4M1PA

Crystal structure of the copper-sensing repressor csor with cu(i) from geobacillus thermodenitrificans ng80-2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
96
structure length
96
Chain Sequence
VLHGTMIPRTKEEIENIMKRLKRIEGQVRGVQKMVEDNRYCIDILVQISAIQAALRQVGMQLLERHANHCVAKAIREGSGEQSLRELMDVIKQFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-sensitive operon repressor (CsoR)
publication title Cu(I)-mediated allosteric switching in a copper-sensing operon repressor (CsoR).
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Transcription repressor
total genus 40
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4m1pA00
3AAIA 5LCYA 2HH7A 4ADZA 5FMNA 5LBMA 4M1PA 4UIGA
chains in the Genus database with same CATH superfamily
3GWHA 2VKOA 5CGMA 3ZCJA 5L3EB 3AA1B 4OX9T 1NWMX 1XMQT 3RYFE 2X51A 3ZMSB 3KVBA 3I9WA 3ZLIA 2JMKA 4EZHA 2KLQA 2X0HA 4O2BE 5JREA 2E9XD 2H7VC 1CUNA 2K48A 1ZV4X 2IC9A 5JH7E 4E7ZA 2XQ7A 4KP3C 4H9RC 4PJNA 2VURA 3RPUA 4CI2B 3TLTA 2H89A 1D1AA 4H63H 2HN2A 4PW8A 3M65A 4HWIB 3B13A 1FMVA 2DCFA 3P4PA 5BMVE 3AVRA 5H6QB 2V6YB 3PU3A 3VR9A 3FXEB 4PJLA 2KMFA 4ZXLA 5HAXA 2KINB 2LRLA 2VKHA 3R84B 3AEGA 3ZMVB 3DP7A 5FXXA 2NR4A 2XQ5A 5JDNA 2Y6XA 1BR0A 4GOUA 2QVAA 3RRWA 1Z0PA 3LSVA 5LHHB 2LSGA 2C0SA 3X1DA 4IE7A 4NXNT 2WZHA 3EDUA 4AQFA 3FHNA 3PUSA 3ZC0A 1J5ET 4ANJA 2A3DA 4IDOA 2BS4A 2XAGB 4B3RT 3VR8A 2G0UA 3PUAA 3QC9A 1Y64B 3JC6D 4ILUA 3P7IA 2UXBT 4AKGA 3FZKB 4PJJA 5EK3A 5JDFA 2LM2A 2V1DB 4YSZA 4MALA 4JI4T 2NTYA 3WAKA 4JEHB 3UU6A 5AQQB 3G06A 4AQGA 5L3DB 4CI1B 2JJ9A 4M1PA 4DR4T 4O8SA 3N9OA 2EHOC 5ADXL 2BS2A 2BG9B 4JI2T 4JI1T 4CQIA 4HTEA 4CXYA 4JI0T 2WDQA 2M6BA 3CIRA 2N2NA 2LRKA 3K3NA 3P4WA 4YSYA 1I6ZA 4TWHA 5L2LA 1MNEA 2VB6A 3RLFF 1HTJF 4QXCB 1VCTA 2BG9E 5KXJA 3PUQA 4QHOA 4UVCB 2XQYA 3CMLA 1SHZC 4JI6T 3O1JA 2V26A 3AEEA 4YTMA 2E2AA 1KNZA 2W4XA 5ABGA 2FUPA 1UURA 3H3AA 1HX1B 5FY7A 5AQLB 5J1GA 3AA6B 4X65T 4HFBA 3U3IA 1I94T 1YXRA 4OYKA 4EIWA 1BR4A 5KDMC 3EUHA 1OEDB 3RC3A 4DMVA 2V7KA 1T98A 2JPFA 2C5KT 2LSKA 4KUMB 2D0TA 1N36T 3DJBA 2MYSA 3Q5EA 4K0KT 3RQUA 4CN4A 4EB6E 2CPTA 2IIUA 5FNVE 3JADA 2XSBA 1MMNA 3V5SA 4B3MT 4GK5E 3L09A 3PUGA 5AQKB 1CHUA 2VK9A 1BR1A 4YT0A 1OEDE 5M4YA 5FVKA 2W00A 1IJ5A 2LM9A 2DL1A 2CEAA 3H37A 3H3MA 5HEUA 4UR9A 3P4RA 2CM0A 2EHOD 3TLUA 3BQIA 4JI3T 3LK3B 2K5BB 4U33A 3VHLA 1NEKA 3LBXB 4Z90A 5AQVB 3KBTA 3OYXA 1YW0A 3L8RA 1HNZT 2AXDS 2V5DA 4LF8T 2E9XA 2KT9A 4ISSA 5LNKA 3IHRA 2BBJA 2BG9C 1OEDA 4O4HE 3Q9DA 3OJAA 2JQ9A 2LHNA 5IWAT 4JYAT 4CXWA 4EYUA 2NOXA 3AXJB 3KDSE 2H7OA 3UU8A 4B6XA 4X5TA 2C5IT 1IBMT 5ABEA 3SWHA 1IJ6A 5HYAA 2A9UA 2JQHA 5F3JA 3ZEFB 4TN7B 2L9QA 3RIUA 5L3BB 3HR0A 2X0YA 5J0ZA 4DV1T 3ZJ1A 1X79A 2OA5A 1SUMB 4O4JE 4LF9T 5LOVE 2IMLA 5AQPB 4WW0A 3AAAB 2VVNA 3FZHB 2B76A 1NAFA 4U2YA 2HPLA 3AEBA 5CFBA 4ILAA 4B3TT 4LFBT 5AQSB 3ABVA 4F8HA 3P8CD 1OEDC 2J47A 3UUMA 2UXDT 4DV2T 3LJCA 1ZKEA 5LHIB 5JDLA 3ONLC 2XSAA 5LJMA 4UXNB 4AKLA 5LGTB 1U5PA 4DV5T 3EAMA 2X68A 2XUEA 5FMNA 3J9X1 2P9BA 4AKRB 5FY0A 2BVLA 3AXJA 4U72A 5HXHA 2CWYA 2UU9T 3ESLA 3OVUA 1KNPA 2XM1A 5JDGA 1YQ3A 3HKDE 4ZI3C 3UUBA 5AQMB 4NUVA 1MIVA 1X9BA 3CKDA 1YKHB 2WP9A 1IBKT 4WBOA 5JDQA 5LG4A 1MMGA 4JI8T 3AAEB 1SA0E 3HKBE 2J1DG 5JRCB 2YDRA 3BK9A 2X9WA 4A56A 3UT5E 5HEGA 3RYIE 5AQHB 4UVAB 3RYCE 2CWOA 4IE0A 5LG3A 1XWMA 2XJ7A 5A1LA 4EYYR 4EV6A 5KMGP 4XBFB 3ZYKA 4CN6A 4PK6A 2JIWA 2QA7A 4HWDA 2PJQA 3OPCA 4ZOLE 1V9DA 4ZI2C 4BAYB 1WR6A 4DBQA 5LMUT 1EZ3A 1WYCA 3J7Yq 4DBRA 1D1BA 4ILBA 3UULA 4L5GA 4IE5A 1W9RA 3MK7C 3AVSA 3AEFA 2JQQA 2YU2A 4KHPT 1UX5A 2CRBA 5HCJA 1IAPA 2DWKA 4TWDA 3GN5B 3RH3A 4TV8E 2NTXA 4YY3T 5CJ5A 4QKNA 4DR7T 2RP4A 4ZI7E 1XDOA 4HFIA 4CXXA 3OKQA 4Z91A 2N1GA 4DV6T 2UXNB 4HWCA 4X66T 2NP9A 2LLYA 1E1HB 4LF5T 4HWHA 4PAGA 5LXTE 2EHOA 1B7TA 1YKEB 4G2AA 3P4QA 4U3CA 2UUBT 3CQCB 1VCSA 2WBLA 4QWNB 4H9SE 4YXDA 3SOLA 2VKDA 3UUNA 1WR0A 4U74A 1E7PA 3N9PA 4ZI3D 4PK5A 4IE4A 2WWUA 4UF0B 4U7YA 4H9QC 4HFCA 1Y01A 1UK5A 3JCFA 3UQ4A 4Z8XA 4DR2T 3PV0F 2KWHA 1HS7A 4X1YE 3W15B 4DVDA 1T72A 3CX8B 5H6RB 3TLWA 1H7CA 3IF8B 4U31A 3ZPOA 2W2UA 5DQWA 2IW5B 2CE7A 1YQ4A 4Q25A 5BR8T 3AAIA 2R6GF 2HH7A 3RX6A 1UCUA 3L39A 2BKOA 2Y48B 5J2UE 3OTOT 3UU5A 5CA0E 1IZNB 1JNZA 4ERRA 1JNRA 5LA6E 3AE3A 4EEBA 5JR9B 4TNVA 2ZM2A 5JDHA 3F31A 3QNUA 5FY1A 4PFPA 2RA1A 2HHHT 4C90A 