4M1BA

Structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
b'KVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVERIIKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKATLKIAESLGYTVVHWSNNSNDWKNPGVNKIVSTVSNNLKGGDIVLLHASDSALQTNKALPLLLQKLKSDGYEQISVSQLISNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polysaccharide deacetylase
publication title Structure determination of BA0150, a putative polysaccharide deacetylase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4m1bA00
2E67A 2NLYA 3CL7A 4F9JA 3HFTA 1XW8A 2C71A 2Y8UA 3WX7A 4HD5A 4NZ3A 4LY4A 4WCJA 2VYOA 2C79A 4NZ5A 1W1A1 2I5IA 3QBUA 5JMUA 1W17A 4NZ1A 3CL6A 2CC0A 4F9DA 2IW0A 4U10A 5BU6A 4NYUA 4V33A 4NZ4A 2C1IA 3S6OA 2C1GA 2QV5A 2XU2A 2W3ZA 4M1BA 1V6TA 3VUSA 4NYYA 4NY2A 2J13A 2DFAA 1W1B1 1Z7AA 1NY1A 3CL8A 3RXZA 4L1GA 4OUIA
chains in the Genus database with same CATH superfamily
2GGGA 3CU2A 2WYSA 2BY0A 4CVWA 3KHDA 4BI6A 5IOBA 2ABBA 3A5VA 4OUEA 4IXXA 4JNMA 4N7QA 4K3ZA 3KOFA 5BRBA 3BWWA 3LCWA 4Y9AA 3OZPA 1H7PA 4MJZA 1LLWA 3CAQA 4HP5A 3QY6A 3CWNA 2XZ7A 3UG3A 3NQ6A 3A47A 3T08A 1Y5WA 3OA5A 2VFHA 1JCXA 3SDOA 3G1HA 4FAMA 4R9OA 3SGGA 4AHQA 1YDYA 3WIJA 1FWCC 4AB4A 2FTYA 3OU8A 3GHRA 4PCTA 2AQWA 3LMYA 2OGYA 2DZUA 4KS0A 4GQ0A 4MYAA 3O7UA 9XIMA 3ATYA 4D6EA 1F61A 3MP3A 4JHOA 4HN8A 3AJXA 6TIMA 3HGOA 4UFKA 4HGXA 4KIRA 1JG9A 3IVTA 2PU0A 3A22A 2VC7A 4GINA 5LNUA 3RG6A 1UIOA 3LTSA 2FH6A 1JQVA 3PTDA 5J5DA 2Z1BA 3IJLA 1PKYA 1S2TA 3T78A 2ISWA 1EJVC 3M7SA 4PUKA 1QI5A 4DBUA 3NO5A 5FF0A 4OQVA 4H8VA 3HOJA 4AIEA 4GOAA 2YBTA 3TOYA 3LOTA 3ZWSA 1NDYA 4ZO6A 3DFSA 1K8YA 1VYPX 3QRHA 1E4LA 3V4BA 4D72A 2HPMA 4GYJA 5I5RA 4TVUA 1UMYA 3B04A 5J04A 2C6QA 4X9SA 4AD1A 4ZB2A 2PD9A 4S3GA 1NVMA 2NV2A 4QS6A 3FYOA 3E0LA 4HIBA 3RCYA 2CETA 1JEZA 1ZCOA 2E67A 3L23A 5DEZA 3PPFA 4AZ5A 1VBJA 3TQKA 3LRMA 3G3MA 1VRDA 3GRIA 2D0HA 3GVVA 2GUYA 2OGJA 2VI0A 4GYKA 3SCQA 1DIDA 1DTNA 1FP8A 2QV5A 3A12A 1W5NA 3W22A 3F2DA 2VEGA 4C6IA 1XSIA 1H1NA 3AFBA 5H8MA 1GVSA 2ZBTA 1CDGA 4FLQA 2V2CA 3WLOA 1XD0A 1EZWA 2PB1A 4BF5A 4DO4A 1JDFA 4Q4MA 3T44A 3BGAA 3M0XA 2QJNA 1EDGA 1U1JA 3A9IA 1TPVA 3LEPA 4C5ZA 3S83A 4F0RA 1XYBA 2XVLA 2ON3A 3N4AA 4HNOA 2AKZA 1SUXA 3N18A 4Y8EA 3ZIZA 1YNYA 3CV7A 1X1ZA 1OF8A 1SW7A 1EYEA 4OHQA 4DX3A 2CBVA 2PLKA 4O52A 3W7MA 3W38A 4K38A 2DQWA 3TWBA 3V0UA 4NASA 1K1DA 4GNJA 2DJLA 4NJGA 2QCEA 4FNQA 1WDSA 3T9PA 1J93A 2V6AA 2B31A 5GJNA 5A5WA 4NQ1A 3NCOA 3DYOA 1FH9A 1WKDA 1JDEA 2PGRA 1UG6A 1KO0A 3W82A 3FA3A 4HU0A 1A3XA 2HNHA 2Z7KA 4W93A 2R1KA 1IE7C 4UZUA 4JBRA 1F2JA 1PZ3A 5CJNA 3A4XA 8TIMA 1OFDA 3G3DA 2PBOA 1DXFA 2WO5A 4H6QA 3NQMA 3MDWA 1HGWA 4DQWA 1J6PA 1D8CA 5CAHA 4U10A 2ISVA 3QPEA 2Z1WA 4HHHA 3WNNA 4UTWC 4LBUA 1W91A 3H2FA 3IGSA 3NSXA 3RM9A 4UWMA 1Z48A 5EYWA 1UKTA 2PTYA 2I1OA 4MWAE 3SECA 4MLRA 1QNSA 1R0MA 1E71M 4JTRA 3PSWA 3VO0A 4X0VA 2YA1A 2Q3OA 2A3HA 2OX4A 2HE8A 5I02A 1PYMA 1AZ1A 1UJPA 3A13A 3PZUA 2E9LA 5KZDA 1UWAA 3CT2A 5JH2A 1WDRA 2MUCA 2VVSA 3L9CA 2ZXBA 3U8GA 2XFFA 4EK7A 1OADA 1UASA 4GI8A 4Y96A 1XICA 2FLIA 4Z42C 1EX1A 3VE7A 3AHTA 2PCQA 2YXOA 2YYUA 1FHUA 1FVPA 3FVDA 3E2RA 1MQPA 3NPXA 3QY8A 4B5VA 1M53A 2HEJA 2YDQA 2JGQA 2QAPA 2G3FA 4FEZA 4AYGA 2ZC1A 1XLLA 3AISA 5AVHA 2WC7A 3JU2A 4NI8A 4ZZ9A 4UMBA 2EPKX 4NNAA 1TWWA 4MZ8A 2NQ9A 4GXWA 1WXJA 3L12A 1MW3A 1MW1A 4DJFD 3K1DA 2O56A 1IEWA 3DBPA 3DYPA 3W83A 3SN0A 4NZFA 4IZGA 4ASTA 5EKYA 3KL3A 3PBGA 1TIWA 1V5XA 2XN1A 4QCEA 1BVZA 3P5YA 5KZMA 1GWJA 3LCFA 4E2VA 4PBGA 3F7JA 4UNKA 1N82A 2W91A 4DJFA 2WMIA 3TONA 3VFCA 1DE6A 2DT2A 3C0SA 2QUMA 1F3EA 1V03A 1OZMA 3UT0A 4LY4A 3IAQA 4NIRA 3L4TA 1JCTA 3GNOA 3TYCA 4F79A 3OO2A 3CZLA 4HHPA 1F3XA 2FJUB 4RE2A 2WQPA 3CHEA 1FWIC 4DYJA 2NVDA 1EO7A 3GXNA 4MDOA 1S5NA 4Z0SA 3W7EA 3GG8A 4NVTA 5TF0A 1NF7A 4KT2A 2AAMA 1E40A 1PTGA 1WAWA 1BRLB 2QNEA 3GDMA 1VENA 2AGTA 3ENLA 1RA0A 5AHMA 4YLWA 1P4CA 2RKXA 3Q58A 4JIEA 6REQB 4IFRA 4HK5A 2I9UA 1TWZA 1HX0A 4R7JA 1O1HA 3GW3A 3CZ8A 3NUKA 4L6HA 1EPVA 1ME8A 2WV8A 4Q6JA 1XLIA 1JCJA 3UY8A 2FIQA 2GFTA 3GE7A 3ABRA 3VOIA 2RDUA 2DORA 3VNIA 2WMJA 2CLIA 3GH7A 3N9KA 4HK6A 5I78A 5LA2A 4I9MA 2NUWA 4EX4A 4CQCA 3AS0A 2G37A 1U5HA 4N9BA 1LWIA 1V7AA 3JUGA 3AZSA 3CL7A 2XGBA 3D5HA 5EY5A 3WDPP 3S1UA 4WSKA 2E5DA 4AVFA 2WNQA 3TN5A 1W3TA 1G69A 1JNEA 4YCPA 2DUZA 3W37A 4MVAA 4FNUA 1DEDA 2HBVA 2VELA 5I3GA 4QS5A 2BDQA 4P7NA 1PHQA 3T7VA 2A85A 3H7VA 3ZXWA 4HOWA 3GQYA 3APTA 3BG3A 1OF6A 3OVGA 1BG9A 3B4YA 1AD1A 4AIUA 2D0GA 3BAYA 1Z89A 2DIJA 4D6CA 2G4JA 1QI0A 4KWOA 4WKAA 3I4KA 3R94A 1EYWA 1P1MA 4DIAA 4C65A 4K39A 1JDCA 2BP1A 4F0KA 1TPH1 1JUKA 3H4GA 4QE1A 4H83A 3NQEA 4QLKA 5JBFA 1PIIA 3INPA 1WZKA 3EMCA 4GBUA 5K9XA 5E9XA 1C8XA 1PKMA 3T2OA 1EB3A 3FHAA 4IICA 1T7LA 4ADSA 1DTUA 1XBVA 3OODA 2OWXA 2C3ZA 2ZVIA 2PBGA 1P7TB 2ACQA 2J4GA 4IP5A 5DT5A 4PSPA 5D2TA 3KCLA 4MAZA 4MY8A 5CPMA 4B16A 1XLMA 2EF9A 2WNWA 3PR2A 3OTRA 2V68A 1G9HA 2EG8A 4J9JA 5F1VA 2P10A 2J7HA 2NLYA 4ZOEA 3S9ZA 3OIHA 1KFBA 1FHDA 1XCXA 3TNOA 1E6ZA 5EFFA 3VUPA 2YA2A 3CV1A 3VIIA 5I2UA 1S1PA 1AK5A 3ZR6A 4K7YA 1ESWA 3TSBA 2ZDRA 1NELA 5CC3A 2QF8A 3GHSA 2DZPA 3QTGA 2YB4A 3KRBA 3VOCA 2TPSA 4WF7A 1TTPA 