4M1RA

Structure of a novel cellulase 5 from a sugarcane soil metagenomic library
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
296
structure length
296
Chain Sequence
b'MVAPITTSGNKVLFGGQQGSIAGNSFFWSNTGWGGEKYYNAQTVAWLKSDWKSSLVRAAMGVDESGGYITDSYNKTRVTTVVDAAIANNMYVIIDWHSHHAEQYQSQAIAFFKEMATKYGNNNNVIYEIYNEPLQVSWSSVIKPYATAVIAEIRKIDPDNLIVVGTPTWSQDVDVAANDPITGYANIAYTLHFYAGTHGQSLRNKASTALSKGIPLFVTEWGSVNADGGGSVATAETNSWVSFMKTNNISNANWALNDKAEGASALVSGASANGGWTSSQLTASGTLAKSIISGWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase 5
publication title Structure and function of a novel cellulase 5 from sugarcane soil metagenome.
pubmed doi rcsb
source organism Soil metagenome
molecule tags Hydrolase
total genus 121
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m1rA00
4CVWA 5EFFA 1V0NA 2J74A 2IUZA 4PYSA 3AROA 4AD2A 1D2KA 1KR1A 4UFMA 3MANA 2Y24A 1VFUA 1BYCA 3JUGA 3IK2A 2V5DA 1W1YA 3TTOA 1DHKA 1V3MA 1WCGA 2V38A 4FLOA 4OZOA 2DT0A 2XFFA 2QMKA 3WENA 3WBAA 3ECQA 3B9DA 1BGGA 2QLYA 4CD7A 2A3AA 3VNYA 3BC9A 3W6LA 1AQMA 2YIHA 3CTTA 3SEPA 3VKKA 3QGVA 4PCSA 1LG2A 1UR9A 2ZX7A 3MV01 5ABGA 1QNQA 3W24A 1GVIA 2ZWZA 2CERA 2VR5A 2WWDA 1GNXA 4OUEA 4E8DA 1UWRA 1W9VA 4CD8A 1ISXA 1MW0A 2Q8XA 1E0VA 3B9EA 4UQEA 3PZGA 1KXQA 1QNOA 2ZUVA 3ZJ6A 2OYLA 1C7SA 5I78A 5D9PA 3WF0A 1BAGA 4B9ZA 2DT2A 4D6HA 1OD8A 4A3HA 1VFMA 4M82A 4PEEA 5CZKA 1KGWA 5BROA 3MUZ1 1ISZA 3RJXA 2WKLA 2J7FA 4PSRA 4J3UA 2VQUA 1V08A 4AW7A 1GQKA 1M7XA 4JFUA 1W9XA 4PMZA 1UQZA 3UG5A 4D6CA 1TUXA 1JG9A 4BQ2A 2WCSA 3AYSA 2YL5A 2CBIA 1HVXA 3WQ4A 1W9PA 1LLOA 3MKKA 1WZMA 4JAWA 1OT1A 2CCRA 2OSXA 2XFYA 2ZIDA 2XFRA 1MW2A 1QPKA 2G3MA 1E4LA 1E56A 4D6EA 3SCQA 1JZ6A 3VIJA 2VZVA 4W84A 