4M1CC

Crystal structure analysis of fab-bound human insulin degrading enzyme (ide) in complex with amyloid-beta (1-40)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
227
structure length
205
Chain Sequence
QLVESGGGLVQPGRLSCAASGFNVSSYSIHWVRQAPGKGLEWVASISSYYGSTSYADSVKGRFTISADTNTAYLQMNSLRDTAVYYCARDRVMYYWSFSKYGYPYGMDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin-degrading enzyme
publication title Crystal Structure Analysis of Fab-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Amyloid-Beta (1-40)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 205
sequence length 227
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1cC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1cC01
3PV7A 4EUPB 3KJ4B 1T04A 1X5XA 4OCXL 4UB0H 1NCCL 4CVXB 1GZQB 2DQJH 4QNPE 4FP8L 1QSEA 3U7YL 5DD5L 2G9HA 4U6VH 5FYLE 3W0WA 3SDXF 2VZ1A 4I5BB 1ITBB 4ZPVB 4G42B 2J4WH 2Y72A 1F8TH 5I1AA 2QADD 1F4YL 4L3EB 5JIPA 1JHKL 3BKYL 3VFRB 4U1JA 3IRZA 4PB9H 3NIDF 1MCWM 5FECA 1YC8A 3LKSB 1KIRA 4KI5C 4LLQA 5EWIH 3VWJA 4GBXC 4OAWB 2IQ9H 4L4VA 4UZGA 1CDYA 2NY7L 1JP5A 3I6GB 2ADIB 2AK4A 2W0KA 1Q9LA 3LEYH 4POZC 3V4PH 1A64A 4MNQE 5HHPB 3FFCA 5D7LA 4RMSA 3GJEB 5DQJA 1MCOH 1YDPA 3DV4B 3VDAA 1SJVA 2IEPA 5E2UH 1E4XL 1A7NH 1A7RL 1IGFL 1DQLH 1KCRH 1I4FB 3MXVH 2OSLA 5IHZB 3CCHB 1YEFH 1W0WB 1I9JH 1TJGH 5I1GH 4H5SB 1RJZB 1JF1B 3OTTA 2APVA 4J3WA 1KEGL 1KC5H 3RVTC 5HYJD 1DANT 1ONQA 4I3RL 3PGCA 1G0DA 4JHAL 3ELAT 3MV8B 2BNRA 2AP2A 3AY4C 2P8LA 1HINL 3ARGA 3EO9L 4OQTA 5BO1H 1CDGA 4NO5B 4GKSB 3ZKNC 5I30H 3BP4A 2WK2A 4M5YH 4KRPD 3UMTA 5FEBA 1Y6KR 4D9LH 3QNXA 2IANE 2VITB 1AXTH 4KMQA 3RVUC 3H3PH 4OKDA 4DZBA 4J12A 2Z8WC 1N3NA 4H8WC 3X11A 5JQ6H 3QP3A 3SDDA 4AEIH 3RUGB 1DBBL 3GSXB 5E9DE 2EDFA 1FIGH 2YD8A 1ACYH 1CFNA 2WQ8A 1A2YA 4NKMB 2VISA 2ZCKL 1TJIL 3VXMD 4P5TB 2KH2B 3OAYH 4QXUH 1RZFL 5D96B 4X4ME 4OFYD 3OV6A 4UBDD 3IFLH 4KXZH 4KWUA 1LP9E 3KAAA 4XX1G 2A1WL 4V1DB 3Q0HA 2MCPL 2ZKHH 3WJJA 3FQNA 1UJ3C 2ZJSH 3S5LA 4K94C 3U2SA 4PRDA 3VMNA 1UH2A 2FR4B 1G7PA 1YN7B 2MKLC 4MJ6B 1RULH 5IQ7L 2XN9A 1RUQL 3AREB 4JZOA 5F7DA 3PL6A 3BH9B 3QULB 5MERB 3V5DB 1NDMB 2PN5A 3LQAH 3M8OL 1FO0H 2X2YA 3F58H 2VXTH 2VDLL 4OV6F 4PTUB 4W4OC 4XI5D 4QYOA 1CK0H 3AS0A 3HAEB 4O2CA 3M45A 5BOZG 2J8UE 5DUBA 4BFGA 5ISZE 3HFMH 4UT9H 3VGGA 1XF4B 3QI9A 2FX8L 4EVNB 2R69L 3MUY1 5IEHA 1YPZF 3MCG1 1AGFB 2WWMD 1Q72H 3SO3B 1D5ZB 1OP5K 4WI9A 5D93B 4PGZA 3OHXB 4F7CA 1B6UA 1OAXL 4TUKL 4IOIB 1INEL 3JZ7A 3CXHJ 1DBAH 4QRRE 3WS3A 4JFDA 2CQVA 3D0VB 1OLZA 2P7TB 4HFWA 5D70H 3TT1L 4JVUA 5CLWA 2ARWA 1UZ8A 3MJ9H 4K55A 2J1KA 2NY1B 5EBLA 1QZ1A 1QRNB 1AI1H 2N1KA 3KJ4C 4N9OB 1BZQK 4X99A 4Z7OE 1RZGA 1XF5B 1CR9H 4G5ZL 2A77L 1CZ8L 1KJ2L 4MD0B 3MR9B 5EFIA 5A43C 3QUKB 5MEOB 1S5IL 2P8PA 3NZ8B 1MHHB 3THMH 3KPLA 1F58H 4UMGA 1Q0XH 3RX8A 1JI1A 3QIWA 1M6OB 5EC1B 5MP6L 4P2RE 3W39B 3HTLX 3V7MA 5C08A 4PBVC 1A3RL 3LZFH 4O02H 4ZAKB 3O45A 2H32B 1ZV5A 4FQXA 5A2LH 4MDJA 5CGTA 5FUOH 1UH3A 1AGDB 2PNDA 1NBQA 2HH0L 4Z7WE 3PABA 1I7UB 4LLVB 4OT1L 3ZL4H 1WVZA 4G6FB 4OZFG 4P4KA 4W81A 4YHYB 5KW9H 1OQXA 2AJXH 3BGMA 1R5VB 3BKCH 1KIPA 3LEXA 3STZB 2H26A 3PJSB 2IH1A 4LHUB 2FD6L 3H9ZA 4MXVF 4OD3H 1OSZA 4DOHE 2OP4L 4JQIH 1JGDB 3MFFA 2AJ3B 5TH2A 4UTBH 4K9EC 4XP9H 1CBVL 4GKNA 1G7LB 2DQTH 5EOQH 5ESQB 2NY5H 4WFGD 2Y07L 3BUTA 3PP4L 2MPAH 3S3JA 2NY3D 4M93C 1FYTD 3V6ZB 5DFTA 2O61B 1S7TB 3VI3E 4LRIA 1RURL 5D1QD 4QRPB 5JZ7C 2RJMA 2XWJB 1A1NA 5ID1B 2R0WH 3KYKL 1H0DB 3V6FB 2Y7QB 4C57C 6FABH 4M6NH 3E6FA 1PW3A 2ICES 2HYMA 1Y6NR 2GT9B 3ZYZA 4Z7NF 1MLCA 2C1PA 4XCCL 4PP2A 3ULVD 4FQ2L 2UWEF 3H9SE 2A83B 4ZOCA 5CILH 1UXWB 2ZG3A 1KTRL 2YUZA 5MEND 2NX5A 5KAQG 2ATKB 2C1OA 1JF6A 1M7DB 4U3XA 1NC4B 4IBLT 3T2OA 3QDGE 5JLZA 1HWHB 5HVWA 3IJSB 5T3XH 3HI5H 3ZDXE 2AEQL 2BRRL 2X4NA 2R8SH 1Q9OB 2J3SA 5CP7B 4FFZH 3EDDA 4XNUH 3UJIH 5FV1L 1PEWA 4YDJA 4L8DA 5DJYB 4AL8L 1OCWL 3LN9A 3GBMH 2ZUTA 1UB6B 3L1OL 1F6AB 1KYOJ 4P5MB 4XMPH 1A4KA 2APWA 1MH5B 3KLAB 1WFNA 3EGSA 4PGDA 2VN4A 5I8KH 2YS4A 3HI1B 4DKFH 4QRQA 1HIML 1UWXH 2X4QB 5I0DA 1HN1A 2FZ3A 4JKMA 5FA4B 4RMRA 3S98A 4Z8FL 4G6AD 4M8QA 1BQUA 1EUTA 3C6LB 3SGJC 1IGYA 1R3IH 1IC7H 5C0BE 5DUPH 4E9LA 4NQED 5TQ2H 3X3GH 4GW5B 3A67H 1K8DB 3GIVB 1WBXA 3MCLL 3H2WA 4M1DL 4PJEA 4XBGB 4XP6L 1HDMA 2VE6A 5GS2D 2DMBA 1U0QA 4F3FA 1JHTB 5T5NF 3ULSB 4LQFH 3SKNB 4WUKL 4JM4L 4Y4KB 4Y16D 3EJZC 2ADFL 4PBWD 4OLUH 3NA4A 3HZMA 3SE8H 4U1SB 3VGDA 2WUCL 1TZHA 4PJXE 1FH5H 4PJ5E 4PLJD 1IEHA 5KS9E 4FMKA 2BY0A 3BP7A 5IOPA 1MI5D 4P23A 5E8OB 5HDBF 2VXQH 1CF8H 4LVNC 3QDAA 2EE3A 4IMKC 2R56L 3OJ2C 3TN0B 5SWQB 2E5EA 2MSPA 1Q0YL 4HIEB 1DQDL 4ZFGH 5E0QA 1YQVH 1R3JB 2PYFA 4ZAKC 1JRHH 3WFCH 2XWTB 3EYVA 4X98A 4IRSA 1JYWA 5E2JA 1B4JH 4NQCD 4PJ9B 3JV4B 1RUKL 3FO0L 4Y2DD 1NGPL 4IEFB 1FIEA 2IAMA 4GRMB 4LQ1A 2FJFA 4BUHA 4HCRH 4U7SA 3I2CH 2N56A 2MHAA 3MRLA 5JHDE 3REWB 2CDGB 2MFNA 1RZKL 3QHFH 4N0RA 2D4DA 1KELH 2UV3A 3C08H 4WI3A 1S78D 5GJTH 4HHAB 1MFDL 5E2WH 4R7NB 4KI5D 2PW1B 1E28B 4RQQB 2D0HA 4L4TD 1KPRB 4NN7B 5JW4R 3MCKB 1CTOA 1GHFL 2Z92A 4S2SB 3V7AG 4POZD 4NHUA 3ZKXC 3UJJL 2ZOLB 4O00A 1EDQA 2ZUQB 5IVXB 2X70A 3SN6N 2N7BA 3PXHA 4L8CA 