1IXPA 1F74A 4L64A 1J18A 2V82A 1PKLA 2G3NA 3SUUA 1CGVA 4C5YA 3EWXA 1V77A 4WGHA 5C9XA 4LCRA 5CBIA 4GCAA 4N9CA 2HNEA 4JQ1A 1V0LA 3GXMA 2OSYA 2YB1A 4TQTA 3KVJA 2IKHA 2ZZ4A 3GTHA 2F6KA 3NSMA 3W9ZA 3V1PA 1FH8A 1U1HA 1V3IA 1ZP4A 4N4QA 3IK2A 3E38A 3CEPA 1UC4A 4ZTXA 1OEPA 5E70A 5DN1A 1K7FA 3ANUA 3ES8A 1LRQA 1R3VA 1N8WA 4BEQA 2OO0A 3NXLA 3T2PA 1JF5A 5F2GA 3CH0A 1F05A 5D2WA 3ZVHA 4FIRA 2CU0A 5HQEA 1JZ7A 4MNJA 4OT7A 4AISA 4JTKA 1R9ZA 2PLCA 2WJDA 3S4TA 5HQLA 2PU1A 1UD6A 3EXSA 4O10A 4XO6A 4NAEA 3MWCA 2DVTA 2VCCA 3A4WA 1ONWA 4S3DA 2X7VA 4QAWA 3W02A 1RCXB 1MEWA 3VE9A 3NO3A 3PN8A 2O0TA 3M1ZA 1MW2A 3LXBA 3AWOA 4DBSA 3SSJA 3DH7A 1VEPA 2POTA 4CCEA 3WLKX 1OWQA 2I57A 2OG9A 4HZ7A 4QROA 3PF3A 1H60A 3SGZA 2ZZ2A 3M9YA 4Q8PA 2WQDA 3ARVA 2DZVA 5D2YA 4JDBA 3T6CA 3FXYA 4E3VA 3W7IA 1P0DA 3W76A 5G1TA 3PUOA 1CEOA 3GH4A 1C92A 3OYZA 5JU6A 3AMGA 1TB3A 3NYDA 3VNLA 4AX7A 1YPFA 1CX9A 1OX6A 4QHRA 4TX8A 1OFEA 5LIYX 4O0KA 1KC7A 2C71A 1C8VA 3RO6A 2ZA2A 1ISYA 2YL5A 1DIEA 3K1GA 3VDGA 1LRTA 2WVSA 3N17A 2VOMA 4CU6A 1KTBA 3DEQA 3WZ0E 3ALGA 3QXBA 1PB0A 4BKNA 2CESA 1PCWA 1YTDA 4QG8A 4I9AA 1GNXA 2ZYFA 3KTSA 3T0BA 1G6CA 3UZZA 4IMEA 3TJ4A 4NRSA 2HVMA 4DI8A 4XD6A 3LGDA 5EMMA 4DBWA 4HA1A 5FJIA 3GG7A 1UWIA 4GUJA 1FWAC 4IX0A 2R1MA 1LUCA 5AYXA 3B0YA 4UFLA 2ZOXA 1DKWA 2X0YA 3FJ4A 2W66A 1GOXA 3TC3A 4NJJA 3EX2A 3G0SA 2XIMA 3DKLA 3WL0A 2ZC8A 2ZX8A 3WQ8A 2IXVA 3WQCA 4LH8A 3H2MA 2AMGA 1ITUA 4ZQOA 1XGDA 4WDWA 3QOKA 3ITOA 3AHXA 3ZR4A 4WVXA 4J3VA 3LTPA 1A4LA 2ZWZA 3NL6A 2G5WA 4I7VA 1SR9A 1XIEA 1D9EA 4GMEA 1GONA 2C8NA 4UCFA 3APYA 3EOUA 1OGBA 2JF7A 3Q4DA 2QJHA 3DHDA 2R1LA 2G3MA 4WEVX 2GJPA 3T4CA 2QCDB 1AW2A 2DSWA 2E4TA 3JZEA 3VNKA 5CPSA 1SFTA 2OT0A 3ZR5A 5G5IA 3BW4A 1P0NA 4X61A 1QU4A 3WFZA 1MXDA 1UUMA 2ZRWA 4HSNA 3TXVA 3PBVA 2GSEA 3A23A 4G7EB 4XKYB 4GGHA 4B5TA 2E0PA 3EAUA 1M65A 1RJQA 3LG3A 2NX9A 4YXGA 1CXIA 3TJXA 5BOFA 1JI2A 4FOJA 3W2LA 1RBAA 3EX6A 1R3TA 3KW3A 1FWNA 1FHVA 3BAIA 2CLHA 1Q6QA 4Q8VA 4AZCB 3CQIA 1QASA 1M41A 4AIOA 1F73A 4GISA 4ICMA 3QR0A 4LS1A 4DBEA 2H6RA 4X63A 4FR1A 3LU2A 1S38A 1TPEA 4ZODA 1JZ2A 4YVVA 1AL8A 1KA9F 3B0VC 1TA3A 2WCSA 1US0A 3BAXA 3GC4A 2CCRA 1J5TA 2DSVA 1Q63A 1DYSA 3M64A 5DCBA 1KQZA 2YW3A 3ABXA 3AJ7A 1PBGA 3W7NA 1Q8AA 3AO0A 2PZNA 1OCBA 4AYSA 3ATZA 1Q2SA 1TWIA 1UH2A 2I9EA 3EB3A 1EHNA 5T9BG 2ZXAA 4JQ2A 1XR2A 5I6SA 4U4MA 3WNOA 1H1YA 3UA3A 3XIMA 5BROA 3FFSA 5MKGB 3AMCA 1EEPA 4GQBA 1QBAA 1KGUA 4PEEA 2HTMA 2ZICA 4DI9A 4REQB 2OOGA 2QCNA 3AU2A 4GVFA 1WKYA 7PTDA 2P76A 3GWQA 1ECQA 2GZXA 3FVMA 4IJBA 1YBQA 5D9NA 2Y24A 3IWPA 2DP3A 4LYRA 3HZ3A 2VM8A 3P3BA 1MFVA 2YXGA 3M6DA 3VKDA 3CH9A 3O8AA 3THQA 1FWRA 4RNHA 1KCLA 3R5EA 4HYRA 2WVTA 4ZOBA 4TX6A 3W71A 2VTFA 1AMKA 3ES7A 1W9VA 2HZGA 4Q6XA 2YDAA 3CMJA 1OYBA 3ARRA 1FDZA 2JKPA 2BB0A 4FNPA 1XDJA 3UEQA 3OEXA 4US5D 3E2VA 3NSNA 1E56A 3L2LA 3R1ZA 2OU4A 1IXQA 2BVDA 3RO8A 5D2VA 5C0QA 4QITA 9XIAA 3FXGA 5CSRA 1OYCA 2CKSA 4GVIA 1K77A 1O68A 2BNJA 5HK4A 1V7YA 4PH6A 5JVLA 1E6QM 2QMJA 4US5A 3WEOA 5M2FX 3DZ1A 4BZYA 5CBJA 2VFFA 4JN8A 3POHA 1K9FA 3V36A 3MO4A 3O63A 1YADA 4J2MA 3BXWA 3FN9A 3W7OA 4DM2A 1ICSA 3OA3A 2GK1B 1CGUA 4U33A 1B3WA 2O9OA 4CNSA 3L2MA 5H6HA 2E40A 2Y61A 1A49A 4DZAA 2PGEA 4V27A 5ABTA 3FKRA 1WP6A 1XH1A 3BJFA 4LALA 1EO5A 3IJ8A 1UC5A 4EKJA 3KM8A 2A7NA 2PDWA 5CH9A 1E6PA 5BW6A 1FCBA 5CC7A 4LVGA 3D0CA 3RITA 5FF3A 4JL2A 4MNMA 1DHPA 5AHIA 2XWDA 4HQVA 4R53A 2NSXA 2Z29A 5HR6A 4W7UA 2D2GA 3KOYA 3PPHA 1HJQA 5A2AA 2ZUUA 1XIHA 2X41A 1O5RA 3UETA 3U57A 3MUCA 4UNIA 2QR6A 5LSMA 5M5DA 1FKWA 4N42A 3WQ5A 4MLJA 3KZPA 2QUTA 3EPOA 3W7LA 4LBRA 4MOZA 3VNJA 3VIFA 3VOJA 1IXNA 3GIPA 1R2TA 1LOLA 2XGIA 1TE1A 1KFCA 3NDOA 6CGTA 3UWQA 1EQCA 3LQLA 3P81A 2QAFA 1LDCA 2WM0A 2AL2B 1V3JA 5IHRA 3G1VA 3IRSA 3WF2A 2EPLX 5XIMA 3V75A 1TTJA 1TJ1A 1AQHA 2RUSA 3IK4A 2POZA 4C6CA 2V8ZA 2VR5A 1Q3NA 1VYRA 4IGSA 2OYMA 1TFVA 1Q6EA 1WUFA 4S39A 1J4EA 5C5YA 4WUIA 2CZDA 4OBRA 2H90A 4XZNX 4IPJA 4GXPA 4AEEA 1F6YA 5EMLA 1M68A 4GHRA 3WBYA 2HJPA 5LIKX 2OQLA 4JR5A 2BY2A 5CAKA 1UR0A 3P61A 1PV8A 3VGBA 2VGFA 2X1TA 3QH2A 4TIMA 2REQA 3AXXA 2P8CA 2XIBA 4ATDA 1JL8A 3MKKA 4QSFA 1F8IA 2A2IA 1CGTA 3PBYA 1CPUA 1VH7A 3WDRA 1KR1A 2NW0A 2E6YA 8XIAA 3NQAA 2QJGA 1GOOA 3ITCA 1B30A 2DV0A 4FK9A 1S3HA 3W7CA 1R8LA 1YRRA 2HDJA 3QHOA 4D6FA 2PTWA 4RNFA 1A5SA 1PCKA 1FQ0A 2YKKA 1QBBA 2XVPA 2XDFA 1F6PA 1OK6A 4ZXOA 1X8FA 1X7IA 3V7PA 1GVIA 3CZEA 3FOKA 1OCQA 3DFTA 1J10A 3W7GA 2GVEA 1IF2A 1LBFA 3S5OA 4UOZA 1UUOA 4JIQA 3WLMA 1O60A 3E2QA 2CEQA 3R8RA 4EPDC 1EA9C 1NDVA 3DCPA 4CQBA 3RYSA 2BTMA 3TWAA 2P50A 1LCOA 4GABA 2J7DA 5AC8A 1A5UA 2V2DA 3LTYA 2V5CA 5DANA 1W8SA 3GAKA 5HWMA 4PCFA 3EOSA 1QAPA 3U5UA 4EP8C 2D24A 4V2XA 4ZQMA 4O1EA 1XIBA 3URNA 4QAIA 1XKYA 5FJTA 3TSDA 1XFCA 2VWTA 3V18A 7ENLA 1EJRC 3RLHA 3GFYA 2E3ZA 2WLZA 3RPDA 2I16A 3PANA 4N6EA 1R3QA 4QJ4B 5LXXA 1E51A 1W2VA 2Y7EA 4D8AA 1W6TA 1W3LA 5A2CA 2GUUA 4JFTA 1H7RA 3THAA 4HCLA 4JYEA 3VTRA 3K2GA 4D8ZA 2ZADA 3E96A 2WSYA 1B5TA 4IF2A 2TAAA 3J7HA 1Y7VA 1GT8A 3QYSA 1GZ1A 4JS3A 5CZSA 3AUOA 1E6SM 4YVXA 2OCZA 4Y9PA 1KBIA 4D9PA 2BVTA 3NWRA 3GNDA 3KAOA 1SO4A 3GB6A 2PDPA 2Z4GA 2XJ7A 4J28A 1U83A 