4M1BA

Structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
KVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVERIIKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKATLKIAESLGYTVVHWSNNSNDWKNPGVNKIVSTVSNNLKGGDIVLLHASDSALQTNKALPLLLQKLKSDGYEQISVSQLISNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polysaccharide deacetylase
publication title Structure determination of BA0150, a putative polysaccharide deacetylase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4m1bA00
3CL8A 5JMUA 2DFAA 2Y8UA 4LY4A 1W1B1 2NLYA 2I5IA 4NY2A 1XW8A 2VYOA 4WCJA 3CL6A 2C79A 1V6TA 4NZ1A 4NYUA 4U10A 2XU2A 3CL7A 4M1BA 2CC0A 2C1GA 4HD5A 2C1IA 4L1GA 3S6OA 3VUSA 4F9DA 5BU6A 1NY1A 3WX7A 2E67A 2QV5A 3HFTA 4NZ3A 1W1A1 4V33A 2IW0A 4NZ5A 2J13A 4OUIA 1W17A 2C71A 4NZ4A 1Z7AA 4NYYA 3RXZA 4F9JA 2W3ZA 3QBUA
chains in the Genus database with same CATH superfamily
1GVYA 2BXYA 4JKMA 3CS2A 4N9BA 3THDA 5FOOA 3W1PA 1IV8A 4B5XA 2FHFA 1YNQA 3RNDA 3HTWA 1TPH1 3RHGA 3MJMA 4AD0A 2J66A 3D3FA 3ICJA 4S38A 1TCMA 1VC4A 3WD3A 1OFDA 3RLUA 3TSDA 4HSOA 3GIYA 1WB0A 3UPMA 3H22A 1DKWA 3BG3A 5AECA 4C1LA 5D32A 3U48A 3ZLGA 3AHYA 4GI8A 1W2PA 3VOCA 3DFOA 1FHDA 4BKNA 4FLOA 1G7VA 3GHSA 4JN7A 4U5KA 5K9XA 2Y8KA 4LYPA 4DF2A 1HO4A 3ZR5A 5HUPA 5IHRA 2PEVA 1V3HA 4MWAB 2J88A 2Q8LA 1KXQA 4QR6A 1R86A 1QBBA 4DM2A 2WJEA 1GOOA 4PUDA 5DRCA 4QNEA 3T0CA 2PD9A 2XFWA 4XZLX 3CNYA 4IT1A 3W1LA 4C1KA 2HXUA 3AYTA 3G1HA 1UKTA 1H2JA 3FV9A 1KGWA 1MNZA 2HS8A 4IUOA 3TN5A 3SGZA 4YVVA 3CIVA 3VC5A 1V7AA 5AC6A 3M7SA 2NT1A 4NZFA 3WNKA 3VU2A 2C13A 4OUEA 4BI7A 1NIUA 3LSCA 1ZB5A 4H04A 2V5KA 2HVOA 2WXDM 1XJBA 4EVZA 1ZL1A 1QK0A 3DU0A 1UWTA 4CNSA 1X1NA 2JKPA 3EDEA 5A2BA 2HPIA 3UPBA 1A5NC 4LAMA 2HWGA 3BAXA 4REQA 3GHTA 2I5GA 4J4KA 1KXTA 4RZ6A 3D3AA 4TMBA 5C70A 4OECA 3QC3A 1UCWA 3M5ZA 3QFEA 2ABBA 3WFAA 1W17A 1JDCA 2VGGA 3B03A 4HYWA 2VENA 2E5BA 1Q66A 3G6MA 4V2XA 3PPFA 4D6DA 1FWIC 4PEEA 3GNNA 4QQUA 4QX4A 2EJ1A 1J6PA 5BXTA 1EJVC 3TA6A 4IX2A 3T1GA 1ZALA 3W7HA 4IF2A 2A3AA 1OFOA 2HE5A 3ZJ7A 3DC8A 4IJRA 4ORIA 1JDEA 1IEWA 2BVDA 3URAA 2I57A 1FVPA 4WY0F 1BKHA 3OQEA 4LWWA 2V2CA 1JZ7A 4MZ1A 1WYIA 1US2A 3PBUA 4DO4A 4NP7A 4OUIA 3V7PA 3WK1A 1F74A 3EEZA 4H1ZA 4LW7A 4LRTA 4LVDA 1VFFA 4DBDA 4TVCA 4L4MA 4H2CA 2QR6A 3G0UA 3M0YA 3TX9A 1XPYA 1KBBA 4K7YA 1KFWA 4UR9A 1XUZA 3SSZA 2DW7A 1UD5A 5F1VA 3LTSA 3ORWA 2WM0A 1UWIA 3UYCA 3QTPA 4MY9A 3NQFA 1MUMA 2IKJA 2HEJA 4U28A 1QATA 2PDYA 1W1YA 4U3CA 1DHPA 1FWRA 1ZBCA 1PYFA 2C14A 2ZZ2A 2XU2A 3DX5A 1TRIA 2PGFA 3U9IA 1OIFA 2J7DA 2CETA 3ISIX 2PDBA 1QMLA 1OFAA 2P8CA 3N18A 3A64A 5D05A 2ESCA 3GR8A 1TWSA 4E5TA 2WQDA 3GFZA 3NXLA 4R5EA 3G22A 2E6DA 1E5NA 3GNRA 3CV6A 1HG3A 4M6QA 3IACA 2Y6ZA 4HYVA 3NM1A 5JH2A 1F76A 2E1WA 3V36A 3QR3A 1F8MA 3H7RA 5LSMA 4ZQRA 1MW2A 1RK6A 3T40A 1KFBA 3AIWA 1RCOB 4A3RA 1U22A 4X3ZA 3AI0A 3BOXA 3GTNA 1VKFA 3UXIA 3P93A 2PB1A 3S1UA 1IGSA 1GKRA 1PVNA 3GZAA 4RW3A 4E2BA 2YKKA 1TA3B 4YVXA 3NEVA 2J8TA 1TVPA 3GDRA 1J5TA 1F4HA 4XZ9A 3WJSA 4PCNA 2DY3A 5H6HA 3BICA 3GC5A 3FDGA 1K4HA 3OBKA 1WBHA 3A12A 3OVPA 4C6OA 2BX7A 3IRSA 3BTNA 1TMHA 3VDBA 1FKXA 1C9DA 4OFCA 3W2MA 3H7VA 4R53A 3RN6A 2R94A 1Q6OA 1XG4A 4E2OA 2NSXA 3E5BA 3E0VA 1SO3A 1NAL1 1NARA 1C9WA 3C4UA 5MKGA 2TYSA 2D69A 1U5VA 1F2JA 4FB7A 4QLKA 4IQLA 4Z2LA 4OV4A 2EF9A 4KWOA 3AZSA 1M7OA 2Z7KA 4Z2JA 2QF8A 5KSWA 1PWMA 1B57A 5K7JA 5CC5A 9CGTA 3FA3A 1FDZA 1E71M 1HT6A 3EWUA 1I75A 3UP8A 3SCUA 4NAFB 3VXGA 4BQ5A 5I79A 4EXQA 3SZ8A 1KM5A 1O66A 2WVTA 4AY1A 4GYPA 1JJKA 1UH3A 5G4HC 1BF6A 3NDZA 2G0WA 4B15A 2ATSA 2Y7DA 3DXIA 4X60A 2YXGA 2V3EA 4G7FA 1OQFA 4S3DA 3MO7A 4PMUA 2REQA 4LF1A 1X7IA 3S5ZA 1EJSC 3WJWA 2XGBA 5J8LA 3A3XA 2QDGA 1EB3A 1F5ZA 2PGRA 4OOUA 4UNKA 1UP0A 2X42A 4JX5A 1KFCA 3LXBA 2Z28A 3AICA 3KEHA 2E5DA 2EPKX 2VGBA 3A23A 4TX8A 1G4SA 2HJPA 2GK1A 1L6WA 3HFTA 2B4GA 2PC8A 3PM6A 3MHGA 1IR1A 5DANA 2OKOA 4JS3A 5AVNA 2EGZA 4Z1DA 5A95A 1UB3A 4AEOA 1R7AA 4DVOA 3HQNA 3UG4A 4JTQA 3BJFA 5KZEA 3BVJA 4JR5A 1J11A 4P7QA 3WQPA 2NLIA 2A7PA 1C91A 4ZO6A 1DJGA 1W31A 3CQKA 3THUA 4L4OA 2NXIA 3W9ZA 2QUMA 3TAOA 1IT0A 1EJUC 2ZUWA 3R58A 2D22A 1GONA 3MHFA 3W7RA 3PWIA 5E70A 4XZNX 3O6AA 4A4AA 5RUBA 5CLTA 1JZ2A 3ARUA 1P5BA 2QDDA 3NUKA 1R47A 3NZGA 5HOSA 3UGVA 1OIMA 4UCFA 3FSUA 1AQHA 1TPUA 3S2CA 1S5TA 4Z42C 4I6KA 4BWLC 1UYQA 2OU4A 5EU9A 2QMJA 2WC7A 2DT0A 5BMWA 1KC7A 1SZNA 1W1A1 2GVGA 1FFRA 1EC7A 4O1CA 1RJRA 3W02A 2P76A 2ACUA 4RPPA 3CUGA 2XINA 1AQFA 1LT7A 3SB0A 4O8RA 1TMQA 1DJHA 3PBYA 2JK2A 2Q02A 1YLVA 4FX8A 2NQLA 3TXZA 2ZA3A 4DAFA 5HPOA 3ZQ9A 1KXVA 4LVAA 3AMCA 1V51A 5KZMA 1E6QM 2E7FA 1UR3M 4R7OA 2XZ7A 1UASA 2FVKA 4AZCA 3AXIA 1TQXA 2PD5A 3BAWA 4HHLA 1VFLA 4HSHA 5C9ZA 4ZSUA 5JUVA 3UWYA 1CGTA 4XBKA 2LLEA 4YWIA 4MWAA 2A3HA 5D2VA 1UD3A 3DKJA 3UJ2A 1J8VA 1AL7A 1KTNA 2BSLA 1TWDA 4RDZA 1NOWA 1UUOA 4MNKA 1XRVA 4TXEA 3OOQA 1XWYA 3O2LA 3U2ZA 3GVQA 2FTYA 4HHPA 4AH7A 1S2TA 3W73A 2OVLA 1CYGA 4L6OA 1HJWA 1WKDA 1PE1A 4HNLA 3USZA 2YIHA 3FN9A 3A9IA 1Q6CA 1H41A 3LM3A 3W7EA 1XD1A 4ZEPA 1A4LA 3MUIA 4UTTC 2DJXA 2B7QA 3C0QA 4HB7A 4RXFA 3UESA 1SR0A 4BFAA 4PFMA 3W7QA 2MANA 1LBMA 4MWAD 1ZFJA 3G1SA 1DPMA 