4M1CC

Crystal structure analysis of fab-bound human insulin degrading enzyme (ide) in complex with amyloid-beta (1-40)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
227
structure length
205
Chain Sequence
QLVESGGGLVQPGRLSCAASGFNVSSYSIHWVRQAPGKGLEWVASISSYYGSTSYADSVKGRFTISADTNTAYLQMNSLRDTAVYYCARDRVMYYWSFSKYGYPYGMDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Analysis of Fab-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Amyloid-Beta (1-40)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Insulin-degrading enzyme
total genus 22
structure length 205
sequence length 227
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1cC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1cC01
3IF1B 3KWWA 4DUWA 1KSRA 3BP4B 4U1SB 4WNQB 4K3GA 3GRWA 3K74B 4XB8A 1N59A 1RZJL 1TVDA 3W0WD 5DRNA 2DQCH 3OKNB 2O5XL 3PWNB 2YK1L 5I0ZA 5C0RL 1LDPH 2H2SC 1RZ8A 4IEFB 1S3KH 2I25N 5ADOH 5IR1B 1P53A 1B6UA 2YR3A 1A3QA 4HC1L 3WNOA 5DQDL 4K2UH 2IMNA 4YHZL 4X5WB 5T1LD 5HHOB 4MD4B 1JYWA 3MRFB 4QRUB 1HILA 1DLFH 3GJFK 4Z6AT 4G7YH 5BS0B 1BQHG 1MJUH 5HD8D 2OZ4L 4JY6B 5ITBL 5MP6H 1CD9B 4PJCE 5IHZA 1I3VA 2ESVE 4XVJH 5JPMB 3NBNA 4JAMA 1KBGL 3OWEA 3DRQA 1GVIA 5KSVB 1QSEA 4JM2F 2FYYA 2OX5A 3KJ4B 4LP5A 2VKXA 4LCWA 2M1KA 1TNNA 4X6CA 3GSVA 1ZT1B 4W6XB 3OXSA 1LO2H 3BWAA 1G7JA 4CNIB 4U1LB 2H2PC 5C0AB 2JJUA 5I1IH 2HT2D 3RVXD 3BHBB 1HXMB 4KQ4H 2KBGA 3FO0H 2YA1A 3OXSB 3WJJA 1H9VA 4XHJD 5DK0A 3KPMA 1D3CA 4JY5L 1SY6A 4UT7L 3DRQB 3O4LA 3G08A 5D9SA 4OCLC 2DBLL 1D9KD 2GJ6B 5JW4R 1KJ2H 5BZWB 3MRCB 2X1WL 4K8RD 5C0BB 1A7BA 3OXRA 1KELL 4JY6A 2EYRA 3R1GL 3FN3A 3KYOA 5HHXL 2V2XA 4J3WA 4PYGA 5IBTL 5IMKA 1FO0L 4AY0A 4MD4A 2VZTA 1WQVT 3SE4A 5DUBA 4OZGE 5IR1A 2GCYB 2OTUB 4O9HH 3QUMB 3L3KA 1KYOJ 5D1ZB 3MA9L 1G0DA 4ZQKA 5DO2D 1MSPA 2QQLL 1D5MA 2HT2C 3RVXC 1Z5LA 1A1MB 3QFJD 4ZOBA 4PGJA 5FECA 3HB3C 1O5DT 5D1ZC 1WBXB 5IMLA 4RA0C 4YJZL 4HS6B 1DBKH 5EPMB 3HZVB 4LASH 4ZPVA 4H1LB 5C92A 5AZEL 4P4KC 5INDB 3L7EB 3WHXA 5GRVK 1XR8B 4A2LA 2WM0A 1KLFA 3DTXB 3QAZC 3BWUC 1I8IA 1N0XH 2J8UF 5DGRA 1HKLL 4OGAC 5L2JB 5C71A 2BVYA 2VL5B 1GHFL 4JG1L 5DD0H 2IBZY 5HD8C 2E27H 4Q0XH 3MRNA 4DGIH 2FGZA 3G5XA 3AS3A 2NQCA 4DN4H 2GJ6D 5DJ8A 2MFNA 2HMID 1LK2A 2W38A 1A5FL 4Y1AA 2V5YA 1TLKA 5FUOH 4X4ME 5IB4A 3TWCL 1GYAA 5DA4A 4OKDA 3UPAA 4PGDB 1Y0LB 1GC1H 1H8NA 4DUXA 3ECBA 5KS9F 5CUSL 1NGXA 3BXNA 5JLZB 2XKUA 2PN5A 5C0ND 2RFXA 4S1DC 2J8UA 3KPOA 1I75A 2AXFA 1ZGLA 1T80A 3LY6A 3W9DB 3UDWC 3KYAA 1K6QH 5EBLB 5F9OL 2R2CA 2DB8A 5KSBA 1TJHH 1OPGL 1MRDH 2HJLA 1GIGH 3ARXA 4EUPH 4YX2L 1SQ2N 1T1WA 3VRIB 3BKCL 2FR4A 1QEWA 2APFA 2VZ3A 5L9DL 3KG5A 4XNQA 2ESVD 4ZAKA 4D2NA 3OAUH 4KHTH 4HXAL 3DURA 3EGSA 2F53B 3B2UD 3A6CL 2W91A 2OK0L 1FLRH 5D7SH 2FWOB 3QEQE 3K2UH 1YNLH 4N5ED 2DBLH 1RZ7L 3ZDXF 3ZDYE 1PQZA 4JY5H 4WWKA 4YDKL 4EUPA 2YA0A 3PWUB 5DTFA 1LEGA 4MXVF 4Z9KB 3LKRB 5DJCB 1LO4L 1YJDL 1M7IA 1AP2B 1H0DB 4N0CD 1VPOL 3LB6D 4YXHL 2NX5B 3QR2A 2W9EH 3MOAH 1XH3A 4XPAL 5C0BD 2YEZA 3MRGA 5TE4L 1ZV5A 5EIVA 4X6DF 5EU6A 3WS3A 2FZ3A 2W07A 5F89A 4IMLB 1I8KA 1YEIL 1JJUA 5IW1A 3ZE2E 1DUYA 3V0WH 3QBTB 5FYLE 1AXTH 4GW5A 3FRPA 3LPFA 1JGDB 2EDLA 3VXRD 1FRGH 1I8LA 4FQQB 4I5BA 3WUWB 5CEZH 3AVEA 5CCKH 2MCG1 2NYYC 4TTGA 5IBLD 4CVXB 3OKMB 4PRDB 3MACL 3P30H 4KPHH 1BREA 1BZ9A 4CDHA 4QRRB 3VG9B 5DEZA 5I1DB 2FATL 1INEL 2ICWI 1ONQB 1M7DB 1YA5A 1CXHA 3HZKA 5TE6H 4WO4D 5F7DA 4YHZH 5C1MB 1KIQB 4XPGH 4WW2B 1OAYL 3RNQA 4OF3A 2G75B 2CIIB 3T77A 2I07B 4PGCB 1B90A 4HPYH 1YEIH 3BJLA 2IADB 1CLYL 1IT9L 4C59B 1YY9C 3TBVB 3TA3B 4KJWC 4LEXH 3GJFH 3L9RB 1O7VA 3ARGA 1VPOH 4YXHH 1EHLH 1C16B 4G9FB 2Y25A 1MCIA 4QOKB 1YEDB 2E9IA 3RIFF 1TZHB 4XCFH 5I1GL 3Q3GB 4P9HC 4Z7VA 4XGZA 5FDWB 1L7IL 2ZSVA 4JFOB 1HYRC 3VE0B 1P7HL 4XPGL 4JM2D 3LEVL 2DQJH 1QHOA 4Q9RL 1A14H 4HX1B 4HXAH 1UH3A 4QY8A 4ZNCD 4NT6B 1UCBL 3QH3A 1T22A 3S9DB 2DQEL 4QWWD 4P2RD 5DRXB 2HRLA 4ZSOE 1CK0H 4HPOH 4JG0L 3DVGB 2NY3D 4X0KB 2MCPL 1BEYL 3UO1L 3HMWL 5K9OA 3Q0HA 3MRIB 2G9HA 5BXFA 4MAYD 1A7NL 4XH2B 3B5GA 1MLBA 3CZFA 3BQUA 5EIIA 5TDNA 1QFPA 2KPNA 2XZQL 5T3ZD 3DJ9A 3AU1A 2NW2B 1KXVC 3S98A 3FTGA 3H7BA 5L7XL 4Z7WE 2GYSA 4ODWB 4OZHB 1ZT7B 5J11B 1V7MH 4APQC 4G9DB 3LKPA 1YN7A 5EZJB 2L7UA 3ETBF 4Y4HD 4LSQH 1MVUA 3FQUB 4U1KA 4F9LC 4TVPD 1AD0B 2XTJD 3GSXB 4P5MB 4PLKC 1T0NA 1IGJB 2X1OA 1GGTA 3O3DB 3W0WE 4NUGL 1LP9F 5DWUH 1C7TA 1UM6L 1T66C 4LF3B 5CP7B 1LO5A 3THML 1BZ7A 4Z0XB 4KK9D 4J3TA 4MA7L 4G9DA 4QRQB 4EI6B 4ODWA 4OZHA 5I2IB 2BSED 3B2VL 2C1OB 2E5EA 1URLA 3EYUH 4GOSA 3O4OC 5GHWH 4NQED 2MPAL 3I75A 1IC7H 4QHKJ 1R3IH 1IEBB 3GMRA 4JO3H 3WKML 4GAYA 5E8DH 3EO0A 3T3ME 3ARBD 4XH2A 5FK9B 4J8RB 1IEAB 5C0BE 3NN8A 2QQKH 1HYSC 3RNKA 3BEWA 1KELH 4Z8FL 1R5WA 5EUOA 3BH8B 2VLMD 4N1CA 5CZXD 2Z8VC 3QXUA 1FG2A 4FQXD 4YHPB 3SHSA 4JJ5B 3VRLF 2GIYA 4HBCH 3C5ZB 1CZ8L 1E28B 4WI6A 1A2YB 1G84A 1WIOA 2DQGH 1KJMA 4OM0L 2ZP0T 4JRYE 5HDBE 3ARBB 2DTML 2ZSVB 2K9UA 4JRXE 2CKBB 1LO2L 1KCKA 3P3YA 3LSOB 1NEZA 4MJ4A 2B4CH 4I9WD 3MCG1 3BOVA 1EX0A 2A0LC 2X4TA 3QQNA 1C16A 1OLLA 4P5KB 2GTZA 4LRNL 5ADPL 5DD6B 3VG0L 3NTCL 4X7SL 1TZGL 2V6HA 3F58L 3QPQD 4R26H 3MC0A 1H3VA 1PG7X 5E6IA 4G6AC 2Y7QA 