2V6YA 3PUZF 1WFDA 4DV4T 4O4IE 3HI2A 3R6NA 2VL0A 5L4EA 3HKEE 2X9XA 2W0GA 4AXPA 3PUXF 2V8SV 3MA9A 4IREA 2LKHA 2XQ6A 5HEOA 3E0ZA 2BZBA 4I55E 3AE1A 4JEUB 5FL0A 2K24A 4TUYE 2NW7A 5LGUB 4HN9A 1U4QA 2LOPA 4UF0A 3ETUA 3LFMA 1N33T 1HG5A 4AISA 1MNDA 2WZIA 2C5JA 3AB3B 2PTFA 3WI3A 3AE6A 5TAOA 1FEWA 4IE6A 3B5MA 3A7MA 2LKGA 4X1IE 4COFA 5LGNB 5FYMA 4KHZF 4UVBB 4GYRA 2NWBA 3C4WA 1DU2A 5AQOB 1WYBA 5F8PA 4HFDA 5AQJB 2H3RA 4L0RA 2LT3A 2J4GA 1YD8G 1HR0T 4EXTA 3O4XE 4FJOA 4K0UA 5CA1E 3CX6B 2BG9A 5JR9A 4H9NC 1US7B 1KK7A 5C8YE 3A8YC 2I59A 4I50E 3KVAA 4AIUA 2DWGA 2V7MA 3DTOA 5EK4A 4DR5T 1Z8UA 3RHWA 1XMOT 3K3QC 3RIAA 3Q5DA 3S4UA 1LVFA 2SPCA 4IDQA 5GONE 2IC6A 2JQKA 1T7SA 3CK6A 2ODVA 4BJNA 4UV9B 3N2KE 2WDRA 4PJMA 5AQRB 3C98B 5DJQC 2LJLA 4KBMB 2CLYB 2CMRA 3T8OA 2XQ9A 2UXXB 2LEHA 4CN1A 2KNDA 4OFZA 4PK4A 3UQ7A 4A98A 3NVOA 5HXCA 4J2CA 3CX7B 3FXDB 2E5VA 3KFWX 2YDQA 4UIGA 3NRYA 4JBWF 3T1HT 2V7IA 5FXWA 3RQWA 4I43B 3Q5XA 4JUYA 2VWAA 1D0ZA 5IHYA 1WLXA 3N5LA 2XQ3A 1MMDA 3HA4A 4YFSA 5JR9C 4V1Av 3IEEA 3MZKB 1XNRT 3MKDA 2HPJA 3QOFA 2X66A 3N2GE 1QSDA 2Q9QC 2PFVA 2X9YA 4QXBB 5FL1A 1HNWT 3EVYA 2DNXA 2PG8A 4A97A 4C91A 3IBPA 2KXPB 1XNQT 4U2ZA 1HX8A 1SE7A 3PUWF 4A5XA 2BKNA 3AEAA 2LOSA 4F6RC 3CPZA 3ZSSA 4EZ4A 3ANWB 3E08A 1O3XA 5LYJE 1W0AA 4KI0F 4WZXA 1HCIA 2NW9A 4X20E 4IL9A 3ZMUB 4N78D 4KX6A 3D0TA 2D2SA 3L3PA 4GK0E 3VKGA 3Q5WA 3K8PC 4O4LE 3LBXA 1MIWA 5C3JA 4LF4T 4O2AE 3FB2A 3PJAA 3CQGB 2YKSA 2FJAA 3EDVA 5J2TE 4HKAA 1N34T 1WCRA 1VRBA 5HXEA 1NENA 5FP3A 2XY8B 3AA0B 2L8KA 5JVDE 3NZQA 4WYVA 1L0VA 2MAWA 3NBXX 3N9MA 4HWFA 2UUCT 2WM9A 2KWIB 1QLBA 1M62A 2WAUA 3ZJ2A 2X0LB 2WU2A 3N2OA 3GMIA 2ZMAA 5E0OA 4XZCA 3ETVA 1XDPA 5JDMA 4OHFA 3PJAJ 4IHJE 4IGUA 4IT4A 3PTRB 3I1AA 4JI7T 2CLYC 4ZZBA 3ANWA 2FBWA 3TKLB 4FI5A 2K9AA 3AE7A 4ZEYA 2XZEA 2K3WA 4X62T 3EABA 4AKHA 2CBIA 2VASA 3ZYLA 3MXZA 4TNWA 2A2FX 3VRBA 4DR1T 5FKYA 3K1SA 1BR2A 1W0BA 3I0OA 2AE9A 2GK9A 4OK0A 3JC6C 2VQET 2YN6A 3ZT5A 3AE9A 5ETWA 2V6XA 2W62A 1D0XA 3T1YT 4HFVA 4QH5A 2HN1A 5L3FB 4DUZT 2L3LA 1KFYA 3ZT7A 2YK0A 3C51A 2WB5A 2ZM0A 1HFAA 5EK2A 3AE5A 4QH4A 1W09A 2WMOA 3QB5A 4PFOA 4LFAT 1KEYA 2BVMA 5AFUL 4H9OC 2YINA 3OYZA 3UU4A 4DUYT 5HCMA 3LK2B 4BJMA 3F57A 2WCAA 3CVRA 1OXZA 4GIWA 2UXCT 4NIQA 4TZ4C 4ZS2A 3AE4A 3ZN1B 4NUUA 4U7IA 5LBMA 2QGSA 3PE0A 3UFEA 1N32T 2LSIA 2Y8DA 5HXSA 4YTNA 4EOZB 5JRCA 3RI5A 4L9IA 4JLEA 2ZM6T 2QRXA 1S35A 3Q2MA 2CA5A 5IYZE 2D5UA 3RF1A 5CB4E 1AJ3A 4BA9A 5AQIB 2V7LA 5LCYA 3A5XA 4IL4A 4I4TE 4P1NA 3ZT6A 2CXFA 4YHJA 3TLVA 4CI3B 2F4VT 2DLRA 3C64A 3ZMTB 2BKPA 4DNDA 1KF6A 2WDVA 2LHRA 3SFEA 4DMWA 3ZC1A 3PU8A 3PDYA 4LMKA 3VRAA 5DABA 4XAXB 4I0UA 2XQ4A 3SS1A 4LFCT 2CBJA 2X9HA 2DHRA 3C50A 3GN5A 5AQUB 4ZI2D 4QX8B 3RGLA 3RKOA 2M6IA 3RRCA 2J62A 3AE2A 1FJGT 5L3GB 2BS3A 2YEVC 4YSXA 5HWYA 4UV8B 4GKJT 2IHR1 4PNIA 2X67A 3N9LA 5EZYE 2WWVA 2Q9QB 3TLSA 5HWXA 2OV9A 3VU7H 4IDPA 3VKHA 4YJ2E 4AKIA 3ZN0B 2FJEA 5AQTB 3WAJA 5FXVA 1T8BA 4LF7T 4OYJA 3BQLA 3HKCE 4YLHA 4E7SA 3QUJA 2VQFT 4G63A 3UUXB 2ACXA 4DV7T 3KBUA 2CCQA 4AQFC 3AA7B 4HE8A 3ONXA 2BBHA 4HFHA 2LE8A 5AQFB 1OWAA 2WMNA 3FZLB 5HEJA 2XAHB 5JTGA 3P4SA 4LF6T 4UEMA 5IUXA 5ABHA 5LJNA 1FMWA 3CWZB 3F2EA 1KNRA 3ZCIA 1J1JA 3SRZA 3O1IA 2E9XB 2WU5A 4MBQA 3NZPA 1WRDA 3C4ZA 3E22E 3AECA 4ILCA 4MLKA 2YU1A 2XASB 2XQ8A 4H63V 4TV9E 4ISTA 2D9DA 2H88A 2Q9QA 1R8IA 2W66A 4GKKT 4QX7B 4ZS3A 4P09A 5ABFB 1D1CA 3B57A 3AEDA 2XHEB 2CXDA 3GA8A 4WNKA 5L47A 2CHNA 3RIFA 3OBVE 2V5CA 1UX4A 4HEAA 4DO0A 4CZZB 4LMJA 2ES0A 4X64T 2UUAT 1LKXA 3SFDA 3NWIA 4UELA 2VVSA 4X1KE 3PURA 2D0UA 5HXRA 2NW8A 2CHOA 2YDSA 2W61A 2ODUA 2N9DA 3I0QA 3KV9A 3QK6A 4IIJE 4DV0T 3ZMZB 2MTQA 2V7JA 5AQGB 4JI5T 3KINB 3QB5K 2FJBA 2B1EA 5DQVA 5KX5E 4DV3T 3U78A 1QUUA 4YTPA 4ADZA 3FZFB 3UTKA 2W67A 2FJDA 2XM2A 5F5WA 2IDOB 3MJXA 4GYSA 4HFEA 1ZEEA 2CXLA 4ASKA 2XTLA 3RKGA 1G73A 2ZM8A 2DI4A 5ABFA 2ACZA 3MACA 5LMNT 1S94A 4P0BA 1UUSA 2BDEA 3UFGA 2E8IA 3V5UA 5LB7B 1UGOA 4QH1A 2MPKA 4DR3T 3IA3A 3KV5A 3N9NA 2XQAA 1G8XA 1MIYA 4WBNE 4B3ST 1J5WA 5LP6E 1D0YA 2I6HA 2WQYA 3HL6A 3ZKRA 4TWFA 4IDZA 2JMHA 2KZ7B 2WS3A 2IAKA 3K3OA 2XAJB 5L3CB 2WSSV 1HF8A 2YOEA 3RYHE 3O9XA 4DR6T 4LMLA 5FXZA 5JQGE 3PUVF 2E9XC 4AI6A 5L4HA 4EAHA 1XZYA 2OLTA 2RPAA 4NPPA 2IUBA 4AQYT 1ZOYA 2XPKA 3FBZA 5HEHA 3P50A 1LRZA 4EGWA 2I0MA 3ZYMA 1ZHCA 3PUYF 2JRKA 3C4XA 2E5LT 5LBQB 4EEDA 3KV6A 3LK42 3JAFA 5FVLA 3O1HA 1GQEA 1HNXT 3RIUC 2VL8A 3JAEA 3KV4A 1IBLT 3ONJA 4YJ3E 2LSJA 2WY2A 1LVKA 4P0AA 1M7KA 5C2TA 3LG7A 4QXHB 3M3ZB 2PBIA 2MBGA 2A72A 3FZMB 2LSYA 4ZHQE 1FIOA 4YHHT 2ZLYA 2Q9QD 4JV5T 3EHZA 3EI0A 3UU3A 3CQXC 2KSRA 1MMAA 5LHGB 4DIDB 2M67A 3RC8A 1ZP0A 3LDQB 2XAQB 2W63A 2EHOB 4KMCA 5AQNB 2XAFB 3N9QA 4IDNA 4HGAA 1HG2A 4TX5A 3ZSTA 3FBLA 4ZZCA 1E2AA 2QYWA 2VKJA 4MFRA 4NXMT 3AE8A 3BQKA 2MOZA 3NRXA 4H9PC 1VOMA 2Z6EA 3NKZA 4MHCA 3I9YA