3ELFA 3PUOA 2XH2A 2GWGA 1K77A 2SFPA 4P7NA 1KBKA 3KFTA 4YHEA 5C6MA 1ZJAA 2VCBA 5LIKX 4FLSA 1CECA 2YW3A 3LBCA 4GQQA 5LIWX 4ZB5A 2Z29A 4S1FA 1D2KA 1KM4A 1ZLPA 2TAAA 1QNPA 4X9YA 5C0QA 2OJPA 3F1QA 3BSMA 2VJXA 3CJPA 1LUCB 3BLPX 1KWKA 1T8XA 3T2OA 1YNPA 3PB2A 3JW7A 4Q4OA 3SR7A 3VOJA 3CZEA 4PULA 5CPOA 4BZYA 1AODA 1J4EA 3NVTA 5C5YA 4GIEA 5ENLA 2VT0A 3HPXA 1KWGA 2VMFA 4DI8A 4GO9A 4W9TA 4IZGA 1T6MA 4JNYA 1BQCA 4LPCA 1XD0A 2BDQA 1G6CA 1PZ3A 3L9CA 1H7XA 1GZJA 5EA9A 3K8LA 4WKAA 3ZJ6A 2DJLA 3LD5A 1HKIA 2OG9A 4RLIA 5A6JA 4HBKA 3DHPA 3VIHA 3NGFA 2V82A 4GFSA 1W3HA 4HD5A 4UFKA 3CLMA 4AY8A 2VZTA 4O4VA 2WC4A 1A3HA 5CAHA 4A2SA 4LVFA 4AIEA 3CZLA 4GFIA 4K2SA 2V3DA 4MYXA 3W01A 1WDRA 2FZDA 4FXFA 3HF3A 1SW7A 3GNDA 4G6CA 3IGSA 1KTBA 4US5D 2KX9A 3H2AA 2ZOXA 3M16A 3E0WA 2NV1A 4YU1A 1WDPA 2Q71A 3L66A 2V5JA 1PEZA 4N6EA 2OWCA 2UZ9A 4M82A 2XDFA 4MDOA 3PTKA 1CCWB 4AIOA 4DBSA 1H7OA 2VZSA 1BGAA 4FIQA 5EL1A 2QIIA 2QUNA 2ISWA 3P2VA 2QCMA 2Z1SA 4OBSA 5C71A 1DWHM 2F2KA 3B04A 4UMCA 5EYWA 5F4XA 4GINA 2EPLX 4ZOBA 4HA0A 2JF7A 3OLIA 2Z00A 3WDJA 1LOLA 2DORA 3R94A 1POJA 4HMCA 4H01A 3WENA 1HKKA 1EYEA 5AC7A 3QVQA 4Z2IA 4IIGA 4QROA 1A5BA 3RLHA 1KM3A 4V1XA 4UXDA 2ZZ1A 4IJCA 3KS6A 3W29A 5FAGA 4FXSA 1OFRA 2ZE0A 3PZQA 1TA3A 1P0DA 3SUWA 1TREA 3T0BA 3UG8A 1JPKA 3OB8A 1LL4A 2DZWA 4GI9A 3DI1A 2GJXA 1GG1A 4XO6A 4GACA 5AOUA 5ABTA 1S39A 3LM7A 3UU0A 4CCDA 2V5LA 1QHOA 3R6IA 4WSKA 4Q8OA 4UQAA 1HKJA 1L6FA 1P0NA 2Z1VA 4DBEA 5IM51 1P43A 3NURA 4AG0A 4NHVA 2XIOA 3NR0A 4C6BA 1LLWA 7CGTA 3JS3A 1V08A 3R1ZA 3W1UA 4GUGA 5FD0A 1YXDA 4TTGA 4IPIA 1KV8A 1Y8BA 2TMDA 4E38A 3WBWA 2XM2A 3LOTA 3PJUA 2Z1XA 3QQ1A 4ERAA 4B90A 3H24A 3C2VA 4HT3A 4NAFA 1EIXA 2Z7GA 3DFHA 2WNNA 4GJJA 2EPMX 3TQ0A 3DYMA 2JKAA 1R38A 2CLKA 8A3HA 3VILA 1Q63A 5LXXA 3GVRA 2UY4A 4M1RA 1DIDA 3H55A 3GRIA 1Q85A 5AVHA 3K13A 3BZGA 2PP1A 1JPIA 3G1YA 2CERA 3QN3A 2FGZA 1TTQA 3IPWA 4PZVA 4PMXA 4UOJA 1PX8A 2PDQA 3KHJA 4JQ2A 5A6SA 4IFRA 3WN6A 4C65A 2QAPA 3BQ6A 4WOZA 4MHBA 1TPVA 3ITGA 4QS6A 2WHKA 4O19A 5BRQA 3R0KA 2X8RA 4S3FA 1REQB 3AALA 4PCPA 2RDUA 1ME9A 3AZTA 3WBYA 4ZOAA 2ZX7A 4JCLA 4GH3A 5F1UA 3W24A 1SW3A 4F3HA 1JDAA 4I8YA 3QPEA 1GEQA 3ARQA 2AKMA 3G3MA 4AWTA 5DMMA 3S5OA 4MYAA 2OYMA 3CEUA 1C8XA 3PNZA 4RXGA 4GX9A 4AVFA 2PS2A 3P60A 3T9PA 5I3FA 3VM7A 3DENA 3TMQA 3TTOA 2IKGA 3HB9A 3CHDA 1G94A 4ZBCA 2DZSA 3PFRA 4MFEA 2OXNA 3L5AA 4Y9OA 3CO8A 4HA3A 5CG0A 1SGJA 4HZ6A 4IQDA 3I65A 4QNWA 4AX6A 3H4WA 3PTMA 3LS9A 3ARRA 4QLLA 2ZRXA 3W1QA 4W87A 3BLLA 3VIPA 2QUVA 3WDPP 3LDVA 4CN1A 3TSMA 3W86A 3WMLA 2PLJA 3I3EA 3H4GA 2V5BA 2INEA 1JPHA 3ITYA 2WVVB 3VKDA 4AYGA 2C1IA 4NILA 1NY1A 4KF1A 4UCGA 2OLAA 2PF8A 3CWOX 4H9UA 1JGIA 4GNKB 1LT8A 4AD2A 4LXFA 3CZGA 5D2TA 2CCRA 1W1B1 4FNUA 3LCFA 4EF8A 1RY0A 3JU2A 4GQGA 5CGQA 4AXNA 8CGTA 2BB0A 1F3TA 2VP8A 4P8WA 1AA1B 3PZUA 1TWZA 2W9MA 3MJYA 4MAVA 4W5ZA 2Z6IA 4DJDA 4O14A 3L0NA 2PBGA 3F4WA 4G1NA 2DSUA 4ADSA 2HVNA 4NU7A 1GVOA 1UH2A 2ZUNA 4UNLA 1L6SA 2GQ8A 1KCXA 4GY0A 5KTLA 1A3XA 3TYZA 1OT1A 3MVIA 3MT1A 1OFQA 5I0DA 4AZ7A 1V0LA 1K9EA 2CZDA 5CLWA 3C2RA 4H8HA 4KS0A 4UFLA 1XYFA 1P1XA 3A13A 4GI6A 1VRXA 3HMCA 5D9PA 4BJHA 2NVAA 1OT2A 4CD4A 3DIPA 1UKPA 2BZNA 3KTXA 3RO6A 1ENUA 6ENLA 3MKCA 3WDQA 4FEZA 1ZS2A 1XIBA 4F0KA 2CBJA 4Z0SA 3GXDA 4ALDA 1OYCA 3KRSA 4XV0A 3PY2A 2BS9A 3L4ZA 3ZXWA 2DZXA 2PZ0A 1E1FA 1JZ6A 5AHFA 3SN0A 1ODZA 2NVDA 4DJDD 2ZC1A 2A3CA 2DSKA 3W37A 2YL5A 5IBXA 3IJ6A 3LRMA 1N8IA 3NQAA 3VC6A 3QMRA 4KEVA 4O4WA 1LUCA 1HKWA 5KMYA 3W88A 2D2HA 3TQVA 4ZENA 3F2CA 4NI3A 2VC9A 2P88A 2D0HA 4WDWA 5I5RA 2G3JA 4I90A 2OX4A 4WZHA 1XKJA 5DY2A 4EE9A 3B0YA 1KNWA 4DRSA 4FIRA 9XIMA 1O5KA 3E2RA 4MJZA 4IIHA 2HDJA 2FZ9A 2XG9A 3CHVA 1K9DA 4LNYA 1ELSA 1DWJM 2BBFA 3NG3A 3HQOA 3VX1A 1QWKA 3NPUA 1GPFA 2ALDA 3PJWA 1TR9A 3UZWA 4W8BA 4C6KA 4PUWA 4LBUA 4CNNA 2VOTA 3BMXA 3S1GA 3EAUA 2NQ9A 2HK1A 2TRSA 5LA0A 3FJ4A 4MY8A 3E0LA 2R8WA 4RCXA 1EO7A 4W93A 1BSIA 2Z6JA 4V27A 2C91A 2EXOA 1KCLA 2CHOA 2XSAA 1XR2A 1TWWA 1MFUA 1EDTA 3VFCA 3MKVA 3NO1A 1QT1A 1XGEA 1NWTA 5I07A 2F6UA 5DY3A 1QO2A 1LWIA 4LX4A 1X39A 1UMYA 1J96A 1MYRA 2JBMA 5A69A 4LSBA 3WMSA 5I24A 1L9WA 3NWRA 1GEHA 5FIPA 2XVNA 4QRNA 1UZ1A 2DT1A 1Q3NA 2NV9A 1IWBA 3CIWA 1WKEA 4KRZA 3PF3A 3IJ7A 2OSYA 3OZMA 1T5AA 4DJEA 1XI3A 1Q8AA 3VFLA 2VFDA 5A8NA 3IJLA 1VAHA 3S83A 3UZYA 4ZB0A 3D46A 4UTWA 3WJXA 3EPOA 1VHCA 1W9VA 1JPMA 4ZMGA 1QPKA 2NW0A 1QVBA 4ROQA 2G3MA 1TV7A 4D6FA 2XFRA 3UG5A 3GKAA 3T0TA 1NQ6A 2Z27A 4ZE5A 4AVOA 1RUSA 1XCFA 3W7IA 2ZTKA 4K8EA 1NQKA 1FXPA 1Z89A 3N11A 4MJ2A 2E8ZA 3RAOA 3RPTA 1QPNA 3WLLA 1YIXA 2ISSA 3EZ4A 1BVWA 4GLEA 3QGKC 3CWNA 3GDBA 4ZO7A 4DJED 4IWWA 3STFA 5E1QA 1KBIA 1FWCC 4O12A 4O1BA 1OK6A 2YX0A 3WF1A 1XSJA 4ZQMA 3UJEA 1GTEA 3BWWA 5K4XA 4ICMA 1QHPA 1BYCA 1DIKA 1I9CB 5E0FA 3P7YA 5A3HA 1F3WA 1YEYA 4HCDA 2BHYA 3O06A 1WXZA 4N0RA 2F38A 3DI0A 3H2CA 1DOSA 2C79A 1HJXA 3UCCA 2A7NA 4LYKA 4LS0A 5EY5A 3FKKA 1QNOA 1E6ZA 4UTUA 1TPC1 3UXAA 2W0UA 5HWNA 4I8DA 4KETA 3AQUA 1MW0A 2PTDA 3R0UA 5D8WA 1GORA 5FEWA 3VZYA 1OYBA 1KFKA 1VFOA 2CXGA 3QLLA 1S2UA 2ZRZA 2FLIA 1RA0A 1B31A 1O1HA 1REQA 3UY8A 1WUEA 4TR9A 3KBSA 1U30A 2PTWA 4WY0B 2I5IA 