4M0PA

Crystal structure of human prs1 m115t mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
304
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANTLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
total genus 93
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA02
3DAHA 4RV4A 1A95A 5BRNA 4RHXA 4QYIA 1MZVA 3S5JA 1I13A 1DKRA 2VFAA 3O7MA 4RAOA 4JITA 3ACDA 1DKUA 1ZN8A 4RABA 3H83A 4RHYA 4P84A 1L1RA 5BSKA 1FSGA 1QB8A 2C4KA 4P80A 3KB8A 1V9SA 1LH0A 5IAOA 1BZYA 1ECGA 1VDMA 1U9YA 1TC2A 4ZFNA 1D6NA 3NAGA 3EFHA 1P4AA 4M0PA 2JKZA 4LYYA 1ZN7A 1NONA 3OHPA 1A96A 4M0KA 1ECCA 1TC1A 1HMPA 4X44A 2GEBA 5HKLA 1HGXA 5BQOA 2XBUA 1NULA 4F8EA 1VCHA 1WD5A 4LYGA 4RANA 1DQPA 4RACA 1XTVA 1UPUA 4TWBA 5ESXA 2JBHA 4QRIA 4RHTA 4RQBA 4LZAA 4LZOA 1A4XA 5HIAA 1I0LA 4RQAA 1STOA 4WN3A 4X45A 5EUCA 5IPFA 3HVUA 4MB6A 1G2QA 1J7JA 1O5OA 1DQNA 4QYIB 4LZNA 1W30A 1I14A 1Y0BA 3OZFA 2EHJA 1IBSA 3ACCA 5K51A 4P83A 4P82A 1P19A 1L1QA 5KAMA 1OROA 4Z1OA 1QCDA 2P1ZA 3DEZA 4S2UA 1QB7A 1XZ8A 1XTUA 2YZKA 1QK4A 1XZNA 1BD3A 5ESWA 1A3CA 1A97A 1ECJA 2JKYA 2H06A 4IJQA 1O57A 1QK5A 1U9ZA 3LPNA 1P18A 2WNSA 5E38A 4P3KA 2IGBA 4RAQA 1OPRA 1QK3A 2PRZA 1GPH1 2H08A 4PFQA 1UPFA 3ACBA 4M0UA 3LRTA 4PAWA 3MJDA 2HCRA 2FXVA 1YFZA 1G2PA 1CJBA 2H07A 1UFRA 5KAPA 3GGJA 5JV5A 1OREA 1XTTA 4FYMA 4P81A 4WMLA 2PRYA 4JLSA 1BD4A 5BQPA 4RHUA 1I0IA 3OZGA 1Z7GA 2E55A 1DBRA 1PZMA 3GEPA 1JLSA 4RADA 3QW4B 2DY0A 1ECBA 1A98A 1QCCA 1GRVA 1ZN9A 1VSTA 1JLRA 3GGCA 1P17A 2AEEA 2PS1A 3DMPA 1AO0A 1G9SA 3N2LA 1I5EA 4KN6A 1ECFA 5JSQA 1R3UA 4P86A 2JI4A 3MBIA 3M3HA 1G9TA 4OHCA 3G6WA
chains in the Genus database with same CATH superfamily
4RF5A 4XIFA 4FP9A 4BN0A 3D2AA 2Q45A 1UXOA 2VYFA 4RTSA 2FFBA 4KRFA 1W9MA 2IU4A 1ZNZA 4W1RA 3AERB 1H2ZA 3DR3A 2BGRA 1VBFA 1IQRA 2AFIB 5L40A 3TZCA 1GNTA 3QPUA 2CHEA 4JJ4A 3OPYA 1OYVA 2W6JA 1DIAA 5DV9A 1ODSA 3B12A 4KKXB 4QYMA 3DF7A 1J9GA 1KS2A 3O4RA 1US8A 4KXFB 3KSUA 4AICA 3AOEC 1D6NA 3P9IA 1IH8A 3C4VA 3JWGA 3B7PA 4IQGA 3R5TA 2NG1A 3G02A 3VISA 3WHPA 3ZCTA 5DN6D 1TO2E 4XZ3A 5AKHA 2AXPA 2IHKA 4F3CA 1UBNA 1ZL2A 5DI9A 4UTNA 1JMYA 1EP2B 1RRKA 4TQUS 2QPLA 1S2GA 3FNFA 1QHNA 2R66A 1WCV1 5T7BA 4WA8A 1O6CA 1QPGA 4PY2A 3GV0A 1PJBA 2HLPA 3MBKA 1BX0A 1GRNA 2CYBA 2DVMA 1QKIA 1M8KA 3HCDA 5JCOA 3AFIA 3K4QA 4YIKA 1P2GA 3OMLA 1F3OA 2H1SA 3LOPA 4O4LA 3GJ5A 4MRMA 1LRJA 3HLTA 1QIEA 2WC1A 5I3CA 3LD9A 1C3OA 3AOEA 1OTYA 4D3ZA 1CSEE 3B3JA 4DREA 3WGIA 4R9VA 4L0QA 4AS2A 5IJXA 2DAPA 2JH8A 3CUUA 3WL7A 3K2IA 2AKYA 1NHWA 3L8CA 3WB0A 1W4CA 3QFHA 2KHZA 3AM1A 5A9SB 4B80A 5A1JA 1TM1E 5AWFC 1XZ8A 3A1VA 4J2OA 2HGZA 1J1IA 2JLCA 3R7FA 2VNHA 1PQWA 4FT2A 2ZE5A 2YJGA 3CH5A 2X7JA 5FO0A 3RFCA 1QG0A 1NNSA 2OCKA 4GQAA 5GJCA 3ZQKA 3G9QA 5M29A 3A6GA 1VHJA 1KARA 4UU0A 4L4RA 4RFSB 5E4JA 5T67A 2WP8J 3QEBZ 2NAPA 1VCMA 2CWDA 3KNZA 4LW8A 1TLTA 4YT2A 3CLUD 4XSGA 4B3IA 3HZRA 4B83A 2R7KA 4KWTA 5G1NA 4D4GA 4OK6A 4QOEA 3H1EA 4I4LA 4XRRA 1FA9A 2RGNA 1EWVA 3F98A 3G49A 3OQHA 4CEJA 1NVUQ 1P9WA 2Q07A 4MWBA 1SUIA 4KLNA 1ULTA 4XB6B 4YRDA 3NM4A 2V5UA 5FF9A 4BMDA 2OFPA 1I7SB 1I7NA 5AH0A 1VIYA 1IB6A 4Z49A 2KLHA 2YUIA 3ICPA 3PGA1 4YT4A 2MINB 4LE0A 1P39A 3RVLA 1VL6A 3LCJA 2PZ8A 1WEHA 1O5IA 1TOAA 4FNAA 1QCCA 1G6HA 4D82A 4HDCA 3MQFA 3JATB 2XB8A 3EH2A 3IEMA 2B4AA 4KTTE 4AUKA 5LQRA 3QX9A 4HPJB 2AI1A 4HC4A 3DB1A 2WTMA 4IQ0A 2RARA 1JQKA 3JASB 1LNZA 3Q7PA 4MR7B 4MMYB 4Y8VA 4CLEA 5I6DA 5JZMA 3PNQA 4ETMA 4DLLA 3WGHA 4QU9A 4UEOA 2AVNA 3ANSA 5BW5A 5K6RA 1U0OC 1SAYA 2DFDA 3C16C 4YONB 2P9CA 4S1TA 1N2ZA 1OZAA 2C04A 3M89A 1C0KA 1KS9A 1NMYA 1P7WA 2QX9A 3HI4A 4V02A 3SZMA 1HLGA 2FVYA 4LQ4A 3WC4A 1UJBA 3TGLA 1Z6ZA 1O95A 1DHTA 5FR2A 4TMXA 1Y80A 3PIRA 1H0KA 4DA9A 4AG3A 1TT5B 2IEAA 2AQHA 1DAEA 2AFIE 4M7RA 4FNMA 1H05A 5H3LA 2HR1A 4PSUA 4AKHA 1J07A 1GSAA 4F5EA 2ZRBA 2CN1A 4GD3Q 1BN6A 1TF5A 4IS2A 1N1EA 4JBYA 1YB2A 4ZQGA 4FDMA 3UZUA 4D26A 1FS5A 1UJ5A 3IAAA 4KQ6A 5NULA 4B4OA 5LD2C 1FRQA 1HMPA 3BJMA 2WMDA 3ICOA 3QJ5A 1I6KA 4M0LA 2QJWA 3L4SO 1DAFA 3TTYA 5CLHA 3QJYA 4CF5A 1P4JA 4BO1A 2H4YA 2EYUA 1AQYA 1YMVA 3U81A 4I8XA 3ZJUA 4IW3B 3T9EA 3TKYA 3VYWA 3K9GA 1U2QA 5K8CA 5KSOA 1ARZA 3UO8B 4EFKA 2OR3A 1VJ0A 2CEKA 5KNCA 2Q0QA 1AMUA 1C0EA 2XZPA 3SFZA 3U9TA 4N12A 3Q9UA 4ZWNA 3WLTA 5AK5A 4J7CA 5K8UA 3NW9A 1Z0JA 4PC7A 4JH0A 3CR3C 1UEIA 1Z83A 4BOYA 1BXRA 3HZHA 2JBAA 1VLLA 1DX6A 3INTA 4KZPA 3GFVA 3GVXA 2FSUA 4OHUA 3SLKA 1RJWA 3DTTA 3JYPA 4JHXA 4K6MA 1NDQA 1G8KA 1OX6A 2OKCA 3IDFA 4WE3A 1C9MA 4NG4A 1CRLA 3IT0A 1F20A 1XVVA 2C4MA 1FNDA 3TNDA 1ISFA 3BMQA 4LHSA 1Z35A 1SUEA 4IEEA 4YIHA 3PRJA 4I5GA 4BMYA 3UTDA 4BC0A 2ZK7A 2WSMA 2IYRA 5E38A 3TTTA 2QTRA 5LD2B 1ESNA 5KS2A 3K71B 3QKSB 3I9FA 4PYRA 4KYTA 4EG1A 5GGYA 1NJ1A 4KBYA 2HGSA 3W7VA 5JEDA 3WJAA 5CVVA 1I5RA 5JECA 1LTKA 5LFAA 2H2FA 1YFZA 3HYLA 4RJKA 1U98A 2CHVA 1VB3A 1U1DA 1FYXA 5EP3A 4AUEA 2JFYA 3TOZA 3OEHD 5IN4A 3DMRA 1K7CA 1F51E 2PUJA 2GHRA 3LKZA 1B8PA 1IZ9A 1WVGA 1T8RA 3DP7A 3KVOA 4RDIA 4AJ1A 4AL4A 1LRLA 3E2PA 3TUZC 2HPVA 3CF4G 3R3ZA 5CLLA 3GD5A 3IAHA 3EN0A 2FMIA 3C43A 4OB8A 5IVDA 1RM5A 4GECA 4K9SA 1LPNA 5EWMA 