4M0PA

Crystal structure of human prs1 m115t mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
304
Chain Sequence
b'NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANTLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0pA02
4IJQA 4OHCA 4RAQA 5E38A 1UFRA 3MBIA 1A3CA 4P3KA 4JLSA 4RV4A 4RANA 1TC1A 3DMPA 3S5JA 2FXVA 4TWBA 2YZKA 4F8EA 3ACCA 4RHXA 1XTVA 1L1RA 1A4XA 1YFZA 1VSTA 4FYMA 4RQAA 5ESWA 3LPNA 1OPRA 1UPUA 2AEEA 3NAGA 4RAOA 1HMPA 1QK5A 4PFQA 4WMLA 3DAHA 1A98A 4M0PA 5K51A 1P4AA 1XZ8A 1NULA 1ZN7A 1A95A 1I0IA 1XTUA 3N2LA 1QB8A 1G2PA 1V9SA 1UPFA 3MJDA 1OREA 1GRVA 5IAOA 1NONA 5BQOA 4ZFNA 2XBUA 1I14A 2WNSA 5EUCA 1O5OA 1Y0BA 5BRNA 1PZMA 1QB7A 1L1QA 2IGBA 1HGXA 1STOA 1ECGA 4PAWA 2PRZA 5ESXA 3EFHA 4RQBA 3HVUA 5JSQA 1VCHA 1J7JA 1JLRA 1DQNA 2EHJA 2JKYA 2PS1A 1W30A 1G2QA 4LYGA 1VDMA 1ZN9A 2GEBA 2H08A 2H07A 1P18A 4P82A 5KAMA 4KN6A 1QCDA 3O7MA 1ZN8A 4P83A 5BQPA 1U9YA 5BSKA 1WD5A 2C4KA 1I5EA 4RABA 4WN3A 4P81A 4QRIA 1ECFA 3OHPA 4P80A 4P86A 4LYYA 1BD4A 1OROA 4RADA 1Z7GA 4RHYA 1U9ZA 4M0UA 1DBRA 3H83A 4JITA 1P17A 1BZYA 1I13A 1CJBA 2JKZA 1IBSA 1DQPA 1TC2A 4S2UA 1XZNA 3GGJA 5HKLA 1FSGA 5HIAA 5IPFA 4RHTA 4M0KA 1I0LA 1G9TA 1G9SA 3QW4B 3ACDA 1DKUA 4RHUA 4RACA 1AO0A 2HCRA 1D6NA 2PRYA 3OZGA 1ECBA 1QK3A 3LRTA 5KAPA 3M3HA 4LZNA 2JI4A 3OZFA 2VFAA 4QYIA 1O57A 1JLSA 1R3UA 2E55A 1A97A 1LH0A 4X45A 1ECJA 1XTTA 3GGCA 4MB6A 4P84A 3KB8A 4Z1OA 5JV5A 2P1ZA 4QYIB 3DEZA 2DY0A 1ECCA 3GEPA 4X44A 2H06A 1A96A 4LZOA 3G6WA 1DKRA 1GPH1 1BD3A 2JBHA 1P19A 1MZVA 1QCCA 1QK4A 4LZAA 3ACBA
chains in the Genus database with same CATH superfamily
4U9UA 1A7JA 1R00A 4QUKA 1E5DA 4F7WA 4R9RA 5L9AA 4F9EA 1RPAA 3WBFA 5F9FA 1AB5A 5KNBD 3WL4A 4E7PA 4K6FA 1U3VA 1T4CA 2P9QA 4KH1A 3QPCA 1E1RA 3PFIA 4B6GA 2GRAA 3T7IA 2O48X 2HIGA 3IILA 1VKJA 2C5AA 2LW7A 2QJWA 4AMUA 4X41A 4FGSA 3ZE9A 2OWEA 3GZTB 4L78A 2AQIA 1U2EA 1S02A 2WIBA 4G4JA 1VKHA 1YS1X 1J8FA 3SS7X 1PSZA 1J5PA 2EP7A 1Q0PA 1U04A 3HR4A 1NR1A 2GFQA 2X0NA 3AL0C 2JIBA 1JEEA 1O97C 1LEHA 3C7CB 4YQFA 5C35A 3KZOA 4X6UA 3RC8A 1Q7BA 5TNXA 4TTAA 1ZVJA 4BNYA 3EZ7A 4UHCA 5P21A 5GIOE 1GU7A 1QRTA 2YTZA 2B25A 3KXIA 1CUDA 3DKKA 1SJ9A 4K03A 2ST1A 2AXPA 5EP3A 3QZUA 3C43A 1M7HA 2KLHA 3FUVA 2CNWD 5J43A 3F5FA 3K9CA 3L6RA 4QDUA 4F4HA 2GO1A 1FNSA 4NS1A 2VPPA 3ROFA 1ZM2A 2JFBA 2JGNA 4R1NA 3UYKA 2ZUEA 1QONA 4DJDC 4UREA 1ZBDA 5IXYA 3RKUA 2OLKA 4Y1EA 4OLBA 2ZBPA 3JALA 1JAYA 3DEIA 1E3WA 2HBRA 3QVWA 5TQ2A 3ENZA 3F6YA 4OM7A 1AMNA 1N7IA 2KLBA 2WHEA 4TRNA 4AZ3B 1O0CA 3GCWA 1KH1A 2V9CA 3HDJA 4ZQIA 4ND7A 4OF4A 4WCFB 1TPYA 4DLVA 5C37A 1AD2A 5IXJA 4OHKA 4L8VA 2JBAB 3QG1A 4ZVLA 1KRHA 4CBVA 2WYVA 3HKCB 5JG7A 1C1HA 3AI7A 3I2YX 4MIYA 3I6IA 1QIEA 3OMWA 3NDJA 1PCXA 3CJRA 3PXEA 4R2LA 3U7QA 1PDVA 2BFEB 4N5NA 3FFWA 1DOZA 5IUJC 1ZUHA 1VJRA 3ZD9A 4CN9A 5EJMA 2JJ2D 1ZU4A 1XT6A 3KU4A 4ETMA 2XXJA 2P4QA 5I5GA 1I13A 2WAYA 4AFNA 4S35A 1ZVQA 1Y1LA 3MBOA 1QAQA 4PYOA 1YC2A 3DGFC 4WBSA 1W0KA 3QKSB 1GAXA 3PQ5A 1R0KA 4ZANA 2C95A 3TNDA 4FI3F 2HHAA 1NYRA 4LY3A 4P3NA 1J8YF 2FGKA 3SFTA 2Z83A 4QPJC 5E7IA 1PR6A 2HMAA 4Q3LA 4X9XA 4NYMQ 1A9TA 3RS7A 4B79A 3AFOA 4KMSA 2EL7A 2LKDA 3JQGA 3A31A 4L9RA 2WAOA 3GZNA 4IR7A 4BB9A 1T4MA 5MHTA 1PWXA 1IBKB 3O4FA 2AZXA 4IFIA 4AKTA 3KXLA 3O1JC 4M7OA 3T7AA 3NIGB 1W29A 2JIQA 3K5PA 3LKZA 4DN6A 1EVKA 1IFXA 1NOJA 5CVCA 3CVXA 1XEFA 3RQSA 1W2HA 3HN2A 1CTQA 4M60A 5JUWA 2CV1A 3D1JA 4I3HA 4D8WA 4JT8A 3KD2A 3THXB 4YT8A 4RWEA 1JR4A 1PJCA 5IAKA 1JR3D 1GLVA 1X8XA 1E9RA 4TZTA 1E9AA 4DJ5X 1EZ4A 1GCAA 2VZLA 1IEVA 4LZZA 5TX7A 5C8DA 3AVVA 1QP7A 4ILEA 3EF0A 1PLKA 2FAXA 3EJ6A 3AR3A 1TYAE 4CM5A 2Y3IA 2EVWX 3C5WP 1PJZA 5LQKA 4BQEA 2O1WA 2RGEA 4MUHA 3PC7A 2QRJA 5JFGA 1O95A 1WTCA 2OHJA 1T6XA 3BAZA 3HZHA 3P9CA 4QO7A 2R1TA 5AJVB 3V7WA 1UR5A 5D5QA 5ECDA 4IOKA 1UMBA 4BFVA 4A82A 1AXRA 3T3GA 4ZVSA 1W5BA 1YBFA 4E15A 1HRKA 2C4WA 4QEDA 1JT2A 1PAUA 1YRWA 5G40A 4OI0A 1QQTA 2G08A 4JI3B 1R4NB 5DRYA 4BNUA 1R15A 4DXAA 2Q0HA 2I6XA 1E4EA 3FKJA 4LOKA 4OH1A 3KSMA 3U3KA 1WDWB 3WLMA 4KIFA 2ZJFA 2HNBA 3DZDA 4OHUA 1PKXA 3IPAA 3RC2A 2ZB4A 1RCTE 3QBEA 2PQ6A 3AEXA 3L1KA 2AMFA 5FOWA 5L7WA 3STTA 3B1JA 3FDXA 1XTQA 5K0GA 3H18A 1PGJA 1YMVA 1JHMA 1FJ2A 1HZZC 2JANA 2X1MA 4GXNA 4F8JA 4DTIA 4PPYA 1QUFA 1ZH4A 5PNTA 3WGIA 3HKBB 1FUEA 1AURA 4GRDA 3BA6A 1PP4A 1CZRA 1Z18A 4WN9A 2YMLA 5BRAA 4L5IA 2J59A 5KHLB 1AIPA 2X86A 4YPOA 4KNWA 1E79A 1SKYE 1EWQA 3RANA 5JH7B 2P1DA 2ZSEA 4HN2A 4XYBA 3Q7RA 4ES6A 1CLUA 1VIDA 2OYSA 2JCGA 2V96A 3PZBA 1V5EA 1Y7IA 5E2IA 1LXCA 4QGSA 4D25A 2PL1A 4DQLA 2G88A 3CLTC 2A9RA 1ANKA 1PWZA 2WHPA 1CNFA 3QFRA 3EQ8A 1PD1A 1KMHA 4PONA 4XB1A 3MIIA 1GD1O 4AUEA 2J6HA 2QMUA 4N7BA 4DUGA 4F85A 1QQAA 1OFUX 3P52A 4KMOA 3B3GA 2J9FB 1P2GA 5AYVA 5A5DA 2VDQB 1GTMA 4IINA 4QM7A 3GLGB 2UVQA 1PX2A 1SRRA 1IBSA 1SUWA 1Y1TA 2B9EA 2RSLA 4W7IA 4YH1A 4RSRA 1RCFA 2IKSA 3HLKA 3TQQA 1O8BA 2QTRA 2OORC 3UATA 2I2AA 1MG0A 3ZWWA 3ZV4A 4CEIA 1MT3A 4BC0A 4UPDA 3ROMA 1ZJ5A 1UOQA 2F3TA 4N3NA 1PQYA 2B4TO 2JFPA 2ZTHA 2O6LA 3A0RB 4IBOA 2YJNA 4QELA 3DFFA 2ZYTX 4W99A 5D3QA 2UZ3A 4ZEOA 1IJKA 1KK3A 1NVBA 