3K4AA 2O92A 3SCSA 2EJ1A 2VRJA 4PMNA 4M80A 1KGXA 1LWHA 3WH8A 3MUIA 4JKKA 4X0VA 3QOKA 5E9AA 2XUCA 3OA5A 2WB5A 5BWFA 1E4NA 4MJ4A 1E6NA 4XZWA 3GH4A 1NOWA 4W5ZA 1CXFA 1XRVA 2CHNA 2WVUA 3II1A 2J78A 1RPKA 2WC3A 1EA9C 2DH3A 4R27A 4A4AA 4HU0A 1UR4A 1WKYA 3RCNA 3PHAA 3W26A 2A3EA 2CETA 4MNJA 1SR0A 2X09A 3T08A 5GNZA 3K8LA 3K8KA 4F9JA 1NWTA 3LPGA 2XSBA 4CGTA 1WNOA 2WKGA 4DWSC 1GQLA 3WMCA 2FGLA 2Y2WA 4KWUA 2XVGA 1W3JA 1JNDA 3O6AA 2BFGA 3VO0A 3N04A 5A6SA 4OIFA 4MNMA 1SMAA 4HMCA 2PWFA 1C91A 3WDIA 1VBUA 1HJUA 1CGYA 1E6SM 2E9MA 4U33A 3AIEA 3SCUA 1DP0A 2VX6A 1OIMA 3A3HA 3B9AA 1FHDA 5AYIA 1E6PA 1K9DA 5LA2A 3GBEA 3TTYA 1XD1A 3ARXA 3CZEA 2FH6A 2Z1KA 3DC0A 1W3KA 5ABEA 2YA0A 4Z2KA 1KB3A 5IFTA 1UD8A 1LG1A 3T2PA 2VX7A 2VVNA 1PX3A 3G6MA 3VGHA 3S6TA 4CU7A 1UYQA 3L4YA 1VBRA 3W29A 3IAPA 1DWGM 3CIVA 3RJYA 3AIBA 1V02A 4PMUA 2DSKA 4PMQA 1H4PA 1MQRA 1NWUA 1BF2A 3CPUA 3KWXA 3VIFA 3BMVA 3N9KA 3W38A 2J7DA 1E71M 3AMGA 5HOSA 4U31A 2ZWYA 3T0DA 1Q6CA 3MSGA 3KE0A 3N18A 3AS0A 4UFKA 3W25A 2VJXA 3WFZA 2J4GA 3QHNA 2PB1A 5A8MA 3W37A 5ABFB 3W53A 1DTUA 3UERA 4KRUA 4F79A 2BNJA 3OLEA 3HU7A 4LXFA 5A8OA 3WFLA 1ZS2A 2G3NA 4D1IA 3WNOA 1V6UA 4B16A 2WM0A 1H41A 4MDOA 1K9TA 4DWSB 3VIHA 5GPRA 2Y4SA 1NQ6A 1E6RA 5DMYA 3MSDA 1MYRA 5HPCA 4HPGA 4W8AA 1VFFA 1NWRA 1V3LA 2BXZA 2GJXB 4HZ6A 4BA0A 3ZT7A 1EDGA 1L0PA 4J3WA 4RE4A 3NUKA 5E0CA 2IXVA 3WSUA 5I3DA 5E6ZA 1JDAA 1TMQA 2CESA 4HZ7A 2NT0A 3WD0A 3BGAA 5AC5A 2YOCA 1GHSA 1ZBCA 2NW0A 1Z32X 4GO9A 1JXKA 4HMEA 3TTQA 1GQJA 3L4XA 3N17A 3WNLA 2XM2A 4ZENA 2VX5A 4GZIA 4JFTA 1G5AA 2WHLA 1MQQA 2G3IA 3F5LA 3VD7A 3A47A 3VM5A 1SMDA 1ESWA 5IFPA 1CWYA 3U7BA 4DM1A 3WMSA 4U2ZA 4AEEA 4XB3A 5C70A 2VUYA 5BXRA 3WF1A 3PTKA 3FXYA 3VU2A 4QCFA 