chains in the Genus database with same CATH topology
3GWHA 4WW0A 5EK4A 3AAAB 2VKOA 4ZI2D 4QX8B 3ZCJA 5L3EB 3RKOA 1NAFA 3AA1B 1NWMX 3K3QC 3S4UA 3RRCA 1LVFA 2HPLA 2SPCA 5GONE 3RYFE 2X51A 5L3GB 2IC6A 3ZMSB 2YEVC 3KVBA 5HWYA 3I9WA 4UV8B 2ODVA 4BJNA 4UV9B 3N2KE 2JMKA 3ZLIA 3P8CD 4PNIA 4PJMA 2X67A 3N9LA 5EZYE 4EZHA 2KLQA 3UUMA 2Q9QB 3C98B 4O2BE 5HWXA 5JREA 5DJQC 2LJLA 4KBMB 2E9XD 2CLYB 2CMRA 2H7VC 2DHRA 3VU7H 3VKHA 1CUNA 3T8OA 2K48A 4YJ2E 2UXXB 4AKIA 3ZN0B 1ZV4X 3LJCA 1ZKEA 2LEHA 5LHIB 5JDLA 3WAJA 2IC9A 5JH7E 2KNDA 4OFZA 5FXVA 4E7ZA 4PK4A 4KP3C 4H9RC 4PJNA 5HXCA 4OYJA 3BQLA 4J2CA 5LJMA 4UXNB 4AKLA 3HKCE 3RPUA 4YLHA 3CX7B 3FXDB 5LGTB 1U5PA 3KFWX 4E7SA 2X68A 3QUJA 2XUEA 5FMNA 3J9X1 4CI2B 2P9BA 4UIGA 4AKRB 3NRYA 1D1AA 4G63A 4H63H 3UUXB 2ACXA 2V7IA 5FY0A 2BVLA 4U72A 5FXWA 3KBUA 4PW8A 4I43B 2CCQA 3M65A 3Q5XA 4JUYA 4AQFC 5HXHA 3AA7B 4HE8A 3B13A 2VWAA 3ONXA 1D0ZA 5IHYA 1FMVA 2CWYA 2DCFA 1WLXA 5BMVE 3N5LA 1MMDA 3AVRA 3HA4A 5H6QB 3ESLA 4YFSA 5JR9C 2LE8A 3PU3A 5JDGA 3FXEB 4PJLA 4V1Av 2KMFA 3IEEA 1OWAA 3HKDE 2WMNA 5HAXA 2KINB 3MZKB 4ZI3C 2VKHA 3R84B 3MKDA 2HPJA 3ZMVB 2X66A 2XAHB 4NUVA 1MIVA 3DP7A 5FXXA 3N2GE 1QSDA 2Q9QC 2PFVA 2X9YA 4QXBB 3CKDA 5JDNA 1YKHB 2Y6XA 1BR0A 4UEMA 3EVYA 4GOUA 2DNXA 3RRWA 5LJNA 1Z0PA 1FMWA 3CWZB 5LHHB 4WBOA 2PG8A 2LSGA 5JDQA 3F2EA 5LG4A 4C91A 2C0SA 3IBPA 2KXPB 1MMGA 3ZCIA 3SRZA 4IE7A 3O1IA 3AAEB 1HX8A 1SA0E 2E9XB 3EDUA 4MBQA 3NZPA 4AQFA 3FHNA 1WRDA 3HKBE 2J1DG 5JRCB 3BK9A 3C4ZA 3E22E 3PUSA 2X9WA 4A56A 3ZC0A 3UT5E 3RYIE 2LOSA 4ANJA 4UVAB 4F6RC 3CPZA 3RYCE 4MLKA 2CWOA 2A3DA 2YU1A 4EZ4A 4IE0A 2XASB 2XAGB 3ANWB 3E08A 2G0UA 4H63V 3PUAA 3QC9A 1O3XA 5LYJE 4TV9E 5A1LA 1Y64B 3JC6D 4ILUA 4ISTA 4EYYR 1HCIA 5KMGP 4XBFB 3P7IA 2NW9A 4X20E 3ZYKA 4AKGA 4PK6A 4PJJA 2QA7A 5EK3A 5JDFA 2Q9QA 3ZMUB 2PJQA 2V1DB 4N78D 4ZOLE 1V9DA 4MALA 4QX7B 4ZI2C 3D0TA 4ZS3A 2D2SA 4P09A 3L3PA 1D1CA 2NTYA 4GK0E 3B57A 4BAYB 2XHEB 2CXDA 3WAKA 3GA8A 4JEHB 1WR6A 4WNKA 4DBQA 3VKGA 1EZ3A 3Q5WA 1WYCA 3K8PC 4O4LE 3J7Yq 3LBXA 4AQGA 5L3DB 4CI1B 2JJ9A 4M1PA 1MIWA 4DBRA 1D1BA 3OBVE 3UULA 4O2AE 4L5GA 1UX4A 3FB2A 4O8SA 4HEAA 4IE5A 3N9OA 3CQGB 2EHOC 5ADXL 4DO0A 3MK7C 3AVSA 4CZZB 3EDVA 2ES0A 4CQIA 2JQQA 5J2TE 2YU2A 1UX5A 4HKAA 1LKXA 4HTEA 4CXYA 1IAPA 2DWKA 3GN5B 3RH3A 1VRBA 5HXEA 4TV8E 5FP3A 2NTXA 4UELA 3AA0B 2L8KA 2N2NA 4QKNA 2RP4A 4ZI7E 4X1KE 3K3NA 3NZQA 5JVDE 3PURA 2D0UA 4CXXA 5HXRA 2NW8A 3OKQA 2N1GA 5L2LA 1MNEA 2VB6A 2W61A 2ODUA 3NBXX 2N9DA 3N9MA 3I0QA 3KV9A 2UXNB 3QK6A 4IIJE 1HTJF 4QXCB 2NP9A 1E1HB 2WM9A 3ZMZB 2KWIB 2MTQA 4PAGA 2WAUA 3ZJ2A 2X0LB 2V7JA 5LXTE 3PUQA 3N2OA 3KINB 2EHOA 1B7TA 3GMIA 1YKEB 2ZMAA 4G2AA 4QHOA 3CQCB 5E0OA 4XZCA 3ETVA 2B1EA 4UVCB 5DQVA 5KX5E 5JDMA 2WBLA 4QWNB 2XQYA 4H9SE 4OHFA 3CMLA 3U78A 1SHZC 1QUUA 3SOLA 2VKDA 3UUNA 4ADZA 4IHJE 3O1JA 4IGUA 3PTRB 2V26A 3UTKA 3I1AA 2CLYC 4U74A 1KNZA 3ANWA 3N9PA 4ZI3D 3MJXA 4FI5A 4GYSA 4PK5A 3TKLB 2K9AA 4IE4A 1ZEEA 2CXLA 4ASKA 2WWUA 4UF0B 2XTLA 4H9QC 3H3AA 4AKHA 5FY7A 4Z8XA 5J1GA 3AA6B 2VASA 3U3IA 4OYKA 1G73A 4EIWA 1BR4A 2KWHA 3ZYLA 2ZM8A 5KDMC 2DI4A 3MXZA 1HS7A 3EUHA 3MACA 3RC3A 4X1YE 1S94A 4P0BA 2A2FX 4DMVA 3W15B 4DVDA 2V7KA 2BDEA 3CX8B 1T98A 2E8IA 2JPFA 3V5UA 1BR2A 5H6RB 1H7CA 3I0OA 3IF8B 3ZPOA 2GK9A 2C5KT 2LSKA 4KUMB 3KV5A 2D0TA 3N9NA 4OK0A 1G8XA 3DJBA 5DQWA 3JC6C 1MIYA 2MYSA 2IW5B 2CE7A 5ETWA 4WBNE 4EB6E 5FNVE 3AAIA 5LP6E 2W62A 1D0YA 1D0XA 1MMNA 3V5SA 4GK5E 3L09A 3PUGA 4HFVA 2HH7A 3HL6A 3RX6A 5L3FB 1UCUA 4IDZA 2JMHA 2L3LA 2KZ7B 2IAKA 2YK0A 2Y48B 2VK9A 1BR1A 3K3OA 3C51A 2XAJB 5J2UE 5L3CB 2WSSV 1HF8A 2ZM0A 1HFAA 5EK2A 5CA0E 5M4YA 1IZNB 2W00A 4ERRA 3RYHE 1IJ5A 3O9XA 2LM9A 5LA6E 5FXZA 5JQGE 2WMOA 4PFOA 5JR9B 2E9XC 2CEAA 2ZM2A 3H37A 4AI6A 2BVMA 5JDHA 5AFUL 3F31A 4EAHA 4H9OC 2YINA 3OYZA 5FY1A 4PFPA 2RA1A 3LK2B 4BJMA 4C90A 2CM0A 3F57A 2EHOD 