4A 2D1TA 4OKIA 4QZVA 1HZJA 3ZJ4A 1I4LD 4QJ3A 1UKEA 4Z4EA 4J0FA 4E32A 2HK7A 3KKPA 3AHEA 3IUNA 1DEAA 4ZPXA 4V03A 1W5SA 1EUCA 1WHTA 3EXFB 4LJ7A 4OHCA 4HYQA 2QN9A 5B58C 4UQLA 4X1KA 1YCGA 4DLVA 3SC6A 2G82A 3HL4A 2PUTA 3D3QA 3GFVA 1KZGB 2F4VB 4BECA 3VDRA 1YZFA 3B8HA 7REQA 1NJ2A 4FS3A 3CUUA 5DH9A 4TS9A 5F5XA 2FP4B 1O9GA 1XCOA 2QL6A 3IAS1 4HZUA 2ZYDA 3M89A 5DYNA 1VIDA 3L0CA 3V1TC 5KJEA 1K9VF 3HY4A 4UTRA 4XM2A 5CEJA 4US2R 3GLFB 3G7UA 2BMDA 2G1PA 1VG0B 2J33A 2RC5A 1ULHA 3CH7A 3DXXA 4MQ5A 3EWNA 3INYA 4EPYA 2F64A 5KBYA 3KTDA 4RABA 3F4LA 1KR2A 3UK0A 4JUBA 2ZJ6A 2X0DA 4CDMA 3THSA 4LPKA 3CGWA 3OX4A 3DEAA 3NPAA 5AH0A 5EQDA 3PD1A 1LDEA 3M2PA 1K98A 3E9NA 4EY5A 1TM4E 3GCXA 4MS1A 2ZYAA 3OX2A 5TQ2A 4HDRA 1WBJB 4FCTA 4ETIA 1C7ZA 1C8BA 5AI8A 1CZOA 3G5UA 4X97A 2IDMA 3WRYA 4AI6A 2HIHA 2H4XA 1QH8B 3LM8A 3F7OA 5CHEA 3KPWA 4B6FA 1V5EA 5FBRB 3CF0A 3V80A 2WPNA 1G20B 1QLJA 4ZICA 3WGUA 3LBIA 4XOUA 5EWJB 1QHHB 1C7EA 1JIVA 2LRHA 3NHJA 4A6PA 1AS2A 1OW3B 2AEMA 3CW8X 3IB3A 4J6EA 1DBWA 5JW6A 5LDGA 4IFBA 4Q66C 3ZIAD 1N36B 4HEJA 2C9YA 3M9WA 2A4MA 3P2YA 1CVIA 1IUOA 2Z56A 3ZYCA 3EFBA 2QX4A 2DKNA 4QFCA 1XNGA 2ZPTX 1J2JA 4DJJA 2YUTA 1TQ2A 3AKDA 4KRYA 3T52A 4ZCRA 4AN4A 5A6SA 1CUSA 4K2HA 4Z9FA 1Z7YA 2J09A 3QXGA 5ESRA 4ACAA 1A69A 1IOVA 1YA6A 3PLNA 1STOA 4G24A 2TRSB 4P08A 1XUOA 3DAYA 2D3WA 5JDCC 3R3ZA 5B2EA 3DXZA 3NWJA 3T7SA 1YT5A 1EHCA 5DNDA 4JIMA 3CG0A 3EGDB 1G20A 4LC1A 2EHJA 5CK4A 2ZGVA 4IXWA 5A9TA 3RIGA 3X2FA 1QP7A 1FJ2A 2EBUA 3NYWA 2XZOA 3U61B 2HU2A 2WF7A 3DZCA 1CK4A 2VUUA 2PUAA 4FEGA 3SZ3A 2FN7A 5DNEA 4UOZA 2C98A 1A4IA 3GJ8A 5E9QA 5JDIC 4D9NA 1FXSA 4KPYA 4PIPA 1PT7A 2C3UA 4NEHB 1UMDB 3AR9A 2FN8A 5CB8A 3C5VA 4C0AC 4MHTA