4M1CC

Crystal structure analysis of fab-bound human insulin degrading enzyme (ide) in complex with amyloid-beta (1-40)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
227
structure length
205
Chain Sequence
b'QLVESGGGLVQPGRLSCAASGFNVSSYSIHWVRQAPGKGLEWVASISSYYGSTSYADSVKGRFTISADTNTAYLQMNSLRDTAVYYCARDRVMYYWSFSKYGYPYGMDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin-degrading enzyme
publication title Crystal Structure Analysis of Fab-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Amyloid-Beta (1-40)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 205
sequence length 227
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1cC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1cC01
2WMPA 3BAEL 4GMTL 3CVHH 2XQYG 3Q6GL 4OTXL 5EU5B 4Z7QE 4PTTB 5IMLB 1BEYH 1RK1A 1NFIB 4HIHA 2E7LC 3B9KC 3LKNB 5IBTL 2P8PA 3F7VB 5T5NG 3C2AL 4ZTPH 5A2IH 2HJLA 1Q1JL 1DEEB 4Z5RB 4CRPA 3OZ9L 5A40E 4P4KC 1L0XA 4ZTOL 3V5HB 1F2XK 3V95A 1A4KA 1OWRM 4LLAA 3W5NA 3O81A 2YXFA 1Q9KA 3DRTB 3MLPA 3QDJD 5JDJA 3QCUH 4E5XA 1OAXL 4PRIA 5E70A 5GS1B 4FQLH 2BMKB 1IQWL 1LVEA 3PABA 3VXUE 4ODUA 4GQ9L 3IJHA 4ORZC 4LBEB 1NKRA 3ARGA 4OQTL 3VG9B 5JOPD 4MGXA 4OZHB 3BESR 4LAJH 1QR1A 1AP2B 3BP4B 2H2PC 2FO4A 5B3NA 1BLNB 1ED3A 2PXYC 2Y6SC 4FQ2H 2ERJC 3QQ4B 4LMQI 4ISVA 3S36X 4WO4B 2ZUUA 3RZCD 1LO4H 1XIWC 3C8HA 2YR3A 3MACH 3QXDB 2YN5A 3ZDYF 4NQCE 1DN0B 4Q6IA 4UINL 3WUZA 4X7FC 2W9DH 2YN3A 3MRFB 4MA3A 4U4BA 2VKWA 3N85H 3O8XC 2M26A 2KBGA 2YSSA 5TE4H 4EI5A 2Q3AA 3PWPD 4OGAC 4MAYA 1CBVL 5GGTH 2PO6C 4AENB 3BVNB 3K81A 5D7IF 5D1ZC 1PW3A 1T5XB 4ZUTB 5FGCB 1AXSA 2BERA 1OARH 5B38G 3IU4L 3FTGA 5TGBA 2IBZY 2JK5B 4NQDD 3X3FL 3TV3H 1RJCA 1LILA 3BW9A 4LGRB 2OZ4A 4F7TB 2BVYA 5CSZA 4OBRA 4M61B 2HFGL 3QWRA 4QRTB 5JO5B 2BRQA 1NGQH 3O2DA 3I85A 3MQIA 1KCSL 5ECJE 1P4BL 3REVA 3H2WA 5IBLD 2IFFL 3RVUC 3VI3F 3NA9H 3JTTA 4WEMB 2BFVH 5HYIA 5K9QI 1KTDB 1O7SA 2HJKA 3T65A 1KNOB 5I6XB 3QUYA 1H8SA 5I16B 1HEZA 2WQRA 3O6KH 4WFED 1I7TA 4P9ML 3RHWF 2D0HA 3WIHA 3VWJC 4JB9L 3EDFA 1IEBB 4PV8B 3P4OB 4AG4L 4JPWL 3DMMC 2ZUQB 1N6UA 3GI8L 3QUKA 4ZFZB 4OZIB 1TJIL 5SX5H 4Y19D 4Y5VA 1AGDB 3I6KA 4POZC 1F2QA 5F71A 5FUOH 3LPFA 3B2UC 4M5ZH 3KAAA 4RMRA 4WUUA 1WC7B 1HINH 3LRSA 3QCVH 2HJFB 1H3VA 3QEQD 4U33A 5EOTA 5I1JH 3BZEB 1JGEB 1AC6A 2VXTL 1Q8MA 3L1OL 3T0BA 5ILTL 3EJJX 3GMLB 3K2UL 4CDHA 3ULUD 2J8OA 5JUEH 2Q7YA 3IB4A 1KTLB 5E4EB 2DQTH 4XNXH 4Z7VF 5J1AA 3X13B 1HKLH 3ULVF 3RI5F 1Q0YH 5B4MD 2E9IA 4G6KL 4TUKH 4IOFC 1E6OH 1T0NA 2X7LA 1OAKL 4P5MB 1R0AH 3SGDI 4KI5F 2X4QA 5B39B 3FJTA 1MAML 3PWNA 4L9LB 25C8H 5F1NB 4DKEH 1ACYH 1VFOA 4FRWA 4XMKH 1UZ8B 4XP5L 1JJUA 3GRWL 3HUJB 4MCYA 2ZUYA 3FT2B 4PV9A 4JN1L 5IB3A 3RAJL 1U93B 2VDLL 1A1NB 1A2YA 2MQCA 1OPGL 3VI4F 1I1CA 1K3IA 1NGYA 4U1KB 3PWLB 1N6QH 2CDEB 4AY0A 1DE4B 4NRZB 2NY4B 5FK9A 1JN6A 1YMMA 1WCBB 5DUPL 3RVTC 3TH4T 2EH8L 3VFVB 1FIGH 4HGWA 4GW5B 4QRPE 4HUNB 4PJIB 4WI8A 2W1NA 2QL1A 4HW6A 4HG4K 2C4XA 4NN6B 3FKUS 1JYXA 4RGNB 1EFXB 2YUVA 4GAFB 4WI5A 1VGKA 4BM7A 4PLJD 2HN7B 1V3MA 5C0BA 4M43H 1E6JH 4N8VA 3U7YH 2VQTA 5E2JA 4Z7UA 2A0LD 2HT4C 3DTXA 1MCKA 4YHLH 1CE1H 1HXYB 1QSFA 1DDHA 1Y18A 1RK0A 1TXKA 2FD6H 4J2XA 3KYMA 1F97A 2FHCA 1ES0B 3D69A 3OGCA 4M5YL 3O6FB 2ICWA 4KAQL 5DRZA 1QEWA 3BPCA 5TE6H 4P4KD 1S7UB 1EV2E 3TBWA 4LGSB 3JV5A 1YEIH 1T0MA 1JPSH 4YAQA 5CGMA 4FFZH 3RWDA 4JFDD 5HHNA 4KVNH 1N59B 4BH8B 4G8EA 1ZLVK 3C60C 5BQ7A 1G7MA 4JEGB 4GH7B 4U3CA 1FIEA 3R0MA 4RFEA 5DHYA 3TO2B 2R2HB 4U0RB 1VADA 4GXUN 2PYFA 4K8RC 3UPRA 4PJGA 4LVHB 3IFNL 4CMHC 3MBXL 2NY0C 4ALAH 3D85B 4G6JL 3M17A 1KJ2B 2XZCH 2OQJA 2PXYD 1CVSC 2Z8RA 4M6AA 5DA4A 4ZPVB 4HC1H 3QPXL 5DZLA 5JXEA 2W9EH 1XIWD 2XT1B 2XKNB 1TMCB 3V4VH 1DFBL 1FNFA 4PJDF 4LPTA 1XH3B 3HA0A 4PB9H 5B8CC 1G1CA 2OI9B 3FFCA 2JIXA 1DQQB 3O8XD 5DRNA 4PGEB 4UU9A 2Q8BL 1O5DT 1U92A 2ESVA 1J1OH 3FO0L 3SGKC 3V6FB 1FO0H 2PO6D 4NZRL 4YO0A 5D1ZD 4HS8H 3WS3B 5FGCE 2EDDA 3ZKMC 2AV1B 1JPFB 4OD1H 4O2FA 1J9CT 2GI7A 1KXQE 4JM4H 4Y16D 2MCPH 4LCWB 5KW9L 4BYHA 1FVEA 4WHTB 1X5GA 3GSWA 4IIQA 5GS2H 2R69H 3DBXB 5EO0A 1YEHH 3U1SH 4ODSH 1E28B 1G9MH 1GGCH 2RB8A 4LSTH 4R7NA 5FHBL 2X4RB 2ORBH 3RWFA 1Z0NA 5EULV 2BOCA 1UWXK 2HVKB 5KS9F 4UQ2B 5A2JH 4GXVL 5IGXH 5F3BB 5T3XH 3O11A 5DLML 3WUWA 1MCLA 1FGNH 3MRPA 3PXHA 4EOWL 1K4CA 4TVPH 4ZFFA 5TE7L 3UC0L 2X4NA 1HQRB 5DWUL 1CFVL 4HIJB 1SYSB 2ZG1A 3VWJD 4UI2A 2OR9L 1YEEL 5DJ8A 2AK4A 2FH8A 4DW2L 1I8KB 4P2QB 1OCWH 3DMMD 3W2DL 1YJDL 2EKSA 5IESL 2AERT 4OZIE 5IFJB 4NCDA 4OT1H 1ZS8B 3JV4A 1GRWA 4POZD 4YQXH 2L0DA 3L5JA 2NXZB 3WE6B 2C3VA 3AGVA 4MLSA 3B2UD 3T0AA 1S5HB 1NCCL 1N2RA 3VDBA 3CVHL 2R15A 1BEYL 5T1KA 5FM4A 3U0TA 3UCRA 2BSSB 5FYJU 5GRVL 4M8QB 1B2WH 4RNRA 2XN9E 2VLKE 4TSBH 3AC0A 1HH9B 1BOGB 5C2BH 2BSRB 1HZHL 3VFUB 2FL5B 3MRGB 5MEPA 4EI6A 2DWDB 2XFXB 3ZDXF 3KPLA 2AABL 2YPLB 1T04B 1QKZL 2ARJB 1HHHA 3GSUB 4WV1A 3DX8B 4BZYA 4ZAKC 3I3EA 4L4VA 4XB8A 3L3IA 3HI6L 4MJ5B 2PCPB 3MMEB 1NGXA 2NY5H 5D93C 3RBSA 4I0KA 4HCRA 2XWBA 1X5AA 4FQLL 1W8NA 3HUJE 4HKJA 4K7PY 2QSCL 4M4RA 3ZYOA 1XFPA 1AQDA 1QPPA 2RBLA 2XI9A 1F90H 3SE3A 2XOTA 1MJUH 4N0FB 1KPVA 4H26B 1A6ZB 3LN4A 4OIAA 4UNVA 3C5JB 