2J74A 3UXKA 1ITXA 5BOOA 3MP4A 4H8UA 3PZIA 3TXZA 1Z6KA 3LCHA 4ZOAA 1ME9A 1UJQA 3IIPA 5CSYA 1KXVA 4MB5A 2C0AA 3DESA 3G0XA 2Z27A 1IIGA 2DVUA 1IWPA 5FAGA 4GY7A 1BWVA 1XYFA 1YTEA 3WG6A 5CPLA 5BMXA 1CGWA 3DIPA 4FI4A 4O14A 5IBXA 4CU7A 4LYPA 1Q6LA 3MSYA 5FL1A 4IPLA 5AB3A 3EX3A 4CEUC 1VFOA 1DXIA 2BGSA 3QHNA 1ZZMA 4ZL1A 1Q6RA 4ATLA 1CB7B 1R2RA 1EQPA 1XIGA 4GACA 1UD8A 1H5VA 4ZE5A 4Q4SA 4H9YA 3LENA 4ALDA 6ALDA 4Z1CA 2DDXA 2PP1A 3QV9A 5HAOA 2D0FA 3QLDA 1UHVA 4S3FA 3EWYA 1BTCA 2O9RA 4MB4A 3A4AA 4HPHA 3LI0A 1JXKA 4HCDA 3UWYA 3WLRA 4M81A 2X8RA 4PUUA 3N2XA 1RLCL 4UTTA 1W9DM 4FNTA 2X1IA 1XRFA 5H8PA 1HVQA 2D2JA 1GW1A 1UROA 2ZVRA 3MO7A 1X98A 3B97A 1KCZA 1OD0A 4DJFC 2DT1A 4JTCA 4HBKA 2E6DA 3SQLA 1PEZA 2J9XA 3BG9A 2DW7A 1Y8BA 1SMAA 4C6QA 4MWAD 4A8NA 1FWFC 2WHMA 3PPGA 1PZ1A 3MUZ1 4L7ZA 1X97A 3DN5A 4LCQA 4XAPA 1GG1A 4FX8A 4YYCA 4DF1A 4IJRA 4IOTA 1TMLA 3BPWA 5CEWA 3AS1A 2VENA 3TK7A 5CC5A 4MWAA 3M7WA 5GVJA 3K8MA 3ZOAA 3WFLA 4B4FA 4LOCA 4QE5A 2PDXA 5KZ6A 3H4WA 3UBPC 4UFJA 4BI7A 1ZTVA 4I5XA 4P7RA 3HMJG 1DV7A 3NXFA 4UOJA 5CBBA 3PFMA 4PMXA 3N1AA 4NF7A 1WBHA 2FQIA 1AVAA 3WY1A 3ZSTA 3ITTA 2OLHA 7CGTA 1NF0A 1HKWA 1ZGDA 1UBPC 2ZRUA 1FX6A 1GCYA 1UKSA 1H09A 1FXQA 5DT7A 2A5HA 5BRPA 1MUCA 1KBJA 4PUJA 4LANA 2VFGA 3GC5A 4PN2A 3PB0A 2HROA 3VNZA 3EDDA 2PRLA 1LF1A 4DM1A 1BVNP 1GVYA 3CYVA 4UQDA 3RHGA 1V51A 4C6OA 4PUEA 3NQ8A 2EKGA 4HVXA 2Q02A 4NSBA 1WXYA 3VKAA 4XZIA 2ZE0A 3AUJA 3NL2A 1XYCA 4CUCA 4DF0A 4DNMA 1PVNA 2W62A 5FF2A 2JKEA 4RW3A 3TN6A 2YPIA 3UZYA 5KINA 3VGHA 4AD5A 3BV4A 5HMDA 2CITA 2BXZA 4H9UA 3TA9A 4H4IA 4W88A 3RLUA 1JRBA 1XIIA 1UCWA 1ECEA 3RJXA 1OQFA 3FKKA 5LNSA 2P5NA 4FLRA 1TRIA 1XP3A 1NSJA 4G1KA 1JD7A 5CKSA 3VMNA 2YCKX 2W27A 3RU8X 3H24A 3KL0A 1GZGA 4PGLA 3EWWA 2QVHA 3FAXA 4UBPC 1EWDA 3TP4A 4XAGA 4XBKA 4R7OA 2JALA 2V0TA 3E2SA 2INFA 4QG6A 2BLEA 1Q4WA 3WJYA 2Y7DA 3PSVA 2BOGX 3W28A 4ZOCA 2JGYA 3N4EA 3CAKA 3I7RA 2P0IA 3OLIA 1R38A 4D6HA 1W1B1 2X05A 5D02A 3DI1A 4HMNA 3LBMA 3O6AA 4L1XA 4LSBA 5E09A 1GYLA 3WENA 4H8HA 3E49A 3AQUA 3WLIA 3HGSA 4L9ZA 2VCBA 5DRCA 3QGVA 1WPCA 3Q94A 3G1RA 5AN7A 1PIFA 1QHPA 4IUOA 3CAWA 4MKSA 4EANA 5G2HA 3VDHA 3R10A 1BVWA 3K8LA 3CZKA 1XF0A 5LA1A 1JPKA 3ELFA 4O4VA 4Z2GA 3A64A 3KRSA 2J79A 3OVPA 3CUHA 2OZTA 1OFOA 3OYXA 3T2QA 3EX4A 4URIA 4HA3A 4A3RA 4S2BA 3PBUA 3CXOA 3LCGA 4J1OA 1KQYA 3O6YX 2BGQA 1ZY9A 4CCDA 5C9ZA 1RK5A 1NP2A 4PMZA 1UQZA 1LBLA 1FWTA 4PCSA 3IGXA 3B8UA 2PS2A 3WNMA 1D3CA 4ZQNA 4PMYA 3QM3A 3OOQA 1AUSL 1EJTC 2QDDA 4UFIA 3M0MA 4ZMGA 3G18A 1TZ9A 4LT9A 5HUOA 5D04C 2VMFA 5CPNA 3GU2A 1EL3A 2A6NA 1ZBKA 4JQ4A 4E4UA 1R87A 2WMIB 2YSWA 1UWUA 4AF0A 5LA0A 5ABHA 2J6VA 3F2CA 5DMMA 3O05A 3CUIA 1VFSA 4FOKA 3FS2A 3TMLA 3PULA 1EUNA 3ARTA 3N15A 1EF2A 3GVRA 3IIOA 1FFQA 4AQLA 1Z69A 4QEEA 4I3GA 2HMCA 2R6OA 2XFYA 1QPOA 4EXAA 1B3YA 4MPKA 1QVBA 3CHFA 1H62A 3A6OA 4EXBA 4KFPA 3W88A 1A53A 2ZZ3A 2IKJA 3L68A 2YBVA 2QGHA 3LK6A 3NPVA 4AZ7A 1IR2A 4JTFA 3G1DA 3RGTA 1R5YA 5AHFA 3ANVA 4JZ5A 4L4LA 1A4MA 2Y4SA 3ZLGA 4ZVJA 5AYIA 3QV7A 1GW9A 1BWLA 3SQSA 3GZ3A 1AH4A 1RP9A 3R4IA 1UKOA 3PBMA 4P8UA 3KUMA 1NWTA 3PUEA 2YLAA 4FXJA 5AYZA 4IPPA 4NUWA 3MC5A 3EB4A 2A7PA 3QMSA 4D6IA 1G94A 4MM1A 2J7BA 4OU1A 2ADAA 1OX5A 1TVPA 5HINA 4F40A 1P7TA 1NFBA 4D8LA 3CIWA 4JIIX 1KD0A 4UZSA 4PMQA 1W9UA 3A3HA 4C6JA 3WQOA 1V3LA 4EOUA 2INEA 3WUGA 1EXPA 4W8LA 4JFUA 4IIEA 5A6SA 3EDEA 4Q4RA 2WJFA 3PB2A 3B8DA 2F2HA 4BJHA 1SYTA 3TCEA 4ROPA 1Z44A 2XZ9A 2JBMA 4GNVA 2ZA3A 1XLJA 5I3DA 1D8WA 4C6FA 2PWUA 2QGYA 1SW3A 2F38A 3PAJA 3AMDA 3QJAA 5AC6A 1L6FA 1ITQA 2G41A 5I06A 2DFAA 2QCMA 3W7QA 4Z08A 3PTKA 3SGUA 4DZIA 3D46A 5G1YA 3LHYA 4FLOA 1XYMA 3H21A 3KVMA 1E4NA 3F5JA 1M03A 2HS6A 3G1XA 4K7VA 3COTA 1M3UA 4F2UA 2BS9A 3PWAA 4AG0A 5XIAA 1DWAM 1TQJA 1UWTA 3M0IA 3OHMB 4Y7EA 1WUEA 3URQA 3R0DA 1Q7MA 4UQBA 4L4PA 3ZLHA 2JK2A 2Q8XA 3BLDA 1UW9A 2EXOA 3VCRA 2W3ZA 3P8IA 3PZNA 2PTDA 2QCLA 1W1YA 3UXAA 2RGLA 1W3IA 3S5ZA 3CAVA 2V30A 1PWLA 1LQ2A 3DC0A 3ARZA 3USZA 1LL4A 4KCTA 2Q09A 1EDQA 2OKTA 1GVEA 1X7FA 1QW7A 4C6KA 4LF1A 1GVFA 3O06A 1ZRQA 2WJZA 4LAKA 3VIKA 2QJMA 5EU9A 1YX1A 1D2KA 2QUUA 3IRDA 3KS5A 3W2MA 1HP5A 2NXIA 3WH6A 1MDRA 4RV8A 4RDWA 1Q65A 3T0CA 1P6WA 4PYSA 3T81A 1EIXA 1PX4A 1GQKA 1R47A 3C8NA 3FX4A 1QOXA 1ELSA 5I23A 4GVHA 4O12A 2J7EA 1WZLA 2Y8VA 2RDTA 3RMJA 2C91A 4FS9A 3A3WA 5FEXA 3LQGA 3MU7A 4GO9A 3QW4B 3B8WA 4JICA 3WQPA 1R46A 1ZAIA 1TUFA 4DZHA 4IIHA 4RPQA 3VNMA 3W1NA 4I7UA 3VVGA 4ZFMA 2ZUWA 3VNDA 2GSJA 1M6JA 3NAVA 3BLPX 4YU1A 3LBCA 3C4UA 3MUIA 4JN6A 2HVNA 5D33A 2AQVA 3UR5A 3UG5A 3M5VA 1KXTA 3VOGA 1TPC1 4FZIA 3QQWA 3NZPA 1M7XA 3MI2A 3N2TA 4FP1A 5CZKA 2WHLA 1FFRA 3GZAA 1HF6A 1HKKA 4E2DA 4Q8QA 3RRAA 4UTHA 1OINA 1V0NA 4X0NA 2DY3A 2JEPA 3QSRA 1Z42A 3T40A 4IIBA 4XD4A 2VDIA 1L6WA 1LM1A 4M24A 3ZVHB 3OG3A 3GTNA 2PDLA 3HG3A 2FFCA 1RR2A 2P53A 1SZEA 2WMGA 3S3GA 5MHBA 1B57A 4GI9A 4AZ6A 3AYRA 3MHUA 3FSTA 3ZO9A 3R2GA 3R7MA 2IS7A 3N6HA 4NAEB 3SQMA 1BKSA 5IDIA 1ZLPA 1A5KC 1YKWA 4AWEA 4GD0A 4W86A 2ZQ0A 4WGXA 2VP8A 4LF2A 4AEOA 1EDTA 4DNHA 1XLEA 3QFWA 5CPQA 4JFSA 2QCGA 3NGJA 2WHJA 6TAAA 5A6KA 2Q8ZA 4TV5A 3T0TA 4M1RA 1OCNA 1R86A 3VIPA 1ZHAA 1N2VA 