1D2HA 3R6LA 1HE4A 3O75A 2FXIA 3R8FA 1MN6A 2X4IA 1D1SA 3K5HA 2D2FA 4GWGA 3L4BA 1EFPA 4QHTA 4A15A 3SU8A 4B2LA 3P71T 5CUQA 2GZMA 3T4UA 5G3ZA 1QBGA 1QRDA 4TXMA 1J39A 4MVJG 3NIWA 2DFVA 5JSQA 1N33B 1AHPA 5FPSA 2PRKA 3VVLA 1GZ3A 3HN2A 4K9MA 3CPSA 1VE9A 5EMHA 4J0DA 4KVAA 2D13A 5ALDA 4YJHB 4CM7A 2LGJA 4FHEA 2CUTA 4IJ6A 3DLCA 2FZVA 1S7CA 3L1HA 4U7FA 3THOA 3TPCA 3EYAA 3TEJA 5BPFA 1NYLA 1SKYB 1Z12A 3KPJA 4L9WA 2P3SA 3VNSA 1NVWQ 3PDUA 4MW6A 2UYCA 1CRQA 3JZAA 1RQ7A 4X1KA 2CHFA 1RRCA 2FPKA 4OGFA 4M1SA 5CVJA 2C7PA 1H8ED 1V9SA 4Y2JA 1QFMA 2J08A 4XDZA 3ANTA 4DLZA 4F4CA 5T6BA 4MUGA 3WMFA 4HI0E 4CPDA 1KIAA 5FTKA 5E6RA 3K05A 4PLPA 4DQKA 1OH7A 4K9PA 3PEEA 4U8GA 2BVNA 4AJ9A 4NAVA 2A1UB 4P2BA 4ZARA 3ZHBA 3D6HA 1FFXB 4G1CA 4Y1GA 3EE6A 4AS1A 4OQ4A 3EDQA 4BRZA 1MH1A 4WBXC 2FPSA 4LDRA 3NANA 5TIIA 1HT0A 1FFBA 2UXDB 4YC7A 1SGWA 1TM5E 2X4GA 3GMSA 1V8FA 1C3XA 2XBMA 3V8RA 1BOFA 3TR0A 2BGNA 2W11A 1X7YB 3ZY6A 5BYBA 1VBNA 3S1AB 2NTNA 4TL7A 3SYMA 4F56A 4XTCS 2VZ8A 2GR9A 2CJFA 1GPDG 5J1TB 3EY9A 4RVCA 3GHYA 4ASUA 3U7RA 3HDYA 5F7ZA 2CKDA 2GZDA 3A31A 3K73O 4TUYB 4WINA 3T5BA 3Q88A 1Z47A 4HGOA 1I4TD 2REQA 4E7OA 2F00A 4GXRA 1RAIA 4U2KA 3WV5A 1F4LA 1GNSA 2QF7A 3IE2A 1FMTA 2VJDA 1IOVA 3A3YA 2CJXA 3FDZA 2I62A 5C18A 3WLAA 1OBCA 2PKXA 2DXIA 2H06A 1QH8B 4UATA 4JBXA 2WFZA 3V4LA 2OPBA 4FYHA 3SZLA 4CG1A 4CMHA 3KQOA 3W9UA 1YK1A 4J1NA 1GZ6A 1RI5A 1U3WA 1ATZA 1EUYA 1TJPB 4GZLA 4QWWA 5FWYB 5K20A 1CF4A 4H3KB 4TYWA 1YFJA 1XKQA 4BP8A 5FBLB 1N57A 1CFZA 2GK7A 2QD2A 2P6OA 3KJZA 2VPXA 3P7MA 3Q85A 2ID8A 2E48A 3DBVO 4IFEA 3Q9NA 3C3YA 1CY2A 2A33A 5BQPA 4BBJA 4Y2XA 1A2QA 2P2NA 1BROA 1JFLA 5AKZA 3GCGA 2X0DA 4E31A 1QYXA 4NYMQ 1L8OA 2O0MA 4INPA 1DO2A 2BFMA 1SVUA 4J1SA 4P98A 4D1YA 1JLSA 4GLBA 1J4AA 3KE9A 3HYRA 2I78A 2ONZA 1E5TA 3LQ2A 4CKCB 2PLWA 1VSTA 4J4TA 5TQJA 2WU0A 3ADCA 3Q6NA 3R0ZA 1NJGA 3MJVA 4I14A 4W82A 1FSZA 4JB8A 4Y9SA 3U3RA 1WXEA 4BQEA 1GYRA 4GSYA 1EZZA 2Q9AA 4QGHA 5GONF 1D0IA 1S2NA 3EUEA 2ZWPA 4DNXA 1LV8A 4FB4A 4PG6A 3RSFA 1TW3A 3GJ0A 5TMBA 2PXCA 3STVA 5BNWA 3MTBA 4KACA 4PM4A 4B31A 1XU9A 3B1KA 4M1OA 4A26A 3F2VA 3HO8A 4WOKA 2ZT5A 3H2SA 2DPYA 2LV8A 4Z7JA 4BYGA 1M67A 4G0WA 3VOAA 3L6DA 4LSWA 2MSEB 4XX0A 3GLFE 3OTOB 2AZMA 2PTGA 1ISIA 3OH8A 4E09A 1WCIB 3WWOA 1W85A 5BWMA 1XXHE 3FWHA 1BZYA 3LIPA 1HNXB 1CUSA 1TGVA 3USES 1H8EA 1R0SA 2ZQ5A 3L41A 3U3JA 1HDOA 2NO0A 2N3ZA 1T26A 1ZC4A 3IMEA 3EXAA 4CMJA 4CU2A 4JLJA 2DFTA 4QDTA 2R4QA 1ONPA 7REQA 2PD6A 3KAJA 3IQHX 2HXSA 3DYIA 3QEMB 2C2YA 4DR3B 2PUDA 1QTQA 2R48A 4IGAA 1VHQA 4E21A 1XRQA 2NUAB 2P90A 3ZLJA 2WZQA 1R0XA 3NKLA 4QFDA 3HKCB 2C3MA 3U3DA 1J8VA 1E2NA 1RRVA 1YRLA 2JGAA 2YJTD 3FOWA 4MGHA 5A71A 3VPSA 4CUZA 4YJ2F 2PZEA 2V6MA 2VP6A 5ED4A 2BMWA 4P4GA 3ZWPA 5CYOA 2PUBA 4C4ZA 2QKYA 3MCAA 1W76A 3PVSA 3GB9A 1NJSA 3WS7A 1D4ZA 1XWFA 1KWKA 3PR3A 1IK6A 4HGNA 3BIXA 3ZHYA 3QX7A 1JEQA 5A5FA 3I92A 1JEDA 4NE9A 2IYVA 1V95A 4YI5A 3DNMA 4MKXA 2XZTA 1RRFA 4ZV7A 2IEGA 1DC8A 1AN0A 1NTOA 1LLUA 2H48A 1IWPB 2P67A 1ODLA 3DMNA 5F1YA 5C1DA 3ZJTA 2Q1TA 1HRDA 4YJ3B 2PUWA 2C9OA 3IUBA 4IDQA 4DG8A 4FGZA 1YO6A 5E7MA 3BD7A 2PU5A 4XWTA 4XWKA 3DKPA 3IUPA 3SIPA 2GKGA 1KK0A 2NUTB 4S1PA 1FSSA 3O73A 3UWSA 3PGKA 4CHTA 4DVGA 3EXFA 2HUPA 5D7NA 2EQ5A 3HBMA 2WD9A 3YASA 4QU8A 3DL2A 3L1UA 3LP5A 3WOVA 2QGNA 3COVA 3E7XA 4INJA 3EXIA 2EHDA 1TYCA 4P1ZA 4Q4AA 2C1XA 2GBLC 1BE1A 2PRZA 4IMJB 2XJ9A 3T34A 1P9LA 2QAIA 3L0OA 4IQ4A 4H1UA 1BEUB 3M9WA 4R2HA 1WB9A 2VG8A 4GBGA 2ZI4A 3SSMA 1RT9A 3VVMA 3DOOA 5SZKB 4JENA 1C3EA 3V34A 4TV8B 1IULA 2IKSA 2PBFA 2H7YA 2WYVA 1FX0B 4BZWA 1XTTA 4KMMA 2IBTA 1E7YA 1PT7A 2W90A 5C0OE 4OLFA 1Z5GA 4F3RA 2B7BA 4CLRA 1SQ6A 4EGCB 5JUWA 3NX4A 4KB5A 3ZK8A 3JPWA 3FZNA 4K6FA 1NR1A 1PZFA 1ZD3A 4XLZA 4TV9A 1XNRB 1PG0A 3PENA 4ZEXA 2AOTA 3H1FA 2I3DA 1E9FA 3T5TA 3TDKA 1ZOOA 4DMKA 1WXHA 4TTIA 2Z04A 2I7DA 3RVQA 3MSCA 4AFNA 3DEKA 5TJHA 5E9AA 1M0EA 2WHPA 4KN6A 2D6FA 3DV9A 1ZC3A 3K15A 1W73A 4KJXA 1C0LA 3NYWA 4BRUA 2YWXA 4JLAA 4EA8A 1XAGA 3A6FA 4OQLA 1Y3IA 3VO1A 1UP7A 4NMWA 1UDBA 5F12A 1HYEA 4CDRA 5D1HA 2XNKA 2QD5A 3NP9A 4QBFA 3RSCA 5TGTA 2H18A 2RHGB 1Q16A 3EQ9A 5A4DA 2PWPA 3EEYA 5F1OA 3GDHA 3BTVA 3HBFA 4CQNA 5CG1A 1S4QA 3KPUA 1F1JA 4FCVA 4EARA 2KI5A 5IMSA 4JODA 2Q7XA 3EEOA 3H13A 1DRJA 3DW1X 3RB8A 5LOVA 4P80A 1JFFB 1VLHA 4R2WA 2ODBA 3ICWA 1M7HA 4O4LF 1B6GA 2IDMA 3SOPA 2WJWA 2V96A 1OR8A 1JAXA 1N5OX 3U7QB 1RE1A 3NYRA 5LXTB 1M9NA 1G98A 5KWVA 5K3FA 5I8WA 4IS3A 3CIOA 4GKAA 4TGLA 4ZOLF 1PWYE 3Q2KA 4POOA 1IXSB 4CDNA 4JJEA 5DT9A 2F48A 1H2YA 1R5JA 3HM9A 2A5JA 4RFSA 1GKYA 2IP4A 1O6BA 4TZKA 2BGKA 2Q4OA 3CRRA 4R31A 5CJPA 4HX5A 4I1RA 1OZFA 2PU7A 1V8ZA 4KXNA 3FCCA 3L8EA 1F8FA 5BV8A 1IBLB 3O3OB 4ZT4A 1SXJD 3KJHA 4F7DA 3RSOA 3TTXA 3U4IA 1EVEA 2H2GA 2X5NA 3EEQA 3V80A 2GT1A 4R40A 4JHLA 3MMNA 1UBFA 1AUPA 2P2YA 1PR2A 1UK9A 3AI3A 3K3PA 2H00A 2VK4A 3T9BA 4DCGA 4EUKA 1Y5MA 1OT3A 5B3AA 1Y0BA 3I23A 3PF9A 4LCJA 5THQA 3QBDA 4RF2A 4W9RA 4UVEA 3EPHA 1B74A 4LOIA 2G1AA 1FEZA 4NG5A 1U65A 1DBIA 1Y1RA 4K87A 2NZUG 2XRYA 1GT91 1ZK0A 1WCIA 1TKRA 3B6MA 3BGOS 3X1XA 3CUTA 1UODA 3L6UA 3PHIA 3FFWA 3HY6A 3VPCA 