4M1RA

Structure of a novel cellulase 5 from a sugarcane soil metagenomic library
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
296
structure length
296
Chain Sequence
MVAPITTSGNKVLFGGQQGSIAGNSFFWSNTGWGGEKYYNAQTVAWLKSDWKSSLVRAAMGVDESGGYITDSYNKTRVTTVVDAAIANNMYVIIDWHSHHAEQYQSQAIAFFKEMATKYGNNNNVIYEIYNEPLQVSWSSVIKPYATAVIAEIRKIDPDNLIVVGTPTWSQDVDVAANDPITGYANIAYTLHFYAGTHGQSLRNKASTALSKGIPLFVTEWGSVNADGGGSVATAETNSWVSFMKTNNISNANWALNDKAEGASALVSGASANGGWTSSQLTASGTLAKSIISGWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a novel cellulase 5 from sugarcane soil metagenome.
pubmed doi rcsb
source organism Soil metagenome
molecule tags Hydrolase
molecule keywords Cellulase 5
total genus 121
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m1rA00
1D3CA 4ZENA 1VIWA 3CTTA 1Q6FA 4Z2LA 5BROA 4IPNB 3WNMA 2J8GA 3CZ8A 1KQZA 1X6LA 5FIPA 2X0YA 3L4VA 1CENA 3K8MA 4ATWA 1MW0A 3K46A 4HPGA 5KZ6A 5A2BA 1WZMA 2WNWA 1NP2A 4M56A 3FXYA 1JD7A 1W9VA 3POHA 1MQQA 4W5ZA 1CYGA 3GDBA 2W4XA 1H1NA 1OIFA 1WZAA 1PZ2A 1PZ3A 1XH2A 2YJQA 3SCNA 1VJSA 1TVPA 2E9LA 4M24A 1H4PA 2Q8XA 1FH9A 1UD3A 5A6LA 5A8OA 4WKHA 2CKRA 2VZVA 8A3HA 2A3BA 3N17A 4NF7A 1E6XM 4QLKA 1J0ZA 4YPJA 5BYWA 1QVBA 4UZUA 1NM9A 1GOMA 3E1F1 2FH8A 3DYMA 1B3ZA 1AQHA 1GW1A 1H09A 1E0VA 3SUUA 2O9PA 4UQ9A 2ZX6A 2BY2A 2GJXB 4W7WA 3WUFA 3GH5A 1ITXA 5ABEA 2CXGA 3GNRA 1WDPA 3ZOAA 3BCFA 2OWWA 1OM0A 4GKLA 2EPOA 1JZ6A 2ZE0A 4ACZB 3A4AA 1JZ7A 1HJXA 1LL4A 2VQUA 2EXOA 4TX6A 5CG0A 5GNZA 2YA1A 4UFJA 4GZJA 2WLZA 2WSPA 2OWCA 1JXJA 3WL1A 5JIWA 3ARXA 2VX5A 4UFKA 3WF1A 1WPCA 3MMDA 3AHZA 5BXSA 4CU7A 2EJ1A 4MTVA 1KWGA 1WE5A 1KBBA 3SUSA 2BNJA 3MV01 5CSYA 1QI0A 2WCGA 1HXJA 5BRQA 1D2KA 1C8YA 4ACZA 3PTMA 3CHFA 1UHVA 2BS9A 4KRTA 1W9PA 1UKOA 1MQPA 1OD8A 3O6AA 2CBIA 3CUIA 3A47A 2ZWYA 3GXFA 4XX6A 3QHMA 4P7OA 1PIFA 1UWRA 4JFWA 2WMHA 1TR1A 1ODZA 2BXZA 1WDSA 3CPUA 3L4YA 1LWHA 1CGTA 3MANA 4W84A 1E4MM 3T2OA 2CHNA 4OBSA 1NWUA 1QBAA 3UERA 5GNXA 1OINA 2UWFA 2Z1KA 5FKYA 1QNPA 1KB3A 2WVVB 3N18A 1PAMA 4LYPA 2DT1A 5A6BA 2X05A 2VX7A 4W7UA 3WL0A 2CBVA 2D22A 3WH7A 2J7BA 4RL3A 3W28A 5ABFA 2VJXA 1V6XA 2F61A 4W88A 2EPLX 4S3KA 4QDMA 2WHJA 1ECEA 5IXEA 1PEZA 1SFSA 3AMLA 5GNYA 3EDEA 1W1YA 4HPHA 4PSRA 4GQRA 4J7RA 5E09A 1NP0A 1WB0A 1XV8A 3RM8A 3SCPA 2XG9A 5BRPA 5CSUA 3ZSSA 3NUKA 1S46A 3WFLA 4TTGA 4AZCB 2ZXDA 4MDOA 2XSBA 2WZEA 4MJ2A 1N82A 3W81A 1BQCA 3KL0A 4X0VA 3N9KA 3T2QA 1E6SM 2ZX7A 2ZIDA 1XHGA 1R7AA 4WJXA 5E0FA 1JZ5A 1QNSA 1KCKA 1KR1A 4MJ4A 3DHUA 1B30A 3SUWA 1JYWA 3L4TA 5HPOA 4Z2JA 3B9DA 3OGSA 1V6UA 1JZ8A 1OD0A 4MB3A 1CGWA 1HP4A 3B9AA 4H8VA 1RP9A 4M82A 5I77A 3SCWA 1EXPA 2XGBA 1E43A 4XZBA 1KQYA 5A1AA 2WBKA 4CU6A 3A6OA 1F4AA 2WKGA 5A6AA 2IUZA 4M8UA 1CNVA 3T09A 2VOTA 2ZUSA 1VENA 1UYQA 3WH8A 3N15A 5A8MA 3GXDA 1G9HA 2J7GA 1OWQA 3KZSA 2YDSA 3SCQA 5BXRA 2CERA 3MO4A 5D4YA 5E6YA 2Y24A 2CBJA 4U33A 3CHEA 5A6SA 1R8LA 5DEZA 4MB4A 5I0DA 5CGMA 4GI6A 2DT2A 1GVIA 1M03A 3SIMA 3SUTA 3PZ9A 1RD6A 1PX8A 3UESA 2D0HA 1HJVA 1ZS2A 2XGIA 1VEMA 4MDPA 1UQZA 3FNDA 4FLOA 1E6RA 3TA9A 1UG6A 4X0NA 3WIJA 3WD1A 3AIRA 1PIGA 3FN9A 1CTNA 2PB1A 2BHUA 3WUBA 2FGZA 2VZSA 1R7OA 5CJ5A 2ZUVA 4PMNA 1V3HA 2CNCA 3CUFA 3AHYA 3DYPA 4A3YA 1W2VA 3ZO9A 1US3A 1C7SA 1W32A 1PX4A 1Q6CA 3CZKA 4AIOA 2PBGA 5ABFB 1RPKA 1I1WA 3AZTA 3ARTA 3T2PA 5D9PA 1QI5A 1QOXA 2V38A 4P7NA 4URIA 3HMCA 3QR3A 2JFEX 4UZSA 2PWEA 3D3AA 3TP4A 1AQ0A 1UR9A 1UD4A 2BVTA 4JCLA 3SURA 3L4WA 1JGIA 1KXTA 4AMCA 1CECA 4BS0A 1W9UA 4JFTA 4E8DA 4JL2A 3WKZA 1EGZA 2ZX8A 2DGAA 4MB1A 1L8NA 2E3ZA 4AD5A 4V2XA 4WLCA 2YBTA 1JYNA 2MANA 5CXPA 5F7UA 2FHCA 2DQXA 3KEHA 2WMFA 4ZXLA 1DWAM 3RPMA 5FCZA 3OZPA 1FA2A 2JIWA 3PZUA 4JAWA 3CGTA 1E5NA 1WDRA 3WMBA 4L4PA 2WYSA 4U5IA 3VX0A 2JF7A 4J28A 4HZ8A 2GSJA 5M03A 1DWIM 1GZJA 1V02E 3SCUA 3EMCA 1B31A 4PMYA 1WNOA 5M17A 3IJ7A 1UWTA 3EDJA 2J47A 3PZIA 2YA0A 1GOQA 2BY1A 3UG5A 1X6NA 1K9FA 2J75A 3ARWA 4PMOA 2F2HA 2E0PA 1BLIA 3BMVA 2Y2WA 3EMQA 3O2LA 4JFUA 3M6DA 1OGBA 4RE3A 4BQ5A 5HDRA 4C7DA 4HA3A 4D6HA 3BSHA 4DUVA 2WC7A 1J0YA 3PTQA 4PTMA 4UQCA 1JI2A 3WBEA 3EBVA 1VFFA 2W62A 3AYSA 1EDTA 2G3MA 4Q7NA 4GQQA 2WHKA 5I79A 1GOOA 4R27A 3AS3A 3OLDA 4NI3A 3NDZA 1CPUA 3WDIA 5A6MA 4IISA 3CHCA 4X9YA 1VF8A 5GQBA 1TVNA 2V5DA 1L0PA 2DSZA 3AQUA 1US2A 3WY1A 5JBDA 1KBKA 3AOFA 1V6YA 3VUPA 3W24A 3ARYA 2J77A 5D8WA 2D24A 1JFHA 1YQ2A 4ZFMA 1MFUA 2VZTA 3EYPA 3RIKA 3ARZA 3VD9A 4TX8A 3BAJA 5E9AA 2BY3A 3L4UA 4P7RA 4TVCA 2DDXA 5I5RA 1SYTA 3LPGA 4FLSA 2A3CA 4PSPA 3CUGA 4HOXA 1EOKA 4J27A 2BFGA 1OT2A 1JYVA 1XCWA 4EKJA 1XSKA 1K6AA 3AMCA 4BCEA 4CVUA 1JXKA 2Y8VA 3U7BA 3NSMA 5HXMA 4W8BA 2A3EA 2GVYA 4LQ1A 1FHDA 2W91A 4MPKA 4EK7A 4JFVA 5IFPA 3MMWA 3WDHA 1XH0A 1VFMA 4CD8A 3AMKA 1NWTA 3RILA 1IT0A 4DWSC 1VBUA 4WKFA 3GXIA 1C8QA 3VO0A 1J10A 4W7VA 4EAMA 4WK9A 3VMOA 4Q22A 1P6WA 3MUY1 3WUGA 4PUDA 4QP0A 4F8XA 1MVYA 2PF0A 2CCRA 2JF6A 3FHAA 1FFQA 3AIBA 3MUIA 5A69A 3WDJA 4IUGA 4B3LA 4PMXA 1BFNA 3LMYA 3WQVA 1JF6A 3K4DA 2ZX5A 3BLKA 1JDCA 2V3DA 3MMUA 1DP0A 3NDYA 4QCEA 1G01A 1JNDA 1I1XA 3RCNA 3K8KA 4FMVA 3W6MA 4BQ4A 2DSUA 4JHOA 2JE8A 5E70A 1TE1A 2GJRA 4RE2A 1ISVA 4LX4A 1E72M 3WELA 1JNEA 4Z2IA 2DH3A 3AIQA 2AOSA 1E15A 