4M16A

Crystal structure of the n-terminal fic domain of bartonella effector protein (bep); substrate of virb t4ss (virb-translocated bep effector protein) from bartonella sp. ar 15-3
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
AHHHHHHMVLNYFYPGTKTLKNKLGIMGYKQLEKRCKRNAKKVINSLRNEPLPETFDSSYLKYLHKRLFGSAFEWAGYTRDLSFAFDDGTIAQMSMMKIPGTDIYFAHGDKIQENLKEFDEILASKSNLQGLSREDFIEETVKLFSFLNYIHPFRAGNEAVQHIFFEKLAEAAGHKLDFSVVTEERIMRACNDAMALKGEEAHQAMKSLFEDISNPEEVIILRDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal Fic Domain of Bartonella effector protein (Bep); substrate of VirB T4SS (VirB-translocated Bep effector protein) from Bartonella sp. AR 15-3
rcsb
source organism Bartonella sp. ar 15-3
molecule tags Cell adhesion
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 82
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4m16A00
4U0UA 5JFZA 4WGJA 5JJ6A 4PY3A 3LETA 5JFFA 4U07A 3ZC7A 2F6SA 2VZAA 4XI8A 3ZCBA 4X2EA 4U0SA 5CGLA 4ITRA 4N67A 3SE5A 4U04A 4LU4A 5EU0A 3CUCA 2G03A 5CMTA 3N3UA 5JJ7A 4M16A 5CKLA 4X2CA 4X2DA 3SHGA 4NPSA 2VY3A 3ZLMA 4U0ZA 2JK8A 3S6AA 3SN9A
chains in the Genus database with same CATH superfamily
4U0UA 5JFZA 4WGJA 5JJ6A 4PY3A 3LETA 5JFFA 4U07A 3ZC7A 2NUNA 2F6SA 2VZAA 4XI8A 3ZCBA 4X2EA 4U0SA 5CGLA 4ITRA 4N67A 3SE5A 4U04A 4LU4A 5EU0A 1NH1A 3CUCA 2G03A 2NUDA 5CMTA 3N3UA 5JJ7A 4M16A 5CKLA 4X2CA 4X2DA 3SHGA 4NPSA 2VY3A 3ZLMA 4U0ZA 2JK8A 3S6AA 3SN9A
chains in the Genus database with same CATH topology
4U0UA 5JFZA 4WGJA 5JJ6A 4PY3A 3LETA 5JFFA 4U07A 3ZC7A 2F6SA 2VZAA 4XI8A 3ZCBA 4X2EA 4U0SA 5CGLA 4ITRA 4N67A 3SE5A 4U04A 4LU4A 5EU0A 3CUCA 2G03A 5CMTA 3N3UA 5JJ7A 4M16A 5CKLA 4X2CA 4X2DA 3SHGA 4NPSA 2VY3A 3ZLMA 4U0ZA 2JK8A 3S6AA 3SN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0U A;  5JFZ A;  4WGJ A;  5JJ6 A;  4PY3 A;  3LET A;  5JFF A;  4U07 A;  3ZC7 A;  2F6S A;  2VZA A;  4XI8 A;  3ZCB A;  4X2E A;  4U0S A;  5CGL A;  4ITR A;  4N67 A;  3SE5 A;  4U04 A;  4LU4 A;  5EU0 A;  3CUC A;  2G03 A;  5CMT A;  3N3U A;  5JJ7 A;  4M16 A;  5CKL A;  4X2C A;  4X2D A;  3SHG A;  4NPS A;  2VY3 A;  3ZLM A;  4U0Z A;  2JK8 A;  3S6A A;  3SN9 A; 
#chains in the Genus database with same CATH topology
 4U0U A;  5JFZ A;  4WGJ A;  5JJ6 A;  4PY3 A;  3LET A;  5JFF A;  4U07 A;  3ZC7 A;  2NUN A;  2F6S A;  2VZA A;  4XI8 A;  3ZCB A;  4X2E A;  4U0S A;  5CGL A;  4ITR A;  4N67 A;  3SE5 A;  4U04 A;  4LU4 A;  5EU0 A;  1NH1 A;  3CUC A;  2G03 A;  2NUD A;  5CMT A;  3N3U A;  5JJ7 A;  4M16 A;  5CKL A;  4X2C A;  4X2D A;  3SHG A;  4NPS A;  2VY3 A;  3ZLM A;  4U0Z A;  2JK8 A;  3S6A A;  3SN9 A; 
#chains in the Genus database with same CATH homology
 4U0U A;  5JFZ A;  4WGJ A;  5JJ6 A;  4PY3 A;  3LET A;  5JFF A;  4U07 A;  3ZC7 A;  2F6S A;  2VZA A;  4XI8 A;  3ZCB A;  4X2E A;  4U0S A;  5CGL A;  4ITR A;  4N67 A;  3SE5 A;  4U04 A;  4LU4 A;  5EU0 A;  3CUC A;  2G03 A;  5CMT A;  3N3U A;  5JJ7 A;  4M16 A;  5CKL A;  4X2C A;  4X2D A;  3SHG A;  4NPS A;  2VY3 A;  3ZLM A;  4U0Z A;  2JK8 A;  3S6A A;  3SN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...