1KCVH 2W9LA 4NC1C 3DROA 2DQHL 4RGMC 5FYJD 1G7JA 2ZZUT 3W9DB 3NIGF 1DR9A 3PIQA 3VDCA 3A6CH 3P0YH 1Z5LA 3IDIB 4X6DE 5GRVL 3RVTD 2YRPA 3RNQB 3ARFA 4Y4HA 2YA2A 4R2GB 3BPOC 1EMTL 1GCFA 1CCZA 4AENB 2VUOA 3MRJB 4OCWL 1A3QA 1WEJH 4DEPB 1WC7A 3SPVB 1IKNC 5K33A 3ZKND 4J8RB 3IFOA 4FS0A 1JMZA 2AEIT 4GG8A 3T0ED 3VW3H 3TEUA 3VFUA 3RWCA 4HS8L 1HKLL 4R9HA 3NVQA 4N0UE 4EUPG 4LU5H 5JXEC 3RY6C 4Q2ZA 4U31A 3RVUD 4DTGH 4PJIF 1LO0L 4EI5B 3MROA 2FECI 4N5UA 2PW2A 1Y18B 4MA8L 4MXQC 1SEQH 4O2EB 4ZOBA 1MREH 5GSVB 3MOAL 4WU5B 1DL7L 4QTHB 1FFNB 4HUUB 5F7WC 4M3JA 3GI8H 2AQ3A 2HT4D 5H35A 2GJJA 3L5HA 1XR8B 3LS5H 4HWEH 3RX5A 3BRDA 4RDQF 3LCYA 1QD0A 1PG7W 3UTOA 5C0CB 3ULVL 3TCLB 4LCIL 1KGCD 1JJUA 2VDNH 5D5MA 3FT4A 2C5DC 3RKDC 3QQ3A 4JR9L 1WAAA 1FBIH 1QSEB 2G9HB 3QPQC 1B0GB 5B38A 3V5HA 5C9KA 4Z7UE 2C7UA 5C07E 1NCWL 2GUOA 1GOFA 4TRPH 1DQTA 4I1NB 5I1AB 2YEZA 1JTPA 2CDEA 1TJHH 2GJ6E 2O5YH 2YKLL 3PHSA 4U1JB 2VLKE 4YAQA 5AG8A 2F58L 3TYFB 1HHJB 2QEJA 1KIRB 4LLQB 3VWJB 2R2EA 5BV7C 2HWZL 4R96B 5IVNA 4L4VB 1A02N 4D94A 1XGTA 1RZJC 4ZFOL 3CFDB 4J23A 4NWUL 4OLZL 3PQYD 1Q9LB 3S88L 1P4BH 2XOTA 1BF8A 5I1EH 1MEXH 35C8H 3FFCB 4MQXD 4FNLL 5DQJB 5ICXB 1YDPB 1U8NA 1VEOA 4XNMA 4CMHB 3F6IA 5TF1L 4M7LL 3WFHA 4GSDL 2BSED 2NTSP 4P3CH 2XV6B 1GJIA 4KZDL 2IBBA 3RZWA 3NIFE 3VD9A 4U3CA 1P7QA 1FZMA 5ABDE 3KJ6L 4U7KA 3U46A 3P0GB 1PQZB 3RBGA 4PJ9C 3GMQA 1XIWD 3IXAB 1ONQB 3T8XA 3PHQA 1U8PA 1JGUL 3HZVA 1EK3A 2BNRB 1QOKA 4DVRL 3JWNC 2P8LB 2HFGL 2OZ4H 2OL3L 1IEBA 3BP4B 3GSRA 4DCQB 1RIUL 2WP3T 1ZS8A 1L0XA 3QNXB 3DURA 1I7TA 4L3ED 3BPLC 3CLFH 4OLWH 3QUZB 4WJ5A 2C4FT 4DZBB 5IHUH 3X11B 2FIKA 3O2DA 2G5BA 1D9KC 1GRWA 3T4AB 5ICZA 1CFNB 1LO2L 4I77H 1G9NL 3RA7H 1A2YB 3GKWH 5IIEA 1JBJA 5KBNC 2VISB 1QBLH 4WFFD 4GG6F 3FZUD 5IBUB 1RUAH 3GJFK 3HAEG 3HA0A 4TULH 3T04D 4GMTL 4O5LH 5IF0B 3SDYL 3OB0H 3GUTA 5E1AA 1CDHA 4S10A 3FO2A 3S5LB 4Q6YA 2CK0L 4PRDB 3QAZB 3EOTL 1CD8A 1GL4B 4HAFA 1KT2A 3ZE2F 4P99A 1G7PB 3CK0H 1CLOH 3BZEA 2XN9B 1QLFA 1R5WA 2R1WB 5E2VL 3TO4A 4U4BA 3IF1A 5F7DB 1JZ3A 3MV8D 5EU3A 4MJIA 2GJZA 4DEPC 4PG2C 4J3UA 1FNGA 1KB5L 4HIIA 2W0PA 1J9CT 5DVMA 5IMLA 5JZ7D 4QYOB 2GK2A 2LAAA 3S35H 4O2CB 5DF0A 4EI6A 4EI5C 3BISA 4DKDC 2BFVL 5DUBB 3HHRB 4U05A 3CH1B 3LEVL 1KN2L 1F97A 4TVPE 3U1SL 4CRPA 1EVTC 3QI9B 3MOBL 3ZTJH 2OJEB 3MXWH 5IEHB 3HUJF 1I8LA 4NCDA 4OZHA 4XVSH 2EIEA 5C0RL 5DSCA 4F7CB 3KPNA 5BZWA 1XH3A 3M17A 5EUKA 2E8YA 3WS3B 4DKEL 3CPLA 4XC3L 1E4WH 4V1DD 1IAKA 4ODSH 2R9HC 1A3LH 1UZ8B 5CIPA 3O4LA 5EBLB 2EEBA 1S7RA 4TVPH 4X99B 5HGAA 1RZGB 3ARED 3N1QC 5TQ0H 1U3YA 4LSSL 1UKSA 2R4SH 1QA9B 2NNAB 5ID0A 2BY2A 5EFIB 3CFIC 1NJ9A 3OR6A 4LHUG 1OF2A 3O6KH 4F15B 2P8PB 4PJFE 4NJAL 1MY5A 2VB5A 3CVHH 3KPLB 1CGVA 4PG9A 5HPMB 2FSEB 1NGQL 3W2DH 3QIWB 1F11A 4UQ3A 1CL7L 1QFUH 3HR5A 4X7EC 5E8DH 3LKOA 2G60L 3VWJC 2XG5A 1J0KA 2CPCA 4NZTL 5GGTH 3O45B 1KG0A 4OZIA 1I8KB 4FQXB 3TJEH 3V0WL 2N4IA 1MRCL 3NCYS 3ZSTA 1G84A 1BX2A 4H8WL 3T1FA 1KLUB 4X0KA 2VXSH 3AUVA 1W72A 4P4KB 4CMHC 5BRZE 3BGMB 5DJCA 5GS3A 2AXGB 1KIPB 3LEXB 2H26B 2IH1B 1Q9KB 3DI2B 4CU7A 3DI3B 1TENA 4UDTA 1AC0A 3EJZD 4K3GA 4M62H 1XR9A 3HE6A 5TH2B 4M4PA 3ISWA 4I0CC 1QRND 4JHBA 4GKNB 3TT3H 1MCQA 2X1OA 5EUOA 4K94L 2DTMH 5LXGH 2ZSWB 2OK0H 3ARGC 2HMIC 1U9KA 4X9HA 3OMZA 4NN6B 5ESAA 4G3YL 4PJHE 3CX2A 1A1NB 3DYMA 3OZ9H 3S3SA 4WTZG 3MLYH 3L3OB 1G7IB 3DIFB 4MA7H 4UNUA 5T3ZD 3E6FB 5KAQF 3GSQB 4JO3H 3SDDC 1MLCB 2NY2B 3DUSB 1F3DJ 3MRBA 4PP2B 4HIXH 4ZAKD 3U30C 2V5YA 3MLSL 5GGRA 4L3CA 5A2JH 4ZUTB 2NX5B 3WCYA 5JLZB 1VPOH 2JJTC 5I8OH 3HCVA 3E2HB 4MHHI 3VG0H 3BZ4A 4JREC 1EZVY 2J12B 1MJ7H 3WJJC 2X4NB 3C5JA 2DWDB 1MCPL 3ULUF 4WIQA 4OJFH 4LHUD 4HXAH 5CBAB 3DX6A 4YDJB 25C8H 5GRVK 4G6JH 1GIGH 4ONFH 4WTXA 3DX8B 5DS8A 4QGYA 3SDAA 5FGCE 3FQXA 1A6TA 1MIMH 1F90H 2VL4A 3PL6C 5F97E 1IAII 1JPTL 2CUIA 2IFFL 4GQ9H 1A4KB 1TNMA 3EGSB 4PGDB 1A7OL 5CJOL 4FQCL 3MLRH 4NWTH 3NN8A 2V17L 4X80L 3BD5A 4H1LH 3O0RH 4QRQB 1R6VA 4F57L 1BQLH 3OAZK 4ZXBB 3IJYA 2XTJE 4XNQB 4I3SH 4WV1A 2DKSA 1JPST 2UUDK 1FGVH 2B4CL 3RHWF 1NEUA 3U4EA 4M8QB 1IGYB 4EDXA 3QI9C 4YR6A 4CU8A 2R1YA 2H6PB 2A6KA 4HUNB 2BCKA 3LN4A 3OJVC 5E00A 4OKVA 1WBXB 3D3VE 1HDMB 2VE6B 3FB5A 1NC4D 4F3FB 2PXYA 4YK4B 1LEKA 5AYUH 3QUYA 4HKXA 3KDMA 4BQCA 4UT6L 2WNGA 1JVKA 4X4MA 4QHLA 3QNZA 1X4XA 3PWUB 3EYUL 2R0KL 3HZMB 4M43H 1U8LA 3NACL 3VXRE 2ENSA 3MYJA 5JXED 4HUKB 5DVLA 2EIZB 1RHHA 4X9FA 3KGRA 2EDYA 4YDKL 4P23B 5HGDB 5KSBF 1T1XA 2Z31C 4K9EL 3A0OA 5I15H 3ARBA 4JEGB 2FDBP 2B5IB 2W1NA 1NGYA 3H7BA 4JPKH 2XY1A 1HZHL 3TJHC 4FXKA 4FQJH 8FABB 3QIWC 1K2DA 5IUSA 1WGOA 5E2TH 2PYFB 3VD5A 4LLWB 4HDIA 3S36X 4JE4B 4FQXC 5KVFH 5BOPA 4X98B 3EYVB 1CVRA 4IRSB 4XP5H 3C6LD 3P4NA 3JUZA 4GFTB 2Q6WB 5IW1A 4Y1AA 3N1MC 1T66C 2BHYA 3CD4A 2GI7A 1AXIB 2J8UA 4P59H 5LCVH 1ZLSH 2IAMB 1K5NA 3K3QA 5ISZA 4FFVD 3RKDD 4HLZH 5T33L 4KU1A 5LG1A 1KJ3L 2MHAB 3MRLB 3QPQD 4JAMA 3ZYJA 3GM8A 1XCTA 2PCPA 4ERSH 4KKNA 1K6QH 5JIIA 2JF1A 3Q6FB 3ZKMC 3UTSB 4QRRA 1FVDB 3O6MH 2R0LH 4TSCH 4NQDE 5C8JB 5TDOB 1IAOA 4LL9A 1EHNA 5E5MA 4YC2C 3QRFM 2H1PL 1A6UL 4PJDE 5IKCA 1FL3A 3CVHB 1VSCA 4KUZH 1K3ZA 1C12A 2Z92B 4BQ6A 3TH4T 3TN0D 1I7RB 1U41A 4YHOL 4RFOL 