3WNMA 1AMYA 3IJ7A 3PZUA 1VJZA 4AIEA 4MNKA 2OYMA 2GFTA 3BAXA 5CPTA 1UR1A 3K4DA 3VMPA 4CD4A 3VIPA 4AD5A 2BHZA 4WLCA 1XSIA 3GZAA 1G9HA 4GXPA 4JCLA 2E4TA 2D20A 2EXOA 4OBRA 2C7FA 2XHYA 5A6MA 1ODZA 4Q7NA 4EANA 4QLLA 4AZIA 5FKYA 3OIHA 5DT7A 3POHA 2GJRA 1FOBA 2VO5A 3MUY1 3VTRA 1PIFA 1CXEA 4MB5A 4AIOA 4JL2A 5AC4A 1HXJA 4HA1A 4V2XA 1SYTA 2JF7A 1XYFA 3AXIA 1TR1A 3WD4A 2YBUA 2YDRA 3T0BA 5JBFA 3OZOA 1MFUA 4PTXA 2UY5A 3NSXA 3BLPX 3EDJA 4GZEA 3CZLA 3DYPA 1UWTA 2WLYA 4MB4A 1HNYA 1B31A 1UWQA 1JYNA 2CEQA 3RM8A 2W62A 4AZCA 4AEFA 3EDEA 4D6IA 4KH2A 5ABHA 3ARPA 3AICA 3D3AA 1TE1A 3GXIA 4J3TA 1HIZA 1NOFA 2J8GA 3ARYA 1F4HA 5I79A 5A6LA 1B3VA 1QI3A 2YA2A 4EK7A 1V6XA 5GQBA 1M03A 1OWQA 4GI9A 5AYBA 4PMRA 4AD3A 2UY3A 1BYAA 1BGAA 1HL8A 3VMNA 2JIWA 4KGJA 2OSWA 1H0IA 1GPFA 2V5CA 2Y8VA 5A2AA 3VDBA 4H2CA 5I2UA 2CPUA 4S3KA 1HKJA 2DSVA 3WL0A 1B30A 2PI6A 2VOTA 3AIVA 4A3YA 2C0HA 3OGRA 2PWGA 2UWFA 2FGZA 1B9ZA 3T09A 5CXPA 1V6WA 4AZ6A 1ITXA 1V6YA 2WZEA 2XPKA 3ALFA 5EBAA 3CMJA 2VNCA 3WDHA 4D6DA 5I0DA 2GDVA 2JALA 4B9YA 4XZBA 3BSHA 2OWWA 4U5KA 1DWFM 3CZGA 3UCQA 1E0WA 4P8VA 4PSPA 3FW6A 5CGTA 4AY1A 1UR0A 3OLIA 1CGUA 1GW1A 5EFDA 5GNXA 2QHAA 3GM8A 2QF8A 2WVTA 1VJSA 1KWKA 3ZMRA 1UWUA 3FAWA 8CGTA 1XGZA 3PZOA 1B3ZA 4WK9A 3AISA 4B15A 2D1ZA 2WLZA 1UR8A 3VGGA 3ZT5A 3WEMA 4WF7A 5BYWA 2D3NA 3PZVA 2W67A 5TD4A 1HP5A 1QOXA 3VDHA 3VVGA 1CBGA 1QI5A 3ZJ7A 1R7OA 2GJPA 2YL9A 2WYSA 1BLIA 1EDTA 1P6WA 1A3HA 1W32A 4HOXA 4LYQA 5C71A 1C8QA 1UD4A 4CU8A 2BVYA 3WUEA 2E9LA 3BCDA 4U5IA 1CZ1A 2XTKA 3FHQA 3EBVA 1MW1A 4MB3A 2BHUA 1F4AA 5I77A 3AXXA 5HXMA 1E9LA 5A2BA 3WQWA 4QCEA 5BXTA 3W0KA 3BAYA 4FLQA 4JKLA 1KXTA 4QLJA 2CKRA 3AIQA 2CBUA 2XGBA 3ZOAA 3OGVA 2J79A 4TTGA 2XVPA 7TAAA 