4M1PA

Crystal structure of the copper-sensing repressor csor with cu(i) from geobacillus thermodenitrificans ng80-2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
96
structure length
96
Chain Sequence
VLHGTMIPRTKEEIENIMKRLKRIEGQVRGVQKMVEDNRYCIDILVQISAIQAALRQVGMQLLERHANHCVAKAIREGSGEQSLRELMDVIKQFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cu(I)-mediated allosteric switching in a copper-sensing operon repressor (CsoR).
pubmed doi rcsb
molecule keywords Copper-sensitive operon repressor (CsoR)
molecule tags Transcription repressor
source organism Geobacillus thermodenitrificans
total genus 40
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4m1pA00
4M1PA 5LBMA 5FMNA 4ADZA 2HH7A 3AAIA 4UIGA 5LCYA
chains in the Genus database with same CATH superfamily
3X1DA 5LCYA 5JR9C 4EYUA 1HNWT 5AQGB 2WDQA 4UR9A 1XWMA 3R6NA 2CM0A 2C5JA 3AAIA 3E08A 2V6YB 2D0TA 2HHHT 3LBXB 2LSYA 5EZYE 3AA6B 1KNPA 5HAXA 3PJAJ 3WAKA 2MOZA 3RRCA 4JI3T 2D9DA 4DV1T 2YDRA 2YN6A 2JIWA 4G2AA 3RIUC 2VVSA 4MBQA 1AJ3A 4EB6E 3L39A 5M4YA 4UVCB 1DU2A 5HCJA 4XZCA 4EIWA 5ETWA 3GN5B 2KXPB 1UUSA 4CXWA 4CN4A 2IAKA 4CQIA 4EZ4A 5H6QB 5AQQB 3B57A 3HKBE 3UFGA 5EK2A 3PV0F 3VKHA 4A5XA 1WRDA 2D0UA 4HWIB 2JPFA 3HA4A 3P8CD 4C90A 1UK5A 3K1SA 3NBXX 4X66T 3VRBA 3PUGA 4DMVA 2DWKA 4DIDB 5F5WA 1T72A 5FL0A 1HG2A 3ETUA 4PK4A 2XAHB 1WCRA 4L9IA 4CI2B 4L0RA 2B1EA 3EAMA 2LHRA 2V1DB 4EV6A 1HNXT 1IBKT 1O3XA 3Q5EA 3V5SA 1SHZC 3O1IA 3B5MA 2KT9A 4TX5A 4NXMT 3SS1A 3NZPA 3K8PC 4YTPA 2XSAA 3CX6B 3I0QA 1KFYA 1YW0A 3RQWA 3EI0A 5LA6E 4OK0A 4EEBA 2XQ8A 3ZC1A 4U2YA 1MIYA 5CA1E 1G73A 4IL4A 3OKQA 2LOPA 3I9WA 2G0UA 3UU3A 3CIRA 2WU2A 4E7ZA 3IA3A 2CHNA 1XDOA 2NW9A 2LRKA 1CHUA 4O2BE 3G06A 2KLQA 4GKJT 1NAFA 4AKGA 4OYJA 4JLEA 3AEFA 2CLYB 2BVMA 5LG3A 3UUMA 3LG7A 2XY8B 3BQIA 1WR6A 4ILBA 5JREA 5JH7E 2E9XB 4X1YE 2PG8A 1KNRA 3ZC0A 4TWFA 3Q9DA 3T1HT 3N9NA 4KBMB 3ZJ1A 5KXJA 3ESLA 4DR6T 3RGLA 4O4LE 1D1BA 1W0BA 4DBRA 4B3RT 2ODUA 1UX4A 2IDOB 5HEUA 5HEHA 2WQYA 2AXDS 4HEAA 3VHLA 1HX1B 3F57A 2D2SA 5LGTB 2E9XC 2H89A 3UU5A 3LK3B 4G63A 3KBUA 2W66A 2WMNA 3DP7A 4ILAA 2JRKA 3QC9A 5FYMA 1WLXA 2WB5A 1I6ZA 3UFEA 1IJ6A 4GYSA 4KHZF 4H63H 3FHNA 2VQFT 1MNDA 4M1PA 3RHWA 4IDOA 3UUBA 3AB3B 5JDLA 4ZS3A 5EK4A 2UXXB 4DR7T 3AE5A 3NKZA 5A1LA 2VKOA 3ZLIA 3BK9A 4GKKT 4AXPA 1YKEB 5L3DB 4TUYE 5AQKB 2ZM6T 2W2UA 1UURA 5AQTB 1J5ET 1M62A 4N78D 4GK0E 3W15B 4YXDA 2DHRA 2M6IA 4EXTA 3ETVA 3PUQA 4JV5T 4YJ3E 2XSBA 2KWHA 4CI3B 2FUPA 3J9X1 5DJQC 4LFAT 2Z6EA 1MMAA 2LJLA 3K3OA 4HTEA 2BKNA 3OBVE 3QOFA 4V1Av 4X62T 1MIVA 4IGUA 4O4IE 2JMHA 5DABA 4LMLA 1WYBA 4H9OC 4YHHT 2VL0A 2N1GA 3RYHE 4HE8A 3FXDB 1MMNA 1D1AA 2BG9A 4ZI2D 2PFVA 3WAJA 4LF9T 4ISTA 3FZLB 5CJ5A 5LJNA 4L5GA 2IUBA 4DVDA 3PTRB 4HFBA 3L8RA 4X1KE 2HPLA 3OYXA 3SRZA 4H9QC 2HN2A 1NWMX 5ABFB 1JNRA 2J47A 5JTGA 5AQJB 3PUSA 3O4XE 1X9BA 1HFAA 3C98B 2E8IA 3OVUA 3SWHA 2K5BB 4WBNE 4UF0A 5FP3A 2CBIA 2Y48B 1BR2A 2JQQA 5BMVE 3RC3A 4DR2T 5J2UE 4I50E 4FI5A 3ZT7A 5L2LA 1ZOYA 3ZEFB 4H9PC 1N32T 1YQ3A 4PNIA 3FZHB 2IW5B 4ZEYA 3RH3A 3ABVA 4UIGA 3CQXC 3N2GE 4B3MT 3AE8A 2NW8A 4HKAA 2CEAA 4EZHA 1Y01A 4AKRB 1YD8G 2IIUA 4PJLA 2BDEA 5LMUT 1T8BA 3CQGB 4GOUA 5J1GA 4K0UA 4KP3C 3CX8B 4X1IE 2A72A 2NTXA 3KVAA 2XQ9A 2HH7A 5KMGP 1IJ5A 3N9QA 2HN1A 2W63A 5JDFA 3EABA 5KX5E 5JR9B 2VQET 3TLUA 5TAOA 4QH4A 1SE7A 2YDQA 2X0YA 1HTJF 5F8PA 5AQRB 3ANWA 4I4TE 4O2AE 2PTFA 3QB5K 2LT3A 2XQ6A 4ZS2A 3F2EA 3P4RA 1B7TA 4NUUA 4JI5T 1V9DA 3C64A 2W4XA 4DV3T 4HGAA 2W61A 2P9BA 4QH1A 5ADXL 3QK6A 1YXRA 3RI5A 2W62A 3P4SA 4QKNA 3VRAA 2UU9T 4TWHA 3C50A 3ZT5A 1D0XA 2VVNA 4HWDA 4U7YA 3ZMVB 4OFZA 3KVBA 5AQMB 5ABHA 4HWFA 5DQWA 3AA1B 4IREA 3CVRA 3GWHA 5FVLA 4U7IA 2E5LT 4Q25A 2YU2A 2UXBT 1N36T 2NP9A 5AQHB 4UV9B 3LK42 2LSKA 4JI7T 2V7JA 1NEKA 1N34T 3C4ZA 2X9WA 3OYZA 4IDNA 2VB6A 2E5VA 2CXLA 4F8HA 3TLTA 2KWIB 4PJJA 5FY7A 2XQ4A 1T98A 5GONE 3AEEA 4JI6T 3E0ZA 3ZKRA 5LJMA 1IAPA 2ZM2A 5HXEA 2IC9A 4LF8T 2L9QA 4ZI3C 4JI2T 2KZ7B 5FNVE 2DWGA 3RYIE 2CBJA 1FEWA 2BBHA 3I9YA 1W0AA 2MYSA 4U74A 5J0ZA 3P7IA 5JDQA 1CUNA 5JVDE 4LF4T 3FZFB 3VU7H 2OV9A 4IE7A 2YU1A 1HG5A 4AKLA 5ABEA 2CXFA 4DO0A 5JRCB 2UXNB 4BJNA 5HXRA 3ZCJA 4PW8A 2LSIA 3IBPA 3L09A 1KK7A 4U2ZA 4YT0A 3UT5E 2JQHA 3A7MA 4UV8B 2X67A 3P4QA 3ZPOA 5LOVE 2DCFA 3CKDA 2YKSA 4ZI2C 4DV2T 2LEHA 2V7KA 5L3CB 2QRXA 1NENA 