1QRRA 3FVRA 1VMDA 2CLSA 4PG6A 1EGMB 3EXHA 1F38A 1E1YA 2RK3A 1QR2A 2I4MA 4HDCA 3U3JA 4FZ3A 2P3LA 3EC2A 4NBSA 4EABA 3H2JA 3DT6A 1SNYA 2Y1GA 2VP2A 4MGZR 1T6BY 1OBHA 3PC3A 5IBQA 2B2NA 4MP3A 1RBYA 4RY8A 1SOUA 1XSEA 1BFKA 2EKDA 2HLDA 3G6WA 3H3JA 2Y1LA 1B76A 1K06A 2RIPA 4JOBA 4PXYA 3HDVA 3W5JA 5IT5A 2RGRA 3JQ8B 4N0QA 3ZXUB 2XF8A 2Y1DA 3TFOA 3NBAA 5CVJA 3SC4A 1E8DA 2X3FA 3CVJA 2QQEA 5G3YA 1ZXBA 2JJYA 2WTXA 1NXQA 4TMWA 5KOYA 1DGQA 1GG2A 2FEKA 2HJGA 2A92A 1DJLA 4Z4HA 1M83A 2TECE 3MZ0A 4MA0A 2FZLA 2J3MA 3ZCSA 5AFSA 1I7LA 2ZPUA 3D3KA 5H3CA 5GVSA 1C1YA 3THSA 1UXJA 1FFHA 2JPDA 3TUIC 4DC1A 2V65A 1XNJA 3KKMA 2ERXA 3COPA 4FYMA 2O8EA 1QANA 1J8DA 1LA2A 4PBTA 1O89A 4R6WA 4BFZA 4L4ZA 1L7PA 1QWSA 3NM4A 4RXMA 3AFNA 4NZOA 5HUHA 3FMPB 4MAMA 2DH6A 3HWX1 1PJ2A 4RDCA 3NT4A 2FP4B 2R6CA 1W96A 3RTGA 3K92A 4X90A 3THRA 3A1CA 2BDTA 4X62B 3OVMA 4MB2A 4FMBB 3D8HA 5F2KA 1IWPB 3Q7SA 1VPVA 2OSVA 3ZWCA 1QGYA 4JLOA 3UW3A 4JQCA 1H9CA 4ILKA 4ZYWA 3ZU2A 2CCJA 2AFHA 2XWQA 1K5HA 5ILOA 1OGJA 3QVMA 3KBBA 3MWGA 5BVGB 2GLTA 4LBVA 1KSGA 3UBMA 1DP4A 2FB9A 1MAWA 4GOXA 4QTUB 1VCMA 3KKZA 1SVLA 3Q6NA 4Y18A 4W5JA 3Q7QA 1YRLA 3WZLA 4DDWA 1ZK2A 2DKOA 4UXIA 4RS3A 6ABPA 5K0FA 1XMXA 4JGGA 5AXDA 1NPYA 3OEYA 3VX3A 4BTVA 2VCHA 3GJTA 2YWGA 3BRWA 3NBKA 3VJLA 2IHBA 2XQJA 1RRFA 3FUUA 5KVCA 3K8YA 1DB3A 5IDQA 3GY0A 1OB2A 1X1CA 2NO9A 1OZFA 2AMVA 2ILTA 4LF8B 1YKGA 1Q1GA 5JY1A 3TIIA 2ZATA 3DMRA 3FR7A 4XCVA 3TLZA 3OQOA 2HSJA 2DHRA 1CZHA 1CEXA 1EVYA 1AS0A 1YQ9A 2IPXA 2IEAA 2ZRFA 4O4LF 2OD9A 2XT9A 4BJHB 1M2KA 1XZDA 4KQGA 4J0KA 2IEIA 4UEKA 5A3SA 2CLLB 3N2GB 1QTNA 4MTCA 2ZJ0A 3CLSD 1PBTA 2C9YA 2GGSA 2Q5CA 4G0PA 1ATIA 5AKZA 4TN5A 3DD5A 3W1WA 5GZ3A 4R1LA 3G82C 4G89A 3W6NA 3ZHQA 2Q5HA 3DKRA 1UP4A 3ROGA 2RI6A 4CKWA 2ZPAA 3BYZA 4O2BA 4QG3A 2VDLB 3IAEA 4L6CA 4XGKA 3H75A 3V7UA 3QV1A 2UUAB 5ALHA 3BD8A 4CDMA 4D4HA 1ZR2A 1J6UA 1XEXB 1NP7A 2ACVA 3RU3A 1MR3F 1UDXA 2GEUA 4L27A 4LCJA 1ORWA 4EQ6B 2B1JA 2V59A 2EX1A 1FYWA 2OD2A 3VSBA 4DV3B 3IIEA 2X4GA 4CE6A 1PL7A 3KUCA 2IZ1A 5JEDA 1O9GA 4EUFA 4C7OB 1OBVA 1NJGA 3RHZA 3PUWA 4IIJF 1YGPA 2ID8A 1KIMA 3T7RA 4F4JA 1FNNA 5B7GA 2H00A 2PGLA 4QYMA 2G8NA 3C3KA 1JEJA 4AS1A 3HCOA 1G5QA 5KTKA 4D9BA 2GETA 5NULA 2PX5A 4PLVA 4HAYA 4XD7D 3O4IA 4F3RA 1MZVA 5AKJA 4B3CA 1DARA 4F60A 2W0MA 2J0VA 4QX6A 5FTLA 3EDMA 1CF9A 3QWBA 3IV7A 3F4KA 2HJVA 5ALKA 2ZRPA 4F04A 2OOSA 1K6XA 1H8HD 2Q4OA 5JI2E 2G3YA 1WMSA 5EQFA 1T35A 4JVMA 4P2BA 3SSNA 3GEHA 5CYPA 4ZDJA 2XUHA 2I7TA 3OT4A 4Z51A 4FT4A 2JFYA 1V5FA 4MVJG 2Q4RA 4PZPA 2V58A 3O7WA 4QGBA 3KR0A 4RPCA 2YW9A 4WNCA 2V7XA 4XA8A 5J9FA 3QIVA 4EH1A 1EE2A 3BL8A 4FFBA 5A4AA 3W1VA 2DHQA 3PZRA 4ZCIA 5DCLA 5JQGB 1NBIA 1K4KA 3BGDA 2OCAA 1GSOA 2X2PA 4C08A 4EKEA 1CWUA 2I5PO 1JHRA 3V7YA 4B4UA 2GEFA 3B3JA 3FYDA 1EK6A 3MPOA 4BOYA 4HMOA 3GC6A 4BB0A 5CD9A 2ARKA 2H5JA 4M1TA 2I4IA 4BJ5A 2GCPA 1UAYA 1W4LA 2YC2C 1JLHA 2I4OA 4RD1A 3EULA 5HF9A 1VI5A 2DT5A 5K0BA 4E21A 1OH5A 4RIHA 4FEGA 3G13A 2VPZA 1IG3A 4BNVA 3H19A 2R85A 1POXA 2PX4A 3E0XA 3CO0S 4PG4A 2IX3A 1T9BA 3MWEB 3UN1A 2J9ZB 4ZV4A 1UWKA 3JQPA 4CV2A 4UM5A 3X1XA 3FYTA 1J9GA 5FAKA 2O3JA 2X41A 1XQXA 3BK2A 3EYWA 4R1UA 4YYZA 2QN1A 3ZLBA 4AZ3A 2VOEA 3LLUA 5BR8B 4OLHA 3E18A 2ORVA 1WV1A 1XR3A 3BK1A 3M1IA 4FW9A 3IAFA 3WOHA 2JLCA 1TCVA 1DIGA 4F6LA 4A0RA 5EVCA 4M7WA 4TVKA 3HKCA 5IVPA 4X93A 3WIVA 2G83A 2XCIA 5G4KA 2JS7A 1JBQA 2WPDA 1GYRA 4L4RA 2FPKA 1KZYC 4WCVA 3UICA 2BFEA 1T29A 2EQ5A 3K5HA 1KY4A 2AOUA 3DFUA 1TJ4A 3LKVA 4R16A 3ZXIA 3IXMA 1L5FA 3MCUA 1DTSA 2Q8PA 4NBTA 1Q7RA 3OTQA 4URZR 3DBLB 1RRVA 2P8JA 1VDZA 2D1QA 2C2YA 3LBFA 4CMIB 3LFHA 3H9UA 3VH3A 3AHDA 4DCUA 2VNSA 3CQ9A 3JQCA 5HQJA 5C80A 4KXLA 3KWFA 4O4LB 1XL0A 2C2HA 1N2BA 2F1IA 1AUVA 3LPMA 3QLVA 2EJWA 3DVAB 2WHRA 3H2IA 3PE4A 2F7SA 2CVHA 3SE7A 3WNQA 1C1XA 1ZP6A 3GV0A 5K4GA 1NVGA 5ICEA 1UANA 3WS7A 2ES4A 4EA9A 1ZJ4A 1CVRA 2JHFA 2EW2A 2O52A 1QAMA 2YFYA 4L02A 2HAEA 5AKHA 5KEIA 1CJCA 1LK5A 3HNRA 1TJNA 4QBTA 3ZVMA 1J7KA 3B1WA 1E0JA 4C6RA 2ZIWB 4H1UA 3VGJA 1G18A 2GXSA 2BGNA 2PT7A 3CNOA 3D64A 4L50A 2CDRA 4NJOA 4AY5A 1QHFA 1SCQA 3C39A 1Y1KE 4QXPA 1C80A 3OU6A 4ZCRA 5HS4A 2NZUG 2FHSA 3I8XA 4MLDA 4DA7A 3THXA 2HLNA 3HEMA 5CIWA 4M54A 3P20A 2Q8QA 4NHEA 2OMKA 1VPLA 5GADl 1KA9H 2MR6A 3K5IA 1TB4A 2FFHA 4U2KA 5KKNB 3Q8LA 3AW8A 4R3NA 4IIJB 3EA4A 4P3XA 5LR6A 4CCYB 4CM3A 2BP7B 4C0JA 3OFNA 1FLNA 4TSRA 2QSUA 4DSAA 5FBVB 2XUFA 4G5XA 4DUZB 3IMFA 1W2WB 4IIUA 3D02A 2Q5QA 2V1UA 2JFZA 4CMEA 4Y2GA 2G9QA 1R0WA 2W6CX 1M6EX 2C31A 1ENOA 5AK0A 1QIFA 5KYYB 4TZKA 5DYIA 1K68A 3H6HA 2O1XA 4W5HA 1IOLA 1FEZA 1B43A 5FF9A 3T5AA 1JPUA 3JRNA 5K51A 3NX4A 3C6KA 3E3AA 2NZYA 4TLAA 1L1FA 2BKVA 1TU4A 5H9WA 5ALSA 1VL5A 3G2LA 1VXRA 2PX3A 4KTVE 4R7TA 3WIUA 1W59A 3LP8A 4U2BA 5G53C 3I01M 1PEKE 5H9VA 5AVJA 3U26A 5BNZA 1IK6A 1MBZA 5CJPA 4TXNA 1P5RA 2IUSA 1PDWA 2FI1A 1U1DA 3U80A 1OXBB 2KW5A 2G09A 1WIWA 1ZJ6A 3GLVA 3Q0TA 3VR0A 1Y8QB 3I2KA 1C9EA 3HKBA 4YCSA 2GASA 2AWNA 5JW6A 3O1LA 1B41A 2DP4E 3RRXA 3AONB 1Y4SA 2VSXA 2BGGA 3NJRA 1FDUA 1C9NA 2JCSA 4DVJA 4GDMA 2FSHA 3RC1A 4BFCA 5JC8A 4X6LA 4RA9B 4F5EA 5JH7A 3FVTA 