1PZ5A 1OAUH 3GJEA 5KVFL 1YPZF 1CU4L 4HEME 4G8GB 4NO0A 1JBJA 3QUZA 5CJBA 1NLBH 4JHAL 5F9WC 3QJFB 4KK5D 3CU7A 1Q94A 3LEYL 1F4HA 3MBXH 4E0RA 5DLMH 3ULVD 4BZ1H 2Z35B 1I8MB 4FG6D 2GEEA 3FZUC 3HHRB 1BOGA 3GMMB 4GLRH 1KPVA 4GMSH 3OZ9L 3WNLA 1X5KA 4LSTL 3MV8B 3RTQC 3IFOB 3MLWL 5ESVA 3HAEG 5GS0L 3S34L 4KTYA 3DHJA 1CFVH 4PJGE 4LNRB 2FZ3B 3UTPD 2ESVB 1MIEL 1MRCL 2W92A 2QSVA 3HC3L 5KS9B 3BPLB 2XYCA 3JUZA 4PJ7A 5D8JH 4H20H 3RUGA 1YYML 2JJWA 1NC4A 1UACH 5EOQH 5CWSB 1PD6A 1NKRA 1LEGB 4N8VA 2ZUTA 1OF2B 1RJLA 3VJ6B 2FSEA 2CLRA 3MQIA 1J8KA 1XEDA 4GXUM 3STLA 3X3FH 2Z93B 5FEBA 4OBRA 2VLRB 4YWGL 1QG3A 1VFBB 3WDIA 5JTWA 4NQCB 1T0MB 1GGBH 1RK1A 5B8CA 3TO2A 4YPGA 4PRHA 3RZCA 4MB5A 1G6VK 5EU5B 1CIUA 4UDUB 3T0WA 3TBSA 5JIPA 2YD1A 1KCVH 5I15L 2DQFA 4OF7A 5D1QC 5DLML 5I8CB 1T6VN 5ALBL 1LEIB 1IAIL 4UBDD 2P8LA 1OAXH 3U6RB 1GPOH 4JDVB 4M6ML 2WZPD 2EDNA 1KJVB 5TDOB 1C8PA 1BLNA 1BBJA 1YEFL 5EBLA 4M7KH 1DBJH 4NBZB 3BPLC 5DUPH 3RDTD 4JDVA 4EI5B 2HKHH 2I26N 2BNUB 2APTA 2AXFB 1EXUA 4NCC2 5IW3A 5IHUH 4N0CC 5E5UB 3KNBB 1FV1B 4MVBD 4S2SA 4DZBB 2V2WA 3QDME 3WKMH 4PGDA 5KW9L 2XRAH 5DD1H 1KT2B 4YXKH 2JELL 4PRHB 4JRYD 5GHWL 1FFNB 2EDXA 5KOVC 4C55A 4Y1AB 4S1QH 1U8KA 1WZKA 2BOBA 4UILL 3T4YB 1I1CA 1Q8MA 4YHKL 1A6WH 2VLRA 3VXMB 3QZWB 4YIQA 4RMUA 2HTLD 1EJOH 4Z95H 1MREL 1IM9A 3VJ6A 3TO4B 1DBMH 2A9MH 4N8VB 2J3SA 5IV2B 2HVJA 3F6LA 2WK2A 3RUGB 1IAIM 3SE9L 2JTDA 4OAWA 3PHSA 4PJCA 3F5WA 3NPSB 5HI5D 1HINH 2ESVA 4HFUH 1OGAB 4QYOA 5TQ2L 3E6FA 4WCYH 1BM3H 4X9BA 5DFVC 1D5MB 1RJZA 5D1ZA 4LSRL 1KPVB 2NLJB 3QUMA 3EJZD 3C5SB 5FYKH 1L6ZA 2Z31C 4M7LL 3BT2H 4XI5C 3GKWL 1JNHB 3UJTH 3QA3A 2AXGB 4JO3L 3CDGA 3MRMA 1UWEL 4E0RB 5C9KA 4R4BB 4CU6A 2A6DB 3VU2A 2FBJH 1FSKB 1ZVHA 5B38G 1T5XA 2R2BA 5C0BA 4G8GA 2UZYB 1FZOA 3P4LA 4GG8B 3G08B 4LPWA 3P0YL 1E4XI 1ROWA 4B53A 3WLWC 3ZE1E 2G5BB 2F53D 3Q1SL 4D9LL 2B8OT 1EBPA 4G5ZH 4WUKL 5TF0A 1ZANH 2AKRB 5CJ8A 1YPZE 1W0YT 2JE8A 3OKEB 4U1LA 5I8KH 2IAMB 5F8RC 4NFBA 1G7JB 1R24A 3QQ4A 1NEZB 4PB0L 4ZAKC 1DE4B 5B39A 4DVBA 2FYYB 3C9NB 5KSVA 4NZTL 4K7PH 4KQ4L 5HGHA 5MI0C 5JPMA 2QTEA 1UCTA 4P23C 1X6NA 3ZTNH 2CK0L 1S9KC 1MCOL 1SM3H 4YHPA 1CTNA 3CLFH 5CGYC 2W9LA 4Y4FD 1NSNL 2YZ1A 4ZXBA 5EUOB 1D9KC 5MEQB 3RNKB 3N9GH 3H0TA 1MCKA 4LGPB 4Q9QL 1IEAA 2FATH 3HUJE 1KGCD 3VXME 3U7YH 4X9IA 1W72A 3UJJL 5JIHA 1EO8L 1ZK9A 2D7PA 3MLXL 1Z0NA 3U2SA 3QHZL 1PDKA 2C26A 3EO0B 1RD6A 3QDHA 4KTEL 4V1DA 2ZUUA 1X6LA 1U3HB 3IXTB 4XBEL 1RJYB 1N59B 3I75B 3CFDB 2BNRE 5ESAA 3M45A 4WNQA 2AGJH 3RRQA 3IF1A 3W0WA 5C0AE 1D5XA 3H7LA 4ORZC 5J1SC 3B83A 4FTVE 5FXCH 4NNPH 3TJEH 2BVPB 3QJHA 2CDGA 3S97C 3CCHB 1A02N 3QCVH 3QUXC 3BUYB 3CFCL 4E41E 1A6AA 3KPRB 1T0NB 5EFIB 2OJZH 2VJXA 3G5ZA 3U4EA 3PHQB 2R4RH 4OZFH 1UQSA 4CW1A 5DZOA 4U1KB 4XPTL 2OCFD 1V3MA 4J3VA 1U8IB 3QT2A 1CLYH 4KK8C 1J0KA 1OW0A 1CDBA 5DEGB 1YZZA 2MQ3A 4I0PD 5GZNC 3U0TB 5GS2D 5AAWA 5D7KE 3NFPB 3QP3A 1A7RL 2GJZB 4NQCD 3CFJB 4BQBA 3P30L 4KPHL 4Y5VB 4A2MA 3NCMA 1PYWA 3QIWD 4K23H 1CL7I 1HI6A 2CUIA 4LLAA 5J6GA 1JPSL 4PJGB 2ITCA 3Q5YA 5L2KA 4HGWA 4XVUC 4XXCC 2Y23A 3X13A 1T22B 3L1OH 3IDNB 5GRVL 2RQ8A 3VXQB 2IFFL 1TVBB 3IJSB 3KYKL 2NY2D 3HNTH 1BX2B 2ZG1A 2YBRA 4W6YB 4JFOA 3SDDD 5F7KC 4Z7VB 1NAMH 5F96H 3QWRD 2VLRE 3TVMD 2Q86A 3BW9B 4OLZH 5EN2B 4G5ZL 4KKCC 4WUKH 4OCSL 4LU5H 2SEBA 3EYFB 5DQ9B 4F8TA 1MQ8A 1BQSA 5JPNA 3EYOB 1FN4A 2DOCA 4CJ1A 3GBMH 3OAYH 4OLUL 1JFQL 1S7QA 2X44D 4NPYA 4KRPD 3K8MA 3TJHC 5AAMA 4F7EA 1GIGL 4LCIL 4L4VD 5AUMA 5T33L 5HGAA 3EZ8A 4U0RB 2WQRA 2AEWA 4JCLA 4J3SA 4LSQL 3HZKB 4TTDD 3RAJL 3HPLB 1V7ML 5ACZA 3O9WD 4MSWB 3PL6A 1YY8A 4CVXA 3VD5A 5FYKL 4XXCA 3IDJB 3BGMB 3HC4H 1DQDL 2AJXH 1MCDA 3EYVA 5T5NF 1A1OA 1T2JA 4ZTOL 3QIWC 4HH9A 2ZWLT 5JPNB 5E6ID 5DMKB 2EDFA 4DGIL 3SKOB 4Q6IA 4LPXA 2YWYA 3MRDB 4N90E 5B22A 4AMKH 4LVHB 5FB8A 2XPGB 3GKZA 4L8DB 4U1IA 2Q86B 5DJZB 4P2OC 4HK3J 3OB8A 1YN6B 1ZHNB 3MFFB 3BZEA 4K94C 4HCRH 2BERA 5EC1B 3T0XA 3WFDH 1B6DA 2XTLA 4HWBA 1ED3B 3MRLA 3IVKB 1PQZB 2H41A 1YPZA 4KRNA 2BNRD 3Q5OA 4MA1C 2XY2A 3QNYA 1S5HA 4OB5H 3VXQA 1KBGH 1GGCL 1QBLL 4NZDA 1DQLL 5KANG 1A7QH 1VCAA 5TPWL 3R06B 4K3HA 4XB7A 4JDTL 2VUOA 2PYFB 2FJGB 3OAZK 1KCRL 1HI6B 2VDLL 2BNRB 4D8PB 3VRIA 2R15A 3FQTB 1KB5B 4ODSL 4PLNC 2HJLB 2J5LC 4X5XB 5IBTH 4GBXD 3CFJA 1N26A 2QR0B 1NFDB 4MZ2A 2VXVL 5KBNC 1AXSB 1HHHB 3P77B 3QIBA 3QEUA 3S88H 4M43L 3I02B 3FB6B 4LSUL 4WFHE 2CKBH 3GSNA 5C0RH 5JLZA 1CGSL 2N1KA 3IU4H 4LCCA 5D7LD 3DVFA 2B0SL 4HUWB 4RAVA 2H3NA 4WEBH 3D3VE 4W6WB 1ZLSH 5CZVL 2UY6A 3QWOA 5I1KH 2DLGA 5KJRL 5GGRY 1GZPB 3NCYP 1ZS8B 3PHQA 4M62L 3SKNB 2R2HA 1CR9L 4MXWH 1D9KA 4QXGH 2AEPL 1U41A 5EFIA 3U46A 3IS0X 5KS9E 3OJDA 1CLOH 3VD7A 3BUYA 2VE6A 3LKNB 1GGIL 1IMHC 4F7PA 1BP3B 1KOAA 2BFVL 2BNQD 1P4LA 2CDGB 3D1MC 5JW4M 5SWQA 5IFAL 3F12A 4OCNC 3SKJH 4OCXL 4OTXL 3LMJL 4UTBH 2MSPA 2FL5B 2ADGA 2FRGP 4LHUG 4IRSC 4KHXL 2VLKB 2IAND 1ADQL 1LO0H 3IXTA 2IEPA 4FN0A 3C2AH 4FQLL 5JIIA 1G7MB 2R39A 2NXZB 4GAJH 3V79C 4ORGB 1MAML 3ARRA 3C5JB 3RWJB 4GMSL 4IOFD 4KKBC 3U2SB 4NKQB 2EYTA 3BKMH 2P44B 5FGBC 1DQJA 3ZE1F 3O2WL 3KLHC 4PRIE 3WLWD 4MAUH 5ADOL 1F4YH 1FVCA 4PRAA 4IDLA 2DL2A 4M43H 1WTGT 3DIFA 2WWMD 3H0TB 4HMCA 