2DLRA 2XQ7A 5J2TE 3IEEA 3MACA 2ZM0A 4YLHA 4IE4A 2V6YA 2UXDT 3LK2B 4HFHA 3LBXA 1ZV4X 2Q9QA 2V8SV 3FZMB 2XAGB 5HEJA 1MMGA 4CXYA 3P50A 2I59A 3SOLA 4H9SE 2XM2A 3AVRA 2XPKA 3MA9A 4GYRA 2J1DG 2CWOA 3VR9A 5L4EA 5FXWA 1WR0A 5L3FB 2JQ9A 1D0YA 2FBWA 1VCSA 2X66A 4TNWA 3TLWA 2M6BA 1VOMA 4DUYT 2WY2A 3HR0A 4TN7B 3C51A 1E7PA 3I0OA 4U33A 5LGUB 4AQGA 1JNZA 3LJCA 3N2OA 4YTNA 2WZIA 2V5DA 5C2TA 4J2CA 1QUUA 3DTOA 3BQLA 2X0HA 2LSGA 4Z8XA 1SUMB 1FIOA 3HI2A 2NOXA 2V7MA 1HS7A 1YQ4A 5CGMA 3CMLA 4UVAB 4CI1B 4U31A 4IDZA 3KV4A 2LRLA 2BG9C 2X9XA 4QXCB 4I55E 4TZ4C 4AKHA 1VCTA 5LNKA 2XHEB 2ZLYA 5HEGA 3IHRA 4LF7T 2XZEA 3CQCB 4MFRA 1HR0T 2YINA 1OWAA 5LHIB 3UU8A 2VKHA 4ZI3D 2FJBA 2Q9QD 4IE0A 3LFMA 5HEOA 4YJ2E 3ONXA 1N33T 4QWNB 5BR8T 2WS3A 2BG9E 4JUYA 3BQKA 2WU5A 5AQNB 3PUXF 4LMJA 2K24A 2DI4A 5KDMC 2ZM8A 5AQIB 1H7CA 2H3RA 2K3WA 5HWXA 3AE9A 1SA0E 2V7IA 2XTLA 2E9XA 1VRBA 4DR4T 4DV4T 1XMOT 3TKLB 2OA5A 4KI0F 2LM2A 4ADZA 4AQFC 1UX5A 2VKJA 4U72A 4MLKA 2XQ5A 4NIQA 4ZXLA 1Z8UA 4BA9A 2J62A 4IIJE 2YEVC 3KDSE 2EHOA 5ABGA 3ZMZB 2PJQA 2WSSV 3GMIA 4DBQA 2J4GA 1ZP0A 4LF6T 3NVOA 4O8SA 2OLTA 2N9DA 2WMOA 2FJAA 2Y6XA 1E2AA 2WDRA 3H3MA 4X64T 4JEHB 3NWIA 3O1HA 5LGNB 2LHNA 3QB5A 3C4WA 3UUNA 4DR5T 4NPPA 1ZHCA 2E2AA 4IDQA 4AIUA 2BS3A 2UXCT 5IHYA 2H7OA 1WFDA 3RYCE 4X5TA 5AQLB 4HN9A 2WDVA 4IE6A 4HFCA 1QLBA 3WI3A 2DNXA 4ASKA 5JQGE 2KINB 3LDQB 2LLYA 3JC6D 4JEUB 1XNRT 3AE2A 1ZEEA 4TNVA 3OJAA 2WCAA 4TV9E 1XMQT 5LXTE 2NW7A 4HWCA 4WZXA 3N2KE 4TV8E 5CFBA 2VKDA 1KEYA 3RQUA 5HYAA 4KUMB 1S35A 2W00A 2CWYA 2CCQA 3J7Yq 3AA0B 3PDYA 5FXZA 3C4XA 3MK7C 3KV9A 4KHPT 2JJ9A 3JADA 3MKDA 2IHR1 3ZYMA 3ZJ2A 4LMKA 5LHGB 1T7SA 4YSXA 2KMFA 1W9RA 3RYFE 2V5CA 3L3PA 4H63V 2EHOD 3RRWA 3CK6A 5C3JA 4P1NA 4JI4T 4K0KT 4JYAT 3N9LA 4CXXA 1OEDA 4Z91A 1FJGT 3RIFA 2WBLA 3DJBA 3S4UA 4DV0T 4O4JE 3K3QC 4WW0A 4UEMA 2AE9A 3RX6A 3AAEB 4HWHA 5ABFA 4HFDA 5FL1A 2YOEA 1R8IA 3CWZB 2V6XA 2V7LA 2IMLA 5F3JA 2X9YA 1J5WA 4B3TT 1HCIA 4I0UA 2JMKA 4ZHQE 2XQ3A 2I0MA 3Q5WA 4QHOA 2Q9QB 2YK0A 3NZQA 5FY1A 1I94T 3U3IA 3EDVA 2V26A 2F4VT 5FKYA 3D0TA 3RKOA 3FXEB 2LM9A 2W0GA 2VURA 2CMRA 3UTKA 3PJAA 2C0SA 2ODVA 5FY0A 5LMNT 4QXBB 2BBJA 4ZOLE 2CXDA 1X79A 4WYVA 3ZSTA 2CRBA 2XUEA 3RIAA 2N2NA 5L3EB 2A2FX 2I6HA 4YHJA 1XZYA 4I43B 1FMWA 2KNDA 4H9NC 3AE3A 2BVLA 3QNUA 4DR1T 1W09A 2MTQA 3H3AA 2ZMAA 2Q9QC 3OTOT 2NWBA 2NTYA 4OYKA 4CN1A 4DR3T 5JDNA 4F6RC 3TLVA 4PK6A 3N9MA 5CB4E 2C5KT 3QUJA 2H7VC 4UVBB 3AVSA 1MMDA 3ONJA 2XASB 2WWVA 5JR9A 3AXJA 5IUXA 2LOSA 2LSJA 1L0VA 2K9AA 4ERRA 3EVYA 3HKEE 4ZZBA 2B76A 5AQVB 3Q5XA 2HPJA 5FMNA 2R6GF 1MIWA 5HWYA 4UXNB 2CPTA 5FVKA 4XAXB 3KV5A 1MNEA 3RIUA 4P0BA 5JDMA 4HFVA 1QSDA 4EAHA 1IBLT 5AQPB 5JDGA 4YY3T 2ES0A 3U78A 4IDPA 2JQKA 3PU3A 4U3CA 3AAAB 4H9RC 1U5PA 1U4QA 1M7KA 5L3GB 2MBGA 3Q2MA 3SFDA 3RKGA 4Z90A 2BZBA 3MXZA 3GA8A 2X0LB 3UU6A 4EYYR 3ZYKA 4IHJE 3E22E 3ZYLA 4PFPA 4O4HE 1ZKEA 1UGOA 2H88A 5LBMA 5IWAT 2WP9A 2BKOA 3KBTA 1UCUA 4TWDA 2VASA 5JDHA 3AEAA 1WYCA 3GN5A 4DV7T 3AE4A 1Z0PA 3UQ4A 5FXXA 5LB7B 1D0ZA 3PUYF 4IL9A 2VWAA 2KSRA 3K3NA 2PBIA 4ANJA 4LFBT 3AEBA 4EGWA 2UUCT 1YKHB 3HKDE 4DNDA 3IF8B 3JC6C 2BG9B 2DL1A 5H6RB 2ACZA 3JAFA 2CHOA 3A8YC 4EEDA 3AE6A 1BR0A 3F31A 1XNQT 2XM1A 4DMWA 4FJOA 3KV6A 2CLYC 3I1AA 2A3DA 3H37A 4X65T 2EHOB 3JCFA 4ILUA 3FBLA 2W67A 5AQSB 2FJEA 4JI0T 5JRCA 5LYJE 3N5LA 1Y64B 1S94A 1LVFA 4WNKA 1HNZT 1G8XA 4QH5A 3M3ZB 5AQOB 2WAUA 2BS2A 3B13A 3AE7A 3M65A 2MAWA 3AE1A 1IZNB 5L47A 2RPAA 4UF0B 2YDSA 3FB2A 3ZT6A 2L8KA 2CE7A 4PK5A 4YFSA 1US7B 4JBWF 2IC6A 1KNZA 2EHOC 2WWUA 3EDUA 1LRZA 2WM9A 1GQEA 5E0OA 3PUWF 4QXHB 4AQYT 3V5UA 2BS4A 1HF8A 4HFEA 5FXVA 4EOZB 5LG4A 1IBMT 3NRXA 3ZN1B 4CN6A 4KX6A 4IE5A 3PE0A 3ZMSB 3KINB 4DV5T 3T8OA 4PJNA 5HXCA 4JI1T 5L4HA 3TLSA 4DV6T 3ZN0B 1KF6A 1BR1A 2X51A 3PURA 2WZHA 3P4PA 2XQAA 4PJMA 4WBOA 2QGSA 2D5UA 3EUHA 4YTMA 4C91A 4MALA 4QX8B 4QX7B 3JAEA 3T1YT 5L3BB 2GK9A 3AEGA 4ILCA 3RC8A 2NR4A 3CPZA 4ZZCA 4DUZT 3ANWB 3RF1A 5LP6E 3A5XA 5LHHB 1OXZA 2LKHA 4YSZA 2XQYA 4PFOA 2K48A 2QYWA 3SFEA 2MPKA 4OX9T 2XJ7A 4JI8T 2QVAA 1EZ3A 4GIWA 2XAQB 3UU4A 1OEDB 4IT4A 3AECA 3UULA 5AFUL 1BR4A 3UUXB 3HL6A 3AEDA 4GK5E 3O9XA 2XAFB 5HXHA 3MZKB 3P4WA 4NXNT 5EK3A 4ZI7E 4PAGA 2LE8A 2RA1A 3HKCE 3FBZA 4B3ST 5AQUB 3FZKB 2BKPA 5AQFB 5CA0E 3Q5DA 4CZZB 3PUVF 4P09A 3ONLC 4YSYA 3N9OA 2ACXA 4X20E 3AA7B 3ZSSA 2UUAT 3RPUA 1OEDC 2CA5A 4XBFB 3OPCA 4BJMA 4B6XA 3LSVA 3PU8A 2FJDA 1HX8A 3CX7B 3O1JA 4LFCT 5LBQB 4AQFA 4E7SA 4HFIA 2VK9A 3UQ7A 2L3LA 3ZMUB 4AI6A 2E9XD 1OEDE 4NUVA 4P0AA 1J1JA 2A9UA 4COFA 1D1CA 4BAYB 1XDPA 3PUAA 4A98A 5HCMA 2SPCA 4OHFA 4UELA 3ZCIA 3VKGA 2C5IT 1FMVA 1LKXA 2X68A 4AISA 3AXJB 3R84B 2UUBT 2Y8DA 4LF5T 2RP4A 5C8YE 2VL8A 3ZMTB 2X9HA 4KMCA 5HXSA 5IYZE 3PUZF 5DQVA 2XAJB 3VR8A 1LVKA 4AKIA 3KFWX 3MJXA 3EHZA 3N9PA 2QA7A 2LKGA 3NRYA 4MHCA 4ISSA 1E1HB 4A56A 2M67A 3RLFF 4A97A