1NH6A 3WH5A 1W2PA 2J62A 2ZXBA 3RJYA 3IANA 1EQPA 3WF0A 3GNPA 2DIEA 3RDKA 2BVYA 2YKKA 4F79A 4JIEA 2VRQA 4CUCA 1E6ZA 1JAKA 4AZ6A 4U3AA 1E4NA 1LL7A 1O7AA 5CLTA 3A4XA 2EEXA 2WHLA 4TVUA 2OSWA 2J7EA 1B3YA 2YL6A 4GI9A 1HKJA 3WH6A 1QI4A 2XHYA 1OCQA 3AIWA 4P8VA 3BCDA 1V0MA 4EE9A 4Z2KA 1M53A 3ALFA 2XVGA 1AQMA 2ZUMA 1GQKA 1Q6EA 2WAGA 2OSXA 1OGGA 1XYZA 3VD4A 4B16A 1NOUA 7A3HA 3AXIA 3OBAA 3VIJA 3VD5A 2J7CA 1JL8A 2GJPA 1EQCA 2YOCA 1ZU8A 1B0IA 2OSYA 2V5CA 1VFUA 3AFBA 1KFWA 3ARSA 1AMYA 1GJUA 1E1FA 4KGJA 5CPSA 2WANA 1ZBKA 3GM8A 5GPRA 2CKSA 1FH7A 4F9JA 1UWSA 3VDHA 3W38A 1WCGA 4S3JA 2VRKA 1VB9A 2XM2A 9CGTA 3CMJA 3VDBA 3CZGA 3IK2A 3NSNA 2PWHA 3WEMA 4PUEA 5IFTA 4BQ2A 3MUAA 5C71A 1KXVA 3VGFA 1BHGA 4OIFA 1XD1A 4F66A 2PWFA 2XPKA 3WMCA 1DWHM 3VKKA 1K9DA 1BAGA 3VGGA 1WDQA 2WMGA 1B1YA 4M80A 3G6MA 1UH3A 4J3XA 3UR7A 1G5AA 3F5LA 4AEFA 2G8ZA 1XSIA 1HT6A 3VM5A 1ISZA 1E5JA 2WZHA 2BV9A 4UTFA 3M7SA 3CZJA 5ECUA 3ZJ8A 4AD1A 1M01A 2CPUA 4HA4A 4FF5A 2ZWZA 3GH7A 3UG4A 1BSIA 3NSXA 1V0LA 4JKLA 2YLLA 3FHQA 3WENA 4GPNA 4UCFA 4UR9A 2D0GA 4N0RA 2CHOA 1E4LA 1OB0A 1UR4A 1CEOA 2XSAA 2D3LA 2XJ7A 2J74A 4WSKA 1ZBCA 1FOBA 1BVZA 3KWXA 2ZUWA 1LF1A 1V3KA 1V08A 2W5FA 4JFSA 1UR8A 2XWDA 3VNZA 3U5UA 1E55A 3N04A 3L4ZA 2VC9A 1C7TA 1E6QM 4FK9A 3PZVA 2VZOA 1OBAA 2Y5EA 5HPCA 4AYSA 1QHZA 1EDQA 1W3LA 1W3HA 3GZAA 1GORA 1W3JA 2QPUA 4UQDA 1B9ZA 4ML4A 3WDRA 4HOZA 4HZ7A 1ZB5A 3TOPA 5HBFA 4U3CA 2PBOA 3VIHA 1LJYA 4GO9A 2JEQA 4D1IA 1BG9A 1V3IA 3ZJ6A 2VR5A 4D6CA 5JIPA 2VX6A 3FW6A 2E40A 2C7FA 1E56A 1WO2A 3CH9A 4D1JA 1G0CA 2CESA 4WF7A 4PEEA 1LWJA 1QHOA 1BTCA 3VU2A 3AISA 4HTYA 1OGSA 3AMDA 3AIUA 3MU7A 2ZUUA 4H2CA 2O92A 1H2JA 1ZJAA 5DT7A 2XWEA 4ZE5A 1FP9A 1V0NA 4AZGA 2D20A 4QLLA 4CGTA 1PJ9A 3BSGA 1MWOA 5FL1A 1QNRA 5A8QA 3AHTA 3WNKA 4CD6A 5I2UA 1B3XA 3DC0A 1IZKA 4H41A 4A3HA 1ZBVA 3PZNA 2VCAA 3OG2A 2D1ZA 1UR2A 1CXLA 2YL9A 2XIIA 1KGUA 4AIUA 1JIBA 2QLYA 1E71M 1HJUA 2E4TA 2E9MA 4PMUA 1VBRA 4ZXOA 1GOIA 4LXFA 4QFUA 2WVUA 5AYIA 1U2YA 2J7HA 1BYCA 3AYRA 1W3KA 3U57A 3RM4A 3FAWA 3PN8A 2D0FA 2WKLA 4TXEA 1PPIA 2VUYA 4UNIA 1C93A 4CN6A 2F8QA 3U7VA 3FY1A 3AHVA 1SR0A 3T0BA 3F5JA 4PCTA 7CGTA 1NOFA 2JALA 1VAHA 2WW5A 3WUEA 4ZEPA 3WH9A 1K9TA 3AZRA 4WSJA 4AEEA 1JAEA 3GTNA 3AROA 5JBEA 4B15A 1UD2A 2VVSA 1NARA 2YA2A 4AZHA 2CYGA 3NJ3A 1OT1A 4B9ZA 3VIFA 2NW0A 3WD4A 1MXDA 3S6TA 4PCSA 3N13A 1BGGA 5LYRA 3G6LA 3AI0A 1HF6A 1CXFA 3PBGA 2VR4A 4LYQA 3AIVA 3QGVA 5BCAA 2NSXA 2PWDA 1E40A 3MSGA 1H5VA 1UWQA 1BPLB 2BXYA 1UD8A 2GDUA 4D6DA 2C8NA 4JCMA 3THCA 3BC9A 1HL8A 4LGXA 3SCTA 4MAVA 5A8NA 1DEDA 4R5EA 4GZEA 1CLVA 4D6JA 3L2LA 3W37A 1EIBA 1XRVA 4PYSA 1QI2A 2DEPA 1EHNA 4W93A 3B8SA 3KL5A 1E6NA 2CIPA 1BYDA 1GUVA 3W4RA 4UFLA 4U5KA 3BLPX 2GK1A 1JZ3A 2D2OA 3CZLA 3AXXA 5D9MA 4W89A 4AD2A 1LLOA 2WK2A 5LA2A 3RO8A 5ABGA 2WWCA 4GXPA 4AZ5A 3GBDA 3VD3A 2J8FA 1J0HA 2O9OA 3OLGA 3ARPA 3ARUA 1W1PA 3TONA 4TVDA 3VOCA 3T0DA 1Q6DA 2BHZA 3ZM8A 3W26A 2UY2A 2XFYA 4BA0A 1CIUA 5FL0A 3VGHA 4FLRA 1C91A 1VRXA 3WNPA 3WQ8A 4W8LA 1OSEA 2VX4A 3PZTA 1HJQA 4DUXA 4MNJA 2J78A 3WSUA 2YL5A 5EMYA 4QAWA 3ZSTA 5I78A 5CQ1A 4J3TA 4ZE4A 3WD0A 2V3EA 4KGLA 1H0GA 1E3ZA 3TTYA 4B3KA 1IZJA 4FLQA 3WNOA 4J3UA 2J79A 1MFVA 2X8RA 3RM9A 2G3IA 1UZ1A 3F4VA 4V27A 3THDA 3WF3A 2XUCA 2CBUA 3EDKA 2JIEA 3WF4A 3OLEA 2GFTA 1LG2A 4TUFA 2AMGA 2VQTA 3ECQA 3VGBA 3VGEA 1H3GA 2EQDA 3UEQA 4PTXA 4P8XA 1HJSA 2WMJA 5D8ZA 5BXPA 3F5KA 2GDVA 3CO4A 4HZ6A 3ZJKA 1BVNP 3VMNA 3WBAA 3QOMA 1R87A 1PBGA 3PZMA 4CCEA 4CN4A 1B3WA 4OUEA 4AD0A 1NWRA 2WMIA 1J9YA 3VIMA 3CHDA 3BAYA 1QPKA 5JBFA 4QCFA 1JDDA 3WEOA 4HMDA 1ISWA 3QHOA 1E73M 4J3SA 2EPKX 3GBEA 2OYKA 2VRJA 4OBRA 1BGAA 3A3HA 3GH4A 1RP8A 1FH8A 1WP6A 3SCVA 1HKKA 3MUZ1 1ZL1A 2WXDM 1GOWA 1NOWA 2WZIA 4HU0A 1KXHA 2WC4A 1J0KA 1E4IA 3UCQA 1WKYA 4YHEA 4J3WA 3SCRA 4AC1X 4V28A 2W67A 2DT3A 3T08A 4LPCA 4P7LA 4PMRA 1MYRA 1LQ0A 3W25A 2IXVA 3ZJ7A 4NRRA 4CU8A 3VVGA 4N42A 1XSJA 2O9TA 3SUVA 3OA5A 1DHKA 1G94A 1UH4A 2TAAA 1XH1A 3IJ9A 1ZBWA 4DWSD 3WFZA 4PBGA 1CXIA 1UKSA 4W87A 4PMVA 2E8ZA 2JEPA 3TTSA 2EO7A 2WVSA 2W61A 4D71A 5CZKA 1HL9A 1UQYA 4J3VA 1J0JA 2J7DA 3A4WA 4QLJA 2NT0A 4D6FA 1TA3A 5I3DA 1NQ6A 4AWEA 4BF7A 1IV8A 4GI8A 5A2CA 4HMCA 3ZT7A 1XCXA 2WB5A 4DWSA 4BZYA 1EO5A 4E4PA 5AC5A 1OIMA 2X0HA 1E6PA 3APGA 4GIAA 3ARQA 4U2YA 5M5DA 4B9YA 2J25A 3CLWA 4NRSA 2OWXA 3VIPA 4C7FA 1GHRA 2J4GA 5ABHA 4OOZA 3LPPA 4JHZA 3ZMRA 4U31A 1SMAA 4W85A 3TTQA 3W82A 2WWDA 5DT5A 5HNNA 1Q6GA 1HVQA 3M46A 4CCDA 2X1IA 3ZR6A 2ZX9A 1ITCA 1D7FA 3QOKA 4AXNA 3VIOA 1UWIA 4OOUA 5IHRA 1X1NA 5A2AA 5TD4A 5LA0A 1B3VA 1QI3A 2V3FA 2VT0A 4NZCA 2A3HA 1M04A 3W27A 2QPSA 2QMJA 2YIHA 3IAPA 2G3NA 1HKIA 1HKMA 2V3GA 2IXUA 1CDGA 2G4FA 1GQIA 2VZUA 3O9NA 1J01A 3SCSA 4D6EA 3VD7A 1KGWA 4HU8A 1Z32X 2E8YA 3WQ5A 5FD0A 3VDAA 3L4XA 2QV4A 1GOKA 1CBGA 4UQEA 2DPEA 3VIGA 4AW7A 3EDFA 3OGVA 2VNCA 3AHXA 4GINA 4UQAA 2XFRA 3W0KA 4UOQA 2AAAA 3EMZA 1SMDA 5FOOA 3S2CA 1DTUA 1GNXA 3T0AA 3RMEA 3IJ8A 3PZGA 1UKPA 3NYDA 2X09A 2Y8KA 4HA1A 3OZOA 2VURA 4IM4A 1BF2A 2EPMX 4PTVA 3WQ4A 1BG4A 5LA1A 4H04A 1VEPA 5A94A 2UY5A 3AMGA 4GZIA 2CETA 2D23A 2ZXQA 2GK1B 8CGTA 3HU7A 2WLYA 4HP5A 1QNOA 4AZBA 4MADA 1KR0A 2RGLA 1HVXA 4YN5A 1HN1A 