2YN2A 1H3EA 5ALLA 2DB3A 1NC1A 1ZJJA 3QMPA 3ZZMA 3ZEAA 1C4KA 3LF1A 1SU4A 3AINA 1G3UA 1XZEA 4W63A 2J32A 4YV1A 5KPDA 3Q2OA 1E5XA 1JXAA 4Y6OA 5F64A 5IN4A 3LOQA 2W2TA 2HQRA 1XRSB 1C0LA 1IAQA 2J9FA 1GV0A 3DZIA 4BEBA 3MHTA 3RS0A 1I5EA 2Y1FA 3NKLA 2RJ3A 3IAAA 3QNMA 5EXTA 3E3LA 4PCVA 4EA8A 1PTJA 2JGJA 3ZHCA 4ERXA 5IF3A 4MV6A 1OTXA 3P94A 2FVXA 2OBBA 5SY9A 1X2BA 1T24A 1I36A 3QUTA 4KWIA 5FTMA 3WLKX 3F49S 3B6IA 2R79A 3HLTA 4FJ2A 4M0FA 4EMBA 4CTNA 2RAFA 2EKZA 4KU4A 3RTBA 5KNDD 3B51X 4NTZA 2V0GA 1M7GA 5TC4A 1E9DA 1FBTA 2OZLA 4XLLA 1E7QA 3MOSA 3TK1A 1N78A 3CGGA 1WW2A 4TLDA 4Y2HA 2OA0A 5K0ZA 4JSRA 2OZKA 5JJBA 1UBLS 5D5HA 2ZK7A 5G4LA 5BR4A 5T4HA 4BRZA 5I7WA 3FROA 4ND5A 5EEGA 4NK5A 5J58A 2H51A 1N9GB 3S70A 1DELA 1BXGB 2XXBA 3U0BA 4C5AA 3A58B 3JQ8A 4OHOA 3FXAA 4G41A 3VSAA 4FINA 1Z73A 1MEJA 1EHIA 4YS6A 1N5JA 3VDMA 1QQBA 2QI9C 1VE9A 2UU9B 5B37A 3G0GA 3ITKA 4FGJA 3BJZA 3IERA 1A4IA 1IATA 3U09A 1JDJA 3FJ1A 1ISPA 2ZQYA 4G0NA 5U1PA 5LWQA 3EDRA 4EENA 1YE8A 3LKDA 2MYPA 4I1UA 2NUAB 1ZVVA 1IMOA 1FNBA 3C87A 2HREA 5AW3A 5K8CA 1TRKA 3FBTA 2XDQB 3J81A 1T1JA 1X86B 4B7CA 1O5IA 4Q3EA 3ZQ6A 3HDYA 2FP4A 2QX7A 5AO9A 3A1DA 3L7IA 1RYHA 3BWCA 1QQ7A 3HRIA 3ON5A 3UH1A 4R1PA 4YNBA 2X3UA 1GDTA 1PZEA 2BGLA 2HSEA 3ABSB 2R7AA 5JCOA 4NAHA 5MFZA 4IXMA 2PUWA 1VE6A 4OSPA 1QZUA 3LO8A 4PBSA 1KFEB 4BDSA 3MB8A 4CKWB 1FZTA 4K1LA 1D4ZA 3JS5A 3PYMA 4GKVA 4U00A 3AUTA 2QE6A 3E9EA 1ZD2P 5CBPA 4W8OA 1FLAA 1I4WA 2ACEA 3C14C 2PXXA 2PBRA 3H2YA 2VRCD 5HS6A 3A14A 2FKAA 1MOQA 5BNIA 2VJDA 2Z30A 5BNTA 1GSAA 3VNVA 4U5QA 3EEBA 4NDNE 3KEQA 1XNGA 4E12A 3I8SA 3O91A 4G84A 4HGZA 2ODQA 5GM2A 3DE0X 3TTWA 3DKPA 2AFHE 3Q8WA 2PMCA 3H5IA 5EWLB 2HUPA 2WKPA 4Y1GA 1JZTA 5CEEA 1MJHA 3PIRA 1JIJA 4GNRA 5A6VA 1SQ5A 3UKOA 4JKYA 3IEUA 2FZGA 2EZTA 2Q4TA 4IXNA 1K98A 2O8BA 4Y30A 3OUUA 5CVEA 5HIJA 2QTZA 3N2GA 3N28A 1EFRD 1M66A 2QENA 3T9CA 2PV0A 1T1RA 2QQGA 2YJ4A 5D6OA 2XWBF 4PQGA 3SP1A 3WGVA 3Q5GA 2XDWA 4L0CA 1IHDA 1KBZA 5KX5B 2XNDA 3QSYA 4EFDA 2HFJA 4UNSA 4AT1A 2HV8A 1P2VA 1CDOA 3C6XA 4JYPA 2H1OA 3RASA 3WWPA 1XCJA 4RVOA 4YJ2B 1VG1A 1XEXA 2IY7A 1THTA 4MCAA 1DPFA 1IJFA 3MGKA 5H02A 3UNXA 3YASA 2X0IA 2IZOA 2OE2A 1BH6A 1U7WA 1B74A 4EQ6A 3AGQA 2C5BA 2RGBA 3IVRA 1EXWA 3JQEA 3PSHA 4WFKA 1U99A 4FQ8A 2XAUA 3SAJA 3ZGLA 4HYYA 1FJHA 4UNQA 3BF7A 3K70B 4C7OA 1ZQ9A 1KTIA 3FY4A 4O08A 3UANA 3EEFA 3O93A 3U4IA 3IR6A 2J0QA 1SG9A 3K1ZA 4LHSA 3WYDA 1LH0A 2CE7A 2CHFA 2J5KA 4WXPA 1GN8A 2W42A 4G0WA 1R6BX 1UJCA 2WSLA 3BTOA 3ORSA 3D8TA 3GEPA 1KYWA 2BKUA 1Z07A 4FYJA 1YI1A 4K6OA 2C2BA 2R87A 3SZLA 3QV2A 1ZAKA 3E27A 2D5BA 4FUTA 2Z9BA 5D6NA 1V16B 3RU7A 3ZKWB 4YBZA 1TVMA 2AR0A 1TUIA 4PFSA 3SYNA 3LUKA 3PDWA 4XUGB 1Y3DE 1AKRA 3MWDA 2TMDA 3C45A 1XTJA 1TFRA 1GGNA 4RKQA 4OK6A 3K53A 1ONSA 5DOVA 3T1NA 5AJZA 1R0LA 3UA3A 5EJ5A 3CTPA 2W48A 3VMFA 3TNYA 1V45E 3O5AA 4BEJA 5JQGA 5KREA 4B17A 1Y8RA 2O2GA 4RY9A 4PX2A 2Z2KA 1CV2A 2AT1A 1A8PA 4YRCA 2JHAA 3E9RA 3CRNA 2EFEB 1MRNA 3F6BX 4HDQB 1SVMA 2IU3A 4DMRA 5JU6A 3SF8B 2KWIA 4LYEA 2GPTA 2HTFA 4LV5B 3KVNA 4YUWA 4B74A 1T6NA 3MM4A 1ZMBA 1G5IA 4EKYA 1CR0A 2PZKA 3MSCA 2OEPA 3TIVA 2H2FA 2AJLI 1VECA 3OE7D 4UE6A 1LNZA 3F78A 4FS8A 1AK1A 2QROA 4KYTA 1SBIA 2NZJA 4PO8A 2WSSD 4DWOA 1KL7A 4U3JA 2DMRA 3FKQA 3D43A 4AJPA 2BUAA 1YONA 1R4MB 4MYRA 2IV7A 1S89A 1QUEA 4DIBA 4DMHA 1RU3A 1KQFA 3OOWA 1JU9A 2CXRA 1ZD3A 3VO9A 4RTJA 2G1KA 1NYTA 2CLFB 3PHCA 4HWRA 1WB5A 2VT6A 1GKIA 2I8CA 5I8WA 3P0EA 4YRRA 5FUQA 1U11A 4RFLA 2VUTA 4CI9A 5KTYA 2A9FA 2H7XA 4JB0A 2PO7A 3AOEC 1ULZA 1I01A 3RYTC 2G77B 4RZIA 3UFBA 2NYAA 2HT6A 3GWZA 1UAAA 4LYGA 2G1UA 2VZ8A 3NDPA 3COJA 3BL6A 2BYTA 1KJZA 4CMHA 4E4YA 4V0SA 1SBYA 4CM9D 3DBLA 3K96A 4UUQA 5FFMA 3GLQA 1AXEA 3H11B 1AGRA 1NBWB 2IVZA 2HF9A 3A4MA 1EE1A 1O54A 3E82A 4NBRA 4YDRA 4F8YA 2FOIA 3Q7IA 4J6FA 5AHWA 1MEEA 2W2MA 3R7FA 1M8KA 2YL2A 4L72A 3GGGA 4RE5A 5IYZF 3G5TA 3LSYA 1ZGCA 2ID7A 4O4LA 5JS7A 3G5AA 4Y98A 1P3JA 1LV8A 5DK6A 3P9QA 3DVAA 2OV3A 1K9VF 3E5NA 4REMA 5CYGA 5AESA 4DVGA 1GG5A 4JI5B 3GI1A 1DAEA 4XGRA 3UMCA 2Z56A 4PTZA 2K5UA 2ADOA 1WVMA 4L5BA 1OKKD 4JLJA 2GBFA 3DCNA 4N5HX 1JQBA 1CXZA 2Y1OA 3OE1A 2PMKA 1OX6A 2CL6X 3U3OA 1LDMA 4W5WA 4ZVNA 4DJTA 2D2VA 4TX1A 4ZVMA 1YMQA 4E0BA 5EXPA 2IYPA 3NHPA 1SD1A 2WD7B 3H5OA 3WK9A 1SY7A 5JZVA 1UJMA 2GB4A 1MT0A 4W82A 3NP7A 4WGFA 5JAOA 4J7CA 3GGCA 1S4QA 4P4TA 4N5DA 2QMEA 3Q9UA 4LXXA 3LDUA 4UEWA 2GI4A 5EVJA 1GQ2A 2H48A 3RYHB 3ZU5A 4AS3A 5IT0A 2NYUA 3JZFA 3S7TA 4UNRA 4IIJA 3L0IB 4X54A 4XUEA 3L8HA 1P5ZB 4OJTA 3IOCA 2YHUA 3VSCA 4QBGB 3DAOA 5JR3A 5B53A 2WBLC 3PFNA 1GR1A 5BQFA 2DHEA 1Y1PA 3HJNA 3AIMA 2UZ4A 2EKLA 4CUKA 4MUGA 1BNCA 3U61B 3BTSA 3DLPX 1LTKA 3SJCA 1KR2A 4F2DA 1Z62A 4GLFA 3UGQA 2JGIA 4Y2QA 1JDBB 1UT8A 2GNAA 4GE0A 3D8UA 1Y9DA 4Z0NA 5M04A 3EPPA 4A91A 4YR9A 4Z3OA 1HLGA 2R4TA 3BQ9A 4N40A 1SC3A 2E9SA 1TU0A 2B69A 1C8BA 2WT8A 2SCUB 1HL7A 2VBFA 3DDZX 3MMNA 2B3TA 3N87A 5ITZB 3UPUA 4XTRA 1R2QA 1QGDA 3ZV3A 2L0XA 2VQ3A 1ZNXA 5LLDA 1H6BA 4YYEA 1Y3FE 4FNMA 3E7WA 3PUYA 1Q2UA 5LBUA 1NIJA 2EFDB 3AJ8A 1JDVA 1QKKA 1V11B 4H1TA 4YAWA 4YRMA 3TOVA 4BQSA 3V2GA 3H87A 