4WI6A 2XQBL 3RVTD 5BS0E 1ZT7A 3A67L 5FKAB 2KQMA 1K8IA 5DC9B 4PJIE 1MCPH 3E1F1 5IEHA 3BXNB 4UTAH 3V7MA 3GGWA 1NMBH 2X4TA 3NCEB 3LAFA 2W9DL 3N85L 2BNUA 4FQHB 3VWKC 1INQB 3V2AR 4UILL 3VFMB 2GY5A 3TC9A 2B8OT 2PYEA 4LQFH 4HIEA 5IVOA 5SWSA 4BK4A 2HT4D 5ETUA 1RI8A 4QHLA 5KSBA 3EYOA 4HPOH 1QBMH 3STZA 1IC7H 1UM4L 3FB8B 6FABH 2FCBA 4RQQA 3AAZB 1P2CA 4QWWD 3EGSA 1A7NH 3H9HB 4WFGD 4ZS6C 1FYTD 1KIRB 2X89A 4JFHE 2A6DA 4PFEA 1AY1H 1DQDH 1T5WA 3RY5A 2Z91B 1ZLUH 4IS6B 3HFMH 5E99H 4W6XB 3Q6FB 3UMTA 3D5OF 3IF1A 4ZO6A 3NA9L 2BFVL 4Y5YA 1B3JA 4JREB 4NNXB 4FXKA 1UXWA 1RQ5A 3D25A 3ARFB 4HV8B 3LS4H 3PE9A 2EH7L 3D9AH 5HJ3B 4Z78A 2IPUK 3QSKB 4FZEH 4LGPB 1B6UA 4I18A 5FA4B 1CQKA 5KTEH 4XBEL 2VC2H 3U7WH 3M45A 2DQFB 4CAGA 3OKLA 5C07D 4R7DB 1UM6H 3CSGA 1CF8L 3JTSB 3RL2A 3OAZK 3U4BH 3VD5A 2FIKA 4WW2F 2K7PA 1SJEA 1C1EL 4Z0XB 1JNHB 2VDOL 5IROA 3AU1A 5D7LD 4P99A 3ZKXC 1AO7D 1PKQB 2AJVH 3LVEA 2H32B 3T4AA 3BP7B 3UJJH 1EEYA 4OBSA 3MRNB 5C0JA 3RFZC 1HINL 4NO2B 1ZEAL 2DL2A 2P5WB 4OLUH 1QSEB 3QCVL 3NH7H 3O3EB 3ZE2F 3DIFA 2LABA 3MLXL 1UXSA 4IMKC 1AGBA 2NZ9D 4HT1H 4KJQD 3BKMH 3UTSE 3TBSB 3WV0A 4MX7B 4UB0H 3S96A 4N8CL 4IRJC 2NW2B 4NWUH 4J3XA 3CLFL 1OLZA 4BKLA 3ZHKA 4KMLB 1R0AL 3HE6D 1JUFB 4IMLA 5JPMA 2D9CA 1MHEA 3CCHB 3IDXH 1N0XL 5DD6A 4WWKB 2AJZB 3CDGA 5ISZB 3UTPD 25C8L 4LCWE 4DKEL 5HDBF 4R96A 1U9KA 2AEQH 4XMKL 2VL5B 1T3FA 2NX5B 2ZSWA 4Y4KB 2YC1B 2CR6A 3F58H 3TGXA 3LKRB 5K9KB 5HHOD 2P7TA 5F44A 4Y2DB 3ULVL 2V17L 3CJJA 2Z93B 3QDGA 1TQCB 2IGFH 5HPOA 1VDGA 3SGEH 5C09D 3MNWA 2DQJL 4O9HH 4FTVD 3IJSB 1FIGL 2WM0A 1KIUA 4HXAH 4YJZL 5CKGA 3G5VA 5EU3A 4P2QE 3WKNA 3R1GH 3WSQL 1IMHC 4D9QD 2ICCA 4LLUB 4O00A 1E6JL 3QIWA 3VDCA 2IBZX 1LE5A 5MERB 2CDFB 1OAUH 1E4WH 1CE1L 1MHHA 3DVNB 4X4XB 4PRBA 2QQQA 3H9SE 4F80A 1M71B 2FD6L 1FVCA 4Z7NF 5BVJA 3NA4A 3ARZA 5BOZG 2D03H 3O4OB 1NLDH 4G8GB 3BEVB 3P0VH 1FFNA 1J5OH 2MPAH 3OB8A 2Z4QA 1BBDL 4KPHL 2B0SL 2NY6B 1DUZB 2YPLE 3U4EA 3MLUH 4XP4H 1ZVSA 3S9DB 4ZAKD 5DI8B 1NGWA 4FFZL 1U3YA 3KPNB 3FN0H 1A6UL 4LRNH 2GCYB 4IBLT 1DVFA 4V1DA 5KANI 1IAMA 3FB5B 1JE6A 4G6MH 5C0IA 1ITCA 1NCDH 2BNQE 3QHFH 3BQUA 2CDGB 2V2TA 3TBTB 1LK2A 1YMHB 1NCBL 2IAMC 4JQVC 1VESA 2EYSB 1RK1B 4PIRF 2N7BA 3T4YB 5LQBH 4X5XA 4ZYKA 5HHMB 3VXMD 1CXFA 4LVEA 2W9EL 3EOBA 1S7WB 2HJLB 3PWVB 4LPWA 4NQVA 3EYVA 2AJUH 3CFKB 3QUZC 2DKUA 4I77L 4UOW1 2A74A 3UDWC 1A6AB 2NY2B 3VXNA 1PGRB 3VWKD 3SDDA 4L8DA 5BV7C 3P30H 1J1OL 3ARTA 3SOBH 4HKBA 3B6SA 2VB5A 3WIIL 5ANMA 3QO1A 1DBBH 1FO0L 4OZFG 4P59H 4X6EB 2UWEF 3IVKB 1DQMH 1ORSA 5DEGA 1C5BL 4HS8L 2C3XA 1Q9KB 2NYYD 3O41B 4BUHA 1HIMH 4LPVA 3MLVH 4UBDC 4OD1L 4PRIB 3VRLE 2FR4A 3UTTD 3ECBB 4JDTL 2OM5A 4ODUB 3IJHB 5HGHA 2MCPL 3VFWA 1XF2B 4N8PA 1I7RA 3ARGB 2RJMA 2YD6A 4JKMA 4IRSC 1I4FA 1HE7A 1XGTA 1YEHL 1BQHB 1X5JA 1QR1B 4HXBH 3U1SL 1G9ML 5E2UL 4LSTL 1ED3B 4AIZA 3U0WH 1X5XA 4HS3A 3WKML 2ORBL 4NHCH 4PJEF 4M7LH 4XPHL 5I76A 4UT6L 3RUGF 1I1RA 4RA0C 1A1MB 1FZJA 1WGOA 4Q6IB 1C7SA 1FGNL 4Z7VA 4O2EB 4M93B 4TVPL 5D6CB 4GS7B 3IYLW 4YH6A 2R2EB 5DR5L 2V5RA 4WGWB 2PETA 4GKZA 4MA3B 2GJ6B 2F54A 3CFEA 4XWOC 4LPUA 1KPUA 4YR6A 2Z92B 4JM2C 4U1HA 2YSSB 4RRPG 4R8WH 1WSST 4Z18A 4EI5B 4HPYL 4L3EE 4YHKL 4R4NC 3TPKA 4MB4A 3W9DA 5FYKE 4WDIA 3SGJA 2HP4A 2GJZA 5DQ9A 3FTGB 5TGBB 1A02N 3HKFA 5F7WC 5C0DA 3VXRD 4BSVA 1PKQE 4WNQB 1OAQL 3AY4A 5GS0H 3MO1B 1U8IB 3MNVA 5K9OA 1D9KA 2X4OB 1A6WH 4QHNA 1QSEE 4PGCB 2GK0B 4U7KA 4LLQB 3AREC 3REVB 3NPSC 4NC2B 3RNKA 4TSBL 2G5BA 1A7BA 2XXMB 4K7PL 5FYLD 3BT2H 4X6DB 3LQAC 4IRJD 2IF7A 3ZMRA 3CFCL 3QUYB 4KK6D 3K0WA 3IFPA 3PP3K 4YPJA 1MWAH 3EFFA 2J7LA 4NC1E 4WI4A 2NMSA 4RMQA 4QXWA 5C08D 3WS6C 2IALA 3LH2L 1EHAA 2HWZL 4WFFE 1MHPH 4QXUH 3PQYD 4MHHG 5ISZE 3OQ3B 2NY5L 4M7LT 2DYPD 2BOBB 4K9EC 1DLFH 1QG3A 2EDXA 3BPOC 4A6YH 7CGTA 5DHVH 3IDYC 5ACZA 5DQDH 4QXGL 1QLFA 3JV6B 3EOAA 3HPLA 1MJUL 4NKOA 4CKVX 4OUUA 4WUUB 5JDSA 1HYRC 3NCFB 2CLVA 1KEGH 5D1XC 3LKPA 2EE6A 5DJXA 5C0CA 3DECA 4CN4A 4P49A 4I3SH 2X1PA 3ZTJG 1J05A 5TDPB 1LEGA 3FHQA 3QDHA 4OM0H 1NBYA 2BK8A 4M1CC 3QNXA 4WCYH 1MCPL 4EQ3A 5J1AB 4HKXA 3TT1H 3U36A 1NAMA 2QADB 3HAEB 1T0NB 3FQTA 4K3JH 3T3ME 1AR1D 4X9IA 2X4QB 1MHCA 2Y7QA 4N90D 3LKQA 4LQFL 2CKBH 1SYVB 3CLEH 5CUSL 1U3JA 4TNWF 5D9SB 1LO3L 3ZE0E 2XZZA 4HPOL 2PTVA 4WTZA 3S5LB 3EYSL 4WIQA 1MNUL 1J87A 3ORJA 4MCYB 6FABL 4HLJA 1V05A 3NFNB 3ARXA 3C5ZA 3QG6A 2XKUA 2P5ED 1NGYB 1AY1L 1DQDL 1X5IA 3FCTA 5FK9B 3F6LA 3CK0H 4PJDA 4PY7A 4R0LC 1CGWA 1U8OA 3BPNB 2BP3A 5GGVH 3DUUA 4WI9A 2XWJB 5A3IC 4P3DB 2J4WH 1F58L 4FZEL 1VGKB 3TIDA 3U7WL 5L7XH 4KGLA 2DI8A 1OOAA 2H8PA 4N1CA 5C0BB 4N8VB 5IHZA 1UM6L 4UV7H 4JDZB 3U4BL 3F7QA 4YXKH 1I8IA 3P9MA 4S10A 5I1EH 2EC9T 2IAMD 1DDHB 1HNGA 3ARDD 1Y18B 1IAKA 5KSAA 5GGVY 2BVPA 5IVNA 2AJVL 3DVGA 3LRGA 4R6UA 2GT9B 4HK3J 3RJQB 3UTZA 1VKXA 4QLRA 1C12A 5I8EA 5C7XH 1FL3A 5HHME 5L8KB 5BVPH 4MQXD 2NY3B 3MROA 5MEQA 1KGCD 1KLFA 3ULUF 4JRXD 3CMOL 1FNGB 2W9LA 5KS9A 3OGCB 1A21A 5MEOA 2ICWB 1JL8A 3FONB 3QUZD 1X3DA 5FOBA 1EAPA 3SCMA 3BKML 3OTTA 2GTWB 3KVQA 4UB0L 1T0MB 4NBXB 2D7TH 4NWUL 2AKRA 4WU5A 4YAQB 5B3JF 5HY9B 1MI5D 1A6TB 5F7DA 5F6IB 5IKCB 3SO3C 3FRPA 3WHXB 1A4JB 4NNYB 2OP4H 4PRNA 3VRIA 