4ZOCA 4FQCH 4KMLB 4DFIA 1KN4L 2B1HH 1Z9MA 5K9JL 2F15A 4NZUL 3HRZA 4NN7B 1EUTA 3KYOB 1VFUA 1CLZL 2WP3O 3QHTC 2JB6A 3EHBC 3GJFA 4NRZA 4QTHA 3MRCA 4M6OL 3RIAF 2GJ6A 4KDTA 3ILQD 3CDFA 4YEEA 5HGHB 3FN9A 1RHHA 3GIZH 5JOPE 3C9NA 5CJQL 3QG7H 3UTQA 1RZGA 3CSYB 3A0OA 1KIPB 3J7HA 4ZUWB 2IGFH 3P40A 2IAMA 3UBXI 4K3JL 4HWZB 4JFPA 5C9JB 1JZ2A 4PJ8A 3P2TA 4F58L 1VENA 4X6CB 3MRRB 5IT2L 5MEOA 3ALPA 4Z7NE 2FO4A 4G6MH 4XPHH 4OZIE 4HWEL 1ZOXA 4M7LT 5AWNL 2I5YH 1MHEA 4LPTA 3D87B 5T1MA 2H6PA 2R0ZH 2DAVA 4HS3B 3LS4L 2AS5M 3TH2T 2LU4A 3KLAA 2BC4A 5KANI 1CXFA 4R7NB 5D6CA 1BIIB 1ETZB 1Q0YH 4WDIA 4YZFE 4ODXB 4G6JL 1JTTA 1C08B 2AXGA 3D69A 4JFFE 4GKZB 4G42A 4F9PA 2WUCH 1Q9WA 3QHFH 5F6HI 4NQDE 4HZLB 1T89C 4PRPB 4FZEH 1CGTA 1NMAL 4JKPH 2IC2A 2NLJA 2WQ8A 3GI8H 4I3RL 4Z7UF 1KULA 5E7BA 1QKZH 4LLWB 4F15C 3SGJC 1ZVSA 3RWIA 1C5BL 3BDYL 5EULV 3M17B 3G6JB 3PWNA 5BVPH 5GPRA 3GZKA 4O9HL 4QYOB 2OZ4A 4HQQH 2ZJSH 1T20B 4U1SA 4Y2DA 5GGTL 1H5BB 1X5LA 4LDLB 4NNYB 3HI1A 3KWWB 3Q2CA 3HA0A 3N06B 4XPFL 4WU7A 2P47B 2YSSA 1OOAA 1TETL 1Q72H 3MLUH 4JN1H 2EKSA 4LLQA 4GQ9L 4KXZH 4L4JA 3TO4A 1ZHLA 2XA3A 3TPKA 5FUCE 4L8BA 1RFDH 4MNQE 5EZOH 1ND0A 3GNMH 3QQ3B 1KJ2L 1R5IA 3JWDH 4NKMA 4JPKH 2OTWA 1A22B 4IMKC 3IDMA 5DHVB 4MXQC 1E6JH 5AEAA 4GKNB 5HHPB 2DM7A 1BJMA 3RL2B 1KT2A 2QHLA 3ARWA 3P9LA 3V8OA 1QLEH 4HIXH 2V2WB 4KROC 4DFHA 3NCYS 4LRIA 1AFVL 3KJ4C 1IL1B 4JFDE 5GGVY 2HWZL 3L3DA 2EDOA 2X05A 3G9AB 3C60A 4M1DH 1UH4A 5CAYB 1FIGH 1BFVL 1BBJB 2WBJC 5BW7C 2DQUH 4NHUA 4D0BB 2P4AB 1G1CA 4X4ZA 3KXFB 1P4IH 4KKBD 3RTQD 5T1KA 4HKXB 4KV5E 4JE4B 3G04B 4OLVH 3TBSB 3T0BA 3BAEH 3MNVA 5K9QI 3H9ZA 4UTAL 5I8OH 4P46B 3BISA 4YPGB 2D31B 3MRBA 5D7JB 4OD1L 4ZUTB 1MAJA 4F7TA 4YFLF 5JW4N 5CMAB 4JM2A 4FP8H 2BRRH 1HHIB 5GGVH 3RQ3A 5KN5B 4G6FB 4RMWA 2Z4QB 2JK5B 4MD0A 2VQUA 5GRWA 3AS1A 1RJLB 2ZCLL 2BSRB 4D94A 1NC4B 3MRKA 1MHPH 2C5DC 3EDJA 1V8HA 5HYJD 3BP7A 4S10A 2B5IC 1G7IB 2ADJB 1WGOA 3QIWA 1S7XA 3U30B 2VTFA 1FORH 1A4JB 5KS9A 3KPSD 1HE7A 3KYNA 5IFHL 2AV7B 5DJ6A 2EE2A 2BMKB 1BD2B 3UYPA 2NTSP 5JNYB 2D7TL 3MV8A 4PJFB 3GI9H 5HY9A 5A2JH 1BOGB 4UI2A 1H8SA 2C7UA 3BD3A 5F7MC 2Z35A 3SGEH 4AQ1B 4QXUH 4YO0B 5DQJA 2EDKA 1Q1JL 2XZCL 3NFNA 3OHXB 1NC4D 2VLME 4M4RA 5HSFA 3BPCA 3QJFA 3O6FB 1C12A 1EIBA 1OT2A 3D39E 1TVHB 4AIZB 5MENE 1D5ZA 4NO0B 3GUTB 3MBEC 2VZ1A 3ARPA 1X5XA 3IT8D 1G7HA 1QFOA 1NFIA 2HTKD 4L29A 3B9KB 3K4ZA 2NTFB 1ACYL 1T2QH 2R2EB 3O4LD 1XGQA 2D7QA 1PFCA 1OB1B 1OTTD 3QIBC 5BOPA 5HJ3A 5KTEL 4PS4L 4XPAH 1NCCL 3AMLA 4FQHA 2VSDA 3D85A 3SJVB 1MJJA 3DO7A 3HUJA 4FQ2H 5BRZA 1MFBL 4TUOB 1FPTL 4FMKA 5C0FB 5DD5L 2VXQH 4O51A 4BFBD 4DAGL 1JYNA 4PBWD 5J0BA 4ZFZB 4TSCH 1RZKC 1NDGA 4JJ5A 1IQWL 4K7PY 4HJJH 3WN5A 1IC5H 4JANA 4XP1L 2J8HA 1Q72L 2WMPA 4P4RB 1KJ2B 3QUML 1DUZA 2VYRE 3NFSL 4FQXA 4XCCH 1NAMB 3WEXB 2IALA 3NABL 1LNUA 4RSVA 1R6VA 3FT3B 5CLWA 4Y16C 1CD1B 1DL7L 2AEQH 4HMEA 3WXVH 5BS0E 4HBQA 2ZUWA 1QR1A 5JOEA 2CIKA 4G43A 5ID0A 5L8LB 4KTDL 4NQDA 1KTDA 5BZDB 1MHCB 3TT3H 4FZEL 5MEPA 3JWOH 2EH7H 3L5XL 4H0IA 2EIEA 4HJ0D 5B8CC 3DYOA 2R0LH 2X10A 4MAYC 1T7YA 3IETB 1HCVA 3VMNA 4ONHB 4TQEH 3DGGA 3V0AC 5EO9B 5IJVB 4ZFGL 1ZGLP 2CO6B 1IAOA 3CX5K 3TVMC 4IHOA 1NANH 4AG4H 1LO5B 3MODH 4HFUL 2DF3A 4QRTA 5D7JC 3VG9C 1HEZB 1Z9OA 5DJXB 3VDBA 4PJ5D 4OT1L 3JSSA 2DQIL 3HR5B 3SE9H 4WEMB 2E9WA 1BVKB 4GSDH 5CJOH 4LLYA 3TH3T 1XIWC 5EZJA 5C0CA 3HAEH 5F6IC 2PKDA 3FFCB 4I2XB 5AZEH 5HHNA 1WCBA 3JTSA 1T2XA 1JZ6A 1BWMA 5DDHA 4XWGH 3NIGF 4XCNA 4P2OD 1CGXA 4JKMA 4S1QL 2XFXA 2QADC 2OR9H 5TDNB 2JELH 3QQ9C 1TNMA 5TFSH 3IFPB 4YHYB 3ARZA 1F4WH 3TBTB 2G9HB 1I7ZA 3FO9A 3LZFL 5ILTH 2DLEA 2IJ0C 4JZNA 5LKNA 1NL0L 4PLJD 4X0KA 3L5JA 5GZND 4NZUH 1P7KA 5HHXH 4ZOAA 5DRXA 3BKYL 4PJHE 3CMOL 4H1LG 4UV4L 3DVNB 1NUDA 5CILH 4OCRH 3V5KA 4PB9H 5ESQA 3BQUC 4FXKA 2LTQB 1LHZA 3ES6B 4O2CA 4UINH 3SBWA 3AMKA 4R8WL 4WU5B 4TSBL 3VGAB 4YDVA 3I6GA 2RCSL 3S36X 1PEZA 4BH7B 2Q1EA 4AH2B 4YE4L 2IMMA 2N4IA 5DJ0A 1JE6A 5EZIH 3REVA 2ARJB 5ERWB 3WD5L 4NDMA 4R0LC 5F1NB 1TZHA 1T1YA 1UWXK 4NM8H 5DMIH 1F58H 1REIA 3RVVC 4NNXB 1J11A 4OUUB 2VLLA 4PP2A 5J6HB 4NC1E 5LAXA 1V05A 3BH9B 4YFLI 4OQTH 3RDTA 1CE6A 3HC3H 5I16B 4C56A 3BUTA 5F7YC 5GRXG 2G75A 1TJGH 4D9RE 1CD0A 4XZUA 4Y16D 2QL1A 4EBQH 4Z7VE 1AJ7L 5D1QA 4LHUA 2PXYB 1N5YL 3U0PA 3QZWG 4CN1A 2IANB 5FM4A 5F7EH 1DCLA 3MOQA 1EEYB 1N8ZA 2BZDA 1WIUA 4LVNB 1FL3B 5E56A 1KYOK 1FGVL 1U6AH 4PJ9C 1JGDA 5A2LH 2DQTL 2NY5L 5J9PB 5JHLL 4RX4D 1FNEB 2DQCL 4OD3H 4TOYH 1UM4L 1G9MH 3VWKA 4IMLA 5IW1B 5I18L 1TJGL 4MS8C 1KTLA 4OZGB 5CP3A 4L4VE 3L7FB 4WWID 3MOBH 1LK3L 3R0NA 1H15A 3MO1B 1H0DA 1TZGH 4P2RA 4X7TB 3I3EA 1HSAB 3G6AA 2DYPB 1OTTC 1SEQH 1BGXL 3KVQA 2CMRH 3MLZH 5D7LB 5I17B 4TPRL 1I8LC 4W4NA 3O3AA 2P24B 5D2NB 3VFMB 4OJFH 3NIFF 1RUKL 4GW4B 2D7OA 4PTUA 3SDXB 1XGUB 1W8OA 4MA3A 2HMIC 1IGTA 5L2KD 3O45A 1N5AA 1SEBA 4NQVA 3MNWB 3DO3A 4LVHC 4YAQB 1KENL 2HRPL 5IBUB 2OJEA 1CFTB 1JP5A 5C3TA 4OGAD 4ZAKB 4TSBH 3KPSE 4NQEB 3EYQC 2ZG3A 3ARED 1DZBA 4X6DA 4TNWK 4AEIH 5ICXA 1FJ1A 1U8JB 3MLYH 5KAQG 5IM7A 4G80A 2Z8WC 4U0QB 2ZCKH 3VFWB 3T4AB 3FT2A 5KSBB 2MTPA 5E7FA 5ACLA 2DICA 4KVNL 4OLXL 3U4AA 1DQDH 1R3LA 1SMOA 2XQYK 3W9DA 4KJYA 