4Y2WA 3EBVA 3TTSA 1W3NA 2QW5A 2PWGA 2XN2A 1HG3A 1TJRA 4Z17A 3ZJ6A 5LHEA 1GKQA 1OB0A 3UWEA 3LZ3A 1R9XA 2DQXA 1WA3A 1JPMA 3FIGA 3MV01 3H26A 5D03A 2XFRA 1XYLA 1XBXA 3MMWA 1WE5A 4C1LA 4PSRA 1XBYA 1VBUA 2FHFA 2XM1A 5CLTA 4B4HA 4KW2A 3UGRA 1QK0A 4PEKA 3A3XA 4JPGA 1XDMA 4GWEA 1I8JA 1CZ1A 3CPUA 1MNZA 1XKJA 1LJYA 1OX4A 1E0TA 1ONRA 1N8IA 3H7UA 4B5NA 2FPTA 2FHCA 1MWOA 5B7YA 4WOQA 3PS7A 2UY3A 4TUFA 2NVCA 4MF4A 1ALDA 5AC7A 4ILSA 1K9EA 4GUIA 2XH0A 1LUCB 3MZNA 3NZGA 4PULA 2GVJA 1GYMA 5AHEA 1JIBA 2TSYA 2UY5A 3L5MA 3GDKA 1XLKA 1VF8A 4AVNA 4A3YA 1GKRA 3K8KA 3MBFA 2IQ0A 5CZ0A 3VOFA 3OJGA 4P7QA 3H22A 5TIMA 4JQ3A 5FI8A 4CNNA 2DZWA 3BAWA 4D1IA 1AJZA 3TW9A 3SCRA 3D3FA 1TPWA 4DRSA 1EP3A 2G3JA 3G24A 4LQ1A 2YFOA 4NJHA 2E7FA 2IUZA 1K70A 3SADA 2OVLA 2OB3A 1TR9A 4Z1BA 4S1FA 3OZMA 1ME7A 2F6UA 3WEMA 1JR1A 1HIZA 4KGJA 2GJNA 1C7SA 4GJIA 1X6UA 4KEZA 3WD0A 3PJUA 4TVDA 1SU5A 4GH1A 1JCNA 3DECA 1I45A 3L0GA 2PGWA 1TO3A 3MYOA 3STGA 4NKCA 1VEMA 4NNCA 3PNZA 4UQAA 3FYYA 1JGIA 2NV9A 3DERA 1AJ0A 3WK1A 4PUDA 1VLWA 1M9HA 4DN1A 1AQMA 4W89A 3ITXA 4TO8A 2VX4A 1D3HA 3M0JA 2FMNA 3DFQA 2XSBA 1O5XA 5A8GA 1XUZA 1NWSA 5GNYA 1YE6A 3BJSA 4HMCA 2AGKA 2DIKA 2PF8A 3L0NA 4U5KA 2ACRA 1XLDA 4PBFA 3CHCA 4R27A 4TMBA 1TV3A 5IHSA 3RJYA 5FD0A 1FY6A 2DH2A 1N8FA 4PFHA 1PKNA 3TLQA 3IPWA 5IXEA 3GU9A 4ZTYA 2Z24A 4FLSA 1I1XA 1WBJA 3LLFA 1JDDA 1VRXA 1XIDA 3GYCA 1YTKA 3UCQA 3TYDA 4CNTA 1ISWA 2GJRA 1H7OA 1XGEA 3KEHA 3AWNA 1Q5MA 3F2BA 4X2PA 1QOPA 1TA3B 2X2GA 1IEVA 5T9CE 2WZTA 5LYRA 5G1MA 2C7FA 1CLKA 4M5PA 1FWEC 3HN3A 5BU9A 1HQTA 3W85A 4F4RA 4TV6A 4U5IA 5AC5A 3LPGA 3WUEA 2PDHA 2CLMA 3W7PA 1RY8A 1JYNA 5HJYA 3S0CA 3SCSA 4FX6M 1UR1A 1J12A 2B0MA 2NXHA 3LA4A 4UQCA 3WMLA 2DT3A 3O16A 4B92A 2YIHA 3UWWA 2PFHA 3WH5A 4M82A 2J7FA 2NWRA 4PZVA 1HKIA 1F3TA 3EX1A 3I3EA 5L9FA 1E1CA 2CPUA 3KBSA 1E3XA 1GUVA 2C14A 1DWJM 2FTPA 3M4HA 2HWGA 3H8AA 3LLXA 1CXKA 1YBQB 4E5TA 1SJAA 4ZENA 3NZRA 3SZ8A 4B9ZA 2F6XA 3MBDA 3T55A 2X1RA 1EJWC 2BXVA 3UG4A 4TVCA 2HXTA 1H2JA 2WZHA 2XH7A 5HR7A 4YN5A 4KERA 2OWCA 1HFBA 1KNWA 3BK0A 2HISA 1WV2A 2PC4A 3P6LA 5ABFA 2UBPC 2FPVA 5CSSA 3VPLA 3CS2A 4DO6A 1GOIA 1X38A 6XIMA 3PHAA 3GLCA 4MSSA 4ZGYA 1EJXC 3M0ZA 3LBOA 2IQDA 1JQXA 3LHZA 4A21A 4CN1A 4PB5A 1M7OA 3LNPA 1H0IA 4J35A 3VC5A 4AFYA 4S3BA 1DIKA 4GYFA 4OBSA 2WVUA 2ZRYA 2Z1XA 1Q13A 1HVXA 1WXZA 2W6RA 3EWUA 3TC7A 4K1GA 2VEPA 4LCSA 4PRTA 2PWEA 1XQKA 3POCA 1CXEA 2O9PA 3TYAA 4B5WA 1R3SA 4CNUA 5E5CA 2GWGA 2CERA 4Q33A 3HPZA 1E0UA 4Y9MA 1DJHA 3ZJKA 2Q01A 3IUDA 1LT8A 2FYMA 3BO9A 1BEUA 4JIHA 2Y85A 2ALRA 3AAMA 3TQVA 3ZQ9A 4RW5A 1TJ0A 1PTDA 1EBGA 2JE8A 3C0QA 4QR6A 4Y9NA 1SO5A 5FJJA 1KW1A 1QR7A 4NZ4A 3BQ6A 4E8GA 1B4KA 1PZ0A 1UZDA 3MB9A 4NI3A 1IT0A 1WQ5A 2HSAA 4G7FA 1R6WA 2GYIA 3WMCA 1P0BA 2Y8UA 4LTSA 5A69A 1KFKA 2FVKA 4Y90A 1CGYA 3VDCA 4FIQA 4S2CA 3LGEA 4OECA 3TJLA 4LUSA 2XTKA 5HA7A 3DFPA 3TCSA 3JRKA 2Z2AA 4B5SA 3VFLA 3CM4A 4KWUA 3AIRA 1GTEA 3M0LA 2QT3A 5A3HA 1MQQA 4GX8A 4IG2A 2PEVA 3MHFA 5I3KA 4YTUA 3NZQA 3IVSA 4Q4KA 1H51A 5HWNA 5D37A 3W4RA 3LPFA 4Q8TA 3MV11 3E5PA 4UXDA 3QC3A 3VI2A 2PWDA 4ICCX 4PUNA 4DELA 3C2YA 2NT0A 4WR3A 2QYGA 5DELA 1YXYA 1AL7A 2OO6A 2WB5A 3TZFA 5M17A 2PWVA 3S47A 1W2PA 3MY9A 4M7SA 1VS1A 1S1RA 4TR9A 2YBUA 1ZAHA 4H7CA 4S3KA 3KP1A 4WKHA 2Z00A 4I8YA 3O3RA 5U4NA 2FHBA 3WDJA 2X09A 5FJPA 3OB8A 2J47A 4BQ3A 3BW3A 1OG0A 5ECUA 5DX7A 1QW9A 1V8EA 4QTGA 1EGVA 4M19A 4XAYA 3WK3A 3IEBA 1JPIA 1SFLA 1NFPA 2DZTA 3CHDA 4NNBA 4UTTC 3LM3A 1U2YA 2DGAA 4C60A 2OODA 1JI1A 1UYQA 5T8GA 1W31A 3EKGA 3GAYA 1Y5VA 1B1YA 1DHKA 5HQMA 3B8VA 2F61A 1SFSA 2AAAA 1HTIA 3DFHA 4U2ZA 4YS1A 1GJWA 4GY0A 1CWYA 3AXMA 1GHSA 2ZZ1A 2REQB 3LCLA 1U5JA 5AYYA 2NQZA 5AZ0A 3UNDA 3WEZA 2E28A 3ONCA 4MWAC 4K37A 4G5DA 4Q8NA 3MI6A 3GR4A 4HN4A 1TZZA 3M41A 3MP5A 4DVOA 2X30A 1JFHA 4F9DA 3MPGA 3VGFA 3GXPA 5CLWA 2AQOA 3EOOA 1JGMA 2RJGA 3WKZA 5FL0A 3LRLA 2XIOA 5BXRA 4ZSUA 3TW7A 3RR4A 3ZMRA 3U2ZA 1CYGA 4IH3A 2PDQA 2WC4A 1QWKA 1W37A 2OZ8A 5EMYA 3EGJA 1T8QA 3F03K 4CQAA 3VZZA 2R94A 3HTWA 1PWMA 5E6ZA 5BXSA 3TNBA 1EHAA 3LY0A 3RAOA 3GR7A 2FZ9A 2WHKA 3MKCA 1TELA 3V5OA 1HZYA 3PFRA 1W3HA 4BWLC 2HE5A 1KM0A 3VD9A 4HK7A 1BG4A 3SY8A 2CIPA 2BXYA 4MUZA 2BFGA 5EA9A 5ECVA 3UJRA 3EDJA 1MDLA 5EB8A 3GFXA 1F7BA 3WMBA 1I4NA 3UZJA 2W0UA 1J0HA 3CIVA 3RM4A 4YTRA 5I07A 1J9YA 2QDEA 4NZ1A 5J8LA 3O6DA 1E1EA 5G2WA 4J3XA 5FJOA 3HB9A 4NILA 3WLJA 4R33A 3LXCA 1E9IA 3U7BA 3VA8A 5D9OA 1YEYA 3AS2A 4EPKA 3FA4A 1VCGA 2AKMA 1GJUA 5FACA 3M07A 1GJPA 1LP6A 4UTKA 3VILA 4OVXA 1LROA 4S3AA 4MB3A 1IEQA 1JPDX 4GY1A 2R14A 4LY8A 3N2CA 1F4AA 2YCJA 3PG9A 5C2CA 4XK2A 2OYLA 5FOOA 1NP0A 2HXUA 5EFDA 2WSKA 3CZGA 4CD5A 4GVGA 3GU1A 4HKPA 5DMYA 3DHFA 1E72M 4DUXA 4K2SA 2PZ0A 4UOQA 1XINA 4RE4A 3RLGA 3EEGA 1EJUC 3XISA 4BF7A 4W5ZA 3KLKA 1HJVA 1OT1A 1YDOA 4W7VA 2YLLA 3LLDA 3WQVA 4KGLA 3LHTA 3NIYA 1XC6A 4AWTA 1SM9A 1V08A 3VM7A 4PA8A 4GG9A 1CXLA 4PMNA 2NQJA 1NQKA 1ZJAA 3TLLA 2BVWA 3GDLA 4LAOA 5BOEA 3KBWA 5TD4A 4P8WA 5CCZA 3IV3A 1FUYA 3QLLA 3PJTA 3R58A 3DI0A 2C1GA 1JZ8A 3U3HA 3OZYA 1AQ0A 1WDDA 4FALA 1EEXA 1V3HA 3N6JA 2ZCGA 4IFOA 2YDRA 3TMQA 1T41A 1OFRA 2DH3A 4QM1A 3CASA 3BANA 1J0ZA 