3H8NA 4PJ8C 1ZV5A 4P23C 3KDMA 4K7PX 4RFEB 5DHYB 3SN6N 2V9TA 4N1EA 4IRSD 1KN2H 1PZ5B 3UPRB 4PJGB 4WI3A 3CDYA 1A9BA 3I2CH 4GAGH 3F58L 5JIIA 3STLA 2GAZA 4G9FA 5CZVH 3M17B 3KLDA 3CH1A 5IIEA 4L8CB 5HHXH 2X1XR 3LY6A 4OAWB 4Y8DC 3WN5C 2FJHB 2EO1A 4WUKH 4HWBL 2PW2A 5IJKA 1A0QH 4AQ1B 3NFPA 5INCB 4YFDB 4GG6B 5F7FA 2XTJC 3BKCH 3VH8A 3D0LA 2GJ6E 2VIRA 3MXVH 1FVDA 4HXAL 3WDHA 5DRNB 5A2KH 4UU9B 4XWOD 1F6AA 1XF5A 4JM2D 1Z9MA 4U1SB 1AR2A 5SV3A 3W0WD 3KYKH 1N8ZA 3R1GL 2ARJQ 4PP1C 1P4LA 5ACLA 3BD3A 3EFDL 1OF2A 1UENA 1B90A 1MCSA 4MD4A 4YXHL 3V9FA 4O2FB 4U1IA 4OCWH 4JJ5A 3BGMB 1QSZA 1UWXH 4PJHE 2IBGA 5IB1A 5DURB 2Y06H 5ACMA 1T89C 3EW3B 1FVEB 1B0GB 3GSWB 3S7GA 1QFUL 5EO0B 5C6PB 3OJMB 2HFFA 2VZOA 4QRRB 3HC4H 2VAJA 1I7ZA 3DHJA 3ARED 1CLZH 2H41A 3U30C 3RWFB 1ONQB 2D03L 1N3NA 2VR4A 4X6DE 3P0VL 5EIVA 1RULL 5D7JA 3TN0B 5IWLA 2ICWI 4EBQH 3O11B 3QQ9D 3O4LA 1NEZA 3MRPB 3W39A 3MLSH 1A22B 3T0EC 1UKQA 3OKNA 4FFVC 4XPAL 1MLCA 1I1YB 4R90L 4FNLH 4MQTB 2R23B 3ZYZA 2AK4B 3H42H 5DJAA 4YHYB 1T20A 3H7BA 4G6ML 2EKSB 3UBXI 2A9NH 4NN7B 4P2RE 1M6OA 3U82B 1BZ7A 3JV4B 2EDEA 3QHFL 3GSQA 4WI7A 5EU6B 3WL9B 4R26H 1JNNL 4I9WE 3W9EA 4C59B 1N2RB 4XP6L 3RDTB 2VE6A 5D1XD 1NUFA 3U0TB 5LQBL 3AXLA 3HZVA 2P46B 5I1HL 4HAFA 5IVXF 4RNRB 3MXWL 2G9HB 1QRNA 4F15C 1KENH 1MUJB 4M1CD 5TF1H 4HUUB 3K2MC 2AJUL 5GISL 4TUOA 4Z6AT 2CIIB 1ZAGA 43C9A 4HUWA 5MEPB 5TH2A 4EI6B 3KPLB 3KPMB 2CK0H 3F6IA 4WV1B 4GRLC 4NT6B 5ELIA 4L4VB 3MGOA 3OF6A 1NGXB 3MLVL 4E41A 2XWBB 4YC2B 2H3NB 4ODBD 5HTSA 3OR7A 4WW2A 1QFWL 2FO1A 1ZA3B 2A83B 4XHQA 4FQXA 1WT5A 3FQNB 1G0YR 1NBVL 4QXTB 1EIBA 1HSAA 4R2GB 1UZ6F 1HSBA 5I1KL 3K1KC 3QQNA 1HHKA 1BWMA 5HGDA 1YQVH 4LHUG 1MQKH 3REWA 1YEDA 4M7LL 4KWUA 4RISH 4YGVA 5IFAH 4OV5A 1IGTA 1NLBL 4WY7H 3WHE1 3MOBL 1YEFH 4LCCC 1AI1L 2E9BA 3MV7A 5IEHB 5F9OL 5A3ID 4Z7OE 3GGWB 1IJ9A 1J88A 3I02A 4H20L 4HF5H 4JFEE 5GSVB 3MLTA 5EORH 2ZSVB 4GRWB 2BNUB 4HWBA 5IB2A 1BQUA 1FZKB 2R4SH 1G7LA 4R8WL 5C0BE 4HIEB 4FQJL 2OCFD 3WLBA 5KAQF 2V2XB 4JY5H 2ENYA 1KIPA 1Q72H 1QLRB 2MNUA 2P4AB 4M3KB 4U1JA 5KSVB 3DSFH 1G9NH 4JO1H 3SDCA 1BVKA 2YA1A 2CUMA 2I5YL 4MXVF 3QIUD 4OFPA 5E8NA 1JTOA 2CLZA 4FOMA 5FDWB 3MREB 1VFMA 2NY1B 1A6WL 4RMSA 4XCFH 5HGAA 2X42A 1JV5B 4A2MA 1CR9L 4M7JH 4KHTL 1JNLL 3QIBA 2H1PH 2IPUG 2W92A 3KS0H 4PJ7B 1JMXA 2FATH 2YPVH 4Y5YB 2OTUB 4PJ9B 2B4CC 5FO7B 1UXWB 1SQ2N 5LXGH 1I8LA 3DX6A 5T3ZD 1VHPA 3WFCH 3G9AB 1MWAL 5DFVC 1CGSH 2XWTA 5F97E 1MAJA 5DD3L 3TZVB 2P8MB 4X8XA 4S1QH 1UWGL 1F3JB 1KB9K 3N9GH 3OKLB 5EZLA 4P23D 4CN6A 4FFWC 1ULVA 2K9UA 32C2B 1ADQL 1N7MH 4KI1A 1DLFL 1SJEB 4A6YL 3ARBA 5DQDL 3O9WC 1T6WA 2JJSA 1CG9B 4QOKB 2VLME 5C0AB 5I71B 2CUHA 3MODH 4C56A 5C0JB 1KEGL 3MFGB 1PX4A 2GITB 5I9QC 3P4LA 5H2BA 4GG6E 5E2TL 3EJZC 1AGBB 4OM0L 1NFDF 2XTJD 4ORGB 4ODWA 3CVHB 4WCYL 1J8HD 3WMSA 1VFBB 4X9FA 4D8PA 3MV8D 5F8QC 5IW6A 3DROA 5FUCC 5SWZA 1YEJH 4I4WA 4ZUUA 2DQEH 4JHWH 1RUKH 4PP1D 3V5KA 1D5IH 1JZ5A 2Z31A 4HUKB 4MA1B 4IMLB 2CKBL 3CLEL 2FX7H 1MHEB 1UH4A 3WLWC 1SHMA 3IKCA 3S35L 1R3LA 3BGFC 5F1SA 5I1DB 3TESA 2VDKL 1T3FB 2EZ0D 2J88H 3QNZB 2DQCL 1U2HA 5D72H 3KXFA 3SY0A 4D0BA 5E94A 2B1AL 1IARB 4KZDH 3OAYH 4QRRE 1G1YA 5LGHH 4XCEA 2P7TB 3BEWA 1S9KC 1CFBA 3TO4B 3QDGB 1YN7A 4P2OA 3MNWB 2A73A 3O3UN 1IFHH 5LBSL 5EG6C 4IM8A 3T0ED 5JOEA 5IEKA 1S7TB 4FFVD 4HSQA 5GGVL 2CPCA 1U3HC 1KF9B 1W2KT 4CNIA 3OKKA 3MJ8A 3GJFH 2DIBA 3G5VB 4U6HB 5DZOA 5EU3B 1RVFH 2F8OA 5HDLA 1TZIA 3CDCA 1I85A 5L7XL 1VCAA 1GH7A 1NC2B 4KRPB 2NW3A 5HXMA 3QIWB 4ELKA 4QRSA 1LE5B 4UV7L 5F7EH 5EU6E 4QEGA 4OGXL 4HMEA 3O45A 1JBJA 1MH5A 3ZDZF 1FVCB 4WW1B 3UJIH 1JZ8A 5FGBA 3VXSB 5BVPL 2JF1A 4A2LA 4J8RA 4KROB 3FQXA 1ZHKB 5FYJE 1DBJL 4C58B 1FFNB 4JKPH 3K4DA 1OTUC 1QFWM 1ZT4B 3RUGA 4NO0B 2IAND 1FFPA 4XAWL 1JHKL 3V4UH 3BP5B 5D2NB 3U4EB 3EYFA 3F7YB 2D7TL 3OBAA 1ZVSB 4GRLD 4JFPA 4PREA 3ZT7A 4L4VE 3IETA 2VZ1A 1OGAA 1ZMYA 4GBXB 4G7VL 1IT9H 4F9LA 1U6AH 1DVFB 1GYAA 5D7IB 1R3HA 2N56A 4PG9B 2OL3H 4V1DB 3NOIA 4BFGA 4L8SA 2V5SA 1EDQA 3D2UA 4YFLF 3ULUL 1ZVHA 1NDMB 3BQUB 2V2TB 1X6NA 4NM8H 4TQEH 3OB0H 1G6RH 5FB8A 3I2CL 1KJVB 2PTTA 4GKSB 1CZ8L 2ZJSH 3T3PF 1EUUA 5FHAL 5D1QC 3TPUA 5CEZE 1ADQA 5HHXL 3OJDA 4X5XB 3U79A 3DWTA 2VJXA 2X4SB 4ZXBC 3EYVB 2ZCKH 1S8DB 1P4IL 1I9RL 1I1FA 3VG0L 2FX8H 2A74B 3E8UH 3ETBF 4G80A 4GRWE 4X99B 3VXNB 4LHUD 4JZJC 1MFEH 2YUZA 3BIKA 4L8DB 3WNMA 1UFUA 4FS0A 3NAAH 3T2PA 4FABH 2LU3A 4HKBB 3B6SB 5ANMB 3QO1B 1KYOK 4NHUB 3QDJA 1ORSB 2BNRD 5DEGB 1OW0A 4KRLB 1P7KA 4RIRA 4OCWL 2G60H 1B6DA 3VFWB 4B50A 4C83B 1V7NL 1UM5L 1I4FB 2EIBA 2X4UB 1EBPA 5HYSG 5HVWA 4YHZH 3HG1A 4PLKC 5JW3L 3V7AG 4PRAA 4PJ7E 4AIZB 1C16B 4MNQE 3RZCA 5IK3B 3S35X 5J13B 1LP9E 4PJXE 5I76B 2IWGA 4EBQL 1FGVL 5CJBA 2OK0H 4Z7VB 4J4PA 4KFZC 4GAYB 1BJ1H 3MLSL 1WIUA 1QFOA 1OT2A 4KTEH 5DFVD 1IQDA 3KLAB 3S8WA 3PWPA 2QQLL 4FNLL 1Q94B 3RGVD 1BFTA 3D39E 4PGJA 4FFWD 4LSPL 2UZIH 4X7DC 4WDIB 1P53A 4NQDA 1M7XA 2EXYC 5BZWB 5C0NC 4E42A 3PDOA 5C0DB 2R2BB 3O9WD 3TIEB 1RZJH 4JFXA 2DL9A 4KKAC 4QOKE 5C0AE 3L3GA 2OSLA 3OKOA 4KK9D 1CT8A 1D9KB 3HC3H 3PP3H 4QHNB 4YBHA 3RNQA 1KIQB 1NBQA 4WFHD 4G3YH 4M7KH 1IGYB 3EJZD 3UXFA 4ZPTA 1YPZA 2O26U 1KENL 5FO9B 4LDOB 