3TVMA 3QXAB 5DD3L 4J6RH 1JRHH 1A21A 3BXNB 5C6PB 5CD3B 3ZHDA 5C09E 4I0KA 4RA3A 1SY6H 4WTZG 3FOMB 5CHNB 4KI5C 5IB4B 2NPLX 2IQAA 5E8OA 5IWLC 4ODVH 5LGKA 1HH9B 2ZZUT 5D93B 2M26A 5BO1L 1NGZA 1D6VH 5ITFB 1U8HB 5D70H 2D9QB 4BK5A 4HKBB 1F4XL 2COQA 1RPQA 3GBNH 25C8L 3WXWL 3VXUB 4WI4A 3P73B 4G3YH 1KEGH 3RWHB 5EU3A 2DTSA 4K8RC 1I8IB 1C5DB 2K1MA 2Z31A 4RMRA 1ZKAA 2ADFH 4DVRH 4ZXBD 5I9QB 1XGYL 1F97A 4P9HH 4LU5L 2Z8SA 4N8CH 1NFDF 1QA9B 3ARGC 5FO8A 1F8TL 2VISA 3KPNB 1I85C 4PR5A 3PWJB 4LCYA 1WF5A 1MIMH 4PJDA 1WBXA 5IMLB 1KIUA 1LE9B 4KRPB 4EIGB 2DDQL 1T7WA 2PXYD 3IS1X 3AXLB 4KZDL 1G7QA 4ZDHA 3D39A 3H3PH 3CGTA 5JUEL 5C0EA 2LAAA 5DUBB 2CR3A 4PJ9D 5DK2A 1M4KA 5IMOB 3ET9F 2ICEB 4GXVH 3MV7A 1F6FB 2X4SB 2D9CA 4KROD 4CVWA 4RWYH 5HYJA 3QEGL 2J1KA 5ETUB 1FZMA 4XX1E 4FQJL 4NN6C 4XNYL 4LLVB 4JHZA 1JGUL 4ZPTA 1I7UB 4MJID 4DZ8A 5BZWA 3QEHA 3JTTA 2W60B 5D9SB 4QT5B 1CS6A 3O4LB 6CGTA 2O26U 1NCDL 3D0VA 4L9LA 4BSWB 2RR3A 4LFHG 3DROB 1ES0A 3DV6A 1SVZA 1EO5A 1KUMA 4JFFA 2YD7A 4LPYA 4ZFFB 5F3HA 5DMJB 2NZ9D 3FHQA 3RVTD 4DWHA 3HPJA 4Q7DA 3FRPG 2A6IA 5F71A 2C1PB 1IJ9A 1I9EA 1IZKA 1A3LL 1IQDB 4K3DL 2BHYA 3JXAA 1ZE3C 4H88L 3GSVB 3C8DA 2XWTA 1I3RB 2GAZB 2P5WB 1A0QL 4UIKH 3EYQD 3UC0L 2W65B 5FYJL 3VWJA 1UJ3A 2OJZL 3OKDA 3UAJC 1A6UH 2VWEC 4KFZC 4N9OB 3L5HA 1MFCH 1UWXH 4XP9L 3WJJC 3HI6L 4F8QA 5LWYL 4KZEL 3IDXL 4RMSA 2P8PB 2AERT 2IH1B 3FT4A 2PW2B 4IOSD 5DF0A 5BS0A 5FOBB 3DGCR 4ONOA 5HHQB 5C8JB 1W0WA 1PEWA 5E94B 4C56E 4M5ZL 5HHOA 3KAAA 4IRZH 1NFKA 1GXEA 1HIML 1T1ZA 1OD9A 5C0IB 3DMMB 5IB2B 3DI2B 1RUAL 5ABDE 3FFCD 4KAQL 4MVBC 1GAFH 2Z8RA 2X89D 4X7DC 2C3VA 2XNAA 4OZ4A 4LIQE 3CMGA 4R96B 2V5SA 3CLEL 5ALCH 3SCMA 4BH8A 1J1OH 3DUUB 4KQ3L 1N3NA 4M9PA 4OLWL 3QPQC 1HHKB 1T5WA 3ZE0E 1ZA6A 1A6ZB 4NQXA 3RGVB 3UTTB 2ORBL 2GT9B 2QADD 5I1LB 4IDJH 3QI9B 2A73A 1JNNL 1FHGA 5E9DD 5I66B 4UDTA 5DVKA 3RY6C 1S7VB 5IB1B 5DVMA 5E2TH 1G9NH 1XGTA 2PO6A 3BESR 4RNRB 3RGVC 5KG9B 5EOTA 4P46D 4RIRB 1KG0A 5IW6B 2VNCA 1JRHI 4YQXL 4P3CH 2AW2A 4GG6F 1BFTA 1YEGL 1NAKH 3OBAA 4NKOB 4LSDA 3VGAC 2YPLD 4JO1H 1BF2A 1VEMA 2DWDB 5E99L 2C4XA 2DQHH 2GFBA 1X5AA 4J1UB 4AL8L 5D2LB 3REWA 3B3IB 2GKIA 2YD6A 3QYCA 3LOWA 5D1XB 5JMRA 3SDAD 4HUVA 5DRZA 1T04A 1JN6B 4OIBA 1EV2E 2FB4L 2R56L 3VGEA 5GGUB 3I2CL 5GRUL 3KLHD 3M1BB 32C2A 4D9QD 1ZLWK 2BY3A 2P43B 4PJ5A 4XNMA 5FKAB 3TCXA 1AGFA 5D96C 5CIPA 2F74B 2ZSWB 2YUZA 5E08H 1M6OB 1BQUA 2FIKB 3VGDA 1EFXA 1A8JH 4MLSA 1AO7B 4A6YH 2GJJA 2VR9A 5E8PA 2BJML 3MJ9L 2IWGA 1W0VB 1K9TA 1FC2D 1KCUL 4MDJA 2HFFA 1NMCB 3ZL4H 2HWZH 4IIQC 3T0EE 1MPAH 2VLKE 5C7XL 2JB5L 4NGHL 5GZOC 2XV6B 2HG5B 2WBJB 5C09A 4LQFH 3CVHB 4NO3A 3H3PL 4IS6A 3FL7A 5EC2B 4LSSH 1T4KA 3IKCB 5FF6B 5HGGS 3NACH 3EOTH 3VI4E 5LJYH 4WV1B 4PPTA 3N1PC 2NXZC 3ZDZE 1K3ZA 3DUHA 4BSVB 2KUTA 1XZ0A 1G6RA 4JJHA 43C9B 4QTIH 2OLDA 3HE6A 4KRLB 2PF6A 4LCUA 2Y5EA 4OV6F 4AM0B 1I4FB 1KFAL 5FA4A 3GMQB 5SX5H 2W0KA 3HE6B 3QIBD 1MWAA 3UBXG 1KIRA 1G6RB 1T1XB 1BVLA 3HAEB 5D2LE 5D7IF 3NA9H 2QV2A 4KK8D 4G7VL 1ZLUK 4LSPL 2RGSA 2B5IB 3U30C 3IFNL 3LKQA 4XC3L 1OP9A 3JV5A 4TUJA 4BFIB 3SGDI 2B1AH 2P5ED 4M93C 1T4KB 4K71C 1XF3B 4D0CA 3BRDA 2NXYC 3FB7B 3V6OC 4U7KA 4PJEA 4HIIB 4PV8A 1JWUA 4K55A 4FFVD 3IJHB 3IDGB 2O5YL 4MNGE 3MV01 2XZAL 5B3JE 1DEEB 4TRPL 4W68A 4XX1G 3CVIH 3WO3B 1AO7A 4M6MH 1NUGA 4PYHA 1FGNH 2VDRH 3EO1A 1Q0XL 4NO2A 4PGBA 4XVSH 4JCMA 2AQ2A 4XNMB 3VXMD 5T3ZH 3HI5H 5J12C 4JPIA 3VFUB 4G8FB 3TZVA 1EMTL 4R7DB 4OGXL 2HKFL 4OLEA 1G9MC 1GGBL 3AFLA 3MLPA 3MV9A 4KI5F 4ISVB 1KPUB 1RMFL 2AJUL 3TC9A 4HUVB 1X9QA 1NGQL 1Q9OA 3QUKB 1UB5A 2X7LB 3B3IA 4LVOC 4HKJB 3REWB 3V4PH 4J1UA 5L0QB 2OL3A 3PWLA 5B3JF 5H94B 5EU4A 3CK0H 5F3BA 2H9GA 3KDMA 1UJTA 3LKSA 1KEML 3E2HB 4FTVA 3SQOL 4C4KT 5DZLA 3D5OF 3WNMA 5LQBH 2R0KH 2YN5A 2NCMA 1MHHA 5FM5O 1PKOA 4J7RA 1YYLL 4ONGH 5B4MD 1Y6MR 1BF8A 1ORQB 3CD4A 4S1SL 5KG9A 5GS0H 3WL9B 1XGTB 2NYYD 5EA0H 5F93C 1RURH 1S7VA 3TT1L 4NIKB 1KC5H 5DUMH 5E4IA 3BP5A 4KRPC 5CKAA 3TA3C 2ITDB 2A9NH 2APXA 2NR6D 2OI9B 2A6KA 1HHKA 5KVGL 4MCZB 5EU7C 4PJ8D 4Y5XC 5BVJB 4NKIL 3SCMB 4BH8B 3LRSB 1NANI 1TCRB 5FYKD 4O02L 2F9BT 4OCYL 3SEPA 2Q87A 3MGTA 4MLIA 3JUYA 1YMHB 3RHWF 3WS6C 4D0DA 3WFCH 5H2BA 4UV7H 5H35B 3MREB 4E42B 4RAUA 3CXDL 3HE7A 4LK4A 4KKNA 1K8IB 4OGYH 4DTGL 4PJXA 3U48A 4KH2A 4QRPA 4P2QB 2PTTA 5HHQA 3CC5B 4OUOA 1NGPL 2PW2A 4JM4L 3O3BA 3BEVA 4NZRH 4PJHA 3ULUE 5BJTA 1S9VB 2AI0H 4U31A 4HF5L 2QSTA 1D7FA 2X4QB 1DSFH 3PJSB 5IB3B 1CCZA 3QWQB 1S7TB 2R69H 3DX7A 3MGOB 4U6TA 5EZIL 3V6ZA 1F6AB 1T7ZA 4CVZA 3SE4C 1JUFB 3RWCB 5KSUB 3KS0H 5BV7C 2GSIA 4MQ7B 3SCMC 2DQGL 1CF8L 2C1PA 1RIHL 1EMTH 3MCKA 3VRJB 1OGTA 2OSLB 2AK4A 1MCWM 4U05A 3GMOA 5BRZD 1LO3L 4XBPB 4ZS7H 1J8HA 1FBIH 3JV4B 4JFFB 4MJ6B 5A3ID 2F19H 1WAAF 2WBWB 3FAXA 1A6TB 3UBXB 3QFDA 1LE5B 2FIRT 3SDDA 2J6EL 1U3JA 1OM3L 3QCUH 2VIRB 2DI7A 1CFSA 1AC0A 4WO4C 2AJZA 1J1XL 2R29L 4M7JL 4B41A 5L6YL 3JV6A 1ZSDB 1KXQE 3KLSA 4HIEA 5EO1A 4MYWB 5ETUA 5FYLL 3NMEA 4HKZA 4L8CB 3ZKSD 3AB0B 2BVOA 5C0GA 2LABA 1D6EA 1PKQA 2XACC 1OP3H 4G6KL 4GRWH 5IROA 5F1OB 1ZTXL 3BPNC 3KPRE 1JPTH 1L0YA 1NH6A 4IOIB 3P4NA 4TVPL 1LWRA 3P4MB 4UB0H 1S9YB 4RBPH 2VZOA 3AXLA 3OR6A 2R1YA 2D03L 