chains in the Genus database with same CATH topology
4H9QC 4XAXB 3KV5A 4CI1B 1MNEA 1NWMX 4P0BA 5JDMA 4HFVA 5LCYA 1QSDA 3PUSA 5JR9C 4EYUA 3O4XE 4EAHA 4IDZA 3KV4A 1HFAA 3C98B 5JDGA 2E8IA 2X9XA 4QXCB 3R6NA 4I55E 2CM0A 4TZ4C 2ES0A 3SWHA 3U78A 4AKHA 5LNKA 2C5JA 3PU3A 2XHEB 3AAIA 3E08A 2K5BB 2ZLYA 4UF0A 3AAAB 2D0TA 4WBNE 5FP3A 4H9RC 3IHRA 1U5PA 1U4QA 2Y48B 3CQCB 1BR2A 2JQQA 3LBXB 4MFRA 5L3GB 5BMVE 2LSYA 3RC3A 2MBGA 3Q2MA 5EZYE 2YINA 1OWAA 5J2UE 5LHIB 3AA6B 5HAXA 2BZBA 4I50E 3WAKA 2MOZA 2VKHA 4ZI3D 4FI5A 3MXZA 3GA8A 5L2LA 3ZEFB 4H9PC 3RRCA 2X0LB 4PNIA 2Q9QD 2IW5B 4EYYR 4IE0A 3LFMA 4G2AA 3RH3A 3ZYKA 4UIGA 3CQXC 4IHJE 4YJ2E 3N2GE 3ONXA 3E22E 4HKAA 2NW8A 2CEAA 4QWNB 3ZYLA 4EZHA 4PFPA 4AKRB 4MBQA 1AJ3A 4O4HE 4EB6E 1YD8G 1ZKEA 4JUYA 5M4YA 4UVCB 4PJLA 3BQKA 2BDEA 3CQGB 5LBMA 4GOUA 5J1GA 4K0UA 3KBTA 1UCUA 4XZCA 2VASA 4EIWA 5ETWA 3GN5B 4KP3C 5JDHA 2KXPB 2K24A 3CX8B 2DI4A 4X1IE 5KDMC 1WYCA 4CXWA 2ZM8A 3GN5A 2A72A 2IAKA 1H7CA 2NTXA 3KVAA 4CQIA 2H3RA 1Z0PA 4EZ4A 2HH7A 5FXXA 5H6QB 5KMGP 5HWXA 1D0ZA 1SA0E 2V7IA 3B57A 3HKBE 2XTLA 5EK2A 2VWAA 2E9XA 3VKHA 1IJ5A 3N9QA 1VRBA 3K3NA 1WRDA 2PBIA 4ANJA 2D0UA 2JPFA 2W63A 5JDFA 5KX5E 3HA4A 3P8CD 1YKHB 4C90A 5JR9B 3HKDE 3TKLB 2OA5A 4DNDA 3IF8B 3NBXX 3JC6C 4ADZA 5TAOA 4AQFC 5H6RB 1UX5A 2VKJA 3PUGA 4U72A 4MLKA 1HTJF 4DMVA 5F8PA 2DWKA 3ANWA 4I4TE 1BR0A 4O2AE 3F31A 1HG2A 4BA9A 2LT3A 4IIJE 3ETUA 4PK4A 4FJOA 4DMWA 3KV6A 2XAHB 2CLYC 2YEVC 3KDSE 3I1AA 4ZS2A 2A3DA 3H37A 3F2EA 4L9IA 2EHOB 4CI2B 4L0RA 2EHOA 2B1EA 1B7TA 4ILUA 4NUUA 2LHRA 2V1DB 3ZMZB 1V9DA 3C64A 4HGAA 2W61A 3FBLA 1O3XA 2PJQA 2P9BA 2WSSV 5ADXL 3QK6A 3V5SA 5JRCA 1SHZC 3O1IA 3GMIA 4DBQA 2KT9A 5LYJE 3N5LA 1Y64B 1S94A 2W62A 4O8SA 1LVFA 4QKNA 4WNKA 2N9DA 1G8XA 4TX5A 3C50A 3SS1A 3NZPA 3K8PC 2WMOA 2WAUA 2Y6XA 3B13A 3M65A 3CX6B 1D0XA 3I0QA 4JEHB 1IZNB 1YW0A 3O1HA 4UF0B 5LA6E 5LGNB 2LHNA 3FB2A 4OK0A 3ZMVB 4OFZA 3KVBA 2L8KA 3ZC1A 2CE7A 4PK5A 4YFSA 3C4WA 1US7B 3UUNA 5DQWA 3AA1B 2IC6A 1MIYA 3CVRA 3GWHA 5CA1E 1ZHCA 1G73A 2EHOC 2WWUA 1KNZA 3EDUA 1LRZA 2WM9A 3OKQA 2LOPA 5E0OA 5IHYA 2H7OA 3I9WA 4QXHB 2G0UA 4E7ZA 2YU2A 3V5UA 3RYCE 1HF8A 5FXVA 2NW9A 4EOZB 5LG4A 4HN9A 3NRXA 3ZN1B 4IE6A 2NP9A 4O2BE 4UV9B 3LK42 2LSKA 4IE5A 2DNXA 3WI3A 4ASKA 3PE0A 3ZMSB 2V7JA 5JQGE 3KINB 3C4ZA 2KINB 3T8OA 4PJNA 5HXCA 2KLQA 2X9WA 1NAFA 3JC6D 4AKGA 3OYZA 4JEUB 4OYJA 4JLEA 2VB6A 2CLYB 2BVMA 3ZN0B 2CXLA 1BR1A 1ZEEA 3OJAA 3UUMA 2X51A 3LG7A 3PURA 4TV9E 3BQIA 1WR6A 2KWIB 2NW7A 4PJMA 5LXTE 4PJJA 4WBOA 2QGSA 2D5UA 3N2KE 3EUHA 5JREA 4C91A 5JH7E 2E9XB 4X1YE 5FY7A 2PG8A 4MALA 3ZC0A 4QX8B 4QX7B 3Q9DA 1T98A 4TV8E 2VKDA 3N9NA 5L3BB 2GK9A 5GONE 4KBMB 5HYAA 3E0ZA 5LJMA 4KUMB 3RC8A 1IAPA 2ZM2A 3ZJ1A 5HXEA 2IC9A 3ESLA 2L9QA 1S35A 4ZI3C 2W00A 2CWYA 2KZ7B 2CCQA 4O4LE 1D1BA 3AA0B 3PDYA 3CPZA 2DWGA 3C4XA 5FNVE 5FXZA 3RYIE 3J7Yq 4DBRA 3ANWB 3MK7C 2ODUA 1UX4A 1FEWA 3KV9A 3I9YA 2MYSA 2JJ9A 4U74A 5LP6E 3A5XA 5LHHB 1OXZA 3P7IA 5JDQA 3MKDA 2XQYA 3ZYMA 3ZJ2A 1CUNA 4PFOA 5JVDE 2K48A 5LHGB 3VU7H 4HEAA 4IE7A 2KMFA 2YU1A 3VHLA 1HG5A 3RYFE 4AKLA 3L3PA 3F57A 4H63V 2D2SA 5LGTB 2E9XC 2EHOD 2CXFA 3RRWA 4DO0A 5JRCB 2UXNB 3LK3B 1EZ3A 4GIWA 4BJNA 2XAQB 5HXRA 4G63A 3ZCJA 4PW8A 3KBUA 2LSIA 3IBPA 3N9LA 3UULA 4CXXA 5AFUL 3L09A 1BR4A 1KK7A 2WMNA 3DP7A 3UUXB 3HL6A 4GK5E 3O9XA 2WBLA 2XAFB 3DJBA 5HXHA 2JRKA 3QC9A 3S4UA 3UT5E 3MZKB 5FYMA 1WLXA 4UV8B 4O4JE 5EK3A 2X67A 3UFEA 1IJ6A 4GYSA 4PAGA 4ZI7E 2LE8A 2RA1A 4H63H 3FHNA 3K3QC 4WW0A 4UEMA 3HKCE 3ZPOA 3FBZA 2DCFA 3CKDA 5LOVE 1MNDA 4M1PA 4ZI2C 3RX6A 2LEHA 3AAEB 2V7KA 5L3CB 3AB3B 5JDLA 4ZS3A 5CA0E 5EK4A 3CWZB 2DLRA 2UXXB 5J2TE 3IEEA 3MACA 2ZM0A 4YLHA 5A1LA 2V7LA 2VKOA 3ZLIA 3BK9A 4CZZB 5F3JA 2X9YA 4P09A 1HCIA 3N9OA 2ACXA 4IE4A 4AXPA 4X20E 3AA7B 1YKEB 5L3DB 2JMKA 4ZHQE 4TUYE 3LK2B 3RPUA 3Q5WA 4QHOA 2CA5A 