4O4IE 3HI2A 3FBZA 3R6NA 3BQIA 3HKEE 2X9XA 3LK3B 2W0GA 3CVRA 4AXPA 1LRZA 1OXZA 2K5BB 4GIWA 3VHLA 3MA9A 3ZYMA 1ZHCA 2JRKA 3C4XA 3E0ZA 3LBXB 5LBQB 4TZ4C 4ZS2A 2BZBA 4I55E 3ZN1B 4JEUB 3KV6A 4NUUA 5LBMA 3LK42 2QGSA 3KBTA 3PE0A 3UFEA 2K24A 4TUYE 2LSIA 2NW7A 3OYXA 1YW0A 5LGUB 4HN9A 1U4QA 2Y8DA 3O1HA 5HXSA 2LOPA 4UF0A 2E9XA 3ETUA 4EOZB 2VL8A 2KT9A 5JRCA 3KV4A 3LFMA 4ISSA 5LNKA 4YJ3E 2LSJA 4L9IA 4JLEA 1LVKA 3IHRA 1HG5A 4P0AA 1MNDA 2C5JA 3AB3B 3WI3A 1S35A 3LG7A 4O4HE 3Q9DA 3OJAA 3Q2MA 2LHNA 4QXHB 5TAOA 2CA5A 5IYZE 2PBIA 1FEWA 2MBGA 4CXWA 2D5UA 4IE6A 4EYUA 5CB4E 2NOXA 2A72A 1AJ3A 4BA9A 2LSYA 4ZHQE 1FIOA 4X1IE 2ZLYA 5LGNB 2Q9QD 3KDSE 5FYMA 2V7LA 2H7OA 4B6XA 5LCYA 3CQXC 2C5IT 4UVBB 3A5XA 4GYRA 1MMAA 4I4TE 2NWBA 2CXFA 5LHGB 2M67A 4YHJA 3SWHA 3RC8A 3C4WA 1IJ6A 4CI3B 2XAQB 2W63A 1WYBA 2DLRA 2EHOB 5F8PA 5HYAA 3C64A 4KMCA 5F3JA 2H3RA 2XAFB 3N9QA 4L0RA 2LT3A 3ZEFB 3ZMTB 4HGAA 4TN7B 4DNDA 1HG2A 2L9QA 1YD8G 4TX5A 2LHRA 3FBLA 4EXTA 4DMWA 5L3BB 3HR0A 3O4XE 4FJOA 2VKJA 3ZC1A 4MFRA 4K0UA 3PU8A 5CA1E 3BQKA 3CX6B 3PDYA 3ZJ1A 2MOZA 3NRXA 1X79A 4H9PC 2OA5A 1US7B 4H9NC 5JR9A 4O4JE 1KK7A 1VOMA 5DABA 5C8YE 5LOVE 4XAXB 2Z6EA 2I59A 4I50E 3SS1A 3KVAA 4MHCA 2DWGA 2V7MA 3I9YA 2X9HA 3C50A 3GN5A 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAI A;  5LCY A;  2HH7 A;  4ADZ A;  5FMN A;  5LBM A;  4M1P A;  4UIG A; 
#chains in the Genus database with same CATH topology
 3GWH A;  2VKO A;  5CGM A;  3ZCJ A;  5L3E B;  3AA1 B;  4OX9 T;  1NWM X;  1XMQ T;  3RYF E;  2X51 A;  3ZMS B;  3KVB A;  3I9W A;  3ZLI A;  2JMK A;  4EZH A;  2KLQ A;  2X0H A;  4O2B E;  5JRE A;  2E9X D;  2H7V C;  1CUN A;  2K48 A;  1ZV4 X;  2IC9 A;  5JH7 E;  4E7Z A;  2XQ7 A;  4KP3 C;  4H9R C;  4PJN A;  2VUR A;  3RPU A;  4CI2 B;  3TLT A;  2H89 A;  1D1A A;  4H63 H;  2HN2 A;  4PW8 A;  3M65 A;  4HWI B;  3B13 A;  1FMV A;  2DCF A;  3P4P A;  5BMV E;  3AVR A;  5H6Q B;  2V6Y B;  3PU3 A;  3VR9 A;  3FXE B;  4PJL A;  2KMF A;  4ZXL A;  5HAX A;  2KIN B;  2LRL A;  2VKH A;  3R84 B;  3AEG A;  3ZMV B;  3DP7 A;  5FXX A;  2NR4 A;  2XQ5 A;  5JDN A;  2Y6X A;  1BR0 A;  4GOU A;  2QVA A;  3RRW A;  1Z0P A;  3LSV A;  5LHH B;  2LSG A;  2C0S A;  3X1D A;  4IE7 A;  4NXN T;  2WZH A;  3EDU A;  4AQF A;  3FHN A;  3PUS A;  3ZC0 A;  1J5E T;  4ANJ A;  2A3D A;  4IDO A;  2BS4 A;  2XAG B;  4B3R T;  3VR8 A;  2G0U A;  3PUA A;  3QC9 A;  1Y64 B;  3JC6 D;  4ILU A;  3P7I A;  2UXB T;  4AKG A;  3FZK B;  4PJJ A;  5EK3 A;  5JDF A;  2LM2 A;  2V1D B;  4YSZ A;  4MAL A;  4JI4 T;  2NTY A;  3WAK A;  4JEH B;  3UU6 A;  5AQQ B;  3G06 A;  4AQG A;  5L3D B;  4CI1 B;  2JJ9 A;  4M1P A;  4DR4 T;  4O8S A;  3N9O A;  2EHO C;  5ADX L;  2BS2 A;  2BG9 B;  4JI2 T;  4JI1 T;  4CQI A;  4HTE A;  4CXY A;  4JI0 T;  2WDQ A;  2M6B A;  3CIR A;  2N2N A;  2LRK A;  3K3N A;  3P4W A;  4YSY A;  1I6Z A;  4TWH A;  5L2L A;  1MNE A;  2VB6 A;  3RLF F;  1HTJ F;  4QXC B;  1VCT A;  2BG9 E;  5KXJ A;  3PUQ A;  4QHO A;  4UVC B;  2XQY A;  3CML A;  1SHZ C;  4JI6 T;  3O1J A;  2V26 A;  3AEE A;  4YTM A;  2E2A A;  1KNZ A;  2W4X A;  5ABG A;  2FUP A;  1UUR A;  3H3A A;  1HX1 B;  5FY7 A;  5AQL B;  5J1G A;  3AA6 B;  4X65 T;  4HFB A;  3U3I A;  1I94 T;  1YXR A;  4OYK A;  4EIW A;  1BR4 A;  5KDM C;  3EUH A;  1OED B;  3RC3 A;  4DMV A;  2V7K A;  1T98 A;  2JPF A;  2C5K T;  2LSK A;  4KUM B;  2D0T A;  1N36 T;  3DJB A;  2MYS A;  3Q5E A;  4K0K T;  3RQU A;  4CN4 A;  4EB6 E;  2CPT A;  2IIU A;  5FNV E;  3JAD A;  2XSB A;  1MMN A;  3V5S A;  4B3M T;  4GK5 E;  3L09 A;  3PUG A;  5AQK B;  1CHU A;  2VK9 A;  1BR1 A;  4YT0 A;  1OED E;  5M4Y A;  5FVK A;  2W00 A;  1IJ5 A;  2LM9 A;  2DL1 A;  2CEA A;  3H37 A;  3H3M A;  5HEU A;  4UR9 A;  3P4R A;  2CM0 A;  2EHO D;  3TLU A;  3BQI A;  4JI3 T;  3LK3 B;  2K5B B;  4U33 A;  3VHL A;  1NEK A;  3LBX B;  4Z90 A;  5AQV B;  3KBT A;  3OYX A;  1YW0 A;  3L8R A;  1HNZ T;  2AXD S;  2V5D A;  4LF8 T;  2E9X A;  2KT9 A;  4ISS A;  5LNK A;  3IHR A;  2BBJ A;  2BG9 C;  1OED A;  4O4H E;  3Q9D A;  3OJA A;  2JQ9 A;  2LHN A;  5IWA T;  4JYA T;  4CXW A;  4EYU A;  2NOX A;  3AXJ B;  3KDS E;  2H7O A;  3UU8 A;  4B6X A;  4X5T A;  2C5I T;  1IBM T;  5ABE A;  3SWH A;  1IJ6 A;  5HYA A;  2A9U A;  2JQH A;  5F3J A;  3ZEF B;  4TN7 B;  2L9Q A;  3RIU A;  5L3B B;  3HR0 A;  2X0Y A;  5J0Z A;  4DV1 T;  3ZJ1 