4M1JA

Crystal structure of pseudomonas aeruginosa pvdq in complex with a transition state analogue
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
165
Chain Sequence
PTGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-homoserine lactone acylase PvdQ subunit beta
publication title Rational Design of a Transition State Analogue with Picomolar Affinity for Pseudomonas aeruginosa PvdQ, a Siderophore Biosynthetic Enzyme.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 54
structure length 165
sequence length 165
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2013-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4m1jA00
3SRBA 4E56A 1FM2A 1AI6A 1AJQA 1CP9A 1GKFA 2WYEA 1GM8A 1GM7A 1FXHA 1KECA 2ADVA 1K7DA 1PNLA 4PEMA 4YFBA 4M1JA 4HSRA 1GK0A 4WKVA 2WYDA 3L94A 4K2GA 1PNMA 3S8RA 1K5SA 3JTRA 2WYCA 4YF9A 1AI4A 3ML0A 1AJPA 1PNKA 4BTHA 4E55A 1AI5A 1FXVA 2WYBA 4PELA 1GK1A 4E57A 2AE4A 2AE3A 1JW0A 1AI7A 3JTQA 1K5QA 2AE5A 1JVZA 3L91A 1JX9A 1GK9A 4K2FA 1GHDA 1KEHA 3SRAA 4YFAA 1E3AA 1OR0A 4WKTA 4WKSA 1AJNA 4WKUA 3K3WA 3SRCA 1GM9A 4HSTA 1H2GA
chains in the Genus database with same CATH superfamily
3SRBA 4E56A 1FM2A 1AI6A 1AJQA 1CP9A 1GKFA 2WYEA 1GM8A 1GM7A 1FXHA 1KECA 2ADVA 1K7DA 3FGRA 1PNLA 4PEMA 4YFBA 4M1JA 4HSRA 1GK0A 4WKVA 2WYDA 3L94A 4K2GA 1PNMA 3S8RA 1K5SA 3JTRA 2WYCA 4YF9A 1AI4A 3ML0A 1AJPA 1PNKA 4BTHA 4E55A 1AI5A 1FXVA 2WYBA 4PELA 1GK1A 4E57A 2AE4A 2AE3A 1JW0A 1AI7A 3JTQA 1K5QA 3FGTA 2AE5A 1JVZA 3L91A 1JX9A 1GK9A 4K2FA 1GHDA 1KEHA 3SRAA 4YFAA 1E3AA 1OR0A 4WKTA 4WKSA 1AJNA 4WKUA 3K3WA 3SRCA 4BWCA 1GM9A 4HSTA 1H2GA
chains in the Genus database with same CATH topology
3SRBA 4E56A 1FM2A 1AI6A 1AJQA 1CP9A 1GKFA 2WYEA 1GM8A 1GM7A 1FXHA 1KECA 2ADVA 1K7DA 1PNLA 4PEMA 4YFBA 4M1JA 4HSRA 1GK0A 4WKVA 2WYDA 3L94A 4K2GA 1PNMA 3S8RA 1K5SA 3JTRA 2WYCA 4YF9A 1AI4A 3ML0A 1AJPA 1PNKA 4BTHA 4E55A 1AI5A 1FXVA 2WYBA 4PELA 1GK1A 4E57A 2AE4A 2AE3A 1JW0A 1AI7A 3JTQA 1K5QA 2AE5A 1JVZA 3L91A 1JX9A 1GK9A 4K2FA 1GHDA 1KEHA 3SRAA 4YFAA 1E3AA 1OR0A 4WKTA 4WKSA 1AJNA 4WKUA 3K3WA 3SRCA 1GM9A 4HSTA 1H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SRB A;  4E56 A;  1FM2 A;  1AI6 A;  1AJQ A;  1CP9 A;  1GKF A;  2WYE A;  1GM8 A;  1GM7 A;  1FXH A;  1KEC A;  2ADV A;  1K7D A;  1PNL A;  4PEM A;  4YFB A;  4M1J A;  4HSR A;  1GK0 A;  4WKV A;  2WYD A;  3L94 A;  4K2G A;  1PNM A;  3S8R A;  1K5S A;  3JTR A;  2WYC A;  4YF9 A;  1AI4 A;  3ML0 A;  1AJP A;  1PNK A;  4BTH A;  4E55 A;  1AI5 A;  1FXV A;  2WYB A;  4PEL A;  1GK1 A;  4E57 A;  2AE4 A;  2AE3 A;  1JW0 A;  1AI7 A;  3JTQ A;  1K5Q A;  2AE5 A;  1JVZ A;  3L91 A;  1JX9 A;  1GK9 A;  4K2F A;  1GHD A;  1KEH A;  3SRA A;  4YFA A;  1E3A A;  1OR0 A;  4WKT A;  4WKS A;  1AJN A;  4WKU A;  3K3W A;  3SRC A;  1GM9 A;  4HST A;  1H2G A; 
#chains in the Genus database with same CATH topology
 3SRB A;  4E56 A;  1FM2 A;  1AI6 A;  1AJQ A;  1CP9 A;  1GKF A;  2WYE A;  1GM8 A;  1GM7 A;  1FXH A;  1KEC A;  2ADV A;  1K7D A;  3FGR A;  1PNL A;  4PEM A;  4YFB A;  4M1J A;  4HSR A;  1GK0 A;  4WKV A;  2WYD A;  3L94 A;  4K2G A;  1PNM A;  3S8R A;  1K5S A;  3JTR A;  2WYC A;  4YF9 A;  1AI4 A;  3ML0 A;  1AJP A;  1PNK A;  4BTH A;  4E55 A;  1AI5 A;  1FXV A;  2WYB A;  4PEL A;  1GK1 A;  4E57 A;  2AE4 A;  2AE3 A;  1JW0 A;  1AI7 A;  3JTQ A;  1K5Q A;  3FGT A;  2AE5 A;  1JVZ A;  3L91 A;  1JX9 A;  1GK9 A;  4K2F A;  1GHD A;  1KEH A;  3SRA A;  4YFA A;  1E3A A;  1OR0 A;  4WKT A;  4WKS A;  1AJN A;  4WKU A;  3K3W A;  3SRC A;  4BWC A;  1GM9 A;  4HST A;  1H2G A; 
#chains in the Genus database with same CATH homology
 3SRB A;  4E56 A;  1FM2 A;  1AI6 A;  1AJQ A;  1CP9 A;  1GKF A;  2WYE A;  1GM8 A;  1GM7 A;  1FXH A;  1KEC A;  2ADV A;  1K7D A;  1PNL A;  4PEM A;  4YFB A;  4M1J A;  4HSR A;  1GK0 A;  4WKV A;  2WYD A;  3L94 A;  4K2G A;  1PNM A;  3S8R A;  1K5S A;  3JTR A;  2WYC A;  4YF9 A;  1AI4 A;  3ML0 A;  1AJP A;  1PNK A;  4BTH A;  4E55 A;  1AI5 A;  1FXV A;  2WYB A;  4PEL A;  1GK1 A;  4E57 A;  2AE4 A;  2AE3 A;  1JW0 A;  1AI7 A;  3JTQ A;  1K5Q A;  2AE5 A;  1JVZ A;  3L91 A;  1JX9 A;  1GK9 A;  4K2F A;  1GHD A;  1KEH A;  3SRA A;  4YFA A;  1E3A A;  1OR0 A;  4WKT A;  4WKS A;  1AJN A;  4WKU A;  3K3W A;  3SRC A;  1GM9 A;  4HST A;  1H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...