4M1RA

Structure of a novel cellulase 5 from a sugarcane soil metagenomic library
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
296
structure length
296
Chain Sequence
MVAPITTSGNKVLFGGQQGSIAGNSFFWSNTGWGGEKYYNAQTVAWLKSDWKSSLVRAAMGVDESGGYITDSYNKTRVTTVVDAAIANNMYVIIDWHSHHAEQYQSQAIAFFKEMATKYGNNNNVIYEIYNEPLQVSWSSVIKPYATAVIAEIRKIDPDNLIVVGTPTWSQDVDVAANDPITGYANIAYTLHFYAGTHGQSLRNKASTALSKGIPLFVTEWGSVNADGGGSVATAETNSWVSFMKTNNISNANWALNDKAEGASALVSGASANGGWTSSQLTASGTLAKSIISGWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase 5
publication title Structure and function of a novel cellulase 5 from sugarcane soil metagenome.
pubmed doi rcsb
source organism Soil metagenome
molecule tags Hydrolase
total genus 121
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m1rA00
3W38A 2ZE0A 1EO5A 1E3XA 4W8LA 4PCSA 2C8NA 1UQYA 1CYGA 3NUKA 1JIBA 3ARRA 4BQ5A 1OT1A 3TA9A 2UWFA 4W86A 1QHOA 4CCDA 1ISVA 2WMHA 4BS0A 5E70A 1JDAA 4M56A 4BF7A 1JF6A 1G5AA 4U5IA 4U31A 1LWJA 4AZ6A 2FDMA 1FFQA 3QHOA 4F66A 2ZUMA 3OG2A 3FNDA 4B16A 2CXGA 4PCTA 4ZENA 3GH7A 2A3AA 2WC3A 3IAPA 4CD4A 1MQRA 1V03A 4PTVA 1US2A 1AQMA 3ALGA 1MVYA 1WO2A 5ABFA 2WNWA 4J3SA 5JUVA 3JUGA 4CN6A 1E71M 2XM1A 3BLPX 2JFEX 4KGLA 2WVTA 3CMJA 1E40A 1U33A 4PBGA 4B3LA 1CXFA 7TAAA 4F79A 1VB9A 8CGTA 1LG2A 4GKLA 3SCVA 4Z2LA 3ZMRA 3RDKA 2OSYA 5DFAA 1JYXA 5HBFA 3B9EA 1E4MM 2QMKA 3VTRA 4UQAA 4J3UA 4ML4A 4UFLA 2VURA 1B30A 3AOFA 5HNNA 3UEQA 3CH9A 4S3JA 4DWSC 1V02A 1C92A 4PUDA 4HOXA 2ZXBA 2WHMA 2G3MA 2J7GA 3ZT6A 2XFRA 3ZR6A 4C7GA 2DH3A 3MMDA 1CXKA 1K9FA 3POHA 1OGBA 4WKHA 3ARYA 1JYNA 1NWSA 2FHFA 3OLIA 1UD5A 3ALFA 2CEQA 4X9YA 1EDTA 4D6FA 3PZNA 3AYRA 3UG5A 3VD5A 2EPKX 3WUFA 4CU6A 2BS9A 4NRSA 1R86A 1E55A 1QNRA 3SUSA 5M03A 1V6XA 1SR0A 2EJ1A 3AYSA 3K1DA 2E9MA 3WNPA 2F8QA 1W1VA 2FH6A 2J62A 3RO8A 1QI2A 1JNDA 3WUEA 4X0NA 3IJ8A 2YBTA 1MW2A 2J7FA 1C8QA 1PZ3A 1ECEA 1QHZA 3AIEA 3DYMA 1EHNA 5HOSA 5I77A 1DEDA 5CXPA 1E4NA 3GXFA 3CHEA 4FK9A 4S3KA 2YLLA 2DIEA 2WKGA 3CHDA 1CGYA 4MB1A 4PN2A 4UTFA 4PRWA 1BAGA 2ZX7A 1W9XA 2JEPA 3A4XA 4R27A 3PHAA 3SCWA 4DWSA 4Z2GA 4H8VA 3ARPA 3QOMA 3VIHA 5M3WA 2E3ZA 4AMCA 1V3JA 2UY5A 5E09A 2PC8A 3AMGA 3VUPA 4GI8A 5JIWA 3NDYA 3QGVA 1QOXA 1VJZA 1F4HA 1HJUA 1R8LA 3FN9A 4YHGA 3RJYA 2ZX8A 1QVBA 1K9EA 1E6SM 1UZ4A 1BGGA 3W81A 2QPUA 5A2BA 1GJUA 1AMYA 5DEZA 4Z2HA 1KXQA 5DF0A 3AIQA 3T0BA 1GQIA 5A8QA 1OGSA 2DQXA 1VAHA 1JGIA 4WIWA 2WVVB 3DYPA 4PMOA 2E40A 1H3GA 3W28A 1UD4A 1DWHM 2Z1SA 4ACZB 1CZ1A 1M04A 5A6AA 1OM0A 1ZBCA 4V27A 5GNXA 1RP9A 1GOOA 4AIEA 1D2KA 1J0HA 4MADA 4TVCA 4UFIA 1CBGA 3WUGA 4AZHA 5F7UA 3AS1A 1SMAA 5BXSA 4R5EA 4LXFA 2X09A 2XVGA 3AMKA 5CLWA 3W26A 1BQCA 2GDVA 3SUTA 3OIHA 3WH6A 5AY7A 4MNJA 1XSKA 2V3GA 1EO7A 3OZPA 3GXMA 2VT0A 3QOKA 2JF7A 4QP0A 2E8ZA 1HJWA 1X1NA 4CN4A 5C70A 1GUVA 1BFNA 2XSAA 5GPRA 4TXEA 3VDBA 3EDFA 5D4YA 4WLCA 1WCGA 3AHZA 5FL1A 4HMDA 3WD0A 1H4PA 2A3CA 2JALA 4EK7A 1W3KA 5DT5A 3GTNA 3ARUA 3W6LA 2EPOA 3RJXA 4CD6A 5IHSA 2D20A 1WPCA 4HOZA 4W8AA 3GH5A 3O6AA 1EA9C 2VR5A 3EBVA 3ARSA 4U33A 1JAKA 1J11A 5CSUA 1UOKA 2ZICA 1GOMA 4AD0A 4AD4A 2B31A 4IM4A 2BHZA 5BCAA 4JFTA 4P8XA 6TAAA 3PTQA 2G3JA 3VGGA 1DWGM 2D3NA 5LA2A 3VD9A 4HOWA 2VX5A 4E2OA 2WHLA 5CJ5A 1V6VA 4CCCA 1DWIM 3EDEA 2O92A 5I79A 1OINA 4GZEA 5FL0A 3M07A 1UA7A 2W63A 9CGTA 3KWXA 1EHAA 1L0PA 1TG7A 3M6DA 1E43A 2WKLA 2ZIDA 1EXPA 2PWHA 1JF5A 2CBJA 1KXHA 3VIGA 2DT0A 4CUCA 2GFTA 3WENA 1IT0A 4D6IA 2CPUA 4IISA 2G8ZA 3N18A 4MB4A 1UKOA 3G6LA 1MW1A 2WZIA 1E6ZA 3ARXA 1QNSA 2YIHA 2DIJA 1OIMA 3MS8A 3U7VA 3AS2A 5JBDA 1KWGA 3VINA 3VGDA 3WD2A 2RGMA 4OOZA 5A8NA 1EGZA 2FGZA 3CZ8A 3OLEA 4MTVA 1W1PA 2PWEA 1WZMA 5A1AA 1IZKA 1WNOA 2ZX5A 2CBIA 2WMJA 3UG3A 3SUWA 1UR1A 2BY3A 1UR9A 2Y2WA 2NT0A 1B3WA 1WZKA 1B31A 1CXHA 5FCZA 2JEQA 3N15A 3BH4A 4JCMA 5E0CA 4ZFMA 1W32A 2JE8A 4JFVA 2VRQA 5A3HA 2W61A 1H1NA 4NF7A 1VBRA 2BNJA 4XZWA 3BAJA 4FLRA 3GYCA 4F9DA 4B9YA 3AZTA 3O9NA 3WDHA 2D24A 4HA1A 4XZBA 1HNYA 2Q8XA 1JXKA 1JXJA 1YHTA 1V3LA 2PBGA 3AHYA 3NYDA 1UWRA 1MXDA 2WM0A 4DWSD 5BXRA 1BVNP 1MWOA 3PBGA 1NOUA 1ITCA 4UFKA 1E56A 3UESA 4BA0A 3WNLA 4L4OA 1YQ2A 5E6YA 4JIEA 3AQUA 3MU7A 5DMYA 2J7HA 1W9BM 1UA3A 3EMCA 3KEHA 5D9NA 1VF8A 3SUUA 3NDZA 1CECA 2XJ7A 1VEOA 2XVLA 2BVTA 2WWDA 2VZOA 4F8XA 1JZ2A 1ZJBA 3GNRA 4UFHA 3WD4A 2WMFA 2WSKA 5GQBA 4PMDA 2YA0A 2W4XA 1JZ7A 1FH9A 4KMQA 2CBVA 3VPLA 2WC7A 4EKJA 1L8NA 4PMRA 1ISWA 1UD8A 4JFWA 3WD3A 1GW1A 2QV4A 2V5CA 1HP4A 4D6CA 1FP8A 5I5RA 3HN3A 2D0GA 4UR9A 5GNZA 4CU8A 3B8SA 2X2YA 4OJYA 3WMSA 2C0HA 1UWTA 4UZUA 3VIMA 4AW7A 4AD5A 5LA0A 4HPHA 1WP6A 2CKRA 1HN1A 4PTWA 1HP5A 1IV8A 2ZUTA 2GSJA 1W1YA 1J18A 2GJXB 3WDJA 2EPNA 5DO8A 3SCTA 1EOMA 3WQ8A 2XPKA 3MMUA 2OLHA 3VDAA 2DEPA 1J12A 5DT7A 1UUQA 1M53A 3B9AA 3VIFA 3PZQA 2DPEA 5I24A 1XYZA 4JFUA 2D23A 4CVUA 4GZIA 4TTGA 3L4UA 3T0AA 1PX8A 1FOBA 1NWRA 2RGLA 3M7SA 1R87A 1XYFA 4J3VA 4AD2A 3GM8A 3RIKA 4U2YA 3CPUA 1B2YA 4PYSA 1BG4A 1KXTA 4UCFA 3ARWA 3SCNA 2WBGA 4D1IA 4LPCA 4M80A 2AOSA 1UR4A 4IPNB 2WXDM 3WMBA 1EDGA 1A47A 2WYSA 3WH5A 4UOZA 3SCQA 3KE0A 2E0PA 1G1YA 2E4TA 3WUBA 1ISZA 3WQWA 1TA3B 2Y24A 4PUEA 5A2CA 2WVSA 3QR3A 2DSVA 3UCQA 5A6SA 1DWJM 1PJ9A 3CUHA 