5E6YA 4O19A 4RNIA 4O1BA 3UXLA 3V0SA 1K7XA 4PTVA 3M46A 1W5PA 1E9LA 4O0ZA 1W56A 2J66A 3M6YA 2HRWA 4XSLA 4OOZA 1PJ9A 3W1RA 1R2SA 1HL8A 5DBTA 5GNXA 1L6YA 1KCKA 3SR7A 5D8ZA 1OC6A 2C19A 3SSZA 4KEVA 1US3A 1KBLA 3GHTA 2D3LA 2WJEA 1W9BM 4IQLA 1KFWA 1X1NA 1IV8A 1ZNNA 4F2BA 1O7AA 1B4EA 3LX9A 3AIEA 4IHCA 1PIGA 4PTDA 1ICPA 4M3PA 3W87A 1TYGA 2YL9A 4PB3A 1KM2A 2VFEA 3EKZA 3LCIA 1IGSA 1G4TA 4P5UA 1US2A 5A6BD 1U1UA 1FP9A 2OKOA 3E3HA 3VAVA 3CGTA 2YZRA 4MWAB 5D09A 4JTLA 1RV8A 3AICA 3O2LA 1VJIA 2A21A 3CBWA 1JUBA 2DW6A 2G0WA 1QTWA 1D3GA 4U3CA 5A6BA 4J3UA 1O12A 5DBUA 3UJFA 1OGSA 4EWJA 5FESA 4EAYA 3N34A 2FB3A 2WK2A 4XSMA 3G77A 3QGAC 1KKRA 2BY1A 4NT0A 5E0CA 2GGJA 4JYFA 4HNVA 4B15A 1X6NA 4KWVA 1UKPA 4XISA 5ABEA 4K8EA 2H8XA 1P1XA 3ANYA 2ZUNA 3UPBA 4AD4A 3BGJA 2R24A 5D38A 1X96A 4W87A 3W2JA 2J24A 1MUMA 3GXIA 1QPKA 4IMAA 3W73A 1J0IA 4CD7A 1J0YA 2YR1A 1ITCA 5HNUA 3AIBA 3LS9A 4YJ5A 3WLHA 4LBSA 4HMDA 5AHLA 4E38A 2X7WA 1PE1A 2VRQA 5DMNA 4KCWA 2VO5A 2J7CA 5CXPA 3SY5A 1DORA 5KITA 1UH4A 3W2NA 1TVNA 4F8XA 4Q3MA 4A29A 2JIWA 4ACZA 3F1QA 4UFMA 3I65A 4PTNA 4JEQA 4O1FA 4B3KA 1KLZA 3WD1A 1JZ3A 4S3JA 1T40A 2PDCA 3ARWA 2ZUTA 4ZE4A 1EC7A 2O7SA 2QV4A 4WDTA 3MCMA 1KRAC 3ZT7A 4H01A 1OFPA 3OGVA 4LXFA 3WL1A 1PX8A 2X2YA 5HNTA 5LKYA 1NEYA 4CVUA 4GBDA 3II1A 2FTWA 3U4FA 4IJCA 1ICQA 3HM7A 3TV8A 3UJ2A 3FDGA 5M3WA 2OXNA 4UTMA 1GOWA 4AH7A 3MUY1 3GFZA 1V02E 3KZSA 3CHVA 1RK6A 4O1AA 2GVYA 2PDYA 4LAZA 4B3LA 4KRZA 3U0HA 5ABGA 1DBTA 2R82A 1DXEA 3CL8A 1FXPA 1Q66A 2FKPA 3VKJA 1K02A 2PP3A 5FCZA 2R8WA 4WJXA 4HD5A 1ADOA 3KVKA 2XIJA 5K7JA 3W25A 1S2VA 3LB0A 3UP8A 3ICJA 5HULA 1C7TA 4O50A 4UTJA 3QY7A 2ZDSA 2BG5A 5C70A 4XZHA 4I9JA 3NPWA 3E0WA 4GI4A 4BI5A 2ZZ6A 1TIMA 4Y9OA 2GOKA 2QULA 3W1AA 1BKHA 4AC1X 3P62A 2GUBA 3RX4A 1I75A 2Y5EA 1K8XA 3R11A 1A3WA 3TQPA 4ORMA 2FZ8A 4XZMX 3OQEA 2RH9A 4ECLA 4FF5A 1XD1A 4Q8OA 2VDHA 3I6RA 1XPYA 1VBGA 1A80A 4DWSC 3OPSA 1UD5A 4IQDA 3WD3A 1W3JA 2VGBA 3TTQA 1V6TA 4XZWA 3I6EA 4X9YA 3F4WA 4O57A 3AI0A 2J8GA 4MIMA 3PP7A 1QI2A 4HHLA 3NGFA 1RQEA 2EGZA 4Q4PA 4JL1A 2OT1A 2YW4A 1VP5A 4HNTA 3NJ3A 2QCFA 2JKAA 4G8TA 2BOEX 3LCXA 4UTFA 1AD4A 2WKJA 8A3HA 1V79A 4AF0B 4H19A 2HK1A 3IIZA 6PTDA 5LGXA 3OBEA 4J3TA 5F7UA 4C90A 3G0UA 1KM3A 4EE9A 2QJIA 3M0YA 4GJ1A 1NWRA 1R3RA 1XIJA 2OELA 4D71A 6ENLA 4X3ZA 1VBRA 4NJIA 3URBA 1JZ4A 3URAA 4U2YA 1F8MA 1GK8A 3C6CA 4DXKA 5EBUA 1B54A 1BYCA 2C15A 2I5GA 1VIWA 3RM8A 1KCXA 1ZP3A 3LDVA 2F9RA 4Z1AA 1RZMA 5FJRA 3MA8A 2XSAA 1TMHA 3GR8A 2OZ3A 1C9WA 3GNPA 3BCDA 1SVDA 2ATMA 3YPIA 2IPJA 3VKBA 3KDOA 4E3TA 2NQHA 3WQGA 3HMCA 1QXLA 3DYMA 4QJ1A 1P0EA 1GQJA 5K3VA 1RQHA 1A0CA 2V5BA 3PY2A 1HGYA 1QWGA 4JX5A 1FCVA 2WPGA 3AXHA 2H3BA 3OGRA 4NU7A 1K8ZA 1TPFA 2XUCA 3VM5A 3WSUA 2O92A 1I9CB 2E5BA 1G0CA 3CUFA 3B9AA 3FEMA 4HPJA 3S1GA 4QGCA 2J78A 3DFOA 5I79A 1SQ7A 4ZO9A 4R7WA 3S42A 3SN4A 5FKYA 4IFKA 4Q4OA 3C8FA 3I3BA 4WXZA 3IUIA 4XWUA 1KBKA 2WKGA 5C9RA 5F4SA 2PD5A 4KIEA 1QT1A 1FWBC 1CLXA 4P8XA 4WX2A 4TTGA 1PDZA 4OKDA 3ONBA 1S5WA 3RNDA 2ZA1A 2EO7A 4Q8MA 4WZHA 3AIVA 3A4JA 3LV5A 3BZJA 3U48A 4C6LA 2VC9A 5A8OA 3MZ2A 2CBJA 4H9MA 2D69A 4INFA 4A22A 1GPWA 5BCAA 3WBWA 1UWRA 4LRSA 1XUUA 3UJSA 1UOKA 2UWFA 3T42A 2VGIA 1GPFA 2Y6ZA 1ZBVA 1HKJA 1XLFA 4RUBA 3V0TA 4HYVA 2NVAA 4FA3A 4CD4A 2KAUC 2OEJA 2X42A 1XISA 3SRDA 2VURA 4NZCA 3NQGA 2NXGA 3IANA 3VX1A 4C6EA 3UZ5A 3WD4A 3RUBL 4U3AA 2QHAA 3W74A 2CHOA 3T1GA 1DJGA 1XLGA 4NX5A 3GUGA 1HP4A 3USBA 4DJDC 3TYZA 3EWDA 3N12A 3UR2A 2GDUA 9RUBA 1ZU8A 4O4WA 3WH8A 2E1WA 3W3OA 3ABZA 3G6MA 1CTNA 1J2BA 1A5NC 4LV9A 3LPPA 4HPGA 5EMUA 3HG4A 3C0JA 1TR1A 1NH6A 5DO8A 4DY1A 3ERPA 4FR6A 4EVZA 3WMSA 1ZUAX 2YGYA 4FPSA 4W8BA 4I5UA 4YWSA 4JX6A 1CNVA 2QLYA 3H2AA 1MI3A 2ZX5A 3STPA 1BQCA 4A6GA 1LQ0A 1BF2A 4HJFA 4W84A 4QE4A 3DGBA 3GM8A 5C54A 3L4ZA 4PE8A 2J9ZA 1H50A 3PM6A 3Q67A 4MNLA 2OX1A 2ONEA 3K5XA 3L66A 4BK9A 4JYDA 1J11A 3HPXA 3H53A 1FWHC 3JW7A 3BLKA 4G1NA 1TCMA 1IEIA 1DOSA 3ABOA 2TRSA 1VJZA 1T6MA 2PDGA 3VGDA 2WNZA 1Q6CA 4FXFA 4MNKA 5BXPA 1MUWA 3I6TA 2AL1A 1WAUA 1VYSX 2OWWA 2V5LA 2VZTA 1P48A 4L61A 2VVNA 4GJJA 1F07A 4L9XA 3TE9A 1SGJA 2J62A 5JQ9A 4JY9A 2VEFA 2XFWA 1E3ZA 4LAMA 1ZS2A 1Q2RA 3STFA 3HPFA 4ML4A 2BODX 1C8YA 1S2WA 2OPJA 3WQWA 3TTOA 1G4PA 1XRSA 3WLTA 4RZ5A 2ZUSA 2DZBA 3VCCA 3L4XA 3S5YA 1O4UA 4JD4A 4UMAA 1W1PA 1MMFA 3UY7A 2VEMA 3VKCA 4WY0A 2W61A 1TTQA 3K30A 2WSQA 4ZR8A 3WH9A 2XG9A 4MYXA 1V0KA 1OABA 4H04A 4JCMA 1VB9A 3UU0A 3NDZA 3M0KA 4UTLA 2HBXA 1KGWA 4NYUA 2VZSA 2CLOA 2YCLA 3S1XA 3TYUA 1GVRA 3W0KA 3GHUA 4LS0A 2HVOA 2BHZA 4IGMA 3EA3A 2XINA 4YWIA 1W1A1 4A4AA 4WY0F 1OY0A 3BOLA 1WB0A 3U6WA 3B9OA 3BE7A 4DXXA 4JNZA 1VFUA 4TU1A 4QRNA 3KVLA 3CTLA 1POKA 3UG8A 2VWSA 1FWDC 1UZHA 1XG3A 2ZXDA 4WKFA 4LU0A 2WLYA 2EG6A 2RDXA 2JIEA 3KFTA 1TMQA 1FBAA 4R5EA 1RJPA 2FZMA 3GYEA 1VEOA 3W1MA 1Z3NA 3GNXA 4YTSA 5BYWA 3MWAA 4OV9A 2YL8A 3AIWA 4JTEA 3OVQA 4F2TA 3ARPA 3V5CA 3DAQA 2A4AA 1U22A 1FDJA 3BMXA 1DJQA 3PNUA 3SIZA 2BBFA 1OX4B 1TVLA 5AFDA 4RKAA 4WDUA 1NDZA 3N9RA 3BURA 1JYWA 3SRFA 1XSJA 3KBJA 3PAOA 4JXCA 2BV9A 2PLJA 1OBAA 3BJTA 4MDPA 3ZT5A 1TPDA 3MVIA 5K4ZA 1W8GA 3SCVA 1ODUA 2EQDA 3NNTA 2CW6A 1A0EA 