2XVKA 1XYZA 3BSGA 3QHOA 4ML4A 2W5FA 3CZKA 3WH6A 2WANA 3IJ9A 2ZXQA 4HA3A 5JIPA 4AZHA 3WD2A 4F66A 5I5RA 5D4YA 2G4FA 2VC9A 1NH6A 3PN8A 3WH9A 4J3XA 1VIWA 1UR2A 1HKMA 1EHNA 3FNDA 4HOZA 4JFSA 2G8ZA 1E73M 3QR3A 5KEZA 1XHGA 4TUFA 2CKSA 2VVSA 4F9DA 1O7AA 3AFBA 2WSPA 2PWHA 1K9EA 1J0JA 4LGXA 3T0AA 3UR8A 2X05A 1OGSA 1SFSA 3AZRA 3ZQ9A 1M04A 5AY7A 1OD0A 4H04A 1XH0A 4OOZA 1V3IA 1G0CA 2GK1A 1QBBA 5CGMA 1LL7A 4EKJA 4MB1A 2WPGA 3N13A 4EE9A 1NM9A 4GIAA 5A1AA 1N82A 4DUWA 3MS8A 2XIIA 3AHVA 3W27A 1EHAA 1W9DM 1CYGA 2ZX9A 2J75A 2OSYA 3EMCA 4IM4A 1BHGA 4XX6A 2D23A 3BAKA 4UR9A 4MJ2A 4W93A 3SCOA 4HP5A 2HISA 2WMGA 3M7SA 3RDKA 3ZR6A 2BY0A 4M29A 1WE5A 4GZJA 2JFEX 1JD9A 4Z2GA 3KL5A 5EB8A 4YHEA 4PBGA 2WMIA 5BRPA 4C7FA 1HJSA 2A3HA 1YQ2A 2CBVA 1V3KA 1GOIA 3RMEA 1UD2A 3AHTA 1XV8A 4HMDA 4UCFA 4RE2A 5IXEA 2VCCA 1C8XA 2ZUSA 1OSEA 3BAWA 3NYDA 1JF5A 3UG4A 3VM7A 5HPOA 2EPOA 1GQIA 2EEXA 1QNRA 2XM1A 4W8LA 2G41A 3NSNA 3OLDA 3M6DA 1KXHA 2WW5A 2CITA 2F2HA 4M1RA 3CH9A 3SCNA 2VZSA 4PTMA 4U3AA 1PZ2A 2E40A 2VI0A 3U5UA 3ARSA 1JZ2A 6CGTA 3RPMA 3ZO9A 2EPMX 4PN2A 3AQUA 1Q6GA 3SCRA 4AISA 3CHCA 2WVVA 2C8NA 1W9BM 2ZX8A 4AZBA 3CMGA 2PWDA 1JL8A 4H41A 4QDMA 5CLWA 4X0NA 1GORA 6A3HA 2QPUA 1J12A 2UY4A 5A95A 3WNKA 2GJXA 1CENA 4GQRA 4OBSA 5FOOA 1PPIA 4AD4A 5JBEA 1JYXA 3TTSA 5DT5A 2W66A 2WHMA 2W92A 4W87A 1UH3A 5M03A 4PMVA 5E70A 3W4RA 3WKZA 4GINA 1WDRA 1HJWA 3D5HA 3ZR5A 1H0GA 1J11A 4H7VA 1XSJA 2E8YA 4Z2IA 1JZ4A 1JAKA 1GONA 5D9OA 3AHXA 2EO7A 1W2PA 1AQ0A 4ZXOA 1Q4NX 4LPCA 3NJ3A 2WK2A 3EMQA 1G1YA 1UKOA 4FLRA 1E0XA 5A8NA 1BTCA 1WZLA 2OWCA 1W1TA 1PIGA 1ECEA 2X8RA 4D71A 3ARRA 4GQQA 4TVCA 2ZUWA 1J0IA 1U30A 2WC4A 1C90A 4ZE4A 3WDRA 3N12A 4W88A 1X1NA 4PMYA 3CGTA 1TCMA 3BAIA 