3MV7D 4Y19E 4GSDL 4CMMB 4NQDD 1HSBA 5B3NA 3V6FA 3O9WA 3FOLB 4YHNB 3FO2A 5JXEA 3ZYZA 1BJ8A 1JGEA 1JGLL 4BJLA 1WT5C 1VERA 4ZTOH 1C5DA 3I3BA 2KDGA 4JRXD 5EOCH 3SDYL 3EHBD 3GIVB 4HGKC 5EU3B 3RWHA 1P1ZB 3S37X 2GY7B 4LARH 1A1NB 1GOHA 3ILPB 5L7XH 1QYGL 4TULL 4ZO6A 5HVWA 2VLKD 1X5HA 2FEDC 2VAAB 4M03A 4Y4FC 3CSGA 2EO1A 3T2PA 1MWAL 3DARA 3MLTA 4XWOD 2C3WA 4KTDH 4ZFOA 2IQAB 1NDMA 4F57L 3L3JB 3STZA 1MCPL 4RFOH 5CKGA 4OI8A 2C9AA 2NY4C 2YC1B 3DX6A 1UGNA 1FNSL 3KPSA 2XKNB 1A4KB 3O6KH 3QXAA 3TVMB 1SBSL 4K3EH 4U6XA 3BO8A 5IHLB 2BDNH 3MSPA 3QULA 2ILLA 2DI9A 4GRMA 5HGBB 2R4SH 2VDOL 4HEPG 4QHLB 3QG6B 3BIAX 1DQQA 1QSFD 4HPOL 5SX4I 3F7RA 3O41A 4HDIA 4FXLA 5HPMB 2C4FT 3VFVB 1U8JA 3R4DA 2FDBP 2CK2A 1EAPA 1BFOA 1R3HA 4R4FL 5FA3A 1A9BB 3IAQA 4APQA 4Z76A 1YMMB 2EDTA 3D3VA 1RZFL 4U1JA 5I0DA 1SEBB 4Z76B 1IGTB 2Q7NA 3VXRE 3QNZB 4MA3B 3OMZA 4ELKB 1VEOA 5IFJB 5BMFH 1EAPB 2R8SH 1OSZB 2G60L 4PJ5E 3C09C 3SY0A 2DIJA 4LPUA 3TYFB 5KTEH 4R2GB 5D7LA 1OM3H 3O8XC 1HSAA 1G7LA 1ORSB 4X6BB 4X7TA 5E5MB 4NCDA 1DQQB 3MO1A 3D18B 1WWWX 1WV7T 1DDHB 5HGBA 2Y06H 4QF1A 4JFEA 1TQCC 5HDQH 1U36A 1KTLB 5MHSD 1U95A 3I6KA 1CF8H 4UAOC 1A3RL 1E4KC 4KQ3H 3SKMB 1CDCA 3GBLA 4JO4H 2ADIB 4DQOL 1E4XL 4HUXA 2KQMA 3GRWH 3IB4A 2NY1B 2E7CA 1CT8A 4HWBL 3MACH 2IPUK 1AHWA 1DANU 3PIQB 1CDJA 1I9IL 1TPXC 2VQ1A 2VDPL 2IANA 3SDAA 5D71L 5I1JH 3AS2A 2VDQL 1HIMH 5DFWH 5CEZD 3VFOB 3VXTB 3GIVA 3MXWH 3QFJB 4DKFH 2CRMA 4N8PA 4XZUB 4NP4H 2R1WA 1JGEB 3TNNB 1W8NA 1D5IH 2ICWA 2YN3A 1WC7A 2EYSB 3I50H 3JWDC 2QADB 4OM1H 4PREB 5BW7A 5CJ5A 3FOLA 1U8MB 3OX8A 5I16A 12E8H 4JFXA 5IB5B 2GUOB 3ALXA 3LH2L 3FONA 3S35L 4PP2B 2FGWH 2FX9H 3QDMB 4H88H 5DMGD 1EBAA 4EDXB 3PABB 1T03L 5E95B 2F54B 4G8EB 1UFUA 5DZNA 2E7LC 3O2DL 2VDKH 1T1YB 2ZPKH 5GXBB 5GGRB 1U0QA 4NDMB 2PYEB 2ARJA 2WLYA 3L95B 4GRLA 1RIVH 4ONFL 1TIUA 5KSBE 3INUL 4K9EC 3I3DA 3SE8L 2Q8AH 2QQNL 4HKZB 5SV4A 1RUMH 4BK4A 4JFYB 5EO1B 1EZVY 3MUGB 3MX0A 3HZMB 2JIXB 4MB4A 3JV6B 2DWEB 2VB5A 1QBAA 2YRPA 1CFSB 5E2WH 4EUPG 2X70B 1FLTX 4GUPA 5CINL 2XQBL 1NKOA 1LE5A 1KTKE 3MZTA 4LBEA 5FO9B 5C0CD 4BZYA 3ULUD 1ZT4A 4XBPA 2ZOKB 1SHMA 4JHBA 2V9TA 3G5VA 5GS0C 3LEXA 4K8RL 3B6SA 5IVZB 1QSZA 1U91B 3PHOB 2JCCE 5AG8A 4Y5YC 3LQAL 2I9TB 1Q9KB 2FLRT 4P2OA 3PGDA 1F6AA 4CVZB 1QSVA 3OF6A 1P84J 3A6BL 1S7TA 4PB0H 2P48B 4PP1D 2YMXH 1FVDA 1ZLUH 3IRZA 3FQNA 4A6YA 1VACA 3LPGA 4KDWA 1BAFH 4JREC 1CDHA 5BJTB 5BV7L 5I1AB 4RGMB 2YRLA 3O3BB 4RBPK 3NAAH 1FCGA 3MNZB 1RK0A 3RVUC 1S7SB 2D2OA 4PJXB 4IIQA 1I3UA 4TUKH 2X09A 3HR5A 1EGJA 5B21A 3TIDA 5GSRB 5DJXA 1KPRA 4RAUB 3UYRL 2JIXD 3PP3H 4QRTB 4TVPH 3LIZL 1QLRB 3WFEL 4AK1A 3DGGB 5T5FH 4G6AD 3H3KA 3UCRA 2YA2A 2NY6C 5D6DA 3GSOB 4JQXA 4U4BA 5GGQL 5FM8A 5I8EA 5LGHL 5MEPB 4F57H 3QCTL 4XVTL 1MHCA 3GSOA 3QIUA 3WNNA 1V7NL 1U3HC 4E9LA 3BP5B 4XMPL 3GSRB 1CL7H 1J18A 5DA0B 3ZKMC 2VXSL 5I74C 3SDXF 4WTWA 4WFGE 2CIKB 5ELIA 5ID0B 4LLDA 1P84K 3WL9A 5L88L 3D2UD 1AXIB 4XNZC 4U6VH 1E6OH 4WUUD 2EEDA 1AI1H 4XRCA 4TTDC 5IK3B 1FFPB 4RGNC 4P5TB 1TTFA 5D72L 2X6MA 1JL8A 4HWEH 3Q6GH 4GKSB 4PJAA 1NUFA 4JRYB 1QBML 1F02I 5H94A 2CQVA 2F8XC 4RGNB 3CFBB 5CZXC 1QRNA 5F9JB 1LQSR 2R69L 3TJHD 3W2DH 5J3HC 1UENA 4PY8J 3FQNB 1N7ML 4EI5D 4NO5A 1LGVA 4ZNEA 1BGXH 2A38A 2R1XA 3KR3H 5DMGC 1AC6A 1G7PB 2YUVA 1NC2D 4LLMB 4L3CB 4N0YL 4JPIB 3HUJB 1JF1A 1VGEL 1YECH 3CNKA 4RQQA 4BKLB 1IGYA 4X9GA 4KI1A 3ZT6A 4WHCA 3CH1B 2LE9A 4UT9L 2ZOKA 5DR5L 1ZT4B 1YUHB 4U49A 3AY4A 2VXTL 3LV3A 2B1HL 3EFDL 2WANA 1X5GA 2A83B 1CGUA 4PJDF 4L29B 5D7IE 1N4XL 3IDGA 3EJJX 4KGLA 3M8OH 5F1SA 4LAQH 5I15H 3E3QE 5D2LF 4XVUD 3TBWA 3HZMA 2OXHA 3MUGA 4I2XE 3MJ7A 3EFFA 1RY7B 4JZJA 3EYSL 3QDJE 3OHXA 1RUPL 1N5YH 2VDML 2PYEA 3DXAD 2NNAA 3DVIA 1YNKL 1TJIH 4ODHH 3TCLA 5J89A 1R0AL 4P3CL 3QO0B 1BVLB 3HAEA 5E6YA 1MWAB 4EDXA 3ULVH 2VDNL 5INCB 3VCLA 3GMQA 4L5FL 1MJ8L 2XICA 3LRGA 3RU8H 1BD2A 5IQ9B 5LGJB 2LAGB 3VXUE 5IB5A 3QDGE 2FHCA 4M8QA 2GITB 1JTPA 3QDGB 1N6UA 2YKLL 4MXWL 3AC0A 5D5MA 4X98A 3TLRA 3OPZH 1JHKL 1K4DB 3C8HA 5ICZA 4KDTC 1QR4A 1OLZA 2BSRA 2V2TA 3N50A 4YLQT 5F1IB 3CXDH 1ZLSL 4PGEB 4ZO8A 3FCTA 1I1AA 1NCWH 5TF1H 5KN5A 1I7RA 1L6XA 1UKTA 2HG5A 2WBJA 4PRBA 1AQKH 1NBYB 5C70A 5CMAA 3DWTA 4QCIB 4F7TB 4OF8A 1OP3K 1MCCA 3UPCA 1AI1L 3HNSL 4Y19B 1I7TB 1MY5A 3JV0A 5I1HL 2OQJB 4IRJD 1NMBL 2Z31D 1J0ZA 3SKMA 2IBBA 2BNQB 4NOBA 3KHOA 4JR9L 2ZSWA 3KLDA 4XP9H 1U95B 1AGFB 1F5WA 4U3XA 4OQ1A 4EVNB 1FL5B 4ZUVA 1IBGL 4XCEA 1CWVA 1U58B 3DUSA 5DO2C 3UC0H 1DDHA 3S5LG 2ERJB 3I6LD 4JRXA 3WFBH 5LQBL 3T3PE 3GFUA 3VXOB 1XAUA 3BZ4B 2FX7L 2V5TA 2BHUA 4M5YL 2ZUYA 4QOKE 3QRGH 5FHBL 5EBMB 4BFGA 1P4BL 4LSPH 1IGFH 2IH3A 3L5WA 3LD8B 1S78C 4I18B 5E4EB 1FFOB 1OVZA 3O4OB 2HFEA 1CXEA 3K46A 2UWEB 4XC1H 3WDHA 1F45A 3S5LB 1A9BA 5HDLA 4XP6L 1JI2A 4QGYA 1JZ3A 3VFRA 3HS0A 2HKFH 5MENB 4ZAKD 5IEKB 4GAGH 4RGNE 5EOTB 4ZS6D 5T1LA 4HUNB 1BQHB 4GJTB 1P2CB 2J2ZA 2EDYA 4RNRA 3VDCA 4LCCC 1FYTB 5FCUH 5HPMA 4XXDA 5JQ6H 2GTWA 4JO2H 4YDIH 3A6BH 4QHLA 3QI9A 4XBGB 2AJXL 3GSQA 5A40E 2GT9A 5HDOA 4I9WE 3I85A 5F9WB 4FABH 4OCWH 4JEGB 2QKIA 5JOFB 1KNOA 1KLGA 4N0RA 4WW2C 4R96A 3G6JA 1MLCA 3D25A 2Y6SD 4ZFOB 3MLTB 4YDLB 1IC7L 4H5SB 1QP1A 2OM5A 1P5UA 