3B4UA 4H6EA 5EMKA 3E96A 1I0BA 1SZGA 2YBUA 3LK6A 2HE8A 3KX6A 3UGRA 3U7BA 1UIOA 2ZA1A 4KBXA 1W0MA 1AL8A 2YL6A 4Z08A 3SRFA 3W7OA 3QBUA 5AYYA 1O60A 3WD2A 3GHRA 2NZLA 3VOIA 1YBQB 1MZRA 4POCA 4WDTA 3R43A 4ACYA 6CGTA 2XPKA 1Q6FA 2B7OA 3WBXA 2RDWA 2VCCA 5A2AA 3CPUA 1XH0A 2Z1BA 3V4BA 1GOMA 3WJYA 3M0KA 4ADTA 4NUWA 3TTYA 1V77A 3I7SA 4Q22A 1W1VA 2CLFA 2GSJA 3HPZA 2PDKA 2PFHA 3LI1A 1XBVA 1MSSA 3BG5A 3SADA 2CLMA 4PMYA 1JDDA 5GNXA 2VEPA 3FYOA 2W92A 3TXVA 4M5PA 3ALGA 4PUJA 3HBLA 3S2LA 4PODA 9RUBA 2GVJA 3GNXA 1FX6A 3MMDA 1LQ0A 4H00A 2PWUA 1LRQA 3ITLA 1ISYA 4L9YA 5LIYX 3MV11 2WVVA 2DUAA 3IJ8A 4UTMA 1RBLA 3KP1A 3FSTA 3EMQA 4P7OA 1HP4A 3WBAA 2KZHA 1U83A 4AIBA 3O63A 4X0VA 4Z1CA 1J5SA 3OW1A 3F03K 4AY7A 1UBPC 2YBVA 1H51A 3FCPA 4LU0A 3BK0A 1CGYA 5KEZA 3N3TA 1TVNA 1QAPA 4JTUA 2QLYA 3ZMRA 4ICCX 4XG1A 1FWBC 3CV1A 4GNVA 1SJDA 2JIEA 3EOEA 2JF6A 4LYRA 3EEGA 1VYSX 4XUGA 4DNMA 3VIOA 4G7EB 3DG7A 2VX4A 1TZZA 1DXIA 2ACQA 2ZUSA 1QU4A 1WAUA 3LQLA 3LCIA 1N7KA 4UQDA 4RNHA 1UOKA 3G1FA 1R3WA 3AHTA 3NTYA 1Z42A 3WNNA 1VCVA 2PODA 3G2GA 1JCLA 3C3NA 1HJVA 3WK3A 4WJXA 1CLVA 1VD6A 2ZZ3A 4UQ9A 1BWKA 2GDUA 2DZVA 1HUVA 1ICQA 4W7UA 3AWNA 3WYZA 1EO5A 1V3LA 2DSWA 1T41A 3VNYA 1M03A 4IPJA 4JYDA 4XKMA 3W1NA 4ENLA 5C9XA 3A3HA 4TX9A 1EF3A 5EPDA 3HGOA 4MLJA 3W2NA 1QPOA 4CKQA 1CT5A 4CNUA 1K6WA 4N02A 5E9XA 1H62A 1NTHA 3RITA 2UY5A 3EMCA 2XH7A 4LYQA 4ZODA 1H5VA 3OO2A 3IJDA 3NYDA 1BD0A 1W3LA 3A6OA 2EG7A 4BWLA 3KS5A 4K38A 1GCYA 2Y7GA 2Z26A 5M3WA 4JGDA 4CVWA 3MMTA 2W66A 2YBTA 3QFWA 3ZR6A 4C6PA 2OKTA 4S23A 5J5DA 1FCUA 4U10A 3KBWA 1YXCA 3TZNA 1QPRA 1I8JA 3ZZ1A 3H12A 5ABEA 3SIMA 3E2SA 1QW8A 3V0TA 1F6PA 3SCOA 4P8UA 1M1BA 4F2TA 3EA2A 5D9MA 1VP5A 1JAKA 5C9WA 3GXFA 4CEXC 3GTIA 3PVFA 3STGA 5BZAA 4LALA 3GTXA 1I60A 5XINA 4KERA 2PU1A 2QJGA 1SPQA 7ODCA 3PG9A 3T08A 1SFJA 3IUIA 4MB4A 3VVGA 1CIUA 3LNPA 1I2QA 1W91A 1X38A 1IWPA 1K3UA 4FA3A 3L4TA 1XIJA 3AHXA 2VM8A 2J6XA 2J78A 4ZQNA 3LXAA 1TPEA 1OB0A 2YCLB 4PB4A 1SMAA 5JMUA 1GW1A 5BXSA 3UWEA 4ZTXA 4DYKA 1RBAA 1CXIA 5AKQA 4IMEA 5CG7A 4IFKB 4UTTA 5LXEA 4HQVA 4L1XA 2R6OA 3BSHA 4M8UA 5EKYA 1KLYA 1IYXA 1WZAA 4ATLA 1FCBA 2R1LA 3NSMA 5DT7A 2OEKA 4DZIA 1AD1A 1JFXA 1KFLA 1W9PA 2NQHA 2QKFA 3NCOA 4LC6A 4H2HA 4AC7C 2OZ0A 3IIPA 1O4UA 3O15A 3N9KA 4UZUA 2ONEA 1VPXA 1UQZA 3NEHA 1I2NA 3FEQA 4YTTA 3C8NA 2H90A 2WLZA 4XAPA 1ZU8A 3Q4DA 1UG6A 1W2VA 2VR2A 3NFUA 1D8CA 5LGZA 4J3SA 3STPA 1AVAA 1GQKA 2CNCA 3ZSTA 2X41A 3BCJA 4JZ5A 4CNPA 3A4XA 4DHGA 5A2CA 1ZNNA 5CJMA 4AD3A 2AAAA 1U5JA 4NL1A 2OT0A 2PDLA 2F6KA 3KBJA 2HQAA 1WDQA 1F3XA 4B4FA 1FA2A 3IRDA 4WHBA 4U2YA 3ONCA 3T0AA 3JR2A 4HU3A 4LS2A 2QCDB 2ZRVA 4ZE4A 2G95A 2RGMA 1TV2A 1NDZA 2D2GA 1E6NA 3GAYA 4LUSB 1JD7A 5AC5A 2ZE3A 4L56A 8XIMA 3GXMA 1VJZA 1OZQA 4Y9PA 3M6YA 4IMGA 5BXPA 4LQ1A 3G0XA 3MHUA 4YL2A 1GOQA 5A6BA 3N17A 3CHCA 3WLPA 3S2JA 2ISFA 1XIDA 4FO4A 1F9CA 2Y8VA 1NF7A 4NT0A 3CUZA 3ANUA 5CSUA 1J18A 1H3GA 4LGXA 1W3TA 3H2EA 4GXPA 2IS7A 1YADA 3GKFA 3TW6A 5AY7A 7TAAA 4RE4A 1CXKA 2YB4A 4BF7A 4QG8A 5I77A 3LHYA 4C6MA 5HUOA 2ZADA 1UW9A 3N13A 1I4NA 4AX7A 2AL2B 4JTLA 2D0GA 3B8WA 2I17A 2X1SA 4DYJA 1FWJC 2X0HA 1QK2A 4O16A 4HMDA 3CMJA 3UYIA 4C6IA 3S2NA 1E43A 2VGFA 5C54A 1ONXA 1YBQA 1ML1A 4LEQA 3W1TA 2O55A 2P8BA 1GYMA 1VBJA 4AQLA 1NEYA 5A8QA 5A6BD 1XBXA 3S6DA 3G0SA 1DTNA 3WLQA 5IRPA 3IJIA 1X7FA 3WQDA 2XWEA 4E3VA 1LL6A 4DB7A 2VC7A 4OIFA 3AIRA 4ZFMA 3RU6A 3ABQA 5D9NA 5JBFA 2XH4A 3N4AA 4CD6A 3ARWA 3UW6A 3E3HA 4R7JA 4CQDA 1VFSA 3R0DA 4FMVA 4BA0A 3EX4A 3DUGA 4TMCA 1X97A 1AJ2A 3PNUA 1EL3A 3GG7A 3I4KA 3AIEA 1W3KA 3MMWA 5HJXA 3SRDA 4AMAA 4AU0A 1LL7A 1PTGA 3II1A 3T0DA 3K4DA 2AGTA 2FHCA 2HZGA 2DFAA 4C6EA 4JQ3A 1PV8A 4Y7EA 2PWGA 4GG9A 3N4FA 4JTCA 3N2BA 3B0XA 4PMOA 3WJZA 1GVFA 3T7VA 4U3AA 1S3HA 2DPEA 3T6CA 1E72M 4L80A 3M64A 4LT9A 2PLKA 4NQ1A 1CGUA 1XLGA 1AW1A 1R9ZA 1MXDA 3AMKA 3IS4A 4Q4KA 2D23A 3DHFA 1EUAA 3SBFA 2CC0A 1H7WA 1V6VA 1A5CA 3FGCB 1V3MA 1A53A 4G7EA 4FXRA 2CLHA 3SN1A 1OC5A 2VZVA 2BHUA 3SDOA 3HG5A 3I6RA 2YW4A 5CCZA 3UR8A 3GIQA 3AXMA 4UQCA 4HVXA 3VABA 3VIIA 3RRXA 3TE9A 3WEZA 4O57A 3ZT5A 4GOAA 4UNIA 3ZWTA 2O56A 1RLDA 5HXMA 1Q4NX 1K7EA 2P10A 4LC8A 1WXYA 5XIMA 1SR9A 4NXKA 4Q4QA 1VPQA 1EEXA 2C8NA 5LNVA 3A21A 5B7ZA 1WX0A 1Z3NA 6XIAA 3OLDA 3GFXA 3OU8A 4RJEA 1O94A 2ZZ7A 1KGXA 4J3ZA 3WX7A 4M6UA 1EPXA 3LLDA 4GWEA 4IL0A 1EC8A 1H7NA 3PSWA 2AOSA 4UR8A 3WF2A 1TJ0A 2E9BA 2ZDSA 1JYVA 4PC8A 1IEQA 5FEZA 5KETA 4Y8EA 4W8AA 1K6AA 1LYXA 3TN4A 4PTXA 3EXTA 3W71A 5J04A 3W70A 5CC6A 4MNMA 1B54A 4NJJA 1E5JA 1OF6A 1O5XA 3T2PA 3SQSA 3WLIA 2XN1A 3TH6A 5CSRA 4AIUA 1EH9A 2YDQA 4JIPA 1B3OA 5M5DA 3F4NA 4EANA 2G50A 7TIMA 1UWSA 3WL1A 3NQ8A 4HK7A 3DEQA 3QOKA 3E6EA 4J1OA 1PKYA 4L65A 4GYKA 2QIWA 3PPCA 1XC6A 4S3CA 1US3A 3NXFA 4X22A 2VI0A 3PPGA 2J24A 1OADA 5CPSA 4GVIA 5T9CE 2DVTA 1JPDX 1V8EA 5EMLA 1XIFA 3LSBA 3HPSA 2XIBA 1UA3A 2DZAA 2V0TA 1YW1A 4J5NA 2FJUB 3GY1A 3L2LA 2VGIA 5TD4A 4B9ZA 3RFAA 1Z9AA 2I7GA 3N9RA 1CXHA 3LXCA 1NFPA 1WDDA 5FEXA 2WV8A 4IISA 2J79A 2FIQA 5EMUA 2DIEA 1YDVA 2PDJA 1UR2A 2PDUA 2VZUA 1U33A 3MO4A 1B2YA 4F2BA 3RYSA 1VBGA 1T40A 3CZ8A 4QAWA 1E55A 2QNEA 3K1DA 3LZ3A 2YCLA 4WQ6A 