4KPEC 3KAKA 9ATCA 4LJYA 4N3BA 3B36A 2HPHA 4QBFA 3A6HA 5DHFA 4KQWA 2GBIA 3AYZB 1U8ZA 3I3OA 4ANFA 4WX2B 3C85A 1RYDA 2GF0A 4TMTA 2R7NA 1Y8QA 1EA7A 3UC9A 2IS2A 1IHYA 1JLMA 3PFWO 5B1YA 4IJ6A 1NZFA 2CD9A 3CRW1 3KKKA 1MOPA 1WXWA 2J3JA 3FHOA 3GFPA 3OLWA 4Q6BA 4RVGA 3RARA 3UB4A 3ZDFA 4F84A 2PSSA 3QHAA 1YZGA 3R0ZA 4MA4A 5KYGA 2EJTA 1R5NA 2JAUA 4RA9A 4CKEB 4GZLA 1X8JA 3BGWA 4J94A 4NE2A 3U6BA 2ZBFA 1N2IA 2XVXA 2HGZA 4M0LA 4PLPA 2IZZA 3U7GA 4BMPB 4UBMA 2EYQA 2VYCA 1JTEA 4JQZA 2BIFA 1Q91A 1NP3A 5AVOA 5IKMA 2UUCB 1XVLA 1H23A 4P92A 5FA5A 5ULLA 3CM0A 4WZZA 1O9HA 2HJRA 4KAAA 3RFCA 2A57A 4GZ6A 3HFSA 3SXUB 4HVLA 2O0KA 1L5YA 2G76A 3NYQA 1G59A 1WX1A 2E1RA 3ZBUA 2KI5A 3EOBI 4DLYA 3U19A 4ZI3A 1JKFA 2J6BA 1OWMA 4CNBA 3HJTA 2R6R1 4N39A 1SHLA 4DLXA 1MX9A 3QBVA 4N18A 4EPTA 1E2MA 1A8UA 3TTVA 2C1XA 3D2BA 1P3DA 1M1UA 2W5UA 3IFSA 5JLJA 1E5QA 4L07A 5JJCA 1Z4IA 5IWCA 3THYB 2YASA 3HXTA 2ZJOA 3PK0A 4X97A 5IN5A 4DMMA 5B58T 3QEKA 4NK4A 3OZEA 2BSXA 3KT0A 3O8QA 4IJWA 5HK9A 4B2YA 5IYZB 2WJIA 1K3UB 1BE0A 4NH4A 3LXXA 2CGEA 4JIGA 4NR0A 1GAWA 3DYBA 4CKYA 5HR5A 1FL9A 3CS3A 4NOMA 1L5MA 3GUCA 3TTSA 4PZCA 1YFLA 1DV2A 4JEHA 2E18A 3K6KA 3LP6A 4XWYA 4GUAA 4DPMA 1NURA 3P2IA 3LRPA 3WJ1A 1SG0A 4CQLB 5HWSA 4PR0A 3WL7A 1GZVA 4LI3X 1CFJA 1NY6A 3PSAA 2FY8A 1SN7A 2G67A 6ADHA 1T2UA 4DANA 4F11A 5HFAA 3FNQA 4LVNA 2A1IA 2CFCA 4GMXA 5JMTA 4EDHA 4H15A 2W93A 1XCBA 2NUAA 3B1VA 3TLBA 1R3DA 4UCXA 2YW2A 4OFWA 2Z4RA 5HRUA 1F8GA 4HDRB 3LNTA 1WHTB 2CCGA 2XDQA 3QNUA 4WSOA 4J0GA 1DT3A 1DVRA 2FUG1 2HKIA 3DOHA 4I8DA 4MQ4A 2AN5A 3HDGA 3OJFA 4OHVA 2QGFA 2ODNA 2KB0A 3U44B 4OX9Y 1J0AA 2HBZA 1CUVA 4MV7A 3QVJA 1R5JA 4EI9A 1SHZA 1ZUD1 2IPOA 3HKDA 2GVDC 3FH0A 3FPCA 3H1BA 1TEZA 4HGYA 1WPGA 3D7NA 3HQ4O 4OY3A 3T06B 4XEUA 4DMKA 1X19A 1PFYA 3JWEA 1PZFA 1ZI6A 3EOAI 4GC9A 4PO1A 3BM5A 1GZ4A 5L4LA 1Y89A 3T94A 1EUZA 3F6PA 1DJOA 5I7SA 2WHXA 1H2HA 4Y0VA 3EPHA 2BKEA 3LH5A 4LJ5A 1SVIA 1HFKA 1EFTA 2OGTA 2P9JA 2P62A 4LX8A 1BE6A 5ES4B 1V5IA 4W5RA 3TKLA 5DBFA 1JDSA 3WI7A 2J0EA 2VSFA 2XMCA 3COVA 4GPTA 5H83A 4BNXA 5F2OA 5ARBA 5K6AA 5KSYA 2VSYA 2ILVA 1AVTA 1KEZA 4OBEA 3JYOA 4UDXX 5B2ZA 3T3MB 5LZ9A 5DTMA 2FJ0A 4ZYXA 4I4TF 2HSWA 4JZKA 3P9IA 4LV8B 2Z09A 1CNMA 3WA7A 3H5RA 4OHWA 1NT2A 2QGZA 3MUOA 4IW3B 5EWLA 1V8BA 2BGKA 3PVCA 5FNVB 3NHUA 2XTNA 1NJFA 3L5KA 3AZOA 1J9ZA 1Z08A 4G8CA 4UHJA 5EUMA 5IABA 4MICA 1XPOA 3ZI0A 2XQKA 4MUEA 3HXLA 2IHTA 1U2RA 5DSTA 1DE0A 4YAOA 3FWKA 2ZI5A 1B7GO 1RADA 4GMKA 1U7PA 1DWOA 3L0OA 4YTEA 2BGWA 5IP5A 3KB1A 3L1VA 2RDMA 4I8XA 4TWJA 5ALOA 2F8LA 2PY6A 2JJ1A 4UU7A 5AI8A 3ZEIA 2CLMB 5KX5A 2VHUA 2WIKA 3DEJA 3FWHA 4BRWA 3DYVA 3AHFA 5K2OA 2W71A 4JK3A 3SYMA 4KO2S 4NFLA 2QL5A 1E64A 1MIHA 1DCTA 2H2GA 3MYYA 4QVKA 2C7OA 3HXPA 1UEIA 2XQVA 3TLXA 3FI9A 2WWVD 4M9XA 2J46A 1U0TA 4IQFA 4RNDB 4UMDA 2A33A 4YASA 1N5RA 3I5XA 1Z38A 2ZRCA 5EQTA 4UQPA 4MYSA 3K16A 3NDIA 4HPWA 3Q3JB 1M2HA 1T5HX 2WWFA 4XFJA 4LTDA 1TJ3A 3NTXA 4MPJA 4BWVA 4U0JA 2BFMA 2R6AA 4JBNA 4K9KA 4ZQEA 1IEXA 4AMBA 2I78A 2OYRA 2I1QA 1RLJA 3H2KA 4WHMA 2BRUA 3GJ8A 1ML4A 4BFYA 2JZCA 3PQCA 5EIFA 5FO1A 4AG6A 5C31A 2GAFA 4U0KA 2QP3A 4WH0A 1NVEA 3ZN2A 2Q45A 1FTYA 4OQNA 1V16A 2I0FA 1S8OA 2IUTA 2IU4A 3I04M 5EWJB 3ZKWA 1JSXA 4TZ0A 3OOEA 4TMVA 2FPXA 3OSUA 4CMAA 3D6UA 4ZAXA 4ER5A 2VS1A 3M0EA 3QKIA 2HJHA 3MJRA 4L73A 1K3TA 3KWMA 1YB5A 4JOCA 2EBFX 1K8ZB 2MYNA 3V1NA 4EO7A 5JE8A 2KJQA 4MVJI 1U8FO 4OMCA 1IB6A 2ATXA 1DT5A 3OLQA 6CHYA 3L79A 1K27A 1XPJA 5T5QA 1P4HA 1V96A 2Y1CA 4MV3A 3MBKA 5JNTA 1TA4A 1UZMA 2EHDA 2JIZD 1QOZA 3R5XA 4Q9KA 2FV8A 1ZLXA 4Q1EA 3S8YA 1IK4A 2R65A 5JAZA 1HTWA 5LQCA 1JWLA 3NR2A 1GNRA 2V7WA 1KR5A 3H1FA 3I2FA 3PHGA 4UBKA 2FQ1A 1A4RA 3L7AA 3VNSA 4A9AA 2AN3A 4EF6A 1RIFA 3SF8A 1LBSA 2GARA 2P1RA 1W4AA 1YRYE 2DPYA 4XWWA 2I6GA 4FBGA 4OQYA 3QA9A 1E79D 1RHUA 4YMIA 2OBNA 5BURA 3WRXA 3DOEA 1XHFA 1YZNA 1DTEA 4EK9A 3F3MA 4EVRA 1G6HA 2WJPA 4KBGA 4EB8A 4R0MA 3LA8A 5IUKC 2V8OA 1SUFA 1L7DA 5DP2A 2DJIA 1WABA 4YRLA 4PLTA 5EGSA 1RZRD 3HFGA 3R0JA 1WZIA 3RCBA 1R4MA 2B99A 3LQQA 5EJAA 4LBWA 5G0SA 4DLRA 4DBLC 4IIEA 1W34A 1IZ7A 1MTZA 2X0FA 1R18A 3WYBA 3OKPA 3T41A 1UK9A 4E3ZA 1Q19A 1Z8FA 2X2FA 3KHSA 3SOZA 2EARA 3AHEA 1J0EA 1F2TA 4KXQA 5EIBC 4G4SP 3WSVA 3ZC3A 4A0SA 4F92B 4AJ4A 1FW6A 4MR9B 3IT3A 5LFAA 1HDEA 4DM7A 1XJ0A 1G0OA 3OIDA 3MTAA 4TMXA 5CLIA 1GCGA 1VBMA 3V4RA 5HMLA 3AHCA 4BQPA 3LM8A 4AK9A 4MDYA 5CA1A 1DUVG 2ZR8A 1U81A 3H11A 3HPQA 2Y93A 3HRKA 4YRSA 1XOIA 2WVJA 3UHJA 4ARVA 2PWAA 5K8IA 2QUZA 3NVKI 3IKMB 1BMTA 1TAQA 4QU8A 1WMBA 2Z98A 5A3JA 5JOQA 1PEAA 4EY4A 1ZD8A 1LQ2A 1K6JA 2ZYDA 2XEDA 1NU6A 2JJ8A 4A0GA 3GFQA 2EIXA 5MFPA 5DYYA 1VKOA 5EE9A 1GNQA 1YR2A 2X5JO 3KSRA 2PSJA 1UFQA 2R2AA 4G36A 4OXKA 4ZD6A 3LT4A 5AD1A 3NLLA 4G86A 4NG5A 3I53A 3VZCA 3DUFB 1T0JB 2ANBA 3C5CA 4B81A 3CH4B 2WLTA 1WWKA 3UJDA 4WFQA 4PX9A 3ZWNA 2WD7A 4EWLA 1PGPA 1KJNA 1A88A 1AGPA 3WG9A 2ZUBA 2Q0QA 4NKRA 4D3FA 1I3KA 4AURA 3P2YA 2UYYA 2FG7C 2DTXA 2EZ9A 3PDJA 5HFNA 4NEQA 3RYHA 5HTOA 4UHHA 5AI5A 1Y9ZA 1QC5B 3N7UA 4G4GA 1K7CA 4P35A 5C34B 2R11A 1DKPA 4P84A 3R7DA 5AP9A 3RF6A 4CQMD 3IOBA 3P19A 4D57A 