5JYEA 2FUKA 2ZUWA 4JVNA 3R76A 3A3NA 1ZIYA 3MXOA 1BDBA 5L7WA 4KO3S 2QQFA 2WUGA 3ZDDA 1W19A 4Y6RA 1J2UA 2RHCA 2BFDB 5IDXA 5K3BA 4CIYA 1ZJJA 4C7VA 5K0CA 4KR3A 1P0CA 1EQUA 4P5PA 1PR3A 3W79A 5GZ6A 4TTAA 1S3GA 1DOZA 1AQIA 1FJGB 1CUVA 1FMJA 3VKHA 1DV2A 4YRMA 4ZVOA 2C5LA 3CEHA 3REQA 4YB8A 2BM9A 3OZ7A 4A8JC 1RLMA 4FSHA 1DLIA 1KMMA 4GI1A 3NNNA 1S9DA 3GVPA 4CMIA 3GYGA 3QLJA 5ALLA 3GGJA 3GRCA 3ENKA 4OB6A 1JEQB 1ORRA 2BBSA 2FE4A 4D0SA 4KNYA 3QFFA 5DNEA 2P4EA 2ZRJA 2WT4A 4NMLA 1VKZA 4R3NA 4RADA 1NL3A 3QW4B 4M0EA 3ZDBA 2WWFA 3MA0A 1PBTA 2XD4A 2Z5GA 4DR4B 1ANKA 1ZUHA 1GZ4A 2WWRA 4EJSC 3L79A 3W2FA 3ZCUA 1RAAA 1PLLA 1BEEA 4DMUB 5JQGA 3PXCX 4L8GA 2YN2A 2X13A 2AK3A 2CFIA 2ZJZA 3OESA 1PTJC 4LY6A 4DARA 2HK6A 3LI2A 3DEAA 1AHNA 2C07A 3JR7A 4WVFA 4HH0A 1EHYA 5H02A 3QXHA 2RK6A 1NNEA 3LQ1A 5KYXB 4BQNA 2R00C 3DMTA 3N7TA 4NARA 4DMGA 2C7QA 1VLMA 2A5LA 1C3OB 3PS9A 1LDNA 2XQFA 3RUPA 1DZ3A 1E3DA 1XELA 4FX2A 4DSNA 1X14A 2A9OA 2PZBA 2CL7X 2FR0A 3DZDA 4MYCA 1Q12A 4YO7A 4CFZA 7ADHA 3A04A 4B17A 2XWBF 3KRTA 3KVYA 4ZRMA 1C3JA 1FUIA 1L7BA 1S7GA 1X9GA 2B6NA 2NZVG 2XOEA 1KTIA 3HM2A 2AF4C 2W2QA 3BQ9A 2NSHA 4TMWA 3SZ3A 5JZ9A 1MX5A 4FFWA 1JWBB 1R7RA 2R2AA 3HJGA 1EX1A 4XQCA 1DJQA 4TYMA 1UFVA 4KVZA 1IPFA 2XMSA 4UVDA 1C30A 4UQOA 4H4EA 2VSYA 4MLCA 4N8SA 3RBAA 2VT6A 4M2LA 3TLCA 4TRNA 1A5TA 2HZBA 3NGXA 2HQOA 2F55A 5EKDA 1T5SA 3OJEA 3GBVA 1RQRA 4EUSA 5D2CA 5HE8A 2VO1A 3ET4A 4TMVA 5A05A 4C0HA 3EH1A 3WRVA 2JRCA 3ITKA 1W5TA 1USWA 1XZIA 3NZEA 2CLOB 4C4XA 4DQLA 5JH7A 1JU9A 2HADA 4K86A 5G0WA 1KHTA 4ODIA 3Q1KA 1AHIA 2O52A 1QGOA 1U28A 2CE7A 2QAGA 2ZQZA 4QXQA 4GR4A 4B9EA 5AIBA 2H51A 4BJ6A 4B85A 5H8WA 2OGSA 5CA1F 3IFSA 4OJNA 3THYA 3P5SA 2VYCA 3OZXA 1EUDA 4Q3KA 4CMEA 5AVWA 1E6KA 3L0YA 4CKXA 4DLTA 2QTVA 4Q3CA 2IS2A 1MJ5A 2O3UA 2IPMA 5AHOA 4BVLA 5AVZA 2PLFA 4CMAA 5F73A 1TF7A 4FDTA 2CNKA 4DEYA 4Q18A 2ENWA 3AEUA 1R4NA 5HZKA 3MFYA 4NS1A 1FW8A 1HT3A 4PHGA 3ZIDA 2N46A 3F7OA 5D3MA 1BO6A 1MX9A 2I80A 5TF0A 2OD2A 1PX2A 1G6KA 2J7KA 2X1HA 4GRIA 1CYEA 1H6CA 3OU7A 5FFFA 5CCXA 2PAFA 1JSLA 2G4CA 1EDZA 2UV8A 2G6BA 5CLGA 2LR0A 4N40A 3NETA 3QWFA 2H9YA 1ORDA 4XLTA 2ZJ2A 1M1NB 5T4FA 3UT6A 5CVUA 4EAAA 2WSSD 1EESA 3KWLA 1BNCA 3H87A 5ETJA 3W9BA 1S2OA 2QQ0A 2Z2JA 4RD4A 3ZY4A 1I4DD 2O7QA 3A58B 3S68A 4W5WA 1XRSB 2ZYSA 2ZROA 2DULA 2XAUA 1C7FA 3L84A 4KI7A 4LJAA 2AJCA 5HKBA 1H1TA 4OUKX 3H9JA 2YBEA 1CUJA 3D54D 2E85A 3ILYA 4QECA 3WYNA 4E5VA 1XRJA 1FOEB 2ZS7A 3B7GA 3VSAA 3WLNA 3FTNA 2RHDA 4CUJA 1YVDA 2QRQA 2YN0A 1VA5A 5JCJA 2TMGA 1E8MA 3M0EA 4CLXA 4EB8A 4JEHA 3UMFA 3HA3A 1NQVA 5TY0A 4CI0B 4H7JA 1CPYA 4EW6A 1F0NA 4GXQA 1UZMA 1ECFA 1U0EA 2VJCA 3HYSA 4P86A 3CR8A 5T3UA 4D2IA 3BD9A 2B8TA 3FBGA 4DC0A 3I73A 2FFRA 1DAOA 3GT4A 5CB4B 1MA3A 1N36B 1RKVA 1NIPA 1KAEA 2C0CA 3RODA 4BMXA 5JI2E 2UVPB 4WI1A 4G4JA 5DP1A 4R9UC 4UCXA 2F7SA 3BJZA 4YXFA 5CEEA 1Y82A 1IL0A 1ADBA 3KR2A 4N49A 2XGMA 3KKQA 4AMYA 4QTYA 1ORIA 4ZAYA 3R3SA 4P34A 2JFUA 3FPBA 3KHSA 1FSGA 2EF1A 2JGDA 1JGTA 2YWRA 4E33A 5JMTA 4HLUA 4FEEA 2QTLA 4JBWA 4PX5A 3WP0A 2E87A 4KE9A 4UQPA 3QWIA 2SBTA 3CZRA 4K2HA 3ICQB 3ZCXA 3ESAA 4OLBA 4TV8F 5ALKA 2H16A 2YQ4A 1SK9A 5E1MA 1KP2A 1PJ3A 1FXWA 1U8EA 3KZCA 5JXIA 2YY7A 4PAGA 5IH3A 4BJ3A 2P2DA 4Y6GB 3KYDA 1X7ZA 1OWPA 3OQOA 3FVQA 1G3RA 3OZEA 5ALRA 3A4MA 1PK8A 1IFXA 1NBAA 1WSAA 3DXFA 1R27A 2C2ZA 1IIBA 5L45A 2X6RA 2ILVA 4NMHA 1BVRA 2KYRA 4QDKA 4N3BA 2WB4A 3BXHA 1DJNA 4LJ5A 5G53C 5HIAA 1TD1A 4O63O 4L5JA 4YMGA 1U2PA 4Z7QB 4KHPB 4XM0A 1OXSC 1J7KA 4QYIB 3V48A 4AF7A 4RORA 2D7DA 4AY4A 1BX3A 3B38A 2NLOA 1BVYF 1V6AA 2O4CA 1JDNA 3AIMA 3RGWS 4H0FA 1NFQA 1P91A 1GAWA 1D2AA 2JGMA 1QYVA 2ROQA 3IBSA 3FSEA 3B1XA 3M1YA 4X93A 4D6XA 3PEWA 1TQ4A 2E5WA 1N0WA 2D59A 2UYYA 4XKJA 2UVQA 4XYGA 1WNTA 1WZUA 1XQ9A 2WJHA 4MV1A 4QLAA 2A1TS 5HA5A 4CKCA 4RJTA 2WIFA 1U0JA 1NXQA 2EWVA 2DPMA 3GJ7A 4ALNA 1KBQA 2DFNA 1CQIB 4XJSA 3WK4A 2ZIWB 4Q24A 5JANA 3K53A 3WWEA 2MR6A 2BYTA 4G8BA 2A1UA 2JJ2D 2NXWA 3T61A 5BXQC 1ZEJA 4ND7A 4ARZA 1FZTA 2VPYA 3FUCA 1Q1GA 4BGEA 1VL5A 2I4LA 4ZYTA 2VTBB 1CR2A 2REBA 1TK3A 4BO7A 4JQSA 1Y33E 2EXXA 1I1NA 2AWOA 4R3WA 4A10A 1HE3A 3PQCA 3MTIA 2PMCA 4Z53A 2I6QA 3GVIA 3Q7SA 1Y8RB 1ZP6A 4MWTA 2O07A 3O92A 3K6SA 5EWJA 1QAMA 1RFLA 1E4YA 1U1EA 4OJYA 2PVCA 4FYVA 3SMVA 4XWOA 1R64A 3CVYA 2XDWA 4U7PB 4H18A 1Z3CA 3FHOA 1BXRB 5JNRA 1JHYA 1N5DA 1NY5A 2ZSHA 4GGOA 3RFVA 2C9ZA 3TBFA 2Q4EA 4WNAA 1HYGA 2FPGB 4I55A 4Y2QA 4ALKA 4F71A 3G2JA 3KOZA 5ENZA 3SGLA 3D8TA 5IBCA 4KQ2A 1WSDA 2ZAGA 3F3KA 3E9DA 4I9NA 3C3MA 3RKSA 4ER3A 2ATVA 4JMLA 2C1EA 1Q0UA 2RBKA 4OP2A 1ST3A 1A7KA 2BKAA 4L50A 4UCWA 3T3DA 2ZXUA 2O19A 1I5EA 3KQSA 2ZYUX 3A9UA 3CLVA 3QMWA 1L4NA 1WUKS 3LUFA 1L1FA 1MW8X 4JJ8A 2WPDD 4UAVA 5JIBA 5IM5A 1PGQA 5B53A 2BGTA 1E7MA 1JU3A 4CV1A 4YMVA 5CD9A 3CCFA 1FXWF 4GVLA 1QIFA 1XF1A 1YDEA 3B7WA 2MSDB 2VT7A 4B6EA 1Y7PA 4YXWD 3CVWA 1L5GB 5LMUB 2ZU6A 3VI3B 1T1RA 3PC8C 3D8BA 2UZAA 4FXPA 2ZTMA 4BTLA 4OEHA 4EDHA 1QGDA 4QUKA 3EPJA 1EX9A 1YDWA 1L5HB 3AHJA 3EZFA 4AZ3B 1KR5A 1A04A 1DWOA 5IAOA 3P26A 1VMEA 4O33A 3FHLA 4JFRA 1A5BB 3GQVA 2G36A 3U3ZA 2GEFA 3JQAB 2G70A 5EJIA 