5B4MD 5E24E 4NRZA 2Z0BA 4X7SH 3G6JF 4L8CB 3KPRE 4YDIH 2HP4A 4P3DA 3DROB 4G6ML 3ORJA 2OCFD 1TTFA 1G7JB 1KBGL 1IGCH 1T5WB 3PIQB 2X7LB 4JKKA 3B43A 2W91A 2VWEE 4Y5YB 3P11H 4PJ9D 4OZGB 5IQ9A 3VFGL 4P4RB 3ARFB 4Y4HB 4NJ9L 3AVEA 5TE4H 2FJHA 2O93L 4W6YB 4RRPA 4JANA 5EZJA 1WC7B 4OD2B 4Z7WA 3KS0J 3VXPB 2YRLA 1YECH 3IFOB 3V6OE 2P44B 1G1YA 3VFUB 3OGCA 3MV11 3RWCB 3BAEH 4Q2ZB 3V4UL 5I6XC 5DJ2B 1LO5B 4CMMA 1VCAA 3EDJA 3MROB 5CHNA 5EO1A 1E6JL 3T77A 3CFEA 4J3XA 4RMWA 1FFPA 1C5CH 3RY4A 3O6LL 3LH2L 5F96L 1XF1A 4XVTH 2LTQB 4DN3H 1UWGL 2R1XA 4P9HC 1FNSL 4K2UH 2VLRE 4JFQA 3RBSA 3IDYB 4BYHA 5H35B 1X5ZA 1EGJH 2EYTB 5DO2C 2W60A 2AQ2A 2ERJB 3ULUC 5I0ZA 2X42A 3HMWL 5F88A 5E6YA 1YA5A 2RCSH 4QXGH 4WY7L 2HRLA 2AS5M 1IL1A 1OPGH 5D5MB 5F3BA 5L8KB 1JL8A 1SY6A 2EXWD 5E95B 2F8OA 4R2GD 2UZIH 3QQ3B 5KSVA 3H9SA 3NCJH 5B38B 3V5HB 2C7UB 4RMQA 3OKEA 1MWAA 7FABL 4NBXB 4JDTH 2YEZB 2CDEB 3MLTA 2Q86A 1MELA 1E6OH 3HC3L 3QDGA 5CKGA 5K9JL 3OB8A 4ZD3H 1YN6A 4YAQB 2D3VA 5DMYA 1QYGH 1OSPH 2GHWB 4YXKL 5AZ2L 3GK8L 4XMKH 4LEXL 3BP5A 1NBVH 4EI5D 5K9KA 3GSUB 2IBZX 4ZS7L 4M7KL 3QHZL 5C0NC 5I8CB 3AS1A 3BZFA 5KSUA 5EZLA 1XGTB 1NMAL 5JORA 4YHZL 3RUGF 2YSSA 2YD7A 4IDLA 4FZ8L 1U8NB 5ENWA 4ZYKA 3PNWA 2Y06L 3WFHB 4S0TD 4XT1C 1NAMA 3O2WL 4LCCC 3G08A 5HHOE 5FCUH 3U9UB 1KLGA 1FZMB 5IT2H 3QH3A 4XCFH 5LBSH 4JG0L 4ETQB 1FCCA 4DGYH 4PGBA 3CZFA 3MBXL 4N68A 5C0CD 1N2RA 4OCSH 3T8XB 1QBMH 3PHQB 5IBUG 1CFVL 1U8PB 5LGHL 2IAMC 4NCC2 3HZVB 4OI9A 3WNLA 5CGYC 2F5BL 5C0BA 3UPRB 1OAQL 1QSED 1IEBB 5GS1A 3GO1H 4JHWH 1C08A 3W0WD 3QEGH 3S5LG 1IC4H 5ADOH 4KFZC 3DURB 1I7TB 1I8IA 2QQKH 1D6VL 4G8GE 4Y0GA 4HWBH 1P1ZA 3QUML 1B3JA 3RZCC 1F13A 4I4WA 2F53E 3K8KA 2FIKB 2VAAA 5E94A 3VWJD 2G5BB 2AJYL 3F7VA 5ICZB 4L4VD 1BFVL 2A6DA 4MCZA 4TSBH 4OGXL 4NQVA 5IIEB 2P24B 1N0XL 1DQMH 2AK4D 5DRZA 3QUXA 4PJXA 4PJ5A 1KTLA 1ORSB 3FFCD 5D7LD 3MRIA 1S7WA 1FORH 4I0PA 5I1IL 3GUTB 4LASL 3KPSE 1A6WH 2EC9T 3FO2B 3F62A 4LCYA 4PRAA 4LDOB 3QFJE 1Z0MA 1IJ9A 1KT2B 2F54B 4C4KO 1BWWA 2VDPL 4HS3A 3S34H 2QV2A 1XGQA 3KLSA 3FJTA 3ARFC 3O41A 2I27N 5EU3B 1E0OB 2BNRD 3ARGD 3CIQA 4HWZA 2F5AH 2HMID 1JNHB 1FNGB 3D69A 4HPOL 1JGVH 2HFTA 4HIIB 3RI5K 4RSVA 4J3TA 5IMLB 2V7HA 4G9FD 4R90H 2EECA 3LKNA 3UYRL 2PTVA 1RJYA 3UAJD 3N85L 4EI6B 5GZOD 4PYGA 3U6RA 1CI5A 3SDDD 4WNQA 3OPZL 1JN6A 4IRZH 3I9GL 3N0PB 4K3JL 5BV7L 2LABA 4OZHB 4XRCB 1NCDL 5DSCB 5EU4A 1B0RA 1GGBL 2CO6B 3KPNB 1P53A 1AFVH 3U0TB 4M6OL 3FCTB 5BZWB 1XH3B 1RZJL 2UZYB 5EUKB 2XRAL 2FRGP 3EYQC 1LE9B 4PJCE 4YE4H 3CVIL 1HK6A 2A9MH 1IAKB 2CXKA 1LD9B 3O6FA 4FQIL 5CIPB 4RISH 1IGTB 3DJ9A 1S7RB 1T3FA 1CLYH 4IS6A 2XN9D 1A4JA 5HGAB 3KYAA 2EDJA 5I18H 2OI9B 5B3JE 1MFBL 3PL6D 1DP0A 5ID0B 1NJ9B 3OR6B 4M5ZL 4UV4L 2AABH 2R0ZL 1T83A 5FA3A 4F7EA 5IVZA 1PYWA 4X6DA 3I6LD 4PG9B 1UZ6E 1F11B 2GEEA 2EH7L 4Z7QE 3QFDA 3HR5B 4LGPB 3LKOB 2Q3AA 4O4YL 2YXMA 4KVCL 3BKJL 3CSPA 4K7PL 3PE9A 3L7FA 1YYLL 1KG0B 4K3DH 4OZIB 1NCTA 2LE9A 3QI9D 3ZT7A 1VHPA 4N0UA 4LLAA 1AR1C 4ELME 2VR5A 4X8JB 1BX2B 3M07A 5FB8A 2E6PA 4X0KB 4LFHG 3ZE1E 5CEZD 5E8EA 5KZCB 3IFNH 1PJ9A 1W72B 2OR9H 3JUYA 5DJCB 3IETA 1IBGL 5GRZA 4Y89A 3U0PA 3HNVL 5ITBL 1FVEA 4JFDD 3T65A 1F2XK 3MGTB 4KHTL 4UDTB 4MXWH 5FFLA 1JZ8A 3VGFA 1FZJB 3HE6B 4P0DA 4F9PA 3L5XH 32C2A 1BFOA 2D7TL 1XF3A 2C3VA 4HF5H 2VQUA 2D7MA 1A1OB 4M1CC 2Z31D 4JO1L 2ZNWA 1XCQA 3MRMB 1EHLL 4IRJC 5E6ZA 5IM7A 5ERWB 1ZVHA 2H8PA 3QIWD 3X3FH 1YNTB 5TE7H 4WUUB 1BVZA 1T2JA 5TJWK 3IAPA 4Z7UA 2XIDA 1CN4A 4RZCA 3MRBB 5C08D 4C83A 1A9BA 5JR1L 4TPRL 4FQXD 4GAFB 4L3CB 2DI8A 2VLKA 3PWPE 4WW1A 2XPGA 5HVHB 2YPLE 1RIHH 3IDMA 4S11A 1T66D 2ICWI 4IHOA 2DJUA 1TPXB 3DMMA 2EYRB 3ZDYE 3P4LA 3HCVB 4P4KD 3BDXA 5HSFA 3C9NB 1B2WH 1G9MH 3KWWA 3C5JB 5IW3A 2VDOL 4M00A 4JFXA 5BVJA 1MQKL 3DX6B 1FNAA 4RCAA 2XKSA 1HCVA 2HFEA 2YUWA 2FO4A 5A2IH 5DS8B 5L2KA 3SDAB 3TO4C 5IFJA 3K0WA 3N06B 3ZKMD 1D6EA 2DS4A 5C3LD 2QR0A 3LQZA 3FQUA 4XP1H 2K9UA 1A6AB 5HHXL 5I1HH 2Q8AL 3NN8B 3GRWH 1TNNA 1NLBH 1OP5H 1YMME 1ZHLA 1LP9F 3B2UC 3H7LA 2D0FA 5FUZH 3IJYB 3O9WC 4XPFL 1OARH 5CZXC 4LFHD 3QG7H 2APFA 1F2QA 1EUUA 4QRSA 3C09B 1PY9A 1YMHB 2BOCB 1ZLWK 5HGBA 2NY2D 3CFKA 2GIYA 5FDWB 4EDXB 3LAFA 4YR6B 5HXMA 3HNSL 1AGBA 3SDXE 4WWID 2F19L 2R1YB 3E8UL 4PRIE 4HWUA 2A6KB 1YEHH 4NN5B 5BMFH 2BCKB 5HGHA 3LN4B 2NX5D 4PGJA 2FEDD 4OKVB 4PLOB 3FB5B 1S9XB 1HHGA 4P2QE 1FAIH 4K8RH 1MF2H 2PXYB 4HKXB 5EO0A 5DLML 3KDMB 8CGTA 1F3DH 2AI0L 3TV3H 4WRLA 4LCUA 3NABL 4JVWA 4QHLB 5JW5A 1U3ZA 1P84K 1RJLA 3U36A 3MRFB 4KJPD 1CICC 4H0GA 1U8LB 4L29A 3MYJB 3MFGB 1IC5H 1YEDA 2LFGA 1RHHB 3WD5L 5CCKL 1T1XB 3LIZH 5GGVY 2DICA 3ARBB 3AU1A 3OXRA 2X1PA 1ED3A 2YUVA 1GGIH 3MJGX 1BZ7A 1NGYB 2PKDA 1P5UA 4FXKB 4OQTL 4UIKH 3WLBA 4CJ1A 1K2DB 3X14A 5EIVA 2XFXA 4CL7A 4WFEE 1T03L 1NGWA 5GGUB 1W2KT 3PWNA 2YC1A 4OLEA 1RK0A 2Y36L 4HDIB 4F9LA 3SQOL 3MV7E 1OTSD 1LO4H 1HEZA 5DO2D 1MFCL 3P4NB 4OF7A 3P73B 3MODH 3QPXL 3BH8A 4JM2B 5IW1B 3VFOA 2YD3A 4Y1AB 4WGVB 2J8UB 3A6BH 2R29L 3WO4B 2P5EB 3QCUH 2X4TA 1C1EH 2VZTA 5ISZB 2DLEA 2A6IB 4DN4L 4JAMB 1QQDA 2CDFA 1EVUA 4NKOA 4FTVB 4U33A 1XCTB 2PCPB 3V52H 1EBPA 3OJDA 5LWYH 3HE6C 2DQFA 1J1OH 3EIFA 2BHZA 2PF6A 4NZUL 4O51B 2AXJA 