1BYAA 4MB3A 2D3LA 1ODZA 3AROA 3FAXA 3CLWA 1B3YA 1R7AA 1W3HA 4CD5A 5CGMA 2DGAA 2OWXA 5A6LA 2WWCA 4MB5A 1W3JA 8A3HA 1TCMA 3VMPA 5FIPA 2BFGA 3UETA 1QI0A 1MW3A 2PBOA 4UOQA 2YDSA 1XGZA 3AI0A 5A6BD 5FOOA 1J01A 4J3WA 4IPLA 3CZGA 4UQBA 4J28A 2PB1A 4B9ZA 3L4XA 4HP5A 1HJQA 1JZ6A 3CZJA 3MKKA 3SIMA 2J79A 1C8XA 2E9BA 1CGUA 5HXMA 3BMWA 5LYRA 1JD9A 4UQCA 4P8UA 1Q4NX 2O9TA 1E6QM 4AZCB 3WY1A 1CGVA 3WNNA 4HA4A 3ARQA 3SCOA 5FD0A 1FH7A 2AAAA 4W87A 1E6XM 4H2CA 2MANA 4NRRA 3CZEA 4D6GA 3PZTA 1G0CA 2A3HA 1WDPA 3VIKA 4TOQA 2VX6A 2X05A 2TAAA 5CSYA 5AC4A 5A2AA 3VIIA 4U2ZA 4RL3A 4ATLA 2VCBA 2QMJA 1ZBVA 3GZAA 1LL6A 4FMVA 3OA5A 4N42A 1LQ0A 1DP0A 5EBAA 3A3HA 4BQ4A 3ZSSA 4GIAA 2IXUA 3IANA 1HJVA 3WIJA 1W1TA 5A6JA 4LYPA 1LLOA 5BRPA 5BXTA 4M1RA 4GO9A 4HTYA 4CCEA 4HPGA 1HJSA 1J10A 5I6SA 4Q22A 2WVVA 1CGTA 1KCKA 4ACZA 2PWDA 2DT3A 1KGWA 4TUFA 2O9PA 2ESCA 5I23A 1CGXA 1UD3A 2BHYA 1UKQA 3I3BA 2VNCA 4EE9A 1MQPA 4BQ2A 5LA1A 5D9PA 3WDIA 1W2PA 1HL8A 5IXEA 1WB0A 1B1YA 5C8BB 3VIJA 1XV8A 4W85A 1ZS2A 1HL9A 3CUJA 4V28A 1HT6A 1R85A 4MAZA 1LL4A 3AIVA 4TX6A 5EFDA 3TP4A 2IUZA 3WSUA 4W89A 2WLZA 3LPFA 4UFMA 1E0XA 3L4WA 2YJQA 3VM7A 1TUXA 4D72A 1BPLB 2DT2A 2VX7A 3U7BA 1OD8A 2VQTA 1ZJAA 1UHVA 1UWQA 4NZCA 3AS0A 4JKKA 3LPGA 1WZAA 3RM8A 1NOWA 1W2VA 3O2LA 1W3LA 4PMVA 1V0NA 2C7FA 2W67A 2HISA 3K8KA 4AZ7A 2NSXA 4D6EA 1A3HA 2XGBA 1SMDA 3U5YA 2EBNA 1JFHA 1ZBKA 3POCA 4M24A 1JDDA 2Y8VA 3A4AA 4HMEA 2XVNA 3M46A 4FF5A 2ZXQA 1UWIA 2XG9A 2ZOXA 4URIA 4QCFA 3IAQA 1Z32X 3IJ9A 1XH2A 5AYIA 2DSZA 3ZT5A 1EQCA 3PZUA 1HIZA 4JL2A 2VCAA 2VRKA 2VVSA 4JKLA 3W0KA 3AIBA 1XD1A 2V5DA 2V3DA 1SFSA 2W62A 1M7XA 2OSXA 2VMFA 4MDOA 4HZ6A 3CMGA 3WD1A 1R7OA 2E9LA 1OD0A 2QLYA 1V3MA 4GQRA 1V02E 1G9HA 1MXGA 1CEOA 5A69A 1ODUA 1BYDA 2XVKA 1HVXA 1KXVA 4L4PA 3BAYA 3VGEA 1PZ2A 1WAWA 2GJRA 4WKFA 1ZL1A 1I1WA 4LYRA 3CUIA 1JZ5A 2ZUSA 2DSKA 1E6PA 1GJWA 3WKZA 1KFWA 3WF2A 1NWTA 2D1ZA 5IFPA 4DWSB 4KWUA 3BAIA 1M01A 3AIWA 1XH1A 1QHPA 2XHYA 1Q6FA 3WDPP 2V38A 4PTMA 2QPSA 1CWYA 2WVUA 4JL1A 3RCNA 4WK9A 2WLYA 3GNPA 4BQ3A 3FW6A 3WH9A 1O6IA 1VFMA 1VJSA 2GJPA 3ZQ9A 3T0DA 3B9DA 2WCAA 4P7QA 1E4LA 2F2HA 4DM1A 1PEZA 5A6KA 1UYQA 4HA3A 1B3XA 4PMUA 4QCEA 1GPFA 3T2PA 1RH9A 2CHNA 4AZBA 4RE4A 2BXZA 1VIWA 4JKMA 1UH4A 3EDJA 2WMIA 2GUYA 4ATDA 3VDCA 1CXLA 5ABGA 2J7BA 3W25A 2ZUNA 1BLIA 5D9MA 3OLDA 1GCYA 2J8FA 2DDXA 1PPIA 1SYTA 4FLQA 3MUY1 3UG4A 2BVYA 2CKSA 3WDRA 5EFFA 3N11A 2BY1A 3MO4A 2WZEA 2ZWZA 5M17A 1C90A 1PIGA 2VJXA 3N12A 3N9KA 3QHNA 4UNIA 1C3FA 2VR4A 4WF7A 3VMNA 3MANA 3OGRA 3CZLA 1NP0A 3SCRA 1X6NA 1E0WA 2J75A 2X0HA 5A94A 1V6WA 2YBUA 3NSNA 2ZUUA 3VIPA 3SCUA 1E70M 2WK2A 5D9OA 1W9DM 3L4ZA 4KRTA 1VFOA 3TONA 4NSBA 4OOUA 2CERA 3KL5A 2EXOA 2DT1A 4X0VA 3UR8A 1GZJA 4AD3A 4XX6A 2WB5A 3BAKA 2V3EA 1TMQA 1H0IA 2VQUA 1V3IA 4KGJA 4P7RA 3BSGA 7CGTA 4QLJA 3CBWA 1E5NA 3MV01 1N82A 1GOQA 1C7TA 2F61A 3APGA 1OCQA 1RP8A 3OGVA 2UY2A 3AZSA 1JNEA 4GO8A 1CLXA 3T2OA 2FGLA 2XFYA 2YL8A 1GVIA 3DHPA 3SUVA 5E9AA 1JAEA 4Z2IA 3CIVA 3DHUA 3TTYA 4B3KA 2CHOA 5FKYA 2VVNA 1QNQA 4H04A 1DWFM 4LYQA 1JI1A 1EDQA 3WDQA 4AZGA 1KBBA 1AQHA 3CHFA 3W37A 1DTUA 2CITA 3DC0A 3TOPA 1XCWA 3TTQA 2YKKA 1Q6DA 5IFTA 4AXNA 2GJXA 1J0YA 1TZ7A 1E6NA 3MUIA 1V08A 3PZVA 5AC5A 3MUZ1 3WBEA 3SCPA 2CBUA 3LPOA 3E1F1 3OB8A 4W7UA 2WMGA 5KEZA 2DSUA 3RM9A 2EQDA 4GI9A 3L4VA 1UR2A 1BYCA 3OBAA 4NI3A 2UY4A 1Y7VA 1NH6A 3UERA 3ZSTA 4EANA 2W66A 2VRJA 2O9RA 1LG1A 2VZTA 3VU2A 1KGUA 4FLSA 2GK1B 4CU7A 3W4RA 3LPPA 3WQ4A 4Q7NA 1FH8A 2W91A 1UR0A 4CN1A 2J77A 3WNKA 1K9DA 1GVYA 1CTNA 4CKQA 5EMYA 4HU0A 1UKSA 2J8GA 3CUFA 2QF8A 3QHMA 1TA3A 4WJXA 1IZJA 2G4FA 5ECUA 1AVAA 3AHTA 4LQ1A 3WF3A 5ABHA 1I75A 1G01A 3MMWA 4W5ZA 2GVYA 2BVDA 3A4WA 1VFUA 3OZOA 2HVMA 3F5LA 1V6UA 1BG9A 2J47A 3VOCA 4ATWA 3KZSA 1UWSA 1ISYA 1HVQA 1ISXA 2OYKA 2J74A 2J7EA 1H0GA 4XUYA 2VTFA 2WHKA 1V0LA 3MUAA 2XIBA 2YL6A 1VENA 2QHAA 4JHOA 1KGXA 3S2CA 3AMDA 4KH2A 3BCDA 1GHRA 1HKKA 2J7CA 1UD6A 3K4AA 3HJEA 4QDMA 1PBGA 2IXVA 2Y5EA 4AZCA 1UG6A 1FA2A 3ARTA 2ZUWA 3VKKA 3VD7A 3ZJ7A 2ZX6A 1H2JA 4A3HA 2FHBA 2FH8A 1GORA 1P6WA 2CYGA 4AISA 1MW0A 4XV0A 3PTKA 4ZXLA 4AIOA 2VZVA 4MJ4A 1C8YA 3WN6A 3KL3A 2YL5A 3GXIA 4AY1A 3KL0A 3BCFA 3VVGA 3DYOA 4TX8A 3ZM8A 4E4PA 1NWUA 1CNVA 3W24A 5I3DA 5CPTA 4GINA 1H41A 4UQ9A 5AYBA 3WNOA 1KBKA 4CD8A 2A3EA 2BV9A 3UR7A 4GPNA 2OWCA 3WMCA 4RE2A 1OIFA 1JL8A 3N04A 5A8OA 3AZRA 4HMCA 1WZLA 2VZSA 2J25A 1MQQA 1UQZA 1JG9A 1E3ZA 1VEMA 1GONA 1QNOA 4HU8A 1XHGA 5IDIA 3K8LA 4ACYA 1BVZA 3AXHA 4PMZA 3OGSA 3NCOA 3IJ7A 4PSPA 3I3EA 1OSEA 2AMGA 3J7HA 4W7WA 1FHDA 4W5UA 4H7VA 1QI5A 4W7VA 1H11A 2BY0A 1GQKA 1BSIA 2J7DA 4E8CA 5BRQA 4Z2JA 1V6YA 3RMEA 1K6AA 5I2UA 3NIYA 4A4AA 1BTCA 4HZ7A 3VDHA 5CGTA 4AZ5A 4JHZA 5D8WA 3WF4A 1KQYA 1G94A 4YN5A 1PIFA 2A3BA 1U2YA 2DSWA 3W82A 1KR1A 3T08A 4PTXA 4BCEA 5A6MA 4CVWA 1VEPA 5CZKA 3WEOA 4WSKA 4TTUA 6A3HA 1HKJA 1HXJA 4M29A 3BC9A 3WNMA 1B0IA 3L4YA 4P7OA 1C93A 3WEZA 1E6RA 4V2XA 1UH2A 6CGTA 2XWDA 3PN8A 3K4DA 2XM2A 4Z2KA 2VC9A 3BMVA 3K46A 1XRVA 3BSHA 1GQJA 1BGAA 5I78A 1W9PA 4H41A 3PZOA 4RE3A 5E6ZA 2G41A 5ABFB 4OBSA 3T2QA 1GHSA 4PSRA 4TVUA 2PWFA 3ZJKA 4WSJA 1E1FA 4UQDA 4AD1A 3AFBA 4W84A 3VNZA 2CETA 1NP2A 2WSPA 