3LBXA 2Q9QB 1ZV4X 2YK0A 3NZQA 5FY1A 3U3IA 4XBFB 4BJMA 3EDVA 2V26A 4B6XA 2Q9QA 4N78D 4GK0E 3D0TA 3RKOA 3FXEB 2LM9A 2XAGB 3W15B 2W0GA 2CMRA 2DHRA 3PU8A 3UTKA 4EXTA 3ETVA 1MMGA 2C0SA 2ODVA 3PUQA 4YJ3E 5FY0A 4CXYA 1HX8A 2KWHA 3CX7B 3O1JA 4QXBB 4CI3B 4ZOLE 2I59A 3J9X1 2CXDA 5LBQB 3SOLA 5DJQC 4H9SE 3AVRA 1X79A 3MA9A 4AQFA 4GYRA 4E7SA 2J1DG 2XUEA 1MMAA 2CWOA 2VK9A 2LJLA 2Z6EA 2N2NA 5FXWA 2A2FX 3K3OA 4YHJA 5L3EB 5L3FB 4HTEA 2L3LA 4I43B 1FMWA 3ZMUB 2KNDA 4H9NC 3OBVE 4AI6A 2BVLA 2E9XD 4NUVA 1D0YA 4P0AA 4V1Av 2X66A 2MTQA 3H3AA 1MIVA 4IGUA 1D1CA 4O4IE 2ZMAA 4BAYB 2JMHA 3PUAA 2Q9QC 2NWBA 2NTYA 4OYKA 2SPCA 1VOMA 4OHFA 4UELA 3ZCIA 5DABA 5JDNA 4F6RC 3HR0A 4TN7B 3VKGA 4PK6A 1WYBA 3C51A 4H9OC 2C5IT 3N9MA 1FMVA 1LKXA 5CB4E 2X68A 2C5KT 3QUJA 3I0OA 2N1GA 2H7VC 4UVBB 3R84B 3AVSA 1MMDA 2Y8DA 2XASB 3RYHE 2RP4A 4AQGA 5LGUB 5JR9A 3LJCA 5C8YE 4HE8A 2VL8A 3FXDB 1MMNA 3ZMTB 2X9HA 1D1AA 4KMCA 5HXSA 2LOSA 3N2OA 4ZI2D 5IYZE 2LSJA 5DQVA 2XAJB 2PFVA 3WAJA 4ISTA 1LVKA 4AKIA 4J2CA 1QUUA 3DTOA 3KFWX 5LJNA 3BQLA 3MJXA 2LSGA 4L5GA 2K9AA 4ERRA 4Z8XA 4DVDA 3N9PA 3PTRB 3EVYA 3HKEE 2QA7A 3NRYA 4MHCA 4ISSA 1E1HB 1FIOA 4X1KE 3HI2A 4A56A 3Q5XA 2M67A 2HPJA 2NOXA 2V7MA 5FMNA 1MIWA 5HWYA 2HPLA 1HS7A 3OYXA 4UXNB 3SRZA 3CMLA 4UVAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1P A;  5LBM A;  5FMN A;  4ADZ A;  2HH7 A;  3AAI A;  4UIG A;  5LCY A; 
#chains in the Genus database with same CATH topology
 3X1D A;  5LCY A;  5JR9 C;  4EYU A;  1HNW T;  5AQG B;  2WDQ A;  4UR9 A;  1XWM A;  3R6N A;  2CM0 A;  2C5J A;  3AAI A;  3E08 A;  2V6Y B;  2D0T A;  2HHH T;  3LBX B;  2LSY A;  5EZY E;  3AA6 B;  1KNP A;  5HAX A;  3PJA J;  3WAK A;  2MOZ A;  3RRC A;  4JI3 T;  2D9D A;  4DV1 T;  2YDR A;  2YN6 A;  2JIW A;  4G2A A;  3RIU C;  2VVS A;  4MBQ A;  1AJ3 A;  4EB6 E;  3L39 A;  5M4Y A;  4UVC B;  1DU2 A;  5HCJ A;  4XZC A;  4EIW A;  5ETW A;  3GN5 B;  2KXP B;  1UUS A;  4CXW A;  4CN4 A;  2IAK A;  4CQI A;  4EZ4 A;  5H6Q B;  5AQQ B;  3B57 A;  3HKB E;  3UFG A;  5EK2 A;  3PV0 F;  3VKH A;  4A5X A;  1WRD A;  2D0U A;  4HWI B;  2JPF A;  3HA4 A;  3P8C D;  4C90 A;  1UK5 A;  3K1S A;  3NBX X;  4X66 T;  3VRB A;  3PUG A;  4DMV A;  2DWK A;  4DID B;  5F5W A;  1T72 A;  5FL0 A;  1HG2 A;  3ETU A;  4PK4 A;  2XAH B;  1WCR A;  4L9I A;  4CI2 B;  4L0R A;  2B1E A;  3EAM A;  2LHR A;  2V1D B;  4EV6 A;  1HNX T;  1IBK T;  1O3X A;  3Q5E A;  3V5S A;  1SHZ C;  3O1I A;  3B5M A;  2KT9 A;  4TX5 A;  4NXM T;  3SS1 A;  3NZP A;  3K8P C;  4YTP A;  2XSA A;  3CX6 B;  3I0Q A;  1KFY A;  1YW0 A;  3RQW A;  3EI0 A;  5LA6 E;  4OK0 A;  4EEB A;  2XQ8 A;  3ZC1 A;  4U2Y A;  1MIY A;  5CA1 E;  1G73 A;  4IL4 A;  3OKQ A;  2LOP A;  3I9W A;  2G0U A;  3UU3 A;  3CIR A;  2WU2 A;  4E7Z A;  3IA3 A;  2CHN A;  1XDO A;  2NW9 A;  2LRK A;  1CHU A;  4O2B E;  3G06 A;  2KLQ A;  4GKJ T;  1NAF A;  4AKG A;  4OYJ A;  4JLE A;  3AEF A;  2CLY B;  2BVM A;  5LG3 A;  3UUM A;  3LG7 A;  2XY8 B;  3BQI A;  1WR6 A;  4ILB A;  5JRE A;  5JH7 E;  2E9X B;  4X1Y E;  2PG8 A;  1KNR A;  3ZC0 A;  4TWF A;  3Q9D A;  3T1H T;  3N9N A;  4KBM B;  3ZJ1 A;  5KXJ A;  3ESL A;  4DR6 T;  3RGL A;  4O4L E;  1D1B A;  1W0B A;  4DBR A;  4B3R T;  2ODU A;  1UX4 A;  2IDO B;  5HEU A;  5HEH A;  2WQY A;  2AXD S;  4HEA A;  3VHL A;  1HX1 B;  3F57 A;  2D2S A;  5LGT B;  2E9X C;  2H89 A;  3UU5 A;  3LK3 B;  4G63 A;  3KBU A;  2W66 A;  2WMN A;  3DP7 A;  4ILA A;  2JRK A;  3QC9 A;  5FYM A;  1WLX A;  2WB5 A;  1I6Z A;  3UFE A;  1IJ6 A;  4GYS A;  4KHZ F;  4H63 H;  3FHN A;  2VQF T;  1MND A;  4M1P A;  3RHW A;  4IDO A;  3UUB A;  3AB3 B;  5JDL A;  4ZS3 A;  5EK4 A;  2UXX B;  4DR7 T;  3AE5 A;  3NKZ A;  5A1L A;  2VKO A;  3ZLI A;  3BK9 A;  4GKK T;  4AXP A;  1YKE B;  5L3D B;  4TUY E;  5AQK B;  2ZM6 T;  2W2U A;  1UUR A;  5AQT B;  1J5E T;  1M62 A;  4N78 D;  4GK0 E;  3W15 B;  4YXD A;  2DHR A;  2M6I A;  4EXT A;  3ETV A;  3PUQ A;  4JV5 T;  4YJ3 E;  2XSB A;  2KWH A;  4CI3 B;  2FUP A;  3J9X 1;  5DJQ C;  4LFA T;  2Z6E A;  1MMA A;  2LJL A;  3K3O A;  4HTE A;  2BKN A;  3OBV E;  3QOF A;  4V1A v;  4X62 T;  1MIV A;  4IGU A;  4O4I E;  2JMH A;  5DAB A;  4LML A;  1WYB A;  4H9O C;  4YHH T;  2VL0 A;  2N1G A;  3RYH E;  4HE8 A;  3FXD B;  1MMN A;  1D1A A;  2BG9 A;  4ZI2 D;  2PFV A;  3WAJ A;  4LF9 T;  4IST A;  3FZL B;  5CJ5 A;  5LJN A;  