3GDBA 4JVWA 4OF5A 3GUTB 4JQXC 5CINL 1SM3H 4D2NA 4KVCH 3HZMA 1GPOL 2CK0L 2V7HA 3OXSA 1Q9OA 2IALB 3FOLA 3SKJH 1SBBA 4KK8C 3RKPA 4YDLB 5DA0B 2B5IB 4GMSH 3OKMA 5GHWL 1RUQL 1WTLA 2AJ3B 4Y19A 5JORA 5JHDA 4KQ3L 3VFSA 5E08H 1KPRA 5ACZB 2J8UE 1QLFB 3JBG7 3EOAB 3HPLB 4GRMA 3QUML 4BH7B 4OUUB 3CZFA 4YXLL 3QEQA 3BZ4A 4NPYA 3PP4H 5E8EA 4BSWB 4ZOCA 3V6OE 3LKPB 2PF6A 3AMLA 5DJXB 5C0CB 5IHLB 3CC5A 2CXKA 1YQVL 3J7HA 4JHBA 1MQKL 4JPVH 4X7EC 3OG6B 4WY7L 1YEFL 3BJLA 3QNXB 1U3HD 5GS1C 4HKXB 1AGCB 5K93A 3WJLA 3U36B 3V52H 1JZ3A 1KB5A 4HZAA 1UJTA 3VG9C 2HKHL 3IGAA 2R4SL 3PWUA 1P6AB 1MHCB 2H2SC 1F3DH 5D8JH 2DMKA 1UYWH 3QUXD 5IP4A 5CJ8A 3NBNA 3Q5OA 5E00B 1Q72L 3AM8C 2P24A 1RUPL 1X5KA 1I3GL 4WO4C 2DTSA 3AS1A 3DSFL 3VD3A 1FO0B 4NQCD 4XC1H 1RY7B 4MZ3A 4QYOA 3VXSE 4X4YA 1MCJA 4K2UH 3C5ZB 3QG6B 5T5FL 4M7JL 1FAIH 1NSNH 4KC3B 4P3CH 2H1PL 3FT3A 2ATPA 2AXGA 3FCTB 3ILQC 4NRYA 4NZUH 4I1NB 4PJDB 3MGTA 3FO2A 2FATL 1M4KA 2YPVL 4WHYG 5D2NE 4HH9B 4DVRH 4PR5A 3DI3B 4JFZH 4HG4J 3DUUB 5EZJB 4Q97A 4JRWA 4J1UB 3RL1B 1R5VA 4QT5A 3PGFL 4YDKL 1CGSL 3H0TA 5JXAL 3I50H 5D7IE 3TFKC 4JZOB 4S1QL 1WBYA 2N7AA 2H8PB 5LJYH 5EUOE 2XY2A 2BXYA 5IHZB 1HH6A 1Q0XL 2AJXL 1N7ML 2VAAA 3P9MB 1W72H 4MXWH 1E4KC 3Q3GA 3MYJA 4XZUB 1IC4H 1IAKB 5KSAB 4UUJB 2E7LA 1YUHB 2BVPB 5I6XC 3DVGB 3BX7C 4F8QA 5CZXC 1VKXB 5D1QD 1AGEA 1JPTL 4KKCC 4NO3B 1FL3B 1L0YA 4TNVK 3MROB 4ZXBD 1H0DB 1W8OA 3EUUA 5KS9B 4P4KA 3VFTA 4YHIA 1EAPB 1CD1A 2A1WH 5JQ6L 2FEEL 3A6BL 3LPGA 2YD5A 2ZUQC 4NKDA 2VLRB 2ZUSA 3OKEA 1RZ7L 1ZANH 4WU5B 5BW7C 1FSKB 1URLA 5I8CA 1PKOA 2DQEL 4JHWL 5F7DB 1JTPA 3T1WA 4YIQA 1K9TA 4S1SH 4PRNB 3VRIB 4MYWB 3QG7L 5CP3A 5EC2A 3SDAB 1FCGA 3SQBA 4XMLL 1IGJB 1WF5A 3H3KA 1JF6A 1U8HA 3LS5H 5B39G 4NZDA 4D9LH 5D72L 1CICC 4BQ8A 1YQ2A 2PXYA 4XP9H 5E4EC 3FAXA 4K94C 3L3JB 5LGHL 1F4WH 4G9FB 1NMCB 2B7DT 4MD0A 3QXWA 1F8TH 3FFCD 3CH1B 2HTLC 1XIWA 2JIXD 2XZAH 4RMUA 2DF3A 5IVXA 3GMPA 5MP6L 2CH8A 1VPOH 5DC4B 3QI9C 4L5FH 5MI0B 3IAGC 1IAIH 3CSYA 3QUMA 3O8XA 4L9LC 4G6AC 3BHBB 3D0LB 3VH8B 5IOPA 2I60H 2VIRB 5C71A 1FVDB 1NC4D 4OGYH 1CL7L 5EOCJ 1F6AB 2PO6A 4HEPG 5D1ZA 1C5DA 4OV6F 4UMGA 5IMMA 3HLAA 1EJ6A 1P4LB 4I3RL 3CNKA 1OF2B 1MFDL 2EXYD 5C0ND 1KJ3H 4G6FB 1FFOA 2P43B 4HK0A 1P9MC 4U1IB 1WAAE 4K3EH 3WXWL 5IB1B 2YD7A 2FHBA 5F7EL 3MRIB 5B38A 5ESVB 4NQXA 2MQ0A 3GNMH 4E0RA 3VI4E 3DNKA 4JRYE 4QRPD 2HFFB 1K5NB 5HHVH 5KSUA 1I7ZB 2ZOKA 1OD9A 1N3NB 4NFBA 4ONHA 5D7JB 2F5AL 3W39B 4PJ5D 4I3GA 1BFOA 4ELMF 3GMMA 1TCMA 1V7MH 3VWJA 2NXYD 3T1FB 3NMEA 4XPGH 3DMMA 1IT9L 4D94A 5DJAB 3DX7A 3UO1H 5T1KD 3DHMA 3O3DB 1JWUA 5A1AA 3KWWB 1LK3L 3L5XL 5DD1L 5DJDA 1MJJA 1U8JA 3O6FC 1FJ1A 3I6LE 3RA7L 1OLLA 4Q9BA 4NM8L 3BRGC 4DZ8B 1Y6NR 2VE6B 4JN2A 5F9JA 5A16B 4NQEB 5C0CE 1P7HL 4DN3L 4KY1H 1JK8B 3AXLB 3IDIA 1X5YA 2HH0H 4J3UA 3K8LA 1QRNB 3CZJA 5E03A 1KJ2H 2A38A 3TF7C 3EJYC 4H25A 4TUOB 1KJMA 2FX8L 1WWWX 4JM2F 4ZO9A 4U0RC 5TH2B 3E8UL 4XNMA 1U8QA 2YMXH 4MJIA 4X7CC 1MFEL 2H2SD 4LVHC 4PJFA 5E2VL 5J9PB 3LKOA 3MGOB 3OKYA 4DQOL 1QBLL 3H6JA 3M8OH 3IDJA 5GGRA 4WO4D 1SJXA 2C9AA 4WW2B 2G60L 2SEBB 3HMXH 4OF3A 4Y1AA 1R5WB 4NGHL 3M07A 5IB4A 3KLSA 5DJCA 1HSAB 4QGYA 5F96H 3T08A 4LLWA 5DTFA 1A6PA 4YHZL 5DRXB 3JZ7A 4PYHA 1EA9C 1HHKB 4OLVL 5HGDB 3DURB 4PJDE 3GSXB 3MRDA 3REWB 5HYEA 3SE9L 4PJCE 1YEDB 4YGVB 2PYED 5ESAB 4OV5B 1NFDA 3IJYB 4YBLC 1GC1H 3MV7B 1PEZA 1S9XB 3I02B 3MLRL 4KTEL 1T66C 1EEZA 3TFKD 2VMFA 4PRPD 5FIEA 2A9ML 3V8OA 1HYSD 1QFHA 5DJ6B 3WLBB 3ROOA 1NQBA 4TVPE 2UZIL 4APQC 4U0QB 3C9NB 1LNUA 1F02I 1W0YT 1GC1C 2EE3A 4KHXH 1RJYB 5H94A 2JB5H 5DS8A 5JIKA 2YD9A 3ILPB 5C70A 1RZJL 1FYTA 1BVKB 5CZXD 5E8NB 4KKCD 4YWGH 5TDNB 5M95B 3HC3L 4NUGL 5J11C 2ZCLH 3MV01 4Q9QL 5EUKB 5KS9E 4LIQL 4OKDA 4G3YL 2L4OA 4M7KL 4NO5A 5I8OL 3KPPA 3OV6A 2DQIH 1DBKH 4B53A 3I75A 1P5VA 1BX2B 2Y36L 1I3UA 2VLRE 4WU7A 3IDGB 3DX6B 5E6ZA 5I19H 2LQRA 2AK1H 4KVCL 4ZUWA 1MLBA 3BYTA 3SKMA 2D2OA 4J3VA 5C07A 2XWTB 1QVOA 5TFSH 3SDYH 5C6TL 3VA2C 3TBYA 5D7SH 2FX9H 1MCQA 1N64H 3TM6A 2Q76A 4HUVA 4PJAF 3QCTH 4CVXA 3I3DA 2XN9D 2V9QA 3G6JE 5D7LA 1AO7A 2VLKD 1CICD 3N1FC 4GSDH 5CIPH 4G9FE 1BGXH 5L9DH 5L2KB 2HTLD 3BIAX 2KZ1B 3PP4L 4R3SA 4ZODA 5DVKA 3GBLA 1UJ3B 5FKPA 5B8CA 3GMNA 3CFDA 3IRZA 3QI9D 5H2BB 3F7PC 1AC0A 3H3BC 4G6AD 3SGKA 4ODWB 4M6NH 3TJHD 3I6GB 4OJFL 1TVHB 3MJ9L 3QFDA 4N0UA 4XAKE 4D8PB 3L6FB 1UACL 3DO7B 1QO3A 3V52L 1QNZH 3HE6A 4I4WB 1Z9OA 3V5KB 1R3KA 3WNPA 1T21B 1IC5H 3L7FA 2N4IA 2Z31B 4KJPC 2RGSA 5I1GH 3BWUC 1LEKB 1UYWL 2I07A 4JCMA 4M3JA 3FQWA 1R3LB 4KDWA 5BS0D 4FFYH 4LU5H 5HHOA 3SY0B 4D0BB 3KXFB 4DKFH 5E94B 5DK0B 5AAMA 4XCEB 3ZYIA 2CQVA 1KG0B 1EFXD 5HPMA 2EYTB 5C09A 2AXFA 4Q2ZA 5GJSH 4FTVA 2MWCA 4P2OB 1YN6A 1T7ZA 2YOCA 2XXCB 5CSBA 1RZGA 3V4PH 2RFXB 2DLFH 4DVRL 5IEKB 1DZBA 1HQ4A 2WK2A 4H5SA 3L95A 3MJ8B 4H1LH 4IRZL 4DJMA 3HS0A 5HGBB 3JWDH 4OD3L 2UWEB 3I50L 4KK5C 4P9HH 2NTFB 4YPGA 4ZFGL 1LEIA 4CU8A 4JDVA 4QKXB 2DQHH 1CQYA 3ES6B 3KPRB 4KDVA 4D9RE 1T03H 4ELKB 3M1BB 4DGYH 4Z77A 5F9DC 1W72L 4MXWL 1DQJB 1J12A 2P45B 1K3ZA 2MHAA 1ZGLP 5T3ZH 1RZKH 4NQEE 5FO8A 4P5KA 3CMGA 3D0VA 4LLVA 3NCYP 3ARFC 43CAA 2R1WA 2OMNA 4DCQB 3VXOB 5F9AC 4TSAH 1QRNE 4JFYB 3RGHA 3EJYD 