4CU7A 4HPGA 4DZAA 2YL9A 4B92A 3W07A 6REQB 1YDNA 1J2BA 4S3KA 2NUXA 1F61A 3AYRA 3DZ1A 1R9YA 1E6RA 3U7VA 1JCTA 3QV8A 1QNVA 1UZDA 4IFKA 1JUBA 1MO0A 2Y61A 3TYCA 3NO5A 3CAWA 3B40A 5D37A 1CEOA 3WL0A 3C2FA 1EX1A 3JUGA 3AHVA 4D1JA 3UBPC 1UP2A 3UZZA 1DJXA 4V28A 3OGSA 5HA7A 1I2PA 3UR7A 1HIZA 4XZWA 4TU1A 3PJTA 1L8PA 3GLCA 2XVGA 3AZRA 3FYPA 3SCRA 1TE6A 3QY6A 4MAZA 1XLLA 4HNTA 4I7VA 5GJNA 1GT8A 3OYXA 4YYFA 2WYSA 4JFVA 2NWSA 2RH9A 2Z2BA 1XGZA 4NZ1A 2V67A 3QC0A 2PDPA 3BURA 4JQ4A 5D30A 1W1ZA 3U8GA 1GG0A 2XM1A 1MRQA 3CUFA 1HL8A 2HV5A 2VKZG 4I9AA 2PUZA 1H50A 4HU8A 3P67A 2P53A 3W26A 1UD8A 4H8UA 4LJ3A 3OA5A 3U5YA 3OYZA 5FL0A 3MUAA 1AQMA 2VWSA 2DEPA 2GVEA 4RPQA 3WKZA 1NP2A 1OGSA 4K36A 1SO6A 1EJ7L 3B8DA 1DVJA 5CSSA 4NSBA 2FYMA 4MVAA 1RPXA 3NPXA 3IAQA 1PJ9A 2QCDA 1ZSXA 2ZWZA 3HQPA 4UOQA 4UFMA 3VCRA 1GYNA 1TSIA 4LUSA 1OYAA 4NIRA 4GGHA 1P48A 1ZBVA 3V35A 5AYXA 3M0HA 4CNOA 1XRSA 1C90A 3FYYA 3P6LA 2AQVA 4XAZA 4A3QA 5LGXA 3N14A 3ZWSA 4I5RA 2ZUUA 4XSMA 3WLKX 1AJ0A 3WD1A 3LGEA 3VDHA 3CIXA 1QTWA 2CU0A 3W76A 3TSBA 1H61A 5I3GA 1FHLA 4JL1A 1FQ0A 2QDHA 3WG6A 4HPXA 3NQCA 4C1NB 3M5XA 1JXJA 4O28A 4M56A 4MSSA 5CPLA 3AYVA 2ZX9A 1DJQA 3GM8A 4JTHA 1W3JA 2NLYA 2GGJA 3P80A 2DP3A 4CNTA 2AL2A 4W88A 5FJUA 3EPMA 1Y7VA 3KOFA 1BG9A 4FLRA 1BWVA 4OBRA 3BJSA 4TX6A 4LF2A 1TRDA 2OPJA 2Z24A 4WKHA 1V3KA 2WNWA 5CEWA 3CAVA 2ZZ6A 3IIOA 4OJYA 1E0WA 2QUUA 2VX6A 3ZT7A 3AFBA 3MVTA 1KR0A 2V69A 3I68A 1RY8A 3E02A 5A8GA 2DH2A 3I6EA 2QVHA 1PX4A 1XYZA 1Q6GA 1E0TA 5HBFA 4AZGA 2B0MA 4GO8A 3SUSA 1H09A 5AZ0A 1GNXA 4RNFA 2H8ZA 3FVMA 3RF9A 3M07A 5DO8A 1OJXA 4E8GA 4IL2A 3NQDA 1DXFA 2A2IA 4Y96A 2Q01A 5KZ6A 2R14A 3WFLA 1MVYA 3IK4A 3B3DA 2WNZA 5FCZA 2D2OA 2ZIDA 3ATYA 2P5NA 3CTTA 3VGBA 1JEZA 2VDGA 3OGVA 2ZUTA 3AS2A 4V33A 4Q6XA 3T78A 2WSPA 5DEZA 5D02A 4HKPA 3FLUA 3NVDA 3WH9A 1U1HA 3LMYA 4D8ZA 1U1JA 4GZIA 4AF0B 2IXVA 3TNBA 4JAWA 1OM0A 1E56A 4N4QA 1BRLB 1X98A 3A22A 3PZIA 5K3VA 4N7QA 4S2BA 4YTSA 2GQ9A 1TQJA 3FGCA 4S3BA 3C56A 1KRCC 1DWAM 1YTKA 3H21A 1DJZA 2ZZ4A 3MDWA 4ZL1A 5IFPA 1BPLB 2GGGA 1WXJA 2P0OA 3G1XA 3BLOA 4Q32A 1LRNA 5H1WA 2GQAA 1IT8A 1BFNA 1WV2A 4GQRA 4D6HA 1EJTC 3PBVA 5HR6A 4GUHA 4NJGA 4CN4A 2A6NA 4ACZB 3TJ4A 4GY1A 1GTHA 2MUCA 4YPJA 1JZ5A 3L4WA 3NZRA 2RHGA 3N2MA 1A5MC 1CZ1A 4LUIA 4KRTA 2A85A 2CZFA 5DBUA 3T44A 2VX7A 3CU2A 1KM1A 5MHBA 5FKYA 2Z0IA 1IZJA 4NRSA 3V18A 2ZRYA 3ABRA 4F4RA 3EWZA 3HJEA 3WQCA 5A1AA 1C3FA 3ATZA 3LTPA 4GNJA 3W74A 1A5AA 4KWUA 3RIKA 5MF5A 1S5WA 4AC1X 3QSTA 3B8TA 3EPNA 3QPZA 2VHLA 3DESA 2ZWYA 3R12A 3FIGA 1Q6LA 4N9DA 4RUBA 2PCEA 4MY1A 2WSRA 1V6UA 2V9DA 3K4WA 3ABOA 1RV8A 4O53A 4PUUA 3LLXA 2VWTA 1GKQA 3PC0A 3HM7A 3VKKA 2H8XA 4Q8VA 3WQVA 4CCEA 1M5WA 2YCIX 1C8QA 3ES7A 1VYPX 1J0HA 3GXNA 1Y5XA 4JHZA 4C90A 1K8XA 2RJGA 1EZ2A 3DOPA 2R1KA 1B0IA 2QGHA 3TTEA 3IJ9A 5B7YA 2PTZA 4PBEA 1Q2RA 2WSYA 4OQVA 1BXCA 1O95A 2QS8A 3GUGA 4RZ5A 1B3YA 3SCTA 4B3ZA 2QCHA 3LENA 3VKCA 2ANUA 3W2JA 4BI5A 2QUTA 1EWDA 3A4AA 1FWNA 4D8LA 3APTA 1XLJA 1VYRA 1X6LA 1UWQA 3NAVA 2NUYA 4PBGA 3PTDA 3CHEA 3HZ3A 3L2IA 4HU4A 3ME3A 1AFSA 2ODOA 4H9ZA 3MUXA 1VIZA 2VQTA 1Y5VA 4IUGA 2JALA 3D6NA 3JZUA 1D7KA 4DWSC 4U4MA 1E4IA 3AIQA 5CGMA 1S2VA 2QJIA 4C7DA 4QSHA 2Q3OA 6REQA 3UXKA 2Z1WA 1MQRA 4HMNA 3RU8X 1P4CA 2EHHA 1EOMA 4B5UA 5C2CA 1O12A 1DWGM 3LHVA 3N4EA 4F9DA 3FW6A 3MUZ1 4XX6A 4JL2A 1W5OA 3GH7A 3STCA 3UVAA 2XSXA 4CCZA 4DO6A 2GZXA 3L68A 3QYSA 4IOTA 2YDAA 4LV4A 2ZVIA 1T7LA 1US0A 3HG3A 4H9YA 5CPNA 3NOEA 3CYVA 1K9TA 4K39A 1UZHA 4L6DA 2ZX8A 5E6ZA 2Z4GA 2J13A 3VKJA 3UWWA 1LQAA 2CYGA 2DGAA 4IIFA 4NJKA 4XTIA 3M0XA 4WJEA 1J79A 2WMHA 2QW5A 6PTDA 4GXWA 2CWNA 3W81A 4G8TA 3PUDA 4Q6JA 3LRLA 1YXYA 1CNVA 2NX9A 4BQ4A 2PWFA 4QAIA 5BOFA 2VURA 3NQ6A 4DIAA 3N2OA 3MV01 1BVNP 1LRTA 5HR7A 2P1FA 1M7XA 5D2XA 1P7TB 1FOBA 3VIMA 3LB0A 3BMWA 3KRBA 4FALA 2O0TA 2EG8A 4P8VA 2V3GA 3LPGA 1PSCA 5K9DA 4OZOA 5LNSA 3KVLA 2ZDRA 3TYUA 4IMAA 4DEFA 1E0XA 3QYQA 3S8HA 4ZR8A 2B7NA 2F7FA 4JQ1A 2BGNE 1GUVA 3APYA 4CQAA 4MZ8A 2E0PA 1O5QA 2GOKA 1Q5MA 1XDJA 1S2CA 4NZ5A 1OK4A 1FUYA 1HX0A 3LCGA 1PO9A 1YE4A 3MP3A 1GZGA 4RZ4A 2FMNA 3IARA 1UMLA 2PCQA 5TQLA 3KTCA 2V30A 4DZ5A 3KLKA 2VL4A 4TVUA 4E2VA 1MMFA 1WKYA 3EDFA 3LGGA 1UHVA 2OEJA 5DBTA 4C1NA 1PTAA 3W83A 3UXLA 3TCEA 2POTA 4NNCA 4MB5A 3QR0A 2Y4SA 1V3IA 1NOUA 1QDSA 1ADSA 2Y24A 2J9YA 2VVSA 1B3XA 3U2EA 1N2VA 1JXKA 4GK8A 1XYMA 3RM9A 5AYZA 5C7HA 1EDGA 4X0NA 3E0IA 4F9JA 1VIWA 2W3ZA 4YTRA 3RPDA 4PFHA 4PCSA 3INPA 3ITXA 4C60A 3POHA 1F8IA 1OG6A 2YZRA 2QEZA 4Q8QA 2X2GA 4XIMA 2V5DA 4MIMA 3E9AA 3N19B 4OVXA 4IG2B 1VBUA 4GKTA 3O3RA 1PKNA 4PMJA 3PS7A 5GNYA 3UZXA 2QGYA 4IIEA 3THCA 3RGTA 5I6SA 1T96A 4PRTA 3V16A 3HGSA 7PTDA 1QI0A 2NVCA 3T05A 3FK4A 1A4MA 4WK9A 4LUYA 2DVXA 3QR1A 1P6BA 5BMXA 1LM1A 3K5XA 2XVKA 3MDUA 5I09A 3OP2A 4HNOA 4PB5A 3ZLHA 3CAKA 4Z2GA 2WMJA 4IPLA 4FS9A 3L5MA 3KOXA 2O9RA 4DXXA 3KUMA 3SCVA 5DQPA 1CGWA 5I3IA 2PDXA 3EWBX 1MQPA 3EB4A 3TW7A 2VC5A 4ZO8A 4DM1A 2WWDA 4I5UA 2PP0A 1JYXA 1JDFA 4KCUA 4MPQA 2QQ6A 3BJTA 4LAKA 3IVUA 4LFYA 4BI6A 1KCZA 3B06A 1B4EA 3VNIA 2PWEA 2GJPA 1K7XA 4OU1A 1UUMA 4AF0A 1TG7A 2IKIA 3O0KA 1FWHC 4KIRA 1UR1A 1BRLA 3M43A 4BY3A 