4L5G A;  2IUB A;  4DVD A;  3PTR B;  4HFB A;  3L8R A;  4X1K E;  2HPL A;  3OYX A;  3SRZ A;  4H9Q C;  2HN2 A;  1NWM X;  5ABF B;  1JNR A;  2J47 A;  5JTG A;  5AQJ B;  3PUS A;  3O4X E;  1X9B A;  1HFA A;  3C98 B;  2E8I A;  3OVU A;  3SWH A;  2K5B B;  4WBN E;  4UF0 A;  5FP3 A;  2CBI A;  2Y48 B;  1BR2 A;  2JQQ A;  5BMV E;  3RC3 A;  4DR2 T;  5J2U E;  4I50 E;  4FI5 A;  3ZT7 A;  5L2L A;  1ZOY A;  3ZEF B;  4H9P C;  1N32 T;  1YQ3 A;  4PNI A;  3FZH B;  2IW5 B;  4ZEY A;  3RH3 A;  3ABV A;  4UIG A;  3CQX C;  3N2G E;  4B3M T;  3AE8 A;  2NW8 A;  4HKA A;  2CEA A;  4EZH A;  1Y01 A;  4AKR B;  1YD8 G;  2IIU A;  4PJL A;  2BDE A;  5LMU T;  1T8B A;  3CQG B;  4GOU A;  5J1G A;  4K0U A;  4KP3 C;  3CX8 B;  4X1I E;  2A72 A;  2NTX A;  3KVA A;  2XQ9 A;  2HH7 A;  5KMG P;  1IJ5 A;  3N9Q A;  2HN1 A;  2W63 A;  5JDF A;  3EAB A;  5KX5 E;  5JR9 B;  2VQE T;  3TLU A;  5TAO A;  4QH4 A;  1SE7 A;  2YDQ A;  2X0Y A;  1HTJ F;  5F8P A;  5AQR B;  3ANW A;  4I4T E;  4O2A E;  2PTF A;  3QB5 K;  2LT3 A;  2XQ6 A;  4ZS2 A;  3F2E A;  3P4R A;  1B7T A;  4NUU A;  4JI5 T;  1V9D A;  3C64 A;  2W4X A;  4DV3 T;  4HGA A;  2W61 A;  2P9B A;  4QH1 A;  5ADX L;  3QK6 A;  1YXR A;  3RI5 A;  2W62 A;  3P4S A;  4QKN A;  3VRA A;  2UU9 T;  4TWH A;  3C50 A;  3ZT5 A;  1D0X A;  2VVN A;  4HWD A;  4U7Y A;  3ZMV B;  4OFZ A;  3KVB A;  5AQM B;  5ABH A;  4HWF A;  5DQW A;  3AA1 B;  4IRE A;  3CVR A;  3GWH A;  5FVL A;  4U7I A;  2E5L T;  4Q25 A;  2YU2 A;  2UXB T;  1N36 T;  2NP9 A;  5AQH B;  4UV9 B;  3LK4 2;  2LSK A;  4JI7 T;  2V7J A;  1NEK A;  1N34 T;  3C4Z A;  2X9W A;  3OYZ A;  4IDN A;  2VB6 A;  2E5V A;  2CXL A;  4F8H A;  3TLT A;  2KWI B;  4PJJ A;  5FY7 A;  2XQ4 A;  1T98 A;  5GON E;  3AEE A;  4JI6 T;  3E0Z A;  3ZKR A;  5LJM A;  1IAP A;  2ZM2 A;  5HXE A;  2IC9 A;  4LF8 T;  2L9Q A;  4ZI3 C;  4JI2 T;  2KZ7 B;  5FNV E;  2DWG A;  3RYI E;  2CBJ A;  1FEW A;  2BBH A;  3I9Y A;  1W0A A;  2MYS A;  4U74 A;  5J0Z A;  3P7I A;  5JDQ A;  1CUN A;  5JVD E;  4LF4 T;  3FZF B;  3VU7 H;  2OV9 A;  4IE7 A;  2YU1 A;  1HG5 A;  4AKL A;  5ABE A;  2CXF A;  4DO0 A;  5JRC B;  2UXN B;  4BJN A;  5HXR A;  3ZCJ A;  4PW8 A;  2LSI A;  3IBP A;  3L09 A;  1KK7 A;  4U2Z A;  4YT0 A;  3UT5 E;  2JQH A;  3A7M A;  4UV8 B;  2X67 A;  3P4Q A;  3ZPO A;  5LOV E;  2DCF A;  3CKD A;  2YKS A;  4ZI2 C;  4DV2 T;  2LEH A;  2V7K A;  5L3C B;  2QRX A;  1NEN A;  2DLR A;  2XQ7 A;  5J2T E;  3IEE A;  3MAC A;  2ZM0 A;  4YLH A;  4IE4 A;  2V6Y A;  2UXD T;  3LK2 B;  4HFH A;  3LBX A;  1ZV4 X;  2Q9Q A;  2V8S V;  3FZM B;  2XAG B;  5HEJ A;  1MMG A;  4CXY A;  3P50 A;  2I59 A;  3SOL A;  4H9S E;  2XM2 A;  3AVR A;  2XPK A;  3MA9 A;  4GYR A;  2J1D G;  2CWO A;  3VR9 A;  5L4E A;  5FXW A;  1WR0 A;  5L3F B;  2JQ9 A;  1D0Y A;  2FBW A;  1VCS A;  2X66 A;  4TNW A;  3TLW A;  2M6B A;  1VOM A;  4DUY T;  2WY2 A;  3HR0 A;  4TN7 B;  3C51 A;  1E7P A;  3I0O A;  4U33 A;  5LGU B;  4AQG A;  1JNZ A;  3LJC A;  3N2O A;  4YTN A;  2WZI A;  2V5D A;  5C2T A;  4J2C A;  1QUU A;  3DTO A;  3BQL A;  2X0H A;  2LSG A;  4Z8X A;  1SUM B;  1FIO A;  3HI2 A;  2NOX A;  2V7M A;  1HS7 A;  1YQ4 A;  5CGM A;  3CML A;  4UVA B;  4CI1 B;  4U31 A;  4IDZ A;  3KV4 A;  2LRL A;  2BG9 C;  2X9X A;  4QXC B;  4I55 E;  4TZ4 C;  4AKH A;  1VCT A;  5LNK A;  2XHE B;  2ZLY A;  5HEG A;  3IHR A;  4LF7 T;  2XZE A;  3CQC B;  4MFR A;  1HR0 T;  2YIN A;  1OWA A;  5LHI B;  3UU8 A;  2VKH A;  4ZI3 D;  2FJB A;  2Q9Q D;  4IE0 A;  3LFM A;  5HEO A;  4YJ2 E;  3ONX A;  1N33 T;  4QWN B;  5BR8 T;  2WS3 A;  2BG9 E;  4JUY A;  3BQK A;  2WU5 A;  5AQN B;  3PUX F;  4LMJ A;  2K24 A;  2DI4 A;  5KDM C;  2ZM8 A;  5AQI B;  1H7C A;  2H3R A;  2K3W A;  5HWX A;  3AE9 A;  1SA0 E;  2V7I A;  2XTL A;  2E9X A;  1VRB A;  4DR4 T;  4DV4 T;  1XMO T;  3TKL B;  2OA5 A;  4KI0 F;  2LM2 A;  4ADZ A;  4AQF C;  1UX5 A;  2VKJ A;  4U72 A;  4MLK A;  2XQ5 A;  4NIQ A;  4ZXL A;  1Z8U A;  4BA9 A;  2J62 A;  4IIJ E;  2YEV C;  3KDS E;  2EHO A;  5ABG A;  3ZMZ B;  2PJQ A;  2WSS V;  3GMI A;  4DBQ A;  2J4G A;  1ZP0 A;  4LF6 T;  3NVO A;  4O8S A;  2OLT A;  2N9D A;  2WMO A;  2FJA A;  2Y6X A;  1E2A A;  2WDR A;  3H3M A;  4X64 T;  4JEH B;  3NWI A;  3O1H A;  5LGN B;  2LHN A;  3QB5 A;  3C4W A;  3UUN A;  4DR5 T;  4NPP A;  1ZHC A;  2E2A A;  4IDQ A;  4AIU A;  2BS3 A;  2UXC T;  5IHY A;  2H7O A;  1WFD