A;  1X79 A;  2OA5 A;  1SUM B;  4O4J E;  4LF9 T;  5LOV E;  2IML A;  5AQP B;  4WW0 A;  3AAA B;  2VVN A;  3FZH B;  2B76 A;  1NAF A;  4U2Y A;  2HPL A;  3AEB A;  5CFB A;  4ILA A;  4B3T T;  4LFB T;  5AQS B;  3ABV A;  4F8H A;  3P8C D;  1OED C;  2J47 A;  3UUM A;  2UXD T;  4DV2 T;  3LJC A;  1ZKE A;  5LHI B;  5JDL A;  3ONL C;  2XSA A;  5LJM A;  4UXN B;  4AKL A;  5LGT B;  1U5P A;  4DV5 T;  3EAM A;  2X68 A;  2XUE A;  5FMN A;  3J9X 1;  2P9B A;  4AKR B;  5FY0 A;  2BVL A;  3AXJ A;  4U72 A;  5HXH A;  2CWY A;  2UU9 T;  3ESL A;  3OVU A;  1KNP A;  2XM1 A;  5JDG A;  1YQ3 A;  3HKD E;  4ZI3 C;  3UUB A;  5AQM B;  4NUV A;  1MIV A;  1X9B A;  3CKD A;  1YKH B;  2WP9 A;  1IBK T;  4WBO A;  5JDQ A;  5LG4 A;  1MMG A;  4JI8 T;  3AAE B;  1SA0 E;  3HKB E;  2J1D G;  5JRC B;  2YDR A;  3BK9 A;  2X9W A;  4A56 A;  3UT5 E;  5HEG A;  3RYI E;  5AQH B;  4UVA B;  3RYC E;  2CWO A;  4IE0 A;  5LG3 A;  1XWM A;  2XJ7 A;  5A1L A;  4EYY R;  4EV6 A;  5KMG P;  4XBF B;  3ZYK A;  4CN6 A;  4PK6 A;  2JIW A;  2QA7 A;  4HWD A;  2PJQ A;  3OPC A;  4ZOL E;  1V9D A;  4ZI2 C;  4BAY B;  1WR6 A;  4DBQ A;  5LMU T;  1EZ3 A;  1WYC A;  3J7Y q;  4DBR A;  1D1B A;  4ILB A;  3UUL A;  4L5G A;  4IE5 A;  1W9R A;  3MK7 C;  3AVS A;  3AEF A;  2JQQ A;  2YU2 A;  4KHP T;  1UX5 A;  2CRB A;  5HCJ A;  1IAP A;  2DWK A;  4TWD A;  3GN5 B;  3RH3 A;  4TV8 E;  2NTX A;  4YY3 T;  5CJ5 A;  4QKN A;  4DR7 T;  2RP4 A;  4ZI7 E;  1XDO A;  4HFI A;  4CXX A;  3OKQ A;  4Z91 A;  2N1G A;  4DV6 T;  2UXN B;  4HWC A;  4X66 T;  2NP9 A;  2LLY A;  1E1H B;  4LF5 T;  4HWH A;  4PAG A;  5LXT E;  2EHO A;  1B7T A;  1YKE B;  4G2A A;  3P4Q A;  4U3C A;  2UUB T;  3CQC B;  1VCS A;  2WBL A;  4QWN B;  4H9S E;  4YXD A;  3SOL A;  2VKD A;  3UUN A;  1WR0 A;  4U74 A;  1E7P A;  3N9P A;  4ZI3 D;  4PK5 A;  4IE4 A;  2WWU A;  4UF0 B;  4U7Y A;  4H9Q C;  4HFC A;  1Y01 A;  1UK5 A;  3JCF A;  3UQ4 A;  4Z8X A;  4DR2 T;  3PV0 F;  2KWH A;  1HS7 A;  4X1Y E;  3W15 B;  4DVD A;  1T72 A;  3CX8 B;  5H6R B;  3TLW A;  1H7C A;  3IF8 B;  4U31 A;  3ZPO A;  2W2U A;  5DQW A;  2IW5 B;  2CE7 A;  1YQ4 A;  4Q25 A;  5BR8 T;  3AAI A;  2R6G F;  2HH7 A;  3RX6 A;  1UCU A;  3L39 A;  2BKO A;  2Y48 B;  5J2U E;  3OTO T;  3UU5 A;  5CA0 E;  1IZN B;  1JNZ A;  4ERR A;  1JNR A;  5LA6 E;  3AE3 A;  4EEB A;  5JR9 B;  4TNV A;  2ZM2 A;  5JDH A;  3F31 A;  3QNU A;  5FY1 A;  4PFP A;  2RA1 A;  2HHH T;  4C90 A;  2V6Y A;  3PUZ F;  1WFD A;  4DV4 T;  4O4I E;  3HI2 A;  3R6N A;  2VL0 A;  5L4E A;  3HKE E;  2X9X A;  2W0G A;  4AXP A;  3PUX F;  2V8S V;  3MA9 A;  4IRE A;  2LKH A;  2XQ6 A;  5HEO A;  3E0Z A;  2BZB A;  4I55 E;  3AE1 A;  4JEU B;  5FL0 A;  2K24 A;  4TUY E;  2NW7 A;  5LGU B;  4HN9 A;  1U4Q A;  2LOP A;  4UF0 A;  3ETU A;  3LFM A;  1N33 T;  1HG5 A;  4AIS A;  1MND A;  2WZI A;  2C5J A;  3AB3 B;  2PTF A;  3WI3 A;  3AE6 A;  5TAO A;  1FEW A;  4IE6 A;  3B5M A;  3A7M A;  2LKG A;  4X1I E;  4COF A;  5LGN B;  5FYM A;  4KHZ F;  4UVB B;  4GYR A;  2NWB A;  3C4W A;  1DU2 A;  5AQO B;  1WYB A;  5F8P A;  4HFD A;  5AQJ B;  2H3R A;  4L0R A;  2LT3 A;  2J4G A;  1YD8 G;  1HR0 T;  4EXT A;  3O4X E;  4FJO A;  4K0U A;  5CA1 E;  3CX6 B;  2BG9 A;  5JR9 A;  4H9N C;  1US7 B;  1KK7 A;  5C8Y E;  3A8Y C;  2I59 A;  4I50 E;  3KVA A;  4AIU A;  2DWG A;  2V7M A;  3DTO A;  5EK4 A;  4DR5 T;  1Z8U A;  3RHW A;  1XMO T;  3K3Q C;  3RIA A;  3Q5D A;  3S4U A;  1LVF A;  2SPC A;  4IDQ A;  5GON E;  2IC6 A;  2JQK A;  1T7S A;  3CK6 A;  2ODV A;  4BJN A;  4UV9 B;  3N2K E;  2WDR A;  4PJM A;  5AQR B;  3C98 B;  5DJQ C;  2LJL A;  4KBM B;  2CLY B;  2CMR A;  3T8O A;  2XQ9 A;  2UXX B;  2LEH A;  4CN1 A;  2KND A;  4OFZ A;  4PK4 A;  3UQ7 A;  4A98 A;  3NVO A;  5HXC A;  4J2C A;  3CX7 B;  3FXD B;  2E5V A;  3KFW X;  2YDQ A;  4UIG A;  3NRY A;  4JBW F;  3T1H T;  2V7I A;  5FXW A;  3RQW A;  4I43 B;  3Q5X A;  4JUY A;  2VWA A;  1D0Z A;  5IHY A;  1WLX A;  3N5L A;  2XQ3 A;  1MMD A;  3HA4 A;  4YFS A;  5JR9 C;  4V1A v;  3IEE A;  3MZK B;  1XNR T;  3MKD A;  2HPJ A;  3QOF A;  2X66 A;  3N2G E;  1QSD A;  2Q9Q C;  2PFV A;  2X9Y A;  4QXB B;  5FL1 A;  1HNW T;  3EVY A;  2DNX A;  2PG8 A;  4A97 A;  4C91 A;  3IBP A;  2KXP B;  1XNQ T;  4U2Z A;  1HX8 A;  1SE7 A;  3PUW F;  4A5X A;  2BKN A;  3AEA A;  2LOS A;  4F6R C;  3CPZ A;  3ZSS A;  4EZ4 A;  3ANW B;  3E08 A;  1O3X