1E15A 1GOIA 3AMLA 3A6OA 4EAMA 3PZ9A 3TTSA 4YHEA 4D6HA 2D0FA 1B3ZA 3WQVA 1HF6A 1UKPA 4U3CA 1PX3A 3ZJ8A 2XYLA 1XC6A 5CQ1A 2E8YA 4QAWA 4ZEPA 3K8MA 1BHGA 3A47A 4D6DA 2WPGA 4U5KA 5BROA 1OB0A 4P7LA 4J3XA 1JYVA 1JZ8A 2VO5A 4OUEA 1XSJA 2XSBA 3THCA 1QBAA 1V0MA 1HJXA 1CGWA 3NJ3A 5GNYA 1UKTA 3MSDA 4AZIA 5JIPA 3AIUA 4IUGA 4LGXA 1QBBA 2WAGA 1Q6CA 3HU7A 2NW0A 1C91A 3VIOA 4BZYA 1E73M 1ZU8A 3MSGA 4QFUA 1CENA 3AXIA 1WDRA 2OYMA 1B3VA 1D3CA 5CPQA 5A8PA 1OBAA 3AMCA 1E4IA 3FXYA 3WL1A 1ZBWA 4PMNA 1CXEA 5EB8A 1UH3A 4MDPA 3VX1A 3WFZA 3N1AA 5IHRA 1J0KA 1LJYA 4JAWA 2JIWA 2WHJA 1BYBA 3VD3A 1UWUA 3PTMA 2OSWA 1TE1A 2Y4SA 2VX4A 1GOKA 2JIEA 1JDCA 4MNKA 2WC4A 3VX0A 1CXIA 3VMOA 4OIFA 3VM5A 2W92A 4DM2A 3W27A 1HKMA 2Y8KA 2D2OA 2VZUA 3N17A 4W88A 3VD4A 4N0RA 1K9TA 4P7NA 1TR1A 3CHCA 1EQPA 1NARA 1FHLA 2CESA 3CGTA 1NM9A 3GBEA 1BF2A 3GBDA 3IK2A 4D71A 4DUVA 3VILA 4UFJA 4CGTA 1NQ6A 1KQZA 3FHQA 1AQ0A 1C7SA 3AIRA 4CD7A 5CG0A 4C7FA 1KR0A 1VBUA 2ZXAA 2EO7A 3AHXA 1MYRA 3SEPA 2EPLX 3VGBA 2V3FA 3I3DA 3WH8A 2WCSA 3CZKA 1KB3A 2JF6A 4GI6A 1W9UA 2XFFA 1WE5A 1F4AA 1QNPA 3WFLA 5KZ6A 4ZXOA 3F5KA 4E8DA 2WMKA 5HPCA 5JBEA 1I1XA 2WBKA 4AC1X 4A3YA 1V3KA 4B15A 4PEEA 3L4TA 2BHUA 1JI2A 2EEXA 1GQLA 3ARVA 3ECQA 4D1JA 3DECA 4AIUA 1OT2A 2WZHA 3AICA 1FFRA 1CDGA 1CPUA 3MV11 1XCXA 3TTOA 1LWHA 5TD4A 1H09A 3F4VA 3EDKA 3ARZA 3D3AA 2X0YA 1B90A 1WDQA 3RM4A 4DUXA 1OGGA 4J7RA 1W91A 2D0HA 3AXXA 4JFSA 5C71A 1JFXA 1H5VA 3ZO9A 1ZB5A 2W5FA 1GOWA 1JYWA 3BGAA 2XVPA 3ZR5A 1UZ1A 3CTTA 4JCLA 3GNOA 3OLGA 3ZT7A 4UZSA 3FAWA 1ESWA 1Q6GA 3BAWA 4D6JA 2G3IA 5HPOA 2J78A 2YDRA 5A6BA 3RPMA 1TFVA 1WDSA 1CIUA 1J9YA 3GDBA 5ABEA 2O9OA 3L2LA 3AISA 3EDDA 2CIPA 2XGIA 3PZGA 4P8WA 1VFFA 4H8UA 3WELA 5M5DA 2GK1A 1J0IA 1US3A 4PMYA 3EYPA 1RPKA 4GQQA 4KRUA 1FP9A 1V3HA 2YA1A 3WBAA 3GH4A 4MAVA 3FHAA 3VO0A 1E0VA 4P8VA 3AS3A 4WKAA 1HX0A 2VOTA 4MJ2A 1MFVA 2D22A 4JZ5A 2ZX9A 2WMIB 2X1IA 3SCSA 3VGFA 3WEMA 3T09A 3FY1A 4W8BA 1GNXA 2DH2A 5A95A 1XH0A 1QW8A 2PF0A 4M81A 3W53A 4TVDA 2XTKA 1VRXA 1TVPA 2VI0A 1E9LA 5I0DA 2OYLA 1EH9A 1JD7A 3ZJ6A 5BXPA 1ITXA 2BXYA 3ZOAA 2GDUA 3N13A 2WANA 2VUYA 1H49A 3HMCA 3CUGA 2PI6A 2G3NA 4ZE4A 3LMYA 3PZIA 1WKYA 3BXWA 4YPJA 4AYSA 2XUCA 2YA2A 2XIIA 5E0FA 2UY3A 1V0KA 3S6TA 1JZ4A 5BYWA 5CLTA 3U57A 4H8HA 2ZXDA 3WQ6A 1E1EA 1LL7A 1PAMA 1Q6EA 3D5HA 2YLAA 1B9ZA 2PWGA 3PZMA 1QI4A 4AEEA 1E5JA 2EPMX 2Z1KA 3AHVA 1CLVA 4MPKA 1JZ3A 3F5JA 3BAXA 5A8MA 2VCCA 4Y7EA 1EOKA 1QI3A 1E72M 4DUWA 1XSIA 4U3AA 5BWFA 4QLKA 3W29A 1J0JA 4OZOA 2X8RA 1LF1A 1QW9A 3WF1A 1W9VA 3EMZA 7A3HA 1MFUA 3W6MA 3G6MA 4FLOA 5JBFA 3WL0A 3AJ7A 4MNMA 4UQEA 2J4GA 3U5UA 1D7FA 1DWAM 5D8ZA 2BY2A 1J0ZA 1U30A 4C7DA 3II1A 4QLLA 2CNCA 1EIBA 4XB3A 1KWKA 3BLKA 4W93A 4LX4A 4M8UA 2WW5A 1NOFA 2YDQA 4UOJA 1X6LA 2XWEA 5CPSA 4MNLA 3THDA 1S46A 3VGHA 3VNYA 4J27A 4OKDA 4PMQA 3WH7A 3GXDA 1TVNA 4OBRA 3SURA 4M82A 2YL9A 3L2MA 1PX4A 1HKIA 2OWWA 1KCLA 2YOCA 2FHCA 2VL4A 3EMQA 2ZUVA 3CO4A 1RD6A 5HDRA 4ZE5A 2CCRA 4K68A 4AEFA 4J3TA 2WCGA 3NSMA 3RILA 4HZ8A 4GXPA 1UD2A 1XD0A 1O7AA 2ZWYA 1DHKA 4PMXA 4GZJA 3WF0A 4AWEA 4F9JA 2NT1A 1QPKA 3ZIZA 1OWQA 3NSXA 1M03A 3WQ5A 1UR8A
chains in the Genus database with same CATH superfamily
3W38A 3W88A 2ZE0A 1VZWA 1DJYA 4DZHA 4MY8A 4N9BA 3SAZA 2G0WA 3ZZ1A 3CT2A 3DCPA 3OP2A 4O11A 2PDHA 4CCDA 1ISVA 3UY8A 2DZXA 4QE5A 5E70A 3MCMA 4BF7A 5FF4A 4JNYA 4AZ6A 4C6OA 2GJLA 4O18A 3OG2A 3FNDA 3WLLA 3GR8A 4ZENA 3GH7A 2A3AA 4GQGA 3VOIA 1U83A 4PTVA 1J93A 3H55A 3ALGA 7ENLA 4KS0A 5IBXA 4JS3A 4DXVA 1RA5A 4XG1A 4K3ZA 2WZMA 2J9ZA 2WNWA 2AGTA 5JUVA 3JUGA 4CN6A 3G3DA 2J88A 1E40A 1SW0A 1CXFA 3UQNA 1LG2A 3SCVA 1U1UA 1PKLA 4C6DA 5BRBA 1TPEA 1LOSA 2OSYA 5DFAA 1M6JA 2QGYA 1D8CA 3I6TA 4FNPA 3L9CA 2QMKA 4S3BA 5LGXA 1ZGDA 3TJIA 1CB7B 4J3UA 4RZBA 1VS1A 3CB3A 4FPSA 1TPH1 2UZ9A 4I7VA 3FDGA 3TN6A 3H8AA 1XIDA 2ZXBA 2J7GA 1R3SA 5C9ZA 4HCDA 3MMDA 1Y65A 4NX0A 4WKHA 3ARYA 1JYNA 1NWSA 3OLIA 2XZ9A 1UD5A 3PPHA 4MM1A 3B03A 4ECLA 1YBQA 3AYRA 3TOYA 2EPKX 3KDNA 2NUYA 1TV4A 4NRSA 1R86A 1QNRA 4IF2A 2Z6IA 3K1DA 2E9MA 4LUSA 3WNPA 2F8QA 1A0DA 1W1VA 4J2PA 4Q8MA 3V36A 2OMAA 1JNDA 3R1ZA 3RN6A 2YBTA 4LAZA 3LGDA 3HMJG 1C8QA 1M41A 2PSNA 5DBUA 3RU8X 1QHZA 3ITTA 3AIEA 1EHNA 3HG5A 4DJDA 5FI8A 3UBPC 4FK9A 1VFSA 2WKGA 3CHDA 4PRWA 1BAGA 1P7TB 2V6AA 1W9XA 4DJFA 1OFBA 4R27A 4AFYA 4PUMA 3SCWA 3S2MA 3UGRA 2MUCA 4H8VA 5AYZA 3VNMA 2FPYA 1POJA 2A6NA 2X2GA 1R3WA 1Z3NA 4OV4A 2AQOA 5H8UA 2B7QA 4HYRA 4GI8A 1O94A 3NDYA 3P84A 4C6JA 2Z1WA 1F4HA 5F4WA 1R8LA 1JPIA 2ZX8A 3KHJA 2ON3A 4Z1AA 1E6SM 2HE5A 3W81A 2DIKA 3KTXA 3V5FA 4HJWA 1QMLA 2DQXA 1VAHA 4GCXA 2WVVB 4PL1A 1JR1A 3W28A 1H3GA 1XLCA 4C1NB 1KFJA 3SBFA 4M19A 4DXXA 4HHMA 5HJYA 3QEZA 1M04A 1O12A 3UR2A 2WOQA 4GQBA 1GOOA 4IP7A 4MADA 3MCOA 4GIEA 3GTFA 3AS1A 2VEGA 1WDWA 2X09A 2XVGA 1FCBA 3GAYA 4GNKB 1Z9AA 5CLWA 4YXGA 1SJCA 3NM3A 3SUTA 3HQPA 4KESA 3GU2A 3LI1A 3OZPA 5E5CA 3GXMA 4JEJA 1HJWA 5EMLA 5C70A 1GUVA 3APTA 1BFNA 2PC4A 3HG3A 3ITLA 1JCXA 1WCGA 5GJPA 5KTLA 1SFLA 3IK4A 3ELFA 1KFLA 3N29A 3AHZA 3P82A 4S2CA 4XO7A 2GOUA 4HMDA 3WD0A 4V1XA 3PJUA 1W8GA 4A29A 4EK7A 3PBMA 3ARUA 5IHSA 2PODA 2XDFA 2WM1A 2VR5A 4HNTA 1IEIA 3ARSA 4U33A 1V7YA 3DDMA 