4JFDB 4MA8L 3QEQD 2HT4D 4OBSA 5DJDB 2AK4E 3EBAA 4X80L 1IGCL 1YEKH 3RY6A 1Q9WB 2XTJB 4ODXA 1QSFB 5D1XC 2MHAA 1IGIH 4PBXA 1XGPA 1S8DA 4R7NA 3CDCA 1MFDL 4JFQB 2FJHB 4YFDB 1YEJL 1IQWH 3KLAB 1BZQK 4P3DB 4JFDD 4Q74A 3O9WB 3VWJB 5DT1H 1MHEB 1ZTXH 1HSBB 4XP5L 4CMMA 4QO1A 1T03H 1IM3B 3HR6A 1I3RA 3S37H 5KVDL 4N0FA 4WHTA 5JW3L 1IQDA 4TN9A 2YZ8A 4MAYB 3SCMD 1UA6H 5FYLH 5IWLA 4LHQB 5JO5A 2ICES 5DD3H 4YQXH 5F3HB 3TZVD 5EIQA 1GZQA 1I1FB 1OP5H 4BFEA 4WHYH 3UTQB 5FO7B 1D6EB 3D0VB 2X9XA 1RHHB 1U8NB 4QT5A 3OJMB 4PJBF 2CDEA 4HIEB 4QTHB 4DZ8B 4MMXC 2XA8H 2JB6B 4OZFB 1MCLA 2XQBH 3VFPB 3EUUA 3SO5A 4X6FA 1J1OL 3H9HB 2VABA 5E03A 2ICEA 2ENSA 1A7RH 3UBXA 4FTVD 3DMMC 1I1FA 4NWUH 1S9WA 3EO9L 5J1TC 1IC4H 3FO1B 4QOKD 1I1YB 5JO5B 2FX8L 1KN2H 5IQ7L 3MPCA 1TQBB 1XF1A 5I1CH 4P48A 4N0FB 4WHTB 4AYFA 3RWJA 5D1QD 1QO3A 4XAKE 2B2XL 5JHDD 2PYEE 1G7MA 4L3ED 4NC2B 3L6FB 5C86A 1K2DA 4UT6H 2X4QA 2VERN 3ARFC 4JHWL 2FJHA 2ADGB 1QFWI 2P45B 1XGPB 2NY0D 2P46B 1S9VA 4MZ3A 1YNKH 3ARDB 1OSPH 1WZ1L 4YR6A 3BN9D 4O4YL 3VXUA 4DEPB 2V7HA 1UZ6E 3HE7D 1UYWH 2EIBA 3PNWB 4C83A 1DVFC 3V5DB 2F58L 2HT3C 1ZS8A 5D5ME 1IRAY 3X17A 4HG4K 5H35A 2DKSA 2OP4H 4RFNB 3RWDA 4D0DB 3QWOB 1KN2L 3QUYB 1RURL 4EKXA 1AJ7H 3A6OA 4NJ9H 1MLCB 3MR9A 3LRSA 3NZ8B 1IC4L 3QI9C 5AD0A 5LXGL 3GSNB 1EH9A 4IOFC 1G0XA 3FB6A 4MX7B 1WCQA 3RL1A 3VW3L 4Y4HB 1KEMH 4ELME 5C07D 1CXIA 4FG6C 3T4AA 4X6CE 2DKUA 1RULH 3VFSA 1FIGL 4G80B 3P0GB 3V0WL 1P2CA 1KB5A 2DD8L 4U1NB 5J06A 4U2YA 2X4RB 5IEKA 4CRPA 4G6FD 3BZFA 3HS0B 1U42A 2ATPB 2K7QA 5EORL 3W2DL 4MGXA 4K7PL 2OJEB 3GK8H 3F7YB 2H9GB 1MFCL 4F33B 5F3BB 3GHEL 1N5AB 2NXYD 1U9KA 4OI7A 4I18A 5C2BH 3SDCA 2XTJC 3UTPE 3NCJL 4GW4A 4PTUB 2UZXB 3BIKB 2X7LA 4WGVB 4L8SA 3HMXL 4HWNA 4M61B 2NY3B 1KPUA 1EHAA 2WSKA 3BZ4A 1RVFH 4YEFA 3VXOA 3QUXA 4P2RB 2EC9U 3DSFL 4XC1L 2N56A 4X7EC 1YN6A 5LBSH 3DUSB 3TN0A 1KEGL 4OZGA 1PLGH 4ZUVB 2VLJE 3LZFH 4EVNA 4Q6IB 3QCTH 3TH4T 2YPVH 4PJDE 3C8KB 4P4KA 4YBLB 1J1PL 3K81A 1FNEA 1A1OB 1I7TA 3P4OA 2IPTL 4G6KH 1G6RH 4XPBL 4P57A 3PV6A 4ZO9A 4KJQC 1A6VL 2IG2H 3NIDF 2MJWA 5I30H 1FFQA 1XF3A 3CSPA 2WWKO 3V0VA 1HYSD 4PJFE 3V52H 5ENWB 5FGRA 2PXYA 5GZOD 6FABH 3MV7E 4OCWL 2BSSB 1BD2E 3I9GH 4X98B 1MEXL 1NMBH 2CGRL 4LKCB 5HGAB 3QDGA 4I0PA 3KPTA 4F7EB 1XIWB 4DN3L 4ERSH 2DRUA 3X3GL 4XNZB 1GHFH 1S7QB 1SYSA 4JQVC 3D2UB 2P42B 3BH9A 4ERSL 3EOTL 4YBQD 1OT1A 3VCLB 3K1KC 5E1HB 1L9MA 5E6IC 4KKLC 4WI3A 4RISH 3ZKNC 4ALAL 3N1FC 2DM2A 2OYPA 2X4PB 1O7SA 1I9RH 1I85A 3HLAB 4NJAH 5FF6A 2PYED 5CJQH 3VXSD 4I77H 4LPVA 1K5NB 3JWNC 3CVHA 4NO3B 4E41B 1MCQA 1AE6L 3V4UL 4APQD 3V5KB 3DVNA 4AEHL 1GH7A 2UUDH 5E8PB 4TOYL 4HGWB 1IBGH 2ITCB 3INUH 4UU9A 3BN3B 3DYMA 3NIGE 4ZD3H 2ED9A 2M2DA 1A7OH 1HDMA 1RVFL 1FYHB 4I0CC 4LLMA 1HQRB 4NSKA 1N64H 3O2WH 4L3EB 5E99H 2GJZA 4HJGB 2XFXB 1FPTH 3NGBB 4JFED 4UOW0 5J8OA 4OF5A 2VITA 2VXTH 2NY3C 2GK2A 4YWGH 5HHOD 3U0TA 4CAGA 3MA7A 4ESKA 2PW1A 5K9KA 4UT9H 5DR5H 1CLCA 5A43C 1JIBA 5E70A 1JPST 4HXBH 5F9JA 2NY1D 3FFCA 2GFBB 2N7BA 1I3GH 1M1SA 2EE3A 5C0CB 1U8IA 1EO7A 3KPPA 1KLUB 2XI9A 3B8YA 5KVEH 4HH8A 5HVHB 5IF0B 4N9GA 4N0UE 3QXDB 3G5ZB 4L4TD 5IK3A 5IMMB 4QHKI 1HEZA 4XRCB 2FX8H 3CCHA 1MCHA 1EEZA 1KB5H 1L7TH 3H42H 3VGHA 4HWBH 3CJJA 3G6JE 5IVXA 2PO6B 4LCWE 3WD5H 1EGJL 4JVPA 5IB1A 1B88A 1MFEH 1D5XB 2DM4A 2A73B 1WICA 1UM4H 5I1LA 4OGXH 2CJUH 4PTTB 5ESAB 1UT9A 5I8EB 1JZ4A 1N3NB 3DUUA 3QDMD 5C08B 5CEZE 3MGAA 2C3HA 3FMGH 2VXVH 1MNUH 4R6UA 2BXYA 3I9GL 3MCLH 4BELD 1UEYA 2EDJA 2KH2B 4FRWA 4NHCH 5BMFL 4ELMF 2Q20A 5E94A 4P4RA 5DMYA 4ZXBB 3MNZA 5IBLC 1UXWA 4YUEL 3RWGA 3LHPL 1Y6KR 3FB8A 5GRZA 1NDGB 2V17H 2C4FU 3AAZB 1J1PH 4P59L 4I4WA 2D0FA 3BSZL 2Z92B 4DVBB 3TPUB 3V5HB 5JMOC 2IQ9L 2LTQC 2BOCA 1EJ6A 2XWTB 1MI5D 2AJ3B 1TQBC 2R4SL 3BAEL 4G8GD 2ED7A 3HPJB 1RZIB 1U91A 4JPWH 5HJ3B 1X5ZA 3B6SB 4NQEE 1XGQB 3ZO0A 2H32A 5TDPA 4POZC 1OHQA 4OF6A 4MDIA 3BPOC 4K7FB 3ARFB 4RWYL 1ZXQA 3GSWA 2DLFL 3ULUL 3T8XB 2X70A 5KSAC 1FGNL 2VDRL 1AH1A 3QEHB 5SX5K 2VXUL 3IAPA 5D5MF 5C0AD 4AIZA 1U3ZA 3LQAH 4GRLC 4OSUH 4R4BA 4Y1AE 4K8RH 4P23D 3MV7B 3V6OE 3HE7C 1YMMD 4GRLB 3N85H 2BJMH 3MJ9H 2CR6A 1F3RB 4YO0A 5DQJB 5EWIH 3CDYA 1ZA3A 1RULL 1XGRA 1KTRL 2MQCA 2EKJA 2YD8A 3WLBA 4CMHC 4GAGL 3DPBA 2B1AL 4V2CB 2IPTH 3QB7C 4AJ0A 4ENEC 4PJFA 1XGYH 1PG7W 5EZLA 4IM8A 1YEJH 4XNXH 3CPLA 3MBEA 5F7HA 5EBGA 2X9WA 3E6FB 2VN7A 1U8MA 3OX8B 4TUKL 3BSZH 4MJIB 3FRUB 2X1QA 4UB0L 4IRJC 2VLJD 2VISB 1X5JA 3QIUD 1J0IA 2ICWB 4OLZL 2QSCH 4O5LL 1FL6B 4WENB 2YHGA 1FSKC 4JQIH 4NQCE 2Z31B 1H5BC 2DQHL 2CD0A 4DW2H 2DL9A 4OD2B 5I1EH 1E27A 2EZ0C 4LL9A 3HNTL 1NEZG 3PWVB 2X9YA 1AHWB 12E8L 2BOBB 4YDLC 3LPWA 1TZIB 4OM1L 5E8OB 1FFNA 3B9AA 5TH2B 1MPAL 3MNVB 3UTSE 4DZBA 1J0YA 5CD3A 5T1KB 2QQQA 3U4BL 3WHE0 5DFVD 2ORBH 4LEOA 1OAQH 2PTVA 2UYLB 2CXGA 3HCVA 3PWPE 3X12A 5IIEB 5ICXB 4Q2ZA 5E00A 1RZJC 2AK1L 3H42L 1BJ1H 2YKLH 4K3JH 1B0RB 1JNJA 1HN1A 3P9LB 5GS1B 4UQ2B 4FFWD 5EUOF 4WJ5A 1IGFL 4GRLD 1RK1B 1DP0A 5B8CB 5JW5B 1FE8H 1PY9A 1KJ3L 1XCQA 2BSTA 3D3VB 3OKLA 2F58H 5BQ7B 3O45B 5JXAH 1VFBA 3PXHA 1R3KA 1XGUA 1R5IB 3SDXA 3IDXH 5IJKA 1NAKL 4HIJB 1ZEAH 1CQKA 2P24A 3LH2H 2FSEB 5D2NA 2XQYG 1OF2A 3BKJL 3O6LH 5KOMC 