3DEZA 3SHWA 2JL1A 3SXJA 2Z43A 4HXEB 2AMJA 4ZC1A 4YAJA 1UBNA 4MWSA 4EHFA 5FL7A 4LSMA 1NA5A 5IZCC 3LE8A 5CK4A 3L7CA 4MYCA 5J5VA 3HVIA 2Q1UA 3UT5B 2OFOA 4E1VA 3ACBA 4YXFA 1FBNA 1LS1A 4AROA 3RTCA 1G3RA 5JVDF 2VH5R 3THWB 4I3FA 2D6FA 3H4IA 2ZRKA 1AQYA 1IRIA 3LCVB 1QJCA 5ITZA 3QF4B 4GEGA 4JJZA 3JR3A 4B76A 3Q9SA 3OIUA 3STVA 1WPXA 2MTBA 4Z1MA 2WF8A 3TKYA 4RHXA 4R2WA 1T91A 3I58A 1X1SA 4JBIA 1AK9A 4ZV9A 4CU2A 3AM1A 3OWHA 3D3QA 2XV1A 3QHQA 1V11A 1GILA 2QTVB 4ENUA 5IH7A 3EGWA 1IM5A 2REBA 2CE2X 3JZDA 3QOFA 1EFDN 2G6TA 1KERA 3WSTA 1HORA 2BHRA 3BRWD 3PFGA 1BWPA 4COKA 1J24A 4I19A 3NUZA 1DRJA 5EL0A 3QVSA 4L1KA 4YMGA 3TN7A 1I7QB 1Q0ZA 2MCFA 4TT3D 3FWPA 4YRNA 9LDBA 5KWEA 2ZS7A 1B0ZA 1QQ6A 2HNKA 3LUAA 5K0EA 3ZY3A 2EP5A 3CNNA 1I0IA 2FN9A 5SZKB 1Y34E 3OX4A 4MMYB 4YRJA 4BEVA 2VSNA 3LK7A 4MQEB 2O5RA 4R01A 1PJTA 3VHRA 1NF3A 1NVDA 3QENA 3EQ2A 3TLKA 1QGOA 1L7EA 4UU0A 2BN4A 1ZFNA 3GDWA 4O5AA 1L3BA 4C20A 1W93A 5IAOA 2WTEA 1FVOA 2I76A 1G8YA 1HNNA 5K09A 3DEKA 5KU1A 4I6EA 5JPCA 1CUBA 2EU8A 1OWLA 3OQIA 4YEDA 2QVXX 5A4MS 3HVKA 1SGWA 3TZ6A 2XZOA 1Z0FA 4MTLA 1WBBA 3O8OA 5HOEA 2QUHA 1EMDA 4N5LA 2FFQA 5LZ2A 1FK8A 1V4NA 4RJTA 2OFFA 3SXUA 2RBKA 4D9CA 1QHHB 2ID9A 3AIIA 4AKGA 1HLDA 2X5KO 4FDAA 3L04A 1Z22A 3PNQA 5EC8A 1GNVA 4KN6A 3F5DA 3FDZB 3QQ5A 3NPMA 2H0AA 4G0VA 3K35A 1LX7A 3MK31 4KQ6A 1M8PA 5KVAA 3BCUA 5IARA 2CSXA 2HBYA 1S6YA 2WJ3A 3AGPA 3CR7A 3U37A 3RVBA 2PVPA 3LY9A 4P86A 1TA0A 4LHZA 5K3AA 1AXGA 1ELOA 1OBCA 4HUQA 4WBNB 5TDHA 2JGAA 5CCDA 1U9ZA 5IYZA 1PG0A 2C00A 2C57A 4YWJA 3O2SB 2B8JA 3EA0A 4IDPA 4JLPA 3FMVA 2Q07A 5AM0A 2H9AA 3V9AA 1ZQ1A 2CLHB 5J2UF 5CHYA 5AXAA 2YXEA 5HKLA 2Q5JA 5ETJA 5I4KA 1RHJA 2XGMA 1O0BA 1IM2A 1UXIA 3DMDA 4IEIA 3DOOA 1N1MA 3CJTA 3PYLA 3L7MA 5DCUA 1YZUA 2PH5A 3AR6A 4CQLA 2AL7A 4UATA 5JRJA 2BDEA 3WGNA 4KI0A 4YMWA 1CK4A 1W6UA 3IPXA 2BVNA 2ZRMA 1ES9A 5HBRA 5KINB 5F73A 2A0KA 3CJQA 1ODTC 3PCTA 4JN6B 3L82B 4YB8A 5ABPA 1QRAA 1RJ9B 1QU2A 5C18A 4DUYB 1HDYA 1DBSA 1QIJA 1OLSB 2RHLA 2IS4A 3QELA 5EIHA 3ZE6A 2YWCA 1OX4A 4AU1A 5LB2A 2FMXA 4NMLA 4EP1A 5SYMA 2Q2QA 1PR0A 2LDBA 3L6BA 4YGYA 1OXTA 3ANSA 1NUQA 1GZ3A 1ZZGA 2C4MA 2SHKA 4F91B 1NXOA 4UDNA 3AJ9A 3PHLA 4YUXA 2YXPX 4K9RA 1XVIA 4LZWA 1YS9A 3AOGA 3SIWA 1EEHA 3I8OA 4K7JA 4D5GA 1KP9A 1J5EB 1E3DA 3QVGA 1H85A 3SBDA 5BW4A 3PQ7A 5IT4A 4DV2B 3N7TA 4FBMA 3SQWA 2BUCA 4J8PA 1DAOA 1NBMA 3KZNA 3BE6A 4HGQA 4IDBA 3A0UA 4U7DA 4LBZA 4NNJA 1QJ4A 1R6XA 1NY5A 4M1SA 5E6UA 4URHA 4UPVA 4KNYA 2LKCA 1ESMA 2Q3MA 2NAPA 1ZKDA 3QTBA 2XMBA 5G1PA 3UMBA 5JTTA 5J23A 3HCRA 2O8CB 4TKVA 2WR8A 1VLJA 2VJAA 3R75A 3PNLA 2FW6A 1JDPA 2BBSA 3G2QA 3F1KA 2JCVA 3Q3VA 4NV1A 4FSHA 2JA2A 2J07A 4KDRA 3VVMA 2PTGA 2GVNA 3A6LA 1OHHA 4A6PA 1ZY2A 3EVNA 3G9ZA 3K9QO 3QFHA 4Q37A 1VJGA 5B4TA 3V48A 1HE4A 2PS9A 2XE7A 3VDNB 2DFVA 4DJJA 5JD6A 1E2HA 5FOUA 1B1AA 1L4GA 3K9FC 2BFNA 4NZYA 3T12A 2MR5A 1Q21A 1T13A 2ZUVA 3IRUA 3RAEC 3SDSA 2P35A 1H1DA 1X3SA 2RHJA 2O8DB 1SCUB 3FZGA 3OC0A 3IAHA 1U28C 3TS1A 2P4UA 2X9QA 4LC0A 1RI5A 1M3SA 3V8VA 6LDHA 1H1LB 1VYTA 5B58C 4F3YA 4MVJM 1H4QA 3PWTA 4WOKA 4BVAA 4JHLA 1OASA 1H4SA 2JH8A 1R0RE 2PKCA 4LEIA 2GXUA 3STYA 5IU6A 1E3MA 2ZTUA 4CLOB 1RE0A 4PF1A 2YDYA 1ORDA 2QRLA 1JEOA 1ODLA 4TYQA 3RIHA 4A8JB 4PC3A 5CNIA 1GP2A 4RCZA 5CEFA 4MHSA 2AEFA 3KG2A 4YV7A 2AW3A 3ETEA 2IDKA 1R0XA 1XF1A 1QS0B 4B82A 5LMCA 4C88A 1F3LA 3WAKA 1M5RA 1WMEA 1IVSA 1W8IA 1CJTC 1LDGA 3K9GA 3G85A 3OFND 4C3ZA 1AKMA 2VHJA 3DM5A 5EJ7A 1TA9A 2WWRA 4LZJA 2VPYA 1BW9A 4JQOA 3UXYA 2JFXA 3ACDA 5AM2A 4PSCA 2BM1A 1EVZA 1DTWA 3OJ0A 3PENA 3I83A 1E7RA 1U7XA 1UBMS 1G98A 4GXQA 3RSOA 2ZAMA 3A1UA 1HDCA 4IJVA 3ODGA 2AOTB 3RYIB 4RZ3A 1IVNA 4IWYA 4M55A 3EARA 3LL4A 3ENNA 3NTUA 3QBTA 4ECAA 1QTRA 1S2MA 1GV1A 4IVPA 1X1DA 4IZ6A 1IQPA 4HEA6 4QLAA 1KC3A 2FW9A 4LXIA 2L69A 2X22A 4Q4DA 5COBA 3VC7A 1V3QE 1ZEJA 4NESA 1RC1A 2XUKA 5G1NA 3V1KA 1SQ0A 4BFSA 1XALA 2EFYA 3FOEC 1TQ2A 2ZYRA 1LW6E 5BV8A 1IL0A 2VKQA 4X71A 4FHGA 4ZDIA 2Z1MA 2V7GA 3T54A 4B6JA 5AVVA 3E6AA 4D46A 4M38A 4DSTA 5CTJA 4RWZA 3HU5A 4GOOD 4HDOB 4LC9A 4DNFA 1L5QA 4HLCA 4RGYA 2RHHA 1NN3A 3GVCA 4AG3A 4BTEA 4E5DA 2CN1A 2GKSA 2NU9B 1HDRA 2A7XA 2Q3DA 4DPLA 4EMSA 5KTTA 2JGEA 3INNA 4RZXA 3WQHA 4PYJA 5AQEA 3U4AA 2VEDA 1PFUA 5TGTA 2YS6A 3M6IA 1JEQB 2IYXA 1DQSA 1W5SA 1XKXA 2AC2A 3EEQA 4MIKA 2J48A 2JFNA 2PTHA 4GYYA 2M6LA 1MH1A 3LOUA 5DM2A 1N9KA 2DWPA 3W2EA 2CJWB 4Z53A 2IOFK 1S3IA 1ZI8A 3I9FA 3Q1LA 3RUCA 1ENPA 3D1VA 2ODBA 5A7GA 3KQYA 5CLQA 2LWIA 2WJWA 2XIJA 3DNMA 4HFRA 4KDCA 1K9SA 2PQ2A 3LQ4A 2AF3C 5L95A 1TMGE 3R6WA 2H3HA 3EIHA 3HN7A 1OFTA 4BRSA 3O4RA 3EN0A 1XDSA 5HX7A 5KYXB 3BMCB 5K0CA 1YBHA 1NUSA 4MR9A 3R3ZA 1M2EA 2YZ7A 2G5TA 1ZHOA 4MINA 4XGQA 4DM3A 1ODJA 4L6IA 1B8NA 2BFCB 3KOOA 1AV6A 5LXTB 1KFCB 1J06A 3WKDA 2F9LA 1BMFD 4ZT3A 4CTOA 4JL8A 3TQSA 1J8VA 2QDXA 2VJYA 1JKXA 4BJ6A 2QTBA 3P0FA 4FT2A 3ZK8A 1AHNA 1TCAA 2JK1A 5I47A 3WRWA 2BGIA 2AZTA 1EJ6A 1AS2A 4CDGA 1R16A 1XEWY 3T3HA 2WZBA 2BTQA 2WG2A 3SEQA 2OVBA 5A7FA 2JLUA 4GP6A 4R81A 3CURA 1IN4A 2CLIB 4CM6A 1J90A 5EIAA 3H13A 3U3DA 3W9UA 4QVIA 1DEXA 1GZDA 1E62A 1OF1A 4KYVA 