5FJOA 1QW7A 3SZ8A 1ZAJA 4ZMGA 1UOKA 1GOMA 3LM7A 4AD4A 4AHPA 3EKGA 3CWOX 1IXOA 4L1XA 3PTQA 1RLCL 2D3NA 1JCYA 3VD9A 5EMUA 1BWKA 2WHLA 3ZXWA 1EWEA 1XXXA 1DWIM 3EDEA 4TQTA 1TTIA 4Q4RA 3M07A 3SB0A 2W63A 9CGTA 2POTA 1L0PA 5HQMA 3WQGA 1O5KA 2QXWA 3SN4A 1OK4A 2HEJA 3ZVHB 3WENA 4MZ8A 4RXGA 1IT0A 4D6IA 2CPUA 4HNUA 3N18A 4KIEA 1XUZA 1ZENA 4I6KA 1OIMA 4A6GA 1KWGA 1OC6A 2QCLA 1JPHA 2RGMA 5A8NA 3REQB 4GJIA 1EGZA 3MJYA 5MKGA 1GG1A 4LS0A 3QF0A 1WZMA 3BJSA 3QM3A 2PDXA 1KLZA 4S3GA 1RPXA 2BY3A 3NA8A 4MOZA 4HK7A 4L1WA 5HUPA 1X97A 2BP1A 2IKHA 4GBUA 5FCZA 2JEQA 4NI8A 3N15A 1BRLA 1BSLA 1RJRA 3BH4A 3EKLA 3GHSA 2XU2A 5E0CA 4ZFMA 4KPLA 4PRTA 4REQB 3SM0A 5DMNA 2DZUA 2VRQA 3GVVA 1H1NA 4GFSA 4H83A 4JN6A 5A3HA 3GTIA 4IWWA 3G2GA 4GY0A 4F9DA 4UB9A 1XIJA 5AYXA 2D24A 4HA1A 1JXKA 2Q8XA 4G56A 1JXJA 2E67A 1NAL1 4ZBCA 2W27A 1DE6A 2PP0A 1V3LA 1H7XA 1XISA 3P0XA 4LB3A 1MRQA 2WM0A 5AHFA 2VFEA 3KVKA 2ZRXA 1RCXB 1ITCA 4UFKA 3ANYA 3UESA 3WNLA 4L4OA 5E6YA 4JIEA 3AQUA 5F1UA 1F3WA 5DMYA 2Z2AA 4DLMA 3EOLA 1P4CA 3STGA 2ACSA 3NDZA 1CECA 2R14A 2XJ7A 2XVLA 1OZQA 1J2BA 2DU2A 2FTPA 5FAJA 4Q32A 2YA0A 4TV6A 5KZDA 5IM51 1JZ7A 1J5TA 1W56A 3HV8A 4HHPA 4HIBA 2PWUA 1JVNA 2IPWA 1L8NA 2PGEA 4GQ0A 2QF7A 4D6CA 4XTIA 3EPOA 2HDJA 4UR9A 5GNZA 4NZFA 3B8SA 5A5WA 3BQ5A 4PTNA 2X2YA 2C0HA 4HN8A 2DY3A 6XIAA 4GK8A 4AD5A 3DUGA 4PUUA 3UF9A 1HN1A 4FAMA 1Q7ZA 5KITA 1VH7A 2ZUTA 1LBMA 2VC6A 3RGTA 3Q37A 3OJGA 4NX5A 2EHHA 2HS8A 3PB0A 5FEPA 2NQ9A 3WDJA 3VDAA 3B9AA 1YDOA 1EBHA 3PZQA 1VYSX 4JFUA 3R8RA 2D23A 4GZIA 1YXYA 3R0KA 5LXEA 4TTGA 3OZYA 4DJEA 1NWRA 1XYMA 2RGLA 3M7SA 1R87A 2OEKA 4J3VA 3CV7A 2XISA 1H5YA 3S2NA 4U2YA 3CLMA 3UY7A 4PYSA 4UCFA 3ARWA 1B5TA 1M7PA 1QK0A 3SCNA 4GCAA 3GXTA 2AOSA 2BWGA 4MJMA 1R3RA 2I17A 2WXDM 1S5TA 3WMBA 1L8PA 1VD6A 2VEPA 3KE0A 3MUCA 2E0PA 5CH9A 2E4TA 1XKJA 4M51A 4DUOA 3H22A 4D2JA 3QMTA 5A6SA 1XLJA 4GNVA 1UCWA 4HD5A 3E2SA 1W3HA 2DGAA 2B7PA 2OWXA 2RDUA 5A6LA 3B8VA 4MB5A 4JQ3A 3FIGA 8A3HA 4GVFA 1TZZA 3P5ZA 1MW3A 3G22A 1UIPA 1N2VA 3FS2A 2QDHA 4PUJA 2GGEA 4J28A 4B9ZA 4HP5A 3KHDA 1JZ6A 3CZJA 3PWAA 1EIXA 2J79A 4Q8WA 1C8XA 4M6PA 2E9BA 1CGUA 1ZFJA 4UQCA 5FF2A 5HNTA 1CGVA 4PR4A 3QZ6A 3HPSA 5H6HA 4HPXA 4W87A 2FTYA 3AAMA 3KRSA 1FWWA 3B06A 2PDGA 5G2WA 3PZTA 5I3FA 1WDPA 3O05A 3VIKA 3MHFA 4JTKA 4TOQA 2VX6A 5CSYA 2XN2A 4U2ZA 4LAMA 3MCNA 2A3LA 1ZPTA 2QZRA 1KBJA 2QMJA 1LL6A 2JBMA 1DP0A 5LIKX 3ZSSA 3O07A 3LB0A 1Q2RA 1XLBA 1Y0EA 3IANA 1HJVA 4ML9A 2BLEA 4LYPA 3V35A 2YSWA 2OO0A 3U2ZA 5I06A 5AVHA 4Q22A 4R85A 3LGGA 1LLWA 1PCKA 1TPWA 3VE9A 5I23A 1UD3A 1UKQA 1DYSA 2Y5JA 2HS6A 1XRTA 1W2PA 5H91A 1F61A 3R13A 5D30A 4DO5A 1B1YA 1PWMA 2CZFA 1VFHA 1ZS2A 3CUJA 3O7UA 2Y5SA 2ZC1A 3N19B 1GT8A 3W23A 2REQA 1UASA 2WLZA 4O50A 4UFMA 2OVLA 1YKWA 1BPLB 2VEIA 3RF9A 1GQNA 3U7BA 1OD8A 1ZJAA 1LCOA 3TK7A 3LPGA 2Q01A 1WZAA 1NOWA 1W3LA 4LVDA 2C7FA 2W67A 4QX4A 4YTTA 4IG2B 2WNQA 4IXXA 1ME9A 3PM6A 5FSDC 1A3HA 1QWKA 4HVXA 1NQKA 1JFHA 1OZMA 5LNVA 4ILSA 1W17A 3CAQA 3M46A 4FF5A 1UWIA 2XG9A 3ATYA 1WX0A 2C71A 1WA3A 3CC1A 3H4WA 1XBZA 2VVSA 1GZ1A 3AIBA 4B3ZA 2V5DA 2PDCA 3DKLA 4UTTA 1M7XA 2VMFA 4MDOA 3PJXA 4ZO6A 1AW1A 1AW5A 4Q4KA 4GUIA 4Y9MA 3VKDA 1G9HA 2GGGA 4LVAA 3PVFA 1FDZA 5A69A 4FS9A 3BAYA 2BXVA 1PZ2A 2GJRA 4WKFA 3G1FA 1ZL1A 3TN4A 2QNEA 3KLKA 2DSKA 1E6PA 3WKZA 3WF2A 1NWTA 5C2GA 2E09A 2FTWA 3PSWA 3BAIA 1TWWA 3AIWA 2H3DA 1XH1A 2X41A 2V38A 3VKJA 2RJGA 3CPRA 3RCNA 1KLYA 2CLFA 3KW3A 1ZCCA 4LUTB 2R8WA 1XLIA 1O6IA 4N2YA 1OC7A 1OVDA 1I0DA 3URQA 1PEZA 1UYQA 4QCEA 4F2UA 4AZBA 2PDKA 3GYEA 4DWDA 4Y9OA 4AVNA 3NQBA 2WMIA 1QT1A 3PULA 4XAYA 4XVEA 4CEUC 2NUXA 4WDUA 1RCQA 2J7BA 1BLIA 3TWAA 1DIEA 1OFRA 1PPIA 3MUY1 1GOXA 3WDRA 2ZWZA 5M17A 1TV8A 5GJNA 4TIMA 4UNIA 1ZP3A 4ZR8A 2VR4A 3H2NA 3OGRA 3CZLA 3H7VA 4KT2A 4UC5A 2J75A 3VIPA 3NSNA 3SGZA 1K8ZA 5HWJA 1VCGA 3WK1A 4WXYA 2WK2A 3L4ZA 4KRTA 3HO8A 4NSBA 3TR9A 5DXXA 3M16A 3HOJA 4XBKA 4AD3A 4XX6A 3BAKA 3IIVA 1KBIA 2AKMA 3MP3A 4EPKA 1H0IA 3UXLA 1EZ2A 4JTRA 3BLFA 4QLJA 2Y7GA 2X7WA 1N82A 4A35A 2YFOA 3DKJA 3UYCA 3APGA 1SO4A 1A49A 3AC0A 5XIMA 4CQ9A 1CLXA 2YL8A 4PTDA 3PUEA 3WQCA 3P60A 1I2NA 2CFFA 5E9AA 3JS3A 4G7FA 3LCGA 4DBWA 4WJEA 2CHOA 1QNQA 1E9IA 3QGKC 1DWFM 4C6NA 4LYQA 4AZGA 4ZOBA 3TLLA 3I4EA 3ME3A 1DTUA 3TOPA 3DC0A 1XCWA 4LWWA 3W7RA 4AXNA 3N9RA 1EPXA 3MUXA 1IR1A 1FVPA 3HURA 5AC5A 3WBEA 1AZ1A 1P0BA 2CBUA 5KEZA 2DJLA 3M0LA 2E6DA 4FXFA 1UR2A 4QDWA 4MSSA 1K7XA 3C56A 3O1NA 5DY2A 3M0JA 5HNUA 4AG0A 3RAOA 3C8FA 3ZVIA 2VRJA 3ZS4A 4H1ZA 1Q5MA 2ZZ7A 4HQVA 5AYYA 3VNJA 1UR0A 3W7JA 1EWDA 2RUSA 4KCWA 3WNKA 1K9DA 2I5GA 3GFYA 3FJ4A 1EL3A 3MBFA 4FNTA 1TA3A 3MWCA 3R94A 3USZA 1PUDA 4WJXA 4JBRA 5E93A 3H6OA 3LTPA 1I75A 3GG1A 4W5ZA 2BVDA 2HVMA 1PDZA 1AD1A 4ATWA 1RR2A 4GUHA 5HA7A 1ISYA 2WSYA 1ISXA 2GVJA 4N02A 2P10A 1EJUC 1SO3A 1V0LA 2XIBA 1UOZA 4JTCA 3SADA 3DENA 2INFA 2GWNA 1WQ5A 3AMDA 8XIMA 5CC6A 4C65A 3BCDA 1GHRA 3HJEA 1CW2A 3RHGA 3TKFA 2B81A 5BNKA 2Z1VA 4AZCA 1S1PA 4Q7BA 1US0A 2VFDA 2ZUWA 1SZFA 3VD7A 3ZJ7A 4F0RA 2AQWA 3PNZA 4QRNA 4A3HA 1PYMA 3AXMA 3EWCA 3LHWA 2FPVA 3W7QA 1V7AA 3R8HA 2OOFA 3SR7A 2FLIA 3S1UA 4ZXLA 4AIOA 4MJ4A 2YL5A 3SSJA 5AB3A 3DYOA 1NWUA 2GSEA 2QPXA 4AF0B 