1TCMA 5EBAA 2VMFA 2CITA 4PN2A 1QW8A 1V3LA 5E6ZA 1MQRA 2ZXAA 5IDIA 1FP8A 1K9EA 3VMPA 1GCYA 1C92A 4WIWA 4AD3A 3OIHA 1EDGA 2VI0A 3BMWA 5CLWA 1G1YA 5BXTA 4K68A 2FDMA 1J18A 1ISXA 1UH2A 3CBWA 3TTOA 3VGDA 1EH9A 3VDCA 3AIEA 4CD7A 5EB8A 1U33A 3PZOA 4NSBA 3VM7A 1UD5A 1V3JA 2X2YA 4YHGA 2C0HA 2A3AA 1W91A 2RGMA 2XVPA 3AS2A 1EO7A 3GYCA 1H11A 1H0IA 1V0KA 1GPFA 2GUYA 6TAAA 1CXEA 3W29A 3MS8A 1WAWA 4W5UA 3WEZA 4H8HA 1KXQA 1MW3A 4KRUA 2ZUTA 1TZ7A 2OLHA 5EFDA 2J7FA 4DUWA 2WSKA 1E9LA 2W63A 4PMQA 1J12A 1GHSA 3UR8A 4PMZA 3W53A 3ZT6A 1WZLA 2XYLA 4AD4A 4L4OA 1ZJBA 1CXHA 1GJWA 2UY3A 2UY4A 5DO8A 3ZQ9A 2DIJA 5DFAA 5I23A 2YDRA 3VNYA 2O9RA 3PTKA 2VL4A 4XB3A 1XC6A 3MKKA 4UOJA 3MV11 1MXGA 1MW2A 3AJ7A 1KGXA 2WHMA 3K1DA 2W66A 5I6SA 1E0WA 4C7GA 5JUVA 4PMDA 3UETA 1DWGM 3D5HA 3JUGA 1CGYA 1TUXA 2YLAA 4OZOA 5D9NA 2WPGA 4DM1A 3K4AA 2E9BA 2XVLA 1CZ1A 2VTFA 2DSVA 4AZIA 4KWUA 4DWSB 3BAWA 1QW9A 1XGZA 1H41A 3N12A 3N1AA 3PHAA 1W9XA 4UFMA 4Y7EA 4JKMA 4Z2HA 1MW1A 1UZ4A 3KL3A 2XM1A 2XFFA 2BY0A 4M29A 1JD9A 4W86A 4RE4A 2VO5A 5A6KA 4P8UA 3NIYA 4EANA 1JG9A 4PTWA 1Y7VA 1W1VA 4M81A 3BAKA 3GXMA 1UWUA 3HN3A 3BAXA 3M07A 1TFVA 4M1RA 3WNNA 1QNQA 2WMIB 3L2MA 3ARRA 2XVNA 2DSKA 3PZQA 2ZICA 1KCLA 3KE0A 4KH2A 3AZSA 1E0XA 2G41A 3ZT5A 1LG1A 4ATDA 3BAIA 5E0CA 1VJZA 4DM2A 5CPTA 3I3EA 1PX3A 1DWJM 4CN1A 4JZ5A 5C70A 2XVKA 3I3DA 4UFIA 1VEOA 4A4AA 3J7HA 3WDPP 3WD2A 4CVWA 1JZ4A 1TMQA 5AY7A 2WVVA 5CGTA 2DH2A 1EA9C 3LPOA 4XZWA 5M3WA 7TAAA 1NWSA 2EPNA 1B90A 3RJXA 1UA3A 5DMYA 2VCBA 1R85A 1BYAA 1GQLA 4MNKA 2BVDA 3VILA 2NT1A 3LPFA 2YBUA 4CD4A 4JL1A 2DSWA 1A47A 2W92A 1W9DM 4D72A 1M7XA 2D3NA 4XV0A 1E1EA 3AS0A 4UQBA 3WMSA 3OLIA 4MB5A 3VTRA 1V03A 1EOMA 3DYOA 3MSDA 3QHNA 4WKAA 1CLXA 4HOWA 1HIZA 2FGLA 4AY1A 1CWYA 1EHAA 2WC3A 1UUQA 4OKDA 1JDAA 2WVTA 3ALGA 6A3HA 2QHAA 1GONA 4CKQA 3POCA 1Q4NX 1H49A 4MNMA 3WNLA 3ZIZA 1UR1A 1UD6A 1UKTA 1B2YA 1F4HA 4AZ7A 5IHSA 1W1TA 2VCCA 3WF2A 1UOKA 3SCOA 4GO8A 3CUHA 1JZ2A 4AZCA 5D9OA 2HVMA 1FFRA 1R86A 5A8PA 1CGVA 2FHFA 1GVYA 1XYFA 1QBBA 3CIVA 4MAZA 4E2OA 1RH9A 4TTUA 4F9DA 3FAXA 2EBNA 2VVNA 3GNOA 1C8XA 2ZOXA 1V3MA 3OB8A 1C90A 1U30A 2DT0A 2WCSA 3I3BA 5DF0A 5A6BD 4D6IA 4CD5A 1BYBA 4Z2GA 3EDDA 4LYRA 4ATLA 4BQ3A 1WZKA 3B9EA 1FHLA 4P7QA 4HMEA 3CZEA 2FH6A 4OJYA 1UR0A 3BGAA 3ZR5A 2OYMA 3ARVA 1DWFM 2CEQA 1VFOA 4PRWA 2Y4SA 1JFXA 3DHPA 2WBGA 5C8BB 2ESCA 1HJWA 5I24A 2FHBA 3WQWA 3OGRA 4KMQA 1ODUA 3VINA 5EFFA 1E3XA 2GJXA 1TG7A 1TA3B 2WCAA 3AICA 3VIKA 2PWGA 4W8AA 1CGUA 3II1A 1CXKA 3VX1A 2XTKA 2WMKA 3VPLA 4IPLA 2XIBA 1CGXA 3AXHA 1YHTA 1JF5A 1A3HA 1C3FA 4ACYA 2BHYA 3WN6A 3CUJA 3WQ6A 1HNYA 1ESWA 3NCOA 4H8UA 3WDQA 2QMKA 2YDQA 1HP5A 3WD3A 5HOSA 3HJEA 3W6LA 4E8CA 2PC8A 1GQJA 2YL8A 1JYXA 3N11A 3UG3A 4MNLA 1LL6A 1V6VA 1O6IA 1E70M 5A3HA 3SEPA 2ZUNA 4UFHA 5BWFA 5A6JA 3AS1A 2QF8A 3U5YA 1V6WA 4D6GA 4H7VA 5KEZA 1UKQA 2G3JA 4U2ZA 2PI6A 5A95A 4JKKA 1AVAA 6CGTA 1J0IA 2HISA 1V02A 1KWKA 4UOZA 3BXWA 1HX0A 2B31A 4XUYA 5AYBA 1XD0A 1I75A 1W9BM 4AIEA 3CMGA 4AISA 2Z1SA 2WM0A 4CCCA 3BH4A 3IAQA 1JI1A 2OYLA 1J11A 1QHPA 4TOQA 1UA7A 3K8LA 1ISYA 5CPQA 5AC4A 3VIIA 4P8WA 3DECA
chains in the Genus database with same CATH superfamily
3GUWA 3DG7A 3LBOA 3WNMA 4JPGA 4GISA 2J8GA 1A3XA 3N2XA 3FGCA 1X6LA 2F6UA 2X0YA 4F2TA 1CENA 1G4PA 1WZMA 2WNWA 2C3ZA 3TC7A 1OIFA 3PF3A 3BO9A 5CJNA 4A05A 2VYOA 3LZ3A 4ZODA 3HG3A 3W3OA 4FAMA 3CS2A 5CSRA 4M0XA 3CQHA 1H50A 7PTDA 1WBHA 4KFPA 1NM9A 4UZUA 1GW1A 2A7NA 3OBKA 4GUJA 3UT0A 2QJMA 4Q8QA 2ZX6A 3LOTA 5HWMA 3CV6A 3G1FA 2B7QA 4LAUA 1W54A 1PYMA 3WUFA 3GH5A 5AKQA 2CXGA 2I56A 4BF5A 4M7TA 3GNXA 1N8IA 4GKLA 3CHVA 4XTIA 3W74A 1HJXA 1ZALA 1S5WA 3LLFA 2ZCGA 4I5UA 4TX6A 4CCZA 1DOSA 1W1A1 4OTKA 1P0BA 1VC4A 4UFJA 2WSPA 3R8RA 3ARXA 4HNUA 4UFKA 3MMDA 3AHZA 1KWGA 1KBBA 4OFCA 3MV01 3EKZA 3PNZA 4JX4A 5C7VA 1TPDA 4R3UA 4Z1AA 1HXJA 1BXNA 3PTMA 3CHFA 1UHVA 3CL8A 2GSEA 1UKOA 4J35A 1MQPA 3CUIA 4Q8UA 1OX5A 2NQHA 4XX6A 4FHAA 3QHMA 4CNOA 4C6PA 4JFWA 5AVHA 4E3TA 5FJOA 1AFSA 1WDSA 3EPMA 2QAPA 3KOWA 1B57A 3C2VA 1R3QA 1KM0A 4W84A 4LEFA 3T2OA 2P53A 4OBSA 1VR6A 3TU9A 1X7IA 1SU5A 3IV3A 4HT3A 4KPLA 4LYPA 3MYPA 5A6BA 2J7BA 4RL3A 3W28A 1GOXA 5H91A 3S42A 2B7PA 1TB3A 2VEMA 2J9XA 4QDMA 2H3BA 5IXEA 1LOSA 1LBFA 3AMLA 4L65A 2BGNE 3Q67A 3NO5A 4GQRA 1OZMA 3VOIA 5C6MA 3NL3A 4HNOA 1C9DA 2XG9A 2QKFA 1XQKA 4IP4A 2XSBA 2WZEA 3PBUA 6REQA 1TO3A 1VIZA 2MUCA 3MPGA 2Y7EA 1VS1A 1BQCA 3R10A 1JCXA 4X0VA 4FA3A 3N9KA 1KTCA 3KHJA 4FNPA 3BV4A 3N9SA 4WJXA 5E0FA 1QNSA 5D30A 1B30A 3ANVA 4Z2JA 2OVLA 3JW7A 2QVHA 3VKBA 2VFEA 3C0JA 1HP4A 1RP9A 2V2HA 1BWVA 3SCWA 1EXPA 4S3CA 2XGBA 3VZYA 3C61A 3QC0A 4FX7A 4RUBA 4CU6A 1F4AA 4FXRA 2WKGA 4REQA 2IUZA 4M8UA 1CNVA 2ZUSA 1W31A 4XTDA 2FTPA 3UZYA 4Q8TA 3N15A 4IIFA 2BZNA 4GYJA 3SCQA 1U5VA 2CERA 3P93A 2Q3OA 4BJHA 2Z28A 1AJ2A 1P0KA 1RJRA 5A6SA 2VFHA 1V4YA 3PJWA 4MB4A 3WG6A 3IRDA 3SUTA 1FWBC 1UC5A 1RD6A 3UESA 1TUFA 1UC4A 3T0CA 4MDPA 4X0NA 3ABXA 3WIJA 3AIRA 1PDZA 3FN9A 3MMTA 2PDNA 2ZRZA 3CAVA 1ADOA 3AWNA 3KRUA 3SRDA 4PMNA 4NY2A 2ZRWA 3M5ZA 4NZ4A 5I3KA 3CUFA 2CZDA 5BOFA 4Q8MA 4XO6A 3N4EA 3ZO9A 5HMSA 1PX4A 1Q6CA 3PUDA 2PBGA 4KBXA 3LTYA 4DF0A 4S39A 3ARTA 4MOZA 3UZJA 