2AOSA 1CGVA 1H3GA 2YA1A 3NCOA 3WEOA 3ZT6A 1IT0A 3ARZA 4J3SA 2WZHA 1FFRA 1TA3A 3VUPA 1WB0A 1U33A 1GCYA 1WDPA 2XJ7A 2DIJA 5FIPA 2BS9A 4W7VA 1I75A 1CIUA 1V02E 3CUHA 1GUVA 5D9MA 2WHKA 3SUTA 1KCLA 1B0IA 1VRXA 4LX4A 1PZ3A 4QP0A 4UFHA 3PZQA 1LL6A 4HPHA 3EMZA 1QI2A 4AC1X 3N15A 4OJYA 1GJUA 2Z1SA 3AXHA 4CD5A 1FFQA 2DH2A 3BAJA 3RM4A 1V0LA 3SCTA 1V0MA 3VX1A 1V6VA 1DWJM 2BY3A 1RP9A 2JF6A 1RH9A 4MAVA 4Z2LA 3APGA 1KCKA 3F5KA 4L4OA 3CHDA 5LA0A 3AOFA 2WMKA 3PZMA 1G01A 2WSKA 1LF1A 4ZXLA 1H49A 4IUGA 1B90A 1OGBA 3ARTA 1KGUA 3G6LA 3I3EA 3OBAA 1CXHA 1QW9A 4TVDA 1QNPA 1EOKA 1J0KA 3AHZA 2WBKA 2CBJA 2TAAA 3WD3A 3ZJ8A 4JKMA 5A6BA 1BPLB 4V28A 4IISA 2UY2A 4BZYA 4PMOA 4XV0A 4FMVA 4PMDA 1E4IA 3UESA 3ZJKA 1Y7VA 3E1F1 4ZE5A 4Z2JA 1WAWA 4WKAA 4QFUA 1B3WA 4L4PA 4ACZA 1B3YA 4GKLA 4P7OA 2J7BA 4P7RA 1C7TA 1XD0A 4CCCA 1E3ZA 3AIUA 2E9BA 3WQ6A 4C7GA 4HU8A 2A3BA 5CSUA 1UKQA 3W82A 1QHZA 3BH4A 3AZSA 3TONA 3WQVA 1PAMA 3WH5A 5EMYA 1PX4A 3L4ZA 4GPNA 1DEDA 2O9OA 2WC7A 5D8WA 5IHRA 4M56A 2JEQA 3GH7A 3DHUA 2JE8A 2B31A 1C93A 1J0HA 4AYSA 2G3JA 4NF7A 2ZICA 3AMKA 5CLTA 4LYRA 2D24A 4MADA 1NP0A 1BG4A 1UH4A 2O9PA 3FY1A 4BQ4A 2A3CA 3A4WA 1E5JA 1HJXA 1R8LA 2DT1A 1ZB5A 1GOWA 3EDFA 1M01A 3AMCA 2VT0A 4UOZA 1UG6A 1R7AA 1ZBKA 2X2YA 5A6AA 3OGSA 1HJQA 5A2CA 2YL8A 4S3JA 7CGTA 1D7FA 2PBOA 3BXWA 3ARWA 4PUDA 4H8VA 5A94A 4ATLA 1CGWA 3CUGA 5DF0A 2XSAA 4BS0A 3MUAA 3BMWA 3GXDA 1GVYA 2IXUA 1L8NA 2YJQA 2E8ZA 2ZXAA 3U57A 3NDZA 4CCDA 3GXFA 4TVUA 4RL3A 5D8ZA 5A8PA 1JI1A 1HF6A 1FH8A 1CGXA 3MMDA 5DEZA 3VGBA 1E40A 3ALGA 2D2OA 1JF6A 2VQTA 4F8XA 4K68A 3LPPA 3SCVA 2VURA 2PWEA 3L4UA 1BYBA 4N0RA 2GK1B 1KQZA 4W5UA 1B3XA 1QW8A 1JXJA 4D6GA 3S2CA 2BVDA 3A4AA 1ODUA 3FN9A 4P7LA 4BQ5A 4UFLA 