1J06A 4Q7JB 4MI3A 4LDPA 1PVVA 4OSPA 3X1DA 4ZVMA 4WTOA 3NTLA 3IMCA 3OPNA 3ZQJA 1GKUB 3C6KA 3WDKA 3EDRA 4ARUA 1N8TA 2BGGA 4DR2B 4EJSA 2FI1A 3IESA 3NEYA 4IDBA 3CZ9A 1OAAA 3FTDA 1CY8A 3IVGA 4GUDA 3ZNQA 1ZM4A 4K46A 2PK3A 1I10A 1YB7A 3BH0A 4LXTA 5EUCA 1V43A 2X5XA 4ZVNA 3CWZA 3KR0A 4RVHA 3O1JC 3BRWA 4URXR 3UJNA 1YCDA 1EX6A 1PT6A 1YOBA 1QTIA 2I22A 4DIEA 2Z6QA 1RMQA 1GTZA 4L16A 2BGUA 3OQIB 4P08A 4PPFA 1XQVA 2XHEA 3CVUA 2XDAA 1IBRA 4U9HS 1DZIA 1RWKA 4WBNF 4YLYA 3KZOA 4YREA 2NACA 1JFSA 4DLSA 2D1YA 3SICE 4GOND 2CNBA 2NOAA 4R2XA 3PT9A 5DNVA 3DGEC 5F7JA 2D00A 1AX9A 2ZB8A 3K92A 3LDHA 1FX1A 5IJ0A 2NADA 3H05A 3NC4A 3L18A 4XSHA 3RUFA 3RYCB 3UPUA 1A72A 2LP4Y 4YCAA 5AJVB 1GXSA 1UDCA 3ELWA 3OZIA 1K4YA 1JW9B 2JG3A 3B52X 2GSDA 4DC1A 3F5SA 5JBQA 1XTRA 2JCGA 4BEJA 1P7VA 4D9NA 2X2FA 4H1WA 3ABRB 3M6VA 4Z4FA 1NBWB 4OFBA 1E0KA 3INYA 4JI0B 4MV5A 4LJRA 5EHIA 3ZK7A 1GLGA 1HDCA 1NJ5A 1HO3A 1WMFA 2A78A 2NGRA 3CLRD 4LXYA 3KDAA 1RP1A 3EVEA 3C74A 1O97C 1SOMA 2H07A 4OG2A 2W2MA 4KW7A 4OYLA 1WXIA 1JBEA 1URPA 3EPRA 5MN5A 1L2TA 3W5BA 1L5KA 1GZUA 1U9CA 1L6RA 1FUUA 1SHJA 3KJXA 4CM8A 3WRYA 5BW4A 2D2IA 1WF6A 3FG9A 5A7HA 4LA4A 1SRQA 4QYSA 2E4UA 4JY7A 4KRXA 2AXQA 3P32A 5KTMA 4EHDA 1O94C 1AQUA 1SUAA 2A5FA 2HBYA 2P4QA 5CVTA 4OXIA 1ECPA 2WVJA 3KXDA 3LBIA 4EHHA 2CMGA 1IVYA 1UK6A 4NEQA 3PITA 1BGWA 1C3LA 5JD5A 4DLRA 4UAGA 1PSWA 3DTYA 1TCUA 1Q77A 4WXRA 4AO8A 1F8GA 1OE0A 2F3RA 1WB4A 2WPDA 2WF8A 3DXXA 3PJDA 4WKPA 4Y6LA 1RABA 2BCEA 4GZMA 2F8LA 4REQA 2IVFA 4YMUA 1K63A 1IN7A 3L8GA 2CNWA 2GVZC 4I4TA 4Y2HA 1T4CA 2HJSA 3QU2A 3UATA 2SICE 4EL5A 1Y42X 1CQJB 1GL3A 2RH5A 3F97A 1Y1SA 2VUTA 4R1OA 2WAXA 5BWCA 1OTHA 2KPOA 3P96A 3OPYB 4EW3A 5CJ2A 3T7KA 1GM5A 3V8NA 3OQ1A 1CJKC 4GH5A 4ZFNA 3DUFA 2IPLA 4K7JA 4AMUA 2BFPA 3NRBA 4A0SA 4MWSA 2VNIA 2C0PA 3MMXA 5EERA 1H2FA 5BWNA 4PR3A 4NNJA 2GM3A 5LZ7A 4CIXA 3UBTA 3USCS 5EJGA 2X14A 1H66A 2CFRA 3OQMA 1SQGA 4F8EA 4I1YA 4RD2A 3U13A 1KO7A 3B1FA 3HKCA 3VQTA 4IFBA 5ES4B 3WJ2A 3FXAA 5FFNA 2OE2A 3BXXA 5GINE 2EKBA 3U4DA 2WJ3A 2VN8A 1Z0DA 5DSXA 4ESOA 2FWIA 1LDYA 2BFNA 1EXNA 4JELA 2WWGA 1KIMA 3CQ9A 3T1HB 3T3MB 4DV5B 2EKZA 3EWNA 1T1GA 2AEFA 3VH2A 4QAJA 2G3YA 4BKPA 4I1IA 5DHQA 2YDXA 4X84A 3V8PA 3IQFA 5FBRB 1OY1A 1P2TA 2I4MA 3SBXA 1G2OA 4NJMA 3NS7A 1XF9A 4M9CA 2D5AA 2FEPA 4NCNA 3QUAA 3PD0A 1S1MA 4L4XA 4GMHA 4K6GA 4JT2A 3KUXA 3KHKA 3M6IA 1P9OA 1SVKA 5L95A 2AYZA 2WICA 3M5WA 5I47A 2GOYA 1W4ZA 1CJSA 4D5EA 2BDEA 1JQAA 4JEUA 3H5TA 1MPTA 3OZDA 3MCVA 3SQMA 2WY2D 3AEZA 4ZQCB 1MFZA 3HY4A 1LCIA 3B3GA 2JIOA 1RYBA 3N2NA 3NT5A 1IDN1 2ZIGA 1I1OA 1SEPA 3PX3A 4IHKA 4GP7A 2VQSA 4OJTA 5FV7A 3RT1A 5AESA 2JAQA 4H15A 4BLUA 2H1LA 3GFSA 2HTFA 4C0LA 2G88A 4NCBA 4HNAB 3RU2A 3LQ4A 4C3UA 3B51X 5H68A 4BMOB 3DDZX 4L51A 4UBIA 1D0SA 2D3WA 1L5OA 3CLSD 1UXIA 1I1QB 2PJRA 1MAVA 3O3MB 5G3YA 1TPYA 4QGSA 2ZRLA 2FR8C 1E5LA 1FDTA 3RFTA 1NF9A 5KYWA 3SF8B 3VR4A 4IVPA 2HK9A 1BIFA 2V03A 3LHFA 4DNFA 1AZLA 5LKAA 1YMUA 2B30A 2DUJA 2EKLA 2IUTA 1SCNE 1G8SA 3L46A 3OVMA 4TN5A 1FFEA 2H9IA 1WMDA 4RPGA 1R6UA 1S1CA 4EOGA 2H1OA 3AZQA 3N58A 2B69A 1GL7A 3RLIA 4C6SA 2IUSA 1AXGA 2WP0A 4MW0A 1SG9A 1DKOA 4J3FA 4OXQA 2PX8A 5EZSA 4ZICA 5KMGA 3LYLA 4OHCA 1IQUA 3G6WA 3AHFA 5ILGA 2ACKA 4MRMB 4S05A 1O9GA 4ZDWA 4C0KA 2ZJOA 2HA6A 3CEMA 3ZE0B 4EKYA 4M53A 2CNWD 3PDHA 4HRAA 5GJBA 4DT1B 2VLBA 3GHHA 5F21A 4RVNA 4P84A 4HRVA 2PFSA 4MW5A 3ETDA 2FLKA 2REQB 1Z3IX 3ET5A 1GTJ1 3ROGA 1G8PA 4CVNA 3Q4GA 4OU4A 3KPVA 3UJDA 4E7PA 2OCPA 2YX1A 3UH1A 1R9NA 2RGUA 4NVRA 4EF5A 1F8XA 4LBZA 1CV2A 3ZTWA 1LLQA 1Z0SA 4ZHQB 4GS5A 1HWYA 1N6LA 2RGYA 3PWSA 1D09A 2EGGA 3LP8A 3KALA 1ETUA 5EP1A 1H0SA 1SVNA 4LTMA 5LMCA 1IM8A 3CN9A 4S04A 4LF5B 2YOFA 1W5EA 2QN3A 1P81A 3LYAA 3FPFA 4HYEA 5DSZA 1NAHA 3D8SA 3OECA 2G0TA 4KE7A 1TFRA 2ZYTX 2CL5A 3OCYA 5DMHA 1EVIA 4TWBA 4MEJA 3N74A 3TAHA 4MYUA 1F0KA 4MNTA 4M88A 1QHSA 5F5LA 2JF0A 3DE4X 2JH3A 2I8CA 3EIEA 4MS3A 2JATA 1CUCA 2P2ZA 4JEMA 4Z2AA 1ZMRA 3CMCO 3ILHA 1YDGA 2QVBA 1VCNA 2H52A 5I7VA 3IDSA 5INTA 4NK4A 5K51A 5KSWB 5DM70 5C7LO 3EZ6A 1LRKA 3UUFA 1JR3D 3JVEA 4B35A 3KB6A 2YIVX 4JLBA 5FWDA 3V2IA 4DADA 4G24A 2ZI6A 4HDNB 1REQA 4NCXA 3RU7A 3V8EA 2XQKA 1KC1A 2C84A 2CLMB 4ZIRB 1GCUA 2GWRA 3AVYA 2XAAA 4J7XA 3EIOA 4JJKA 4G5SA 5EP2A 1AKVA 3P9CA 3WQBA 2R1VA 3Q7EA 4FOOA 4IIGA 4KQJA 4LZPA 4UHFA 2QE6A 1JFVA 3WHKA 1OXXK 5CW1A 2P6NA 3LX5A 4S24A 4Q9HA 2JASA 2O23A 5CRIA 4EW1A 4J90A 1F2VA 1U2DA 1T34A 4HLQB 5TMEA 1YBHA 4L6AA 3FYUC 5A0FA 4BBAA 1G7RA 1KEKA 4FLMA 4F4FA 6CHYA 4WXPA 5JAOA 2QLLA 2BBWA 3EG5A 4LC0A 3ZGVA 1QWOA 4ZU1X 1PFQA 2A0YA 1JEEA 2XYGA 3AF3A 2BFBA 3DOIA 4X3PA 2ORWA 4GZ6A 3THSA 4AP5A 4CLOA 1BD4A 4BQQA 2A9JA 1UKZA 3UPDA 3STXA 3DCYA 5LBIA 3PHJA 2OAQ1 3P2MA 4PTLA 1ICIA 5FLKA 2Q29A 3G17A 3H3JA 4BO6A 1G1MA 2XOKD 4ZK2A 4TKZA 3R5FA 2IY7A 3OCWA 5DH9A 4B2IA 1NVXQ 3GN1A 4BNKA 1Y5RA 1Y9AA 1GDDA 2B8JA 2QR2A 3DE7X 1ZGZA 2DG2A 2V1XA 1O6ZA 2RG1A 1RKXA 3OF2A 3U7QA 3ONFA 1TZ2A 4NKRA 3TD6A 3GBSA 1XVUA 3ORQA 3B20A 3PNBA 4C08A 1DXHA 2WOOA 1BXZA 2OCYC 4TXHA 1KJWA 1H0HA 4AURA 4J03A 5A4AA 3WQRA 1C41A 1NOKA 3KSBC 3V8VA 1QE3A 3CR7A 