5I3IA 3MHUA 3JR2A 1KBKA 2D73A 2YBVA 4GGBA 3UR7A 3W00A 4GPNA 5MF5A 4A8LA 1LT7A 1JL8A 3N04A 4HMCA 1WZLA 1TZ9A 3IIXA 3H4GA 1MQQA 3UT0A 4ZODA 4MY9A 3VNDA 1UQZA 3UPBA 4JQ2A 1E3ZA 1VEMA 3A22A 3TFXA 1GONA 5F2LA 1QNOA 1R9YA 4HU8A 3K8LA 3LZ5A 4B90A 1BVZA 3W1LA 1W3TA 3AXHA 2O55A 3EPNA 4PMZA 2HWGA 1TX2A 3BMXA 1AD4A 3TVAA 3R0DA 1OSEA 5D32A 1KRMA 4N6FA 1Z8AA 4NIRA 1P0DA 2J7DA 1KM4A 1MUWA 4M0XA 1GVEA 3VDHA 4IX0A 4AZ5A 3WF4A 1KQYA 3W9ZA 1PIFA 7REQA 3W75A 4ZQMA 5EMKA 1UB3A 4PTXA 4BCEA 3PR2A 1GJPA 1Q6RA 4YVPA 1S2UA 1XX1A 1HKJA 3R6IA 4QS6A 3WNMA 3L4YA 4ZO9A 1E6RA 4K7YA 4V2XA 3AO0A 4YTRA 3WK2A 3QY8A 4DBUA 5RUBA 3VK5A 5JU6A 3PTDA 1MRAA 4ZL1A 1XRVA 2CLMA 3BSHA 1W9PA 1BF6A 3CO8A 4RE3A 3LERA 4ZA0A 1R3VA 4OBSA 3U8GA 1OCBA 3DOPA 1N8WA 2BASA 4JICA 4AD1A 4W84A 2CU0A 3VNZA 1NP2A 3ES7A 1GOIA 5CC5A 4YHEA 4C90A 4CNNA 5C0QA 1HF6A 2ISWA 1FCVA 1PX3A 4LEFA 4GX9A 1A5CA 1UUMA 4EWND 1XC6A 5CQ1A 1O5QA 1AH4A 3SECA 1R0MA 5JQ9A 1BHGA 2YXXA 1OB0A 3EWZA 1B3OA 4HSOA 2XSBA 2QDDA 1CGWA 1EC9A 4K8HA 3BOFA 2PFHA 4AZIA 2WJZA 5JIPA 3D6NA 1XGDA 3MKCA 1RVKA 1JGMA 2WAGA 1Q6CA 3LCLA 4O1FA 4KQNA 4O0ZA 1H60A 2C1GA 3HFYA 4C6PA 3EEZA 3VIOA 1YBQB 3MSGA 3UJEA 3AXIA 3SRDA 5D09A 2A21A 3GNXA 3UXDA 4RNHA 2FJKA 3QPYA 3AMCA 3DZ1A 1EYWA 1AJ0A 2YW4A 3K4WA 5EB8A 1UH3A 3CH0A 3B97A 4C6EA 4OV9A 4S3FA 3M43A 1QATA 1J0KA 3MSYA 1BYBA 4HU3A 2VD9A 4GY1A 2OSWA 4YCPA 2Y4SA 2VX4A 2ZADA 1IT8A 2Y88A 4FXSA 2Y8KA 2A6LA 3N17A 4ENLA 3VD4A 4N0RA 3CHCA 1NARA 1FHLA 1D3GA 3CGTA 2Q09A 2Z4GA 3GBEA 2E25A 1BF2A 4D71A 1J2WA 3VC5A 2D2JA 4JY9A 3UZJA 1KQZA 3TMQA 1KTNA 3NL5A 2QUVA 4XUGA 2NUWA 1ZY9A 5CG0A 3H2AA 1VBUA 3A12A 3VGBA 4X60A 1KB3A 3DI0A 3LBMA 2ACQA 1AUSL 3S9YA 2XFFA 1WE5A 2CZ5A 1KBLA 4JTJA 4LVBA 1W1A1 4HHHA 1VBGA 2Q6ZA 1K7EA 4E8DA 4WUIA 4ZQOA 3LBCA 5HPCA 3C2OA 4H19A 2P50A 5JBEA 3EA2A 3LI0A 1EC7A 1DIKA 1RZMA 2DVTA 1GQLA 1SZEA 1KRAC 1OT2A 3GXPA 4UMBA 3QN3A 3AICA 1EB3A 3S47A 4DNMA 1ZRQA 2YXGA 1N8IA 1A0EA 2PZ0A 1J6OA 1X8CA 3MPGA 1F9CA 1OC5A 3TJLA 1H51A 2ANUA 2OQYA 1WDQA 3S6OA 5REQA 2E28A 1W91A 3GIYA 3P0WA 1H5VA 3H12A 3ZO9A 3F4WA 4LS2A 2XVPA 4H9ZA 1OCJA 1IF2A 3H4XA 4RJEA 2BBFA 4O13A 3ZT7A 4FI4A 4I8YA 3ANVA 3NDOA 2PPGA 3BAWA 4D6JA 4UBPC 3OYXA 2G3IA 3WFAA 5HPOA 1TFVA 3I4KA 1CIUA 5XINA 3OOQA 4XKMA 3AISA 5BU6A 3QLLA 4RZ4A 4R9OA 3AU6A 3TXZA 4H8UA 4FIRA 4GWEA 4BKNA 5M5DA 1US3A 3M5VA 4QSHA 3GC4A 4GQQA 1FP9A 3EAUA 4LW7A 3TLQA 3WBAA 3HQNA 4GXWA 5T26A 5FAGA 3BG3A 3N2XA 4MKSA 1MFVA 4GVIA 3GRIA 5A6TC 3KCLA 1ML1A 3MWAA 1PE1A 4NAEB 3MDWA 3N6HA 3WEMA 2HBXA 2Z7GA 3SY5A 4W8BA 1RALA 4H6RA 4BR1A 3OODA 3V0SA 3RNDA 3C0LA 3R0UA 4FX7A 4EPBC 3A3XA 3S1XA 3FXGA 3WX7A 2PGWA 3ZJ6A 5BXPA 2QDGA 3EX6A 3ZOAA 1YX1A 1IHIA 3ABRA 4ERIA 3N13A 2WANA 4XZ9A 4IXHA 3CUGA 4OBTA 2G3NA 3PZIA 3C2VA 4LU0A 1WKYA 3H70A 4LSBA 4AYSA 3LUTA 3L0NA 2XIIA 3BSMA 2WQPA 4BWLA 1V0KA 1KFEA 1JZ4A 1XRFA 3WQ6A 2NVAA 1LL7A 4MWAC 5M1TA 1PAMA 4YYCA 4S3EA 1CX9A 1VQTA 1QI4A 1NTHA 4AEEA 3KOZA 4H9MA 2PAJA 1XDJA 4MPKA 3TAOA 3BAXA 1AQFA 2PGFA 4MHBA 3WJSA 4ZOAA 2H90A 4AVFA 4CNPA 1K8CA 4B5XA 4U3AA 5LHFA 4OU1A 1KM3A 7ODCA 1XBYA 5T9BG 3W29A 2DW6A 4UTWC 1FX6A 1QW9A 3WF1A 2V5KA 3G0SA 4O1BA 2YZRA 7A3HA 1MFUA 4NAFB 4GYKA 1GEQA 4FLOA 5JBFA 1ADDA 4WRHA 3N3MA 2GUBA 3A13A 2CNCA 4WHBA 1Q8JA 4LX4A 5GVJA 4AY7A 1NOFA 2I16A 1X6LA 3GVRA 2OEJA 2Z2UA 1X39A 4MNLA 4DBEA 1H7PA 3CL6A 4L9ZA 4M6QA 4J27A 3QFEA 4MUZA 3O6YX 4LS1A 3E02A 3RR1A 3LV6A 3SY1A 3E12A 5TF0A 3W7IA 4IQLA 3DBNA 1PX4A 5DLCA 3KDOA 4XZMX 3TZFA 3EMQA 2CCRA 4UR8A 3SQMA 3RILA 3TDFA 2BOFX 2WO5A 3RMJA 1LTDA 2OXNA 4PMXA 3WF0A 2RDTA 4RV3A 4EIVA 3EX4A 1XLKA 3MBDA 3W72A 3F2BA 2Z7KA 4E8GA 4IMEA 2C8NA 1DL3A 1S1RA 2QUUA 2HK0A 4N9DA 2VDGA 3L68A 2GQAA 4N7QA 1FHVA 2QJGA 4W86A 1AH0A 4JD4A 3U4AA 3MY9A 3UYIA 2VR2A 1JDAA 1VLIA 3IWPA 1JF6A 4PH6A 3D0CA 2FDMA 3BJTA 3OU8A 3BV4A 4F66A 1W37A 3LD5A 1ME7A 2CXGA 4BHYA 1V8EA 3IRSA 2VDHA 3L65A 3IAPA 2W79A 3M0HA 1V03A 1US2A 1EUAA 1AQMA 3PFRA 4M7TA 1WO2A 2R82A 3L23A 1GEHA 1EX5A 3BLPX 2JFEX 4KGLA 1KM1A 2WVTA 3APYA 1RXOB 3CMJA 4PB3A 4F79A 1IIGA 4DZ5A 4GKLA 4Z2LA 3ZMRA 3BL3A 3B9EA 4Z1DA 3M0YA 3I68A 4YWSA 4UQAA 4UFLA 1ONXA 3AOFA 4OWGA 1R2SA 5HANA 4F4RA 3LEPA 4HOXA 1AW2A 3ZT6A 2OCZA 2IS7A 2P8BA 4M6UA 4IMGA 3BDKA 1CXKA 1K9FA 1TQJA 3AUJA 3POHA 2AMXA 1VYRA 4F0LA 3ALFA 1Q3NA 3SSZA 2E1DA 1SFJA 3PZNA 4UTLA 3P67A 3WUFA 4CU6A 2BS9A 2PCQA 1E55A 3SUSA 2J66A 5KETA 4FNRA 3GHRA 4MYAA 2EJ1A 3AYSA 2HK1A 1XL9A 1JCJA 3OG3A 1OX6A 1KM5A 2GJNA 4FOUA 4GYPC 1RJQA 5LNRA 3WUEA 4X0NA 3ABXA 2J7FA 2NQZA 2HCVA 3HQOA 1O66A 2CWNA 3N4FA 4G6CA 3K2GA 1ZZMA 4Q8QA 3BGJA 1LYXA 3MVTA 1DEDA 2WJEA 1XICA 5BOFA 1FDYA 3DXIA 3OO2A 3MHGA 1ZLPA 2EKCA 3QH2A 4K1WA 3GVWA 3NQGA 4Z2GA 3UJFA 4IFKA 3QOMA 2E3ZA 2PCEA 1KC7A 3WYZA 2VYOA 3DG7A 3UR5A 5E09A 4HSHA 1I2QA 3QGVA 1QOXA 4DPQA 3S5ZA 2F6KA 2Y8UA 4RV8A 1M03A 1UZ4A 1SZNA 2A85A 3NQFA 2QPUA 1AMYA 1YNPA 4Z2HA 4IIEA 4B91A 3T0BA 5XIAA 5B80A 3OQ8A 4IIHA 4WIWA 4PMOA 1LM1A 2OG9A 5A6AA 3T44A 4Z17A 3FOKA 3CK5A 3VZZA 2Y62A 2I5QA 4TVCA 1J0HA 2ZVRA 4UFIA 1CBGA 4AZHA 2ZZ3A 5BXSA 3S6DA 2V8ZA 3AMKA 4NP7A 1NFBA 5AN7A 4HNVA 4I9TA 1IGWA 4I5UA 4J2MA 1BQCA 1PTAA 2REQB 3OIHA 3DFTA 4R7JA 5AY7A 