A;  5LYJ E;  1W0A A;  4KI0 F;  4WZX A;  1HCI A;  2NW9 A;  4X20 E;  4IL9 A;  3ZMU B;  4N78 D;  4KX6 A;  3D0T A;  2D2S A;  3L3P A;  4GK0 E;  3VKG A;  3Q5W A;  3K8P C;  4O4L E;  3LBX A;  1MIW A;  5C3J A;  4LF4 T;  4O2A E;  3FB2 A;  3PJA A;  3CQG B;  2YKS A;  2FJA A;  3EDV A;  5J2T E;  4HKA A;  1N34 T;  1WCR A;  1VRB A;  5HXE A;  1NEN A;  5FP3 A;  2XY8 B;  3AA0 B;  2L8K A;  5JVD E;  3NZQ A;  4WYV A;  1L0V A;  2MAW A;  3NBX X;  3N9M A;  4HWF A;  2UUC T;  2WM9 A;  2KWI B;  1QLB A;  1M62 A;  2WAU A;  3ZJ2 A;  2X0L B;  2WU2 A;  3N2O A;  3GMI A;  2ZMA A;  5E0O A;  4XZC A;  3ETV A;  1XDP A;  5JDM A;  4OHF A;  3PJA J;  4IHJ E;  4IGU A;  4IT4 A;  3PTR B;  3I1A A;  4JI7 T;  2CLY C;  4ZZB A;  3ANW A;  2FBW A;  3TKL B;  4FI5 A;  2K9A A;  3AE7 A;  4ZEY A;  2XZE A;  2K3W A;  4X62 T;  3EAB A;  4AKH A;  2CBI A;  2VAS A;  3ZYL A;  3MXZ A;  4TNW A;  2A2F X;  3VRB A;  4DR1 T;  5FKY A;  3K1S A;  1BR2 A;  1W0B A;  3I0O A;  2AE9 A;  2GK9 A;  4OK0 A;  3JC6 C;  2VQE T;  2YN6 A;  3ZT5 A;  3AE9 A;  5ETW A;  2V6X A;  2W62 A;  1D0X A;  3T1Y T;  4HFV A;  4QH5 A;  2HN1 A;  5L3F B;  4DUZ T;  2L3L A;  1KFY A;  3ZT7 A;  2YK0 A;  3C51 A;  2WB5 A;  2ZM0 A;  1HFA A;  5EK2 A;  3AE5 A;  4QH4 A;  1W09 A;  2WMO A;  3QB5 A;  4PFO A;  4LFA T;  1KEY A;  2BVM A;  5AFU L;  4H9O C;  2YIN A;  3OYZ A;  3UU4 A;  4DUY T;  5HCM A;  3LK2 B;  4BJM A;  3F57 A;  2WCA A;  3CVR A;  1OXZ A;  4GIW A;  2UXC T;  4NIQ A;  4TZ4 C;  4ZS2 A;  3AE4 A;  3ZN1 B;  4NUU A;  4U7I A;  5LBM A;  2QGS A;  3PE0 A;  3UFE A;  1N32 T;  2LSI A;  2Y8D A;  5HXS A;  4YTN A;  4EOZ B;  5JRC A;  3RI5 A;  4L9I A;  4JLE A;  2ZM6 T;  2QRX A;  1S35 A;  3Q2M A;  2CA5 A;  5IYZ E;  2D5U A;  3RF1 A;  5CB4 E;  1AJ3 A;  4BA9 A;  5AQI B;  2V7L A;  5LCY A;  3A5X A;  4IL4 A;  4I4T E;  4P1N A;  3ZT6 A;  2CXF A;  4YHJ A;  3TLV A;  4CI3 B;  2F4V T;  2DLR A;  3C64 A;  3ZMT B;  2BKP A;  4DND A;  1KF6 A;  2WDV A;  2LHR A;  3SFE A;  4DMW A;  3ZC1 A;  3PU8 A;  3PDY A;  4LMK A;  3VRA A;  5DAB A;  4XAX B;  4I0U A;  2XQ4 A;  3SS1 A;  4LFC T;  2CBJ A;  2X9H A;  2DHR A;  3C50 A;  3GN5 A;  5AQU B;  4ZI2 D;  4QX8 B;  3RGL A;  3RKO A;  2M6I A;  3RRC A;  2J62 A;  3AE2 A;  1FJG T;  5L3G B;  2BS3 A;  2YEV C;  4YSX A;  5HWY A;  4UV8 B;  4GKJ T;  2IHR 1;  4PNI A;  2X67 A;  3N9L A;  5EZY E;  2WWV A;  2Q9Q B;  3TLS A;  5HWX A;  2OV9 A;  3VU7 H;  4IDP A;  3VKH A;  4YJ2 E;  4AKI A;  3ZN0 B;  2FJE A;  5AQT B;  3WAJ A;  5FXV A;  1T8B A;  4LF7 T;  4OYJ A;  3BQL A;  3HKC E;  4YLH A;  4E7S A;  3QUJ A;  2VQF T;  4G63 A;  3UUX B;  2ACX A;  4DV7 T;  3KBU A;  2CCQ A;  4AQF C;  3AA7 B;  4HE8 A;  3ONX A;  2BBH A;  4HFH A;  2LE8 A;  5AQF B;  1OWA A;  2WMN A;  3FZL B;  5HEJ A;  2XAH B;  5JTG A;  3P4S A;  4LF6 T;  4UEM A;  5IUX A;  5ABH A;  5LJN A;  1FMW A;  3CWZ B;  3F2E A;  1KNR A;  3ZCI A;  1J1J A;  3SRZ A;  3O1I A;  2E9X B;  2WU5 A;  4MBQ A;  3NZP A;  1WRD A;  3C4Z A;  3E22 E;  3AEC A;  4ILC A;  4MLK A;  2YU1 A;  2XAS B;  2XQ8 A;  4H63 V;  4TV9 E;  4IST A;  2D9D A;  2H88 A;  2Q9Q A;  1R8I A;  2W66 A;  4GKK T;  4QX7 B;  4ZS3 A;  4P09 A;  5ABF B;  1D1C A;  3B57 A;  3AED A;  2XHE B;  2CXD A;  3GA8 A;  4WNK A;  5L47 A;  2CHN A;  3RIF A;  3OBV E;  2V5C A;  1UX4 A;  4HEA A;  4DO0 A;  4CZZ B;  4LMJ A;  2ES0 A;  4X64 T;  2UUA T;  1LKX A;  3SFD A;  3NWI A;  4UEL A;  2VVS A;  4X1K E;  3PUR A;  2D0U A;  5HXR A;  2NW8 A;  2CHO A;  2YDS A;  2W61 A;  2ODU A;  2N9D A;  3I0Q A;  3KV9 A;  3QK6 A;  4IIJ E;  4DV0 T;  3ZMZ B;  2MTQ A;  2V7J A;  5AQG B;  4JI5 T;  3KIN B;  3QB5 K;  2FJB A;  2B1E A;  5DQV A;  5KX5 E;  4DV3 T;  3U78 A;  1QUU A;  4YTP A;  4ADZ A;  3FZF B;  3UTK A;  2W67 A;  2FJD A;  2XM2 A;  5F5W A;  2IDO B;  3MJX A;  4GYS A;  4HFE A;  1ZEE A;  2CXL A;  4ASK A;  2XTL A;  3RKG A;  1G73 A;  2ZM8 A;  2DI4 A;  5ABF A;  2ACZ A;  3MAC A;  5LMN T;  1S94 A;  4P0B A;  1UUS A;  2BDE A;  3UFG A;  2E8I A;  3V5U A;  5LB7 B;  1UGO A;  4QH1 A;  2MPK A;  4DR3 T;  3IA3 A;  3KV5 A;  3N9N A;  2XQA A;  1G8X A;  1MIY A;  4WBN E;  4B3S T;  1J5W A;  5LP6 E;  1D0Y A;  2I6H A;  2WQY A;  3HL6 A;  3ZKR A;  4TWF A;  4IDZ A;  2JMH A;  2KZ7 B;  2WS3 A;  2IAK A;  3K3O A;  2XAJ B;  5L3C B;  2WSS V;  1HF8 A;  2YOE A;  3RYH E;  3O9X A;  4DR6 T;  4LML A;  5FXZ A;  5JQG