5H59A 3G7NA 3E1GA 1WBBA 2G9QA 2AF3C 2GASA 4EA9A 4CJXA 1EEHA 4NFYA 2H0AA 4X3OA 1HSZA 2GA8A 1N2BA 5KOJA 2ZEJA 4TQAA 2PKEA 1Q91A 2QVGA 3E3AA 3KB2A 1THMA 4PZAA 3RJMA 1JHOA 2I67A 3HEAA 2J5BA 2ZRKA 3CKKA 3FDJA 5HE9A 4DB2A 1VKOA 1E94E 2FOLA 5IANA 4V3BA 3EXG2 4S35A 1RPZA 4R3UC 1PSZA 1ZGJA 4DY4A 2HFKA 3M5DA 5FLEX 2WYWA 3G8BA 1E0AA 3WI7A 1H4TA 2XCOA 2QTTA 4D45A 2NYVA 2YHIB 3BCRA 4P4LA 4ZQFA 2RJ3A 1TKBA 1ZOPA 4WUTA 2DPXA 3WFIA 1T5DX 2XQGA 1P2UA 2YYSA 2HDHA 3KZNA 4MX8A 5LDDC 1KE2A 3LVFO 2BE7A 5IKOA 4YASA 1HE8B 1J49A 1W5BA 2O0JA 4P4SB 3O1IC 4PNPA 3PIIA 4TLDA 1PYGA 1E5XA 3F6BX 4KMOA 2C3UA 3KUCA 1WBJB 3JAWB 5MFZA 4O4JB 2D2VA 5HZHA 2QP9X 1NMSA 1DPFA 3F6RA 2XECA 2HIGA 2YIMA 4LRSB 3A9SA 1T1EA 1VLQA 3E9MA 4M22A 5JROA 1U0BB 1AV6A 2CVHA 2QM3A 2EBUA 4QBTA 2M1XA 4INOA 4L0MA 5EHNA 2NT4A 3AHHA 5C8DA 1EAMA 2RBGA 2OFOA 1NIJA 4FYYA 1HYBA 4QHSA 1R0LA 3NPMA 5AK3A 1IHDA 2IU0A 2FPWA 4MS1B 1XZAA 2WDPA 3CNQS 3K72B 3MS2A 5AJZA 5EG5A 5CXQA 3ZD8A 2JD0A 3JYHA 3A1TA 4OI4A 4DQDA 1U81A 4E03A 1Q3TA 1XXLA 3QENA 1NG9A 4IPTA 1RXIA 2FP4A 1W5AA 2VAVA 3FB4A 1M2VB 4KXYA 4UFNA 5K0NA 3S3TA 1JDPA 3W9SA 2D1QA 4D9HA 4HEJA 3PGVA 4Z1MA 5SZJA 1Q74A 4RTMA 3DBHB 5BQ3A 1V47A 3KOYA 2G06A 2P2CA 3M7IA 2PH3A 4YT5A 1X39A 1DKMA 1T6YA 2WIDA 3H6HA 1DKLA 3L02A 1BHSA 3ZYCA 5FJIA 3VGPA 3NKVA 1FQJA 1HORA 2W7TA 1C3VA 4BNXA 2JIBA 3QVOA 4ARAA 4PRZA 4TLEA 2XXAB 1KDPA 13PKA 1BHQ1 1AN9A 2DZDA 1A8SA 2H4HA 2H1HA 1YR1A 3A9RA 2QUHA 2JK0A 4HFJA 1JPNA 4R2MA 4RC9A 1K3UB 3LHIA 5J4VA 1LQUA 3ROMA 1PQUA 3TLJA 4MPPA 2RGBA 3G0OA 4BNFA 5BNIA 3NDJA 4UQLA 2C7BA 1XMXA 1QG2A 5IWCA 2BEVB 2NN3C 2XOKA 4XDGA 4XB1A 2VEOA 1TQ6A 2A14A 3THXA 1QFZA 1ULUA 2HTEA 4OMUA 1LBQA 5FPHA 2GF2A 1DRUA 1ID1A 3JWEA 3NQ41 3V7WA 4NAHA 2QLBA 2GVDC 3M3DA 1NWHA 5KYKA 4XFDA 4HT3B 5GIOE 4X3CA 2V65A 4R83A 1A50B 1HTTA 4YFVA 4QGBA 1V9CA 4FGUA 1XQWA 2P2GA 4BP3A 1IMJA 1QP0A 4AC9A 4AZTA 3KO8A 1DKRA 3ESYA 4CM5A 5DZSA 4DLPA 3RK0A 1WOYA 1HOXA 4EG4A 4YP6A 3WBFA 4TMYA 3TS1A 2ZRGA 1M76A 4D9MA 5BOSA 2ZYRA 3TJMA 4TLAA 2XCIA 1ZPDA 2WBLC 2BTQB 2ZULA 3C5EA 1WQ4A 1PFYA 1C1HA 5AVJA 1USUA 3DHWC 4HNHA 5AI5A 5EUMA 1RQGA 3DHNA 3FFXA 3HC7A 1WUIS 4N5LA 4QO8A 2PBLA 1Z8FA 5CPBA 1MG5A 1KZ6A 2HJHA 3O03A 2WILA 1W29A 1ZN7A 4WNAB 1TVCA 1FDSA 1OJLA 2Q1SA 3STWA 1GFSA 2C4VA 1BFKA 2O8VA 1NTRA 1ZK2A 4YS6A 4ZCPA 5ALOA 1BN7A 3DWGA 4ZU6X 3Q2IA 3TTWA 2GZ1A 1M34B 3CSUA 3U39A 1WD5A 3H1BA 4DLWA 4M4SA 1EVJA 3EFOA 4BV8A 2CXUA 5I9IA 3AVTA 3LK7A 5HK8A 1YULA 3ZJYA 3ZQUA 1E3QA 4ZRNA 5F2KA 1EE1A 1WVMA 3QY9A 2FPPA 1DX9A 3B6ZA 4KH1A 2WKSA 3WFZA 3GP8A 2FZWA 3LTNC 1G2QA 2PFGA 1GV1A 1QFJA 3CLTD 1JH8A 3D4IA 3FVTA 3VJRA 2UVPA 2JLUA 2OV2A 1MV8A 1XU4A 3HCOA 1Z06A 2OO5A 3KKZA 3Q0IA 4J0KA 4XD2A 4YP5A 5LYJB 3PLAE 1E3WB 3TZ6A 3ZQ4A 4K6OA 4DJEC 1U2TA 1OLSA 5K6AA 2FMXA 3U0VA 3WNDA 4C2UA 3G8YA 1S3FA 2B1GA 3EBOA 1A76A 2H9AA 4K88A 3HN7A 4OBXA 4N47A 4AZ3A 2QB5A 3BMXA 3U7JA 4J16A 5A7GA 4AKEA 2VTDA 4NCJA 4OGLA 3ZHSA 4BB6A 1R5NA 3HACA 3MS7A 4IZHA 3ZOKA 2JKYA 1T4BA 4QBIA 2ON6A 3V97A 5CH5A 2VATA 2IA5A 1GZ7A 3D6VA 1WG8A 3NH9A 3O3NB 4W5HA 4BPBA 4MLDA 3RARA 1GIAA 3JWPA 3LHSA 1VBMA 2QR3A 3Q5EA 1UJ2A 4LMPA 3SN6A 1IVNA 1G7CA 3DUWA 4A2WA 1IHPA 4ZTUB 2Y6VA 1ODJA 3ZXIA 2D1RA 3MERA 5A04A 1SU7A 3PKJA 4QRDA 1ISPA 1J9EA 2IEYA 4G5RA 3EGDA 2G5GX 4Z7NB 1QHYA 1TX4B 2W48A 5JRDS 3H9CA 2P9YA 1ZO8A 3SNHA 4A8TA 1B26A 4CEIB 2GBFA 3DPSA 4NBSA 2XSZD 4QAQA 2FCRA 1NI4B 2D0OB 2FZGA 3I58A 4K9KA 1U4SA 4PYMA 3VAAA 4B6OA 4EGJA 3K31A 2WUFA 3MT0A 4GBMA 2I3GA 3LE8A 5DHRA 5AUOB 1V4NA 3F6SA 1N5KA 1WETA 3V4ZA 3W1EA 5TQ2B 3AU9A 3IDOA 2NU9B 2UAGA 4AJJA 4C6TA 6PFKA 3AY3A 1REQB 2HQBA 3PX7A 1HYHA 2VRNA 2VSQA 1VHTA 2IXEA 3LV8A 3BGDA 4H3SA 1PNTA 3K6JA 1Q2XA 3KS9A 5DVZA 5LLSA 3WKAA 1EINA 3QVWA 3GI1A 3HK2A 1ZJ4A 1Y34E 4A92A 4YMLA 4URUR 4FT4A 2Z58A 3DMGA 3O94A 3G8DA 2NW6A 4X91A 3RVPA 3Q6MA 3T12A 4BKMA 4BVKA 4B33A 1ZFNA 4DQ0A 5GONA 1VPWA 5DTRA 1WPXA 3KT6A 3AVPA 3C97A 2JJ1A 5TQ0A 3EEIA 2E37A 4YAIA 4TVOA 5AJYA 4C22A 1VXOA 1XMQB 5KOHA 2VRWA 4JAVC 1WOMA 3DMFA 3E4CA 3KOXA 5FOXA 2FWNA 1UM9B 3HRIA 4MZXA 5JLAA 4HJRA 4M1KA 3RJ9A 5AXDA 4BFWA 3IQEA 4FYIA 3R9XA 2Z9CA 3BXOA 2GN0A 3HKEA 2BEWA 3I9OA 3V7FA 5HR5A 1E9DA 3ESDA 3TW8B 2XV1A 2AS0A 1ZMBA 3PGLA 2BI7A 4ZT2A 4BRWA 4LYFA 3ZCSA 1BS9A 1GNRA 5ENDA 3TSAA 2AQIA 1M2KA 4EGFA 2PMEA 3JPYA 2FUG1 3LBHA 4K03A 3SC4A 2Q3EA 1I30A 2YXLA 3D4LA 3I2FA 3RF6A 3N2ZB 5JAUA 3R0VA 2GPYA 2K5UA 4MKRA 5TVGA 1CERA 1AK1A 3PDJA 5JQWA 2WWVD 3CUVA 3DZJA 2OBFA 1BYUA 2QSZA 3GN2A 4WZAA 3RQSA 3WNCA 2ZRNA 1GTG1 1SU8A 2WV7A 1VSVA 2HNBA 2ZB4A 4OL9A 2XNDD 2GX6A 3ZWYA 2XKAA 3ETJA 3H4MA 2EL7A 3HXPA 1VGRA 2OWDA 3NWBA 4KN5A 1UJNA 4QGFA 3G5LA 5KI6A 4ZQEA 1COWA 1C1XA 1IZ8A 4A73A 1N6NA 4LE1A 4UE3S 5HRAA 3BAZA 3K0SA 3EWAA 4D80A 2AUTA 2WDZA 4FYJA 5ITWA 4ETWA 4I50B 1CP3A 1UBKS 1KU0A 3NHBA 3QNWA 4Z1OA 4ITRC 3L5OA 1FP7A 1L8QA 1AKUA 4G36A 2HV8A 3OTIA 5CK4A 3RVOA 3DVLA 4ZOQI 2J0SA 3X2EA 2KX7A 1Z7EA 3MELA 1L8AA 3K5IA 3NBMA 4UEWA 3TOSA 2ZYVX 3K4PA 1MAWA 3ZE8A 4BFLA 3T06B 2Q62A 1U7XA 2IF0A 2W2XA 3FMVA 5B1YA 2CNDA 2QUJA 1KERA 4L5IA 1GXSB 1EBBA 4NU5A 4Q4LA 