1TTIA 4WDXA 5DX7A 5DRIA 1RLCL 3P8JA 4CLMA 5EBAA 2VRKA 4HNUA 5I3JA 4S3AA 4JY8A 1JZ3A 3CPRA 6TAAA 1TZ9A 1C7SA 4BF9A 1A50A 5FACA 3CEPA 5D2WA 1WDWA 3W6MA 5IHSA 4O50A 5C8BB 2DVUA 4LTSA 4IPPA 1E0UA 1SO5A 3FXYA 2Q09A 1TMLA 4W4QA 4H7VA 4IIBA 4ACZA 1QFEA 3C2OA 4E4PA 3H54A 3QKEA 4WVXA 1RD5A 3ITVA 3LG3A 1JIBA 2PWHA 1RA5A 1DP0A 4BF5A 1LWHA 1TO3A 3MU7A 4MPKA 2J9XA 4UTHA 1VHNA 3WUEA 1MUWA 1AH4A 5CPTA 2C16A 2DZUA 4C6CA 3I3DA 1JCMP 4QEHA 2I14A 3LPFA 3STEA 3L23A 3IGHX 3RJYA 1KXHA 1XYAA 2NQZA 1QI5A 5G2HA 1KTCA 2BY3A 3H6OA 2PLCA 3CXOA 4HZMA 4DXVA 5A6AA 1ITQA 1OVDA 4XK2A 1DIEA 3QTGA 3TC7A 4CD7A 3ZFHA 1OWQA 4S39A 4MB1A 3N1AA 2GVYA 2WHLA 3S3GA 2YFOA 1J0JA 1PZ0A 4TUFA 3L5LA 1XDLA 3SY1A 2VTFA 4GABA 1NWUA 4OWGA 4A05A 2PGEA 3YPIA 4QHRA 5EBUA 3TKFA 2ZXQA 3BAKA 2E09A 3HU7A 5HQEA 1R3SA 1NWRA 3VNZA 2WAGA 5BOOA 4PCFA 1FH7A 1U2YA 3WMCA 4DPQA 3M0ZA 8XIAA 3W6LA 1XISA 2A79A 4WOQA 1PTDA 1KLZA 3IVSA 2HS6A 4M3PA 3W7KA 4GYPC 2IQ0A 3XINA 4O0QA 1RK5A 1IEIA 1ZRQA 1W5MA 4QS5A 2XTKA 1MDLA 5E0KA 2RJHA 1UA7A 4HPJA 3ZR4A 1ISXA 3NYZA 1PHQA 1Q7MA 5I3DA 1JRCA 1GQLA 1KB3A 1DEDA 2PPGA 5AYBA 1Q6DA 1FWSA 2CITA 3BARA 2Y8UA 3EDDA 3NQMA 2Y62A 4B16A 4Y90A 4B3LA 4HA1A 1BKSA 1QR7A 2ZKMX 4MKVA 3NNTA 2IQTA 1W32A 3QHNA 3HN3A 1GYLA 3PZTA 1XLMA 2FVMA 3NSXA 2WVUA 1C29A 4IM4A 2VXNA 3SRHA 1BLIA 1YPIA 4YCPA 3C3UA 1YQ2A 3SUVA 1P6WA 4LS1A 1UP3A 4GUFA 4RK8A 2XISA 4L1WA 4INFA 3T81A 2UWFA 4ML9A 5DCDA 3TROA 4ERIA 1A49A 1CXLA 1U1UA 4CVUA 5AC4A 4X61A 3OJGA 5A5WA 1JR1A 2Z2AA 1OG0A 2C0HA 4ZTYA 5F2MA 2OQLA 2JKEA 2QMKA 1GVQA 1LORA 3FJNA 1A0EA 2QJHA 4BR1A 3A24A 1XKYA 2I16A 1B30A 2OZ8A 3M0IA 3EX3A 1TWIA 1TZ7A 4H3DA 4D6CA 1B9ZA 2CBIA 5AHNA 2GUBA 1RAKA 3KCLA 2HBXA 5LHFA 3GXPA 3ARXA 3GVVA 3SUTA 1PCKA 3N9SA 5U7SA 2PDWA 3CBWA 2WCAA 3AMGA 1EBGA 3PZNA 4P7RA 3M46A 1GJPA 7A3HA 2PWDA 4D2JA 1SFSA 1XSKA 2FB2A 4HNCA 2GSHA 5BU6A 3WLJA 4IXXA 4JBRA 3VNKA 3VK5A 2YFNA 3LBMA 3ABXA 1D3HA 4KQNA 3AXKA 3A9BA 1XRTA 1XFBA 3CUXA 2Y63A 4J40A 3RX2A 3GBDA 3GC4A 2OLHA 3MSRA 1TCDA 2H3BA 3S4TA 4ZCWA 3W00A 3DC0A 2FPYA 5CH9A 3SY5A 2IPWA 4QM1A 4KIEA 1OC7A 2HBVA 3Q67A 3E12A 4DWSB 4KRUA 1TX0A 1XIGA 1LDCA 4NZ3A 3DYOA 3DG6A 3BOFA 4J9JA 5EGRA 4H9TA 2ALRA 4JEQA 3CYJA 4N9CA 1KKRA 4MMWA 4A8IA 4AMCA 4Q8NA 4XD3A 1BHGA 2WM1A 4U31A 1TYGA 3T09A 4UC5A 5HAOA 1WQ5A 4NJIA 1QNRA 3W1MA 1NJJA 4G2DA 3TN3A 4BK9A 1OGBA 3OPSA 3TEVA 4CUCA 4IG2A 2WZHA 3DAQA 5T91A 1LZOA 3LZ5A 5GVJA 2J25A 2QJMA 3G18A 3TR2A 1PIIA 4PUNA 3W87A 1GJWA 5F2LA 3KWXA 4I9MA 3IUDA 4NX0A 4QEEA 1VPYA 2YL8A 2VZOA 3UJFA 4UFJA 4NZJA 3GDKA 2HNEA 4IGSA 3CHFA 5FESA 3VGHA 1SO4A 5IDZA 2YYTA 4N6FA 3F2BA 4HA4A 1TX2A 4XAGA 3AS0A 1EJRC 2ZRUA 2XVPA 4IJBA 2B7PA 2HMCA 2ZUVA 4PUKA 3RG6A 2Y7EA 3S1VA 1W9UA 1ICPA 3SCQA 4XISA 3RDKA 3MBFA 2GYIA 3VMOA 1M6JA 1IGWA 3VMPA 4F0HA 4KT2A 1SU5A 4RL3A 3W53A 3I6TA 1EJXC 2WKLA 4QXIA 1TFVA 2X0SA 5BRBA 3E38A 4AD5A 1MEIA 1G4TA 3RCNA 4CCCA 3G24A 2QZRA 2TODA 2RKXA 4LY8A 2O9TA 4US5A 1BEUA 5PTDA 4O10A 4C5YA 4K7VA 3VAVA 2IW0A 3VZZA 1EX5A 2WSQA 3QZ6A 2CZVA 4NRRA 1FRBA 5FF3A 1DYSA 1XBYA 2HRWA 1AMYA 2BV9A 5IDIA 5DMLA 3GFYA 3TQKA 2QJNA 3R7MA 1FBAA 4NVTA 3DBPA 1MXGA 3UERA 4AXKA 4R27A 3POCA 4QJ1A 2QHAA 2YSWA 3QM3A 4Q7IA 2XJ7A 1UIPA 4FNRA 4GVHA 3TCSA 1C8YA 1B3VA 1W5QA 4YNGA 4QIUA 3O7UA 1FWFC 1RJPA 2VR4A 5BW6A 4PMZA 4FX7A 4JIIX 5AHIA 3UWQA 5ECUA 2EO7A 3RILA 2HROA 5TIMA 3F4VA 4WXYA 3F4CA 3VIKA 4EP8C 1E6XM 1HL9A 3R2GA 5A6TC 5K4ZA 1AMKA 4B5NA 3HIJA 4J3UA 4B9YA 3OG3A 4P8XA 1E3ZA 2DDXA 1FWAC 3DFNA 4D8AA 2NX3A 4JHOA 3NZ1A 4QISA 4FI4A 3LBOA 3V1HA 3TOYA 1VFTA 2MNRA 3K4AA 3WO8A 2CHNA 1HL2A 4QBXA 1EGVA 2Q8XA 3TN6A 2ZXAA 2YYUA 1DIOA 1HFBA 3H26A 4JKKA 4O1DA 2WNQA 1BYDA 2P50A 3TUUA 3EA3A 4NASA 3IK2A 4WRHA 1KRMA 2I9EA 2PDCA 1EHAA 2UBPC 4HGXA 4TQTA 1MW1A 4KGJA 2HSAA 4YJ5A 5T26A 3PTQA 3L4XA 3P61A 1B5TA 3TC3A 4J35A 4DLFA 4DAIA 4QDPA 1CPUA 4JY9A 1XSIA 4HCLA 3V5CA 2EKGA 3CL8A 3UJRA 4XBSA 1NFBA 4L5ZA 4UQBA 4ES4A 3SN4A 1FWTA 1Z41A 1YPFA 1YE6A 3RR4A 4GZJA 2CLOA 1V6XA 4EOUA 3RR1A 4Z0JA 4JPGA 2VFIA 4YLWA 3B0PA 3LX9A 3DHUA 2D1ZA 5CBBA 4O1FA 2OODA 4GZEA 3VPLA 3JVAA 3SJNA 3W7GA 1TV5A 1V93A 1CB2A 4EK7A 3GNPA 2VO5A 1OBAA 1H5YA 3QQWA 3P74A 3VIJA 4DJFA 3UWVA 5REQB 4XVDA 4C6NA 3IUHA 1OY0A 2DIKA 2G8ZA 4ZOCA 1MUCA 4IGMA 4AZ6A 1SM9A 1FXQA 3KBMA 2HK0A 4HNNA 1NSJA 5LNWA 1QRQA 2O4MA 4S3GA 1X1OA 4D72A 1QW9A 3L2MA 2BGQA 1RCQA 3DBNA 3C6CA 3UNTA 2VD8A 4PSRA 4J3WA 3W1XA 4XVEA 3BCDA 2P0IA 5HQMA 1Q7ZA 3LEPA 4AAJA 2WPGA 2O9PA 3QHMA 1C93A 1A0CA 4LNCA 1KBLA 2WC3A 4PTDA 5GNZA 1XYCA 3EOLA 4M29A 2D3LA 4JIQA 3Q45A 2X05A 2G4FA 3TIMA 4MM1A 2H9AB 1M7JA 3C0SA 1A5SA 3NDOA 4DJFD 2VDIA 2WSKA 3O07A 3R10A 2FDSA 3F5KA 3GIPA 4WD0A 3QSRA 4IXHA 4URIA 3LCHA 5D8ZA 3BG9A 4W8LA 2DT3A 1UD6A 4XQ6A 5A8OA 3GX9A 1W3NA 3S1WA 2WLYA 2WZEA 1H0IA 5HJYA 5CZJA 1EP3A 1F3EA 1UZ4A 4FF5A 1LP6A 3EOUA 2OQHA 3B9DA 4LY4A 5MKGB 3MC5A 1XRFA 4FR6A 3HPAA 1XLKA 2PRHA 2WMFA 1EPVA 4RZBA 4YTUA 3UNDA 4W85A 3DECA 4RX0A 2RFGA 3RMJA 4HN8A 3TYEA 2WMKA 5K9CA 2BTMA 3EOOA 3NL2A 2VEMA 3R79A 2G37A 2NSOA 1W5NA 4HCHA 4OHQA 1TELA 3ARPA 2VNCA 1L0PA 3SRKA 1I6NA 3EWCA 4PMDA 4HOZA 3R8RA 1EQPA 5A8MA 3WEOA 