3WFCL 2AQ3A 1I9JH 5J56B 3O41B 3NA4A 4WU7B 4WFEE 2H2PD 4PJ7B 4YPJA 4JR9H 1ZLWH 4N8VG 2J6EA 1IT9H 3BO8B 4KK6C 4Y2DB 3DETC 3B9VA 3ZKXC 2Q8BH 5SWSB 2YC1A 4JKLA 4UBDC 3PGFL 4QRPD 3DETD 3L3JA 4KK6D 2HJKB 3IYLW 4RFEB 1IARB 3NPSC 3W39A 1OQOA 3SDCC 4N5UA 4X7CC 1U8PB 1QQDB 3O8XA 4KHXH 2VAAA 1GOFA 4HZLA 5CCKL 4K3EL 5JDSB 4PJ7E 4UMGA 1QUNA 4UTBL 1DBAL 1JHLL 1A1NA 4L8SC 4U1MB 1C08A 1IAII 3DBXA 4JB9H 3N1QC 4CDGC 4Z7NF 1CFNB 1NSNH 4WDIB 4CU8A 4HW6A 1SJXA 2ZKHH 2APBA 4PG2A 3RKPA 5EOCJ 5H37G 5TE4H 1F58L 2F8VA 1IGML 3T2NL 1B4JH 3L3HA 4M48L 1U3HD 4HXBL 2LV4A 1VKXB 5DD6A 2Y9RT 3NCEB 2R1YB 2FCBA 4X8JA 1FORL 2NY6D 5CP3H 4Y5XB 2PCPA 1KF9B 3P4MA 4L4VB 1U2HA 4AQOA 4Z7UB 4U7SA 5AZ2L 5EU6E 1E4WH 3MJ9A 4PJEF 5F1NA 5FYJD 1A3LH 3G6JF 1RZGB 3CSYA 3PQYD 3CMOH 4UV4H 5DJ0B 3E8UL 1P7QB 1XR9B 4N8CL 5D96B 2BVOB 4BH7A 3BP6A 1UJ3C 3ULVC 4EN3A 5MERA 2D03H 3RA7H 3ZYJA 4FXKB 4KK5C 4UOW1 1S9XB 4X6EB 4HUUB 3IDYB 1FG2B 1BJ1J 3LS5L 3SDDB 3U36A 4JGUA 2IG2L 5DJ2B 1VFAB 4YGVB 2PTUA 3E0GA 1YEKL 1P7KB 1A6TA 2PR4L 4MJ6A 4MA8H 4FQ1H 2A6JA 2O61A 2VLJB 3KR3L 2UZIH 5IVOA 3KPLA 4F3FA 1E0OB 4MNHB 2MKLC 1GC1L 4HG4J 4MQXD 3JVGC 5KSUA 4K9EL 1JUFA 1L9NA 4JREB 4RISL 4ALAH 4KMQA 3TA3D 4O58L 1IEBA 3SKUD 5E2UH 1TENA 1NC2A 2EXYC 4XCNB 1BM3L 3DHMA 1E4WL 3C60C 4ENED 4KY1L 1AQKL 3OB0H 2VZVA 4ELMA 4CL7A 2PTTB 1H3WM 2WINB 5C2BL 1BVKA 1P4LB 2OTPA 2VE6B 3LKNA 4U6VL 1DBML 2A9ML 1QHPA 3BPOB 1PBYA 1UWGL 2XXCB 4P49A 4LASL 3DLQR 1KACB 1CGYA 2IQ9H 3IGAB 2WINA 7FABH 4Y8AA 4ELMB 1CG9A 4QHNB 3LKPB 4CADA 4ZSOA 4TPRH 4KKLD 3RP1A 4ONHA 2I9LA 4FQ1L 2WV3A 5CSZA 3SJVE 1DN0B 1MJ8H 1ZWIB 4KI5E 3TIEB 2NW2A 1YEEH 3MRPA 5D7LE 1V5JA 4BM7A 2Q6WA 5GRJL 1JZ5A 3SO3B 1GPOL 2DJ4A 3R1GH 4KVNH 5J7CC 3WEXA 4UUJA 3E8UH 5C0DA 1B4RA 1KJ2A 1T66D 1VESA 3KDMB 4PLKD 1IKFH 4P5TD 1OQXA 3K0WA 2WBKA 4PRHD 1KC5L 4X6EA 4ODTH 1WWBX 4EBQL 4FQLH 2AJSL 4HKJA 2FD6L 5CLTA 4E5XA 1ADQH 2J4WH 4U3HA 4EN3B 3VI4F 1ED3A 1C5CH 3UP1A 3VE0A 3BP6B 1WWAX 4S1RH 3H2WA 4S0SD 4HMDA 4NKDB 4R90H 4XGZB 5FDWA 1UACL 4OZHE 2EXYD 3WS6A 4G8FA 1B0WA 3ROOA 2Y36L 3ME0A 1I9RL 2VDQH 2W9DL 3GM8A 3RU8L 4K23L 4Y5XA 2DJSA 3ARGB 3EO1B 2YPKA 2LVEA 4X8JB 3O0RH 4Y89A 1CVRA 1NLDL 1RMFH 2AJUH 2IAMC 3EYVB 4PRNB 2ZCHH 1BOYA 3B9KA 2DMBA 1G7HB 3T77B 3GMPA 2CIIA 1JWUB 3Q6GL 4Z7QE 3SE8H 3RNQB 1KN4H 1QOKA 4JKWA 3OKOB 1TVHA 1EZVX 4D0CB 3UZVB 5EU7E 1CFNA 1P9MA 5F7NC 1M7DA 2YK1H 3JZ7A 4LAQL 5JDSA 4Z7OF 1RZJH 1U8PA 3GGWA 3O8XB 1T1XA 1FNGA 3W39B 3V52L 3WUWA 1V3KA 5HVHC 1KIRB 1U8QB 5HY9B 4JDTH 2WNGA 3TV3H 1FVEA 2HJKA 4RFEA 4GAFB 5FYJU 1UA6L 1WFNA 1Z9SA 1I4FA 2OL3H 4PP1C 3EYFA 5DQ9A 5SWZE 1RZFH 3QI9D 3X14B 3RPIB 1IE5A 3T04D 1I1RA 1XH3B 2AV7A 4KRMB 5JQHC 2QSCL 4KJWD 4MCYB 4O5LH 2BRRL 4BSVA 1QVOB 4YHML 2OXGA 2JCCF 2BFVH 2NX5A 5JW4Q 1M7IB 4YDJA 2EEAA 1CLOL 4PD4K 43CAB 1DFBL 4O2EB 3VWJC 1CI5A 1JPGA 3ARUA 1QFWH 1ZLVH 4J2XA 2Z4QA 3DSFH 3V95A 4XTRD 5E8NA 5C09B 4MD5B 3QUYC 4WW1A 4GH7B 3NVQA 1P4IL 4AEEA 3X13B 1OTUC 4XCYA 5D2NC 4MDJB 3H9SD 2DM3A 4QRSA 2B39A 2Q76B 1W0VA 2EIZB 3S7GA 1P7QD 3MODL 1UZ8A 2F53A 3MRBB 4WJ5B 4WFED 1JZ7A 4RFOL 3SDCD 3TO4D 4F37F 3T0ED 1OGAD 5I74B 4OCRL 2F54D 1AY1H 2GSGA 4HKXA 4K07A 1PYWB 3KXFA 3EIFA 2CXKA 3D9AH 4PY8I 2NY6B 4Y5VA 3S36H 4Z5RA 1FYTE 2JB5H 2O5YH 4NGHH 1DVFB 2IFGA 2G60H 4FQIH 3HCVB 4KVCH 2UYLA 2JKXA 1JN6A 3TN0C 3UX9B 2JJSA 1PZUB 1G1YA 1SVCP 4JZOB 4NN5B 5TFSL 15C8L 3IKKA 3W11C 3ECBB 2XN9A 4DW2L 3WFEH 1OARL 2PR4H 1Y0LA 3ESUF 5D2NE 1OWRM 2APVA 3RL2A 1WJ3A 4I48B 4AEFA 4QXWA 5GJTL 5SX4H 2YPVL 1ODAA 3MFGB 2H1PH 3DOSA 3WXWH 4Z78B 5GJSH 4O2FA 2W0PA 3C6LA 3MRNB 3E2HC 5GJTH 4F37K 1MVFA 3FAWA 1QSEE 2Z0BA 1FC1A 4Y5YA 1AQDB 1PGRB 1SBSH 1X5IA 1MY7A 2VAJA 5BV7H 2V17L 5DC9B 4ETYA 4MMZC 2YRZA 3U9UA 1QKZL 1FL6A 3DX9B 3L7EA 3WHXB 1J10A 5DD5H 1H3UA 4KXZI 3UMTA 5I66A 1TITA 1UG9A 3AY4C 2J88L 2YMXL 3HI1B 4H1LA 4ZYKB 4ZPVB 4HS6A 3TV3L 5DJAA 3S36L 3MBEB 4BQ6A 4S1DD 3L1OL 5EG6C 2AABL 1XF5B 3K7UA 1HWHB 3VD3A 3WUWG 1OW0C 4PJBE 5JHDA 1IGMH 2CRYA 4NP4L 4P2QE 3L3KB 2DMCA 5IVNA 4JVWA 3RVWD 1MUJB 3VFGL 3WLBB 1ZA3B 2CKNA 5MEQA 2O93L 1ZHBA 1CIDA 2R0ZL 1W0WB 4P2RE 5C8JA 4GKZA 4OKVB 3D69B 5IMKB 5DHYB 3ZDYF 4JPWL 5ALCL 1DN2A 1VB9A 1NLDH 1JFQH 3OXRB 5T1DH 1GAFL 4YNYB 3QEQB 4UOJA 1KB5L 1L7TL 1RUKH 4NJ9L 3T8XA 1JYXA 4HC1A 1UJ3B 3DI3B 3OKDB 2H6PB 4UILH 4HT1L 1NFDE 3MUHL 3PGCB 3ARFA 1DE4A 5B39B 1P4BH 1JPTL 3MRRA 4V1DE 1SJHB 5HGDA 2XY1A 3EW3B 4HHAA 3RHWK 3AM8A 3BHBA 4L5FH 4JFPB 5C9JA 3W5MA 1FO0B 2PXYC 4EIZC 3JWOC 1CBVL 2HLAB 3U82B 5IHUL 4ZUWA 4O4YH 2K7PA 4ODHL 1R0AH 1G9ML 2Z92A 1QSEB 2V5RA 2NY4D 4JHWH 4Z7UE 5FDYA 3P9WB 5CD5C 3WV0A 4C58B 1MFNA 5MEND 1N64L 1T5XB 2R2BB 4LLVA 4Y2DD 3RGHA 3HFML 1MCEA 3SPVB 3FB8B 2A6DA 2HYMA 3U9PH 1KJ3H 5E9DE 1HHJA 4X4XB 5I19L 1UXWB 5FGSA 4UIMB 3MRMB 1J05A 3MYJA 3QA3B 5T3XD 1I9IH 1JNHA 5TF1L 3VFNB 3WO4B 1RZKH 1IGIL 1VHPA 5T1DL 3OGCA 2UVFA 3G6DH 2GQHA 4ZDHB 4POZD 1RJZB 4ACPA 4D3CH 5JHDB 3GEWB 4JN2A 2DYPD 1XF5A 1FNSH 4HD9A 5C08A 1OAQL 3OKNA 1Z0MA 4MNGB 2D0HA 5DJAB 5DS8B 3PWJA 5HDQL 1NGPH 4GBXC 4ZYKA 3KPNA 2YD3A 3FQWB 3OR7B 4PR5B 3UYOD 3V4PL 1CFVL 4OAWB 3DX9A 3EDDA 3ABZA 1C5CL 3HI6H 5M7QA 1AQDA 2VWEE 4M7ZC 2FD6H 