3D87B 1PJ9A 2BCKB 2ZUWA 3DVFA 4PJEB 1TENA 4P48A 4LARH 4Y88A 3OHXB 2A1WL 3FRUA 4NKIL 4ZAKA 4OCXL 3EYFB 2A6IA 4JFPB 2BRRL 4PREB 1VACB 1FORH 2W65A 1X5LA 2LAAA 4HWUA 3VXPA 2K3TA 2OLDA 4IHOA 3MR9A 3L5HA 1IGIH 3BH9A 1NGZA 5LCVH 4L8SB 4PPTA 4H8WH 5CEYA 5DQJB 1MWAB 5DJYA 3LS5L 1LHZA 3WFEH 1RHFA 1A7RH 2CXGA 3UTSD 3PNWB 4XP9L 4YDJA 5F3HA 5FB8B 2VXVH 1F4WL 5L8JB 3VXMA 2VITB 5GRVK 3ZE2E 3WFDL 2VDRL 5BZDB 4QRQB 3NIDF 5ERWB 5F7LB 1HXMB 1QFWI 4NC1C 4U1MA 1HHGA 4ZSOE 4A6YB 1VPOL 4L5FL 1UQSB 5CILL 1FL5A 1JGUL 3VWKA 1ZLSH 2C1PA 1C5CL 4G9DA 1BQLH 2A6KA 4LCWD 1T66D 1OSPH 4FQ1L 4XTRC 4LSUH 5K9JH 3MJ7A 1U8KA 2J3SA 5JW4M 3QDJB 5IR1A 1SVCP 4APQD 4JO2L 1P7KB 3UTTA 1G7IA 1RJZA 3LHPH 1INDL 4EKXA 1Z9LA 4RIRB 1WFNA 5HDBE 1TQCC 2VR9A 3MJ9A 3GJEA 1U42A 1I7UA 1KCVH 2CKBB 2ITCA 3PV6A 3WHE0 2VISB 4Z95L 1V3JA 2LU7A 3RZCB 3BP6A 2ADIA 3BZFA 1G0DA 3V0WH 4JKWA 3P40A 1X5ZA 3QH3B 2UYLB 4HS6B 5K59E 4NP4H 2GYSA 3C08L 2YD1A 4TTGA 4W70A 4X6FB 1IQDB 1FHGA 4R9HA 4XPFH 3O2WH 3KJ6L 3GKWH 1V7ML 8FABA 4TTDC 5EA0L 3BD4A 1EJOL 3H9SD 3KNBA 4XPGL 2DLHA 4FMFA 1OT1A 4OSUH 5KN5A 5DEZA 3D18A 4NQDB 4YE4H 1MCWW 3UO1L 3IDNA 3VXRA 2J1KA 4OGZA 3O4OC 4E42B 3BO8A 4NUJB 4YX2L 3PDOB 3RU8H 4N0YH 2JCCF 3LV3A 2OSLB 5L2KE 3ZTNH 2NY6C 5BV7L 3GMRA 1YNTB 4YZFF 2YPLD 3DSNA 4IMKA 4FQPA 1CXEA 4IRJA 2DB8A 3FO1A 5CJQH 3GO1H 1L7TH 1YYML 2L7JA 3DXAA 2Y1VA 1LGVA 5C08A 2BNQD 3GIVA 2C26A 3GI9H 3N50A 3PQYA 4QHUA 4KJPD 3C6SB 2DYPA 4ESKA 3N0PB 3HNVH 3OKMB 4JPKH 5DUBB 1B4JH 1WBXB 1F4AA 4NDMA 1FV1A 4Y19B 3BSZH 1T4KA 3HMXL 3VFSB 3BDYL 1KPRB 5SX5K 2RIKA 5BO1H 3KYNB 1OGTA 2IH3B 3LRHA 4U1LA 2LV4A 5J6GA 3QEUA 3Q1SH 1S7SB 4GRMB 1WZKA 5F96L 1MFCH 4UQ3A 3BZ4B 1QHOA 3TBVA 5E8EB 4O5LL 2QTEA 1WFOA 1KLGA 4NRXA 3B5HA 4ZQKB 4ACPA 1AQKL 3CC5B 3T77A 3RHWK 4LEOA 5TQ2L 5DEFA 2YPKB 2VLJE 3SDXF 3S36H 1NCTA 1BQHG 3U2SA 2CRYA 2QR0B 3V0AC 5J6HA 2EYRA 3MJ6A 3NCJH 4F3FA 3DUHA 5ADOH 2UWEE 3G08A 4KK5D 1TVBA 3OGOE 5IJVA 1CU4H 4ONGH 1D3CA 2Q6WB 4OF0A 3KPRE 1EH9A 3TYFA 2P24B 3LQAL 4KHXL 1YZZA 2RQ8A 3HHRB 4XBPA 4FXGB 4NN5B 3ARPA 4X6CF 1UVQB 1YECL 3RWJA 5D5ME 1F3DJ 2P5EA 3EO0A 4D0DA 3W82A 4HFUH 1BOYA 1CN4A 3NZ8A 4GS7C 4JO3L 4PJEE 2OZ4H 4J6RH 3FT3B 2ATPB 3AS2A 5C8JA 5F8RC 3ZYJA 2DD8H 4L3CA 2HLAA 4L3ED 4PG2C 3MGTB 3FO2B 3O2DH 4NYLA 4RGMC 5FYKD 1H3PH 4PR5B 3U46A 4OCMC 1DEDA 5CHNB 3CGTA 3SKOA 4PTUB 2AK1L 4JQIL 1W0VA 3G5YA 4EN3C 2ADFL 4O58L 4Z7QF 5HYJD 1JRHL 1G84A 4HBCH 5TFSL 5SWQB 4JR9H 1WBYB 3MRBB 1QSED 3OWEA 2FX9L 2DWEB 1N64L 4HAGA 2IAMA 5F70A 3ARDA 4N9OB 2NTSP 4O02H 2ZUTA 1JYVA 3WIHH 4MA8H 3Q3GB 3MYJB 1MFAH 1P7QD 3VCLA 4EVNB 4GSDL 1BGXL 1FNAA 2RCSH 1MCDA 1LO2H 4MXQC 2V5MA 3W81A 4JRXA 3LEYH 3NCCB 1NANI 1DLHA 5HYQB 1ZWIB 4NQTA 2VDQH 2BY1A 4L8BA 3QUZA 4JAMB 1UA6H 4WFFD 3EYUL 3UDWA 1RIHH 3S37L 2EDKA 1CGYA 3K4AA 1QP1A 4M6NL 3F8UB 4XTRD 4ELMA 4DEPB 4JFDB 3RBGA 1MI5A 1CGXA 3BKYH 3BAEH 3MFFA 5I8CB 3S3SA 4ZOAA 4PGBB 3U83A 3Q6GH 4OTXH 3KYOB 3CIQA 3TJEH 1IC5L 5BOPA 1MQ8A 4HUMB 3CD4A 1OQXA 2ZNWA 5FF6A 3C2AH 4HHAA 3HAEG 2C3HA 4OZFA 4IRSA 1X7QA 1RZIA 1Q1JH 5I66B 1GAFH 5IF0A 4CVWA 4FFYL 3OZ9H 2D31A 3CX5K 4LEXH 1FZMA 4ZTOH 5E1AA 3LKSA 3GSVA 3U6RA 1SEBB 3S5LG 1EK3A 2Z8VC 5IVXB 4DWHA 3GMPB 2D3VA 3HNSL 1MCFA 2FGWL 4GG8A 1OAXH 3GK8L 4I13B 4NKMA 1IQWH 3DETD 3ZSSA 5F89A 1QBAA 2DLFL 3QDMB 4JM2A 3W0WA 4S0SD 1I8MA 4TTDD 4U6XA 1TQBB 2PO6B 4QCIB 5CMAA 1C5DB 3JWDL 3HLAB 2CO6B 5DHXB 4P9HL 2APXA 2DAVA 1FFOB 1GZPA 4HK0B 2DQHL 5ABDE 4Y16B 4R97C 5CEXA 2F74A 2ADGB 4RRPA 2CIKA 2NY6D 4MQ7A 3CFBB 3LQZA 4UINH 3RWCA 5T3ZL 4E0RB 1RZKL 4N8VG 3BPNC 3AREA 2D0GA 3WEXB 4HJ0C 3PGCA 2YUXA 1CBVH 3VFRA 2PW1B 3JV0A 4LARL 3IXAB 3SJVE 3FHAA 2VXSH 2X09A 3VFNA 2YK1H 1OSZA 4YNYB 3IU4H 3PWJA 3WS6A 1HILB 4PS4L 2DRUA 1K4DA 3GMMB 4WENB 5C9JB 1CFSB 2A77H 5JPNA 5DJ0B 4P57A 3DMMB 1DANT 3OJ2C 1AHWB 1IGIL 1GGYA 5HHMD 1P4BH 4HMCA 2NY3C 4ODXA 5LCVL 3RTQD 2H6PA 2X70A 3EZ8A 1MJJB 3OAUL 1WV7T 2R29L 5D1XA 2BX5A 2FSEA 2HRPH 5T1DL 4YHPA 1MPAH 2VXVL 5EOCL 5GSRB 1ZVYA 4P9MH 5DSCA 1PG7X 3T8XA 5F6IC 4MNGA 4AG4H 2PUQT 4DUXA 4DAGL 4MS8C 1KJMB 1M7DA 1ZLSL 1BQLL 1JYNA 1OSPL 5EZOL 4Q58C 5C1MB 4UT9L 2NCMA 3LKOB 1MCHA 4NJAL 4OCYH 1QUNA 2VXTH 3S37X 5ILTH 4PJAA 1FRGH 3HNTH 3HE7C 3E6FA 4I2XE 2BY0A 4Z0BH 3KYAA 2YZ8A 4NQSA 5IB4B 4XNUL 1N5AB 2FWOA 3HPJA 2VABB 1TETH 5DJCB 2GTZA 2X10A 2GJ6D 2H9GB 1OAKH 2YBRA 3ZHDA 2ATKA 4R0LA 1EEUA 5EWIL 2PN5A 4JPIA 1DUYA 1MAMH 3MJGX 3V0WL 2X1WL 1NFDB 1KELH 1D5XB 4XT1C 1DBAH 4CW1B 1A7OH 1RUAH 3GIZL 3QRFM 4XP5H 1NCNA 4JHAL 3S4SB 1HK6A 4LKCA 4EN3D 2XICA 3GKWL 1G7PA 1PY9A 1LQSR 2LAGB 4G42A 3LN9A 4IDLA 1LNUB 4UDTA 5F7KC 4XWGL 4CJ0A 5DUPH 3BZDA 5ICZB 3O3BA 5H94B 5DS8B 5L6YL 2EH8H 1UB6B 3GJFB 3RU8L 2LTQB 4WHDA 3TN0C 5AUMA 4Z7WB 4S2SB 3RY6C 4PB0H 3MRCA 4AT6A 1RSFA 1A3LL 2VSCA 2D7NA 5CLWA 3HRZA 1FG2A 5ID1A 4NO5B 3U9PL 3I75B 2R0LL 5EIIB 1T83C 1CDYA 4JFDE 4BQ6A 4NN7C 4WU7B 2HG5B 4P2RD 1FPTH 4H88L 4ZUWB 1MLBB 3SKMB 4PJ8A 1T22A 1TZHB 2FJFA 4I9WD 1BBJA 1QVOB 2AV7A 4P23A 1HOCB 3RDTC 1Z9SA 4OLYH 3VFGL 3HNVL 5D71L 3FMGL 4X4MA 1B4JL 4M5YH 3LPWA 4TOYL 4KAQH 2XG4A 5D7LB 3ARWA 3BSZL 1AO7B 3CPLA 4LDEB 4HKZA 5DMYA 1T7VA 4HCRH 1W0WB 1XGPB 1FCCA 