1WOBA 3VGDA 4RDVA 4DWSA 2XIIA 4GUJA 3GW0A 3DYPA 1EOKA 1IF2A 4QTGA 4ZQPA 5F2IA 5HK4A 2E68A 3HV8A 4Q8WA 1DE6A 3IV3A 4ERGA 5M17A 1XPGA 5CQ1A 4M19A 4I7UA 3TLQA 5FF2A 7XIMA 2V2DA 3W1AA 4Y6GA 1IHIA 3W84A 3SCNA 2PZNA 4DBUA 4F40A 2NQ5A 2C6QA 1ECQA 5FJOA 4XWUA 4CD8A 2V38A 3BW4A 4Q4RA 4GE8A 2XWDA 1JL8A 4PRRA 4XUYA 2OELA 4I7WA 3RM4A 2CLLA 3T8LA 3VINA 1MZHA 4K8HA 2ZBTA 4PMNA 4DWSD 3H7UA 1FFQA 3NZQA 1B9BA 4FZIA 5FI8A 4RV3A 4IQEA 5IBXC 3BGAA 4H4IA 2QYGA 4MG4A 3EDJA 3A3WA 3KHDA 3OBAA 3QW4B 3ARVA 2OEMA 3R8HA 4QDWA 1OZMA 1G7UA 4WDUA 4E3TA 1VEOA 3R25A 3MB9A 2WB5A 3FHQA 3FA4A 3O16A 4JTSA 3VD9A 3C61A 2FZ8A 2BP1A 2GJNA 2F6XA 4O17A 1DJNA 3WH7A 3WUFA 4QG9A 1RP8A 4BQ3A 3WD4A 2FGBA 1FTXA 2GUYA 3TMLA 4NZCA 3WDRA 1XC4A 4O0ZA 4DYEA 1S38A 3UQNA 1Q2SA 1XGDA 5D4YA 2BGSA 2G41A 4AZCB 5FAJA 3AO0A 3P14A 3SCWA 3CO4A 5JBDA 1YRRA 4DXKA 4HOXA 2EEXA 3QQ0A 3CUIA 2PWVA 1ZQ5A 1TPB1 2J8FA 1WO2A 4BQ2A 5DFAA 1RPKA 3ENLA 1V4YA 3VE9A 1SQ7A 2YLAA 4UTJA 5DXXA 4NNAA 3SI9A 2BLEA 3Q65A 3UCQA 5A8PA 3GS6A 3OA3A 5JIPA 1QCWA 4AHPA 3PULA 1EA9C 2WBGA 1AQ0A 4J7RA 2BG5A 4GJ1A 3PWAA 4GA8A 3W7MA 3WMBA 4D6IA 1QOQA 4LUTB 1JCNA 3LYEA 3S6OA 2TPSA 1XQLA 4ZB2A 5HANA 3ZO9A 2X30A 3LTYA 1IE7C 9XIAA 2CEQA 3GU9A 2D73A 1RBOB 1ISZA 4X63A 3LY0A 4DJEC 3TWAA 1T0OA 1OSEA 2ACRA 3BUVA 4K8GA 3U2OA 2C15A 3P0WA 2NX1A 4JTJA 1E6PA 1PYMA 3ARSA 1G4EA 2QPUA 4UTWC 1ZUAX 2Q3RA 2PE4A 1V02A 1WUFA 5H8MA 3W75A 4Z1AA 3CMGA 1NWSA 2JIWA 3VD3A 4W7WA 2PP3A 3HFYA 4Q7NA 1HXJA 1TJ2A 4NY2A 1V0MA 1ZP3A 4V1YA 2DSZA 3DERA 5DELA 2AQOA 1E3XA 1UWUA 3FNDA 3LV5A 4PMRA 1VBRA 2QV4A 3G8EA 1WZLA 3DGRA 2CFFA 4LVBA 1DQXA 4HYRA 1TVLA 2QULA 4EPEC 4Q4MA 3G1VA 1JUEA 3VGEA 3LI0A 2FB3A 1HKMA 4IP5A 3MW7A 2D2JA 1DV7A 5CZTA 3AU2A 3NL5A 4A3HA 5HMDA 5ABHA 3PJXA 3AISA 4W7VA 3MP4A 4NYYA 4PSPA 2E28A 4ICNA 3W38A 4AWUA 1XS2A 1ME8A 4WXZA 5A6KA 3MBDA 3CL6A 3E0FA 3VNLA 4DELA 3HJZA 4O52A 3T2QA 2OQYA 3GW3A 1MDRA 2FZNA 3W22A 2Z2UA 4FR1A 3OEXA 1FDJA 4Z1BA 4D9PA 2CESA 3WUBA 3CC1A 5IXEA 3KXQA 2WWCA 3VUPA 4Q3MA 5REQA 4HK5A 1SJBA 2WKGA 3S5NA 2GGIA 1I1XA 4J28A 1PKMA 2OFJA 4A3YA 3UETA 1DWFM 3U5UA 4JD4A 3F2DA 2DZTA 3CZKA 3E1F1 3W1RA 4A8NA 3M1ZA 1XL9A 5I3KA 3N04A 4MNLA 5AHLA 4DF1A 3V5FA 5FA5A 1ONWA 1UC5A 3QY7A 2GGEA 4FPSA 3V0UA 1RCXB 4PR4A 3KDOA 3H2OA 1UPMB 2X09A 4MUPA 1K03A 2HVMA 3QZEA 3MWCA 2J7GA 1IIGA 2XIJA 1HP5A 3PN8A 4QLJA 4AHOA 3GWQA 3ITOA 1VFUA 5BU9A 3VUSA 2R24A 1EBHA 2ZRWA 1RVKA 2H9AA 1VFHA 3MSYA 1E15A 3GR7A 1Q7QA 5G5IA 2C0AA 1SFTA 4CU6A 4AZ5A 4WF7A 3TAKA 4MUZA 2EBNA 1EYWA 3COTA 4O1EA 5FF4A 1V7YA 1JAEA 1PUDA 1Z8AA 4KWSA 1BSLA 3LHTA 1R2TA 3GG8A 2GJXB 5E5CA 1GOWA 1H49A 2R82A 4QSFA 2GDVA 2OYLA 3WF0A 1PXGA 1WZKA 3F5LA 3FS2A 1UPPA 2CLEA 1GOXA 1CBGA 4O11A 3TDFA 4RE0A 2P3EA 2Y2WA 2W62A 1R7OA 5DXYA 3C2EA 4IP7A 2J6VA 3BC9A 1IIHA 3V1PA 4PUMA 4MKSA 5B80A 1IZKA 2CIPA 3WQGA 3KP0A 3PHAA 2WVSA 2OSXA 3MCOA 3E74A 1ISWA 2ASHA 4H6QA 6ALDA 1J93A 2HTMA 1VBHA 1XX1A 1XHGA 2QCFA 1Y5WA 4UFHA 3TJIA 1C92A 1ZENA 1IR2A 3VZXA 1XV8A 2I1OA 2ZA2A 3N2XA 4GMEA 3UJSA 3CGTA 3VI2A 2FQIA 2J62A 1R3VA 3HGJA 2ZQ0A 4MF4A 3G1DA 4PH6A 3N15A 1EP2A 3H2MA 4IMCA 3O0FA 3T4CA 1E70M 1MW3A 3CTLA 5I78A 1G0CA 4FOUA 2Y70A 4LANA 5AZ1A 4PTVA 1R87A 4DZHA 4JOMA 3W25A 1JNEA 4JDYA 4GJIA 2FGLA 1G69A 4IH3A 2RAGA 4KGLA 3FAWA 4B5WA 2EPOA 2QPXA 3O6CA 4I9TA 3WQOA 1TJ1A 1K8ZA 3W82A 1EHNA 1SJAA 2RDTA 4QCEA 1GOKA 2WBKA 1EP1A 1I0DA 1IXNA 4QP0A 2QCGA 3B97A 3RLVA 3CL7A 3PZVA 3T8QA 4JYEA 1W56A 4DI9A 5D03A 3TZFA 1PPIA 4BCEA 3UG3A 3PUGA 3SFKA 1NVMA 2OLSA 3M0VA 3VNMA 3IIZA 3M6DA 1K1DA 4PCTA 4FOKA 4DWDA 1RVGA 4PEKA 1N55A 4YVPA 2X16A 3L0KA 1FHVA 1HJSA 1UR8A 1A5LC 1OX4B 3TFXA 3PBWA 3REQB 5G1MA 1GOIA 4O18A 3EWDA 1TJRA 3KZSA 5LYRA 1D9EA 3UWUA 2PF0A 2WOQA 4NKCA 1UKSA 4F0SA 4JFSA 3WNPA 4Y8FA 2NT0A 3C86A 5M1TA 5HMSA 5EB8A 1GQNA 4F2UA 1ZBKA 3BCFA 5SWUA 1GVEA 3NGJA 3B8SA 3LGDA 1GHSA 3A4JA 4IIDA 1XG3A 2R1NA 4FLQA 1ZJBA 1RALA 3TONA 1PKLA 5KZDA 1R5YA 2FZMA 3C0JA 1JVNA 3S5SA 3WFZA 2V8ZA 4NNBA 2QVNA 1XCWA 3HGRA 3OHMB 4AD4A 4W84A 3VIGA 3S0CA 1Z32X 1TIWA 3O6YX 1LQ2A 3SIZA 1WBJA 3PR2A 1I1WA 4L61A 2GGHA 1NELA 3HURA 5FF0A 3BMVA 1POKA 1BYAA 1YPXA 3K30A 3PB0A 3CASA 3TVAA 1UR9A 2JEQA 5LNUA 2R1MA 4GH1A 1LTDA 5CZSA 1PL9A 2GFTA 4GD0A 4IMDA 3GTFA 5H91A 2FMOA 5LNRA 1XLAA 1Z48A 1JNDA 3ANYA 1D3CA 4LUTA 4L7ZA 3FFSA 2FZBA 4DQWA 2FPTA 1PIGA 3KRZA 4C6FA 3H4XA 3KVMA 3U2CA 1KD0A 1LWJA 3FVDA 4PGLA 2C7FA 4KMQA 4XD6A 1KQYA 3THAA 4M6VA 4NX5A 2Q8ZA 1B1YA 3AJ7A 3W0KA 1GHRA 5L9FA 1XIMA 3GTHA 4R33A 3ZS4A 1R30A 3KRUA 1M9HA 4DUWA 3KE0A 2A0NA 4GC4A 4GI4A 2C18A 3WLHA 4CD5A 1FWGC 3MZNA 3CQJA 1F4AA 3OHIA 2DQXA 1OEPA 4A29A 4HHMA 3M44A 1E4MM 3AMDA 2BY1A 1Z44A 4MTVA 3EX2A 1LG1A 1ZGDA 2FTPA 1HQTA 4QJ5B 4GCXA 1H7RA 3VNDA 3I7QA 4KPLA 3AXXA 4IGNA 2W79A 2OO6A 4O0KA 3UWZA 5DMNA 4OGZA 5BWFA 4AVNA 3W28A 4QCFA 1R2SA 1BGGA 3BXWA 4P61A 2YJQA 3ID7A 4Q4SA 1H60A 4GZ7A 4N4PA 3TFCA 2PTYA 3RUBL 4XSLA 5JH1A 1E9ZB 3NQ7A 5G2WA 3H8AA 5D2YA 1HTIA 1KBJA 3IVTA 4GCAA 1Q6RA 3ZIZA 4XB3A 1XUUA 5FSDC 3LUTA 4GIAA 3CH9A 4U33A 1MQQA 2VQUA 4AFYA 5GQBA 2BOFX 4CQCA 1J0KA 2OOGA 1EIBA 2AQWA 4CN6A 3S9YA 2VELA 3F5JA 3S1XA 4GISA 