4URIA 3ENLA 4CQDA 3VNJA 4MWAE 2H8XA 2ISSA 4HCDA 1UR9A 4AHOA 4JCLA 1KRCC 3SO7A 1NDWA 3L4WA 2WZMA 2XZ9A 2HPMA 4Y6GA 2YCLB 1XINA 1NDVA 5DRIA 3E0FA 1H1ZA 1K4HA 3WLJA 1DL3A 1W9UA 2OO6A 3BJTA 3WKZA 2VD9A 1EGVA 3BLLA 3LCIA 4IIGA 4AD5A 4V2XA 3URBA 4GYFA 3S9ZA 2FHCA 3W23A 4L1XA 4PL2A 1ITUA 1PKNA 4DJFA 1AA1B 1UZDA 1WDRA 3MKVA 1HG3A 1V02E 3I7RA 4ZGYA 3B0UX 5M17A 3IGHX 4NNBA 3V3WA 3GHRA 3PZIA 2BY1A 3GDLA 3UG5A 1X6NA 4WGXA 3RLHA 1PXGA 2DVUA 4BEUA 3BMVA 3O2LA 4JFUA 4NILA 1TPWA 3B8VA 2NV2A 1Z69A 4BQ5A 5C7HA 2HS6A 1T0OA 1X39A 1XW8A 3BSHA 3LCXA 4UQCA 1XM3A 1DJZA 4L1GA 4ONVA 1AODA 1EDTA 2AL2B 2YFOA 1DIKA 3Q65A 5I79A 4X60A 2OPJA 3NDZA 2NUYA 5CZJA 4P5UA 3W1NA 5JBDA 3AOFA 1V6YA 4DEFA 4LEQA 2BG5A 2AAMA 3HMJG 3WQEA 2X1TA 3EXSA 4LVFA 4JQ1A 4Q4OA 2C13A 1YQ2A 3W72A 4ZVJA 2VZTA 3RIKA 3FYPA 3L5MA 4NJGA 2HVOA 1TR9A 3JRKA 2QDEA 1ZENA 3L4UA 4IP5A 2DDXA 2G96A 4LUYA 5I5RA 1SYTA 2Y62A 3H22A 3V18A 2BFGA 3REQB 3S3GA 4O18A 4GNJA 4ADTA 1P43A 4BCEA 1JXKA 3U7BA 4GACA 4DN1A 5AC6A 4HMNA 5HXMA 3R5EA 4HSNA 3W22A 1Y8BA 2ZRVA 3CIXA 4EK7A 2GPTA 4Z0JA 1OZQA 1PTGA 1ICPA 3MMWA 5I07A 3DG3A 1XH0A 3SECA 1VFMA 4CD8A 2AMXA 4WKFA 1C8QA 3VO0A 1LLZA 4WK9A 1O68A 3GTFA 3RMJA 3IUHA 3EA3A 4JEQA 3FHAA 3IRSA 3AIBA 5A69A 2PCEA 3R7MA 3LCWA 4LJ3A 2TODA 3A3WA 4ZB2A 3DU0A 1EC8A 1KV8A 3FJLA 5F2IA 3VCCA 4X63A 1JNDA 3K8KA 4RDVA 3LHWA 3OTRA 2O0TA 4WGHA 2JE8A 5E70A 1F61A 3K5XA 3I7QA 2AQOA 3OVPA 5FJRA 2DH3A 3WH5A 1W2PA 2C19A 1F8IA 4RPPA 2OX4A 3IANA 1YPXA 3WF0A 3GNPA 2ZZ1A 3GVGA 3VFCA 1SZNA 2XIOA 4IJBA 4JIEA 5MHBA 3BZJA 2VRQA 1CB2A 1TRIA 1Q45A 1Z42A 3S0CA 1HQTA 4U3AA 1E4NA 1O7AA 1M68A 3UVIA 4LBSA 4TVUA 2J7EA 1T6MA 1TIWA 4GI9A 3LHYA 2QT3A 3WH6A 3TYDA 3ZLHA 4FIRA 4XD3A 2QCMA 1OCQA 3ALFA 4AG0A 2ZUMA 3N9RA 2WAGA 4JD4A 1WXZA 2OSXA 5EYWA 3AXIA 3MHUA 4G6CA 4JY9A 3VD5A 2VEFA 4DJFD 1JL8A 1W0MA 4WRHA 3BJFA 1OX6A 1ZU8A 1P1XA 1XRSA 2OSYA 2V5CA 3AFBA 1GJUA 4KWWA 5CPSA 2NQ9A 3H54A 1ZBKA 5CH9A 1FX6A 3BQ6A 2QUUA 4S38A 9CGTA 3VDBA 3CZGA 1XX1A 3NSNA 3EA1A 4WY0F 4BQ2A 1TZ9A 3MUAA 3B9NA 4N02A 1OFOA 4B5NA 3QQ0A 1XD1A 2GLKA 4F66A 1J2BA 2QJJA 5CBBA 3HTWA 1K9DA 1BAGA 2ZKMX 1WDQA 3UR7A 1V8EA 4MPQA 5G2WA 3EAUA 1VBJA 4JX6A 4WEVX 1XSIA 3VM5A 3NFUA 4IG2A 5DRCA 5D2TA 3C52A 1E5JA 4DZAA 4UTFA 1UASA 2OXNA 2RFGA 3ZJ8A 5DQPA 2CPUA 3SY5A 4KT2A 4E0CA 2X42A 1V0LA 4XZLX 4MVAA 3WENA 5FACA 1THFD 2DZWA 2PDUA 2ISWA 4WD0A 5KITA 4GVIA 3KRSA 3CQKA 1QATA 2J27A 1X96A 1E4LA 2NQ5A 2XSAA 5D03A 2J74A 4FNUA 2VD8A 2V2CA 5DY3A 3LGEA 2GSHA 3LCHA 1MEWA 3W83A 2J6VA 3GQYA 4FK9A 3PZVA 1REQA 1I2RA 4AYSA 5L9FA 2OG9A 3UYCA 2C1IA 2BXVA 2PDPA 3H2NA 3SQLA 3OVGA 1BG9A 1O66A 3MUCA 1XDJA 3W7DA 4M6QA 4NYYA 3LTPA 2VX6A 2PPGA 1T96A 4DAIA 1UR3M 2C7FA 1E56A 1WO2A 1G0CA 3M0MA 2HWGA 4GNKB 4WF7A 3ATZA 1LWJA 1QHOA 3MO7A 1BTCA 1NF0A 3G2GA 2ODOA 4H2CA 3UWWA 4HNTA 4GVGA 2NUWA 2O92A 4GJ1A 2I14A 4BHYA 1K1DA 4ZE5A 2QR6A 3VNDA 4A35A 2CHRA 3LCLA 2CLKA 2WQPA 3WFAA 5FL1A 1XIGA 1M7OA 3QV9A 2FJKA 3QJAA 2NVDA 3E49A 3W1TA 1JPHA 4G1NA 3CL6A 3PZNA 4MGGA 3SBFA 4QE1A 4DJDA 2R6OA 3KAOA 3R94A 2XIIA 3OQEA 1NFPA 1LBMA 2GQ9A 3BK0A 4NASA 1DHPA 3EGJA 3HV9A 3IGXA 3ISIX 2PDYA 4DNMA 3SADA 1S38A 3CT2A 2G95A 4QFUA 3I4KA 3KBWA 4CNPA 3SQSA 3RX4A 1XLGA 2VEGA 3S8HA 1VCFA 4LANA 3LUTA 3M0JA 1JPMA 2VUYA 2XSXA 2F8QA 4ZO9A 3U7VA 2X1UA 4GH3A 4LB4A 4KW2A 3F2BA 3DFNA 4PCTA 3W7IA 3B06A 1NVMA 1QPQA 3BCJA 3CT7A 2VGGA 3A64A 2GVLA 1UD2A 4B15A 1NARA 2YA2A 4C6IA 4HHHA 1MXDA 3S4TA 1SO4A 2OELA 2Y7GA 5LYRA 1W1ZA 3TSDA 4WUIA 2P3ZA 2G3FA 4K2SA 3PBGA 4LYQA 3QGVA 1FHVA 2Y7FA 4S3BA 3PAJA 2NSXA 2FZMA 1E40A 2VP8A 1Y5WA 3IV8A 2O55A 2PDCA 2QJIA 2BXYA 3G77A 2OQYA 3CL7A 4D6DA 1XLDA 4EVZA 3Q45A 4JCMA 1HL8A 1NY1A 3TN4A 4C1NB 1DEDA 4PB3A 2ZDSA 3CWOX 3R25A 5IRPA 3KM8A 3JR2A 4HK7A 3W37A 1EIBA 4NZFA 2X16A 2PP0A 3RG6A 1QI2A 4JGDA 1VFTA 4AWUA 1EHNA 4K7YA 1PB0A 3B8SA 5C9XA 1BYDA 1GUVA 3WLQA 4MZ1A 3APTA 1JEZA 4W89A 1LLOA 3S46A 4A2SA 1SW0A 1A0CA 2WWCA 3IS4A 1WOAA 2WOQA 3DHDA 3GBDA 1MDRA 2W27A 2O9OA 4CEXC 3ARUA 1YBQB 4ZFCA 3TONA 1PIIA 3S2LA 3TYCA 3VKJA 1SQ7A 1PO9A 2BHZA 1EGMA 2QXWA 4BA0A 2YX0A 2DP3A 4FB7A 3TV8A 3TYZA 4FLRA 1POKA 2ZZ2A 4MNJA 2E1DA 5BW6A 2YL5A 3ZSTA 5I78A 1RCXB 4IMDA 5KZDA 3RX2A 1W3IA 4A6GA 3USZA 3S83A 4HYRA 1TTPA 1U1HA 4FLQA 3FJ6A 4XBJA 4ORMA 3PB0A 3UVAA 3RM9A 4IMFA 1W6TA 3F4VA 5I02A 3THDA 2EGZA 3LY0A 3EDKA 4NJKA 4N7QA 1ZJHA 5LXXA 4TUFA 3OA3A 2VQTA 3ECQA 4Y9AA 3UWVA 2EQDA 4H00A 1V77A 1XBYA 3TSMA 3A9IA 3L5LA 3ZJKA 1LRQA 4LCSA 4NAFB 4L4LA 3WBAA 3K1GA 3R4IA 1PBGA 2PDIA 1M1BA 3SN1A 1F05A 4AIBA 4GHRA 4CCEA 4OV4A 5FJTA 3IGSA 1R47A 2ZZ7A 1HGWA 2WMIA 2I5QA 1J9YA 4GGBA 2WNNA 3U8GA 4UMAA 3W7EA 1LYXA 1XXXA 1GVQA 1QPKA 3WLLA 4QCFA 2PWUA 5B7YA 3HGRA 1E73M 4ZTXA 5B7ZA 2Q6ZA 1OFRA 4GUHA 4OBRA 4DB7A 1IR1A 1LP6A 1RP8A 3HG4A 4PFHA 3S9IA 2RDXA 1FH8A 1WP6A 3TLQA 1ZL1A 1NOWA 4X22A 3T4WA 3MQTA 2DFAA 4EWND 4H7CA 2WSQA 3UCQA 1WKYA 1YMYA 3FJ4A 3JZUA 3XINA 2FIQA 1NDYA 3RU8X 2DT3A 3EEGA 1MYRA 2OR2A 3M64A 4PR4A 2PTZA 1M5WA 1KFJA 2P88A 3FSUA 1G94A 3RX3A 4NXKA 5LNUA 1UH4A 2TAAA 3W73A 1P7TA 2EG8A 1FDYA 3NQFA 5LNRA 3C3UA 4QX4A 1S1PA 2PS2A 1CXIA 4W87A 3ZFHA 2E8ZA 2JEPA 4A3RA 1S3TC 4WY0B 3LDVA 1H61A 