3IJYA 4XNUH 4QHUB 4Z7WB 3LD8C 5E4EC 5IMMA 4YIQB 4O2FB 3RTQA 4L1DA 2J88H 5T1KD 5I1EL 1RZ7H 4PJGF 4OCYH 5F72S 2R2HB 1TCMA 2EDDA 4N9GB 1UM5H 5C6TH 1FZKB 1KLUA 3QDAA 3ZMRA 2QEJA 2E7LA 5GGSA 1CE1L 3RVWC 3MLUL 4O58H 1JCKA 4S2SB 2VXSH 3QDGD 1EERB 1KV3A 4JZOA 3F7PC 5SWZB 3PDGA 1WITA 3BGFC 3TZVC 1HHHA 1QSED 3QIBB 4PV9A 2HA1A 1FH5H 4RZCB 1DVFA 1BLNB 2BDNL 1A6VH 2D4DA 3V4UH 4NSKB 1QFWM 1ZVYA 2P8LB 3BGFB 1FJ1B 1GGCH 4I77L 1LEIA 2DQUL 5DURB 4D8PA 4NWTH 2BNRA 2LVCA 1HZHH 4UDUA 2PYFA 3OB0K 3WIFB 5EU5A 4G7VH 2DS4A 3N1MC 1N7MH 1N2RB 1MCOH 1UZ8B 4FQIL 2DTMH 1XF4A 4QRSB 4QHMA 3O9WC 4HFWB 5JUEH 3ULVE 3HKFA 4YGAB 4TULH 3BVNA 1BWWA 3I84A 1AGEB 4MNQD 2XN9E 3MRJB 2F19L 4PJIF 3VFMA 2CLRB 4AMKL 3EDKA 3MRLB 3HG1A 5I17A 2E27L 5IOPB 4O2EA 1F3JA 2X89A 3FB5B 3G5YA 4GBXA 1EVTC 3WYRA 2CDFB 2P5EE 2KZWA 5FUCC 5JR1L 3LKOA 1H15B 1NCWL 1ZANL 2XTJE 3MFFA 3L7FA 2AV1B 4PBVC 4MCYA 2CGRH 4F58H 3VRLE 4L8DA 4U1IB 1HOCA 2ZUQB 4Z95L 1JHKH 3VXPB 3T2NH 5DMKA 1ITBB 4FFZH 4F7CA 3VWKB 4XHQA 1DFBH 5C7XH 1V7NH 4HH9B 4YHKH 3IFOA 3SGDH 5HHMB 2WUBH 5GGTH 2PO6D 1R5VA 5J3HD 5FCSH 1JVKA 3BGMA 4NWTL 1S7RB 4JM4H 1FNGB 4P2CG 3GGWB 4I18C 3U0WH 4XPBH 4I0PB 4N68A 5E1AB 3WHE1 3EOAB 4U3CA 1N8ZB 1EEYA 3PL6B 4LKCA 1RJCA 3WFBL 4RGND 2BSSA 5ACZB 4LHUB 4HSQA 2FHFA 2Q8AL 3RIFK 4WTXA 1YEFH 4C56D 5SWSE 4PFEA 4GRWB 5EDXA 3UTZA 2I27N 2Y1VA 5DC4B 5E1AA 2OP4L 3GMPB 4K71B 2VDKL 2ZPKL 1NCTA 1PZ5B 4DUVA 5EB9A 1K8DA 4P57B 3SO3C 4LSVL 4AL8H 3ROLB 4PJFF 5I6XB 1HWGB 1UM5L 5C6TL 3ZKND 5DXWA 1HNFA 3EYOA 3B9KD 3C8KA 4P4KB 4P5KA 2SEBB 4F7CB 3NIDE 3OV6A 2I5YL 3VXPA 4NNXA 5HI3C 4M93B 3ROOB 3GHEH 2KQNA 1A6PA 1GC1C 3BKJH 4OIIL 4EJ1C 5C2UB 2ZCHL 3O6FD 1K85A 3REVB 1B4JL 4Y19D 4YBHA 3CX5J 5CIPH 1VGEH 1F3JB 2F53E 5TQ0H 1KJMB 4OCXH 4RFNC 4M61A 3I6GB 1P6FA 1A2YA 1TVBA 3IJSA 4OFPA 1AGEA 4WW2F 3KXFE 3SDCB 4JDZB 1FP5A 1CR9H 4QHMB 3LCYA 1R5WB 5C0DB 4KJQD 1YC7A 4JO4L 3DRTA 5I73B 2ATPA 3WIFA 2IAMD 1TJIL 4J8RA 4QEGA 3BZFB 3ZHLA 4ODTL 1EPFA 1RUAH 1I7ZB 3TM6A 2NX5D 4U1NA 4K94L 5FK9A 3VFSB 3DYPA 2Q6WB 4GAYB 1GSMA 1Q0XH 1UC6A 2BVTA 2NZ9C 3HFMH 3OG6B 3RVTC 5CEXA 1EVUA 2V9QA 5GS0D 4JO1L 5F21B 1DN0A 4R9HA 5AD0B 5JDJA 1EHNA 1I9JL 2BY1A 5GRJH 4O00A 2DKMA 5GGSB 1ZLVK 1X3DA 1INDL 2NMSA 4M3KB 1BZ7B 3DX8B 3RWDB 2ZUQC 5L8KB 3C09B 3QNXA 4RWHA 4LLUA 1CBVH 4LF3A 5CP7A 4RGMC 3V5DA 1CXKA 1JHTA 4GT7A 3O3UN 2B2XH 5F7LB 3RTQB 2AGJL 4NC1C 4IDJL 3IJYB 2BVPA 2B4CL 2YXMA 4IHOB 4HT1H 1YN7B 4WO4A 3F62A 4NC0B 5F8QC 2AK1H 4NM8L 4EXKA 5M94B 4B7IA 3H7BB 3O2VL 3FQWA 3OR7A 1L0QA 3T65B 3L6FA 4P0DA 1RJYA 1NC2B 4MNGA 2XG5A 1KTDB 3UDWA 1FRGL 1KB9J 1U3HA 5CS7A 5DI8A 15C8H 4OV5A 1SYVA 3ARGD 3HI5L 2HFTA 4X5LA 5BXFB 1W72B 4F3FB 3FHAA 4R2GC 3S88L 1SM3L 3KPRD 3UXFA 2EDQA 1BVZA 4ZXBC 2OMNA 3ZSSA 2VLJA 3JVGA 2IALB 3CVIL 2A6JB 2W9EL 3MOAL 3MUZ1 3DVGA 3VFNA 3WN5C 5HYFA 2NXYB 3PQYA 5DJ2A 4XMPH 5DSCA 1CU4H 2IPKB 4X6FB 3WIIL 3ZE0F 4JANB 4EN3D 3WN5B 5JQ6L 3D39D 2DDQH 1F4WL 1A0QH 4PJ7F 4UIKL 2HP4A 3F58H 5DGQA 3GSUB 5KVDH 3ZYIA 1MIML 1X7QA 2CDEB 1G6RL 4HUMB 4IMKA 5E08L 4H25A 1U8NA 3C6SB 4MQTB 5GS3A 3NABH 3C60D 4EXPX 1FH5L 4JY4B 2VC2H 1UKSA 3Q3GA 3NFSH 4DVRL 1RIUL 1T6WA 3QQ4B 4NBXB 3RGVD 3UTTD 4B5EA 2HLAA 4Z7UA 3RA7L 1MJJB 3DO7B 1FO0A 4ONFH 2Y72A 1MCSA 3NGBC 2QSQA 5ANME 4MAYA 2VC2L 1QPPA 1UZ6F 5FHBH 5HGDB 1CE1H 4BUHA 1GRWA 2G5BA 1HCFX 1IM3A 3RIAK 1DTUA 3TA3A 2FJFA 1PAMA 4OLYL 5J13C 3V7AG 3DMMD 4GG8A 3S8WA 3N85L 4DK3A 1KIQA 3IXAA 5E0QA 4NHCL 4U1HB 4H0HB 1MWAH 1U93A 1G9EA 2E8YA 5EUOE 5HHMD 2R0LL 3WFHA 3CDGB 4M48H 2XZQH 3OAYK 2X41A 2VXUH 3AUVA 2H32H 3IFLL 1ZHBB 3D6GA 3RVUD 1A7NH 1UXSA 4YDIL 1JPSH 3QXVA 4MWFA 4FQQA 3RJQB 4LDOB 5E5RB 1XMWA 4GFTB 5K93A 4H1LH 8FABB 5JNYA 1ACZA 1KLGB 5SWSA 2JJSC 1IEHA 4MA7H 3UZEA 3F5WB 1A4JA 4FOMA 1S7XB 2FB4H 4XP4L 2VR4A 2W9DH 4NN6B 3EOBA 1FYTA 2HVJB 2AVGA 2E9BA 5I19H 5IEHA 5DTFB 4Y5YB 1QLFA 4YXKL 1IM9B 5KW9H 3P11L 1MAKA 2JK5A 4MD0B 3VH8A 2ZG2A 3C6LB 1QNZH 3QZWA 4M02A 1HHIA 5DC0A 4Z78A 1R3KB 3S5LA 2XXMB 3VD4A 1INDH 4HLZH 3WCYA 1S5IL 3H9YA 4YK4B 3NOIA 5JW5A 3EGSB 2IH3B 3L5WB 4LVNC 4LEXL 3E6HA 2VDMH 5L6YH 4I48A 4P46A 1NCCH 5GS1A 1ZEAL 4MB3A 1H3PL 5SWZD 3LQAC 1B0RA 4FQCL 2J8OA 1IAIH 3OTTA 4BYHA 2XN9B 2ZCKL 1T0PB 3MUJA 3X12B 3VFTB 5IIEA 2RBLA 2BNUA 4AEIL 3E3QC 35C8H 1BFSA 2YS4A 4JRXB 9CGTA 2DI8A 3TYGL 4Z5RB 5DUML 4LEOB 4OLWH 2RFXB 2DQFB 5I8CA 5JXED 2GSGB 1YYLH 1ZHKB 1MFEL 2B4CC 1TQCB 2VDOH 1LP9A 1OD7A 1E4XH 3RZCB 1UCBH 3K2MC 4ZS6C 3TFKD 1JGUH 3RUGE 1TZIA 2Q76A 3IDMB 4NBYB 4H20L 4XCYB 3ARDC 2Y07L 2XA8L 2Y36H 1VDGA 3PWVA 3VFGH 3QQ3A 5E8NB 7FABL 3RKDC 3FCTB 3VH8B 2WIMA 1JF5A 1EFXD 4Y2OA 4PLJC 1QLFB 4DEPC 1JPGB 3S6CA 5F1IA 2EKSB 2VMFA 4YHIB 3EOBB 5KJRH 1XR8A 5IFHH 4PRHE 5AYUH 4LARL 2R8SL 2B0SH 4N90D 1H5BA 4M8QB 4EDWL 5EPMA 4MJIA 5I8KL 1EHXA 4JGJA 3ARVA 4LNRA 3S37L 5IQ9A 3CPLB 3T2QA 5ESVB 8FABA 1ZVSB 3BX7C 3RWIB 3PWPB 5INCA 2YOCA 1FVEB 2X1PA 4CUCA 3N1GC 4MWFB 3GMMA 4GG6B 4WFHD 5FHAH 3ZT7A 3H6JA 4M3JA 1UXSB 3RBGA 1FCCA 5EA0L 2E7MA 2NNAB 3T3PF 1CD8A 3HG1D 5LG1A 4ONGL 4G42B 1OP5K 4JZJB 3WFHB 4NYLA 4LCWD 2V2XB 1YEEL 4KJPD 1U93B 4EN3C 3VG0H 4M6AA 4U1HA 4CBPA 4QLRA 4OQTL 3OKOA 3W5NA 4Z7OE 4OB5L