3O8AA 3UR5A 3VOHA 3KL3A 3CQHA 3UA4A 3SEPA 2XIQA 3DHDA 3AS3A 4AHQA 4V15A 2E6YA 3CMFA 1ONEA 1LOQA 5XIAA 4FAMA 4JNZA 5I3HA 1F7BA 2CZ5A 3GD6A 4Q8UA 3NL3A 1K8CA 1WP6A 2W27A 3OVRA 4WGHA 4JFUA 4F0RA 1YHTA 4WKFA 3G6LA 3UT0A 1WZMA 3LCLA 3AC0A 2QPSA 2OOFA 2O9OA 4JTRA 3N6JA 4HJWA 2WCSA 1IWAA 2PTXA 1WA3A 1TV4A 4DUXA 4R9OA 4TV5A 1H63A 4UTKA 3EX1A 1VF8A 2B31A 4WY0A 5DT5A 3TV8A 4NAEB 1WPCA 1VFMA 3EWXA 3A4WA 4H9VA 2PC4A 1F6KA 2HPMA 2E3ZA 3B8UA 4GGBA 1I45A 3QHOA 5CC3A 1N8FA 2W61A 1KGUA 4H83A 3AIBA 1W8GA 4K6AA 3K8KA 3BZJA 4DUOA 3RO8A 1PB0A 4M7TA 4NI8A 3IWPA 4HOWA 4PBFA 4AYSA 5E93A 2A3BA 1PAMA 2D24A 2WPBA 1R46A 5H8UA 5IOBA 2CBVA 1FH9A 4ORMA 2ZICA 4GPNA 3IEBA 3QZAA 1JFHA 4EPDC 3OIXA 3FJ6A 1VH7A 1XW8A 1BTCA 5HQLA 4DF0A 1ITCA 4XZMX 5H8PA 2DV0A 1XF0A 1BWLA 4FF7A 5TBOA 1TUFA 3VM5A 5HJLA 2G96A 4C6JA 4WCJA 2QXWA 2FDMA 4M81A 2GL5A 3D47A 3FKRA 2TSYA 1NP0A 5A6MA 3SECA 3SSJA 2E67A 1ZCOA 3ANVA 4HP5A 2Y88A 3CV7A 2NQJA 3RM8A 3FEMA 3WLOA 3O05A 3NM3A 2IMRA 4P2VA 4RKAA 4W5UA 1QWGA 3VDGA 1S2WA 4EACA 3C0LA 3PAOA 2PAJA 5AYIA 1ZJHA 4FX6M 1HVXA 4Y9NA 2F8QA 4Z1YA 5FL1A 5F2GA 3IJQA 3L12A 5I03A 3GH5A 2BFGA 1FCQA 4ILSA 3AMLA 4K1GA 1M3UA 1D8WA 4ZA0A 1XLEA 5BWAA 4M80A 5G2IA 2VUNA 5EFFA 3P8IA 4JTFA 3SURA 1N8WA 1SZEA 2C3ZA 5D09A 5BNKA 3J7HA 1ZP4A 3PANA 1K02A 1TPDA 3KZPA 1KQZA 2G5WA 3UPWA 3H23A 4D6GA 1Q45A 5I00A 2WMGA 4IFOA 3F7JA 4JXCA 3SW6A 4GYFA 2FH6A 2YR1A 1OX4A 1ADOA 4AD1A 3REQA 1CDGA 4WIWA 1SZFA 3TR9A 3N12A 4TOQA 1WOAA 4UFIA 4AWSA 4JNMA 3WQ5A 4YXGA 3DDMA 2BMBA 5FJTA 3WNLA 4J3VA 2CLIA 2VEKA 1EDQA 2GDQA 4EPBC 5AN7A 4J27A 3M7WA 2NUWA 2DIJA 3LA4A 5BXRA 3URNA 3GUWA 2D20A 2JGQA 1MI3A 5JQ9A 5GJPA 1GVRA 4Z2HA 1EF2A 2J7CA 3GU1A 4J3XA 1EJWC 4X9SA 1XH1A 1B3WA 5HWJA 1O7AA 3VE7A 2J47A 4RDWA 3WZ0E 3W7NA 2WMIB 1E1EA 2JEPA 3Q37A 1YTDA 3LPOA 1H1YA 1UC4A 3A47A 4ATDA 4PUEA 2ZUMA 4GC3A 2E6AA 2DQWA 1HF6A 3C5QA 1GJUA 2IQDA 1EGMA 1GPWA 1ITXA 3U4AA 3QRHA 1KKOA 5LHEA 4A3UA 2X2YA 3EB2A 3R8GA 2O7QA 4DO7A 4C91A 4XO7A 1YMYA 4E4FA 3GAKA 3P3BA 1HGYA 2CHRA 3FHAA 2Y5EA 3VOFA 3RMEA 4LAZA 4KW2A 3CQIA 3M47A 4KEUA 3A5VA 1RH9A 3O1NA 4XBJA 1SMDA 3WLSA 3WLTA 4MADA 4I9JA 3OODA 3OQ8A 2XFFA 4MJMA 1OF8A 1QO5A 2DH3A 4FXJA 3SGUA 3KTSA 3RJXA 3KM8A 5E6YA 1S5MA 4H8VA 4UTIA 4O13A 3G1AA 3GG1A 2E40A 5CAKA 4JEJA 1LJYA 3USBA 1KRAC 3CT7A 2AKZA 1ZY9A 2WHMA 2AMGA 1DQWA 1TB3A 1NH6A 3GYEA 2W6RA 2OTDA 2EKCA 1Z6KA 3V0SA 5EFDA 1F73A 4TIMA 1UWRA 2WJFA 1NDYA 1TPWA 3K46A 3FAXA 1A0DA 1HKVA 3WQEA 2XGIA 5FSEC 1JD9A 3GDTA 3RRAA 2AAMA 2PLMA 1ZAIA 2C19A 2ZYFA 4ML4A 4FNTA 5GPRA 3PAJA 3CV2A 4CQ9A 3CB3A 3B0VC 1Q6EA 3GBEA 4S2CA 4LBSA 2YGYA 2QCCA 4GQBA 3SCSA 5G4WA 1AJZA 1OD8A 4J3TA 3L7RA 3EYPA 2QV5A 1RQBA 3I4EA 1OX6A 3VMNA 3BLIA 4PL1A 1J12A 3SY8A 2I9UA 4YN5A 4K1WA 4A35A 3WH6A 3ABZA 1UR4A 3GO2A 4C5ZA 4WGXA 4HZ8A 3B4YA 4QJ3B 2OGYA 3WQ4A 1AZ1A 3VCCA 3W7PA 2PDIA 3EB3A 2GUUA 4AZBA 3BOLA 4S3EA 1UUQA 5CZ0A 1VJIA 1DJIA 4ZQOA 3MP5A 1Y0EA 1X8FA 1NF0A 1ODUA 1WKFA 4R3UA 4LCQA 4QFUA 3UA3A 1KFEA 3W3OA 3H2FA 1E9LA 3NQGA 2J9ZA 5CJNA 4QDMA 5DLCA 1J10A 5FEPA 2FH8A 2CZEA 4MNJA 3R4IA 2VEIA 2V63A 4LH8A 1XLFA 3QJAA 5FJJA 3GHUA 2R1PA 1RQEA 1NFGA 1GQIA 4X2PA 1EWEA 3LMZA 3LHZA 2PDFA 1JG9A 1F6YA 5I02A 3GNOA 2QCLA 3PPHA 4Q4PA 4QE1A 1LOSA 1KCKA 4H8NA 1BQGA 4MB3A 4HZ7A 1XLHA 2J27A 1FWEC 5I7GA 2OZ3A 3GU2A 3N6HA 3PBGA 2BVYA 5EMYA 4IICA 3PZ9A 4JYFA 3WK0A 5HINA 3AIUA 3ES8A 4HPHA 4DUVA 4AB4A 3N2TA 4BS0A 2QCNA 3PG8A 3I7RA 2EPHA 4MFDA 3CZJA 3VD7A 3KVKA 3EKZA 4KFOA 3WQ8A 1J0ZA 3KCOA 3NQEA 1XBZA 3DKLA 4NAEA 3W6YA 1OC6A 4E8CA 4BHYA 3BQ5A 3GR4A 2WHJA 5ABGA 2JGYA 2XH0A 1V79A 3CT2A 1PIFA 4XD5A 5H2ZA 4ZVJA 5LKYA 3GC2A 3HG4A 3SQMA 5JU6A 4GYJA 4AEFA 4Y9MA 3GQYA 4Q8MA 3ZVHB 2VYOA 2J4GA 4JN6A 1QUMA 2VRJA 3WH8A 4EWJA 2IPFA 3MS8A 1XCXA 2ISDA 4D6EA 1KW1A 4WX2A 3KVJA 1PHWA 3QLDA 2AGKA 1UJQA 4F48A 3BO9A 4LVGA 3FXGA 4AEEA 4YCOA 2J74A 3MYOA 4HIBA 3F4DA 4JX4A 3N29A 4O8AA 3DFSA 4Q7BA 2IPGA 4D6JA 1L2QA 1FKWA 1IXPA 3VD4A 3ECQA 1K70A 3N73A 3ONBA 3S5YA 5M03A 1DORA 5CBIA 3RCYA 3TTSA 4A21A 1VS1A 1Q4WA 2BASA 4EX4A 1HZYA 2DZPA 1OFBA 3P5YA 3B0UX 4QGCA 2BVWA 4JTKA 2POZA 3UD6A 2YB1A 5E9AA 4QJ4B 3V3WA 1S1RA 3E49A 5CXPA 1CLXA 2YZ5A 4DX3A 1S46A 3LLFA 3W72A 1HN1A 4LCSA 1V03A 3EX6A 2VVNA 2WCGA 1UR0A 4OKDA 3NQBA 5G4EA 5DMYA 5HNTA 4D1IA 5ABFB 4J2MA 4MJ4A 1OABA 3SO7A 3TW9A 4MZYA 3OG2A 2G97A 2YLLA 1K4GA 3G3DA 4JX6A 2UY2A 2V5CA 4NJHA 4F66A 3N25A 4OT7A 1F05A 1GZ1A 1JI1A 2CWXA 4F8XA 1R9XA 2YA0A 4A8RA 1LG2A 2DU2A 3R11A 2PDHA 4UMBA 4ATWA 3KL5A 1EFZA 3WSUA 2FTWA 5C9RA 2QT3A 4HMEA 2J7HA 4PA8A 4UTLA 2X1IA 2GJRA 2A7RA 2WJZA 3V75A 2OGJA 3W2LA 1XIIA 1BAGA 3SQLA 4GHRA 1CLKA 3QH2A 3G77A 3PK7A 4WSHA 1PBGA 2WJDA 2Z25A 3FY1A 5C7VA 1NDVA 2UV8G 3VGGA 3BE7A 3JRKA 3BW3A 1ZPTA 4B4HA 2G4JA 4GVFA 5CBJA 4JTIA 2NV2A 3ZJ8A 4B91A 3XIMA 3KBNA 2GSEA 3MKKA 1JZ8A 2ZC8A 4H6KA 1J2WA 4E4UA 1X1ZA 5IFTA 5EMJA 3PBMA 3UEQA 2OR2A 3SUUA 3KDNA 1D7FA 5D38A 3IGUA 4G56A 3P62A 4NYUA 3H2NA 1XXXA 4UQEA 3HOJA 5I23A 1SW0A 1P0KA 5K2ZA 1W9XA 1QBAA 4JTTA 2G3IA 3TWBA 1RXOB 2PURA 5BCAA 4TO8A 1J0YA 1T99A 2VX5A 2WMIA 2FFCA 4H9MA 1DTUA 1W1TA 2P3ZA 2FKPA 1M7PA 2A1YA 3W7DA 