E;  3PUV F;  2E9X C;  4AI6 A;  5L4H A;  4EAH A;  1XZY A;  2OLT A;  2RPA A;  4NPP A;  2IUB A;  4AQY T;  1ZOY A;  2XPK A;  3FBZ A;  5HEH A;  3P50 A;  1LRZ A;  4EGW A;  2I0M A;  3ZYM A;  1ZHC A;  3PUY F;  2JRK A;  3C4X A;  2E5L T;  5LBQ B;  4EED A;  3KV6 A;  3LK4 2;  3JAF A;  5FVL A;  3O1H A;  1GQE A;  1HNX T;  3RIU C;  2VL8 A;  3JAE A;  3KV4 A;  1IBL T;  3ONJ A;  4YJ3 E;  2LSJ A;  2WY2 A;  1LVK A;  4P0A A;  1M7K A;  5C2T A;  3LG7 A;  4QXH B;  3M3Z B;  2PBI A;  2MBG A;  2A72 A;  3FZM B;  2LSY A;  4ZHQ E;  1FIO A;  4YHH T;  2ZLY A;  2Q9Q D;  4JV5 T;  3EHZ A;  3EI0 A;  3UU3 A;  3CQX C;  2KSR A;  1MMA A;  5LHG B;  4DID B;  2M67 A;  3RC8 A;  1ZP0 A;  3LDQ B;  2XAQ B;  2W63 A;  2EHO B;  4KMC A;  5AQN B;  2XAF B;  3N9Q A;  4IDN A;  4HGA A;  1HG2 A;  4TX5 A;  3ZST A;  3FBL A;  4ZZC A;  1E2A A;  2QYW A;  2VKJ A;  4MFR A;  4NXM T;  3AE8 A;  3BQK A;  2MOZ A;  3NRX A;  4H9P C;  1VOM A;  2Z6E A;  3NKZ A;  4MHC A;  3I9Y A; 
#chains in the Genus database with same CATH homology
 3GWH A;  4WW0 A;  5EK4 A;  3AAA B;  2VKO A;  4ZI2 D;  4QX8 B;  3ZCJ A;  5L3E B;  3RKO A;  1NAF A;  3AA1 B;  1NWM X;  3K3Q C;  3S4U A;  3RRC A;  1LVF A;  2HPL A;  2SPC A;  5GON E;  3RYF E;  2X51 A;  5L3G B;  2IC6 A;  3ZMS B;  2YEV C;  3KVB A;  5HWY A;  3I9W A;  4UV8 B;  2ODV A;  4BJN A;  4UV9 B;  3N2K E;  2JMK A;  3ZLI A;  3P8C D;  4PNI A;  4PJM A;  2X67 A;  3N9L A;  5EZY E;  4EZH A;  2KLQ A;  3UUM A;  2Q9Q B;  3C98 B;  4O2B E;  5HWX A;  5JRE A;  5DJQ C;  2LJL A;  4KBM B;  2E9X D;  2CLY B;  2CMR A;  2H7V C;  2DHR A;  3VU7 H;  3VKH A;  1CUN A;  3T8O A;  2K48 A;  4YJ2 E;  2UXX B;  4AKI A;  3ZN0 B;  1ZV4 X;  3LJC A;  1ZKE A;  2LEH A;  5LHI B;  5JDL A;  3WAJ A;  2IC9 A;  5JH7 E;  2KND A;  4OFZ A;  5FXV A;  4E7Z A;  4PK4 A;  4KP3 C;  4H9R C;  4PJN A;  5HXC A;  4OYJ A;  3BQL A;  4J2C A;  5LJM A;  4UXN B;  4AKL A;  3HKC E;  3RPU A;  4YLH A;  3CX7 B;  3FXD B;  5LGT B;  1U5P A;  3KFW X;  4E7S A;  2X68 A;  3QUJ A;  2XUE A;  5FMN A;  3J9X 1;  4CI2 B;  2P9B A;  4UIG A;  4AKR B;  3NRY A;  1D1A A;  4G63 A;  4H63 H;  3UUX B;  2ACX A;  2V7I A;  5FY0 A;  2BVL A;  4U72 A;  5FXW A;  3KBU A;  4PW8 A;  4I43 B;  2CCQ A;  3M65 A;  3Q5X A;  4JUY A;  4AQF C;  5HXH A;  3AA7 B;  4HE8 A;  3B13 A;  2VWA A;  3ONX A;  1D0Z A;  5IHY A;  1FMV A;  2CWY A;  2DCF A;  1WLX A;  5BMV E;  3N5L A;  1MMD A;  3AVR A;  3HA4 A;  5H6Q B;  3ESL A;  4YFS A;  5JR9 C;  2LE8 A;  3PU3 A;  5JDG A;  3FXE B;  4PJL A;  4V1A v;  2KMF A;  3IEE A;  1OWA A;  3HKD E;  2WMN A;  5HAX A;  2KIN B;  3MZK B;  4ZI3 C;  2VKH A;  3R84 B;  3MKD A;  2HPJ A;  3ZMV B;  2X66 A;  2XAH B;  4NUV A;  1MIV A;  3DP7 A;  5FXX A;  3N2G E;  1QSD A;  2Q9Q C;  2PFV A;  2X9Y A;  4QXB B;  3CKD A;  5JDN A;  1YKH B;  2Y6X A;  1BR0 A;  4UEM A;  3EVY A;  4GOU A;  2DNX A;  3RRW A;  5LJN A;  1Z0P A;  1FMW A;  3CWZ B;  5LHH B;  4WBO A;  2PG8 A;  2LSG A;  5JDQ A;  3F2E A;  5LG4 A;  4C91 A;  2C0S A;  3IBP A;  2KXP B;  1MMG A;  3ZCI A;  3SRZ A;  4IE7 A;  3O1I A;  3AAE B;  1HX8 A;  1SA0 E;  2E9X B;  3EDU A;  4MBQ A;  3NZP A;  4AQF A;  3FHN A;  1WRD A;  3HKB E;  2J1D G;  5JRC B;  3BK9 A;  3C4Z A;  3E22 E;  3PUS A;  2X9W A;  4A56 A;  3ZC0 A;  3UT5 E;  3RYI E;  2LOS A;  4ANJ A;  4UVA B;  4F6R C;  3CPZ A;  3RYC E;  4MLK A;  2CWO A;  2A3D A;  2YU1 A;  4EZ4 A;  4IE0 A;  2XAS B;  2XAG B;  3ANW B;  3E08 A;  2G0U A;  4H63 V;  3PUA A;  3QC9 A;  1O3X A;  5LYJ E;  4TV9 E;  5A1L A;  1Y64 B;  3JC6 D;  4ILU A;  4IST A;  4EYY R;  1HCI A;  5KMG P;  4XBF B;  3P7I A;  2NW9 A;  4X20 E;  3ZYK A;  4AKG A;  4PK6 A;  4PJJ A;  2QA7 A;  5EK3 A;  5JDF A;  2Q9Q A;  3ZMU B;  2PJQ A;  2V1D B;  4N78 D;  4ZOL E;  1V9D A;  4MAL A;  4QX7 B;  4ZI2 C;  3D0T A;  4ZS3 A;  2D2S A;  4P09 A;  3L3P A;  1D1C A;  2NTY A;  4GK0 E;  3B57 A;  4BAY B;  2XHE B;  2CXD A;  3WAK A;  3GA8 A;  4JEH B;  1WR6 A;  4WNK A;  4DBQ A;  3VKG A;  1EZ3 A;  3Q5W A;  1WYC A;  3K8P C;  4O4L E;  3J7Y q;  3LBX A;  4AQG A;  5L3D B;  4CI1 B;  2JJ9 A;  4M1P A;  1MIW A;  4DBR A;  1D1B A;  3OBV E;  3UUL A;  4O2A E;  4L5G A;  1UX4 A;  3FB2 A;  4O8S A;  4HEA A;  4IE5 A;  3N9O A;  3CQG B;  2EHO C;  5ADX L;  4DO0 A;  3MK7 C;  3AVS A;  4CZZ B;  3EDV A;  2ES0 A;  4CQI A;  2JQQ A;  5J2T E;  2YU2 A;  1UX5 A;  4HKA A;  