1NAKL 4JGUA 3WN5A 1F4XL 5EO9A 2JB6A 4UIMB 2YWZA 1MFCL 3QWOA 2OL3B 4R3SB 4XPTL 2MOVA 4Y89A 1VERA 5IVXE 3L3HA 5TQ0H 4WV1C 4GW4A 1CDBA 3QDME 1J8HA 3S36L 3MUGA 5EZIL 1G6RB 4ZDHB 3MV8A 1ODAA 4YC2C 2GJJA 2BVOA 2DLGA 3RIFF 4NZTH 3TEUA 4F7PA 1MCBA 2Z9TA 3PL6B 1QO3B 3NCJL 3HE6B 5M7QA 1HWGB 2E3VA 3MBXH 1R6VA 4G6JH 1IAOA 4ONGL 3RWGA 5IVZB 4R2GC 2FEDC 1QLEL 2WBJD 5E9DB 3NIGF 3QPXH 4Y4FC 5D70H 3Q5YA 1YA5A 1T89A 2I07B 4OKVB 3UZQA 1BVZA 1DFBH 3FQWB 1CL7I 2B4CL 4DVBB 1P1ZB 1YYLH 5HHOB 5KJRL 3SBWC 1WBZA 2Q8BH 3U4AA 4OZGA 2IG2H 4JFED 3O2VL 5HPMB 3EDEA 1NH6A 4NZRH 5C09B 2OZ4L 4J6RL 5ADPL 2AXFB 4Q2ZB 3X17A 4XCYA 3JUZA 4FTVB 2DD8L 3T0EA 5GRXG 4MMXC 1RZGB 3GBMH 3O2DL 3JWOC 3FFDA 5EBMA 3SO5A 1N26A 2I9LA 3RP1A 5KW9H 2E5EA 3P4NB 4CUCA 4I5BA 3MUJA 1KLUA 1OD7A 3HS0B 4MB3A 3QT2A 1GSMA 1RIVL 3QO0A 4HBCL 5FHBH 1LEIB 4JR9L 4LL9A 4Y5XC 1O0VA 2CR3A 3FB6A 2VZUA 3ESVF 3KPQA 2Q86B 4N9GA 4Z77B 1PD6A 1I75A 3AS3A 5EBWA 4MXVE 4MA8L 4XNQA 4EOWH 2MHAB 3DGGB 4PJ9C 5TE7H 1YNKL 5FO8B 4P5KB 3MRQB 2Z8SA 5DWUH 1HNFA 1LO2L 1TCRB 43CAB 3LEYL 1CDUA 5H37H 1P69B 2VDQL 4OZ4B 4DW2H 1Z5LA 2IANA 3PDGA 1AFVL 3TZVC 1UA6L 1RIHL 3RWIA 3U9UA 5JNYB 4MS8D 3W2DH 4UDUB 2J6EA 4J23A 3HUJF 3NABH 35C8H 3FRUB 4GRLA 4FA8A 3EYQC 4RAVB 3P9LA 4EDXA 2A6IB 1SJHB 1YDPA 3BKYL 3MBEB 1NCCH 5IROC 3V6ZB 4BFIB 3VXPB 2D7OA 2R1XA 3OMZA 1ETZA 3TJEL 1D5MA 3MR9B 5I71C 1ZLWK 3QJHB 1YJDC 4OF8A 4LSQL 3HE7D 2WIIA 4G5ZL 1WEJH 1FNSL 1BF8A 4YFLI 2VOTA 1GAFL 4PJIF 4R4FL 2JCCA 1GOFA 4L3AA 1HZHH 4PRDA 3IU3A 2XG5A 5F3HB 4LEXL 4HULB 3DV4B 2AABH 1QKZH 5HI3C 3VXMB 1IGCL 4L4TB 12E8H 1TLKA 1FNHA 3HI6H 4CL7A 4MA1C 3H3PH 3GKZA 1F4YL 4MWFA 3GMQB 4YFEA 4KMQA 2CUIA 1D6EB 4LHUA 3VWKB 5DURD 3VGAB 4G9DB 2QSCH 1MCIA 2A6KB 3ALXA 1T1ZB 4XXCC 3ZL4H 1KYOJ 3MRMA 3C2SA 2BNRA 3NACL 3ARRA 1U8KB 3MJ7B 4QRRD 5IR1B 1KCKA 2ICEB 5BJTA 3UTTB 1G7IB 4Y2OA 2HFEB 2XQBH 3HG1D 3TO4C 5ITBL 3GJEB 3A67H 4U6VH 3V6OC 3TN0D 2GHWB 4Z7WE 5E6IB 5J7CC 1PQZA 2E7HA 4CMMB 5AYUL 3G6DH 4J4PD 1JZ6A 4IDJL 3VXQB 4UILH 1M1SA 3FQUA 4JY6B 4ETQA 3BP6B 4LP5A 1Y6KR 5TDOA 4C55A 2H26A 1XGUB 3SDXA 4M7ZB 4YDVB 4M48L 2VXSL 4KRPC 2YK1L 1B0RA 5IMOB 3DYMA 1CYGA 4LPXA 4X7TA 1UM4H 3E3QE 1JI1A 3RGVA 5C0RH 5EU6D 2A77L 2WW8A 3RDTD 4B7IA 1HDMA 2C3GA 5JLZA 2DQUH 3L5WB 1UT9A 3GSOB 3DLQR 3IDNB 3O9WA 1U95B 5J3HC 2X1OA 5FYJD 1OP5K 3SHSA 1QBBA 2AGJL 4KZEL 3ZDZE 4X6CA 4YK4B 1PZUB 3GMRB 2HRPL 2HT3C 5D2NC 5EDXA 1MPAL 2EH7H 4OLWL 4JFFB 2Q3ZA 1LD9B 1A9EA 2FGZA 2FZ3A 2JJTC 4MA7H 4XBEH 4YHMH 3RQ3A 1W72B 4GBXC 4IRJB 1CFNA 3FO1B 1CF8H 3QNYA 5CJXC 4HLZH 4RGOL 3L3KB 1BD2B 3WFHB 1C1EH 2F53E 2VDOH 1I9IL 3BN3B 1H5BC 5D2LB 4TSCL 4QHUB 4R2GD 4QY8B 5E9DE 3UTPE 3GSNA 4Y4FD 4U05A 2DYPB 1AXIB 1ZEAH 4OCYL 4S1RL 5I74B 1KC5L 5CEZD 5DK3A 1WFUA 1MEXL 3MLXH 3NZHH 4B7LA 1FRGL 3HNTL 5HHOE 4FZ8L 4AEFA 1T4KB 4Z0BL 4JZNB 1QQDA 3AB0C 3CU7A 4N8CH 4U1LB 3T3PE 1TETL 2LVCA 3CFJA 3QEUB 3CLFH 4UQ3B 3TBVB 5C09E 3WDJA 5ALCL 1ZA6A 4W6YB 1MREL 1KLGB 2X4PA 2GUOA 3FO9A 4U1GB 2Q8AL 3S34L 1TITA 1SBSL 5CD5C 3TCLB 4ZNEA 1N0XH 1U3HA 3I9GH 3I3BA 3V7AE 1KELL 2P48B 4XRCB 1DBAL 1A7OL 1RUAL 2CLRB 2OTPA 3K7UA 4KKLC 5IFHL 5LWYH 3LD8C 5J6HB 2OJZH 3GBNH 4D9QE 5LKNA 5JTWA 5I2IA 3QBTB 5DMIH 1G7JB 3G08B 1TVBB 3DO3A 4HJGB 3G04B 4LF3A 5CLTA 3ULVH 3QUXA 5L0QB 1XF3B 2V17H 3INUL 2QBWA 4LMQE 3N1MC 1NDGA 3D3VE 1BJMA 4Q6YA 2BDNH 5I0ZA 4MNQD 5AD0A 3BMVA 5A2LH 1QYGL 5I1AA 5EPMB 4S1DD 3QEGH 4NQCA 2DQJH 4XBPB 5J13C 3S88H 4PJ9D 3OXRA 4UTBL 1S7RA 3RWJB 4PB0L 5F7UA 4HDIB 5T1LB 2DQDH 3TZVD 2BVEA 3WSQH 2R2CA 1CXLA 3C5SA 3FT4B 3L7EB 2W60A 3LEVL 4L3CB 3D39D 1MCWM 2HLAB 3UX9B 4TNWK 2CJUL 3U46B 3V5DA 2YZ1A 5ENWB 1KSRA 1II4E 1KFAL 4EIGB 4MJ6B 4OIIL 3MRLB 3SKOB 1FPTL 4M6OL 4FQQA 1W0VB 5C0AD 3G5YB 1RFDL 4DZBB 2NQCA 3FB7A 1XR9A 3B9KD 1D9KC 4OLYL 1BAFH 3VRJA 5DVNA 4NJ9H 4JFOA 2IAMB 3ARDB 2IADA 4LAQL 3VGBA 4OCSH 3BH8A 2DKSA 1BBDH 3WD5L 4KPHH 2B0SH 5D1QA 1FL6A 4HCRL 5JW5A 4GW1B 3VXME 2GW5A 1JVKA 5HI3D 2APWA 2VQ1B 4L4TE 4ZXBA 1AKJB 1TJHH 4JVPA 1GVIA 1D5ZA 1DLHB 1H15B 1NCUA 1XZ0A 1A6UH 5TQ0L 2DM4A 4L8BB 1RU9L 4JCLA 4YDLC 4JZJA 3UBXA 5HYFA 5BV7B 3MV9B 4ELMB 3BUYA 2G75B 4OZHE 5DMGC 4NZTL 1CE6A 1NCBH 1TZGL 1BIIA 1ZHNA 4RBPK 2H2PD 3GHBH 1WICA 4HX1B 3IKKA 3P77A 2GK2A 2Y6SD 1NAMH 5AZ2L 3TO4D 1YNLL 5D70L 2Z35A 3RVWC 4OLEA 3MV11 4IOSD 4IRSB 1J18A 1RZIB 4NM4L 1OB1B 4IOIB 3RVXC 1JMZA 1K6QL 3WIFA 3H9ZA 1YYLL 2X05A 4I77H 2D31B 3C6LB 1FZMB 3PIQA 5E1AB 1QR4A 3LKSB 3GSVB 1U8LA 3PF2A 1S78C 2EDNA 2IG2L 2DIJA 3WIIH 4OGAD 2DTML 1OP3H 1C5BH 1JF1B 1J1XH 4X8JB 2GIYA 2R9HC 4V2CB 3L3DB 4WEBH 1Z6JT 4NKMB 3O0RH 1D6VH 3GBML 4JDTH 3VD9A 1NC4A 1U36A 5L2JB 3B4NA 1RHHA 4JM2B 3H9YA 4ZUSA 3W0WB 5EFIA 2CMRH 1KT2A 4U6XB 1BZ9B 3SE4C 1XR8A 5C92A 3PHSA 5INDA 1QZ1A 5E2UH 4P2YA 1DQTA 3VXSD 3C5ZC 5HSFA 3WKMH 1GZPB 3QWQB 5J3HD 4CDGC 5CEXB 3RVUD 2F74B 1NFKA 5F88B 3R06A 4LCUB 4XPHH 5KVMC 1DN2A 3MRHA 4UT6H 4NO0D 4XNZB 3JVGC 2K7QA 4M9OA 4QRPA 3LQZB 2PKDA 4MJ2A 4JFFE 2CK2A 5DR5H 3NPSB 1G9MC 3KPSB 1QHPA 1IILE 3PGCB 4QTHA 4HPYH 4YHKH 4JQXA 4QF1A 2P47B 3TNNA 3VMOA 1O7VA 4O2CB 1BD2E 4PJ5A 1BECA 1TTGA 35C8L 3NABL 3ZE1E 5D2LE 1IKNC 5EU5A 5IMLA 4K94L 1OAQH 5BXFB 