2YRZA 4KY1L 3VU2A 5E08H 1QR1A 1N59B 1RMFL 4L4JA 1INDH 5F7MC 2X4PA 4X9IA 5IHLB 5C70A 5IKCB 4P23D 4RGOH 4C54A 1HQRB 3IAQA 4JKPL 4HC1A 5AUMA 3SGEH 1S7UA 4KTDH 4JB9H 1DSFL 3WIFA 2FECL 1IFHH 5F9JA 4IDJH 1J86A 4NRZB 3ES6A 1EEYB 3CLEH 4JFYA 4PUBL 2WIIA 4P3DB 3L95A 1CFSA 1CGUA 1BWMA 4X7DC 3CC5B 4IRSD 4OGZA 4YFEA 2BSSA 5JUEH 1N5YH 1WWWX 2VLME 3DYPA 5ITFB 5EG6C 4G8EA 5GHWL 3VI3F 1P6FA 2FJHB 2HT3C 3QJFB 2IAMD 5J56B 5K9OA 5CGYD 3FFDA 4JANB 2JB5L 5EZJB 5CZVH 2RQ8A 4EOWH 4POYA 2AEWA 4IIQA 3LD8B 3OGCB 5BRZA 1YPZE 3SDAC 4YLQT 1IKFH 4ZQKA 2Y5TA 5GGQL 4CMMB 2CD0A 4Y5XA 5CHNB 3GSOB 5EO1B 5B38G 4KAQH 1F4WH 1U8MA 4MAUL 3T77B 2DIAA 2ZUSA 3MA9L 3CFEB 1MNUL 1FFPB 2PO6B 1S7XA 3SE3C 4Z0BH 4WV1C 3VD4A 5JPNA 2JJSA 3RU8L 2R1XB 3C09C 5I1LA 2JKXA 1NCUA 4JFQB 2WBJA 2WUBL 3UTZA 1ZA3A 4PJHA 1NCCH 5HI4C 4NUGH 2IG2H 2W60B 4U1NA 1T5XB 2X1WL 5DD5H 5F88B 3WXWL 2H2PC 5EU5A 3D5OF 5L9DL 2C4XA 1BOYA 1CE6A 1WT5A 4WVRA 1URLA 2WBKA 1IL1B 4LLDA 2CLVB 5F3BB 4HLJA 4PY8J 3MNVA 1UM5H 3BPCB 5C2BH 3ARFD 4Y4HD 1XF2A 4QT5A 3QUYC 3H9SB 5IB3A 4R8WH 5KSVB 4XPTH 3BUYA 3B5HA 1WTGT 4OLYH 2DWEA 4WEUD 1MCIA 3OKEB 1UB5A 3S4SA 1LILA 1MWAB 3MMEA 3V0VA 1T7VA 1BAFL 4QHNA 4ONGL 3MLTB 2Q86B 5MI0B 3QDGB 5DEFA 1YN6B 2NY7H 2DMCA 2BX5A 4PGEA 5ECJE 2AJUL 5D1XB 4S1RL 1A7PL 3BSZL 3BP5B 5JMOC 1TETH 4Q97A 3V95A 2J8HA 5TFSH 1E4XH 3BZFB 3KS0H 5C7XL 1A7RH 4UQ2B 3WIHH 1MCEA 4HV8A 4NO0A 4BH7A 3WXVL 4ZPTA 5FO9A 2OJZH 5ENWB 3PNWB 1UCBL 4XHQA 1KEGH 4GAGL 1NAMB 3L5JA 1A22B 3NPSB 2W9EL 4I3RH 3EYQD 2GSGA 3G08B 4XWGL 4XTRC 1KLGB 5DMKA 3FAWA 3QH3B 3W81A 5J12B 1RZ7L 4PGBB 3HMXH 1N2RB 3WO4C 2VOTA 1L0QA 1P4LA 4R4FL 1DEEA 4H25A 4KUCF 2NW2A 4ZSOE 4LP4A 3IS0X 4CJ0A 4Z7NE 1CLZH 5C0IA 4CKVX 3TP4A 2UWEE 3BFOA 3QEQE 2J6EL 3D3VA 4G8IA 4ODWA 4UINL 5FK9A 3SE9H 3C5ZB 1I8IB 4I2XB 4NC0B 4RGNB 4JVPA 5BVPL 5JXAL 1QHPA 5AWNL 4D8PA 1P1ZB 3QDJB 4E0RA 2R4RL 1TJIH 1T1WA 4CGTA 4I4WB 4LPXA 2IQAA 5DMIL 5E6IA 3RWFA 5E94B 2VAAB 4AEHL 3NTCL 3O11A 7CGTA 4MQSB 3F7VB 2CGRH 4OCRL 2A6DB 3BIKB 4MCZB 1I9IH 4NQVB 2MCPH 4OFPA 2D7OA 5DRZB 2VLJA 3VXRA 3QUXB 4PJXB 1AR1D 1K3IA 2RHEA 3H6JA 1KTLB 4NKDA 3UYPA 3DHMA 3BO8B 3MRIB 4WO4B 1S7WB 4XC1L 5EOTA 4LARH 4I0PB 5IQ7H 5DHVA 1I9RL 3WS6A 1JNNL 3GNMH 1CXKA 1ADQH 3WIIL 1P7QD 4JFOA 2CJUH 4P9HL 1AHWB 3M8OH 1M05A 4HS3B 3U79A 2VDLH 3VRJB 1OOAA 5KTEH 3O41B 3BT2L 3UEZA 3MREA 3OKOB 3ULUL 4O9HL 1K8IA 3BEWA 1L7IL 4HWZB 4FN0A 2VDRL 1A6PA 3H42L 5FYKD 3VXOA 3D69B 1W0VA 5C6PB 3MRHA 3T0XA 4M1CD 1CGSL 1GOHA 4YFLI 2HKFH 2V7HB 4LSPL 3O2VL 5T5FL 4AEEA 4DWHA 2DLIA 2IMMA 3E0GA 5I1KH 2FX8H 4U6YA 1RJYB 2R69H 4FZEH 3CFCL 2B2XL 4GUPA 4HJ0C 4PJBA 4YBLB 1QFWM 4XPAH 4Q74A 1OAXH 4TUKH 4WNQB 3RDTA 2VRAA 1JN6B 1PFCA 3ILQC 2AXFA 1FV1A 1CXEA 5F89B 3F7RA 4LLMA 5DWUL 4NQDA 3QDME 5EU4B 3UBXA 3LV3A 4F37F 5A2KH 4PJDA 1KTDB 4MMXC 2YPVL 2MQCA 2EDEA 3D87B 1NUNB 5EH1A 3QXUA 4P57A 4UAOB 1AO7E 4PRBA 1KJ2H 5HDBE 3O6FB 1UG9A 3RP1A 1EZVX 1T89C 4ODVL 4O2FB 2GKIA 1T3FB 3V4VL 5EC2A 3TO4D 2GQHA 1RU9L 3QIUA 1MHCB 1IGJB 4MJID 5MP6H 1J5OL 5FA3B 2JIXA 2XKUA 5IVZB 1A3RH 4X6DB 4HGWA 3QA3B 3JV0A 1RIVH 3B2UD 1CGYA 3MUGB 3S97C 4NNXA 1MJ8L 3HLAA 3ESVF 1ITCA 5CZXD 3E3QE 1IT9L 2P8MA 3GBLA 4FQPA 5D71L 4OT1H 3MV9D 4H0IA 4NFBA 5L2JA 5KJRL 3BJ91 3L7FB 3V6OA 2R2CA 1OT1A 5DD3H 4M7JL 3OG4B 5I1DA 4XVJL 5FB8B 2VQ1A 4F7TA 3N1PC 2OP4H 4UDUB 4EN3A 3R4DA 5E8EB 3D39E 5B8CA 1DLHA 2FCBA 3U0PB 3BPNB 5I2IB 3IFPA 3T65B 3PP4H 4K7PX 1JFQL 3IDGA 3O4LD 2VLRA 4Q0XL 4KKBC 3BD4A 1XF3B 1JGLL 1DZBA 2C3VB 3B6SA 5GS1C 2Z8SA 3Q1SL 3G5YA 2FX7L 3GJFH 3D85B 3LN5A 1U42A 3O3AA 5D7IB 4ZFOA 1IAIL 3U82B 5C0EA 5IM7B 3QRGL 5IW6B 3NIFF 2H8PB 3R1GH 3MLZL 3BWAA 3L3IA 3IU4L 5SWSE 2JLLA 2V5SA 4C83B 2HFFB 1A9BB 2AEQH 2BRRH 1ZSDA 4KHXL 1EEZB 1EFXA 3GZKA 5D6CB 1KCSH 3GKZA 3K74B 3IDMB 1U8QA 2DD8L 4IHOB 4AL8H 4FABH 1R3LA 2O26U 2PYEE 2V9RA 4PJIE 2DLFH 1VEMA 4FQQA 1XZ0A 4JFXB 3L1OH 4ZNEE 5BVJB 4JQVA 5JHLH 3B3IA 1T21A 2BVQA 2HFEB 5D2LA 2FO4B 2F74A 5DJDA 5AZEL 3HE6D 2YHGA 4Z78A 5L2KB 5IFJB 1F3RB 1UWEL 3VXME 5HHOA 1D6EB 1HIMH 2QR0B 1LNUA 3LQZB 1H3PL 3FQUB 1WFUA 4YWGL 5EBMA 5I9QC 1VFAB 4APQB 2WIMA 1ZHLB 2P48B 4PJ7F 4Z8FH 3VFWA 3GHBH 5L0QB 3WDHA 2XI9A 3ZO0A 3TESA 4X83A 1REIA 4M3KB 4QRSB 3VD7A 4ZG1A 2I9LA 3EFFA 4KKLC 5FYLD 4R4NC 4XP6H 4M1DH 4OFDA 3CFKB 5HGBB 4K71B 3CUPA 3UTTE 4U1MB 1U2HA 2IWGA 2E3VA 1AGBB 4G8GA 1WCBA 5F8RC 4JM4H 5HGHB 1C7SA 1CDJA 3C8KA 2F53A 2OTUB 2EKSA 2ADFH 1HHGB 5D2NB 2E27L 3EHBC 3JV6B 5EO0B 2HT3D 3MUJA 3O81A 4LCUB 5DT1L 3S37L 3O6FC 3NGBC 4YHPA 1KPUB 1KB5A 4G9DB 4OUUA 1AGCB 1DBJH 3HG1E 1I1AA 1DQJA 1RJLB 3U36B 1AH1A 4U7MA 3SDAD 2EYSA 4L29B 2R56H 3MZTA 3KPSA 3SJVE 4OF0A 1YEDB 1VB9A 1NFIA 2YN5A 4JFEA 4UT7L 1DQDH 1MCWW 1MHPH 3D18A 3JV5A 1PEZA 2VLLB 3WNMA 3AU1B 3OXRB 1ED3B 3P30H 2H3NA 1BZ7B 5GS0C 2VC2H 1TQBB 5JW3L 5FYKL 3X14B 4DFIA 4GBXA 2XFXB 3LPGA 4QO1A 2CUMA 2EH8H 3TBSB 1NGWB 3TO2A 2IGFH 3PWNB 1J18A 1NGPH 1ZT4A 1FZKA 3RGVA 3WKML 1BHGA 2IAND 1B9ZA 4AM0B 2ED8A 3BH8B 4GS7B 3VFOB 2A38A 2GSIA 2H2PD 3X17A 5J0BA 1CT8A 2M26A 5J3HC 4N1EA 4PJFF 1QSFB 3V5KA 4OZGF 1BM3L 2X4TB 4EXKA 2W0FA 2PXYD 3QUYD 1MFDH 1QQDB 3VFSB 4OF6A 5ANME 4BQ9A 4NKOB 3OJDB 