A;  3RYC E;  4X5T A;  5AQL B;  4HN9 A;  2WDV A;  4IE6 A;  4HFC A;  1QLB A;  3WI3 A;  2DNX A;  4ASK A;  5JQG E;  2KIN B;  3LDQ B;  2LLY A;  3JC6 D;  4JEU B;  1XNR T;  3AE2 A;  1ZEE A;  4TNV A;  3OJA A;  2WCA A;  4TV9 E;  1XMQ T;  5LXT E;  2NW7 A;  4HWC A;  4WZX A;  3N2K E;  4TV8 E;  5CFB A;  2VKD A;  1KEY A;  3RQU A;  5HYA A;  4KUM B;  1S35 A;  2W00 A;  2CWY A;  2CCQ A;  3J7Y q;  3AA0 B;  3PDY A;  5FXZ A;  3C4X A;  3MK7 C;  3KV9 A;  4KHP T;  2JJ9 A;  3JAD A;  3MKD A;  2IHR 1;  3ZYM A;  3ZJ2 A;  4LMK A;  5LHG B;  1T7S A;  4YSX A;  2KMF A;  1W9R A;  3RYF E;  2V5C A;  3L3P A;  4H63 V;  2EHO D;  3RRW A;  3CK6 A;  5C3J A;  4P1N A;  4JI4 T;  4K0K T;  4JYA T;  3N9L A;  4CXX A;  1OED A;  4Z91 A;  1FJG T;  3RIF A;  2WBL A;  3DJB A;  3S4U A;  4DV0 T;  4O4J E;  3K3Q C;  4WW0 A;  4UEM A;  2AE9 A;  3RX6 A;  3AAE B;  4HWH A;  5ABF A;  4HFD A;  5FL1 A;  2YOE A;  1R8I A;  3CWZ B;  2V6X A;  2V7L A;  2IML A;  5F3J A;  2X9Y A;  1J5W A;  4B3T T;  1HCI A;  4I0U A;  2JMK A;  4ZHQ E;  2XQ3 A;  2I0M A;  3Q5W A;  4QHO A;  2Q9Q B;  2YK0 A;  3NZQ A;  5FY1 A;  1I94 T;  3U3I A;  3EDV A;  2V26 A;  2F4V T;  5FKY A;  3D0T A;  3RKO A;  3FXE B;  2LM9 A;  2W0G A;  2VUR A;  2CMR A;  3UTK A;  3PJA A;  2C0S A;  2ODV A;  5FY0 A;  5LMN T;  4QXB B;  2BBJ A;  4ZOL E;  2CXD A;  1X79 A;  4WYV A;  3ZST A;  2CRB A;  2XUE A;  3RIA A;  2N2N A;  5L3E B;  2A2F X;  2I6H A;  4YHJ A;  1XZY A;  4I43 B;  1FMW A;  2KND A;  4H9N C;  3AE3 A;  2BVL A;  3QNU A;  4DR1 T;  1W09 A;  2MTQ A;  3H3A A;  2ZMA A;  2Q9Q C;  3OTO T;  2NWB A;  2NTY A;  4OYK A;  4CN1 A;  4DR3 T;  5JDN A;  4F6R C;  3TLV A;  4PK6 A;  3N9M A;  5CB4 E;  2C5K T;  3QUJ A;  2H7V C;  4UVB B;  3AVS A;  1MMD A;  3ONJ A;  2XAS B;  2WWV A;  5JR9 A;  3AXJ A;  5IUX A;  2LOS A;  2LSJ A;  1L0V A;  2K9A A;  4ERR A;  3EVY A;  3HKE E;  4ZZB A;  2B76 A;  5AQV B;  3Q5X A;  2HPJ A;  5FMN A;  2R6G F;  1MIW A;  5HWY A;  4UXN B;  2CPT A;  5FVK A;  4XAX B;  3KV5 A;  1MNE A;  3RIU A;  4P0B A;  5JDM A;  4HFV A;  1QSD A;  4EAH A;  1IBL T;  5AQP B;  5JDG A;  4YY3 T;  2ES0 A;  3U78 A;  4IDP A;  2JQK A;  3PU3 A;  4U3C A;  3AAA B;  4H9R C;  1U5P A;  1U4Q A;  1M7K A;  5L3G B;  2MBG A;  3Q2M A;  3SFD A;  3RKG A;  4Z90 A;  2BZB A;  3MXZ A;  3GA8 A;  2X0L B;  3UU6 A;  4EYY R;  3ZYK A;  4IHJ E;  3E22 E;  3ZYL A;  4PFP A;  4O4H E;  1ZKE A;  1UGO A;  2H88 A;  5LBM A;  5IWA T;  2WP9 A;  2BKO A;  3KBT A;  1UCU A;  4TWD A;  2VAS A;  5JDH A;  3AEA A;  1WYC A;  3GN5 A;  4DV7 T;  3AE4 A;  1Z0P A;  3UQ4 A;  5FXX A;  5LB7 B;  1D0Z A;  3PUY F;  4IL9 A;  2VWA A;  2KSR A;  3K3N A;  2PBI A;  4ANJ A;  4LFB T;  3AEB A;  4EGW A;  2UUC T;  1YKH B;  3HKD E;  4DND A;  3IF8 B;  3JC6 C;  2BG9 B;  2DL1 A;  5H6R B;  2ACZ A;  3JAF A;  2CHO A;  3A8Y C;  4EED A;  3AE6 A;  1BR0 A;  3F31 A;  1XNQ T;  2XM1 A;  4DMW A;  4FJO A;  3KV6 A;  2CLY C;  3I1A A;  2A3D A;  3H37 A;  4X65 T;  2EHO B;  3JCF A;  4ILU A;  3FBL A;  2W67 A;  5AQS B;  2FJE A;  4JI0 T;  5JRC A;  5LYJ E;  3N5L A;  1Y64 B;  1S94 A;  1LVF A;  4WNK A;  1HNZ T;  1G8X A;  4QH5 A;  3M3Z B;  5AQO B;  2WAU A;  2BS2 A;  3B13 A;  3AE7 A;  3M65 A;  2MAW A;  3AE1 A;  1IZN B;  5L47 A;  2RPA A;  4UF0 B;  2YDS A;  3FB2 A;  3ZT6 A;  2L8K A;  2CE7 A;  4PK5 A;  4YFS A;  1US7 B;  4JBW F;  2IC6 A;  1KNZ A;  2EHO C;  2WWU A;  3EDU A;  1LRZ A;  2WM9 A;  1GQE A;  5E0O A;  3PUW F;  4QXH B;  4AQY T;  3V5U A;  2BS4 A;  1HF8 A;  4HFE A;  5FXV A;  4EOZ B;  5LG4 A;  1IBM T;  3NRX A;  3ZN1 B;  4CN6 A;  4KX6 A;  4IE5 A;  3PE0 A;  3ZMS B;  3KIN B;  4DV5 T;  3T8O A;  4PJN A;  5HXC A;  4JI1 T;  5L4H A;  3TLS A;  4DV6 T;  3ZN0 B;  1KF6 A;  1BR1 A;  2X51 A;  3PUR A;  2WZH A;  3P4P A;  2XQA A;  4PJM A;  4WBO A;  2QGS A;  2D5U A;  3EUH A;  4YTM A;  4C91 A;  4MAL A;  4QX8 B;  4QX7 B;  3JAE A;  3T1Y T;  5L3B B;  2GK9 A;  3AEG A;  4ILC A;  3RC8 A;  2NR4 A;  3CPZ A;  4ZZC A;  4DUZ T;  3ANW B;  3RF1 A;  5LP6 E;  3A5X A;  5LHH B;  1OXZ A;  2LKH A;  4YSZ A;  2XQY A;  4PFO A;  2K48 A;  2QYW A;  3SFE A;  2MPK A;  4OX9 T;  2XJ7 A;  4JI8 T;  2QVA A;  1EZ3 A;  4GIW A;  2XAQ B;  3UU4 A;  1OED B;  4IT4 A;  3AEC A;  3UUL A;  5AFU L;  1BR4 A;  3UUX B;  3HL6 A;  3AED A;  4GK5 E;  3O9X A;  2XAF B;  5HXH A;  3MZK B;  3P4W A;  4NXN T;  5EK3 A;  4ZI7 