1LEHA 1JXOA 2M2IA 4UNPA 3CMMA 2O0LA 4HWRA 4KEAA 2IIBA 1TM4E 1P3Y1 1XLUA 1DKNA 1UBLS 3DT8A 3GPCA 5M2QA 4XUGB 1A77A 4TVBA 3I5YA 2EARA 1LLDA 2J5QA 2Q99A 3A1DA 2HF7A 4HZUA 4NZNA 5AK4A 5JMPA 3QBVA 2AYYA 2NTYC 3RHSA 4DWOA 1G5PA 5LOVB 1C7ZA 3T6KA 2CLDX 2H5EA 1BA2A 3KIPA 1PKXA 2FW0A 4LY3A 5IASA 2V7EA 1EUZA 2Z43A 4F4JA 2E89A 2JGJA 3THRA 4AJPA 4ROSA 3ZHRA 2H7VA 5HUJA 5KZMB 5FL3A 5H3CA 3T3IA 1OI4A 1NBMD 1OWNA 4KAJA 2VQEB 1JBQA 3E5HA 1FSFA 4L57A 1MT0A 2AOWA 2FQYA 1GPYA 1SEVA 4ZI2A 3VPDA 2YICA 2HPAA 3A2MA 1N2OA 4EHIA 4RZIA 1CETA 4ZC8A 4BNJA 3DD5A 4ALMA 4FBMA 4D98A 4TZ0A 3C8ZA 1H5NA 1PR9A 3RTBA 5BUZA 4PSDA 4EY3A 2V98A 4DM7A 2RHRA 4EO9A 3ITEA 3EVNA 3AVUA 4MRVA 4PYJA 3DAHA 2O05A 2QTCA 1GP2A 2GHQA 4P7BA 5A5DA 1FJXA 2BMVA 2QX6A 3BORA 5DKFA 5DGTA 2Z3WA 1XD8A 2PH1A 5DBHX 4BB9A 4ZCMA 2DBYA 1UPXA 2C83A 4TT8A 2ST1A 2VXYA 3H5NA 4UU1A 5JATA 5G0UA 4FC7A 5E95A 2O7RA 5BSEA 4BX8A 1RLJA 2GUGA 3ZXUB 4Z4HA 5FUYA 3VHXA 4HNTA 3PLRA 2I7VA 3H6GA 3SKVA 3VKWA 5K7SA 2DX7A 4V03A 5HF8A 3V4VB 1NUAA 2CK3D 1NMQA 3R77A 5ALQA 5JISA 3DEHA 4IRUB 1THGA 5CYGA 2VQ6A 4G0UA 4WECA 1Y6GA 3C6MA 3IEUA 1DLJA 3L7NA 4MPJA 3FUWA 1BW9A 4Q19A 3CFYA 3MN1A 1U7TA 3LKVA 4GR9A 2DPHA 2PZKA 2XUKA 3QTLA 4JGIA 3M6LA 5DE3A 4F38A 3R7NA 2XMZA 2CNNA 4M1EA 2IDJA 1R4ZA 3LY5A 3S6JA 3SC6A 5T4HA 5ECGC 4RQBA 4LZAA 3RS7A 4OHPA 4EO4A 4HBGA 3EVDA 5G0VA 4D79A 4CIBA 3ZIUA 4P9NA 1FYEA 2ZIEA 2VDMB 2ENUA 1RAEA 2AEMA 2XNDA 1NW7A 4HB0A 5BPHA 2RG7A 4JYCA 3EW7A 3VPFA 1I7LA 1XDUA 2J3HA 3SHTA 3UJ7A 1XPOA 1X8JA 5FI5A 5CK5A 1L1QA 4RK6A 4OTZA 1N2IA 2G7MC 3CUYA 5CH8A 4RWEA 2H8GA 4B6PA 3GQBB 2QN6A 3ZKAA 4LXIA 4REOA 1KVRA 1QK4A 1DEXA 1YBFA 1AGXA 2XA1A 4H08A 2MYUA 4YT8A 4MSUA 3FOBA 4ZHQA 5AJHA 1KEUA 3AV0B 3K1JA 5ALFA 5FTNA 5I9TA 4Q47A 4EF4A 4D42A 1Q3HA 1YR8A 4JNKA 4Q39A 1XQYA 2O50A 1Z38A 2GF0A 3QKUA 4PGFA 1GUDA 2QMZA 1A9ZA 1JXAA 4Q1CA 3BFXA 2O2XA 1DUVG 1AKNA 1OAOC 3HU5A 4MVJI 1LZKA 4UXJA 3C7TA 4HEA1 2DPLA 1E3JA 1G5TA 1UFQA 5KREA 3UT0A 4XD7D 5DN9A 2HWKA 3N8HA 2R7MA 2P6RA 5C7OO 2IZOA 4D6PA 2YS7A 4QDZA 3JD1A 3UG6A 2GCEA 1R1DA 1JYEA 2EGUA 2O2HA 2F1OA 2MMGA 2IIQA 1WQ3A 3HDTA 3NI2A 3ZHVA 4BNWA 4QDJA 2ZUTA 4AULA 3KQHA 4H17A 4BKOA 1N3BA 2GAJA 2G9ZA 2O6LA 3PIDA 2DUWA 2ICAA 3KOWA 4KCGA 3ZC3A 1AXRA 2OQ2A 2X8BA 3MSXA 4FEAA 4G1FA 3BM5A 1SKUA 1ZKMA 2R11A 3MCTA 1ZNYA 1HE2A 1TD9A 2RAUA 3H11A 1WZNA 4ZVKA 1ESMA 2NUPA 4AZ0B 2VA9A 2Z98A 5A6SA 3OZBA 1MLDA 4GLFA 3NIGB 1N8KA 4AQDA 1DRWA 1OOEA 2HIAA 1E2HA 3AI7A 1RWMA 2NVBA 4DNPA 1KAHA 1HZJA 1KMHA 2JHFA 3UUGA 4UBNA 5LKRA 4HWGA 2EP5A 3Q7IA 5C8YB 2NU6A 3SHVA 3LUDA 5EWLB 2W8ZA 3TKLA 2YZMA 3O91A 1SXHA 1R88A 3N6RA 4LSMA 2AKEA 1XIVA 2J0UA 1EDBA 1MZVA 3NJRA 1XDGA 3L5KA 4FR5A 4RKQA 5DRYA 3W6NA 4B3TB 3AERA 1UCFA 3JVDA 2IIPA 2EZ4A 2JW5A 4GNRA 3K0AA 4JITA 1V35A 4DA7A 4ZJZA 1BFDA 5CDTA 2QTGA 3G1WA 1MEJA 1A88A 3LCVB 4FUTA 2ZWVA 1TMYA 2EP7A 2BSQA 1QGYA 2PLRA 3CJRA 5DGHA 5LVAA 3FKSA 3U6BA 1NM5A 2GJSA 1O8BA 3N0TA 1CHNA 2ZRDA 1HRKA 3GLFB 1Q7TA 4HOYA 3U44A 4HN2A 5C1PA 4FFSA 4HAOA 4UUPA 4KSYA 1RYMA 2C97A 1WDWB 1H5QA 4D25A 2Q3FA 3UVEA 5JCPA 2Y0BA 1LW6E 2QGFA 3GFTA 2VR1A 3OOSA 4DDTA 3GNSA 3Q7TA 4JCOA 5CW2A 3Q3JB 5HX7A 4ARSA 5IVHA 5LB4A 2R8EA 3WKEA 1EFHA 4DM3A 3E35A 4J0FA 1K5HA 2WD8A 3C70A 4FMDB 4G56A 4LI0A 3IEVA 2W71A 4LY0A 1SA0A 1J0XO 1U8ZA 3A06A 3RRJA 3SS7X 3CF0A 4YAUA 1R10A 1YS7A 3DMHA 3WZLA 4IIHA 3UK2A 1M1XB 5IJAA 2OBMA 3I37X 1U8TA 2PZAA 4RXMA 3S2SA 3H2IA 1OFIA 4WZAB 1IG0A 4CQMD 3B13B 1T9ZA 5HCUA 3AI2A 5ALGA 4YRBA 8ADHA 4Y3UA 2I7XA 5LQNA 2JFOA 1AIPA 4RZSA 5ABPA 3TLBA 2NP7A 1Q20A 1JT2A 4GM0A 3GDFA 4Q66C 3BDAA 5KNDA 4QBGB 2PYIA 1QGED 1HLDA 1FUYB 2XF2A 3M1LA 1C8KA 2P78A 1M73E 4W9NA 2HMYB 1NV9A 4E70A 1CIVA 2FZ4A 3VU9A 2JA2A 2O2YA 1EFRD 1HETA 3HGMA 4MJXA 1HY3A 1O77A 4KVFA 2JLZA 4R0NA 1U2DC 1V5EA 5CXXA 3UK7A 1WABA 3IVAA 1NLFA 5CH3A 2HQRA 3PHCA 4ND1A 2CVOA 3R3WA 4B7ZA 4IINA 2V9ZA 2NXNA 1FTQA 1YKGA 2BFAA 4D8YA 4DIUA 3M34A 2W2LD 3LUBA 4GI7A 2DSNA 3H2ZA 2B0JA 2Q2NA 1W94A 2Q5OA 1PEYA 2X9NA 3H2JA 3HBAA 4RD0A 2HSEA 4F21A 1SFRA 3OA0A 3CRMA 1T9GR 2NVOA 3JVVA 3E9NA 2GAOA 2FG7C 4A6EA 4YRNA 4P6VF 3L01A 2FPIA 1N75A 1X74A 5AHXA 4M1MA 3LXRA 3ZEIA 4W9NC 3QHQA 1ZVJA 1E6MA 3JXEA 5CT5A 1WTCA 3BIFA 1UT8A 3U60B 2Y0PA 3KKEA 4B43A 4TWJA 1OF1A 4R69A 3FWKA 2ZXFA 5H16A 2Y92A 5HBRA 2QD1A 1NVVQ 2PZMA 4DT1A 3GEPA 1QGUA 5B12A 3ABOB 1M7BA 2FE1A 3SHOA 1DWPA 1O6GA 1QGZA 2NZYA 3IURA 4S3MA 4KAAA 5D86A 1TM7E 1U3DA 3HRHA 2J31A 5EUQB 3PXBA 3ASZA 4OH7A 2O8BB 1L5SA 3RIYA 2AMYA 2E82A 4K8OA 1HQYE 4Y2PA 4JVOA 1L4KA 1JLMA 3EQ8A 4JI4B 2WA1A 4ZYWA 1CB0A 3W0LB 3PUXA 1DAIA 4OUDB 4EZIA 4F11A 3QSGA 1HZZA 1SULA 5E1OA 4R8SA 1J22A 4M7WA 3HBJA 5J4YA 1D0VA 2GPSA 3BXPA 4I6GA 3NVMB 1TDJA 1FNSA 2G28A 4RX1A 1QOQB 1E6CA 1KJ9A 4FDAA 2CXTA 5C4IA 4KGDA 4UULA 1OXBB 4MV4A 3HA5A 4YJ3A 1MO2A 2B99A 4XWGA 4TKUA 3F7MA 1WTAA 3LZDA 2YV5A 1CUZA 4G4SP 3WQSB 3VU8A 2HSZA 3AF5A 1G3IA 4E15A 4RMNA 2R7AA 3D7LA 3RIEA 1C14A 2FWRA 1UZLA 3F8WA 4OSEA 3C3BA 3RSSA 2NIPA 4Y2TA 5CDGA 1KYWA 1Q50A 2AKAB 3GLIA 4N7JA 3IAS1 4KPUB 3RQIA 4AKTA 4ANFA 3FRIA 3VMFA 1RBZA 2OHOA 1KH2A 4E5UA 