2EE6A 1EO5A 4HX1A 4GG6E 3TBYA 2VTFA 5TPWL 1QR1B 2OTWA 4I13B 3OXSA 3DGCR 4NZRL 3UO1L 4JCLA 4RRPG 3WSQL 3Q3GB 4KRNA 4NHCL 4NOFA 4YDVA 1P84J 2DBLH 4LCWE 1XGPB 3P77B 3ARBD 5A16A 1FSKB 4I8DA 2BK8A 5AUMB 4XGZA 1S7UB 1FPTH 3RIAK 4HEME 3WIFB 1C5DA 1FFOB 4MA1C 3K46A 4NPYA 3I3EA 1QFPA 5F9JB 4P5KA 1YEJL 5K59F 3ES6B 1X5LA 2ICEA 2WIIB 3DX7A 3L95B 5IV2B 1CFSB 4GW4A 5F9WB 1EMTH 4WFGE 3W9EB 2XZAL 4LIQL 4OCWH 2IPKA 3SGDH 4HUVA 2BSSB 3DX9A 1FYTE 1TVHA 5I76A 4WWKA 4Y1AD 4G8EB 3DRTA 3DMMC 3HR6A 2X1QA 1EPFA 3KYOA 1UJ3A 1WUNT 4N0CC 4MD4A 5D5MF 5ISZD 3MQIA 5K9OB 3OAZH 3O8XC 4ELMA 4LOUC 1FCGA 4HZLA 1LO0H 3VE0A 4E41E 1GC1H 3UTQA 3NZHL 3RWJA 2IH3A 5BRZB 3KXFE 2UUDH 3HUJE 1U8KA 4MA8H 2XXCB 1EO7A 3D2UD 4QRRD 1CE1L 1MCLA 1L0YA 5MENE 1QBAA 1HSBA 1ZWIB 5JDSA 4ZQKB 4B5EA 1L7TH 2Y5TB 1LQSR 3AAZA 4Y5XB 2Q7YB 4JRXE 1DL7H 3INUL 2QADB 3VXTB 5CP3H 1U8MB 2EXYC 4G7YL 2MWCA 1S7XB 1IM3A 4DAGL 5J11B 4PS4L 4TUJA 5I1LB 3MRKA 4LCIH 1FGNL 4RFEB 2WBJB 3ARXA 3FO1B 3UTZB 1ZA3B 1HQ4A 4U1NB 1MCCA 1NFDE 2IPTH 4IOSD 2FB4L 4HBCL 5EU5B 1CE6B 3UBXI 5CD5C 4B50A 4LLDB 1AD0B 3ARPA 4EIZC 3MNVB 4CVUA 2V5MA 1GH7A 4RAUB 1XF2B 4MJ5A 4OF8A 4QT5B 5I73C 1OGTA 5IB3B 1FVCA 3P40A 5F7HA 1UB5B 3S4SB 2YPLA 1CIUA 1Q9WA 3OAUL 4QHNB 2HWZH 2IF7A 3FB6B 3NFNA 5BJTB 5DEFB 2CLRA 1JTTA 5DJ0B 4OLZH 4PGEB 2DQJL 2KKQA 1WZ1H 4KRPB 5D8JH 2DL2A 3FHQA 4HJ0D 4GH7B 3RWDA 4FNLH 2J4WL 1U58A 3C2SA 1F8TL 1ZHBB 2FATL 4UIMB 1BJ1J 2V5RA 4HV8B 4NO0B 5L88H 4OZFH 3KJ6H 5I19H 3EJJX 3N1GC 4JCMA 4ZPTB 5EWIL 5C09E 5FO9B 1DDHB 3CDGB 2HG5A 1UM4L 2IQ9L 1MPAL 1QKZH 4D9QD 4JRYE 3H8NA 1YMMA 2GSGB 3TVMC 5HYQA 3LEYL 5ALCL 4DVRH 2XTJB 2HFGH 5FYLL 2OL3H 2DQUH 3LHPL 5GS2H 5F1KC 1P4LB 1A7NL 2IJ0C 1EV2E 1HSAB 4H25B 4ZO7A 1DQLL 1KCRL 4LLYA 3H9SD 1J87A 3SDXA 1YEFL 4M1GL 1I9JL 4PRIA 5D6DA 5I1GL 2A74A 5C0IB 5C6WH 3CJJA 4UILH 3DBXA 4Y7MA 1U93A 1NC2A 1KC5L 2AK1H 1X5YA 2HVJA 2NXYB 4G8IB 4A6YA 2FLRT 5KN5A 2I24N 3QDGD 4P2QA 1G9NH 1IEAB 4D8PB 2E9BA 4E0RB 3LKPA 2VABB 4I9WD 5E6IB 2IQAB 3B83A 3RWFB 1FDLH 5I30L 1AXSA 2VNCA 1BVKA 4M5YL 3IGAA 4WCYL 1Q1JL 2FGZA 4LHQB 1FSKC 3OKKA 4GMTH 2XZCL 1PSKH 4IJ3B 1JYNA 4HUXA 1AXTL 4JDZA 2VLJB 1N6QH 1KTKE 2CK0H 2GK0B 1Y6MR 2CH8A 4NKDB 4OCLC 3EOTH 2MKWA 5EOTB 2DYPA 3CX5J 4MDIA 2WBWB 5DHVB 1KIQA 3CXHK 5E2VH 1ACYL 2IADA 2V2WA 5F9WC 5DR5H 4JFOB 1FAKT 1OHQA 4BK5A 1M05B 4Z7VB 2DQEH 1NQBA 2CKBA 1T1ZA 2LU4A 3CFJA 4KKBD 3MV7A 5LAXA 2ZKHL 1K8IB 5C0BD 5HYFA 1W0VB 1JZ6A 2BFVH 3MRHB 2AQ1A 4IIQC 1YY8A 1RULL 4NKIH 3U1SH 1G6RA 3UPCA 5FYJE 4RGND 1QVOA 4U6YB 5D1ZA 4V2CB 4U1IA 3LMJL 4NUJA 4GUPB 3VXUE 4PJBB 3MC0A 4Y5XC 1FO0L 4OIBA 4Z95H 5C0RH 3AS2A 5DHYA 5DGQA 3X13A 4K7FA 4L1HA 4G80A 4XCYA 4DKEH 2AXFB 4YX2H 1CK0L 3Q6GH 5DZOA 3VGAB 4LLMB 1G1CA 4M7ZB 4NQDB 3LV3B 4PJ5D 1N5AA 3T0EE 4D0DA 4UV7L 4PJDB 3C2AH 2WBJC 4I0PD 3U83A 1BPVA 2AV1A 5FYJH 4LSSH 4P57B 4ORGA 5KSBE 4PRBB 3GMNB 4D0BA 1DJSA 3FB7A 3QZWA 3PWJB 2CRZA 1Q72L 2FH8A 1G7HA 4NJAH 4NNPL 1XGYL 3EUUA 4YPGA 1G7QB 3U0WH 1NGQH 3QIUB 4WI8A 5EZIL 3HE7C 5HDOA 1S5HA 3GI9L 1CL7H 2YR3A 4OFIA 4KTEL 3VD3A 4LSVH 2JIXB 2HVKB 3TZVA 4HGWB 2BHUA 1MCFA 4P46A 5DD1H 1A1MA 3V0WH 3RFZC 2NY3B 3HLAB 5AD0A 1CR9L 4KDTC 5F8QC 2O5ZH 4LSDA 3MV01 3ILPA 1KGCE 5L2JB 5JHDD 4HQQL 4IMKA 3THML 4PLNC 4MAYA 4J3OC 1M1SA 1YPZA 4KI1A 3QG6B 4F7TB 1MCNA 4ZNCD 2ID5A 1E4KC 1HHIA 1KN4H 4EN3B 2EZ0C 4ZO8A 4QXTB 3LZFL 4O02L 5EA0H 2OXHA 3BP6B 1DLHB 2VXVL 5B8CB 2UY6A 3IFPB 4K94H 2L7UA 3B2VL 4LRNL 2QQLH 4R97B 5KVDH 3D1MC 2XTJC 3O6FD 5DI8A 3IDGB 3ZL4L 5CSZA 2VLRB 1WBZB 5KW9L 3CSBA 1TVBA 4YHKH 3BMWA 5IHBA 4BSVA 1KYOK 3QQNA 4PGCB 3G6JE 4JQIL 1GGCL 5IEKA 4UTBL 3LN5B 1LMKA 3B8YA 3O3AB 4ZFOB 3VFMB 5GS0D 2DQTL 3MLSH 5EOQL 4EJ1C 5C0EB 4W70A 3DO7A 5KOMC 3BWAB 5E6IC 2A73A 4AZ8A 4YDLB 4N0FA 4PREA 3P4MA 1LEIA 4GMSH 4AH2A 2F15A 1AR2A 4IJ3C 1HOCB 1MCPH 1JNLH 5HI5C 4L9DA 1U8QB 3K7UA 3U9PH 5LGKA 1R3LB 5J3HD 4LAQL 3PGFH 1FE8L 1LO3L 1WIPA 2QQQA 1BJ8A 4FQQB 4OCNC 3EZ8A 5E4IA 3HC0A 1JPTH 4GW1A 1I1YA 1LK3H 4PR5A 3EW3B 1A7OH 4XNZB 2X4SA 4FQCH 2FLBT 5D2LB 1T21B 2LU3A 4EUPH 2V17H 4XAWL 4HGMA 1FG2A 4OTXL 4PV8A 4X80H 4QTIL 4Z78B 4P2OA 4F57H 2NY0B 1YJDC 5HHOB 5FHBL 1OW0A 1IKNA 1ETZA 5EBMB 4RX4A 2JJWA 4KPHL 5E5RB 1U8HA 1CYGA 1O5DT 1SY6L 1BD2A 2JCCF 1SJEA 4JFZL 3T3MF 2Z4QA 3RY6A 5I1CL 4CVZA 1MI5B 4ZSOA 4X5WB 4ZFFA 3M1BB 2ARJQ 5I8KL 1CGWA 2UWEA 4DKFL 3RDTC 3CUPB 3GMRB 5J13B 1SJHA 4BFEA 1H3VA 3MV8E 5AYQA 4EDWL 2VLKD 3QXAB 1CG9A 2NY6C 15C8H 3WEXA 4M7ZC 4UT6H 3C8KB 1C8PA 2F53B 5IBTH 4Z76A 4JM2F 1JYVA 2EKSB 3DMMD 3EYUH 3PP3K 4NQCB 1IC7L 3HN3A 4MQ7A 3NACH 4N0CD 5TQ2L 3X3GL 3MO1B 3O8XD 4LOUD 4YHPB 2P49B 3DNKA 1KB5B 1KF9B 3A6OA 4OUUB 3RUGE 1I1AB 1DQJB 2VL5A 3SHSA 3CMGA 3MJ8B 3KPSB 1HZHH 1H3TA 3QIUC 1NFIB 3TM6A 2Z8VC 4JFEB 1V7ML 1MRDH 2F9BT 2NLJB 3D18B 5CINH 4WGWB 2VWEC 4OLUL 4X6CA 2EXYD 2H3NB 4S0SD 5TE6L 3K8MA 1FH5L 1SQ2N 1FQ9C 4GBXB 3DRQA 3VWKC 3TO2B 1FL6B 3V79C 4C59B 4L4TB 1JPGA 3V6OC 1CF8L 4A2LA 4JDVA 4FXGB 4ZS6C 5CSGA 3WHE0 4BFBD 4U49A 2AVGA 5KVEH 1PVHA 2GSIB 3S7GA 1Z9LA 3RPIA 2V9QA 1YQVL 1CT8B 1LDPL 1OAYH 5CD5D 3V5KB 5B8CC 3WFCL 1QNZL 2W0FB 1TTUA 4LVOC 3W11C 3ZHDA 1UZ6F 4AMKL 3QQ9C 4JO4L 4Z7QF 