E;  4PAG A;  2LE8 A;  2RA1 A;  3HKC E;  3FBZ A;  4B3S T;  5AQU B;  3FZK B;  2BKP A;  5AQF B;  5CA0 E;  3Q5D A;  4CZZ B;  3PUV F;  4P09 A;  3ONL C;  4YSY A;  3N9O A;  2ACX A;  4X20 E;  3AA7 B;  3ZSS A;  2UUA T;  3RPU A;  1OED C;  2CA5 A;  4XBF B;  3OPC A;  4BJM A;  4B6X A;  3LSV A;  3PU8 A;  2FJD A;  1HX8 A;  3CX7 B;  3O1J A;  4LFC T;  5LBQ B;  4AQF A;  4E7S A;  4HFI A;  2VK9 A;  3UQ7 A;  2L3L A;  3ZMU B;  4AI6 A;  2E9X D;  1OED E;  4NUV A;  4P0A A;  1J1J A;  2A9U A;  4COF A;  1D1C A;  4BAY B;  1XDP A;  3PUA A;  4A98 A;  5HCM A;  2SPC A;  4OHF A;  4UEL A;  3ZCI A;  3VKG A;  2C5I T;  1FMV A;  1LKX A;  2X68 A;  4AIS A;  3AXJ B;  3R84 B;  2UUB T;  2Y8D A;  4LF5 T;  2RP4 A;  5C8Y E;  2VL8 A;  3ZMT B;  2X9H A;  4KMC A;  5HXS A;  5IYZ E;  3PUZ F;  5DQV A;  2XAJ B;  3VR8 A;  1LVK A;  4AKI A;  3KFW X;  3MJX A;  3EHZ A;  3N9P A;  2QA7 A;  2LKG A;  3NRY A;  4MHC A;  4ISS A;  1E1H B;  4A56 A;  2M67 A;  3RLF F;  4A97 A; 
#chains in the Genus database with same CATH homology
 4H9Q C;  4XAX B;  3KV5 A;  4CI1 B;  1MNE A;  1NWM X;  4P0B A;  5JDM A;  4HFV A;  5LCY A;  1QSD A;  3PUS A;  5JR9 C;  4EYU A;  3O4X E;  4EAH A;  4IDZ A;  3KV4 A;  1HFA A;  3C98 B;  5JDG A;  2E8I A;  2X9X A;  4QXC B;  3R6N A;  4I55 E;  2CM0 A;  4TZ4 C;  2ES0 A;  3SWH A;  3U78 A;  4AKH A;  5LNK A;  2C5J A;  3PU3 A;  2XHE B;  3AAI A;  3E08 A;  2K5B B;  2ZLY A;  4UF0 A;  3AAA B;  2D0T A;  4WBN E;  5FP3 A;  4H9R C;  3IHR A;  1U5P A;  1U4Q A;  2Y48 B;  3CQC B;  1BR2 A;  2JQQ A;  3LBX B;  4MFR A;  5L3G B;  5BMV E;  2LSY A;  3RC3 A;  2MBG A;  3Q2M A;  5EZY E;  2YIN A;  1OWA A;  5J2U E;  5LHI B;  3AA6 B;  5HAX A;  2BZB A;  4I50 E;  3WAK A;  2MOZ A;  2VKH A;  4ZI3 D;  4FI5 A;  3MXZ A;  3GA8 A;  5L2L A;  3ZEF B;  4H9P C;  3RRC A;  2X0L B;  4PNI A;  2Q9Q D;  2IW5 B;  4EYY R;  4IE0 A;  3LFM A;  4G2A A;  3RH3 A;  3ZYK A;  4UIG A;  3CQX C;  4IHJ E;  4YJ2 E;  3N2G E;  3ONX A;  3E22 E;  4HKA A;  2NW8 A;  2CEA A;  4QWN B;  3ZYL A;  4EZH A;  4PFP A;  4AKR B;  4MBQ A;  1AJ3 A;  4O4H E;  4EB6 E;  1YD8 G;  1ZKE A;  4JUY A;  5M4Y A;  4UVC B;  4PJL A;  3BQK A;  2BDE A;  3CQG B;  5LBM A;  4GOU A;  5J1G A;  4K0U A;  3KBT A;  1UCU A;  4XZC A;  2VAS A;  4EIW A;  5ETW A;  3GN5 B;  4KP3 C;  5JDH A;  2KXP B;  2K24 A;  3CX8 B;  2DI4 A;  4X1I E;  5KDM C;  1WYC A;  4CXW A;  2ZM8 A;  3GN5 A;  2A72 A;  2IAK A;  1H7C A;  2NTX A;  3KVA A;  4CQI A;  2H3R A;  1Z0P A;  4EZ4 A;  2HH7 A;  5FXX A;  5H6Q B;  5KMG P;  5HWX A;  1D0Z A;  1SA0 E;  2V7I A;  3B57 A;  3HKB E;  2XTL A;  5EK2 A;  2VWA A;  2E9X A;  3VKH A;  1IJ5 A;  3N9Q A;  1VRB A;  3K3N A;  1WRD A;  2PBI A;  4ANJ A;  2D0U A;  2JPF A;  2W63 A;  5JDF A;  5KX5 E;  3HA4 A;  3P8C D;  1YKH B;  4C90 A;  5JR9 B;  3HKD E;  3TKL B;  2OA5 A;  4DND A;  3IF8 B;  3NBX X;  3JC6 C;  4ADZ A;  5TAO A;  4AQF C;  5H6R B;  1UX5 A;  2VKJ A;  3PUG A;  4U72 A;  4MLK A;  1HTJ F;  4DMV A;  5F8P A;  2DWK A;  3ANW A;  4I4T E;  1BR0 A;  4O2A E;  3F31 A;  1HG2 A;  4BA9 A;  2LT3 A;  4IIJ E;  3ETU A;  4PK4 A;  4FJO A;  4DMW A;  3KV6 A;  2XAH B;  2CLY C;  2YEV C;  3KDS E;  3I1A A;  4ZS2 A;  2A3D A;  3H37 A;  3F2E A;  4L9I A;  2EHO B;  4CI2 B;  4L0R A;  2EHO A;  2B1E A;  1B7T A;  4ILU A;  4NUU A;  2LHR A;  2V1D B;  3ZMZ B;  1V9D A;  3C64 A;  4HGA A;  2W61 A;  3FBL A;  1O3X A;  2PJQ A;  2P9B A;  2WSS V;  5ADX L;  3QK6 A;  3V5S A;  5JRC A;  1SHZ C;  3O1I A;  3GMI A;  4DBQ A;  2KT9 A;  5LYJ E;  3N5L A;  1Y64 B;  1S94 A;  2W62 A;  4O8S A;  1LVF A;  4QKN A;  4WNK A;  2N9D A;  1G8X A;  4TX5 A;  3C50 A;  3SS1 A;  3NZP A;  3K8P C;  2WMO A;  2WAU A;  2Y6X A;  3B13 A;  3M65 A;  3CX6 B;  1D0X A;  3I0Q A;  4JEH B;  1IZN B;  1YW0 A;  3O1H A;  4UF0 B;  5LA6 E;  5LGN B;  2LHN A;  3FB2 A;  4OK0 A;  3ZMV B;  4OFZ A;  3KVB A;  2L8K A;  3ZC1 A;  2CE7 A;  4PK5 A;  4YFS A;  3C4W A;  1US7 B;  3UUN A;  5DQW A;  3AA1 B;  2IC6 A;  1MIY A;  3CVR A;  3GWH A;  5CA1 E;  1ZHC A;  1G73 A;  2EHO C;  2WWU A;  1KNZ A;  3EDU A;  1LRZ A;  2WM9 A;  3OKQ A;  2LOP A;  5E0O A;  5IHY A;  2H7O A;  3I9W A;  4QXH B;  2G0U A;  4E7Z A;  2YU2 A;  3V5U A;  3RYC E;  1HF8 A;  5FXV A;  2NW9 A;  4EOZ B;  5LG4 A;  4HN9 A;  3NRX A;  3ZN1 B;  4IE6 A;  2NP9 A;  4O2B E;  4UV9 B;  3LK4 2;  2LSK A;  4IE5 A;  2DNX A;  