1EFUA 2CUZA 1IPEA 1RZRD 3TQOA 2Q27A 1U0LA 3GPDG 2JZCA 2FU5C 1LI5A 4EFMA 5LWQA 3VR2A 4IXDA 3LS2A 2GEDA 2XMPA 3KTAB 5AVXA 2G80A 1CY7A 2VDKB 4INZA 4R5MA 3REFA 4DQXA 4LZNA 1CUAA 3ZH2A 2P8SA 3ETGA 2PL1A 4MQEA 5ALSA 3RABA 3JALA 3M5CA 3QELB 2B92A 3DXZA 2DBZA 4DUGD 4YV2A 1ZH4A 1R5OA 3Q72A 1XD2A 5KNDD 2HAEA 3M2PA 3M6FA 3IP6A 1P19A 3OBBA 3KCQA 1B14A 3FJYA 1U7WA 3L4BC 4J7UA 1LF5A 3A9CA 5HP4A 2QPTA 3A4VA 3SEZA 4BNUA 4Z9XA 2QU8A 3FTFA 1EFRA 1XTUA 2XJ4A 3GJSA 1EFPB 4EDFA 1E2GA 4QU0A 3TBHA 4Q4HA 1Y5NA 4F91B 3L40A 2L69A 1C30B 5HXAA 5F9MA 4H6WA 2GZHA 4HADA 2DPGA 4IX9A 3PK0A 4R16A 3I2IA 5EXEA 3NCTA 4PX2A 2IJGX 5AW7A 1X80A 2OKGA 2PO7A 4KE8A 3WWDA 4O5AA 3PQEA 2H08A 4QUGA 3T7DA 2D7CA 3N2KA 5A9TA 2AD5A 3ETNA 5F4BA 1P2SA 4LYDA 1YZHA 2R2GA 4MW1A 4B84A 4F45A 2N1MA 4F86A 3BKXA 2WQ7A 2BFEB 4KQCA 4AY3A 3ERCA 2CJYA 4JCCA 2COEA 4NZ9A 2PQ6A 1Q83A 1V39A 1R6AA 3JARA 4IOLA 4BMSA 3CF2A 4RNDB 1QVAA 1DJPA 3FVVA 2UZ3A 3IQGX 1E3WA 2JLBA 1A9OA 1NP3A 1KKMA 2PGAA 1PW7A 3AEUB 5FA8A 3T4XA 1XA0A 3PD7A 5CDSA 1YT5A 2IOHA 2PUGA 3DZFA 1DGQA 1Z45A 2A6PA 3LDUA 2VJAA 2OD9A 4GQBA 3S5UA 1LBEA 3MMSA 3T4PA 4AAYA 5IJ0B 1KXZA 3RUDA 2ZW9A 1XFAA 1G18A 5F2NA 3U61B 1H42A 2I2BA 4GO1A 1NPTO 1U7HA 2QDKA 4N3CA 1J2EA 2DCUA 3OHSX 4EA6A 5LBUA 3UKDA 3CE9A 1SC1A 4ZO4A 1KI8A 4DCPA 1RM3A 2XW6A 5BSVA 4RLHA 4UU8A 1EJ6A 1W1UA 4HLDA 5HG0A 3DTNA 3VSEA 2ERYA 1UOQA 3MTQA 3B2QA 3UV7A 1E1KA 1HDEA 4YR7A 1HG0A 2KS6A 4YV1A 2MSCB 2I3ZA 2VFAA 3BZUA 2QLMA 1KQ3A 1P4RA 2YYYA 4PZLA 1TUGA 3WGNA 1TTQB 4N7BA 3GK3A 4YFYA 4ECAA 4G09A 4NF2A 1L1RA 3U49A 3D59A 1LK0A 4CM6A 3K9CA 2R86A 2ZJAA 1SZJG 2W98A 4PLWA 5KWIA 3GRYA 1TVKB 3KK0A 3CKLA 4ZGBA 2FFQA 1GTMA 3AR3A 5BSHA 5ICCA 2Q5CA 1C4WA 4ZO8A 3ZU4A 4OQQA 3TRJA 3WWPA 4BS9A 4DCJA 3L0CA 1PBNA 2C7OA 3V4FA 1N6IA 2JPDA 2PL5A 4KU4A 2E21A 5DCUA 1R8XA 3JYOA 3C4JA 3SIRA 1JT9A 1ZHFA 2VYVA 2OGZA 4WJKB 3IKLA 2BJHA 1K8ZB 1KVSA 3GRUA 3ADDA 5AVYA 1T2UA 3PPVA 1Z7BA 4O2BB 4BP9A 1PL7A 3ADPA 4HH1A 2G77B 2JAHA 2OHVA 4C4SA 3HV0A 3QZUA 4NICA 3RFFA 5KYXA 3RAPR 1Y1LA 3WR5A 3A14A 5GTDA 3RRYA 3STYA 3IA7A 4DR6B 4CLRB 3RTAA 3ND5A 3QV1A 1M2OB 1M6VB 1ZINA 4UTZA 3QFSA 4YO8A 1GYQA 2OORA 5C46F 5J5VA 4F06A 3VPXA 2F62A 2IXTA 1EK1A 2JFGA 4RSHA 1YQ9A 1Z0IA 3OKFA 1DDIA 3S2FA 4N5NA 2XNJA 1MBZA 4C0JA 4L5AA 1E2EA 1G64A 3MWEA 4DRYA 2PV0A 3E82A 3ONDA 2EOAA 2GNPA 4FWBA 3VBEA 2W9XA 3NDIA 3CINA 3FCXA 2C2KA 2OLJA 5DLPA 3KSAC 5K3SA 4DG9A 4OLJA 3QKIA 1BC5A 4WX2B 4TS9A 1N4AA 1TIPA 2D74A 3EXIB 3H8WA 1OVGA 3K0HA 1S9HA 1OPRA 5H81A 4DMLA 4S1WA 5HSGA 2NMVA 2ZBDA 2OG2A 5HCNA 5A6VA 5BV7A 3BIOA 3QA3E 3A2NA 5LXTF 1EQ2A 1F4PA 4AVYA 5IJ9A 1L4EA 5CM8B 3IKJA 2A5DA 2DWQA 1NDUA 3DE2X 4RD3A 4WBSA 1RIIA 1QO9A 4DCVA 2FZEA 4JR1A 2NO7A 3S2ZA 1ZIXA 4OH1A 4UCFA 4P81A 4X95A 3EB9A 3LUGA 4UKDA 4C88A 5CURA 2ZE6A 3NRCA 4H77A 5KTRA 4JGBA 3QFCA 1LPBB 3WOHA 1ZHOA 1WXWA 1KJNA 4IY1A 4PYIA 3ZX5A 5YASA 1YDMA 1DPGA 3TL2A 2YRFA 3OD1A 4WCVA 4D8TA 1TKAA 4MUNA 4Y98A 1A98A 3LAWA 5EE0A 3W2TA 1XZBA 2MSNA 1V1MB 1U4NA 1JJIA 1JTVA 1K3TA 1AV7A 4YJFA 4TSFA 5AOCA 1R0YA 3HUTA 4IWNA 1SCUB 1YU6A 4DUYB 4HR7A 4LMRA 1ZGGA 3TNLA 3UWKA 3ZLTA 1Q0HA 4BO5A 1AZSC 5CT4A 4I46A 5ARBA 2C5SA 1G9TA 3QEMA 3CX4A 4I9FA 1PJTA 4JBIA 4JT4A 4NULA 4RGQA 4ZEOA 3V2GA 3K0FB 2XQJA 4HFRA 5BW8A 2PH5A 4R1PA 3RW9A 3GEDA 1DU4A 1NBME 1W0JD 2PM8A 4QULA 3UXYA 2VDNB 4U6SA 2Q1UA 3D3KA 1FQKA 2G07A 2FUEA 2YMQA 4PC2A 3H83A 5B6JA 4MV9A 4LDNA 2IHNA 3GFBA 4IDFA 4UZSA 1ABEA 3QU5A 3FPJA 4BXOB 1VJGA 4TZTA 3BB1A 3PGJA 1ZONA 3UANA 1MX3A 3UENA 3HDGA 3ZE6A 1U6JA 5HOEA 3QVGA 3OFJA 1V4VA 2HWYA 3OTGA 5A3VA 2FK8A 1JDSA 4N0MA 1IN8A 3CX8A 4URVR 5AM0A 2GXQA 2PT5A 2B9VA 3TPZA 3BMNA 1I4EB 3VPAA 1U0GA 3QVMA 5DGDA 3JW8A 3LJKA 2P7HA 1G0OA 2W37A 4L7QA 2N47A 1JG6A 2P35A 4P3XA 3WYGA 4PAOA 2XLBA 4PX3A 4G3XA 4F9FA 1YRQA 2VYVD 4GHWA 1QVWA 3G0CA 4JBLA 9GPBA 4N8DA 2QYSA 1V7PC 5LQKA 2XA9A 4D99A 4ZMRA 2QA5A 3IUNA 5GP1A 2FRDC 1RM4A 1F0YA 5ILOA 2HK7A 4BBPA 2JJ8A 3PCRB 3G2HA 4RF4A 3FDXA 4Q4CA 4P22A 4NOMA 3RV4A 1KH1A 5EJAA 1SUCA 4V0KA 3R9IA 1T43A 4PGHA 1ZIPA 2JVIA 5FBHA 4KWHA 2IV3A 3DONA 5F3DA 4NQZA 5LMNB 1XKXA 1YASA 2IUFA 3AP3A 5F35A 3BMNB 2WVAA 2OQRA 3NBQA 4Q9KA 3M1AA 4Y9TA 2B3DA 3FR7A 3HDQA 5EPEA 1PK7A 2ZU0C 3COWA 3JZFA 3NC1C 4LN1A 4EQ6A 2IHYA 3F1LA 1I3MA 1T2DA 1VMKA 4HPWA 2GLUA 4LG1A 1IDOA 2AFHE 3DO6A 1B93A 3I76A 3MS4A 2OXFA 3QF7A 4Q4HB 4YDRA 4D97A 1CLEA 4Q4JB 3PCXA 1SKQA 1M3SA 4RFVA 4W9MC 3VH4A 1BTOA 2JFVA 3T1TA 3UAVA 1AH2A 4B0PA 3JSXA 4UMFA 4KQKA 3U26A 1W1IA 3E7FA 2YZGA 1FU7A 1QK3A 3CRQA 3DWFA 1CK4A 4FFPA 4FI3C 5GV7A 4ZAXA 2R79A 3A4NA 3N0RA 1Y81A 5IFLA 5IXSA 4MARA 5D85A 4RPLA 2CXSA 1G7SA 2IYXA 3IO5A 4FSDA 4XX0B 3EGDB 1KJZA 5TF4A 4EECA 5I45A 5IG2A 5K6AC 2XCSB 1ZR2A 2B1RA 3SOZA 1A4IA 4FDLA 3I5AA 1K08A 1S3IA 5JSFA 2ZBQA 2JLSA 4Q00A 5JY6A 3C8MA 4JLSA 3E81A 4Y6PA 2OHHA 4MA5A 1X7GA 1OBVA 2OV4A 4IHJB 4GC9A 1TLFA 4BWFB 4BASA 2GESA 3Q15C 5C1OA 1I94B 2WJJA 4FB5A 4CIWA 5DASA 4DV7B 2GBIA 1N6KA 2XUIA 5DBIA 3FMGA 1IBMB 1II8A 1SH7A 3CXUA 3DAYA 4KJZA 1N5RA 1O54A 2BEWB 3AGQA 3L7LA 4PEVA 4DXHA 4RDCA 4EKNB 1ZJZA 1N2JA 5JVDB 