1A6UH 3WMSA 4HX1B 1CD1B 1H8OA 4EBQL 2B1AH 1SMOA 1IGML 3WL9A 2YBRA 5DRWA 4HCRL 3TBYB 3K80A 3VGBA 2OTWB 4ZO6A 3ME0A 1AO7A 4NDMA 4XB8A 4YDVB 3ARYA 5F7NC 3ZE1F 2MQ3A 2X4RA 1JF5A 1NMCC 3GGWA 3OGOE 4FFWC 3C08L 4X5LA 4ETYA 3QO1A 4XGZB 4MQTB 2BVUA 5E70A 2FNBA 4OGYL 3T2QA 1C5DB 2AJVL 1KFAL 1A14L 4P5KB 4U1KA 1NBZA 1D9KA 1OD9A 3VFGH 2BMKA 1UXSA 3DX7B 1YEGL 1ES0A 2IPKB 4MA3A 4J6RH 2ADJA 3DX9B 5GIRB 4YHLL 4DUVA 2DQDH 5GSRA 3I3DA 3KYOB 1KCVL 2DQCL 1UJ3B 5F9OH 4MD4B 1I1CA 3IDNA 5DK2A 3KYMB 1BEYH 3K4DA 5T3ZE 1IZKA 4HZLB 5EIQA 3VE0B 5ALBH 3UTQB 3QSKB 2DKUA 2C26A 1FNEA 3D39A 1ZLWH 1KULA 1KLFA 2NY0C 1VFBA 2EC8A 2FX9L 2HLFC 2OLDA 3O6LH 3LH2H 1HSBB 5JDSB 1OP3K 5IESH 1KPVA 3AAZB 2L4OA 5EB9A 1UWGH 2X4UB 4F8TA 3S4SG 4XNYH 1EXUA 3KLHC 3QWOB 5T3ZH 3SGEI 4ALAH 3F5WB 1IM3B 1ZGLA 3HMWH 4XBPA 4ISVB 4TUJB 3NFPB 5EBGA 4WY7H 5GS0L 3PQYB 1WIOA 4CDGC 1KJMA 5FYKU 1HQ4B 4RBPK 3C8HA 4FA8A 4KJWD 4XP4H 5SWSA 4NRXB 3LKRA 4QRPE 4UUJA 3MUHL 4YXLL 5K9JH 4NQXA 1OGTB 5I1JL 3IVKA 1FVCB 3LS5L 1TVDA 3BN9C 4HWEL 5AZ2H 3GK8H 1LDSA 3AXLA 2VH5L 4LEXH 2YPLB 5TDNA 4ZS7H 4M7KH 2JB6B 2APBA 1I1AC 2VDNL 3QHZH 1QLRA 2CLRB 4GO6B 2YZ1A 1MRFL 2PYEA 5BRZD 1NMAH 4QEGA 1LE5A 4PJIA 3L3HA 3WDJA 5GRXG 4Z18A 3RWDB 3VGEA 4BM7A 1NLDL 4AIOA 2BNQE 4TRPL 1SBBA 2C9AA 2NZ9C 3MRGA 1BF2A 1TJHL 2O5YL 4Z77B 1ZTXH 4I18A 1ZVSA 2RGSA 4I3GA 5HHME 4JG0H 2HG5B 2OX5A 4JY6A 3ARVA 1DE4A 5ICYB 2GCYA 2WBJD 3RGVC 4MX7A 5HYQB 4NKQB 1P4BL 3V9FA 2F5BH 5I1EL 1MEXL 35C8L 3BN3B 4U0RC 1MY7A 1ODAA 4OCYL 4S1DC 4PPTA 2C3WA 3PF2A 2HAZA 3UTTA 1D6VH 1CU4H 5TDPB 1H3GA 1T0MA 3QUMH 1DUYA 3FN3A 3BQUA 3SBWA 2A74B 4HXBH 2G75A 1N4XH 1U93B 1NC2B 2AJYH 3BVNA 2HVJB 2AGJH 5J4MA 1BFVH 2EDDA 2EKJA 1N0XH 3EFDH 4M93B 2OZ4L 2XA3A 4FQHA 1Q94A 1AXSB 1BVKB 1V3KA 4G9FA 4NO3A 3OKKB 3HG1A 4RIRB 4LASH 2HJLB 4HUXB 4JDZB 4OLWL 2WLZA 4NO0D 3SJVA 1TFHA 1DEDA 2EZ0D 2DYPB 3TLRA 2VDPH 4EIGB 1RUPL 1KIQB 4GOSA 1RZIA 2AJZB 2IADB 5DURB 1AGEA 4QF1A 1A6VL 4MMZC 2HLAA 5DVOA 2XTJD 4ZUWA 2V6HA 4PJAF 4WWKC 2JJTA 2CKBB 5E8NA 4GXUM 4JLRA 3UBXG 1UEYA 1ZKAA 3KPPA 5FV2A 3MV7B 5DQDH 5LAXB 1U95A 2DQGL 3O3DA 3UYRH 4Y5VA 4XWOC 4ZMAT 1YNKH 3N85H 1XT5A 3BE1L 1RK1A 1YY8B 5BCAA 1CLOL 1X4ZA 5HDLA 3OPZH 3P9LA 2NXYD 3D3VD 1G6RB 2XQBL 1QVOB 2H45A 4U1IB 3EYSH 1J05A 4HW6A 4NUJB 3PWLA 4XNXL 5E6ID 4OD1H 3WFZA 5ANMA 2UVFA 4QHUA 1U3JA 5B39A 4NQTA 2V2XB 2XRAH 4XCYB 1RPQA 2K7PA 4G80B 1CDBA 3CVIH 4GG6A 1UYWL 4HMCA 2VLJD 5CJXA 4ZO9A 3VXRD 1C16A 3JWOC 3L9RA 2BJML 1N5AB 1E4JA 4FQIH 1KENL 4D0DB 4KH2A 1DUZB 3SKMA 3QCVL 4LCWA 2BVOA 3BKMH 2YPKB 3MXWL 4ORGB 2DAVA 3FB7B 3QZWB 1OAKL 4XVSL 3NBNA 1G7HB 3I6KA 3QEHA 4UV4H 3FONA 1PDKA 4J1UA 2LQRA 3QIBC 4XPBL 5DDHB 1T7YA 1SVZA 2EH7H 2DRUA 4ODSL 5EORL 1VGKA 3QXDA 5KOVC 5J9PA 5IVXE 5IB5A 4KVCH 5FM8A 4NBZB 3TZVB 4TVPL 3WFEH 4P46B 1A1MB 1LK2A 5CLTA 3SGKC 5D7IF 2R4SL 2Q8BH 2Z31A 4PJGF 1OAUH 2NW3A 1VFOA 1PY4A 4IOFC 4LVNB 4E41A 2DJ4A 3O6KL 1CGXA 2B4CC 5T1DH 5JA8B 3RDTD 1IQDA 3KXFA 2A0LC 3HUJA 4N8PA 1OL0A 5ITBH 2XXMB 1QFUL 1KUMA 2VDKH 4GRLA 1HHIB 2NY6D 1U8JB 3FMGL 2D7PA 4NQDD 3EOBA 4JRXA 5GGTL 4HC1L 4LSQL 1ZHNA 3DGGA 3R0MA 5BZDA 4AQ1B 1HI6B 1JPFA 2D7TH 5JO5A 3I75A 4MNGB 4NNYA 3QBTB 3DECA 4LDEB 3T2NH 3T4YA 5CSZB 5J89A 1TVBB 4JO1H 2VJXA 2FWOB 2OM5A 4KDVA 1EHLH 3ZSSA 2HJKA 4BSVB 1SBSL 3QIUD 4YZFF 4KC3B 5D6DC 1EAPB 5EU6A 4ZFZA 5IEKB 5HDQH 5GGSB 4M62L 4AYFA 2P47B 4YNYA 1N64H 2XZQH 2JIXD 2G5RA 3GEWB 3ZLQC 4NP4H 1P4IH 3TT3L 5JR1H 1KNOA 4TPRH 5KG9B 4ZTOH 5LXGL 4L8SA 3DO7B 2DM7A 4MJ2A 1NCBH 5C0GA 3MRQA 3LB6C 3SOBL 4U1HA 2H41A 3VMPA 4PREB 5C0JA 5T3XE 1QP1A 1GVIA 4C58B 1LEIB 4AH2B 4LNRA 4WHDA 3ZKXB 1AE6L 2N7AA 4LK4A 4YGVA 4EN3D 3C5SB 4JO3L 3C87A 4NYLA 4RGMB 4HIXL 2HTKC 4MS8C 3DTXA 4DQOL 5DZLA 5HY9A 2EDWA 5H2BA 3VXSE 1CXHA 4GW1B 1I1YB 3S9DB 3QQ9D 4R26L 3VJ6A 5IB4B 5HHXH 1I8MA 2X4SB 2Q8AH 5C09A 4ZUUB 2ILLA 2J6EA 3BPOB 1FG2B 1VPOL 5I8OL 2VLRD 4P2OB 3HC4H 4JRYA 4G8FA 4XHJC 3QUMB 4WTWA 4HXAL 1MAML 4JGJA 3MRNA 5EOCL 3CFBA 4G6JL 1JV5A 1GIGL 4ONFL 1BD2B 1SJEB 3FOLA 4FFWD 2Z4QB 1MCJA 5D1ZC 2DDQH 3HNSH 1PG7L 2F19H 4ZFFB 4AIZA 1UENA 4NWTL 3VXNA 1I1FA 2UWEB 3RWIA 1X5JA 1SJHB 3O0RL 4PRHE 2BNRE 5DLMH 3QXTA 4ZODA 1B0WA 1EFXD 2GY5A 4ZUVA 3TA3A 3DWTA 4Z76B 3ROOA 3OKMA 5FM5O 5IFHH 1W8NA 4ONHA 1PGRB 4MQ7B 5SV4A 5D7KD 4E42A 2XA8L 2P1YA 4DKAA 4MCYA 1X7QB 3FN9A 4J7RA 3WD5H 5FGSA 5GRUL 4D3CH 2VL5B 3G5VA 2UYLA 5AYUL 2NY0D 3HRZA 2HLFD 4OQTH 4OSUH 3GSNA 2QSVA 5HHOD 3BXNA 5GJSH 2D0GA 3NCBB 4TNVK 4HIHA 4QWWC 4X6CB 3TZVC 1PX4A 4I0KA 5CWSB 3SQOH 3MZGB 3S36L 4P46C 3KLHD 1K9TA 1MFCH 2BVPA 4CUCA 1O0VA 3ZTNH 5BV7B 2QSTA 1JPGB 5I15L 3DETC 2R29H 2VZSA 4OV5B 4OLVL 2XT1B 4MAYC 4JDVB 1XMWA 5FOJA 4FQJL 4G8GD 2AAVA 2FHFA 3RNKB 2DKMA 1V3MA 4DN4H 1PZ5A 1I3VA 3L5WA 3RPIB 3VXUA 4TNWK 5D7JC 5E2TL 2F53D 4P9ML 4LCCA 3WV0A 5KVFL 4NZUH 1FNLA 4KY1H 3BN9D 4XCEA 3WN5C 3EYOA 5E7BA 5INDA 1PLGL 3UCRA 1RMFH 1IVLA 3GMMB 4P59L 5CEXA 3ARDA 1F3JA 1I1AD 4IMLA 2YOCA 2W59A 4JKPH 1V3LA 2YBRB 4XH2B 1T0NA 3KPSD 5HD8C 1DSFH 1AO7B 1VGEL 4MD5B 3STBA 5KSBA 1L9MA 4NDMB 4JFED 1GZPA 3I85A 2X4RB 3GGWB 3BPLB 2NZ9D 3QO1B 3KPMA 1YJDL 1K6QL 4IM8A 4PUBH 3RZCA 3EDKA 5JQHC 3O6ML 