4QITA 4CU8A 4KCWA 3K8MA 4GY7A 4XAYA 1VJSA 1X8CA 1MFVA 1DXEA 3C8FA 5CSYA 1D3GA 2DT2A 4HNVA 2J7BA 2VCAA 4GBUA 4UBPC 3QY8A 1RD6A 3OVQA 1AZ2A 1PZ1A 1WAWA 1RJQA 4L9XA 1G01A 2PDMA 2ABAA 1EGZA 1ZCCA 1DL3A 1TTJA 4YTQA 1RQHA 4Q8TA 1M41A 2YCEA 1RZMA 1E1CB 2DUZA 2WZMA 1VGAA 5C9UA 1NOFA 3DH7A 4GXMA 1OD0A 2FJKA 3O6DA 3Q2DA 2OO0A 3KOZA 2VUYA 4GQ0A 3TU9A 1B90A 3W7JA 4UMAA 4QE4A 2VDHA 1A5UA 1ECEA 1K9FA 1EC9A 5TNVA 3WQFA 3KBVA 1UOZA 3W27A 1YDOA 1DHKA 4NG3A 3LCXA 3GB6A 2R91A 2IXUA 1XINA 3D0CA 1MEWA 1ONRA 1JCXA 2WK2A 4ADUA 3EMZA 4ONVA 4WR3A 3WDIA 2VFEA 1K7FA 1ESWA 3KLLA 2PGWA 6A3HA 3GG0A 4CQBA 4WSJA 1Z69A 1ISVA 4M1BA 1BYBA 4H7CA 3DGBA 3NPVA 4LAUA 4MDPA 3BGJA 3WNMA 4I5XA 2CLPA 4IMFA 3RK8A 4HTYA 5G1TA 3NIYA 1EEPA 2X0YA 4B5TA 1EZWA 3OZOA 4GKLA 3BGGA 4ZFCA 5DCBA 4E0CA 3GZ3A 3MYPA 1PX3A 1O68A 1BF2A 3MPGA 5KITA 4DPPA 2OT1A 3SM0A 1GVSA 3WLRA 1QHZA 4NF7A 2B81A 1A47A 2DSVA 1ALDA 1W5PA 1TV3A 1NDWA 2PBOA 1OHLA 1PDYA 3QGVA 1DQUA 1XLBA 3LCWA 3M0LA 4GX8A 5DF0A 3UZJA 2BXZA 1XIHA 5KINA 1TR1A 3TK7A 5C2GA 4LCRA 2J77A 2WW5A 3ABSA 1W6TA 4RNIA 4ZO9A 4MLRA 4QG6A 4EIVA 4M6PA 3E5PA 1GQJA 8RUCA 4DO5A 3TP4A 4M7SA 1Q13A 3U6WA 3CLWA 1UBSA 1RSCA 3QGAC 2WANA 3MI3A 1OGGA 3QW3A 2A3LA 3WIJA 1JULA 1KA9F 3CUJA 4XZIA 3TYBA 3AXHA 1YKWA 3VD5A 3GXIA 2WZIA 1X6UA 3HG2A 4KKXA 2X40A 4QE5A 2XYLA 3NA8A 2WO5A 1JYWA 3TJXA 1CENA 2Y5SA 4PN2A 3PP7A 4YHGA 2VR5A 2OWXA 3UZ5A 1E0VA 1R3QA 1AK5A 4DBWA 1U5HA 3XISA 4F0MA 1R85A 3K1GA 2BODX 2OCZA 4UUIA 4DN1A 1QASA 1YNYA 4PTNA 4AISA 3BAIA 4WJ8A 3QMTA 5FJPA 4H9XA 2RDXA 1W9DM 3MCNA 3MI2A 3B9NA 1JF6A 1UD4A 1XDMA 2PDGA 3PWGA 2HXTA 4G9PA 1AUSL 1R3YA 4HJFA 4UIOA 1SJCA 4WLCA 3L0GA 3B8VA 2A6LA 3EBVA 1SUXA 6XIMA 1JCJA 2ZZ5A 3I10A 2VFHA 5HNRA 3HMJG 1XLIA 1SSDA 4IQJA 1OINA 3VDCA 1RHCA 1ZBWA 2WKJA 4B5SA 3T55A 1EQCA 4US6A 2DW6A 4BEQA 2EPNA 1XFCA 1V0KA 1J0IA 4ASTA 2F2HA 2HISA 1W8SA 3BAYA 2GQ3A 2QJJA 5HATA 3W2KA 1XLCA 3M0MA 2ZFAA 4UR7A 3FOKA 1WNOA 3CM4A 1H7PA 1TV8A 2PRLA 1JI2A 1VRDA 2X1RA 3DFPA 3AWOA 2IKHA 1QI4A 3BV7A 3HV9A 4E6MA 3NJ3A 2INZA 1UKQA 3ZVHA 2XVLA 3AOFA 5A6LA 1SFLA 1DWIM 3BLDA 4LB4A 1H0GA 3LPPA 4JTEA 1R8LA 4L6HA 4RE3A 2JFEX 3CAQA 3G5EA 1W9BM 3U0HA 2VOMA 2Y85A 4XKYB 1R3TA 3VYLA 2ON3A 3E2VA 1MNSA 7REQB 1J9YA 2E9LA 2XHYA 4JIHA 4GRSA 4MOZA 2W4XA 4JTGA 4KFPA 4H7ZA 3L4VA 4ZQCA 1J01A 2JE8A 2FPVA 4KFNA 3ZLFA 1S2AA 3NZPA 3KL0A 1XQKA 2OMAA 2YCJA 3WF3A 4Q8PA 1AW5A 1ZAHA 3U4FA 1V5XA 4GIYA 2ICSA 5AHEA 4H19A 2IPJA 3T07A 4WUIA 2Y7FA 4MWAE 2PA6A 2XIMA 4KCVA 3W85A 4P5UA 2F61A 3VX0A 3HO8A 3SFWA 2ZXBA 2RGLA 1T8QA 1PCWA 1QW7A 4EWND 3P82A 3MCMA 1FWWA 1XLDA 3BLFA 4Z2KA 3WLMA 5ABFA 1YDYA 3NL6A 1PS9A 1CTNA 2BNJA 1L6GA 4ECLA 3ZOAA 4G5DA 2BXVA 3M0JA 4F79A 3LNMA 4J2PA 4KCTA 1VLIA 4O15A 2PU0A 3B9EA 1UH4A 3WBEA 5D04C 4L9ZA 4L64A 3GSMA 1UROA 1P1MA 3P81A 2YOCA 1YTEA 2E6FA 3QPYA 1RR2A 4N42A 3S2MA 3PZOA 2BOGX 3S9ZA 1QOXA 3NQVA 4FK9A 4C7GA 1X96A 2J7FA 1JQVA 3MSDA 3L4UA 3Q94A 4LB3A 1Q8JA 1KO0A 2VRQA 3SAZA 1S5NA 4PRWA 5DN1A 1TUXA 4OBTA 2X1UA 1M65A 3S6TA 1S5VA 4ZZ9A 1FH8A 4FNPA 1Q65A 3GYCA 4RDYA 4QQ3A 3DCPA 4FHAA 1E6SM 1W3IA 2INFA 3U57A 4JTAA 4U2ZA 1BXBA 4O1AA 4ZSTA 1K8YA 3QXBA 1H11A 3M5YA 3W2UA 1E51A 1BG4A 2O4QA 3VA8A 4L4PA 4AW7A 3WH5A 1TTPA 4W89A 3M4HA 4WEVX 1OX5A 2YCKX 3L67A 3OLGA 2E25A 2L5HA 4A22A 2Q6ZA 4E8DA 4PMQA 1W37A 3MUY1 2HCVA 3WD0A 3PUEA 5CPMA 3L21A 2YDRA 2Y0FA 3FA5A 3AAMA 3WK2A 4UWMA 5CKSA 1W1IE 5GJMA 3EOSA 2ZX6A 5D33A 3ARZA 4PYSA 1IXOA 1L2UA 4G1KA 3MANA 3BPWA 1YX1A 1F07A 2OX1A 6TIMA 1JCYA 1KM6A 2VEGA 5JVLA 4GVGA 1E1CA 3MWAA 5LIUX 3AYSA 2GLKA 2IUZA 3P5ZA 4PL2A 4JFWA 2W5FA 4TTUA 3RX3A 1LF1A 1ITUA 2BY0A 1WDSA 4HPNA 4EXBA 1OFPA 5LZLA 1SZRA 3MMUA 4B2DA 1HGWA 2D0FA 3ZT6A 3W7LA 3ZYZA 1G4PA 3GVWA 1VEPA 3DN5A 5D9OA 5T8GA 4ROPA 1A5OC 2GWNA 3M9YA 4FSAA 1QI2A 3NOYA 3PSVA 3VNJA 1G1YA 3ZVIA 3EA1A 4U5IA 4JCMA 1R6WA 2J75A 1OCBA 3ITTA 3LV6A 3S47A 1CXFA 2CW6A 2X7WA 3MQTA 3WNOA 1HNYA 5HMEA 3TQPA 1V6YA 1LCOA 3VKBA 4OTKA 1I2OA 5HWMA 1BTMA 1M68A 3L4YA 1XIEA 1TIMA 3QF0A 4OOZA 1UQYA 4PMVA 4EXAA 4HN4A 1SSGA 5HNNA 3SCPA 3H53A 2J7EA 2YXXA 3OVGA 1XP3A 4M0XA 2VC6A 1HW6A 5J5RA 4IP4A 1TJPA 1KM0A 3JZEA 4B2DD 4GUIA 2A3EA 5CZKA 3KCJA 1R0MA 4TV6A 1IT7A 3GK0A 2PI6A 1VCFA 5CGTA 2H6RA 4W86A 3BH4A 2QDEA 4AZIA 4KEZA 3CH0A 1Q6QA 1WCGA 3PZMA 5FF7A 4C6DA 1GW9A 1P7TA 3ALFA 3MSGA 5M2FX 3VGFA 4R7WA 2WZTA 1Z7AA 2VFFA 2YXOA 4JIRA 4JKLA 1CXEA 4M51A 2AMXA 4JIEA 1VLWA 3HQ1A 3R5EA 3AIVA 3VTRA 1B4KA 1N82A 2VEFA 1JQXA 5AC8A 4R88A 3S42A 3VDAA 4X2RA 3OLEA 4EPKA 3G1RA 2PDNA 2BHZA 2GPTA 3U3HA 4LUJA 1JYNA 4LAOA 3T4WA 1G9HA 3EXSA 1CGXA 2OYKA 2DZBA 3QV6A 1QOPA 3CQ0A 5ECVA 5BRPA 2QF7A 4KWWA 3TYDA 5HMFA 4E2DA 3LHWA 3LERA 2GVLA 5LIXX 3BL3A 3CPGA 2VD9A 5E0CA 4MWAC 5EMMA 5A94A 4I6VA 2QAFA 3PZGA 3RLGA 1JUKA 4UTFA 4JTDA 4TVDA 3QMSA 4B3KA 3FX4A 4EAMA 1ICSA 3IIXA 3CWHA 1EKOA 3C2YA 4ZXLA 3UF9A 1CGVA 1P6CA 3OZPA 4JN8A 5L6UA 1IEVA 1I2RA 2CPUA 2H3DA 3MA8A 3NO3A 4DY1A 1IQ8A 4ZXOA 1BVZA 3R89A 5F7UA 3K2GA 3RPMA 5AFDA 3AU6A 1TE1A 3QKZA 1M04A 3V5OA 1THFD 3APGA 1P0EA 1MWOA 3M41A 2Z1KA 3P84A 1JZ4A 3IANA 4CEUC 3UVIA 3I3BA 3MTWA 1VB9A 2KAUC 5C55A 1KV5A 1XH2A