5E5MB 3RWEB 5E95B 2JJWA 1Y6MR 3LKNA 3F7VA 5I17B 2W07A 3S98A 4XGZA 1LDSA 4RMTA 4Z5RA 5I30H 2H6PB 2X70B 1R5IA 1WEJL 4K7PH 1MRDL 2WUBL 1MELA 3CFCH 5DO2C 2FECI 3CX2A 5D6DC 2FSEB 4IOFD 5KOMC 4YHPB 1JWSA 1S7XA 1CFQA 2WLZA 5CD5D 3LH2H 1FSKC 2HWZH 4MJID 3DRTA 12E8L 4TULH 1KACB 5J12B 1B0WA 2D7QA 5GS1A 4MNGB 3NCYS 3ZE0F 3H3PL 5CP7B 5CIPB 4KKLD 4XNYL 4LBEA 3SDAC 1CGTA 5BRZB 4YHNA 5GQBA 1ZHBA 3G6AA 1AP2A 3ZL4L 4QXGH 4Y1AD 1RAMA 3Q48A 5F72S 1RD6A 2OBGA 1VEMA 2BZDA 3AM8A 1NCAH 3VH8G 5I0DA 2NY5C 4R4BB 1H3UA 1QPXA 4WO4A 2X5PA 1VSCA 1FNEB 4P0DA 5FECB 4PBXA 4LLDB 1DN0A 4U6VL 2GY7B 5IJKC 3Q2CA 1Z3GH 3G9VA 4L1HA 5MI0C 5HI4C 3K4ZA 2FWOB 3HPJB 3MRFA 2IQ9L 1SVZA 3OX8A 5F6HJ 5I15H 2PTUA 1GJIA 4RGNE 1VGEL 5FCSH 2CRMA 3G6DL 2ZP0T 4AJ0A 3P3YA 1T5XA 3B9DA 3U0PA 5CUSH 1DUYB 1WLHA 2JK5A 4M1GL 1LO3H 4X0KA 3WXVL 5IMKB 2YEZA 1MVFA 3BFOA 1E4XL 3ARUA 3EYSH 1MNUH 3QZWB 4ZG1A 4M61A 4PRPA 8CGTA 5C0RL 1KCRL 3F65A 2DQUL 1XGYL 4G42B 4JRYD 4AM0B 1E4KA 2IMNA 2FIRT 5SX4I 4LNVA 4MHHI 1ZT1B 3QIUB 4H1LB 4X7SH 3RZWA 4KU1A 5D7JC 1Q38A 2HLFC 1JRHI 1JGLL 3MRCB 4AT6B 4PY8J 1SJVA 1T0PB 1EAJA 2I9TB 3TA3C 5F9WB 1F58H 4ENEC 3AFLA 1VB9A 3C60D 3HRZB 3P4OA 4MA7L 5FEBA 4YHML 3U48A 1S9VB 3NPZB 1FC1A 5ID0A 5BW7A 3MV9E 5DJ2B 4K8RD 3OKDA 4AH2A 2EIDA 2FJGB 5GXBB 1GGIL 2NY0D 1PYWA 4HZLB 5MENB 1T22B 2HJFA 2FJFB 4P23B 3VE0A 4EDWH 1JGEA 3RVWD 5HHQB 3CMOH 2XN9A 1QA9A 2KH2B 3MCLL 2VLKA 1CICA 1KTLA 3NZHL 5DDHA 3CPLB 4HKZB 4BZ1L 3X12A 5DMJB 3A6CH 4KGJA 3B9AA 5EB9A 3WN5B 2JB6B 3QISA 3PGDB 3QI9A 1A6VH 1ZSDB 5ESQA 3ZKMD 2XTJB 4GW4B 4L9LA 3PJSB 5F1NA 4RZCB 4X5WA 5AG9A 4PJHF 3MUGB 5IQ9A 1UZ8A 3I9GL 3HUJA 5I1CH 2BVOB 1VEPA 5LWYL 2OJZL 4F7PB 1U93A 3GBNL 5EN2B 3UPCA 5DMIL 3IFLL 1P9MA 1YY9C 2WUCH 4U1KA 5JW4Q 3PWLA 2O5YL 4XH2A 4YDIH 1EMTH 1YC7A 3V8CA 4HWBH 2OXGA 2BDNL 1T1WA 5BS0A 3VFVA 3D48R 4XHJC 3A0OA 1GHFL 1AD9B 3QEGL 4PJIA 5GS2D 3S88L 2FYYA 1FBIL 4HWZB 3U30B 3OAYK 2IQAB 2EDHA 3KPSE 1EFXA 1WBZB 2HN7A 1DL7H 1N5YH 2DQDL 1BFVH 4LCIH 5T3XD 3KR3L 3EFDH 3CUPA 4DOHB 5H8DA 1ZKAA 3VA6A 4YXHH 4TVPD 5EBMB 2MCG1 1ZGLA 5J06A 2I9LB 3F12B 3GJFK 5EC1B 3R0NA 2P1YA 1QFUH 1KLUB 1ES0A 4GFTB 1AIFB 3QO0B 2M2DA 3ARYA 4GJTB 3T0WA 1BAFL 3FB6B 4OCLC 4NJ9L 3KPQB 2AJSH 4N9GB 1XCQA 1S7UA 1RULH 5DO2D 4OCSL 1KTKE 3RPIA 4D0CB 2EDBA 4XNQB 1FZOA 1CLCA 2F8VA 5JA9A 2EICA 4KTDL 2VLRD 1N59A 2VKXA 1I8LC 4XPAH 3VXTA 4R90H 4BH8A 1TJHL 5DD0L 2R0KL 2JELH 2IANB 5I1IH 4OLXH 1ZLWH 2BHZA 3RWIB 3SDAD 3LEXB 5BRZE 4TPRH 4TRPH 1NMAL 4FG6C 4BQBA 4KJWC 3MZGB 4JY4B 2J2ZA 4EDXB 1YDPB 3TYGH 1ZGLM 1JNNH 4ZPVA 1PBYA 4XP6H 4NZJA 3GHBL 2MFNA 5EOQL 1UEMA 4MNHA 4HIHB 1NAML 2P8PB 2I25N 5I1HH 2FBJL 1XH3A 4AMKL 3MXWH 1UJ3C 2WIIB 5HI4D 5DD5L 3UTSA 5GISH 1JP5A 3OB0K 4KKNA 3B9VA 4TN9A 4Z8FH 3SQOL 1A4KB 4KDTC 2AV1A 1JPFA 2EDOA 4PLOB 1SY6H 1J1XL 3CXHK 4MWFB 4E5XB 4LCWA 4WEBL 5FCUL 3O0RL 1D6VL 3PABB 1QFWH 1J1PL 5JA8B 3DBXA 2Q7NA 4DFHA 1NBVH 2NY7L 2CMRL 4ZS6D 1E28A 5HDOA 2BNRB 4APQA 2X4RA 3AMKA 5I1KH 2FO4B 2HVKA 4UQ2A 2FHFA 3HMWH 4ISVB 1S7VA 5KZCD 1NLBH 2HLFD 3IXTA 3MOBH 1PQZB 1MRFL 5FYKL 1AI1H 2ZCHL 4AEIH 1DJSA 5F9OH 2B39A 4H20H 4HIJA 3TA3D 4ENED 2F19L 1I8KA 4P2QA 2D4FA 3MC0A 3FQUB 4RWHA 4ETQB 4M6MH 3HR6A 3PDDA 1WIOA 4FQJH 4RMVA 4MAYB 2X9XA 5TDOB 3WNNA 5T3ZE 1F45A 3IAQA 3SDXB 1ZS8A 1AXSB 4GXUM 1B0RB 1CTOA 3SPVA 1IM9D 4D9RD 2VO5A 2AJYL 1OP5H 1S5HA 5MENE 1I3VA 3RGVB 2EIZA 2I5YH 3H9SA 3BW9B 5CSZB 2BSSA 5JLZB 2P5WE 4M8QA 1OAZH 4NQED 4BFBD 4M1DL 1CR9H 1CVRA 2EEAA 4KHTH 1JNLH 2WWKT 1MAKA 3V0VA 2CGRL 2R0WL 1HH9A 1GGBH 4GG6F 5I30L 3UYRH 3VFUA 2FL5A 3JTTB 3MRGA 2NR6C 2DWDA 2HJKB 3T65B 5GS0C 2YPLA 4X6CB 4DK3A 1T04A 3GSUA 2ARJA 3EDKA 4F37F 3DX8A 3MRKA 1HEZB 3MNZA 4NWTH 3DXAD 1I7TB 1MJ7H 2PCPA 3MMEA 5DD3H 2DMBA 5ICXA 1UWGH 4TULL 1CFNB 3QNYB 1ADQH 2BNQA 4LFHG 6CGTA 3QUKB 2NX5E 1MIEL 2F9BT 4Y5VB 1YY9D 3I6KB 5CWSA 3VJ6A 1C08A 1MRCL 4RDQG 1NCAL 3LRSB 5FKAA 5EOTB 4X83A 5CAYB 4XHJD 3LSOA 5E2TH 5DZNA 5E8DL 3BXNA 2Q7YB 2DLTA 1Z3GL 1QQDB 1K2DA 4S0TD 4G43A 1INQA 3CFJB 4NCC2 5I15L 5L88H 3NIDE 2X7LB 1FP5A 4DOHE 4Q9RH 4L9DA 2JE8A 3VW3H 4K7FA 1JGVH 3B8SA 1U3HB 5FUZL 3PWNB 3S35H 3AAZA 3H9HA 2VDKH 3HI5H 1AJ7L 2WSKA 4X9HA 5I2IB 2DQCH 1KIRA 2B1AH 4C54A 4PV9B 3K8KA 1CFTA 5IB3B 2UUDH 4IS6A 1A2YB 2VUOA 3QUXB 5IW1A 1DBML 3Q6FA 5LGKA 4G8GE 2P42B 3P0GB 3CSBA 3CXDL 3WJJC 4HFWA 3FQRA 1JN6B 1YMMB 2APBA 1YPZF 3PHQA 5LBSH 1OY3B 1KCUL 4NQCB 4RFNB 4X7SL 3OXRB 5C3LD 2WANA 4HGWB 1U58A 1GGTA 1ROWA 5HJ3A 4HEME 3MRRA 4BA8A 2DQFA 2KUTA 3NIFE 1JZ4A 2AQ2A 4L3EA 3JTSA 2Y5EA 2W60B 3QFJD 5I73B 1PVHA 2DM2A 4ZUVA 4FG6D 4Z7UB 4PRHD 2KPNA 4KJWD 3V5DB 3DTXB 1PKQA 1UKSA 1QSFB 2GSGA 2H32A 4OGXH 5HYJA 1EHXA 1RK0B 3MRNA 4Z9KB 2MMXA 4PD4K 4PBVC 1DP0A 5L2KD 1QSEA 4EDWL 1V3KA 3KYMB 3QXVA 2AXJA 3D6GA 5D7KE 2GFBA 2ZUXA 4KUCD 1A64A 1A3RH 3D69B 4QNPF 1DBJH 1P7QA 3F5WA 2EECA 5EO1A 5DRZB 1QEWB 5I18H 3BH8B 3BPCB 3DOSA 5D1QB 3A6CL 4XAWH 1JHKH 3TBWB 4GRWF 3DYPA 1UKTA 2R1YA 4ZXBB 2RAMA 1JUFA 1MCEA 1TIUA 1RURH 3RWDB 5HHNB 4RBPH 1D5ZB 1A6VL 4W4OC 4G7VH 4U31A 2AJZA 4G8EB 5D96B 4UBDD 5BQ7B 1G7MB 15C8L 4PRIE 1NANH 3UBXB 4F9PC 1VFAA 1CDIA 2VL5A 3ULUH 5I1CL 1ZK9A 2YC1A 1VADB 