5AW0A 1OUMA 2NXNA 4PVDA 1ZNQO 4ZO6A 1XPRA 2VPTA 2VF4X 1UEXC 4FCCA 3KSDO 3DUFA 3K1AB 2W6MA 4ID9A 5AUPB 1GPUA 7ABPA 1XPUA 1ZUNB 1EZ1A 4Q4JB 3OCUA 1B73A 4QDTA 2G4VA 4JT4A 4P3YA 1E4OA 5HE9A 5BN4B 2GTHA 1B23P 4JJAA 1EK1A 1HZZA 5F51A 2OC9A 5GOTA 2B5WA 3JVUA 3PP8A 1ZESA 3EXIB 4GR4A 4M1EA 3SVTA 2UVDA 4REQA 5K8TA 1VI2A 3WNCA 1D4AA 4CLXA 2C9ZA 2ZYWX 1JHXA 4F7DA 5JARA 1QC5A 4L0MA 4M8KA 2PR7A 1NKTA 3U4HA 4HWGA 3WB9A 5KKAA 4EPXA 4D4IA 1TZKA 3U13A 1FU7A 2WUEA 1QH9A 2G4LA 2O2IA 5BSMA 4DYDA 2ZQZA 3B1FA 1JH8A 3LLVA 2YXDA 2ZITA 4JDUA 4MCJA 2IOFA 3MXTA 4RUKA 1SKBA 2PXCA 5CVUA 2X8JB 1WUIS 1K8YB 4YP1A 5IC5A 4B80A 5CRIA 1P9NA 1DQZA 2I4TA 3CUKA 3GIWA 5CXQA 5F1OA 3THWA 4TYYA 1A9YA 2QN2A 4YJFB 2LRHA 4D9EA 1P80A 4XVUA 4B3GA 1FRFS 2D54A 2DECA 2VNJA 4EHNA 1I3NA 5DSXA 5TGDA 2EW8A 1GG9A 1NQWA 4RVUA 3TRDA 2F90A 5CM2Z 1NW7A 3EQZA 2ZB8A 4FYHA 3WNVA 4QYSA 4AN0A 1TTQB 1L4MA 2NVWA 2QMHA 2XMQA 4WGGA 2P3SA 2IPLA 3JQBC 4D45A 2QTVA 2X4DA 3N2EA 5B7NA 3R3HA 2X1LA 5CDYA 1Z0JA 3EVTA 2OORA 3GJ0A 1L4FA 1UL1X 2AX4A 1JV2B 5FUMA 4GEKA 5ESWA 3RHTA 1JU3A 1OPRA 1S01A 1AHIA 2DLDA 3KXDA 3WB0A 3GWGA 5A02A 5E4JA 1GPKA 1KZHA 1YCDA 1E2IA 1GUAA 2VNIA 3O73A 2HI0A 1ILWA 2PKQP 3VC3A 1H0HA 1ECLA 1YD7A 2OXRA 4GKBA 2YC4C 3Q1KA 1BHSA 1WBJB 4MQEA 4PHCA 3FYHA 3WX0A 3FTEA 2DWCA 2XWSA 4KW7A 4QU5A 2QTFA 1JHPA 3NAMA 1O6ZA 4CR6A 4L8GA 4I6GA 2J1LA 2YOGA 4Z8YA 3DWGA 3N6RA 1AGYA 2BM9A 1SXJB 2ZJBA 4IUCS 3BSFA 1U9CA 1HE1C 1SUPA 3UMGA 3MCVA 4UUOA 4ABYA 5M29A 1PEYA 2KHZA 2QX6A 2CXTA 4QXOA 4TT8A 1RWBA 3DBVO 3ZCVA 3KB6A 2Z95A 3QM1A 3CV3A 4YRAA 2H2DA 1T2FA 1TZ2A 1QHHA 2UXDB 2VTKA 3LDGA 3KR2A 4TN1A 3L8GA 4G5YA 1ZLYA 4UZEA 3SZGA 1GFSA 4HT3B 1ABEA 4Y9RA 1ILEA 3FDZA 1V7PC 2ODTX 3IQFA 3I1FA 1R9NA 3RG8A 1VKNA 4XSVA 4CF3A 3BZBA 5KNDH 4CTKA 4KUEA 2Q5LA 5CT4A 3O82A 1H4TA 2ORWA 4IDNA 4BNFA 1K63A 3DVSX 3LUGA 3NYRA 4KPFC 3DO8A 3MCWA 3D9QX 5CGZA 2AEMA 1J20A 5AI9A 3MF4A 5IBRA 3Q6IA 1SR8A 3VR4H 5BQXA 2VJMB 3DQQA 5JCPA 2BCEA 3IAS1 1QH8A 2C42A 3WO1A 2R0QC 3DLHA 4RHYA 5JMPA 2JFWA 4IKOA 2VR1A 4PTYA 4C6HA 4V1CI 1GU1A 2PQMA 1PL6A 2D1YA 2NV0A 4FJ1A 4CF4A 3AEUB 3AVXA 4RJIA 3CF6R 4WY8A 2V98A 1EFKA 2OM2A 2AB0A 3F2IA 4PZ0A 4XXHA 1XZNA 3ZE1B 1ZGGA 1N75A 4E2XA 3HUUA 4KIJA 5JAIA 4AIIA 5H4HA 4ETIA 1DDIA 2FK8A 2ZANA 4UBLA 5E1BA 1IZYA 3W1EA 1TCBA 2QSZA 3K2EA 4HWSA 1MO3A 1YBVA 3WMRA 2PZEA 5KQSA 4YACA 3EC1A 4O4IF 1FMTA 1I0ZA 1N9ZA 1RJ9A 2V6IA 3T8YA 5ALYA 1UFVA 2QG9A 1DJPA 1OLSA 1YCHA 5B2FA 5JS1A 3KX2A 2E21A 2H1CA 3R3WA 4L0QA 2GCGA 3JSAA 4IF4A 4QE3A 1U3TA 4UHFA 4UNNA 4W8HA 2O3SA 5HE8A 4M8NE 3DW1X 3PA8A 4XWTA 3UIEA 4CHTA 3PC8C 4MMZB 3RFVA 3W05A 3DF9A 3SC6A 4XW2A 4LJ8A 5I8PA 3FD8A 4M0DA 4X64B 2FWPA 2JAXA 3A1TA 5MDHA 4M53A 1QCCA 2OFXA 3OFSA 5E8JA 2Z4SA 4BO4A 2ZSFA 3GHYA 2QNIA 4G1EB 4CM4B 1LPPA 3FSGA 2XB2A 4EPYA 3FGZA 2CL5A 3UVEA 1LLUA 2HEGA 1J49A 3D5QA 2ZIXA 2K87A 3H9JA 3HUDA 3S5JA 4D9IA 5B2EA 3GDHA 5LKAA 5IANA 3U31A 1ZISA 1A7UA 4N7JA 3LHFA 1L1RA 4RDXA 2O8CA 1T4DA 4KFTA 1Y80A 4N65A 2GZ1A 4CMJA 3NHAA 4R9SA 4QWMA 1CEQA 1E6UA 1B16A 2GZRA 3QI2A 4BNIA 5KYTA 5LD2C 1F6DA 1NW9B 2H1LA 4ZWNA 4FFSA 4QTTB 3EVZA 2J3KA 2OL4A 4ENVA 2Y1WA 4RVDA 4Z7OB 1NBME 1NULA 2Y71A 4XIIA 3TMYA 5KOJB 2RH5A 3H8SA 4DLWA 1LDNA 1J5XA 3CWZA 4ZZIA 4J1TA 3QLTA 1NNLA 3SSOA 1EI9A 1PI3A 1S8NA 1VB5A 2NQ8A 4K6CA 2IEZA 1G8PA 4LQCA 1ZOOA 2C5HA 4UOEA 1FPQA 2GAAA 3L2OB 3LV8A 4ZO9A 1KOFA 2WHYA 3PXAA 2A3NA 1E2DA 3U1BA 3UMFA 2O8DA 1LPAB 3AF4A 2FYTA 5E9WA 4M9UA 4FC7A 1KZGB 1YJCA 3TRJA 2RGWA 3LWNA 3TZEA 2VATA 3ECAA 3NRBA 4HMQA 4P4GA 1H4VB 4DBVO 3UGJA 4BV9A 4E6EA 2Q2NA 2IYRA 3KQPA 4O3MA 4HOYA 2JCXA 3ESAA 4BBAA 5ALEA 4A2WA 1DAGA 1E9VA 2D59A 2H7CA 3B85A 3UO8B 3KZVA 4RDHA 4GM4A 5IJAA 3G7NA 1NVVQ 2Z6QA 4NC9A 2BUBA 1N6OA 4GBJA 4CLOA 5FYQA 2CMGA 1YCGA 3QITA 3WL8A 4JYZA 3ZW9A 4K3UA 2YINC 4NXNB 2VHQA 4A8JA 2J3LA 2OECA 1Z6QA 2W8BA 2X23A 3OE5A 4Q39A 4NQZA 4GC5A 4O2RA 1D04A 1DZ3A 1K2WA 3D6FA 3ICCA 5B12A 1QS0A 4NU8X 2FLKA 3FB1A 3H84A 4OHZA 3V55A 3WGYA 4ZREA 1SAYA 2NSJA 4C0SA 1RWPA 3UWDA 3DZ8A 3MN1A 1HM5A 4JITA 2J08A 4Q9LA 2QN9A 2XE4A 4NAUA 1RD4A 1ZJYA 3CZRA 3ZQUA 5BUSA 1TM7E 1RZVA 2Q9CA 1H9AA 2IUUA 4BMDA 1HYEA 5D87A 4ZMBA 5MN6A 3BCSA 3ADOA 2C4HA 3JAMA 2P2GA 1TJYA 3DULA 2EBHX 2VQDA 3FKSD 3L4BC 4KBFA 3VDXA 2G63A 4LK3A 3ZU4A 3NWJA 1X6VA 3LPCA 4MB0A 4X6XA 4A27A 5IC4A 1I3OA 2BZSA 3OP1A 4GG1A 4LF6B 4BNTA 2AOTA 5JAMA 5K3OA 5LLSA 1SFRA 2PRYA 3C7DB 4IJKA 4D44A 4QNRA 1FOEB 1YRBA 3SS9X 4AC9A 4AN1A 2G9UA 2R8YA 2COEA 1LPBB 3CYFA 1QFSA 2BF7A 3JASA 1P1RA 4HSEA 3SY8A 2G1PA 1TAUA 1XTTA 1F14A 1X7WA 3OLCX 1ZCZA 1QDLB 2QXUA 3BXEA 4CG0A 1VZ2A 2CXXA 3MJCA 4OGGA 2FSGA 1PT7A 4PAOA 4LZOA 4DV4B 2D1SA 4LXGA 3V1LA 5EXEA 1HDGO 1Z6PA 4HGPA 5JJIA 4JI2B 1HE8B 3JYLA 1N3BA 1FMCA 2GESA 1RTTA 1ISSA 3GMDA 4AMGA 8ABPA 2NU9A 4MUBA 5H8WA 3JR7A 2W0SA 4HEJA 4UD2A 5FHRA 5CDFA 2O2CA 3QE9Y 3LQRA 2ZDQA 1CZUA 3NWOA 4I4LA 1DBPA 3BZWA 3STWA 4YAFA 1J8QA 1G8FA 3SFZA 1NVWQ 3WDMA 4E11A 1DAIA 4M0CA 3QEJA 3AB7A 1ARZA 1NSFA 4MQUA 3LDHA 5FUXA 2HM7A 4D3SA 3OEEA 3OEWA 1TDJA 1GM5A 2NVOA 3S81A 3SM3A 4O0MA 2YX1A 3RJ9A 1UZNA 5B6JA 