2GGJA 4GIEA 2ZVIA 4D6FA 5I3DA 1IV8A 4IFKA 4WHBA 4GI8A 5A2CA 2V5LA 5F2MA 5KETA 1O12A 4OE7A 4E4PA 4GIAA 3ARQA 1RBOB 3E6EA 4B9YA 4N9EA 3M43A 2ZZ3A 4DF1A 3LTSA 3MHFA 2P0IA 5EMKA 2QDGA 3Q58A 4W85A 2X40A 2OT1A 5DT5A 1I0BA 1Q6GA 4O1CA 4TR9A 5LNSA 1LRTA 3WLKX 2X1IA 3ZR6A 1ITCA 1KV5A 3G1RA 3QW4B 2NV1A 1UWIA 3PG8A 1VBGA 2GOUA 1X1NA 3P81A 4QIUA 1B3VA 1Z3NA 4NZCA 2V3FA 3DFPA 4JTDA 2A3HA 4RDZA 4F2UA 3GU2A 4DPPA 2G4FA 5EA9A 1GQIA 3O9NA 2DUZA 4B5SA 1ML1A 4EP8C 2NQZA 1Z32X 3W1XA 5C9RA 2ZZ6A 1IIGA 3NOYA 3HQ1A 1UBSA 3H55A 3JS3A 3EDFA 1FWDC 4AWSA 3KRBA 1VKFA 4ZB5A 4GYPA 4JTQA 4UQAA 2XFRA 3TIMA 2WJZA 2Z24A 5EU9A 3FYYA 9XIMA 2OZ0A 2GQAA 1IZCA 3OQ8A 3PZGA 1GWJA 3QGKC 4UXDA 3VNLA 2Y8KA 4PTVA 3WQ4A 5LKYA 5LA1A 5I03A 2HNHA 3W07A 3JVAA 1ONRA 3SW6A 1VEPA 5A94A 3HQOA 3CWNA 2D23A 2ZXQA 3EWBX 3M0XA 1XPGA 8CGTA 3HU7A 3RXZA 4H9YA 3GC4A 1KR0A 4MWAB 4YN5A 1FRBA 2OTDA 1ZCCA 5EBAA 2F38A 3VC6A 5IDIA 1FP8A 3TR9A 1O1ZA 1AH0A 2FFIA 4DYEA 1XIFA 4I7UA 4HGXA 3ES7A 1ZZMA 5BXTA 2WKJA 5HINA 3I7SA 3CJPA 3UJ2A 4M6VA 3UP8A 1IGWA 1Z7AA 4LUSB 3VDCA 5H2ZA 4IX2A 2ZQ0A 5G4WA 3OPSA 3PZOA 4NSBA 2G0WA 1UD5A 3FVDA 1V3JA 3DESA 2WSRA 2A3AA 1W91A 4PEKA 3GYCA 1MO0A 3PS7A 1GPFA 4PTDA 1LTDA 6TAAA 3H2AA 3GG7A 3SB0A 5BWAA 5XINA 3BVJA 1P6BA 1WKEA 2PE4A 2ZUTA 4LAMA 2OLHA 2ZA3A 4B4FA 4EAYA 4DUWA 4Z1YA 2Z7KA 4O14A 1E9LA 1LT7A 1OHLA 4ZQPA 1GHSA 3O15A 1OYAA 4N9BA 1WZLA 1JPKA 2ZC8A 3TROA 1O60A 3H23A 1PSCA 3O8AA 5KINA 3BURA 1CXHA 1TPH1 5DO8A 1XYCA 1IXQA 3ZQ9A 3VNYA 2HK0A 1TWZA 4JTEA 3WMLA 3MWCA 3PTKA 1LT8A 3PPFA 1LORA 1ADSA 3AJ7A 2INEA 1Z48A 1FKWA 3K1DA 1XG4A 3VNKA 1XLJA 3BDKA 4DWDA 1XIMA 4KCVA 4PMDA 3JUGA 1K7XA 1CGYA 2YLAA 2Y5JA 3W2MA 2WPGA 3P60A 1L6FA 4IGMA 4KWUA 1H41A 4UFMA 3KL3A 2QF7A 2BY0A 1A5KC 1EP1A 1H7WA 4FF7A 4EANA 5D33A 1Y7VA 4EWJA 4M81A 1Z44A 3BAKA 3GXMA 3O7UA 1UWUA 3BAXA 3M07A 4M1RA 3G24A 2WMIB 2Y5SA 2Y8UA 3ARRA 3B0YA 1JQVA 1TV8A 3PZQA 1S5TA 3BARA 2A6NA 3WLNA 2XFWA 5E0CA 1TPC1 1WDWA 3IIVA 3MHGA 3AAMA 3NQ7A 5AY7A 1EJ7L 2OQLA 3LYEA 5FF3A 1EA9C 3UGVA 3LPOA 3E3HA 5CAHA 5KMYA 4BR1A 3N19B 5M3WA 1UA3A 5DMYA 2VCBA 4PUNA 4XQ6A 1L6YA 3RRXA 2QCDB 4FZIA 3GE7A 6XIAA 2YBUA 1P1MA 1O5QA 4CD4A 4JL1A 1D7KA 2DSWA 1A47A 1W9DM 2ICSA 4F2BA 1SJBA 2Z1BA 1YYAA 3A21A 3QZ6A 3TOYA 3P8IA 4TU1A 3VTRA 4HPXA 4PB5A 3PG9A 1EOMA 4AF0B 3QHNA 4GCXA 1TPFA 1CWYA 1AK5A 3Q37A 2WC3A 1UUQA 4OKDA 1GVRA 3GNNA 3N3TA 1FBAA 4DBUA 3REQA 3UPMA 3LXCA 5D09A 5HR7A 1UR1A 1UD6A 1UKTA 1A5CA 1F4HA 1GQNA 3F2DA 3TUUA 1ZQ5A 1W1TA 2J66A 4ZR8A 4RW5A 4JOMA 4GO8A 2G4JA 1OCJA 2CLOA 4YTRA 4E3VA 3PPHA 3W1PA 4CQBA 1K3UA 2DUXA 1AW5A 3WX7A 4HZMA 4US5D 4GXWA 1J5SA 1GVYA 3WLSA 1YXCA 3FGCB 2RHGA 3F4WA 3PFMA 4LYKA 5F1UA 4ECLA 2ZOXA 3OB8A 4PL1A 1HTIA 3I3BA 4UUIA 5A6BD 1KO0A 3KS5A 4XSMA 3TLLA 3NEHA 4DQWA 2CLHA 1WZKA 4PUJA 1FHLA 1VPXA 3VDGA 4P7QA 4HMEA 3CZEA 3QMSA 3THAA 5C0QA 5D2XA 2FH6A 3DOPA 5BZAA 5CZSA 4D8AA 4AAJA 4UMBA 1VFOA 3UY8A 3UFYA 2Y4SA 1JFXA 4WX2A 2PTYA 3O0FA 1DJIA 1RALA 2RUSA 3WQCA 3NM3A 4PUKA 3WQWA 4RNFA 3O63A 3VINA 5DXYA 3O16A 4AX6A 3TC6A 4WZHA 2IQ0A 1X7FA 1TG7A 1YLVA 4K6AA 4IGSA 2BDQA 3H7VA 3NVDA 8XIAA 3VIKA 3EX3A 1RQEA 1EUAA 1LZOA 1CGUA 3II1A 1CXKA 5D32A 3VPLA 2XIBA 1JF5A 3U4FA 1TTQA 1C3FA 3KZPA 2VFIA 3TYEA 5FEXA 4GYPC 2C71A 2YDQA 5HOSA 2F9RA 4BWLC 2PC8A 3ANUA 3UPBA 5C9UA 2NVAA 4JTTA 2INFA 2CZ5A 3FX4A 1MNZA 4XKMA 3UG3A 4AU0A 3H2CA 4GUFA 4UFHA 2BOFX 1V6WA 2W9MA 2G3JA 5A95A 4JKKA 1AVAA 3WCZA 1X8FA 3QBUA 1V02A 3TC3A 2O4QA 4KWVA 5REQA 4ZB0A 5CPMA 3CMGA 3VKDA 3DGRA 1J11A 1ICSA 1GKRA 1VHNA 2H6RA 4XVEA 3M4HA 2OKTA 1UMYA 4AHPA 3SIZA 4K37A 3SY1A 5HATA 4IPNB 1ZUAX 2B0MA 5EPDA 1TTJA 4J1OA 1EB3A 3KOYA 4HK6A 3U2CA 3DFTA 3K8MA 4O0QA 2E6AA 2Y61A 1MW0A 5KZ6A 4CQ9A 1ZAHA 1NP2A 4FXFA 1W9VA 1QXLA 1DJWA 3GDBA 1RZMA 1PZ3A 4PTNA 3S1GA 1VJSA 4M24A 4C6FA 3A5VA 1P7TB 1H4PA 2Q8XA 5FF2A 1QOQA 3EOUA 5A8OA 1E0UA 4WKHA 1GYNA 2DZUA 3N17A 3MZNA 1OF6A 3O6YX 1E6XM 4Y90A 2XISA 4NNCA 1YX1A 5BYWA 4JTUA 4WY0A 7ENLA 1QOPA 3BLEA 1QVBA 5LIUX 4O15A 3E1F1 4OV9A 4QJ3B 1H09A 3SUUA 4UQ9A 4LVDA 4FPSA 2TMDA 1JR1A 1DKWA 1ITXA 3QKZA 1BEUA 1KFEA 3QTPA 1WDPA 4A3QA 3BCFA 1OM0A 2J9ZA 2EPOA 3OODA 1AD1A 2PGWA 3A5FA 3OZYA 1JZ7A 4GX9A 2EXOA 5CG0A 3N2CA 1TX2A 3VA8A 5JIWA 4UTJA 3WF1A 2GGEA 5BXSA 2YGYA 1XLIA 3LK6A 1WE5A 1LLWA 3CV7A 1QI0A 5KTLA 5DBUA 1DBTA 5KZMA 1NIUA 1D2KA 2BS9A 4KRTA 4DO6A 4I9AA 3GIPA 3LV5A 4QJ4B 1BRLA 5HQLA 5CCZA 1TR1A 2BXZA 3L4YA 2Z26A 1SSDA 4E2DA 1OJXA 3NAVA 1JCTA 3UBPC 3UZWA 2FQIA 3DGBA 2MNRA 3O07A 2J8TA 4O17A 1EF2A 2REQA 1QNPA 1W3TA 1P4CA 1PAMA 2VX7A 3ITTA 3WL0A 3A23A 2HZGA 4ILSA 1SVDA 3PUEA 1GTHA 3P61A 3KS6A 3GVVA 1IEWA 2Z25A 2RJHA 2FZDA 1V6XA 4QJ1A 3UU0A 2WZTA 4X3ZA 2EPLX 2V82A 1QO2A 2VOMA 1ECEA 1ENUA 1QW7A 5SWUA 5GNYA 3CU2A 2FVKA 4HPHA 5FSEC 3H4WA 2WJFA 4J7RA 3PPCA 3OG3A 2BP1A 4J2PA 4HD5A 5CPNA 3H7UA 3EWWA 4YCOA 4TTGA 3GW3A 3IIZA 4MDOA 2QUTA 3IEBA 3BGJA 3TX9A 2IKJA 4Q8NA 3HO8A 2ZX7A 2ZIDA 3M0ZA 2W6RA 1XHGA 3KTXA 2ZBTA 1JZ5A 1KR1A 4MJ4A 4ML9A 3L4TA 3OGSA 1V6UA 3TVAA 3SY8A 1A80A 2FVMA 4H8VA 5LNVA 1FWEC 4N9CA 1VCGA 4XZBA 1KQYA 1Q7ZA 3MW7A 3HG5A 3SI9A 5A6AA 1UUMA 3LV6A 3T09A 3M0IA 4R33A 1UYQA 1ICQA 3TW7A 2IS7A 3EWDA 