4DYEA 3AYTA 4PB4A 1EO7A 1XKYA 2VT0A 2QKFA 2Q8ZA 5HJXA 2NX1A 1OADA 1X1NA 4CN4A 2P3ZA 2XSAA 5GPRA 4IT1A 4S2BA 4B2DA 3Q4DA 3EDFA 4MFDA 4KETA 4WLCA 5K4XA 1SU5A 3ORWA 1YIXA 3MYPA 2A3CA 4JIHA 1DJIA 2JALA 1YPIA 1W3KA 3GTNA 2OZ8A 4KERA 2PRLA 2ODOA 1WPCA 4B4HA 3AWOA 4FX8A 1TV2A 1F74A 1WKEA 2ZICA 4AD0A 5BMWA 3M0MA 4IP5A 2X1RA 1XLDA 5BCAA 4P8XA 4OGZA 6TAAA 5H8MA 1M68A 1UBSA 3TU9A 2VX5A 3TX9A 2OODA 3WQFA 3FCPA 3W70A 1YMYA 4LVFA 1HUVA 1V6VA 4O4WA 4QEHA 5EMJA 3UU0A 3ANUA 3VCCA 2C1HA 2OT0A 5FL0A 4BFAA 5BOOA 1W31A 3GFZA 1MZHA 3BGGA 6PTDA 3KWXA 1QOPA 1JCMP 3VI2A 3NURA 1OABA 5LHEA 1JF5A 4RK8A 4IL2A 5AHNA 2HPIA 3UWWA 2DT0A 1K4GA 2IMRA 4DPPA 2CLEA 2Z1XA 1UKOA 2H3BA 3QGAC 3G6LA 2WZIA 1E6ZA 1QNSA 2YIHA 2DIJA 1OY0A 4TR9A 2EG6A 3AS2A 1TV5A 3WD2A 1A53A 1W5QA 3SFKA 1SSGA 4GJJA 2BOEX 2Z00A 3GC5A 4MTVA 4DHGA 2E1WA 2J24A 3ZYZA 3BTNA 3DFSA 1IZKA 3T1GA 3SUWA 3C86A 5E0KA 3NM1A 1UR9A 2Y2WA 2NT0A 3QC3A 3HGSA 1KM2A 3FV9A 4X2PA 4GFIA 1SQ7A 3M5ZA 2RJHA 3VKBA 4ZFCA 1YE6A 4QISA 5T8GA 4E3TA 4H9TA 1GGOA 2YB1A 3SDOA 4C5ZA 3T8LA 1QO5A 1PZ1A 2W61A 2YPIA 1FHUA 5HR7A 1H1ZA 1W5OA 2BNJA 1X96A 4ROQA 4XZWA 3L0KA 3GYCA 4C6KA 3O9NA 4DXKA 5JH1A 3HGJA 4F0KA 5AFDA 1HNYA 1QRQA 2HNHA 2PBGA 3KBMA 3NYDA 4JTLA 4GI4A 4LCRA 1MXDA 1FWAC 3UZYA 1K3UA 1ECQA 1MWOA 3QMRA 5F2MA 1NOUA 5D04C 3LYEA 1E56A 1YQ2A 3MU7A 3JW7A 1UA3A 2VEMA 2C6QA 3BG5A 1VF8A 1JUBA 3SUUA 2ZKMX 2NLYA 1ZJBA 4UFHA 2NSOA 3TIMA 2WMFA 2WSKA 1O68A 3KRBA 2ASHA 1OYBA 2W4XA 1DQUA 4ZO7A 5K2ZA 4O57A 3DESA 2OU4A 3QV7A 4PMRA 1ISWA 1UD8A 4JFWA 4QHRA 1HP4A 1JDEA 3GDMA 5I5RA 1W0MA 4OJYA 3WMSA 3N3TA 4YS1A 3KBSA 3VIMA 1VPXA 3BLDA 4HPHA 2CKRA 1Z48A 5FSEC 2VFHA 3TROA 3B8DA 4R7OA 3IUDA 2H9AA 2YB4A 1W1YA 1PWLA 2BSLA 4U10A 5DO8A 2Z0IA 3MMUA 2OLHA 3WQEA 3NTYA 4E6MA 5I24A 1XYZA 4ICMA 1T8XA 4O8RA 3L4UA 3BO9A 4HNLA 1T99A 3FA4A 3JVAA 3DFYA 4AD2A 5J5DA 4ONVA 3CPUA 4D8AA 1UIOA 4E2DA 4D1IA 5AHEA 3PUOA 3W7NA 4Y2WA 3UVAA 2RHGA 4IPNB 3H2OA 3FDKA 5CGQA 3TZNA 3HG2A 1KTBA 1XQLA 1A47A 3L5AA 1DIDA 3WH5A 3IJDA 3BG9A 3H21A 2F7FA 1T7LA 3QC0A 2DW7A 1G1YA 1TA3B 1YE4A 5A2CA 2WVSA 2ATSA 7XIMA 2J27A 1DWJM 3VYLA 4Q4QA 4MB3A 2D3LA 2JGQA 3FAXA 4XD3A 3CLWA 3H2CA 5D38A 3GDTA 1DKWA 4ZSTA 4FALA 2NWRA 4OE7A 3VMPA 5FIPA 1EEPA 2BFGA 1MEWA 2C91A 1K03A 4F0HA 1G4TA 3W85A 1YTEA 4QG9A 3QKEA 1LWIA 5FOOA 1J01A 2X16A 1OFEA 5DY3A 3BE7A 1QO2A 4LRTA 3EWUA 4K38A 2X0SA 4KWSA 4HSNA 5HXMA 4DJDC 2F6XA 4G7EA 4P8UA 3TCSA 4K7VA 4AZCB 3V1PA 3WNNA 4HA4A 3GC2A 1TKKA 4C6QA 2AAAA 2O56A 2PURA 4H2CA 2J6XA 1G4EA 4S3CA 3W83A 4NRRA 4RW3A 5CZTA 3CZEA 4GC3A 1H7OA 2VDIA 3B8TA 3MVIA 3EWDA 3TWBA 2Z27A 4RUBA 4ATLA 2RDWA 5HMSA 4K8EA 4QSFA 1RK6A 5I00A 4N42A 4LY8A 3HQ1A 4RDZA 5EBAA 4MYXA 2A2IA 2IXUA 1W1TA 5HUOA 1Q2SA 1YNYA 2FZNA 1L6FA 1NDWA 5BXTA 2R24A 4GOAA 4CCEA 5I6SA 1LORA 3TQPA 1A4LA 1FWFC 1CGTA 1RUSA 4R53A 2DT3A 4GVGA 3TXVA 1IIHA 2ESCA 3N25A 4EE9A 1MQPA 1TJRA 2E68A 4BQ2A 5D9PA 2Q8LA 1WB0A 3C52A 5FF0A 2IPJA 3B8IA 3PANA 1YLVA 1H61A 4WJ8A 4A8RA 4TX6A 1Q85A 4LV4A 3WSUA 5CPNA 4W89A 5ABTA 2VGIA 1EBGA 4D72A 3DAQA 2VX7A 1PHQA 1KV5A 5LNUA 3MP4A 2DVXA 3AS0A 5J8LA 1GKPA 1EGVA 3BLOA 4LRSA 1V0NA 3A64A 5CPLA 2ZDSA 3S4TA 4YCOA 4C1LA 1TV3A 3AUOA 1NJJA 2F84A 4QNWA 1DORA 3BLEA 3POCA 1K4HA 1JDDA 5F4SA 3A4AA 4X9SA 3USBA 3EXTA 4HMEA 1R2RA 1HG3A 1PDYA 2ZXQA 3PNUA 3N6JA 4ZB0A 5H8PA 5AYIA 1H62A 3IPWA 4Q8PA 5HMEA 2YCEA 2VRKA 1E1CA 3W0KA 2QVHA 4JX4A 1XD1A 4IPJA 4JIPA 2OSXA 2QCFA 4R34A 2QS8A 3LRMA 2PTWA 1NFGA 5FESA 3OTRA 4HZ6A 3WD1A 2PZNA 3W6YA 3RCYA 1V02E 3F4CA 2Y6ZA 1CEOA 1H50A 2XVKA 2QCMA 3OHIA 1LQAA 3VGEA 4NUWA 5DELA 3QQWA 3VE7A 4HB7A 3HPZA 4DIAA 4LYRA 2ZUSA 1J5SA 4IGNA 4PEKA 2EGZA 1GJWA 4XIAA 1KFWA 5IFPA 4DWSB 3GU9A 1M01A 4XSMA 4PTMA 3QV8A 2QPSA 2WVUA 1WBJA 3ITYA 2XIQA 3FW6A 2XH7A 4BQ3A 3HF3A 2A1YA 3V1HA 2VM8A 1VFMA 1VJSA 2GJPA 3T0DA 6XIMA 2WCAA 4P7QA 1GVSA 2F2HA 1S2TA 4HA3A 1VP5A 2F38A 1FWBC 2CHNA 1UH4A 3QYQA 1R46A 2GUYA 5HQLA 3ZR4A 2ZE3A 5ABGA 2FZDA 2B7NA 3W07A 4IFRA 5D9MA 4QQ3A 2DDXA 5IOBA 1SYTA 4FLQA 2BVYA 4L7ZA 2IKJA 4RE0A 1YPFA 2BY1A 4UTJA 1DVJA 2WZEA 4WD0A 3NZRA 3ITVA 1PIGA 1LT8A 3ABOA 3S0CA 2DZWA 3FJNA 1NP0A 3KOXA 1X6NA 1E0WA 4GACA 1RJPA 2NXHA 5C9XA 4I7WA 3BZGA 4LVGA 4BJHA 3SCUA 1W1ZA 2G96A 1E70M 3NQVA 4EF8A 3CAVA 3LXAA 4JNMA 5DCBA 2VFGA 3VCRA 5AC7A 4OOUA 2CERA 1XIFA 2FJUB 2PLKA 2OZTA 2V0TA 4H8NA 1XPYA 2I5IA 1FWTA 2Y7FA 2WB5A 4G9PA 1TMQA 1XINA 2FZ9A 4P61A 4INFA 7CGTA 3CV2A 3CXOA 4NYUA 1E5NA 1AJ2A 3U48A 4E5TA 4LUIA 2F61A 1OCQA 5FJTA 4GY7A 3TYCA 3W2UA 3OGVA 4EXQA 1ZTVA 4YVXA 3ZLFA 3NQDA 5HQEA 3V75A 1GVIA 3NQMA 3UCDA 1KM6A 3MTWA 4DJDD 5CBIA 3TYUA 4DVOA 4FX6M 1T0OA 3COTA 4DJFD 3CHFA 5REQB 3LHUA 2DVUA 1GK8A 4MUPA 1Q6DA 5IFTA 3PFMA 4Q6JA 1E6NA 3MUIA 3OVQA 1V08A 2C79A 1XG3A 3DG6A 3SCPA 2WMGA 1KV8A 2ZRYA 3L4VA 1O95A 1QAPA 3RG6A 3RX2A 2UY4A 1OQFA 1NH6A 4FP1A 3UERA 4KWVA 1FWSA 2Y7DA 3G1DA 3TNOA 3U2EA 4OQVA 1LG1A 2VZTA 3VU2A 3W4RA 3TSDA 5SWUA 2W91A 1J8VA 3G18A 5DQPA 2QIWA 3MT1A 4HYVA 1GTHA 4ZCWA 3F2CA 3UPMA 4L6OA 1DJGA 4H6EA 2MNRA 5EMYA 5E9XA 4GC4A 1UKSA 3UVIA 3QHMA 4IOTA 3SIZA 3ICJA 5DANA 4KFOA 3VZYA 4XK2A 1IZJA 3TMLA 1AVAA 3W1MA 5FACA 3UWUA 2I7GA 3TH6A 2ZZ1A 3N73A 2GVYA 