2DR2A 3FCEA 2CJWA 4AWAA 2XVMA 2WJ4A 1WVGA 2NU6B 1VRCA 4X8LA 1OGIA 1RQXA 1WA5A 1KIFA 1UXHA 1VSVA 2XKBA 2ZWMA 3OE4A 3QLJA 4QUHA 3H6KA 2CVOA 3WAJA 3C3JA 4TWIA 4BUCA 1NG9A 2BEUB 1ZNWA 4LGYA 3WNDA 5KNCA 1LRLA 2QTHA 3C3EA 1FYFA 1U7DA 5DBEX 4DKJA 4TSFA 1SQGA 1KAQA 2Q2WA 1ULSA 4PO3X 5KYXA 3BMCA 5ALVA 4OBWA 4BCDA 1ISJA 1E1QA 1GZSA 3FIUA 1BU8A 1TK3A 4R3UC 4JUAA 1SCNE 3TLEA 2XQGA 2I7VA 1Y3IA 2BFCA 2PT9A 3AKDA 3ICOA 2DR3A 2Y05A 5HF8A 4BGDA 4KE6A 5AVRA 1QVRA 5EUCA 2KBFA 1FRZA 2WAMA 1L5VA 4CHGA 4Z1MD 5I45A 2C9CA 1AU9A 1EK0A 4FP9A 2OGZA 1KJIA 4H4EA 1H2YA 4G65A 4II7A 1TECE 4Q5IA 2IIBA 3WLTA 1XL1A 2CLCX 3KZMA 3JYQA 3R8XA 3EZYA 2GWRA 3N0TA 4Y2PA 3B13B 3HBAA 3R9IA 3MOGA 1WKCA 4BNNA 4RTKA 1CIPA 4RVFA 2QTWB 1KZ1A 3W2IA 3PDIB 4EHKA 4HRVA 1NZDA 1AKNA 4JXZA 2EC5A 4CQNA 4F0JA 4XOUA 3FOZA 4G0MA 4HDSA 4HQRA 1RJFA 3TBKA 2A14A 2NPOA 1E9FA 1BHO1 13PKA 2ZUSA 3K1AA 1G4AE 3ZYCA 5JZOA 1SA0B 4TL6A 1ZUNA 3UG6A 3OHPA 1I3MA 4NECA 1MAAA 3C6BA 2DG2A 3DCIA 3QFTA 4Q4JA 4H1WA 5LQNA 2WF9A 4N8DA 1NJ6A 5DNEA 3ME5A 2VWGA 5BN4A 2C1EA 4O2LA 4HGOA 2ZIGA 1ORTA 3QIAA 3TW8B 3EXIA 2HHHB 2O0JA 3AM4A 2PXAA 3MILA 1RQGA 3CH6A 4AX4A 2C2XA 5TQVA 2NQ2C 2R1ZA 3A8TA 4BVJA 3FGNA 3LXUX 3ZIDA 5KUTA 3SYRA 5B57C 2F1HA 2JLRA 4RD0A 4HV4A 5K0SA 1BCSB 4RACA 5CT9A 1FVFA 3NHWA 3OZGA 1QVZA 2A86A 3I4CA 3NTQA 3O26A 4NH0A 3RVMA 4BO1A 4DMCA 4AKHA 1GLGA 1V4BA 3HGMA 4ID3A 1ZC4A 1FP2A 2FEAA 4MW4A 4LXYA 4G5FA 4CM8B 4IG4A 2NTVA 2C59A 1PJQA 3MWFA 3U3ZA 2H54A 1V8FA 4WVLA 4YJFA 3VISA 1LNQA 2IP1A 3PR3A 2YV4A 4ND4A 1WM1A 4LXQA 3UF0A 4PC1A 3VPHA 2QPTA 1H6DA 2XMSA 2GPJA 2FSPA 2R60A 3OJXA 3DC7A 1CQWA 2J4DA 4J0HA 1XTPA 5CG2A 2PQ0A 3JRWA 1PK7A 4HAOA 1L5HA 3RC3A 4CIWA 2ROQA 4LZAA 1EVQA 3GFOA 4WQMA 2I66A 1QLWA 1XAGA 2IYUA 3MJSA 4EVIA 3A70A 2O9JA 1IHXA 3MC1A 4B3FX 1U1CA 2X0EA 1WQ1R 4EY7A 4AMYA 5CTAA 1Q84A 4HAXA 3NAQA 3HM9A 3MINB 4L85A 3T34A 4QOIA 1THMA 1GIAA 1CPYA 1TM3E 4MW5A 3LYLA 2YOFA 3P9PA 5BN3A 3GRRA 5DHSA 3FJYA 1U8EA 1KO1A 2CMDA 1UPUA 3ABZA 3HA5A 5DHTA 3EC7A 3QPAA 1AB6A 4B6FA 1ZGZA 1RXCA 3MMXA 1NFRA 1UBUS 2M6SA 3TZCA 4MCIA 4RYDA 3TSAA 3CO5A 4EMTA 4OFZA 3DZGA 4OKSA 1O6GA 1TAHA 4AJ2A 4OVKA 5AKKA 3INTA 1N2EA 1NLYA 1SXJA 2RKBA 3I04A 1E1NA 1XFAA 4K26A 4LV6A 4QXMA 3AU9A 2LCFA 1KXZA 1TIBA 1GQYA 2VYNA 3ETCA 3R09A 3WGUA 5L45A 3U9SA 5IK2A 1OT3A 3F7OA 4YXWA 3R3SA 1W5EA 1D6MA 3AR4A 1Z2EA 3E9ZA 3BIWA 2ZWAA 4IM7A 4PYQA 4QTXA 4ZJUA 3R0IA 1X13A 3IO3A 1KO8A 4KJZA 4QLOA 2CF6A 5F35A 1H2AS 2QVYX 1KY2A 4GT1A 1HQCA 1E7SA 3QFCA 3SD7A 2OBLA 2FW1A 3HVUA 3FJOA 1NXWA 3MLAA 1P6QA 2W22A 2K4MA 3PUJA 4PLWA 5F7ZA 2DPHA 1DQNA 3L4KA 1GTVA 2YY6A 3C97A 1RI1A 2RHRA 3FGPA 3MJHA 1RMQA 2P2ZA 2QF7A 2JDID 1GQQA 1L7OA 1YFKA 3BGOS 1QV6A 3DTTA 3WWEA 4D4KA 4TV8F 2N47A 3KS9A 5E1DA 4EGJA 4TUYF 1I33A 2IEBA 4JFRA 1EJ2A 3BS4A 3VYSB 2CUZA 4YBRA 2BBOA 4M9RA 1QHEA 1H8EA 2R96A 1BYIA 4I66A 4XWAA 2AHRA 3HVHA 3SI7A 5JANA 4OU5A 1RW4A 2K7FA 1GRNA 1OH7A 2XITA 2NVBA 2B92A 1L7AA 4XIYA 3AW9A 4UVEA 2R44A 3AP2A 3AIKA 4IMRA 3GLFB 1S2IA 3G9QA 4OXNA 3AUSA 2R8RA 3FYSA 5FQOA 3EVBA 5EUQB 3TE6A 3VR5A 4BLQA 2BGMA 4E5VA 4F3NA 3LO5A 4WACA 5J4LA 3VAZA 3T1YB 3P0RA 3IIIA 1G6KA 4BNZA 3IKJA 4O1HA 1YZKA 2EQAA 2L2QA 3OZ7A 4C14A 1YAJA 1JQEA 2CXPA 2N46A 3T3NA 4WZ6A 3P26A 5H16A 5FRDA 2CXOA 3GR6A 3RUEA 4A8PA 4AZTA 3RODA 3TZKA 3I1JA 4OB6A 4QBHA 3UTDA 3FZEA 1CUFA 3KEMA 1FYDA 1RXUA 3L8EA 4S1WA 2ZGVA 5H81A 5A71A 4NP6A 2HLHA 3UAOA 4BB5A 5HA5A 3KT6A 2IPMA 3UV3A 1KOLA 1ZOPA 3S3TA 3VR6A 4DRXA 1ZJWA 1K0UA 3E0QA 1II9A 4DWJA 1FB5A 1T5BA 1VFNA 1ONNA 2EG5A 4CM4A 5IKPA 1BCRB 3VPXA 1T5LA 2WAXA 1FFCA 1RXYA 2ZIEA 3LDAA 4PEVA 2Q3HA 2X3YA 3VR3D 4QBIA 5C4IA 1Q12A 1Z8DA 1C7QA 2VZ0A 4HC4A 4JP2A 1SPBS 2ZJZA 4TS9A 3UAVA 2BI7A 4KAFA 1W4CA 4KGZA 4B73A 1QH0A 4ZOEA 3ZWDA 2H1RA 1HL3A 2BELA 3N5CA 1EXMA 3ACCA 3GJXC 4XGNA 2HIHA 2P75A 2H57A 5ALRA 3JQQA 3ZIAA 2QIPA 5JZSA 2YJ6A 4QJIA 4YJDA 5T8KA 5M7EA 2GK7A 3TB4A 1L4HA 1NI5A 1QG6A 3BAFA 3FPHA 4ACAA 1K6EA 2NPIA 1A50B 3G68A 4I5IA 3OC6A 4NU6A 2YZMA 3F8WA 4KQFA 2OPHA 3ZCXA 4EELA 5KOJA 5K3FB 1JJVA 3O8CA 2E82A 3JAWB 5HJ5A 1V71A 4KYIB 1WHSA 2GTPA 5FTNA 2NP6A 3SDBA 1LGYA 2BMVA 2VH1A 3IE2A 3RAJA 3RI3A 3KOYA 3U3MA 2QRZA 4KXNA 1U3WA 2VXBA 2O2YA 3MT7A 4KWTA 1F9EA 4PZ9A 4R83A 1GPYA 2PYZA 3B6KA 3QF7A 1JLLB 1SEVA 2P5SA 3GLKA 4ZCTA 4IQ0A 3GCGA 4WUTA 3T38A 3MT0A 3RS3A 3HXOA 4US0R 1SC6A 2XCTB 3RTAA 3I3SR 1T4GA 2WG0A 2IX9A 4I55B 1FU8A 4FS3A 4L9WA 4FN4A 5ALNA 1X3LA 2QM8A 3KPWA 3IQIX 5DSZA 1UBJS 2WJGA 5K6RA 3GUUA 1JPVA 3X2SA 2EP8A 1M34B 3K7EA 1IJEA 1E9CA 3QXGA 1IQUA 2GDZA 1JLRA 1F51E 3HMQA 4PPQA 4CNQA 5FWXB 2W6JD 4ZDKA 2Z1NA 2B8WA 3LYHA 4XKJA 5F7JA 2W6NA 3QU9A 2FW0A 1SPXA 1XAJA 1BOOA 3QX7A 4BLRA 1C0EA 1UJ5A 5EE1A 3KJHA 4KRXA 1Z56C 3SIRA 5JRZA 1GL3A 1NI4A 2ZRHA 1CZKA 2F1KA 5EHNA 1G55A 1HA3A 5H1YA 2AGVA 4POOA 5A9TA 2ZXUA 1U2GA 4TV8B 1OFIA 5FP0A 2XNHA 4RADA 1QPBA 2GPAA 3NEYA 5TY0A 1SZCA 3T99A 1Q92A 2B83A 5FL7D 3TXAA 1LKZA 1UKVY 4NYMR 4O4HF 3G9XA 1LBQA 3PHIA 3N76A 3NTOA 4I0WB 4LRUA 3TM5A 3EIWA 4LE2A 4NF2A 3VV3A 1T9GR 5BMOA 1FSGA 2M6RA 2A9KA 4JVNA 4DM4A 1JAZA 1K8QA 