2R0LL 1N6VA 4Y8DC 3RPKA 1XGRA 4GBXD 4U1KB 1NBZB 1D9KB 3I02B 2BMKB 2J5LC 1UXSB 1RVFL 4R7DA 3RGVD 1QACA 2P5WA 4BELD 5I66B 1MVFA 4MA3B 4R4BB 1EO8L 2Y23A 5CEZH 2JB5H 2A9NL 2VO5A 2E7HA 2JELL 2FYYA 4S1DD 5IG7A 5GSRB 4YDIL 2AERT 4JFFA 5DYOA 3IDNB 5DK2B 4HUMB 1AKJA 1T2QL 2XYCA 3P9MA 1HYRC 1IGCL 1LHZA 3IJHA 3SY0A 3P11L 1OWRM 4Q9RH 4MAUH 3H9HB 3MA9H 4P2OC 5TE4L 1NCAL 1U8OA 2NXZC 3IDJA 4X7TA 1OW0C 2Z91A 5ACZA 4KJQC 1OY3B 1L6ZA 5C9JA 1CFTB 5IJVA 5J1AA 1JUFA 3BAEL 2WUBH 3K2UL 1J0IA 1KIUA 1P9MA 3OJMB 2JJVA 5ESVA 3G6JA 3KHQA 5E99L 4JPVL 5F70A 1H8NA 4L8BA 1BLNA 5L6YL 2NZIA 3LRGA 5FF6A 4JFPA 3FOMA 2IC2A 5IFAL 1U3HC 1MFEH 1H8SA 3MLVL 3SGDI 1A47A 1II4E 4DN3L 1ZEAH 5MEQB 1IM9A 4WWKD 3ARUA 3LKRB 2XG4A 5FUCE 1QEWA 4UUJB 4BFIA 4NQXB 4N90E 1P2CA 1I3RA 1YZZA 1GZQA 3ESUF 2AJUH 1IARB 4S1RH 4XWOD 1A7PH 3BSZH 2RCSL 4W68A 1H3WM 4KK9C 1T04B 5CJQL 1QLRB 4YBQC 4CNIA 2PYEB 5IMOA 2HRPH 5C7XH 1LE5B 2UZIL 5HHNA 3W0WB 3NCJL 3L3HB 2OXGA 3TIDA 2X1XR 3LKSA 2ZUXA 1UVQA 5DJXA 4WHTA 4OAWA 4JDTL 1UCBH 3MRGB 4N5EC 1E6OL 4ZD3L 2W9EH 3WHE1 4XWGH 3I6GA 5FECB 4X7CC 4I18B 4XMKL 3MLUH 1YEEH 4J3VA 4PJ8C 1ZVSB 1VKXA 1NBVL 5C92A 1S7VA 4GRWB 4JY6B 1VEPA 1WQVT 1DE4B 5HVGB 2AK4B 5KVMC 4GLRI 1J0HA 5D7LB 1I3GL 5IHZA 2CMRH 1W0WA 1FP5A 5L8LB 4OF5A 4KMLB 4YO0A 1RJZA 1IILE 3DSFH 4M61A 4Z7VF 3QIBD 4UINH 3VRLE 2OSLB 5BVPH 3DUHA 5AWNH 3RIFK 1T0MB 5EN2A 3BQUB 2GTZA 3OG6B 4NO5A 2YPLD 3BVNB 3PGCB 1QBML 4OCRH 3RGHA 3ARGB 1L4IA 3RVWC 2I26N 4TSAL 1U92A 3EOYG 4P2CG 3GO1L 4FQHB 4JHWL 4JY4A 2W9DH 1Q94B 5JOPE 4IOFD 3AC0A 5DD0H 4XC1H 5FGRA 5ADOL 4G9FB 4IRJA 4NO3B 3RUGA 1EFQA 1HHKA 5IR1A 3FQRA 1UACH 2A0LD 1A7QL 4RWYH 3ZT6A 1N3NB 4HSQA 1T6WA 4P9HH 3SDDB 1RJCA 1OM3H 5I74C 3U30B 2VZ3A 2XWBA 1RZIB 4H20H 3BT2H 5F7EH 3KNBA 4TSBL 1YMMD 5J6GA 4X4YA 4QF1B 1DQML 3SKJH 3BDYL 1RI8A 2HLAB 4S1SH 4ZUWB 2VDRH 3E3QC 1LVEA 4PJ7E 1Z9MA 5E8NB 5FM5M 4JREB 2ATPA 4MJ6A 1FORL 4JLRB 5T1KA 1HH6A 3KPPB 3FQNB 2EICA 3O2VH 5T5FH 1U95B 1A6WL 3U2SB 3V5DA 3CFCH 1DBKL 4PRID 1RK1B 4Z0XA 1UM6H 3QZWG 4JZOB 1NC2D 3P9LB 3PL6B 3U7AA 4KQ4L 2J7LA 2ICWJ 4P2QD 4Y4FC 5BS0E 4U1LA 1J05B 3PWLB 2GFBA 3HAEA 3FN0H 4PY7A 1XAUA 5ANMB 1HXYA 4QHUB 3LB6D 2PTUA 5B39B 4ODXA 2GYSA 1GAFH 4DK6A 3PDGA 3O9WA 4GG6B 5GRJH 1C16B 1WICA 3MV9A 3L9RB 1ACZA 3K1KC 4ODVH 3VMOA 3LPFA 3SKMB 1TITA 2DYPD 3F7YA 3ULVF 4LCWB 4FMFA 5JOEA 2BVOB 4R0LA 3V4VH 5J1TC 1CXLA 3OSKA 3UTSE 5DURD 4MS8D 1RU9H 5FO8A 2QTEA 4PRPE 5IGXL 1J5OH 3ECBA 3QEHB 4WFED 1AFVL 1DQQA 5IK3A 4JPWL 1TTGA 4JFDB 2DLHA 4YE4L 1EBAA 4OM1H 2VQTA 3MV7D 4JRWA 4XHJD 4HFWB 1CTNA 1JZ4A 1VGKB 2X09A 3OBAA 5SWZE 5J9PB 5D71H 3E1F1 5IB5B 1CFQA 1QO3A 3UROR 1CICA 3GBNH 3NZ8A 2WP3O 2YA1A 2UY7A 1LK2B 4M7JH 5D1ZD 4TQEH 4XVUC 1M6OA 1NFDF 4WU7A 2Z31B 4ZUSA 2NW3B 1DVFA 3J8F7 4OZGE 5DEGA 4U2ZA 1TQCC 3REVA 4KV5F 2H32A 3HUJB 4I18C 2OS7A 2BSTA 5C08B 4F58H 3GIZH 4JRXB 4XZUA 4M9OA 1JFQH 4YIQA 4MDJB 4Q0XH 3BIAX 5BZDB 1M71A 2DB8A 5EZOH 4F8QA 1B4RA 4E5XA 3PABB 3I75B 4NNYB 1JGLH 3Q1SH 1G9EA 3SQBA 2VDML 4AT6A 3T4YB 4WHCA 1JGDA 3IFNL 3WNNA 5D2LF 1X3DA 1IAIH 1OSZB 2VR9A 1T0PB 1X44A 2HJKB 3QRGH 3VFVA 5K59E 4MZ2A 1T7WA 3NAAH 3MFFB 3BQUC 5EU6B 3SBWC 4ZFZB 1EJOH 4MXWL 4ODHL 1R3HA 3IU4H 4QWWD 5C0AA 3OL2A 3TZVD 2VLMD 4QRPA 1NSNL 4P46D 3GHEL 1T7ZA 3ARRA 3RTQA 5C2UB 2I60L 4L8SB 4KHXH 3MOQA 2IALA 4OF3A 4YC2B 4OI7A 2YZ8A 1PKQA 4HF5L 3MRQB 5C0GB 2X5PA 4L9LA 4U1HB 3G9VA 5C0JB 5D5ME 4GAJL 3DETD 1GPOL 4G6KL 5BXFA 1FRGL 4MAYD 4LNRB 3PDOA 1WAAE 4NM8L 3X3FL 1PBYA 2WWMC 2UVEA 4FXLA 4YGVB 2C1PB 1S3KL 5AZEH 3NPZB 2BNQA 4NYLB 3CDFA 3EYFA 5D72H 2ZG1A 3VA6A 1UWEH 1J0ZA 3JWOL 5H2BB 5L7XL 2C1OB 5F72S 1S9YA 1I8MB 1RIHL 5C09B 4WW2F 4C56E 1ZLUK 1L6XA 4OGAC 1A6ZA 5K9QI 3FKUS 4JJHA 4MNQA 4Y5VC 1UB6A 3V0AC 1NGZA 5F6HI 4L8DB 3MRNB 4HT1H 3FT3A 3FOLB 3HI1A 5CD3A 4HD9A 1QHOA 5I6XB 3AROA 3MJ7A 1HWGB 4AY0A 2ZCLH 3MPCA 4AIZB 4KI5F 2ZSVA 3GRWL 1NLBL 4DGIL 4TOYL 3RWIB 4P48A 2E27H 3SE3A 5FUZL 3TBVA 1OARL 1CVSC 1BVLA 2FZ3B 4M6MH 5CJXC 2FGWH 3S37H 3HPLA 1U6AL 1YYMH 3IDXH 3TA3B 4HJGA 2DL9A 1KEML 1K8DA 3ROOB 4NIKB 4NZJA 4AQOA 2IANA 4ONHB 1PG7X 4LAJH 1JHTA 4U2YA 4E42B 4F7MA 5I16A 1F4XL 1OGAE 4LBEA 4PJEB 4UT7H 4Y4KA 1GC1C 4XCNA 4UTAH 5E9DA 1NDGA 1FAIL 2UYLB 3MLXL 4P2OD 4CW1A 1QLEL 3HRZB 5T5NG 5H37H 1DFBL 1YQ2A 2NXZD 5JW3H 1P69B 3BXNB 4KJQD 3RWEA 1FO0A 4OIIL 3UDWA 4HIHB 4RX4D 1LP9A 1QFHA 1CIDA 1MJUL 4XAKE 1J1PH 1MHEA 1R3KA 1BD2D 1TZHB 1J0JA 4KRLB 5JDJA 2BVPB 2OQJA 3NCMA 3BP7B 5IOPB 4YHNA 4HIEA 3O2DH 2F54E 3QWRA 2WWKT 5DMJB 1N7ML 4A6YL 1R3JA 4MXQD 1BBDL 1WBYA 2NMSA 4GRLC 5JW4N 3VXUB 2BXZA 3DVNA 2EIBA 2EDLA 5JW4Q 4LCCB 1A0QL 4GRMA 1IAMA 2RAMA 4XCEB 3WJLC 3MODL 4U6TA 1X5KA 4J2XA 3REWA 3MJ9A 3WSQH 2CDGA 4NHCH 3TNMA 3QDHA 5CEXB 2FJFB 1F3JB 1FLRL 2QSQA 3QCUL 4IMLB 1F00I 1VA9A 4YBQD 4XBEL 1NKOA 4LVHC 3WFBL 1T0NB 5F6IC 1BGXH 4NSKA 3ZE0F 3K4AA 1OP9A 4R7NA 2CKBL 4LDLB 1YEJH 1GZPB 3V52L 2PW1A 1J1OL 1E28A 3D2UA 4N5ED 3NFSL 5BQ7A 3RZCB 4LIQH 3KYNA 4L8SC 4MB5A 4BQ8A 4XXDA 5J06A 1XGRB 3HI6H 1B90A 1JI2A 2ZOLA 4RGOL 5DA4A 2V2TA 1G6RL 2XZZA 4R7DB 2P5WB 3BWUC 1WZLA 4NHUB 4Y88A 5ILTL 1ZT7A 3W9DA 1O7SA 2ICWA 3DPBA 1IFHL 2X70B 1R0AL 4IDJL 