2CLHA 1VFUA 3HV9A 3OZOA 5C55A 1BG9A 2J47A 3UJ2A 3URNA 5B7ZA 4NZ5A 4RLIA 2J7EA 1H0GA 4XUYA 2PDWA 3NPXA 3EA3A 2VTFA 2WHKA 1PKMA 1FCQA 1L6SA 5G2HA 4MPQA 1VENA 3GVGA 4JHOA 4LUYA 1KGXA 1I6NA 5DN1A 2J7CA 1EJTC 2IXVA 4GD0A 1R47A 1YTDA 2CLIA 2VFIA 1UG6A 3VKKA 1H2JA 4XD4A 2FH8A 4JPGA 1NDYA 3LHVA 2CYGA 4XV0A 4YLWA 4ADUA 1NELA 3CAKA 3PTKA 2EPHA 2VZVA 3W1TA 2NV9A 1C8YA 4OTKA 3GXIA 3JU2A 3TYAA 4TX8A 3ZM8A 3QFWA 4E2VA 4GINA 1H41A 3G8RA 1TMLA 4QE1A 3URBA 4Q8UA 1AH3A 3WNOA 4CD8A 4LTSA 1VPQA 2BV9A 4QXIA 5LNSA 4NHVA 1VYPX 3WMCA 1IWBA 2IPFA 1VLWA 2BB0A 5KZEA 3I65A 3Q58A 1R6WA 1YDNA 5JXQA 3THAA 3E0LA 3TJ4A 4UR7A 1XHGA 5IDIA 5EGRA 4ACYA 4IQDA 1LRQA 4F0SA 3STEA 3GQYA 2G5WA 1TJ0A 3W84A 1OYAA 2QDEA 4DRSA 4PSPA 3I3EA 2AMGA 3WLRA 2DUXA 3H2EA 4Q8NA 1P7TA 2XZ7A 2GVGA 4H7VA 4W7VA 4FNSA 1H11A 2BY0A 1GQKA 3TEVA 1ELSA 4IUOA 1BSIA 5BRQA 4NJGA 4Z2JA 1V6YA 3SRKA 4LALA 3PK7A 1S5WA 4A4AA 4I5RA 3HBLA 2NV2A 1M9HA 4G2DA 3RLHA 5D8WA 1QR7A 4R88A 1G94A 5LGZA 1M7JA 1D7KA 2DSWA 5IDZA 3E3HA 4BF5A 2RKXA 3VOGA 3K1GA 5CZKA 4WSKA 3WLPA 1B0IA 3WEZA 1C93A 1OFAA 2WSQA 2Z2BA 1GVRA 5EBUA 6CGTA 2XWDA 1FWDC 4C1NA 2GYIA 4DF2A 1ZJIA 2VC9A 1M5WA 4Y9AA 3K46A 5HK4A 1GQJA 1BGAA 4H00A 4MVAA 4L6HA 1WXYA 4Y6GA 3PZOA 4X63A 3NZQA 3T2QA 3NQ2A 3ZJKA 1G4SA 5T9CE 3AFBA 4B5WA 4PZVA 2CETA 1E15A 1Q13A 3PZ9A 5BOEA 1B3ZA 3WQVA 1UKPA 3FJ6A 5D37A 2CLPA 4QAWA 2OR2A 1O1ZA 1SVDA 4P7LA 1MO0A 4M3PA 1XSJA 1V0MA 2WQDA 1HJXA 1AG1O 3MJMA 3NJ3A 1GKRA 4HCLA 3WCZA 4NNBA 1UKTA 2HQAA 2QCGA 1L6WA 4HZMA 2FFCA 3AIUA 1ZP4A 2J8TA 4A21A 3IVSA 4L65A 4Z0JA 1U22A 3HU7A 3KRUA 2Q71A 1VBJA 2YX0A 3EOSA 2V82A 1C91A 1Z7AA 1EX1A 4BZYA 4QG8A 4QFUA 2QCNA 3NO1A 1TX0A 3UGVA 3LX9A 2ALDA 2HTMA 1TIWA 1V51A 3SRFA 1T8QA 4DJED 3SJNA 3GD6A 1LJYA 4JAWA 4RNJA 1SGJA 3EX1A 3RCMA 1UWUA 3BVJA 4R9XA 3NOEA 1GOKA 4MNKA 2WC4A 3V4BA 3VX0A 4QTGA 3VMOA 1RD5A 3VM5A 2ZVIA 5DXYA 1HKMA 3W1RA 4W88A 5G4EA 1EQPA 3GG7A 1NM9A 3PAJA 4JQ1A 4UFJA 1EEXA 3RRAA 1C7SA 3TSMA 4C7FA 3VUSA 3AHXA 1MYRA 3SEPA 2EPLX 1Y5WA 3R79A 3CZKA 3E5PA 3V5CA 3W1QA 3NVTA 3U4FA 3LV5A 4GI6A 1PZ0A 1F4AA 3W01A 1A5SA 4DZIA 1TMHA 2HVOA 1Q8AA 1BWLA 2D2HA 4A3YA 1TO3A 1V3KA 2PP3A 4PEEA 2BHUA 4WQ6A 4D1JA 2ISFA 3DECA 5AZ0A 4IQJA 2FYMA 2WZHA 1F2JA 5D2VA 1CDGA 5L9FA 2E7FA 4NVTA 1X7IA 1LWHA 5TD4A 4B5UA 4DY1A 3S83A 3EDKA 1XYAA 3DFPA 1IEVA 1P6CA 1B90A 4JFSA 3LRKA 5C71A 1JFXA 5D05A 2YW3A 1ZB5A 4NT0A 1I2OA 3IV3A 1GOWA 4B5NA 1B54A 5FF7A 3ZR5A 1UZ1A 4E38A 4JCLA 3MI3A 3R12A 3BLLA 3OLGA 2HVNA 4M6VA 4ERGA 1PYFA 4K39A 1TV7A 4NQ1A 2Z24A 1SJBA 5A6BA 3FVDA 1TRIA 1IEXA 1JCTA 5ABEA 4B5VA 2CIPA 3PZGA 1XF0A 4P8WA 2QQ6A 4M1BA 2ZA3A 2C15A 3EYPA 1RPKA 1TYGA 3KTSA 3PBYA 1IWAA 1V3HA 4GZ7A 3GFXA 3GH4A 4XZIA 2ZBTA 5BZAA 1MMFA 1E0VA 2JKEA 1R9ZA 1XM3A 2Q3RA 4WKAA 1HX0A 2VOTA 3O15A 4MJ2A 4HHLA 4Q7IA 1MZRA 2ZX9A 3SCSA 3RLGA 3E5BA 2O0TA 5A95A 1QW8A 4GISA 1R3QA 3G77A 1LOLA 2XTKA 2PS2A 3Q65A 5I0DA 1ADOA 4DI9A 4L5ZA 2ALRA 1REQA 4PL2A 4L6DA 5U7SA 3T78A 1EJVC 4PUWA 1FRBA 1XLEA 1F7BA 2GDUA 3CUXA 4O0KA 4WSHA 2HE8A 2XIMA 2FPTA 4I90A 1DV7A 1H49A 3PPGA 4QE4A 3QPZA 3BXWA 4K1GA 2TRSA 2EF9A 2B7OA 4IMDA 3V16A 2YA2A 3N14A 5E0FA 1OCNA 3KVMA 2J9XA 4O1EA 1GTEA 3HG4A 3W76A 4QBXA 5HNRA 3D5HA 2ZA1A 2A7PA 3CWHA 3UXAA 2PWGA 1TCDA 1K6WA 1RSCA 1E5JA 3RPTA 2EPMX 2Z1KA 3GE7A 3CV1A 5HWMA 4LBUA 1UW9A 3H26A 4IGMA 1EOKA 4Y7EA 1E72M 2GVLA 2V5BA 1L2UA 3LXCA 4DBSA 4WOQA 1XSIA 4R33A 4RZ6A 3S1GA 2I56A 1J0JA 2V30A 4OZOA 2X8RA 1DQWA 1LF1A 3BW3A 2ZTJA 5DRCA 2PDMA 3G6MA 3BLIA 3WL0A 1KD0A 3AJ7A 3B8UA 4UQEA 5AHLA 3U5UA 4AQLA 4GH3A 4S1FA 3OBEA 5D8ZA 1PKYA 1K77A 3QQ1A 3ZLGA 3BARA 2O7SA 1H7NA 1KWKA 1HFBA 4MY1A 4ALDA 4M8UA 2WW5A 2ZCGA 2FVLA 4HA0A 4CQBA 1LP6A 5G5IA 3QTPA 4IJCA 3N34A 4QR6A 5CPSA 1KW1A 3KVJA 4DO7A 4LB4A 3THDA 4H9VA 4JN7A 4J35A 1ME8A 4FXJA 3ONBA 2GSHA 4AX7A 1HO4A 3I6RA 4ES4A 4MWAA 3W74A 4S23A 1G7VA 2VGFA 4M82A 2YL9A 2XGZA 3N2MA 2OWWA 3TV8A 1HL2A 4AYGA 1MEHA 3CO4A 1RD6A 3OEXA 2P0OA 1W3NA 4IIBA 3EA1A 2ACRA 1XD0A 1O7AA 2ZWYA 3P61A 5F1VA 3SFWA 3R25A 3KZPA 1QPKA 2QJJA 3ZIZA 1OWQA 4GH1A 4NZ4A 3WQ5A 2ISVA 3SW6A 1EO5A 1E3XA 1SFTA 1UQYA 1RQBA 4KF1A 4NNAA 4EOUA 2DZPA 2IQTA 4AHQA 3ARRA 4BQ5A 4H9UA 2QUNA 1V5XA 4MF4A 4HPJA 1U1HA 1QHOA 4FR1A 1YXCA 2ZC8A 4DQWA 4ZVJA 1T5AA 3QXBA 4BS0A 3O06A 4M56A 4MKNA 1G5AA 4WZHA 2E6AA 4U31A 1FFQA 3QHOA 2ZUMA 4B16A 4PCTA 4LAKA 1DPMA 3NQEA 2WC3A 4O53A 4CD4A 2R91A 3AU2A 1KCZA 2W9MA 1UPMB 4J3SA 1E71M 3NXFA 3T40A 3IJLA 4H01A 1U33A 3P93A 3P14A 5M2FX 3UWQA 1VB9A 8CGTA 1SJAA 1L6YA 3BK0A 3FA5A 2PU1A 3RDKA 1IWPA 3EGJA 4JOMA 1JYXA 2OB3A 4FZIA 3Q45A 3VTRA 3UJRA 3TC7A 4HT3A 5HNNA 4V15A 3CH9A 4DWSC 2OO6A 1V02A 1ONRA 3ZWTA 2WHMA 2G3MA 5TNVA 2XFRA 3ZR6A 5AECA 2PDLA 1LLZA 4L9XA 1FDJA 3GG8A 2BGQA 4X9YA 1EDTA 4EWJA 1RA0A 1WBHA 1BKHA 3UG5A 3VD5A 3TYEA 3W71A 4JNZA 3V0TA 3NQAA 2YYUA 4GRSA 4ZO8A 5M03A 1SR0A 2PDPA 2QVNA 3RX3A 4Q4PA 4UNKA 2FH6A 1W5NA 2J62A 3RLVA 1QI2A 3BWWA 2FZMA 1MW2A 4XVDA 1P6BA 1MUMA 1ECEA 1WXJA 3P80A 3B0YA 1KTCA 4NZ3A 3KOYA 3B0VC 3CEPA 3T81A 1ZAHA 2GZXA 5HOSA 2A7RA 1E4NA 3KM8A 3GXFA 3CHEA 1ZCOA 2YLLA 4S3KA 2DIEA 4PN2A 1F6PA 4UTFA 4LF1A 3PC0A 2ZX7A 4NXKA 4RR4A 2ISDA 3PHAA 3TW7A 2C13A 