1X39A 2VP4A 4EKGA 2SKCA 5AIBA 2UYHA 4X20A 2B94A 3QW4B 2GTIA 1EFLA 4ZYYA 3WFJA 2WV7A 4JJIA 4EHAA 4MKIA 1SVNA 1QK3A 2XSZD 4H0CA 4ZQHA 4RM2A 5E4YA 1QIGA 4HB3A 1PNQA 3LYUA 4UBIA 4EHHA 2VTVA 4IVQA 4H60A 3TCKA 1FFYA 1KDVA 3LXRA 3JARB 4ZOLB 2DERA 5EIBD 1GTRA 1GJRA 4FIZA 1Y4AE 4YCCA 1WB6A 3O74A 1U2SA 3EUFA 3IT2A 1BDBA 1N57A 1PYGA 2BFBB 2JFFA 3GP3A 3PLNA 3PQ3A 3QPWA 4J43A 4NATA 2Q9BA 9GPBA 5IG2A 1XU4A 3NXKA 1MP0A 3T4PA 4H7KA 2CBXA 4TTVA 1UOEA 2C92A 3V8MA 4BASA 2ZVPX 4L9AA 1N0HA 3T9FA 1A3CA 3E3NA 1T9KA 4BFXA 2ACWA 3PEEA 4CM1A 1LUAA 3V34A 2VVTA 1W46A 2QZ4A 2BJVA 3T3IA 2L82A 3E22B 5DIZA 1Q1BA 3QMVA 1BSVA 4RQAA 4TYWA 2D1RA 2F62A 2UZAA 3LCMA 5TEWA 5DB4A 5CG1A 5CDFE 2BTEA 1QHGA 2XZTA 3L43A 4F46A 3NONA 3KQHA 3P2EA 4QWWA 4ARAA 3UJNA 2FLWA 2VJLA 4RD4A 4YMHA 4NNPA 4JA0A 1C8VB 3X44A 4MWGA 1XHLA 1H1TA 3KHKA 4TXHA 3PFCA 2FJUA 4GBGA 5DWVA 2D0PB 4E13A 2ZSUA 1A27A 3PJFA 5DEIA 5JSZB 1XZGA 3U4MA 2ZIAA 3DOJA 2HSGA 4H16A 1UPBA 3FFXA 2XE6A 3E3OA 3H2HA 4IXWA 1Z2PX 1ZH8A 3EUWA 4OYLA 4LHYA 4UHKA 2BSAA 1D2RA 1D2MA 2WD9A 5DOZA 2IXAA 2LGJA 4JC0A 4CKXA 3WGOA 1L7XA 4KO1S 2GZ2A 1O8CA 5DN6D 5EJ4A 1EAMA 4BNHA 1SELA 4WINA 5AVKA 1GZ5A 1LRJA 4OOEA 2J3HA 1X94A 2V6MA 3M5CA 3I52A 3W9BA 4ZYUA 5IXSA 1T2DA 4RA6B 3CCBA 5CX1B 5ALPA 1K66A 4AZ0B 1IPEA 1KDTA 2IGBA 4ZKEA 2V3CC 4ARZB 1YQDA 1RYEA 2FLVA 3QPDA 4XR9A 4BPBA 2IW3A 2O3TA 2IWRA 4D99A 3DW3X 3U3RA 1YL7A 2JD1A 1J2RA 2VHWA 3DEHA 3NIDB 1X0VA 2I3GA 4WCDA 3WGQA 2Q4DA 5TPWA 1IUOA 6REQB 1SA0A 4ERNA 2PD3A 2E6UX 2XBMA 2OY0A 2Q6TA 2VN8A 5T4BA 3PXGA 2VG8A 2AG5A 3MD0A 1U0EA 1IXYA 1I2BA 3PEYA 1WG8A 4KR6A 4HNVA 2WW8A 3M4JA 2JCBA 1T36B 4RH3A 4EKDA 3JD1A 4B3DA 1EFHA 2CBGA 3EZXA 4KMRA 5K01A 1Y7LA 2YZGA 2ZSKA 3TW8A 1EQAA 1AZWA 1XMJA 3CKYA 4HXGA 4XWOA 2MSLA 2WUWE 1WW8A 2P11A 1JMVA 1QH1A 2ODPA 1ACJA 5H80A 1JXQA 2AR7A 2D74A 2FGJA 3FRIA 4QUGA 4CT0A 2VF8A 3H3FA 2XCSB 4LJ9A 3H4TA 3S7ZA 1BCSA 1GZ6A 1N2ZA 5JSKA 2I7CA 3JW8A 4W5TA 3KYCB 4EW1A 1A9RA 2FMHA 4J4TA 4OIFA 1MQAA 1QMPA 1RQ2A 2V74B 1W36B 4CL8A 1VQ1A 3D8RA 1GUDA 4B85A 5T7BA 2HCRA 2WMDA 3ZI7A 2GPBA 2ZVDA 3GARA 1M6WA 2WF7A 2ON6A 3JZAA 5EHGA 3ADPA 4MVJA 3ANYB 2D4AA 4DG8A 5KYWB 3D7LA 3L8ZA 3BE4A 2QAGC 2IJGX 3WL6A 1P72A 1WCWA 2L18A 1LK7A 1I2DA 1TQ6A 4IUDS 2XZLA 1OHHD 2H6EA 4WKOA 5BVHA 1XZPA 4H3HB 4KP7A 3KV3O 3AR5A 4FXOA 4DQKA 1L5KA 2G80A 1GVHA 3MINA 5CBKA 4J75A 4B8WA 1DJNA 4PAMA 3RSLA 3WRYC 4DA8A 4F2GA 1OW3B 1QP4A 4PRKA 4TTIA 1A5BB 5AVXA 1GQFA 1YDMA 2MDTA 2GBCA 4CTJA 4EJ6A 1E2UA 2WWHA 3L7NA 2PM8A 1ESZA 4FZVA 4U5XA 2OD7A 1DEHA 2V7UA 3GYBA 2QK4A 1G6Q1 1NR5A 4H18A 4O2AF 4W9RA 4YRPA 2PGDA 3GCXA 1UINA 2P9ZA 4IQ8A 3KVVA 1UM9B 3AT1A 3BD7A 1Y7TA 3A32A 3OX2A 3RVDA 5KO2A 1EDOA 4NZPA 1Z47A 1QF9A 4GXTA 3PQEA 4FHFA 2ZTVA 4L2IB 1TMOA 2OILA 4FOOA 521PA 1R6VA 3NHRA 1WCIA 1HETA 3RUAA 4BP9A 1DC8A 2WAAA 1QHXA 3ND5A 3PFHA 4UDYX 2P90A 4KE8A 2V7QA 1YRQA 1HDOA 2XW6A 4RHFA 5F98A 1V9SA 3U3XA 5C8YB 2RFLA 3U5TA 2WILA 4BLSA 3ZLUA 5AVWA 1JX6A 2AI2A 3W9YA 2P9EA 4YAIA 1E32A 4EAAA 1U9IC 1UBFA 5CFRA 1X7ZB 2QAIA 3GVIA 1P81A 1SXJE 1ICEA 2NVUB 5KQRA 3BPSA 5FLEX 2HDOA 1B2LA 4DNQA 5LNK6 4YT5A 4AVYA 1JG1A 4S12A 1G63A 2W2LD 1H69A 4FCTA 2B2XA 3CT6A 5AHRA 3LRXA 1NNEA 1T9DA 3KKPA 5FPSA 1JYSA 1NUHA 3D31A 3EXG1 3R3XA 3W5IA 1LVGA 2I8LA 5G41A 3MA0A 2YIVX 4IILA 1ZAYA 1HDZA 4EI8A 5JWRA 1KJQA 2LV8A 4Q9JA 4FDVA 4R8RA 4BZXA 2RHWA 1KEEB 4DWWA 1OC4A 4PNZA 3LL7A 1WETA 3SYKA 2IFTA 1LQUA 2E4YA 3PX3A 3TIFA 3DAFA 2Y0EA 4AP9A 3B3AA 2Q62A 1BEEA 1P1FA 2WFLB 4UJ5A 4DCMA 2IS1A 1JMKC 4HATA 5FNZA 3T3EA 4BMZA 3HJFA 1AGNA 3I62A 1NJ2A 4TKZA 4DF3A 4EL0A 2FN4A 3LAWA 1PLLA 2A0FA 4O8ZA 3DSRA 3LPAA 4H4DA 3GAAA 3QUBA 3T5CA 1GGMA 3LWDA 2YV2A 1TD1A 2P7HA 2OUKA 4TLMB 4R68A 1JSLA 4TWAA 3IBSA 4JLNA 5F1YA 3GX1A 4CG2A 2FX3A 1W47A 3JAKA 4AZVA 3QVUA 3QVLA 3QFFA 2CYCA 1UKCA 3M6AA 4JLDA 3T5MA 4CI0B 2ZI3A 1KFKB 1RPJA 2M1XA 3B1XA 1MX3A 3IKLA 3O1IC 4ZT7A 3L6EA 4EIWA 4MITA 3TH5A 3LWBA 5C51B 4WLFA 3M89A 3R9XB 3BXGA 1LSSA 4B3HA 3FF1A 4AJ1A 4JXKA 1OWNA 1UJ4A 3VTKA 4BO3A 2HJSA 3MIZA 4JVOA 2A35A 3P9SA 2HYDA 5EKXA 1HSZA 4F6RB 3VHLB 1WMFA 4IHKA 4PZZA 4P34A 5IJ9B 2HO5A 4UE3S 1QVWA 4W1PA 1YTLA 4GKAA 5FORA 1XKTA 3N07A 3UUFA 3LT1A 3RVKA 3CG4A 4LZLA 4M7PA 4BX9A 4YRIA 2VDWB 4EB6B 1V39A 3Q3HA 4E1AA 3HCAA 5JO0A 4JBWA 2RGAA 2NQTA 3WMGA 3VYVA 3PPIA 4WIAA 1P62B 1E2LA 3PVSA 4JJ8A 4RANA 2F43B 2I6QA 1A5SB 2IL1A 4YRBA 5CB6A 1WR8A 1JS1X 3FMIA 4W9NC 1U0OC 1F2DA 4XAQA 1O87A 1ZX1A 2R8ZA 1BN7A 3NGLA 4BMVA 4DIMA 3K0EA 3GJQA 3PKJA 3VPFA 2F17A 3ICWA 2FRXA 2OV8A 3S2EA 1XG5A 3R5HA 4IP0A 2QL9A 3WC4A 2EYUA 3OQHA 4TRMA 4BBPA 1N2JA 3PHJA 5M3BA 4BP1A 1XD8A 1XJCA 2A0XA 3DR3A 3JAWA 2Q0XA 3D0OA 4JLAA 1X1AA 2PL9A 4NCAA 2NUBA 5JATA 2BONA 2WF5A 3T0FA 2ZM6B 1PZXA 3ZDEA 5FUYA 2FTKE 1CE8B 4FZ5A 4LHWA 4J4HA 4Q0MA 1HTTA 3NAZA 1BDHA 2I99A 4KHPB 4HTAA 1YK0A 1JLLA 3RABA 3KJIA 1RKXA 3IVXA 4PFJA 3NEPX 2X1HA 4C5CA 3T5PA 2DLCX 3NHZA 5BRNA 2IKQA 2RGYA 1MOSA 3CIOA 3NWBA 4I55A 1KK2A 4UXJA 2PGIA 1FYEA 1R64A 1S8AA 3ED5A 4H7EA 4LPKA 1EQ2A 1M34A 2C96A 2NTJA 2C07A 4EA7A 4QDJA 4PHHA 3W5UA 1EGQA 4R1MA 3CC8A 1V4VA