3WZ2A 3RC9A 1DC4A 2WF5A 1RHRA 1FYVA 2FEKA 3PFFA 1G20B 2GM5A 3EMVA 3I42A 1WUJS 1YZYA 3TZKA 1HE5A 1CBUA 4BKRA 5KVCA 2IX9A 4PINA 1M72A 3WBKA 4KR7A 1FB5A 3C3CA 4L78A 4Z99A 4YECA 4O59O 4X1OA 5A4IS 5KQGA 3TCXB 5LB2A 2VBIA 2YRWA 4YA6A 4GKBA 3WLFA 2GFQA 3EVCA 4RZUA 4CQJA 1QIIA 2Y4OA 1YGPA 4PQRA 1M2GA 3NKFA 2C4KA 1X7HA 1P4HA 1MEOA 1GNQA 3AL2A 3RTDA 1YR7A 1AO3A 2CBGA 1JN0A 1H2EA 2ZPAA 2F43B 2OG1A 3RPEA 1TECE 5AW6A 5CYFA 4JK3A 3X2SA 4KIGA 4CUKA 1SKMA 1LPOA 3OCXA 5EIBC 1OX4A 2C9CA 2EWMA 5KVQA 3U1BA 1TXGA 4BE7B 2WWTA 5HRUA 4BUZA 2WIKA 4L75A 3WV4A 4A23A 2GHIA 3PGMA 5EQTA 2PQ2A 4XYMA 3HZZA 2QYTA 1YCGA 2NSJA 3ZQ6A 4M0DA 3NHWA 4A91A 5BN4A 2FN9A 2WUEA 1ND6A 2Y1OA 3FGNA 3WFJA 2NNWB 4I2NA 1I0LA 1ZCAA 3H0CA 4QFMA 3DE1X 1ITZA 5HFAA 4BMCA 2VTEA 3R0XA 5BMOA 2BSXA 3IAS6 2B61A 4NATA 4OYHA 3HTXA 1DEKA 5FPQA 2EFEB 1RYDA 1WY5A 2Q8QA 3H4IA 1M5RA 3P0HA 1HUQA 3FSRA 3UWPA 3AJDA 5KNBH 1X1DA 2AX3A 2ZKLA 3RK4A 1Y8CA 3HO1A 3OD5A 1S0UA 4IXWA 5F3RA 5JAZA 4NYJQ 3VC2A 2Q3HA 2P6MA 4EGSA 2GCGA 3ZZTA 1XMOB 3KOOA 3MK31 1AE1A 3IR7A 2PSSA 2VHJA 1RYZA 2Y1KA 1K0UA 2YWEA 5CA0B 3TIVA 3VDRA 3LOQA 2ZT8A 1YONA 5E9JA 3AR6A 4KR6A 1XQ6A 3LLCA 3Q3IA 3RJ5A 2GJ4A 1KQPA 4HVAA 4JJIA 1CY0A 1G5FA 3LDAA 1E18A 2IH5A 3DAOA 2AW5A 3I6QA 5KDDA 3U7FB 2GB4A 3U37A 5DT2A 4W5OA 3J7AC 3SJCA 2HSWA 1EXMA 3U3OA 1NSFA 1KK3A 2N42A 1XXHB 1PR1A 1SCDA 2C5BA 4UUOA 1EDEA 2KLBA 4KAXA 3CW2A 1QIHA 2V5VA 4L3WA 1U80A 2QL7A 3BWEA 2FSVC 1RI3A 2DU8A 3B60A 1UMBB 3GYBA 5EQJB 1L5QA 1VKNA 5ESRA 4FEGA 4QOIA 1ZGHA 4RM2A 3BFPA 4Z9BA 2O8BA 1X6VA 2OO3A 1YS6A 5ER6A 3NH6A 1R9JA 3OZGA 4B6JA 1JV2B 2W2TA 2Q2QA 1GQSA 1UJ4A 2VJLA 4J1QA 4CMKA 1MW9X 1VYVA 1X70A 2JGIA 2FOXA 3PE4A 1E59A 1ZNQO 1T9CA 1XYVA 1YOVB 1ZN9A 2OCLA 3AM3A 3DF9A 3PDIB 1R9MA 4ZI5A 2OA0A 4DXAA 2QTNA 3HB7A 2Q28A 2FSSA 3ZJVA 4WBNA 3CH4B 3HRKA 3OICA 1Z16A 2B4KA 3EGOA 1H8HD 3D7KA 4OXNA 5EC8A 3M4NA 9MHTA 2OZEA 1QRAA 2O2GA 2NZWA 4MKZA 3I4LA 2HJWA 4L95C 3LKBA 1XP5A 5MGNA 2Z4RA 2AL7A 1U2GC 5ALIA 1NGSA 3PSAA 1ZK1A 2WE8A 2QTMA 3EEBA 4KDFA 4CCSA 3STTA 3BH6A 3IS3A 5KYYB 4PZ9A 3O0TA 3EARA 2ZM6B 1ORVA 1VE3A 2AN4A 4HVLA 2YZNA 1UT5A 3W8RA 4DBVO 5HM6A 2G1KA 3LUAA 3AKDA 2J32A 1UBMS 4ITVA 1KMHB 2GZ3A 5H7XA 2FAXA 5LP6F 4ZVUA 2ATEA 3MGAA 4F4DA 1P60A 2YHIA 2QI9C 1NZFA 2D0PB 1J2TA 1I3CA 4OBEA 1C0PA 5KYTA 1N2GA 2FK7A 4JXJA 3QTTA 2H0QA 3DEJA 3PA6A 4EI2A 5A4FS 2WTUA 3MCWA 1NXSA 4MR7A 1DL5A 3OLWA 4XIJA 2YJ6A 1C5KA 3OU2A 2BBTA 2EKDA 5ULLA 1E4EB 1W87A 1E92A 2K2WA 3LGAA 2EDCA 2XNHA 2W5UA 3PFKA 4IGFA 4ALIA 1K6JA 3STUA 5KCMA 4ZVRA 3S0JA 4DYVA 2ZJ8A 1Y63A 4COOA 4P54A 2J8ZA 1S2MA 4BGIA 1QHHA 2BFFA 5ISMA 3A26A 3NNSA 4HDRA 4R7GA 2F6RA 1PDOA 1UM8A 3TR6A 4B5LA 4IDAA 1DDGA 2VUIB 4DGSA 2K7FA 1YZ3A 3FLEA 3GP3A 3WRXA 5D5HA 2DH6A 4CR6A 3PP8A 1I2BA 5SZHB 3MFQA 3G5TA 4L73A 3ADKA 3EUFA 4TTJA 4QSHA 3EXHA 3NHKA 5BYJA 2ZBGA 1BH2A 1UZNA 5JZVA 1SVWA 1HBJA 1WX1A 2CL6X 4D9GA 3I1IA 3FPKA 2GQ0A 6Q21A 1XT6A 3UJ6A 3IP9A 3QG5A 5EKXA 4MS4A 1DBQA 1RTKA 1YS2X 4IO1A 4JA0A 3DVRX 2GJ9A 1NJFA 4BZXA 3AEYA 1KRHA 1NRIA 2FSVA 4IRMA 4JLNA 2DTXA 4WNIA 1MABA 1PJAA 3FCEA 1SVSA 3M9XA 1VA4A 2O0HA 1F48A 1EG7A 2PXAA 2SKCA 3EIQA 3NWJA 5CGQB 5F1PA 5IRCD 1UC8A 5HS6A 1EUCA 5HJEA 4P0PB 2TRSB 2OENG 1RRMA 4RMHA 4LK3A 4B45A 4PS1A 3ECSA 2I2AA 2R8BA 4BPRA 3I9V1 1TVKA 1ZD8A 5CCDA 4QPJC 2PRYA 4E4YA 4M76B 1UJ6A 5LA6B 3G2PA 3FNBA 2BR5A 4H16A 2PL9A 3DVAB 5IC6A 4PG8A 1QZTA 1ZH2A 3TPFA 1NU6A 4M54A 3HP7A 4EATA 2K4MA 2QZZA 4L76A 4BMZA 1ESZA 4EZBA 1G17A 4ZOEA 3X1ZA 3G2IA 3CG4A 5EL0A 3H1PA 1PV2A 2UZ1B 3ODPA 1L5ZA 1QQBA 1VE7A 1XZQA 3L7BA 1OFVA 2EZUA 1EXDA 2AXNA 5K09A 2I8LA 1Y8RA 1BCSB 3H0KA 3K9FC 2WNIA 2EYQA 1YBVA 3VUFA 3JSAA 2VNSA 3AEKB 5I8ZA 3RSHA 3OPQA 5IEJA 5F9FA 4GXTA 5LL6P 3DZHA 1OH5A 4N6GA 1Z2PX 4PO1A 3O83A 2PNFA 3TNFA 3DKIA 1SIWA 1Z2NX 3A2LA 1R0CA 1W0CA 2JEZA 2BHLA 3ORRA 4G1VA 4MQUA 5JLJA 3UAYA 3OA2A 3V2HA 2E4AA 4GSLA 1PR6A 2W6OA 5I51A 2YZ2A 2LTAA 3O2JA 5LSAA 3AUAA 1GD1O 3D5QA 1AUXA 4IDPA 1KP9A 1T3ZA 1LUAA 1Z7WA 3KJNA 1MHPA 3FZQA 4JDPA 3MNFA 3R9KA 1CZRA 1YQUA 1D1TA 2E5FA 2I29A 3H1AA 1VG9B 2AFVA 4Q3LA 1E3IA 2P9BA 4UM7A 1A82A 1UBHS 2HU2A 4RV9A 4B2PA 3RT9A 2G8NA 4LC1A 3HMKA 3SBOA 3WICA 2OYCA 1OXMA 1FC0A 5ALMA 2M6KA 4QM7A 4MI6A 1A9XA 3RVDA 1HGXA 1J9ZA 2O2IA 1X80B 3MMZA 3PTLA 2CBZA 3HU2A 1V2GA 1R6XA 3PQ7A 1CQWA 1D7AA 3AY0A 3DP9A 4RKYA 4RSMA 2EFYA 2V7XA 4UVGA 1JPJA 4XOUA 3L6BA 3LCRA 3SPXA 5KQMA 4ZHQF 3NHYA 3OMWA 5J47A 1H9CA 3DLBA 2BY4A 4M9ZA 2XODA 1P80A 3D81A 4PBRA 1DG9A 3K0CC 1X7YA 2EWWA 2HSGA 4HPXB 3EC1A 1WIWA 2F67A 2YBDA 1QV7A 2X0JA 3OQPA 4ZO6A 3TSCA 3VC7A 1FP4A 2YKGA 4JUCA 1W30A 3GLRA 1ZVKA 2ZYWX 5FWAA 1MDBA 5JASA 2YXDA 3OWOA 2Q46A 4FFMA 1RWWA 5CFMA 3WDLA 1W47A 5ALVA 1T8YA 1BMTA 1PHPA 1HC7A 3CSDA 5B1HA 4A1FA 4E4TA 3H19A 1FNBA 3F4KA 3MGCA 4DEXA 2WYUA 3HE3A 2F43A 3L4EA 2O57A 3M4XA 4RD6A 2ZUBA 2AOUA 1KGDA 2PPVA 5D1NA 1ODIA 1M6HA 2BEUB 3KKLA 3O1LA 3ZXSA 4KO1S 3UGKA 4OQYA 3WGGA 8ATCA 1ONNA 1R5BA 4BNLA 3EOBI 4LCEA 2Y1DA 4QX6A 1Y48E 2JD2A 3EY4A 4K1XA 4D74A 3GLIB 3ZDRA 2NP6A 1KMIY 2YFKA 4A2CA 3KQUA 5ALYA 2PUEA 3HNPA 2X40A 3H97A 3ADOA