1A5OC 4HN8A 1FWJC 2YDSA 5BXRA 2SFPA 1RAKA 2OLAA 2CBJA 4GUGA 4R53A 2GYIA 2QULA 4U33A 5I0DA 3VNIA 2DT2A 1M03A 3PZ9A 4XSLA 1PX8A 3RRAA 3TZNA 1HJVA 3ABRA 3NPVA 4LUIA 2XGIA 1GVSA 1UQZA 3W2LA 4FLOA 2JGQA 1PIGA 3PK7A 4NXSA 1UP2A 2I5IA 2BHUA 2GVJA 1SJDA 4ZSTA 1E1CA 2VZSA 4H83A 5CJ5A 3QY6A 1L9WA 1EBGA 2PU0A 3GKFA 2FB2A 2E77A 3W2JA 4FIQA 3LM3A 4A3YA 1W2VA 5M2FX 1C7SA 4AWTA 1W32A 4LF2A 3N14A 4NZ5A 7REQB 5ABFB 4C6JA 4W9TA 3AJXA 2EG6A 1R3YA 3AZTA 1FXQA 1JCNA 1QI5A 1VD6A 1QOXA 3BICA 3KCLA 3UNDA 3HZ3A 4GZ7A 5TNVA 2VGFA 4LT9A 1XGDA 1IEQA 2XH2A 4HBKA 3M5VA 1YKWA 1K7EA 1AQ0A 3E0LA 3EX1A 3PSWA 2Q8LA 4XWUA 2X0SA 4FALA 1JGIA 2E25A 4JNMA 4QEEA 2X7VA 2Z29A 3WLOA 4AMCA 3GWQA 2ZFAA 4JL2A 1EGZA 4MB1A 4LCRA 3PWIA 4WLCA 5AYXA 1JYNA 4IXXA 5CXPA 4IL0A 1PE1A 3HGJA 2WNZA 3KEHA 4ZXLA 1DWAM 1D9EA 3PZUA 4JAWA 2CLMA 3C2FA 4IHCA 4L4PA 4O1EA 4LALA 1SUXA 4U5IA 3VX0A 4ENLA 3R11A 2GSJA 3UWZA 1GZJA 4GFSA 4C65A 3EMCA 4PMYA 1LUCB 1WNOA 2PGRA 3IJ7A 4XKYB 4IIBA 1R9XA 1QUMA 1K9FA 2J75A 3GXPA 2F2HA 5FJUA 2E0PA 1MZRA 2Y2WA 3TAOA 1QR7A 1OGBA 4KEVA 1YADA 4C7DA 4HA3A 3W71A 3MY9A 4DUVA 2WC7A 3LLXA 4R34A 4HHPA 1PUDA 1WX0A 1JI2A 1MUCA 3GG1A 4RR4A 2ZE3A 1PL9A 4EX4A 1G4EA 3EBVA 1VFFA 1D3HA 3DEQA 4L5ZA 2G3MA 2PDXA 5FI8A 3UJFA 2PMQA 3AS3A 2QZRA 5A6MA 3WDIA 3W7PA 1RQBA 5DX7A 2DZSA 3NGFA 4C6KA 3LCGA 1TVNA 2V5DA 4J4KA 3AQUA 1A5LC 3IVSA 5F1VA 3ARYA 3B05A 3PUOA 2J77A 4YTQA 4A8NA 4GFIA 1TWWA 2D24A 3QY8A 2PZNA 5D2VA 1IYXA 2V2DA 4AB4A 4O11A 3EYPA 4B5XA 3ARZA 2Z1XA 3BAJA 2NXGA 3STEA 2TRSA 4M51A 5HWJA 4P7RA 3KW3A 3WLIA 4FLSA 2A3CA 3CUGA 4HOXA 1EOKA 4J27A 1OT2A 1JYVA 1TMLA 4PULA 1KM4A 1GPWA 3AMCA 1BRLB 2Y8VA 2A3EA 1JQXA 4LQ1A 4MPKA 3OW1A 5F2GA 1QWGA 4JFVA 4D8LA 5DANA 4QSFA 3IWPA 3CK5A 1TMHA 1NWTA 4Q4SA 1IT0A 4DWSC 3GXIA 1OG0A 1XYAA 1Q7QA 2FMOA 4GMEA 3VMOA 4Q22A 1IE7C 3MUY1 3NZ1A 1MVYA 4LAKA 2CCRA 2JF6A 3MUIA 4BY3A 3FEMA 3WDJA 2DUAA 1PVNA 2VWTA 3MSYA 1VPQA 5FJIA 4PMXA 1BFNA 3LMYA 1XF0A 3EWXA 2GUUA 3N25A 3VCRA 3WQVA 2B7NA 1JDCA 2ZX5A 2V3DA 3MMUA 1DP0A 4QCEA 5AZ1A 4BI5A 3ME3A 1G01A 3RLGA 4NP7A 3ORWA 2DSUA 5D02A 1F3TA 1I2PA 1TE1A 1X8CA 2J13A 1K70A 4S3EA 4LX4A 1JNEA 1QJWA 4NJHA 4IJCA 3W7RA 1WXJA 3LA4A 5HA7A 4ZL1A 5CG7A 3MTWA 1ZY9A 2ZXBA 4H9UA 3LRMA 1YXYA 2BVYA 2YKKA 4HJWA 4F79A 7ODCA 2GGHA 3C8NA 4CUCA 4RXFA 4I5RA 5AC8A 3INPA 1KTNA 2EEXA 5HNRA 4W4QA 2NQLA 2YL6A 5C9WA 4TIMA 3TFCA 1E9IA 2XHYA 3NQGA 1M53A 4TX9A 2XVGA 1ONWA 1Q6EA 3URAA 1XYZA 4MLRA 3CB3A 3DI0A 2YB1A 4F40A 3UWYA 2QUVA 2X30A 3PJTA 4ZQCA 2ZA2A 5XIAA 3GFXA 2IMRA 2QCNA 1VFUA 3CPGA 3STFA 1E1FA 1FDJA 1R3VA 5G4EA 2WANA 1YDNA 2CKSA 3R89A 4F9JA 4TV6A 1TJ2A 3FIGA 4EACA 3BJSA 1VB9A 2NVCA 1K77A 3TQVA 1T41A 3IK2A 3KP1A 4PUEA 4Q4QA 1IQ8A 3W7CA 3VGFA 1RCQA 5AYZA 5C2XA 2QDHA 4HSHA 2PWFA 2XPKA 3NZGA 2QCHA 3NQ8A 4AVNA 4UC5A 1DWHM 3VXGA 3VKKA 4QQUA 1TWDA 1E9YB 1EJVC 3F7JA 1UH3A 3N34A 3F5LA 4AEFA 2XN0A 3K13A 1ISZA 4GVHA 2BV9A 4GI4A 3CZJA 4FR6A 5K9XA 4AD1A 1HGYA 3FFSA 4KRZA 4HA4A 3UG4A 1BSIA 3NSXA 4Z17A 2CZFA 1A0DA 4JKLA 2PP3A 2YLLA 4YTUA 4GPNA 3DFYA 3TDFA 1AJZA 4XUGA 4UCFA 4UR9A 1UMLA 2ISFA 3DH7A 1OB0A 3BV7A 3KWXA 1LF1A 2XWDA 3W7GA 1E55A 1W3NA 4HB7A 3N04A 4LOCA 1E6QM 1TV7A 4NAEA 2Y5EA 4F4RA 4I6VA 4CNTA 4OUIA 5K9CA 3IK4A 2YW4A 3M9YA 4IQJA 4YL2A 2PF8A 4UQDA 3TOPA 2Q01A 1LJYA 1H7NA 4LBUA 2BX7A 2XINA 4QS6A 2A21A 2I7GA 5GVJA 4L4MA 1EA0A 1TVLA 3PP7A 3L0NA 3KXQA 4EF8A 4M3PA 4PEEA 2F6KA 4HK5A 3AISA 3T4CA 5JH2A 3AIUA 3M0YA 1FWWA 3MZ2A 2NV9A 4N4PA 3W84A 4NX5A 1RJQA 1V0NA 1WUFA 1LUCA 1Q7MA 3BSGA 5G1TA 3C2OA 3PFRA 3GSMA 3HGOA 2DJXA 3AHTA 3NPXA 2Z2AA 4LH8A 5L6UA 3NOEA 3G0UA 4M5PA 3OG2A 1YDYA 2D1ZA 1UR2A 1SO3A 4LVGA 1CXLA 2YL9A 1KGUA 1XIIA 4RXGA 2Y7DA 4GC4A 4HYVA 3FA4A 2R91A 2XH7A 3P84A 3S9YA 3C86A 2WVUA 1U2YA 4K7VA 2GJLA 2J7HA 3KRZA 3H7RA 3AYRA 2C15A 3RM4A 3E38A 2O4MA 3SJ3A 5H8PA 4K36A 4QG6A 5HUOA 1PPIA 1C93A 4CN6A 2GWGA 3ABZA 1EBHA 1XBZA 1S39A 3AHVA 1L2UA 4DI9A 3S2MA 2ALRA 1BSLA 3BOFA 3F5JA 4Q8WA 7CGTA 1NOFA 1KC7A 5HULA 3WUEA 4ZEPA 1LCOA 3NL6A 4AEEA 1JAEA 1TPVA 4XO7A 2VVSA 2CYGA 1NFGA 4HTBA 4JQ3A 2PTDA 6TIMA 2BLEA 3WD4A 3FSTA 4I3GA 3N13A 4G7FA 4GJIA 2FMNA 1EP3A 1WQ5A 1UB3A 2VR4A 4OECA 1VFHA 3AIVA 5CAKA 2PWDA 3MSGA 4HNVA 4NZ3A 3CQJA 3G1SA 1AJ0A 4GK8A 1BPLB 3HFYA 3LERA 2DZXA 2GDUA 2C8NA 3G3MA 4QM1A 4LC8A 3SCTA 3T8QA 1MNSA 5A8NA 4R5EA 4GZEA 1RLDA 1CLVA 1Q3NA 4D6JA 5HWNA 3T42A 1LRNA 3NO1A 1S2TA 3MP4A 2BWGA 3L9CA 1AD4A 3GD6A 4W93A 3KL5A 4BKNA 1S3HA 4C6CA 3P2VA 2GK1A 5TBOA 3W86A 1K8CA 2D2OA 4DJED 3AXXA 1Q63A 3FVMA 2HK1A 1YE4A 1XP3A 4QDWA 3V4BA 1JVNA 5EBUA 3CQ0A 2QUNA 3PWAA 4QS5A 4KCUA 2PDLA 3VZZA 4US6A 3BTNA 3ARPA 4C60A 4FO4A 2D2JA 4O8AA 4L6DA 4EF9A 3BG3A 3AALA 3VOCA 4Y96A 2PDJA 1UBPC 4MWAC 1CIUA 3VGHA 4LSBA 3WNPA 5JU6A 3WJZA 1FCVA 1OC6A 4DUXA 2J78A 3WSUA 4QAWA 4OBTA 1OFPA 4J3TA 2PU1A 4ZE4A 3N29A 3TYUA 2V3EA 1IXOA 3TTYA 4ZQMA 5K2ZA 2YCJA 1RXOB 1IZJA 3IUIA 5TIMA 2FGBA 2HS8A 3TKFA 4J3UA 3OP2A 2X8RA 1UZ1A 3U0HA 3TZFA 4S2CA 2I9EA 4IL2A 2CBUA 1O95A 4QAIA 2CLIA 2ZRUA 4X2PA 3HGSA 3FK4A 4Y9MA 3RPDA 4QHRA 3LXBA 3F2CA 1ONEA 3UEQA 4PTXA 4M6UA 2I1OA 1HJSA 3A9BA 4IIDA 3F5KA 3MVTA 3NXLA 2OKOA 3DG6A 4CNSA 1BVNP 4AFYA 