1DLFH 1D5XA 4O58H 2VN7A 2B1HH 4OBRA 4JFFB 3DV6A 3LRHA 1CGTA 4HIJA 1K4DA 1SM3H 2ZCHL 4LPVA 2X89A 4S1QL 5DYOB 1MFAL 1AKJB 3RI5F 3P9MB 1CE1H 3MRJA 4G7VL 5JUEL 1Z5LB 4P2RA 1N5YL 3IJHB 5CIPH 3SPVA 3CAFA 4B7IA 3L7EA 1N26A 2GTWA 4OZIE 1AJ7L 4ODTH 4G7YH 2EEAA 2Q7NA 3IRPX 1BMGA 1U8OB 3IDJB 4X7TB 2Z91B 3RVWD 5E5UB 3MNZA 4EOWL 2RB8A 1AO7D 1P6AB 4GG8B 4PS4H 1ZLVK 5J1AB 1KACB 4YXHH 1FGNH 1MCSA 5T1LD 1JUFB 4BZ1L 3KPTA 1MCKA 1ZANH 3PP3H 4O2EA 5GSVA 2PW2B 1IMHC 1S9KC 1V7NL 5SV3A 3G6JB 4HUUA 1D9KD 1F4WL 4L8BB 4HGKC 1BLNB 4JG1L 1AIFA 1MJJA 4JFPB 1XR8A 2YD6A 3MRRA 1D3CA 3TA3C 1BJMA 4WW2C 1W72H 3OAUH 3TCLA 1NANI 4HFUH 1QEWB 4Y8AA 5DJAA 4BFIB 4JFHE 1P2CB 1I3RB 4WENB 4Y19E 4NUGL 2IG2L 3UZVB 1T89A 1B0GA 4WUUE 4RDQG 5FHAL 3CU1A 3FT4B 2FATH 4CNIB 1UM5L 1S78C 5C2BL 5IMOB 5HHNB 3D39D 4R8WL 4Y4FD 4XPTL 1KCUL 2XQYG 4OLYL 6CGTA 3TIDB 2GUOB 3TYFA 3LQMA 3VXSA 1HHJA 5D4QA 1UVQB 5DJXB 4WHTB 2FBJL 4R96A 1UM4H 4MLSA 1MPAH 4KQ3L 3TCXA 3T09A 1W0YT 4Q58C 3CFDA 3L6FA 5ALCH 2M1KA 2R2EB 1VKXB 5FYLH 3TF7C 1S7VB 1KCKA 5ICXA 2X44D 3LHPH 3C60A 1TETL 5TFSL 4BZ2L 4JN1H 2D03L 3JSSA 1RAMA 3NCEB 3WIHL 4LGSB 1HXMA 3WBDA 4M1GH 1FNFA 3VG9C 3PV6A 4LVEA 4XNMB 4YO0B 1PQZA 2KQNA 2OJZL 4M61B 4G43A 5SWSD 4U1GC 4HH9A 2P46B 3IXAA 3SO5A 1RUML 2H2SC 4JKWA 1P7QB 5CJ5A 3T0AA 4PRHA 3U46B 4RA0C 2ZUYA 5EN2B 3ZDZE 2R9HD 2GTZB 3GMQB 3B5GA 2Z35A 4DCQA 2E6JA 2K1MA 3HMXL 4K3EH 3T0EC 4WCYH 1LEGA 3BRGC 3ARDC 1Q1JH 4BH8A 2XZCH 2PYED 4AG4L 2AJSL 1U92B 2WW8A 3DLQR 3QUZA 3EJYC 3HNTH 3GSRB 4XVUD 2C3HA 4JY4B 4U0QB 1CLZL 4HH8A 2X05A 3WNPA 1ZS8B 4RMVA 2B39A 3UTPE 3VCLA 4IRJB 1GXEA 3T4AA 3SE9L 1HHKB 5IR1B 3BI9X 3FQRB 4WJ5B 4J3SA 3VXQA 2XACC 4M4RA 2BDNH 4GJTB 2BNUA 4UOW1 3FB8A 1CQYA 1SMAA 2CGRL 2XWBB 2O5XH 2HT4C 5IF0A 3KNBB 5B39G 5J6GB 1I9IL 3TYGH 4N0YL 4X4YB 5DFVC 5KS9A 2JCCE 3T3ME 1OP3H 2ATPB 4LARL 3B9VA 5E1AB 2NYYC 1HH6B 5T1KB 1IAIM 2R1WA 3GNML 3MACL 3RAJH 1MAJA 3UTTD 1ADQL 4RFNC 5D7SL 4HCRA 2CJUL 3LMJH 4TN9A 1YEKL 1UJTA 1C5BH 3BQUD 3BZEB 4Z0XB 1FC1A 1QLFB 1R5WB 3Q48A 1D5IH 3TO4B 3IF1B 1EA9C 5KTEL 2ZUWA 3HRPA 4MJIB 4U1LB 2GJZB 2IBZY 4Z6AT 2GFBB 3N9GH 4Y1AE 4PY7B 4RBPH 1HXYB 5L8JB 1ZA6A 3CH1A 4ODXB 2P5EE 4UV7H 2HKFL 5JW4M 4QRTA 3O9WB 3UXFA 5AAMA 3HG1D 5IWLA 3G6AA 5I1KL 3ZHKA 2OJEA 4FZEL 4YHIA 3F6LA 3MV9B 5JHDA 2MOVA 3ZKSD 3SJVD 4MQXC 1P9MC 4FTVE 4XPAL 1FYHB 3F7YB 1HNGA 4NNPH 5CJ8A 4R0LB 1XGYH 5FO8B 3GMOA 5EZIH 3GI9H 3ZYIA 2JE8A 4Q9QH 3ECBB 3M17B 1XIWC 1DQQB 5IK3B 4KTEH 4KXZI 3CPLB 3QXVA 2FIRT 4OGAD 12E8L 5IROC 4QOKE 3RVVC 1QA9A 2NNAA 3O4LB 1CFQB 1QO3B 3D25A 1CICB 5C6TL 3P2TA 4HQQH 1KSRA 4F2MA 3I50H 5HPMA 2FSEA 4QHKI 1ORQA 4WU7B 4ZUSB 1OF2B 1DVFB 2Z8RA 5EDXA 3MGOA 5DEGB 3REVB 1RIVL 1I8KA 2VXVH 4EZMA 4Q7DA 4UQ3B 5EOCJ 3B2VH 4LRNH 4W6XB 2BSTB 3JWDC 3RRQA 1KLUA 3FZUC 4XZUB 4YIQB 4YEEA 4KTYA 3BRFA 4LPCA 4WHYG 3ARSA 1E27A 4LCWD 1M71B 2A2QT 2AXGA 5DD3L 2DQIL 3PDDA 4E5XB 3T1FB 4BKLA 1Q9KA 4JHZA 4HG4J 4X4XA 2R39A 4AT6B 1GGCH 4MB3A 4ZTPH 3DSNA 4OIAA 5JPMA 3KPOA 3VFVB 4CADA 4HK3J 2VSCA 2ZSWA 1P7KA 1XR9B 1R3HB 4PRNA 5C0AB 4D9QE 3FQWA 3CMOL 4FFYL 5EUOB 1T80A 3RTQB 5IBLC 3L3OA 1Q8MA 2IALB 1G7IA 3DIFA 4LSTL 1PKQB 4L9LB 5ESAB 4E41D 3GSQA 3JBG7 3DUSA 4LAQH 5BXFB 1FE8H 1LO3H 3PDOB 3TJHD 3KXFD 4LSRH 4TUOA 2DIJA 4BSWA 3R1GL 4LSUL 4P5TC 3GSVA 4GRLD 2EDXA 4ZUTA 5C07A 2EDOA 1G0YR 1QFWH 1UA6H 4OB5H 5D96C 2BNQB 2BXYA 4JRXD 4XAWH 5GGRB 2GJ6A 4OTXH 5H8DA 3T0VA 4QTIH 3EYFB 3SDCA 3ZMRA 4I9WE 2DJSA 4XXCA 5FHBH 2DWDA 4EQ2A 1KCSL 3EKCA 1S9YB 5CBAA 1Z9OA 5HHMB 4KPHH 5I8EA 2B0SH 3BZ4B 3TIEA 4FABL 4MYWB 1A6ZB 1SY6H 3QCTL 4JFZH 3DX8A 3AREC 2DLFL 5I1CH 3O8XA 4N1HB 3MSPA 4MNQB 2OZ4A 1NGZB 1MWAH 5JHLL 5A3IC 5EU6D 1I85C 3FT3B 1R5IA 1CQKA 1T20A 3G5ZA 2DI7A 3FQXB 1A6TB 5CD3B 4X6CF 3CGTA 4ZXBA 4ZDHA 4JO2H 1PX3A 3MJ7B 4EDWH 4XNQA 2L7JA 4YPJA 1YNLH 4KKCC 2ZSVB 1JWSA 1QFOA 2HKHH 5HBBA 3ARQA 3CDYA 3BESR 1QBBA 3GHBL 3TBVB 4WV1B 3VA2C 4X4ZA 4PTTA 1BVLB 5AEAA 2H6PA 3HPLB 4H88H 4DZ8A 4HJGB 2EDNA 1HCFX 2EDTA 3SO3C 1NAKL 3U4EB 1FC2D 5D93C 4BSJA 1NAMH 2IANB 1WF5A 4I2XE 4R0LC 4RGNE 2BOBA 2PETA 3QDJE 4F7MB 5I16B 1VACA 5E00B 4LBEB 1V7MH 4QGTA 1J1XH 4XCNB 3U4AA 5C09D 5E9DB 2BC4A 2NY1C 3PWUA 5CKAA 1LEKB 4OBSA 3QUYB 4XPHH 1NDGB 4CW1B 2VDQH 4JRYD 5TE6H 2CIIA 5DD6A 1MVUA 3RWEB 3OKNA 1FO0B 3NCYP 3QNZB 2EIZA 5HGDA 4PJ7A 1AQKH 1LP9B 2M8XA 1DBJL 5DMGC 1MHEB 1R3KB 1F4HA 2PR4H 1WITA 2R2HA 2DI9A 2OQJB 3SEPA 8FABA 4YHNB 2ITDA 3GMPA 1MHPL 1DVFC 5K93A 1LDPH 3H7BB 3P30L 4LLWA 5M94B 2VC2L 2ED7A 1QNZH 1WBYB 4J4PC 2MCG1 5BS0A 4AMKH 2EH8L 2Q6WA 4JO4H 3DVNB 1JWUA 2IGFL 3TA3D 1KJVA 1TZGL 2CRMA 5IVXF 3TVMA 4YHYC 4ESKA 2EDRA 4WEBL 4D9RE 4EBQH 3ULUD 1IGMH 5KSAA 4NFCA 3EO0A 2ENYA 1AP2A 3TNMB 4HK0A 1K5NB 2Q3ZA 4MHHG 5J6HA 4GXVL 4ORZC 3Q6FA 4M48L 5K9QG 3UTSA 4LPWA 5DUMH 4NSKB 4OGYH 1FVDA 4KMTL 2OR7A 1X4YA 5JMRA 5C8JA 4FQ1L 5TDOA 2AJVH 1KFAH 1A14H 3N50A 4PRPA 1T1YA 3D2UB 3UJTL 3KPQA 4QRRB 3CVHA 5BQ7B 3RTQC 1YEGH 4JGUA 1IAOB 3KYNB 4PJAE 4XXDB 5E5MB 1I7RA 1AY1H 4P49A 2D4FA 4HS6A 5SWZA 1FL3B 5J1SC 4L9LC 4YHLH 2DBLL 1YY9C 5C0ND 5GGTA 2V2TB 1BP3B 1C12B 4HPYL 3Q5OA 2DQCH 4NGHL 2EDBA 1IE5A 5HHVL 1FPTL 1ZT7B 4Y2DC 2ICWB