2A3EA 3R25A 1BHGA 1UWSA 4H6KA 4PUMA 1XSKA 4LAUA 2BMBA 4KRUA 3CYJA 2CZFA 1XC4A 2QVNA 4TMCA 2VL4A 3CB3A 3W01A 1HKMA 4PMOA 1LG2A 1IXOA 1ML1A 3ME3A 1FHLA 4ES4A 3ZJ8A 1RD5A 2VT0A 2VRJA 3KS6A 4LVAA 1I6NA 1CW2A 1R7AA 1E4MM 3CIXA 4J3WA 1AA1B 3C3UA 1PX3A 2H3DA 3UERA 1V6XA 3BICA 3RN6A 1J8VA 4Y6GA 1ZFJA 4Q7BA 1QW8A 1J0KA 4XTDA 2B7QA 1M01A 3G22A 1B3ZA 4GIRA 1UP2A 2G96A 1Z41A 2NLIA 5C55A 2TMDA 4CU8A 2I5IA 1K9DA 4NG3A 1RP8A 3IJIA 3GIQA 5DXXA 2I56A 4F0SA 4WHBA 1FOBA 3VNYA 2E09A 1XGZA 3L5LA 1TREA 2GVGA 4QNEA 4QLLA 2PDJA 1UD3A 7REQA 2D22A 4J7RA 2FFIA 2CC0A 2O4MA 3W6LA 3TX9A 2ZZ7A 5MF5A 3WUFA 4TXEA 3VIGA 5RUBA 5C7HA 4HU8A 5A1AA 3MMDA 2WZIA 3QFEA 1J2WA 4IIFA 4NP7A 3UVIA 4DPPA 1JXJA 5GPRA 3KBMA 1ODZA 3EPNA 3V1HA 6XIAA 3TVAA 1C3FA 3AC0A 2CYGA 1QI3A 4GRSA 4ZFCA 3C2RA 5F2IA 4QQ3A 1MZHA 5DXYA 3F4VA 3VIJA 5GJMA 1HT6A 1BGAA 3WBEA 1MO0A 3C0LA 3HQ1A 5LNRA 1IGWA 4FXRA 3OG2A 2WWCA 1DJNA 1NTHA 2ZFAA 2P0OA 2XWEA 4CLMA 2I7GA 1JFXA 1BSIA 3TUUA 3WJSA 3W7HA 5H8UA 3NEVA 2GOUA 1RCQA 3GO2A 1C9DA 2E77A 1BWKA 4GGBA 4M56A 1Z9AA 2RAGA 4V28A 1TV4A 3CK5A 5AY7A 2P3EA 3LMZA 1J01A 3WH7A 1E1CB 3OLEA 2ZRXA 1OHLA 2WKLA 4P2VA 1BF6A 2WC3A 4PODA 4GFIA 3FGCA 2OLSA 1XLCA 2FMOA 5KTLA 4S3CA 5I09A 2Z0IA 3WFAA 2VC6A 1QATA 4IISA 4G2DA 4FB7A 3VC6A 2EPNA 4N9EA 1DWGM 5IFPA 2DEPA 1HO1A 1VAHA 4PTMA 2OOFA 3I68A 5ABFB 2PDBA 4O18A 3LD5A 4H9VA 3V5FA 3WF1A 3PVFA 4MZ1A 3W1TA 1OJXA 4A8RA 1YLVA 1O6IA 3T09A 3GBDA 1L8NA 2QDGA 2O55A 4XBSA 3P0WA 1JRCA 1D7KA 3H54A 4TOQA 2VJXA 3FEQA 4AHPA 1EZ2A 4C1KA 3WQDA 3R8GA 4PCPA 1QNRA 4XVDA 3H12A 4LUTA 3C61A 4WJ8A 7TAAA 3LGGA 4M6VA 4L5ZA 4PBEA 3FCPA 1XIFA 4OOUA 2VX6A 4ACYA 1EX5A 3SUSA 1KR0A 1UZ4A 2CXEA 3KTXA 4GIYA 3BOFA 5GJPA 3FNDA 1G5AA 4WQ6A 3OP2A 1KXHA 2D2HA 2E8ZA 5I3FA 3WJZA 2VQUA 5FAJA 4YCOA 1KRCC 1X1OA 4M29A 3UYCA 3M0HA 3TJIA 2V5JA 1XG4A 5GNZA 3GUWA 4LPCA 4I9TA 4YL2A 1T99A 3DFYA 4P7LA 4AX6A 5TAOA 3UA4A 3WUBA 1CBGA 4R34A 4N4PA 4O28A 2IMRA 4UQEA 1I60A 3HQNA 4UMCA 4MFDA 4O16A 1OT2A 3NOYA 2ICSA 3HG5A 3W24A 2PGFA 4IMGA 3Q65A 3DC8A 3TA6A 3O0FA 4PL1A 5G4HC 2PPGA 2R9RA 2B7PA 3BDKA 2J75A 4MADA 4MJ2A 1H49A 4A2RA 4Q8WA 1WCGA 3NQ7A 3QC0A 3GY1A 2R91A 1V6YA 3EMZA 1Q85A 4LUSB 1NDWA 3RDKA 1CLVA 4MB1A 4PMRA 3T8QA 4IG2B 5CJMA 3A5FA 3W2KA 4O0QA 5AECA 1EJSC 3S2NA 2VGGA 1IHIA 1L6GA 3RPMA 1ZENA 1G4SA 4IQEA 4F66A 2J8TA 1GVOA 3PC0A 2WCGA 1RPXA 3G1YA 1YPXA 4YTQA 2GSHA 4AMAA 3THUA 1J5SA 1UQYA 2G3IA 5A6AA 3P14A 3I4EA 3P8JA 3BCFA 3TFCA 1W9XA 4P61A 1EGMA 3NVDA 1DP0A 5EMJA 3SUTA 3N11A 4HT3A 1PXGA 5FEZA 1XDLA 1JYVA 3OW1A 1TWDA 2NUYA 4Z0JA 4F9JA 2V3DA 4CEXC 2NUXA 3QYQA 3HQPA 1L8PA 3RLVA 1DWIM 3MTWA 4GZEA 2ESCA 4LUIA 3MMTA 1A5LC 1ISVA 3PZTA 1BAGA 2VD9A 3W86A 4XB3A 1TE6A 5H91A 4J4KA 2PDUA 2Z2BA 1ONXA 4DUWA 1QHZA 5JBDA 3LM7A 2WM1A 2DZAA 2W5FA 3SBFA 4ICNA 1HJXA 4KWWA 4GNKB 2ATSA 4NAFA 1B31A 3TU9A 1HUVA 1QUMA 3C56A 4HTYA 1V6WA 5E1QA 1SR0A 2QJJA 4OFCA 3KE0A 3H4XA 3WELA 1WNOA 4JDYA 2WSPA 3TR2A 1BPLB 3NYZA 2NT1A 1RXOB 3C86A 2V3FA 3QZEA 1S2CA 3DENA 2PDMA 3EXTA 4KFOA 3EYPA 4JTQA 2VOTA 2X0HA 3U7VA 4MKVA 5HMEA 1QPRA 3BLEA 2GDQA 1MRAA 1TWSA 3ALFA 3LERA 5REQA 3TN4A 3CWHA 3CQHA 1AZ2A 4YIWA 3FV9A 5JUVA 4IQJA 4NY2A 1PUDA 4OGZA 5G2IA 1I0DA 1A3HA 4HU3A 3UJEA 1RHCA 1WOBA 3BSHA 3DG3A 3UWZA 4FMVA 2PE4A 3NFUA 3VXGA 1XHGA 1LBMA 2J27A 5HDRA 4ENLA 1ZSXA 2Y7GA 4XAFA 2VUYA 4O54A 3SCTA 4KBXA 4IXHA 1LL7A 4QISA 3DOPA 3TAKA 2Y63A 2OQHA 1B3XA 3GD6A 4XZBA 3G6LA 2RGMA 4AZGA 4ADUA 1R3YA 3S9YA 3VMOA 3ZM8A 4ATWA 1LLZA 3KWSA 5CG7A 1GG0A 1EXBA 1P6BA 1O95A 3DHPA 1OFQA 1KKOA 2DUAA 3AHZA 3W07A 1DE5A 3A9BA 4C6PA 1MNSA 2V2HA 1YQ2A 1TPUA 5DY2A 3OZOA 2FVMA 1RVGA 5A6JA 4EPEC 4ZSTA 1TPB1 4LVDA 1D7FA 1MQRA 3VU2A 4J5NA 4J40A 4MJMA 2Q6ZA 3TZNA 1NOFA 3ECQA 3QR1A 3K4WA 3PK7A 4LGXA 3CB8A 3IIVA 1F9CA 4F48A 4KCVA 1VHCA 1S46A 4HTBA 2I17A 2XIIA 2YCIX 4JX4A 3UQNA 4QG9A 4XIAA 3HJZA 1CB2A 1RLDA 3PZVA 4LUYA 4X2RA 1PTAA 4GQQA 1YXCA 2X1UA 3KTCA 1P6CA 4POCA 2W63A 3LHUA 3DXIA 4GO8A 1C8QA 3TYEA 4NL1A 1BXCA 1ZPTA 3PZ9A 4HA4A 2XN0A 2WMFA 4UC5A 4N0RA 1TZ7A 3OLGA 2VD8A 3W1XA 4ZO7A 3GVGA 4C6NA 1QDSA 3PBWA 4MFEA 1JF6A 4DXVA 2CLLA 4Z1DA 1T5AA 3E6EA 1VZWA 4L4OA 2PDNA 3VMPA 5I3IA 1IZCA 2VEKA 3WCZA 3ORWA 3WQFA 2ALDA 2UZ9A 1XCWA 1EH9A 4BWLA 1PL9A 3QKZA 4BF9A 4NZ5A 2OEMA 2DIEA 5J5RA 2BX7A 4A3QA 1W32A 5HXMA 3CTTA 4JTHA 4KEMA 1EF3A 2XH4A 3P84A 1VFTA 4Q7NA 4B9YA 1LQAA 3FDKA 3ITLA 3AALA 3EPMA 3B06A 3IAPA 4HU4A 1LOQA 2DSZA 2PCEA 3GXFA 4AY7A 4E2OA 2CFFA 3IVUA 2GJXA 5AHNA 2IXUA 4LEFA 4U28A 4OWGA 4C1NA 4JEJA 4ZB0A 2WVVA 3WNPA 3O0KA 2V38A 1VLIA 8RUCA 1NWUA 1GZJA 3R6IA 1NY1A 2QDHA 5CZJA 1K4HA 3CUJA 3V3WA 1S5TA 5D30A 2C1HA 3JZUA 1V02A 3SCPA 3AZTA 5C9WA 1DIOA 4HMEA 1SZRA 5KZEA 4PR4A 7XIMA 1OK4A 4QP0A 3B40A 1L6SA 4WJEA 4GC3A 3N29A 2BSLA 1SPQA 4B3ZA 3APGA 5H2ZA 2YCEA 2CLFA 3GVWA 2WCAA 4AMCA 1A5AA 3PWIA 2X0SA 5DRIA 3WNLA 4GKLA 3GS6A 5F4WA 4MUPA 2CHRA 7TIMA 4OV4A 1BGGA 1NJJA 2XVGA 4X60A 2AOSA 5G4WA 1AFSA 3VABA 5F1UA 1B90A 1ONEA 3TDFA 1W5QA 3IIXA 3WBXA 2CZEA 3UPMA 1M1BA 2Z7GA 1BYAA 4AD0A 3BH4A 2GQAA 2B4GA 1GKPA 4DJEC 1QJWA 1PHWA 3FSUA 1E73M 4OZOA 1ZL1A 3IJDA 3W00A 3GSMA 1KWGA 3WO8A 