3VMNA 4YVXA 3QOMA 1EL3A 3T9PA 5HR6A 4CN4A 4OUEA 4QR6A 1QU4A 1OX4B 2V9DA 4PFMA 1J79A 3BAYA 5U4NA 3WEOA 2YCEA 3EWYA 2CWNA 4HMDA 3QHOA 2VEPA 5EGRA 3LLDA 3GBEA 2VRJA 1BGAA 4XAFA 3A3HA 3WBYA 4JXCA 4PGLA 1PKMA 3TK7A 1GOWA 1OK6A 1R9YA 2Z27A 1OX4A 4HU0A 1KXHA 3G1HA 4XD4A 2WC4A 1MXSA 1VFSA 2OOGA 4YHEA 3SCRA 4AC1X 3W7MA 2QCCA 4V28A 4GD0A 1SFJA 2W67A 4LPCA 3PAOA 1LQ0A 3W9ZA 4H01A 4ZSUA 4NQ1A 4B91A 1NJJA 4RDYA 3VVGA 3NA8A 4RJEA 1XRFA 1HW6A 4PE8A 2WJDA 4CQAA 3IJ9A 3WFZA 3PNUA 2YBVA 1BKHA 5CBIA 2PEVA 4PMVA 4EPDC 3LSBA 1YTEA 2W61A 4D71A 2OODA 4ADSA 1YIXA 4H9XA 1NTHA 3UR2A 4IG2B 4KIRA 4DJEC 3VUSA 4BZYA 4DWSA 4PCFA 4UTHA 3APGA 4U2YA 3M7WA 3CLWA 2OWXA 3LSCA 3VIPA 1DV7A 3NM1A 4QJ5B 2J4GA 3W01A 3H12A 4JHZA 4JYEA 4ZOAA 3TTQA 1JPDX 1DIEA 4BI7A 5LHFA 5HNNA 5IBXC 4MFEA 2YXGA 1CW2A 1K6WA 3QOKA 2RKXA 3VIOA 3BL3A 1VP5A 2CZVA 2ZA1A 3WQDA 5TD4A 2CWXA 1QI3A 2VT0A 3TYAA 2JBMA 4FXSA 2YIHA 5LIWX 1HKIA 1VYRA 1HKMA 4G8TA 1CDGA 2VENA 4D6EA 2INZA 5FF0A 4J3ZA 4F0KA 1RV8A 4P61A 4S3AA 1W37A 4K1GA 1CBGA 4QGCA 2QJHA 2OGYA 2D2GA 3OGVA 5AB3A 3AHXA 4QBXA 4GINA 4HHLA 4Z08A 2QNEA 3E9AA 4FP1A 1KNWA 1XIHA 3S2CA 1DTUA 1X1ZA 3W2UA 5LIXX 3BMXA 2ABAA 1GNXA 3M47A 4HCHA 3NL5A 4N6FA 5I06A 4GXMA 4R9OA 4B4HA 3QPZA 3NYDA 2X09A 2PP1A 1MEHA 3URNA 5D38A 4GZIA 5AHEA 4AMAA 4ICMA 1TV5A 2WLYA 1QNOA 4AZBA 3GXTA 4ZOCA 2BMBA 1HVXA 1DXIA 3BG5A 1HN1A 4PCPA 4RX0A 1T7LA 1L6GA 1MQRA 2L5HA 2O56A 1W5NA 3VMPA 3GFYA 4UCGA 1GCYA 4WIWA 4AD3A 2ZRYA 3HG2A 3OIHA 4R7OA 2Y0FA 1SJAA 5CLWA 4DPQA 1PYFA 2FDMA 4I9MA 1J18A 3CBWA 3U4AA 3VGDA 1EH9A 4R85A 3AIEA 4CD7A 3W00A 3VC5A 3EX6A 3LMZA 1U33A 4H6QA 4UNKA 2RGMA 5EMUA 1H11A 1H0IA 2GUYA 3NVTA 1WAWA 3WEZA 3BG9A 4LNYA 1OG6A 4L6HA 1KXQA 2QEZA 4H2HA 3I6EA 4NAEB 2NXIA 3LS9A 2J7FA 4QE5A 1EFZA 2WSKA 2W63A 3CMFA 2ACUA 1P0EA 3SSJA 3UR8A 4MF4A 4PMZA 1X98A 2XYLA 3LX9A 1A4LA 1GJWA 2OCZA 4UBPC 2J24A 3T6CA 4C6BA 5I23A 1PTDA 2YDRA 1ZNNA 2O9RA 3WJYA 3S6DA 3VE7A 2Z6IA 1QRQA 4GY1A 3CEUA 3L5AA 2QW5A 4O13A 4L64A 1HKWA 2Z1WA 2WHMA 4IT1A 4I9TA 2W66A 5JUVA 3UETA 4DLMA 1DWGM 4LRSA 5J04A 1TUXA 2Q09A 4DM1A 1ME7A 2XVLA 4AXKA 4AZIA 4O8RA 1XLEA 3BAWA 3L0GA 5CKSA 3PHAA 1W9XA 4Y7EA 4Z2HA 1UJQA 2QYGA 1XPYA 4DYJA 2EKGA 1JD9A 4RE4A 4E38A 4PTWA 5I09A 1W1VA 4DZ5A 4MM1A 1QDSA 3UZXA 3HN3A 3WNNA 4NU7A 4L61A 4IXHA 4KERA 2ZICA 1KCLA 3KE0A 3G8RA 2R82A 4H9ZA 2G41A 1LG1A 1DJNA 3I3EA 4JIIX 5C70A 3I3DA 4JR5A 4UFIA 1VEOA 3J7HA 1JZ4A 1TMQA 4PH6A 4HKPA 4XZWA 5J8LA 1M7PA 2CLEA 1NWSA 2EPNA 1B90A 3STPA 3ZWTA 3RJXA 4UTMA 4Q32A 3DC8A 1R85A 1F9CA 2A4AA 3VILA 3N4FA 1TSIA 3OVQA 1LOQA 1KD0A 1KKOA 2W92A 4FNTA 1S5MA 4XV0A 3E2SA 3DHFA 3NTYA 4ZQNA 1AH3A 3E74A 1A5UA 2BSLA 4U10A 1NU5A 4GVFA 3MSDA 1CLXA 4HOWA 2FGLA 1EHAA 1NSJA 2YCKX 4IFRA 3FXGA 2QHAA 3FDGA 3M6YA 1Q4NX 5HNUA 3ZIZA 1ZFJA 4YTSA 3A3XA 2OEJA 1B2YA 1P6CA 2VCCA 3WF2A 1UOKA 3SCOA 3B9OA 3V0TA 5EY5A 1NFBA 4DVOA 3MJMA 2HVMA 3UA3A 1GZ1A 5LXEA 2NSOA 2J9YA 1GKPA 5HMFA 2FHFA 4NHVA 1XYFA 3CIVA 4TTUA 2X7WA 1MRQA 3BUVA 2QUMA 2VVNA 1LQ2A 5TQLA 1C8XA 3WJWA 2PDBA 2VHLA 3NQAA 2EF9A 1V3MA 1YPIA 3BW2A 3G8EA 1H7PA 4D6IA 1DIOA 4CD5A 1JRCA 3GY1A 1BYBA 3L2IA 4DJDD 3B9EA 4YWSA 2IQTA 3SAZA 5GJMA 1U5JA 4JQ2A 1UR0A 1UWAA 3ZR5A 3ARVA 2CEQA 4LVBA 3DHPA 1MMFA 1UPMB 1FHUA 3RPTA 4KEMA 4C1KA 2AQWA 1ODUA 1SZRA 1GVFA 5EFFA 3VK5A 1Q5MA 3ITGA 2W79A 2F6XA 4AY8A 1E3XA 3W1QA 3V35A 2XDFA 3AICA 3NQMA 2PLMA 2XN1A 2PWGA 1XI3A 2PAJA 3TA6A 4XIMA 2E6YA 2E1WA 4O1AA 2PA6A 2W3ZA 1D8WA 1XLLA 3AXHA 1O5XA 2BASA 3GR7A 3SGZA 3WN6A 1KM5A 1XKYA 3WQ6A 1PV8A 3MI3A 2OZTA 2DV0A 1HP5A 4ASTA 3W6LA 7XIMA 3KWSA 5F4SA 1XLKA 2RDWA 1I0DA 1ECQA 3QW3A 3L68A 1R2TA 1FWCC 1V6VA 1OFAA 3KHDA 1Q13A 5A3HA 2C0AA 2WSYA 1TE6A 5A6JA 3AS1A 2QF8A 3TMLA 1FTXA 1TJ1A 1UKQA 2PI6A 1PWMA 4IZGA 4U4MA 6CGTA 2HISA 3WZ0E 1KWKA 1WV2A 1QO5A 1HX0A 2GGGA 1AUSL 2B31A 4XUYA 2ZRXA 5AYBA 1XD0A 1I75A 3H26A 3H21A 3W7OA 4Q33A 4I8YA 1XG3A 2X41A 4GWEA 1V5XA 1QHPA 3C0SA 4H6EA 4ORIA 3K8LA 1ISYA 4HA0A 3TJXA 1D3CA 1DXEA 2PDWA 4ZENA 1VIWA 2OQHA 3CTTA 1Q6FA 3S1XA 3E96A 4IFOA 4DO4A 2F2KA 4JTHA 4JTCA 3CZ8A 2VC5A 3N2BA 3NQDA 1I2QA 4ATWA 4QROA 3W1RA 3HJZA 1OC7A 1JD7A 1W8SA 1RSCA 4Q4RA 3POHA 1H1NA 2A7PA 1WZAA 1PZ2A 3M5YA 2YJQA 2GWNA 1TVPA 4FI4A 3NYZA 6ALDA 1UD3A 3W2NA 3UXIA 8A3HA 2A3BA 3BPWA 7TIMA 2ON3A 1RQHA 4F48A 1J0ZA 4YPJA 3TAKA 4JHMA 1TIMA 4ZMGA 1EZ2A 1SFTA 1GOMA 1VRDA 2FH8A 3DYMA 1B3ZA 2R24A 3LHZA 1AQHA 3P0WA 3NPUA 2HE5A 4XZHA 4JY8A 1E1CB 2O9PA 2IPWA 1A49A 2GJXB 4W7WA 3T55A 5ABEA 1KCZA 3GNRA 4JS3A 3OU8A 3ZOAA 1JZ6A 2ZE0A 4LTSA 4KS0A 2VUNA 2DW7A 5I3GA 1EYWA 2TSYA 3A4AA 3GVRA 4R9XA 5I3IA 5JMUA 2VQUA 5GNZA 3TWBA 3UWUA 3VABA 2WLZA 4LAZA 2VX5A 1E0TA 5G1YA 4CU7A 3TXZA 4UTWA 1GZGA 3SUSA 2BNJA 2GOKA 3MA8A 1XL9A 5CSYA 1PWLA 4HYWA 3QKEA 2WCGA 2YCIX 5BRQA 1C8YA 3ITYA 3ONBA 1W9PA 1OD8A 3O6AA 2CBIA 3U2EA 3IJ6A 4GBDA 4JQAA 2Q71A 4O0KA 4P7OA 3HURA 2WMHA 1G7VA 1ODZA 1XJBA 3CPUA 1KTBA 1CGTA 3MANA 1E4MM 4NZJA 1XYLA 3N2MA 4O1BA 3LQLA 2GL5A 3UERA 5GNXA 2NX3A 2UWFA 3B8IA 2PFHA 5FKYA 4HHMA 5HK4A 2FPVA 2WVVB 4NIRA 3KOZA 4IMCA 2KX9A 5EMMA 2CBVA 2D22A 1SZFA 3WH7A 1JCLA 3T81A 1NEYA 1FXPA 4R7WA 4GLEA 2AQVA 3EXRA 2PC4A 2HEJA 2VELA 4W88A 