1LKX A;  4HTE A;  4CXY A;  1IAP A;  2DWK A;  3GN5 B;  3RH3 A;  1VRB A;  5HXE A;  4TV8 E;  5FP3 A;  2NTX A;  4UEL A;  3AA0 B;  2L8K A;  2N2N A;  4QKN A;  2RP4 A;  4ZI7 E;  4X1K E;  3K3N A;  3NZQ A;  5JVD E;  3PUR A;  2D0U A;  4CXX A;  5HXR A;  2NW8 A;  3OKQ A;  2N1G A;  5L2L A;  1MNE A;  2VB6 A;  2W61 A;  2ODU A;  3NBX X;  2N9D A;  3N9M A;  3I0Q A;  3KV9 A;  2UXN B;  3QK6 A;  4IIJ E;  1HTJ F;  4QXC B;  2NP9 A;  1E1H B;  2WM9 A;  3ZMZ B;  2KWI B;  2MTQ A;  4PAG A;  2WAU A;  3ZJ2 A;  2X0L B;  2V7J A;  5LXT E;  3PUQ A;  3N2O A;  3KIN B;  2EHO A;  1B7T A;  3GMI A;  1YKE B;  2ZMA A;  4G2A A;  4QHO A;  3CQC B;  5E0O A;  4XZC A;  3ETV A;  2B1E A;  4UVC B;  5DQV A;  5KX5 E;  5JDM A;  2WBL A;  4QWN B;  2XQY A;  4H9S E;  4OHF A;  3CML A;  3U78 A;  1SHZ C;  1QUU A;  3SOL A;  2VKD A;  3UUN A;  4ADZ A;  4IHJ E;  3O1J A;  4IGU A;  3PTR B;  2V26 A;  3UTK A;  3I1A A;  2CLY C;  4U74 A;  1KNZ A;  3ANW A;  3N9P A;  4ZI3 D;  3MJX A;  4FI5 A;  4GYS A;  4PK5 A;  3TKL B;  2K9A A;  4IE4 A;  1ZEE A;  2CXL A;  4ASK A;  2WWU A;  4UF0 B;  2XTL A;  4H9Q C;  3H3A A;  4AKH A;  5FY7 A;  4Z8X A;  5J1G A;  3AA6 B;  2VAS A;  3U3I A;  4OYK A;  1G73 A;  4EIW A;  1BR4 A;  2KWH A;  3ZYL A;  2ZM8 A;  5KDM C;  2DI4 A;  3MXZ A;  1HS7 A;  3EUH A;  3MAC A;  3RC3 A;  4X1Y E;  1S94 A;  4P0B A;  2A2F X;  4DMV A;  3W15 B;  4DVD A;  2V7K A;  2BDE A;  3CX8 B;  1T98 A;  2E8I A;  2JPF A;  3V5U A;  1BR2 A;  5H6R B;  1H7C A;  3I0O A;  3IF8 B;  3ZPO A;  2GK9 A;  2C5K T;  2LSK A;  4KUM B;  3KV5 A;  2D0T A;  3N9N A;  4OK0 A;  1G8X A;  3DJB A;  5DQW A;  3JC6 C;  1MIY A;  2MYS A;  2IW5 B;  2CE7 A;  5ETW A;  4WBN E;  4EB6 E;  5FNV E;  3AAI A;  5LP6 E;  2W62 A;  1D0Y A;  1D0X A;  1MMN A;  3V5S A;  4GK5 E;  3L09 A;  3PUG A;  4HFV A;  2HH7 A;  3HL6 A;  3RX6 A;  5L3F B;  1UCU A;  4IDZ A;  2JMH A;  2L3L A;  2KZ7 B;  2IAK A;  2YK0 A;  2Y48 B;  2VK9 A;  1BR1 A;  3K3O A;  3C51 A;  2XAJ B;  5J2U E;  5L3C B;  2WSS V;  1HF8 A;  2ZM0 A;  1HFA A;  5EK2 A;  5CA0 E;  5M4Y A;  1IZN B;  2W00 A;  4ERR A;  3RYH E;  1IJ5 A;  3O9X A;  2LM9 A;  5LA6 E;  5FXZ A;  5JQG E;  2WMO A;  4PFO A;  5JR9 B;  2E9X C;  2CEA A;  2ZM2 A;  3H37 A;  4AI6 A;  2BVM A;  5JDH A;  5AFU L;  3F31 A;  4EAH A;  4H9O C;  2YIN A;  3OYZ A;  5FY1 A;  4PFP A;  2RA1 A;  3LK2 B;  4BJM A;  4C90 A;  2CM0 A;  3F57 A;  2EHO D;  4O4I E;  3HI2 A;  3FBZ A;  3R6N A;  3BQI A;  3HKE E;  2X9X A;  3LK3 B;  2W0G A;  3CVR A;  4AXP A;  1LRZ A;  1OXZ A;  2K5B B;  4GIW A;  3VHL A;  3MA9 A;  3ZYM A;  1ZHC A;  2JRK A;  3C4X A;  3E0Z A;  3LBX B;  5LBQ B;  4TZ4 C;  4ZS2 A;  2BZB A;  4I55 E;  3ZN1 B;  4JEU B;  3KV6 A;  4NUU A;  5LBM A;  3LK4 2;  2QGS A;  3KBT A;  3PE0 A;  3UFE A;  2K24 A;  4TUY E;  2LSI A;  2NW7 A;  3OYX A;  1YW0 A;  5LGU B;  4HN9 A;  1U4Q A;  2Y8D A;  3O1H A;  5HXS A;  2LOP A;  4UF0 A;  2E9X A;  3ETU A;  4EOZ B;  2VL8 A;  2KT9 A;  5JRC A;  3KV4 A;  3LFM A;  4ISS A;  5LNK A;  4YJ3 E;  2LSJ A;  4L9I A;  4JLE A;  1LVK A;  3IHR A;  1HG5 A;  4P0A A;  1MND A;  2C5J A;  3AB3 B;  3WI3 A;  1S35 A;  3LG7 A;  4O4H E;  3Q9D A;  3OJA A;  3Q2M A;  2LHN A;  4QXH B;  5TAO A;  2CA5 A;  5IYZ E;  2PBI A;  1FEW A;  2MBG A;  4CXW A;  2D5U A;  4IE6 A;  4EYU A;  5CB4 E;  2NOX A;  2A72 A;  1AJ3 A;  4BA9 A;  2LSY A;  4ZHQ E;  1FIO A;  4X1I E;  2ZLY A;  5LGN B;  2Q9Q D;  3KDS E;  5FYM A;  2V7L A;  2H7O A;  4B6X A;  5LCY A;  3CQX C;  2C5I T;  4UVB B;  3A5X A;  4GYR A;  1MMA A;  4I4T E;  2NWB A;  2CXF A;  5LHG B;  2M67 A;  4YHJ A;  3SWH A;  3RC8 A;  3C4W A;  1IJ6 A;  4CI3 B;  2XAQ B;  2W63 A;  1WYB A;  2DLR A;  2EHO B;  5F8P A;  5HYA A;  3C64 A;  4KMC A;  5F3J A;  2H3R A;  2XAF B;  3N9Q A;  4L0R A;  2LT3 A;  3ZEF B;  3ZMT B;  4HGA A;  4TN7 B;  4DND A;  1HG2 A;  2L9Q A;  1YD8 G;  4TX5 A;  2LHR A;  3FBL A;  4EXT A;  4DMW A;  5L3B B;  3HR0 A;  3O4X E;  4FJO A;  2VKJ A;  3ZC1 A;  4MFR A;  4K0U A;  3PU8 A;  5CA1 E;  3BQK A;  3CX6 B;  3PDY A;  3ZJ1 A;  2MOZ A;  3NRX A;  1X79 A;  4H9P C;  2OA5 A;  1US7 B;  4H9N C;  5JR9 A;  4O4J E;  1KK7 A;  1VOM A;  5DAB A;  5C8Y E;  5LOV E;  4XAX B;  2Z6E A;  2I59 A;  4I50 E;  3SS1 A;  3KVA A;  4MHC A;  2DWG A;  2V7M A;  3I9Y A;  2X9H A;  3C50 A;  3GN5 A;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...