4QG6A 1ALDA 3VIHA 3ARPA 5M3WA 4AMCA 1A5MC 2UY5A 3N4EA 4YU1A 3AMGA 3VUPA 3EX3A 4F0MA 1JPMA 5I09A 5TBOA 1HJUA 1LQ2A 3RJYA 3GX9A 1QVBA 1K9EA 5DCEA 3I10A 3TR2A 1MNZA 3O0KA 3S9ZA 5DEZA 3VFCA 2VOMA 3G1RA 4MG4A 2VC7A 4RCXA 1OGSA 3DYPA 3WBXA 2P1FA 1GVQA 2Z1SA 1CZ1A 5I07A 4JTGA 4GYPA 1OM0A 5G4WA 4V27A 1S38A 5GNXA 1TR9A 3VC6A 1RP9A 1DJQA 2P0IA 3QJAA 1S5VA 3WUGA 1C8VA 4I9MA 4LXFA 1X38A 4R7WA 4DF1A 4Q8TA 3IEBA 2XIOA 3UZZA 3O3RA 3WH6A 4US5A 3CASA 2E5BA 4MNJA 3CUZA 1XSKA 1TPUA 2V3GA 3ZWSA 2KX9A 2YCLA 2E8ZA 3R8GA 3VCNA 4J3ZA 2YR1A 3F03K 4BI6A 4H9XA 4IIDA 2PRMA 3C0QA 3F2DA 1AL8A 3L2IA 1UZHA 1XYCA 4C6MA 5DT5A 3W6LA 3RJXA 4CD6A 1Z89A 2NZLA 3GVQA 4W8AA 3RLUA 5H1WA 3EBVA 1XIEA 4XBSA 2GQ9A 1JAKA 1J11A 1X1ZA 5CSUA 4IX2A 2Y63A 3KBNA 5K9DA 3LCHA 2BHZA 4IM4A 3U9IA 5C2CA 4JFTA 2G3JA 4YL2A 1DWGM 2QCDB 4UUIA 4HOWA 4LEQA 1G6CA 3GR4A 1QPRA 4E2OA 5C7VA 2YZ5A 1E1CB 1EPVA 4JDYA 4G1NA 1EA0A 3A5FA 2O92A 5I79A 1PIIA 3P5YA 3CB8A 1Q63A 4NYYA 1SZRA 1HGWA 4BK9A 3S5OA 3W1UA 1UA7A 1WOAA 2GOKA 4R3UA 1TG7A 3M6DA 1E43A 2ZIDA 2PWHA 2PUZA 2E6FA 4W4QA 3PG9A 1S2VA 2CBJA 1KXHA 1YW1A 3U3HA 1X7FA 4CUCA 1YYAA 1PXGA 3B0UX 3A5VA 3W7EA 2G8ZA 4MB4A 1MW1A 5AC6A 2SFPA 3GSMA 3MS8A 5JBDA 1NDVA 4BWLC 5KZMA 3VINA 3NGJA 3P3BA 4TMBA 1OX4A 2NXIA 4OOZA 1U5HA 4IL0A 2HZGA 4X22A 3OLEA 4Q4MA 3UZXA 4JYFA 2FVMA 1W1PA 4IMCA 2PWEA 5A1AA 1S3HA 1WNOA 1TPDA 4GKTA 4JTHA 2WMJA 1O5RA 3OYZA 1OYCA 3GB6A 2NQLA 3HFTA 1B3WA 4J1OA 4UTMA 1WZKA 2Z25A 2BVWA 3MW7A 1BKSA 3C61A 4WVXA 3UWYA 3W2NA 1Q4WA 2ABBA 3KS5A 3S42A 1VJIA 2JE8A 1C9DA 3OZMA 5ENLA 1VBRA 3VDGA 1TE6A 1XIBA 1UMYA 3BAJA 3AZTA 2PDYA 4LYKA 1S2CA 3NO5A 1DJZA 3AHYA 4NJJA 2I9EA 1UWRA 3LG3A 4Z08A 3TSBA 2AL2B 3DFOA 3HB9A 4DWSD 3RUBL 1IR2A 5BXRA 4MLRA 3PBGA 5AHMA 3LM3A 3TNBA 1XR2A 1JULA 4BA0A 4DB7A 3JRKA 3EB3A 4AY8A 2J7HA 1W9BM 2DJXA 4TX9A 3MSRA 2TMDA 5D9NA 1XBVA 4YTUA 1S5MA 1H63A 2X42A 1VEOA 3LHZA 5C2XA 3GNRA 3WD4A 5GQBA 4PMDA 1SUXA 4HBKA 5CPMA 3M0IA 1FH9A 3VPLA 1HKVA 3P62A 2X1SA 1XFBA 2V67A 2ACUA 1MDLA 4CQCA 2V5CA 3P8IA 4AF0A 1LRTA 1LUCB 4CNSA 4CU8A 3PJTA 1F5ZA 3GKAA 1DOSA 5CJNA 4K8GA 1R5YA 5LZLA 4MZ1A 1PB0A 1UWTA 3FKKA 4UZUA 1JJKA 3O63A 5LA0A 1WP6A 4PTWA 2CZDA 1IV8A 4LV9A 1EF2A 1J18A 3TN5A 1FWHC 5FEWA 1YDVA 2EPNA 3SCTA 1EOMA 4HNOA 2XPKA 2BX7A 1BXBA 2DEPA 1J12A 5DT7A 3MC5A 1DIOA 6REQA 1IXPA 1HQTA 4LC8A 1YEYA 2E5DA 4AMAA 1FOBA 1XYFA 1KKOA 3KUMA 4IH3A 3SQLA 2DZSA 4BEQA 2BG5A 3QSRA 1BG4A 5FEZA 3GDKA 1XGEA 2ZFAA 4LPCA 3BANA 4IQEA 1IE7C 3STCA 3NQ7A 2EJAA 1U5VA 1UR4A 1AZ2A 4MZYA 1KFBA 3C5QA 5D2TA 4UOZA 3MDUA 3SCQA 3TYBA 1I8JA 4O15A 3M0KA 5LIWX 3QV6A 5G4HC 2Y24A 4N9EA 4POCA 3QR3A 3W7KA 1W1B1 2DSVA 3CUHA 1QPNA 1BYAA 1OEPA 1ODZA 4XBJA 2DV0A 3AROA 3F4DA 1B3YA 4CD5A 3WLNA 4QS5A 1W3JA 1FWCC 2NQ5A 3KOWA 3ID7A 4O1AA 1X6UA 3E49A 3UETA 2PBOA 2BGNE 5D33A 4DYJA 2YDSA 2NX9A 4NZJA 5G2IA 4HK6A 2FKPA 4J3WA 4IPLA 3WO8A 3CZGA 5CZSA 4XIMA 2OX1A 3L4XA 4WGHA 3TJXA 4N9CA 4RNIA 5CEWA 3MKKA 3F1QA 3GKFA 2CLOA 2VEFA 4YIWA 4AAJA 3A24A 3BMWA 3B4YA 5LYRA 3WLIA 1Q4NX 1E6QM 2HSAA 1MI3A 4EF9A 4H7CA 3B05A 3ARQA 3LBOA 4H4IA 4YNGA 2F6UA 4XKYA 5FD0A 4A3RA 1FH7A 3PF3A 1UJPA 1WV2A 1E6XM 3CQIA 2YFNA 2MANA 4ZTXA 3FSTA 1G0CA 1VBHA 2V5JA 2Y89A 2X1TA 1XI3A 2X05A 4CNOA 5AC4A 2DUAA 4GUFA 3W7OA 1NSJA 3TN3A 2VCBA 1NVMA 3GZAA 3UA4A 4YTSA 4AEOA 4LANA 2IW0A 3W2MA 3RYSA 2V2DA 1FWEC 3WIJA 5BRPA 4AVOA 1HJSA 3MP5A 5EYWA 1RBAA 2VP8A 4GE8A 4ACZA 2PA6A 3KTCA 4TUFA 2GWGA 3I3BA 1G67A 2VNCA 3W2JA 4PUKA 5LA1A 3WDIA 2DP3A 1HL8A 1KFKA 1UP2A 1XV8A 1EZWA 3B9OA 4EP8C 4V28A 1HT6A 4MAZA 4PBFA 1LL4A 3AIVA 4NY2A 5EFDA 3TP4A 1UWAA 3L0GA 3EB2A 2IUZA 2D2GA 1EYEA 3LPFA 1E0XA 1P0NA 1TUXA 3NNTA 4IPIA 3ONCA 3CL7A 1RY0A 5FJPA 1FCUA 5AVNA 2VQTA 3FYPA 1IGSA 1UWQA 4NZCA 2PTYA 4PB5A 1FWGC 4JKKA 1LDCA 3RM8A 1W2VA 3EWWA 1QPOA 1VIZA 3M0ZA 3O2LA 4Q8VA 1V6TA 1UP0A 1XDMA 1TTQA 4I5XA 4Y8EA 3I7RA 4HU4A 2O7QA 4JYEA 2NSXA 3H54A 1YTKA 3BPWA 3EX2A 1SMDA 3U5YA 1Y5VA 4AH7A 1ZBKA 4NG3A 4YVVA 3UZ5A 1IQ8A 4H9YA 1FQ0A 1IXQA 2XVNA 1FWJC 2ZOXA 4O8AA 4URIA 3IJ9A 2FZBA 3IVTA 4ZB2A 2GVEA 3DEQA 2DSZA 3T05A 1TWZA 3ZT5A 3C6CA 1EQCA 3MO7A 2VCAA 5H2ZA 4LUSB 3G24A 3PBVA 5CSSA 4AIBA 2V3DA 5AC8A 5BWAA 4ORMA 3Q94A 3QW4B 4YMZA 3R4IA 5B7YA 4ZQNA 1XP3A 5FJRA 4UXDA 3A3WA 4HGXA 2QLYA 1I60A 4L64A 1BYDA 1HVXA 3WBWA 2QGHA 5CZ0A 1OFPA 1I1WA 4PFHA 1V93A 5I03A 1JZ5A 1T41A 1RCOB 1SO6A 1UBPC 1Q6OA 2D1ZA 3MI6A 5GJMA 3L21A 3JZEA 2XHYA 1Q6FA 2HROA 2FQIA 3LLXA 3FA3A 1HKWA 2JGYA 3GNPA 2ONEA 3NPWA 2ZRUA 4A22A 5CZJA 3B9DA 4KFNA 1E4LA 3IJQA 1W5PA 5A6KA 1B3XA 3R58A 3T2PA 1GPFA 1RH9A 1XW8A 3V0UA 4RE4A 1VIWA 4JKMA 4NAEA 1DJWA 1Q65A 4L61A 5K3VA 3K13A 1HTIA 4G8TA 1CXLA 1QXLA 3W25A 4RNFA 4RW5A 3OW1A 3DH7A 3OPSA 4TU1A 3W86A 5EFFA 5HULA 3N11A 4B92A 4XQ6A 2VJXA 1EJSC 4XISA 1QFEA 2V2HA 3N12A 3N9KA 2PRHA 3UCCA 1C3FA 3M9YA 3LRLA 4WF7A 3VMNA 3EEGA 2X0HA 2P3EA 1V6WA 2YBUA 2ZUUA 1FXQA 4ZB5A 2GGJA 3Q2DA 4QROA 1C9WA 1J6PA 2BTMA 1VFOA 1YPXA 2Y61A 5LSMA 3TONA 2VEKA 3R5EA 3KL5A 1ZSXA 3NL3A 3DG3A 3N2TA 3UR8A 1IYXA 5DBTA 3NEHA 2QV5A 4CQAA 4KGJA 5KINA 2ZRWA 1JQVA 3N6QA 1XC4A 4P7RA 4DBDA 3RO6A 3CBWA 3MV01 1IEQA 4IMFA 4KCUA 1B57A 3S5SA 1AA1B 3QZEA 3GG0A