3WI3 A;  4ASK A;  3PE0 A;  3ZMS B;  2V7J A;  5JQG E;  3KIN B;  3C4Z A;  2KIN B;  3T8O A;  4PJN A;  5HXC A;  2KLQ A;  2X9W A;  1NAF A;  3JC6 D;  4AKG A;  3OYZ A;  4JEU B;  4OYJ A;  4JLE A;  2VB6 A;  2CLY B;  2BVM A;  3ZN0 B;  2CXL A;  1BR1 A;  1ZEE A;  3OJA A;  3UUM A;  2X51 A;  3LG7 A;  3PUR A;  4TV9 E;  3BQI A;  1WR6 A;  2KWI B;  2NW7 A;  4PJM A;  5LXT E;  4PJJ A;  4WBO A;  2QGS A;  2D5U A;  3N2K E;  3EUH A;  5JRE A;  4C91 A;  5JH7 E;  2E9X B;  4X1Y E;  5FY7 A;  2PG8 A;  4MAL A;  3ZC0 A;  4QX8 B;  4QX7 B;  3Q9D A;  1T98 A;  4TV8 E;  2VKD A;  3N9N A;  5L3B B;  2GK9 A;  5GON E;  4KBM B;  5HYA A;  3E0Z A;  5LJM A;  4KUM B;  3RC8 A;  1IAP A;  2ZM2 A;  3ZJ1 A;  5HXE A;  2IC9 A;  3ESL A;  2L9Q A;  1S35 A;  4ZI3 C;  2W00 A;  2CWY A;  2KZ7 B;  2CCQ A;  4O4L E;  1D1B A;  3AA0 B;  3PDY A;  3CPZ A;  2DWG A;  3C4X A;  5FNV E;  5FXZ A;  3RYI E;  3J7Y q;  4DBR A;  3ANW B;  3MK7 C;  2ODU A;  1UX4 A;  1FEW A;  3KV9 A;  3I9Y A;  2MYS A;  2JJ9 A;  4U74 A;  5LP6 E;  3A5X A;  5LHH B;  1OXZ A;  3P7I A;  5JDQ A;  3MKD A;  2XQY A;  3ZYM A;  3ZJ2 A;  1CUN A;  4PFO A;  5JVD E;  2K48 A;  5LHG B;  3VU7 H;  4HEA A;  4IE7 A;  2KMF A;  2YU1 A;  3VHL A;  1HG5 A;  3RYF E;  4AKL A;  3L3P A;  3F57 A;  4H63 V;  2D2S A;  5LGT B;  2E9X C;  2EHO D;  2CXF A;  3RRW A;  4DO0 A;  5JRC B;  2UXN B;  3LK3 B;  1EZ3 A;  4GIW A;  4BJN A;  2XAQ B;  5HXR A;  4G63 A;  3ZCJ A;  4PW8 A;  3KBU A;  2LSI A;  3IBP A;  3N9L A;  3UUL A;  4CXX A;  5AFU L;  3L09 A;  1BR4 A;  1KK7 A;  2WMN A;  3DP7 A;  3UUX B;  3HL6 A;  4GK5 E;  3O9X A;  2WBL A;  2XAF B;  3DJB A;  5HXH A;  2JRK A;  3QC9 A;  3S4U A;  3UT5 E;  3MZK B;  5FYM A;  1WLX A;  4UV8 B;  4O4J E;  5EK3 A;  2X67 A;  3UFE A;  1IJ6 A;  4GYS A;  4PAG A;  4ZI7 E;  2LE8 A;  2RA1 A;  4H63 H;  3FHN A;  3K3Q C;  4WW0 A;  4UEM A;  3HKC E;  3ZPO A;  3FBZ A;  2DCF A;  3CKD A;  5LOV E;  1MND A;  4M1P A;  4ZI2 C;  3RX6 A;  2LEH A;  3AAE B;  2V7K A;  5L3C B;  3AB3 B;  5JDL A;  4ZS3 A;  5CA0 E;  5EK4 A;  3CWZ B;  2DLR A;  2UXX B;  5J2T E;  3IEE A;  3MAC A;  2ZM0 A;  4YLH A;  5A1L A;  2V7L A;  2VKO A;  3ZLI A;  3BK9 A;  4CZZ B;  5F3J A;  2X9Y A;  4P09 A;  1HCI A;  3N9O A;  2ACX A;  4IE4 A;  4AXP A;  4X20 E;  3AA7 B;  1YKE B;  5L3D B;  2JMK A;  4ZHQ E;  4TUY E;  3LK2 B;  3RPU A;  3Q5W A;  4QHO A;  2CA5 A;  3LBX A;  2Q9Q B;  1ZV4 X;  2YK0 A;  3NZQ A;  5FY1 A;  3U3I A;  4XBF B;  4BJM A;  3EDV A;  2V26 A;  4B6X A;  2Q9Q A;  4N78 D;  4GK0 E;  3D0T A;  3RKO A;  3FXE B;  2LM9 A;  2XAG B;  3W15 B;  2W0G A;  2CMR A;  2DHR A;  3PU8 A;  3UTK A;  4EXT A;  3ETV A;  1MMG A;  2C0S A;  2ODV A;  3PUQ A;  4YJ3 E;  5FY0 A;  4CXY A;  1HX8 A;  2KWH A;  3CX7 B;  3O1J A;  4QXB B;  4CI3 B;  4ZOL E;  2I59 A;  3J9X 1;  2CXD A;  5LBQ B;  3SOL A;  5DJQ C;  4H9S E;  3AVR A;  1X79 A;  3MA9 A;  4AQF A;  4GYR A;  4E7S A;  2J1D G;  2XUE A;  1MMA A;  2CWO A;  2VK9 A;  2LJL A;  2Z6E A;  2N2N A;  5FXW A;  2A2F X;  3K3O A;  4YHJ A;  5L3E B;  5L3F B;  4HTE A;  2L3L A;  4I43 B;  1FMW A;  3ZMU B;  2KND A;  4H9N C;  3OBV E;  4AI6 A;  2BVL A;  2E9X D;  4NUV A;  1D0Y A;  4P0A A;  4V1A v;  2X66 A;  2MTQ A;  3H3A A;  1MIV A;  4IGU A;  1D1C A;  4O4I E;  2ZMA A;  4BAY B;  2JMH A;  3PUA A;  2Q9Q C;  2NWB A;  2NTY A;  4OYK A;  2SPC A;  1VOM A;  4OHF A;  4UEL A;  3ZCI A;  5DAB A;  5JDN A;  4F6R C;  3HR0 A;  4TN7 B;  3VKG A;  4PK6 A;  1WYB A;  3C51 A;  4H9O C;  2C5I T;  3N9M A;  1FMV A;  1LKX A;  5CB4 E;  2X68 A;  2C5K T;  3QUJ A;  3I0O A;  2N1G A;  2H7V C;  4UVB B;  3R84 B;  3AVS A;  1MMD A;  2Y8D A;  2XAS B;  3RYH E;  2RP4 A;  4AQG A;  5LGU B;  5JR9 A;  3LJC A;  5C8Y E;  4HE8 A;  2VL8 A;  3FXD B;  1MMN A;  3ZMT B;  2X9H A;  1D1A A;  4KMC A;  5HXS A;  2LOS A;  3N2O A;  4ZI2 D;  5IYZ E;  2LSJ A;  5DQV A;  2XAJ B;  2PFV A;  3WAJ A;  4IST A;  1LVK A;  4AKI A;  4J2C A;  1QUU A;  3DTO A;  3KFW X;  5LJN A;  3BQL A;  3MJX A;  2LSG A;  4L5G A;  2K9A A;  4ERR A;  4Z8X A;  4DVD A;  3N9P A;  3PTR B;  3EVY A;  3HKE E;  2QA7 A;  3NRY A;  4MHC A;  4ISS A;  1E1H B;  1FIO A;  4X1K E;  3HI2 A;  4A56 A;  3Q5X A;  2M67 A;  2HPJ A;  2NOX A;  2V7M A;  5FMN A;  1MIW A;  5HWY A;  2HPL A;  1HS7 A;  3OYX A;  4UXN B;  3SRZ A;  3CML A;  4UVA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...