1UKQA 1FH7A 1S2AA 3ZYZA 2A3AA 1VFMA 1DJYA 4L56A 3HA1A 5CG0A 3NTYA 2ANUA 2WNNA 2Y89A 3B9EA 1OCJA 1N7KA 1MXGA 2G8ZA 2GGEA 2E6FA 2VXNA 3TFXA 4MJ4A 1GOQA 4JNYA 1G7UA 1OIMA 2J77A 1X39A 2VZOA 3RK8A 1JZ5A 2PMQA 1TCDA 4LC6A 1MW0A 2ZZ5A 1U5VA 4GUGA 5CPTA 3WK0A 1EP2A 3W53A 4ACZB 4AEFA 1NFGA 4GFSA 3B3DA 3CMFA 3MJMA 1RA5A 2OEKA 1DJXA 1LTDA 2ACUA 1Y5XA 4AWUA 1EP1A 2VFDA 1ZJHA 1MZRA 3B05A 2WWDA 5A8PA 4LVBA 3WLSA 3QGKC 4UIOA 1JAEA 3PZMA 4WIWA 1A5OC 2YL6A 1KRBC 4ERIA 3BOXA 2NV1A 4GZJA 2XVNA 3HV8A 4AXKA 3MSRA 1OM0A 1FKXA 2XVKA 4QEHA 2KZHA 3ZSSA 3NL5A 3QN3A 1GYNA 3VK5A 3SCNA 4FXSA 2PP0A 4CGTA 1V6VA 4FOUA 3W2UA 3LNMA 1PYFA 3ABSA 3CEUA 4I6VA 1IQ8A 2HPIA 2A0NA 4IGNA 3GDRA 2D1ZA 2P1FA 3F5LA 3MYPA 1PS9A 1WO2A 2GPTA 3HO8A 2DU2A 1JNDA 2NSOA 4IT1A 2H9AA 3LSCA 1YE4A 2VHLA 1TQXA 1SJBA 1SZFA 3V16A 3R8HA 3TAOA 3TSMA 3TTEA 3S8HA 2ZX6A 5B7ZA 4ZEPA 1C91A 2XIQA 4YNGA 4LNCA 3S5SA 3QW3A 1H7NA 3MI3A 3GC2A 1ISZA 2XSXA 3VUSA 2PUZA 2QCHA 2GQ3A 4IMFA 2IKIA 1H11A 1REQA 1XLAA 4BA0A 3TW6A 3R79A 4DAFA 5A8MA 1BSLA 4OIFA 3PJWA 4UTIA 2VNCA 4QFUA 2BY3A 4KMQA 3OHIA 1KFLA 4V15A 5E93A 4QXIA 3S1WA 1UR4A 3S2MA 3DDMA 2GWNA 3MKVA 5A2BA 4G9PA 1TTIA 3JS3A 5DFAA 4WSJA 4O13A 1TV5A 3MSDA 3AROA 3H23A 5TBOA 1TRDA 1IYXA 3PTQA 1RJRA 1RBOB 1V3MA 2EJAA 5HUPA 3BLOA 4KCUA 3FW6A 4J3SA 1Z32X 5T26A 1XQLA 1VPYA 3L4WA 4DUVA 4JKLA 3PJXA 3RXZA 4KF1A 2FGBA 3EDFA 1SSDA 2V3EA 4LS2A 2GGHA 5D05A 3WX7A 4EAMA 4I6KA 4RR4A 4IL2A 1HXJA 1YNQA 2Q3RA 3NZ1A 3CMGA 3C2VA 3BQ5A 2NQ5A 2IKGA 2NZLA 3T0DA 3VKKA 3WQ4A 3C2OA 4IGHA 3OBKA 1AJ2A 5HANA 4AXNA 4L9YA 4RCXA 4UB9A 5JIWA 4QDMA 3BG5A 4K36A 2VYOA 1VQTA 1DL3A 1GEHA 1TV7A 1PZ2A 3F5KA 3WF0A 1OC7A 3G1AA 3MJYA 3RCNA 4GZIA 3TC6A 3SCOA 1M7JA 1VCFA 5XINA 4JTUA 3L5AA 4ZBCA 3IJ6A 4Z2JA 3EWZA 3E1F1 5C6MA 5HMFA 3KXQA 4OBTA 3QZAA 2VZVA 3B03A 1VFLA 2XU2A 4LNYA 5A6MA 3KRZA 1HJWA 2SFPA 2DJXA 1XRVA 2OMAA 1WDWA 3EWBX 4KFNA 3M5ZA 1UPPA 3BLLA 2W67A 2PWFA 1WDPA 4DWSD 2P88A 2WAGA 4LEQA 4JTJA 1E6XM 4RXGA 4B91A 1XH0A 5LGZA 1W5MA 3UW6A 3VYLA 4AZIA 4YHGA 3TR9A 4IFKB 2ZTJA 1E1FA 1XI3A 4PMUA 1LG1A 3ARYA 3O1NA 3UF9A 4XV0A 1JCLA 4DWSA 4CCCA 2XH2A 2LLEA 2ODOA 1R7OA 3B0PA 1UA7A 1XS2A 3KLLA 2PODA 4DZ5A 1UOZA 2WANA 4YPJA 3GH5A 3BZGA 1E6RA 5HMSA 4EXQA 6A3HA 4XG1A 2JQXA 4M6UA 5DF0A 3PPCA 3GXTA 3CV6A 4V1XA 4EACA 2DVXA 3UZWA 3L4UA 2CHNA 4JAWA 4AUBA 4RDZA 2XHYA 4D2JA 3LZ5A 5DY3A 3P60A 2FB2A 3A21A 4AZHA 2A3LA 4IWWA 1H3GA 4S3EA 3PZQA 3WLLA 1S39A 5HATA 1LORA 3EEZA 1H4PA 5JBEA 3KHJA 2OZ0A 3IUHA 4AW7A 4X22A 2OSWA 2C1IA 1A47A 2ABAA 2XISA 1W0MA 1YIXA 1YW1A 4HPXA 4GZ7A 1B2YA 3P0XA 4L4MA 1FCUA 5A6TC 1SZNA 4TX9A 1H7WA 1MVYA 3HPSA 3NDYA 3CWOX 3HPAA 4RLIA 2IQTA 2F7FA 4QSHA 2TODA 4DF2A 1FWWA 1AODA 5IDZA 1JYXA 4NZJA 5DCDA 1UH3A 2B7NA 1LRNA 5LIUX 5H1WA 1GOMA 3BCJA 3NQFA 2Z26A 4XO7A 1P43A 3SUWA 5I24A 3M16A 1LYXA 1JPHA 5CPOA 4HA0A 4OTKA 1TJ2A 1EKOA 3QPYA 3REQA 4WOZA 4RV3A 2CXGA 4LB4A 1UR2A 1M5WA 4DO7A 3VD7A 3B8SA 4HB7A 3WDQA 1IWAA 3HFYA 3M43A 4LYKA 3KX6A 2DZSA 3PUDA 3N2OA 4M7TA 4IL0A 3VD4A 4GYPC 1UMLA 3MSGA 4C6MA 4UR9A 4RK8A 1VJSA 3MMUA 4XUYA 1UP3A 2EEXA 4AWSA 2BHUA 3K13A 3UZXA 5I7GA 4QQUA 5C71A 4UNLA 5D9PA 3L2IA 1NU5A 5CZTA 4UR8A 4RDVA 1Q4NX 3R43A 1ZAJA 1U33A 1OD8A 3GG0A 2Y70A 1X8CA 1RQBA 3WNKA 3FYPA 2KX9A 4QLJA 1JCMP 4DO5A 3TN3A 4H2HA 2R1PA 5HJXA 3AIQA 2EKCA 1DQUA 2F8QA 4IMCA 5LXEA 3WBAA 2CKRA 3GTIA 3W23A 4PC8A 1Z8AA 2PSNA 1B9ZA 2VKZG 1WKEA 2W4XA 3VX0A 5CSUA 5D2XA 5GQBA 4WK9A 3C2EA 3OLDA 2XYLA 4PCNA 1W5OA 1E15A 5EMKA 3A24A 4WY0B 3BW2A 3N3TA 1CI1A 4XUGA 4QNWA 4DJDD 2BGNE 2QKFA 4BR1A 1TJPA 2D3NA 3CUGA 1EIBA 2Y7FA 3TQ0A 1IWBA 4O1DA 4JQAA 3WK2A 3VIHA 3N19B 4DJDA 1J0JA 1ZBWA 2YCLB 5HBFA 1ISXA 4H1ZA 1F4HA 3PTMA 4S38A 1DVJA 1K3UA 2TYSA 3LN3A 3VZYA 4JHZA 1XWYA 2O9TA 4M80A 3VGEA 3HGRA 7A3HA 3S46A 1UPMB 3CC1A 3GVQA 3NL3A 4FNRA 2FH8A 4MG4A 3W84A 4MKNA 2WOQA 3P5ZA 1TX0A 4PL2A 3VCNA 5BZAA 4KEUA 2MNRA 5T91A 3EOEA 4O17A 3T8LA 3GDBA 4ERAA 3GBEA 5M1TA 4K1WA 1E5NA 4Q8UA 3G1FA 3SAZA 4Z1YA 3N6QA 2VEIA 3NR0A 5LNVA 1H61A 1OZQA 2CLPA 5FSDC 5K2ZA 3UD6A 3QSTA 4HPNA 1K03A 4WDXA 1JUEA 3RILA 3P93A 4WD0A 4MPQA 3LPOA 2E1DA 2BHYA 3GXDA 5CGQA 3W72A 3EA2A 4NYYA 1DQWA 1HW6A 4IIGA 4BCEA 1JULA 5L6UA 4IM4A 1G4EA 1KTNA 3CZJA 4JY8A 4I5RA 1I2RA 2QZRA 4LJ3A 4LUJA 1HKVA 2V63A 2WPBA 3BUVA 3M47A 1WDQA 2PDKA 4CQ9A 2PTXA 5IM51 4K8HA 4GIEA 1RAKA 2YXXA 4FO4A 4LV4A 3W27A 2YDSA 2INZA 2NX3A 2J88A 1O1ZA 1WZMA 4E8DA 1GQNA 1KM5A 4ZA0A 1JVNA 1TX2A 1QNQA 1R85A 1F6KA 2ZRZA 3XINA 3QOMA 3SRHA 3RF9A 4K6AA 2V67A 4XQ6A 3UNTA 1Q45A 3SCWA 1A5CA 3DKJA 2CLKA 4IX2A 4PFMA 3D3AA 1VGAA 1UB3A 1OG6A 1KFJA 3Q2DA 2R1NA 1A5MC 3MANA 5I00A 1XV8A 1KM4A 1BLIA 1LT7A 3BLIA 3N3MA 1VHNA 5I77A 3BGGA 4A05A 3S1VA 1L0PA 3WJXA 2VX7A 2O7QA 3R12A 4H2CA 4HZ6A 4J27A 1KWKA 4IIDA 4C7DA 3NURA 3KBVA 4G56A 3VZXA 3WLNA 1CCWB 1M7PA 3HG2A 1WYIA 2GVLA 4JTAA 5DMLA 3QV6A 5D8WA 1K6AA 2XGZA 5G4EA 3NQ2A 7REQB 3CV2A 5U7SA 3NQDA 2UY4A 2DT0A 1K7EA 5LIWX 3N2MA 4R3UA 3UWVA 1XJBA 1UD4A 3B4UA 3RR1A 2BWGA 1RH9A 3MS8A 3T05A 4YMZA 4KETA 4Z2LA 1W9PA 3S6DA 3QHMA 4A8LA 3TROA 3KOXA 3NA8A 4AD2A 1GQLA 4H00A 4LFYA 3I10A 1NOUA 1HNYA 4E4PA 