4S1FA 4S3KA 1TWIA 2WHJA 2Q8ZA 3TQPA 3BGGA 1SFSA 3RLVA 2GVGA 3ATYA 3URQA 1RBAA 4E2VA 4PSRA 1EC9A 1K02A 1Q2RA 1NP0A 3ZVHB 1XV8A 2ACRA 1TV3A 2HXUA 4GABA 3ZSSA 3NUKA 1S46A 3WFLA 1IEVA 3SR7A 4C6MA 5IM51 1SM9A 4MJ2A 3W81A 3PJUA 4EPKA 4HJFA 3KL0A 5AHMA 3V7PA 2A5HA 2Z00A 5F4XA 3T2QA 4YS1A 5CC6A 4QXIA 3LENA 2Q02A 3MWAA 4EPEC 5TF0A 3U48A 4Y9OA 3DHUA 3SUWA 5HPOA 4FS9A 1NQKA 1JZ8A 3L66A 1F74A 1CGWA 4M82A 2FYMA 1HZYA 4F0LA 3AUOA 1WOBA 4OWGA 2PDMA 4Q4PA 1F6PA 3EWCA 3T7VA 2R1MA 1E43A 3D3FA 3IARA 4RPQA 1YNPA 4UNLA 4FEZA 3IIPA 2OEMA 1VENA 4DJFC 3WH8A 1XS2A 2ZTKA 3GXDA 1H5YA 1G9HA 3BOLA 3ABOA 1RR2A 3UPWA 1R3WA 4WOQA 4HNLA 5F4WA 3P80A 5E6YA 3UWQA 3B0VC 3CHEA 4H9TA 4XZNX 3SIMA 2Z2BA 3HM7A 5FESA 4DZIA 3FJNA 3UJRA 3I6TA 2D0HA 2PTXA 3GHUA 2Z0IA 1YRRA 1VEMA 3C2EA 4QNWA 3GR8A 5DCEA 1E6RA 3TA9A 1UG6A 3A12A 1G69A 3P5YA 1CTNA 2PB1A 2VFFA 5HQEA 3H53A 3WUBA 2I16A 1R7OA 2JKEA 3C2YA 3A22A 1V3HA 3PTDA 1XDLA 3DYPA 4M7SA 5IOBA 1ZP4A 1G4TA 1M7JA 5K9DA 2BODX 3DENA 3CZKA 1RPKA 4KEZA 1P0NA 1J93A 1I1WA 1LWIA 3UA4A 3GVQA 4FSAA 1JJKA 2E09A 2V38A 4P7NA 3UXAA 4FXJA 1XFBA 3QR3A 2JFEX 2E6FA 4UZSA 2PWEA 3D3AA 1PZ1A 4G7EB 2BVTA 2X1RA 1E51A 3VKAA 2R14A 1XFCA 3LU2A 5AECA 1KXTA 3EX2A 3TYBA 1YDVA 2H90A 4BS0A 2Z1VA 2FZ9A 4JFTA 5BU9A 4E8DA 4ES4A 2ZX8A 1DPMA 1L8NA 2E3ZA 4IX0A 4PC8A 2YBTA 1WBJA 2MANA 1MRAA 2VKZG 4HCLA 4MZ8A 3O06A 4BI6A 2WMFA 3RPMA 3GU1A 2JIWA 1PS9A 3CGTA 3EX4A 3W7HA 2WYSA 4J28A 4HZ8A 1NF7A 3SCUA 2VDGA 1IEIA 3EDJA 3ITOA 1V7AA 1DIDA 4PMOA 5AHIA 3S5OA 3TFXA 4Q3MA 3VNMA 4LUSA 4RE3A 3U2OA 2Z6JA 1L8PA 4D6HA 2NWRA 3RYSA 2DZAA 1N8FA 3NNTA 2QJGA 1IT7A 5U7SA 4Q7BA 2EPHA 4Q7NA 4GQQA 1TV2A 1E9ZB 2WHKA 4R27A 2QJNA 1N8WA 1CPUA 4IISA 4X9YA 4MWAA 4DBEA 1AQFA 1L0PA 5CSSA 4IOTA 1US2A 4RV8A 2Z7GA 1KBKA 3P67A 4XAGA 2V69A 3W24A 3SJNA 5FEPA 5D8WA 2JGYA 4JNZA 3E0IA 3GS6A 4EXAA 4ZFMA 1MFUA 4O1DA 2YR1A 3E2QA 3WK0A 4C6DA 3DKJA 3V5FA 5FJPA 3CV2A 4XAPA 5E9AA 3OYXA 3GUGA 1Z6KA 4KESA 5FSDC 1CB7B 4PSPA 2RAGA 4GQGA 1XSKA 4EKJA 2YDAA 8TIMA 1J96A 2XIQA 3S5ZA 4C5YA 4K39A 8XIMA 4C1LA 3HA1A 1XBXA 3F4NA 2W91A 4NG3A 3WDHA 5JXQA 3AMKA 3PULA 3RILA 1VBUA 3E02A 1OK4A 1BVWA 4K8EA 3GDRA 4MKVA 1MZHA 1HFBA 1P6WA 4QP0A 1FFQA 4NJJA 3HPXA 4IUGA 2FTWA 4B3LA 1AL7A 1S2WA 4OT7A 2PDHA 1JF6A 3PR2A 1OCNA 4IGNA 3NDYA 3DKLA 2XIJA 1I1XA 2WQDA 4RNIA 4FMVA 4BQ4A 2FZBA 1SW3A 3MJYA 4RE2A 1V51A 1ISVA 1TREA 1G67A 2NXHA 4Z2IA 4LNCA 2AOSA 1NH6A 2E5DA 2J62A 1KRAC 1VQTA 1OFDA 4PRRA 1Q2SA 3P5ZA 5H1WA 3RDKA 2R1KA 3QZEA 1O5KA 4L80A 5T9CE 2PLCA 3CYVA 1LL7A 1GVOA 3WBWA 5CLTA 3H6OA 4RCXA 3WBXA 3R58A 2OSWA 4IPJA 2OLSA 2HBVA 1K8ZA 1QI4A 2XH0A 3AIWA 4P8VA 1V0MA 4Z2KA 4JTIA 1AQMA 1M9HA 1X38A 1GQKA 3SQMA 3VD4A 3TQ0A 3OBAA 3VIJA 4AH7A 1A3WA 2GJPA 2YOCA 3M0LA 2CC0A 3O05A 3BLDA 3S1WA 1QK2A 2Y6ZA 1KFWA 1AMYA 4KGJA 1KRBC 4HU4A 4WQ6A 3GM8A 1FH7A 1UWSA 1FCQA 3APYA 3W38A 2ISDA 1B4KA 2VRKA 2XM2A 1UIOA 3CMJA 5MKGA 1A5MC 1HO4A 2PWHA 4FOJA 1FWAC 3USBA 3AC0A 1KXVA 4JBRA 1CT5A 4OIFA 4RV3A 3W87A 1LROA 1YW1A 1QNVA 3R6IA 1B1YA 4M80A 1V7YA 3W70A 5BMXA 1R2RA 1G5AA 1TRDA 1Q8AA 1GEHA 1HT6A 1KKRA 5A6TC 3DFOA 4G5DA 3W7JA 2WZHA 3QMTA 3M7SA 5ECUA 1FVPA 3TN6A 1UZHA 4FF5A 1R0MA 1F73A 3M0VA 4JN7A 3ZS4A 2D0GA 3VOGA 4LB3A 4N0RA 2CHOA 1SZEA 3AU6A 1CEOA 4AY7A 2XJ7A 4WSKA 1ZBCA 3RNDA 1TPUA 3OO2A 1BVZA 1IWBA 2ZUWA 1V3KA 3AXMA 3HPSA 3VNZA 7REQA 4EIVA 3MDUA 3U5UA 3N2OA 3WLMA 2VC9A 2ONEA 1OBAA 4DNHA 5HPCA 4Y2WA 1R9ZA 5K4XA 2PDFA 1EDQA 1W3LA 1W3HA 3GZAA 1QCWA 1GORA 1W3JA 1B9ZA 4ML4A 3UZ5A 4IQDA 4IIHA 4GA8A 3NWRA 4HZ7A 1ZB5A 4U3CA 3VIHA 3ZLGA 2G37A 3GVWA 1W8GA 4D1IA 4LFYA 1V3IA 1EPXA 1EJSC 2HPIA 2OZ3A 4Q6JA 2VR5A 3HBLA 1CLKA 3TTEA 5AYYA 2E40A 5FA5A 3RUBL 3RR4A 5JH1A 3KVMA 1UJPA 4KCWA 4D1JA 2CESA 2I5GA 4G9PA 1OGSA 4HTYA 3AMDA 2ZUUA 1IXNA 1OF8A 3N4AA 1H2JA 1KFKA 1RVKA 3FKKA 2C14A 3W7KA 2Y89A 4CGTA 1PJ9A 1RPXA 1EP2A 4FX6M 1DJXA 3CQIA 5A8QA 3W1AA 3WNKA 3I10A 4A3HA 1IZKA 3GRIA 1F76A 4HVXA 1F5ZA 1XIBA 2PURA 2QV5A 1B5TA 3B8WA 1FWTA 3QQWA 4MUZA 3DUGA 5G4HC 4J40A 2QLYA 4Q6XA 4PMJA 3B8UA 3LRLA 2P1FA 4ROQA 3NQBA 4Q8VA 4PMUA 2FZNA 3LHTA 3RR1A 1VBRA 1TWSA 1GOIA 4LXFA 2XIMA 3VE9A 4IQLA 3DFSA 3KOFA 4XAZA 4DZHA 5AYIA 3NQ2A 5GJNA 3CTLA 1BYCA 1Q6LA 4K1WA 4ZOEA 1W3KA 2P8CA 3PN8A 3W7NA 1Q4WA 2WKLA 4TXEA 3HFTA 1FWSA 2P5NA 1QTWA 3FY1A 4L7ZA 3CUXA 1SR0A 3TQKA 3T0BA 2H9AB 2JALA 2WW5A 3WH9A 4XBSA 1FWGC 3CPRA 3V16A 1K9TA 3AZRA 3T78A 4WSJA 3GTNA 4LBRA 3AROA 3HOJA 4KFOA 1S5NA 4AZHA 2DY3A 3SZ8A 3HPZA 1M3UA 3NJ3A 2A1YA 3KCOA 3VIFA 4YVPA 3WK1A 4WDWA 4J2MA 3B0XA 4PCSA 2REQB 3OYZA 3A4JA 4F0HA 3TCEA 1CXFA 3BLFA 2FPYA 5BU6A 3R8HA 4MY9A 4AC7C 1FDZA 1FWIC 1SJCA 3B03A 4ZTYA 4L56A 5F2LA 2ZZ5A 2OZ8A 3E12A 1EX1A 3BE7A 1L2QA 4MAVA 1J5TA 3B0PA 1F6YA 2PWVA 1PKYA 3L2LA 1XRVA 1BTMA 1T5AA 4ZZ9A 2C6QA 3LNPA 2DEPA 3KTCA 5BRBA 2CIPA 3QY7A 3W4RA 3W76A 2C18A 3GZ3A 3CLMA 3QM3A 4UFLA 2ACSA 3IACA 1JZ3A 3CZLA 4GY7A 3UY7A 3JZEA 3BANA 4ICNA 5LA2A 3T0TA 1PDYA 1ZAJA 3W75A 4F0MA 1DTNA 3VD3A 1EEPA 3NQEA 2EG7A 1J0HA 1GT8A 2GUBA 4G7EA 4UTTA 4TVDA 1KRMA 1KM6A 3T0DA 2Y88A 1Q6DA 1UPPA 3ZM8A 1AW1A 4UTIA 3N6QA 1XYBA 1U1UA 5M1TA 3CASA 2A0NA 1VRXA 1HJQA 5HUPA 1A5BA 4HPNA 2VDHA 3QTGA