2DQGH 3BUYB 3EHBC 3LKRA 2PYFB 2BNRE 5K9KA 5I75C 2QQNL 1EFQA 1BIIB 1ZHNB 1UG9A 1FNLA 1CZ8H 2WUCL 2YKLL 2OQJB 5FHAH 3P77B 1CK0H 5EBLA 4YEFA 1I3RA 5CS7A 4PJ7F 4YDIL 2QHRH 1EMTL 4K07A 1KB5H 4NOFA 4LLYA 3L3OA 1LP9F 2D7PA 4PJXF 5IG7A 4EZMA 3CX5J 1P4IH 1I9RH 3VG0H 2NPLX 2EE9A 2VLJD 3LOWA 1WFTA 3FFCB 5B4MC 2EDYA 2JIXB 1X4YA 5T33H 1U92B 2ESVB 1DL7L 3QQ3A 1N5YL 2H45A 4R4ND 4YO0B 1BFVL 4LCIL 2AEPL 4M03A 2CDFA 3KPRD 4NNPL 1FLRL 3DVNA 4X4XA 4LNRA 1JCKA 5F1IA 4ZUSB 1M71A 5EFIB 1V7NH 4XVJL 1UM5H 3UAJC 4IIQB 1XR8B 4NN5C 1A7QH 1LMKA 1NUGA 2B2XL 4XVSL 3L5IA 4R7NB 5JW3H 1ND0A 1TTUA 1BMGA 1T7XA 4IJ3B 2BOCB 2AJSL 3MUHL 2NR6D 2GQHA 4OFIA 1DUZA 5GS0D 2JLLA 2VWEE 3WUWB 1FGVH 5T5NF 5F7NC 5DI8A 2R4RL 1K4CB 4ZFFB 2X4NB 2VZ3A 2QQLH 5AZEH 1I9EA 4QTHB 1HCVA 4UNUA 2HVJA 3FB5A 1EGJH 4AK1A 2JELL 4LSPH 5DJ8B 4HGMA 5E5RB 4QF1B 5I1IL 2X1QA 4OLXL 3LMJL 1MFNA 3TNNB 4PJ5B 4TPRL 4TRPL 4Z76A 4UT7H 3EKCA 1I9JL 1YMHA 3NFSL 2NXYB 4RAUA 2J8UF 4X4ZA 2C3VB 2EYSA 3TYGL 4WUUE 3T4YA 5T1KB 1FDLH 4LFHD 3RTQA 4XGZB 1S7WA 3PWVA 1P6FA 2OJEA 1K8DA 3CFKA 1R5IB 1A6AA 3HRPA 1OAYL 1JFQL 5CP3H 5CINH 1JWSB 4X6EA 4DEPC 1S7XB 1GPOH 1CFQB 3IVKA 1HHHB 4Z8FL 3O41A 4ZNEE 5CCKL 4LSVL 3L3IB 3B5GA 4HIIA 1SY6L 3IAPA 3ECBA 5GHWH 4XCCH 1IGFH 1RUQH 3GFUA 1XF2A 1REIA 4JANA 1QFPA 4W81A 4DUVA 3VU2A 4HKJB 4KQ3H 4LSRH 1IVLA 4P5TC 4YHNB 1AQDB 1ZHBB 3G6AB 1BQHA 4LHJB 3QUMH 4YXLH 1PSKL 1KPVB 2B20A 3LN4B 5KOVC 2OTWA 4LASH 1TJGL 1A5FL 1YMME 4I0PC 1A1MA 3HMWL 1I1AC 1ZT7B 4O2EA 5DYOA 4TYUA 5D6CA 5I8KH 1K8IB 3UP1A 2R2EA 4AEIL 2GJ6A 2C7UA 3OX8B 1IKFH 1BWWA 2X4TB 2Z92A 3DV6A 2XV6B 4PG2A 2GKIA 2E8ZA 2HKHH 1TQBC 1FE8L 4X9BA 4DGVH 3U0PB 1T7WA 2ID5A 2PYEB 4M6ML 5E8OA 4Z7UE 5EUOF 5SWSB 1GOHA 5ETUB 4PJHA 4X0KB 4QHLB 4XBGA 1ZTXH 1QSFE 1EHNA 3EYOB 4KV5F 2YEZB 4WNQA 4Y16C 4EN3A 5KSBB 1RUPH 3MO1A 1I3GH 1U8IA 3STZB 4PRPB 2X4OA 1U8NA 4ONOA 4RQQB 1P2CB 3EGSB 4PGCA 4X9GA 2BC4A 2GK0A 5DVLA 5KBNC 1Y0LA 4F57L 4LLQA 4U6YA 1OAZL 1U8PA 5T5FH 7FABH 2DJSA 2A6DB 1T5WB 2QQKL 4X6DA 1GGBL 3UYRL 3IF1B 1KXTB 1G9NC 1IGML 4FXKB 3SJVD 5KAQG 4ODHH 1ACZA 3D25B 1UEYA 4XXDA 4NWTL 3PGFH 4OUOA 4YDKH 3K3QA 4Z78B 1MJ7L 4GUPA 5JXAH 2CKNA 2DI7A 3MPCA 4I18B 4PJFF 3TP4A 2FH6A 2BOBA 4XMPL 4PLNC 1MJ8L 4PJ8D 4G8FA 5CGTA 4FQIH 5ID0B 2AS5M 4DN4L 1AHWC 3HCVA 4K3DH 3RL2B 1A14L 1Q0XH 2AJXH 4P2RA 5KVGL 3EHBD 4Y4HC 2FIKB 4X5LA 4D3CH 4PJGE 3OKDB 4AH2B 3JV6A 1QACA 3AU1B 1HI6A 1PYWB 2XPGA 3T4AB 4KXZI 1WWCA 3VE0B 1EEYB 1JPTH 5GZNC 4NFDA 4MVBC 5J1SC 4KH2A 3FOMA 1RIUH 5TDPA 5JW4R 2XN9B 1QA9B 2VLKB 1CICB 3DIFB 1UXSB 4X6BA 5DDHB 3X12B 3FFCE 5JQ6H 3A6BH 2YRPA 3HAEA 4U3HA 3S96B 3QULA 2XA3A 2ESVE 4AIXA 1RZ7H 4RWYL 5L88L 4BKLB 4MAUH 1SYVA 3QI9B 5ESQB 5A2FA 4OLZL 4Q9RL 5D9SA 5JPMB 3VW3L 1JGVL 3QG7H 2BJML 4X5WB 3S5LA 3T0DA 5DD6B 1WAAF 4XMLH 3CDGB 4BSJA 5IQ9B 5IUSA 3HI5L 4P4RA 4R96B 5GZOC 3NFNA 3P73A 3T0XA 3UAJD 2ZSWB 3BD5A 2DICA 5GGRY 2WBJA 2FDBP 1SY6A 4F7CA 4XH2B 2GEEA 4OQTA 3BE1H 3S4SG 1CLOL 5MP6H 2YA0A 1T1WB 5BS0B 3B3IA 5L8LB 3STBA 2OR8A 5IBUB 2WNGA 4GO6B 4Q9CA 2FYYB 1MF2H 2XWJA 3LCYA 4JFEA 4L4JA 3ME0A 4P3DA 5DFWH 1CL7H 2BVUA 4EUPA 4RX4D 2AK4E 2YD2A 4KMTL 4I3RH 4L1DA 2ILLA 4OFKA 3CUPB 1MFDH 4JDZA 4PJ5E 4BFEA 1NL0H 1MSPA 3WXWH 2AQ1A 5FYJL 1T2QL 1ZGLB 1MHHB 5GRJH 4QWWC 2GT9A 2LTQC 4PRBB 1TPXB 2VSDA 3TVMC 4XX1E 3QJFA 1HHJA 1FNGA 5BVJB 4K55A 3UYOD 3FONA 1XCQB 1A3RL 1RZ8A 2GTWA 5I18L 2Z4QB 3RPIB 2F5AH 3F62A 3HZKA 4K8RH 1LO5A 1FZOB 4OM1L 5HY9A 5IB5A 3DUSA 1F42A 1A6TA 2Z0BA 5IKCA 3QXAA 3VXTB 1NGWB 5KVDL 1RURL 5FXCH 3WHXA 1A4JA 4NNYA 3E3QC 5F1KC 4KUZH 5CEZL 5CZKA 5DFTA 2MSPA 5C0IB 3VGDA 1PZ5A 4P5TD 3HC0A 1LK3H 3L5XH 5DD1H 2DQGL 3RA7H 1LK2B 5CGYC 1JHTA 4L8CA 1IAII 4OAWA 2FJHA 3OR6A 2Y25A 1WUNT 4DN3H 1KTRL 3HE7A 1CK0L 4MNHB 5LG1A 4I0PD 1GL4B 1I1AD 5INCA 2QHRL 4ZYKB 4CU6A 1KB5L 1SMAA 4GG6A 4PJCF 3EOBB 4LDLB 2NZ9C 2XA8L 3JWOL 4KJQC 4NQVB 1E0OB 1QSVA 3UTSB 5J56B 2HMIC 3QDMD 4I48A 4U1SA 3T09A 5T33L 3SDDB 3FZUC 3PL6C 2PYEE 3HE6C 5E2VH 4LSSL 3N1QC 3S97C 4YBLB 4FQCH 2EC9U 5SWSE 1QBLH 4DQOH 4P46C 3BGMA 3EAKA 5HDQH 5KSBE 4WHCA 4CVUA 4ERSH 1JPST 2FR4B 2NZIA 1H3TA 3OPZH 4PRPE 1L9MA 1B0GA 5HGHB 3JUYA 4NGHH 1I7RB 2EDLA 4QRRA 1S3KH 2E7CA 2WBWB 4APQB 2A6JA 1XGTB 3NIGE 3V6BR 1A7QL 3UPAA 1N6VA 1ONQA 1OM3H 2BVTA 3GRWA 4OD2A 4PP2A 4OLVH 4URTB 4HS3B 3TN0A 3RY6A 1E4XI 4OFYD 3SE9H 1S7VB 4ETYA 4MZ2A 5GPRA 1V3LA 3IXTB 5J11B 4UIKH 1FZJB 4N5EC 1XF4A 1I1YA 5DVOA 3THML 3MLRH 4GKZB 2R23A 3X3GL 2ZWLT 1DQLH 1MIMH 2F54B 3CFEB 2A9MH 5AZEL 1KPUB 1T83A 4YR6B 4U1HB 3CU1A 1EGJL 3BUTA 3W9DB 2J5LC 4Y4HD 3SPVB 3G6JF 2GJZB 4UT7L 5DQ9B 5EU6A 3WL9A 3RDTA 4BSVB 2EIZB 3IS1X 3H9SB 5EIQA 5GZND 2C5DC 3MNVB 5K9OB 1TFHA 3NGBB 4MVBD 4NUGH 4Q9QH 2BY2A 1FDLL 2G9HA 4ZTPL 4WVRA 4LIQH 4F2MA 1MUJA 3V0VB 4BJLA 4HUUA 5I8OH 2CIIA 3RNKB 2G5BB 1RZJC 5HVHB 4LVNC 1BQSA 2Y36H 1BFSA 2HA1A 3KPMA 1JI2A 4NT6A 2PR4H 3MRKB 3IFPB 3MNZB 4LRIC 3EFFB 3MBEC 5K9QG 3ABZA 5ICXB 5C6TH 1U0QA 1K85A 3QCUL 5HI5C 2YRLA 2H3NA 3WLWD 4XCCL 1IGFL 1ZA3A 2A83A 4J3TA 4F58H 3FQNA 5GZOD 2BNQB 3QR2A 4QXTA 3GM8A 4LSRL 1F4HA 5JIHA 4Y4FA 5CWSB 3VJ6B 1IEAA 1C08B 5CKAA 1WWBX 4NKOB 4OCRH 3QDGE 4FQ2L 5JDSB