2NWSA 5CC6A 4UFHA 3AHYA 5D9MA 5IRPA 3L0KA 4WLCA 1L9WA 3U2EA 2HK0A 3ABQA 2QMKA 1AMYA 3E0IA 3IJQA 4AZBA 2WZEA 3K4AA 2VFIA 3FY1A 1VFHA 4S23A 1RALA 2EJ1A 3CLWA 1H63A 3S2CA 2UY2A 2MANA 1YMYA 1TV8A 1O5QA 3AS3A 3LV6A 2QPSA 3UCDA 5FF7A 5SWUA 1K9TA 5HPOA 1AQFA 2PA6A 4BQ4A 1G1YA 5DQPA 2ZRVA 4GK8A 1EFZA 4H6RA 4JTDA 3THCA 4GH3A 1QPNA 3BVJA 5K4XA 2EBNA 1EGZA 3SIMA 1JZ6A 3RCMA 3FGCB 1NQ6A 5IFTA 3MCNA 1EUAA 1KM1A 3W70A 4B5XA 2F84A 2V3GA 5BNKA 4W85A 4H9TA 3KWXA 3GKFA 1FWSA 3NQCA 2X40A 1B3OA 4K8GA 1O94A 3HJEA 3P82A 3N25A 1W1VA 4ROQA 1MYRA 4MZYA 2EG7A 3UXIA 3CUZA 1K6WA 2VR4A 1GGOA 1W1IE 5HJLA 3I3DA 4JIRA 1KTCA 4M6PA 3B9DA 1HN1A 5I3JA 3LSBA 1PSCA 1QHOA 1DQXA 4JKKA 4ADTA 4DPQA 2DPEA 1SO3A 2E9BA 4D1JA 3RMEA 1H7XA 4LUTB 2IPWA 2RJHA 4GE8A 2X16A 2C16A 2OJPA 1DJZA 2E25A 2V9DA 3R13A 4PTXA 2RDWA 4QDWA 2YYTA 5A8QA 1E6NA 3U2OA 2Z25A 1ZB5A 5JIPA 4B2DD 3FJ6A 3UWUA 1O5KA 3IJ7A 4MHBA 3S2JA 2ASHA 3P7YA 4JKMA 4GLEA 4R9XA 1XL9A 3NEHA 2QPUA 4IP4A 1IT7A 5BWFA 3BTNA 5DLCA 1XIMA 1SMDA 2V81A 2E68A 1Q7QA 1KGXA 3EA1A 4JIPA 4B2DA 3MVTA 4CN6A 1X6LA 4KQNA 4PRWA 5KETA 2A79A 2D73A 3BLFA 4CNPA 1SO6A 4M1BA 2C13A 1TUXA 1A50A 3E9AA 4RZ4A 2GJLA 4JOMA 3QR3A 3TTYA 1QFEA 1V93A 1AW1A 3AOFA 4ZQCA 1QNOA 3N4FA 1P5BA 1Q6DA 3MCOA 1ADSA 1UWQA 3WDHA 1Z7AA 5F2MA 4L65A 3H6OA 1OFAA 3MQTA 1PAMA 3HIJA 2B81A 5HWJA 4MAVA 4CKQA 3N13A 1BQGA 4H41A 4J3ZA 3CPRA 4Q32A 3TIMA 4H9XA 4XZLX 4P7OA 5F4XA 1R30A 3DBNA 3WDIA 3AZRA 3W1QA 1OSEA 3F4CA 1J6OA 4Q22A 1I2PA 4FSAA 3CT7A 4L6DA 1V0MA 3KRUA 2IPFA 3L67A 3CQKA 2L5HA 2WW5A 3R0UA 5AYBA 4PUWA 3GW0A 1E0VA 4O11A 1AH0A 4Y8FA 3DX5A 4O15A 5D32A 4BFAA 3WF4A 1EWEA 3CUXA 4OE7A 3DGRA 3VDBA 5JMUA 3CQ0A 4G6CA 1CECA 1YDVA 1UUQA 3L21A 4HZMA 1V3KA 1PPIA 3EB2A 5AC4A 4ZQRA 4KKXA 1BTMA 2VR2A 2J13A 1KFEA 2J9YA 2Z1SA 3LRKA 2QCCA 4PMJA 3TYBA 3QBUA 3ID7A 3FA5A 3RPTA 2BVYA 4C91A 1BRLA 1RUSA 4P8VA 5EL1A 1FTXA 5CQ1A 4KWSA 2G50A 4W7WA 3U4AA 4AAJA 3H2CA 4XZ9A 3O6CA 4Z2KA 2HQAA 1BYDA 4AVOA 4N9DA 4AC7C 5F2LA 1TV2A 6REQA 3NQVA 2QXWA 3D47A 2FPYA 4XD5A 1UR8A 5FEWA 2W79A 3IGHX 4ZCWA 4D6GA 2OQYA 1O66A 1RBLA 3WF3A 1GQIA 1I2OA 3P74A 5TQLA 1JAKA 3AMLA 1T0OA 4UUIA 2WSRA 3NO1A 4NAFB 1VCVA 5K9CA 2RFGA 4EIVA 2D20A 1I2QA 4ONVA 5CGMA 3VOHA 3SN1A 4DHGA 1YYAA 4HSHA 3UR8A 1EA0A 4UTUA 4XIMA 1G67A 3OBAA 3W75A 4EWND 3ZT6A 3ZS4A 3AXKA 1EOMA 3M44A 3UESA 2DZXA 2J8FA 3DFNA 3M0VA 5REQB 3BSGA 4GIAA 4PMVA 5BRQA 3E12A 4BEUA 4MY1A 1XLBA 3UYIA 2B7OA 1W1ZA 3CNYA 1OGGA 4NHVA 5EBAA 5D4YA 2O4QA 4HNNA 2PRHA 4W5UA 1ZJIA 3T0AA 3FLUA 1TG7A 1AW5A 4M6QA 4GXMA 3CQJA 4KH2A 2Y5JA 4W9TA 3BC9A 3KL5A 1W17A 2C18A 3O9NA 1I0BA 4UTWA 5CGTA 1POJA 1BXNA 3L7RA 5E9AA 2PRMA 1U30A 2J6XA 1KV8A 2Y1HA 1IR1A 9CGTA 2A3BA 3DU0A 2G97A 3CJPA 1LOSA 2YFNA 1XH2A 2CBUA 2HCVA 3C3NA 4DLFA 3B0XA 4IPNB 3RIKA 1VFFA 2GDVA 1R3WA 1KRMA 5I3HA 4DLMA 4ORIA 3OGSA 4O53A 2ZWYA 3Q37A 2NX1A 1DWHM 4JFWA 4A35A 1DPMA 4HNLA 5K9DA 3LHWA 4B90A 1KXQA 1ZCCA 4D6JA 1G01A 1J96A 3MDUA 3HV9A 4RPPA 4M8UA 3DUGA 4V1YA 1J79A 1Q7ZA 3KCJA 4DYKA 1DJIA 5BXTA 4CD8A 1QPQA 2GLKA 3TKFA 2J25A 1WKFA 4JTGA 3ARSA 3G2GA 1L2UA 1VPQA 2QUNA 1XBZA 4HOXA 2WBKA 1FA2A 5LNWA 3FJLA 2PAJA 1UD2A 3H2NA 4GPNA 2BOFX 4AY8A 4PTWA 2W92A 1CXHA 3VIOA 4E0CA 1EPXA 1OYAA 1XCFA 2F2KA 1QO5A 3IV8A 4JTIA 3ARXA 2PWHA 5BU6A 3JVAA 1GHRA 1OC5A 5A95A 4ZQPA 1BXBA 3LYEA 3SJ3A 2I14A 2Y62A 2Z2UA 3EZ4A 4H3DA 3GKAA 3VINA 4DB7A 1W54A 4ZB5A 1NM9A 2EPHA 1Q6GA 4PMDA 2I5QA 2PURA 3UGVA 2FZBA 3AXIA 1FDYA 2EHHA 1UP0A 3WJWA 3CLMA 2X1SA 1OFBA 3KCOA 3GDTA 4I8DA 2G95A 3C52A 4CN4A 4WSHA 1CT5A 1K4GA 2GJXB 2A6LA 3MUXA 3JR2A 2C79A 4CNOA 2E9MA 5FEPA 4AD3A 3BV7A 3SURA 4QJ5B 1NAL1 4C1NB 1MFUA 1JDAA 3S6OA 3SW6A 1QI4A 2WVVB 3SI9A 1ZJBA 2FDMA 3GTFA 3W1UA 3N73A 2WXDM 4AY1A 1IEXA 1S5VA 3R89A 1JCYA 1MSSA 2Y0FA 4QIUA 3P67A 1CGXA 2VDGA 2A7RA 2P8BA 3RX3A 5LIXX 1KM6A 4MMWA 4DYEA 3NQBA 4Z2HA 3OVRA 3H7RA 1IIHA 3EKLA 1RVKA 1LWJA 4N02A 1VD6A 4GQRA 4WRHA 3TH6A 1RSCA 4IP7A 3LI1A 1C90A 5E0FA 4OJYA 2RHGA 1T8XA 4C7GA 5JH1A 1PDYA 3S9IA 4H7ZA 2ZTKA 1KLYA 2WZMA 4IPIA 5EGRA 3SFKA 5A6LA 1UA3A 3VD3A 3QQ1A 3SM0A 2QF7A 2J7GA 4LB3A 2QIIA 5FIPA 1ZBCA 3IARA 2ZE3A 3W7DA 2CLEA 5FF4A 1EC9A 4YYFA 1GVQA 4N6FA 3S5NA 4LC8A 2AMXA 4RXFA 2YOCA 3CO8A 1YNPA 8XIMA 3N04A 4XAZA 3DG7A 3BMVA 1EOKA 3O15A 5BMWA 2BZNA 2YX0A 1QCWA 4GX9A 5C7VA 5TNVA 3ZZ1A 5HNNA 5C2XA 3SY1A 3NPUA 4HJWA 4PB4A 2Y8KA 1VPXA 3QF0A 1YHTA 4M0XA 4O8AA 3SJNA 3AMKA 4J2PA 2IPGA 3RX2A 2A1YA 3ARQA 3NM3A 3RU6A 4H7VA 3S6TA 1A0DA 3VGGA 4YVPA 3G8EA 4RDYA 1MRQA 2Z28A 1QO2A 3UVAA 1LWHA 1GEQA 3QMRA 3GIYA 1MEHA 4FNSA 3IS4A 3ZWTA 2VRKA 3E5BA 3UR7A 1VC4A 1SZGA 3KP0A 3P80A 1LZOA 3WLPA 1XLHA 4BS0A 4RZBA 3I7QA 3N14A 1K8CA 3KOWA 1AG1O 2C0HA 5KEZA 3B8IA 3KBNA 1Y65A 4A2SA 1XW8A 2QUVA 5C2GA 3N2BA 1T96A 1SJDA 4QDPA 4EPBC 3C2FA 3T4WA 4LVFA 2Q8LA 1E0XA 1RCOB 1BFNA 1GTHA 1CENA 2QCDA 1NARA 3MUAA 2UV8G 1Q8JA 3W7JA 1V6UA 4JFVA 2E8YA 1VIZA 1IZJA 1H0GA 2GQ8A 1SSGA 4R85A 4G7EA 4XKYA 2VUNA 3L4YA 2CZ5A 1HL9A 2GL5A 2Q71A 3DG6A 3FK4A 1E9YB 4KPLA 3MT1A 4JTSA 4DJED 1C93A 3UPWA 2WBGA 1I2NA 2VX5A 2H9AB 2OR2A 5LHFA 5HOSA 4JGDA 5C8BB 4AZCA 4DBDA 2OLAA 3BAKA 4DJEA 3QKEA