4DWSA 4J27A 2W4XA 1BVZA 3UR7A 3L4WA 1NOUA 3CHEA 3QOMA 1UD3A 1LJYA 5CJ5A 4C7DA 2WAGA 3CUFA 3VIKA 1CTNA 1OT2A 1EQPA 1TVPA 1R86A 1GOKA 3EDKA 4IPNB 4E2OA 3K46A 3KL3A 1QI0A 3GNRA 1WDSA 4OKDA 4D6FA 1CXIA 1JZ8A 4MAZA 2ZXBA 1B1YA 3L2LA 1UKTA 1OINA 2WMIB 1VEPA 1MVYA 3LPFA 2JIEA 1GOOA 1TZ7A 1JFHA 1W9UA 1WO2A 3VIMA 1JZ5A 2XGIA 3DYOA 3GNOA 1R87A 1E70M 4ZEPA 1UKSA 3VGEA 3CUIA 2O9RA 4MDPA 4JFVA 1C3FA 2YLLA 6TAAA 3OG2A 3AZTA 2DSUA 1EGZA 4UFIA 1Q6DA 4RE3A 3WIJA 5A6JA 3BCFA 2CIPA 4HOWA 1HT6A 1WPCA 3PBGA 4W89A 1VF8A 3CO4A 3N11A 3W6MA 1A47A 2E0PA 3ZSSA 4FLSA 2V3DA 3GH5A 1OIFA 2BXYA 4AIUA 2YBTA 1LQ0A 2AAAA 3J7HA 4PRWA 2EPKX 4FF5A 1EH9A 2VZOA 4OOUA 2AMGA 4WJXA 3HMCA 2J7GA 3NDYA 4KMQA 3SURA 4UZSA 3DECA 4AZGA 1ISYA 2RGMA 2W91A 4PMXA 3M07A 1YHTA 1WZKA 5C8BB 1V0KA 2XVLA 4UQ9A 3WL1A 1Q6FA 2V3GA 3THDA 4TOQA 5BRQA 1HVQA 1H2JA 2VR4A 1KFWA 1CECA 1UA3A 2BVTA 3LPOA 3GNPA 3SIMA 4NRSA 3CHFA 3I3BA 1JIBA 3CLWA 2PF0A 1CXKA 2XIBA 2X0HA 4MPKA 1UD5A 3A6OA 4PTWA 1QHOA 1HKKA 1C92A 1MWOA 2EPNA 3CUJA 3RILA 3VD9A 2ZX6A 4ATDA 1G94A 5M5DA 3VINA 2V3FA 1X6LA 4BQ3A 2BHYA 3HJEA 3M46A 1TVNA 1ISWA 1E5NA 4CN6A 4P8XA 3VGFA 4U2YA 3UG3A 4URIA 2CXGA 1CXLA 5FL0A 1TA3B 1TFVA 1ZJAA 3QHMA 4UZUA 5DO8A 1WDQA 3RO8A 1OBAA 1OCQA 4D1JA 3MO4A 1PJ9A 2FH8A 4Q22A 4TX6A 3VD5A 3AMLA 1KQYA 3PZNA 5LYRA 1W1VA 3WDPP 1UWSA 5HNNA 4QLKA 1DWAM 1OGGA 5A6KA 2NT1A 4NI3A 1UKPA 1GOMA 2VL4A 1Q6EA 3W81A 2VZTA 1CGTA 2ZUNA 1KWGA 4PCTA 5CG0A 2X1IA 3VD4A 2CYGA 2JEPA 3VIGA 1MFVA 3TOPA 3IANA 1E6QM 4Y7EA 5I6SA 2ZX5A 3WN6A 1E3XA 4CUCA 2GVYA 3AJ7A 5BCAA 2J7HA 1H5VA 2O9TA 2E3ZA 1BSIA 5A8QA 3B8SA 4UQAA 3WNNA 1W2VA 3DYMA 4YPJA 4WKFA 1NP2A 4ZFMA 3RM9A 3NIYA 1HKIA 2QV4A 4V27A 1JZ7A 1EDQA 1JZ3A 2D0GA 3WF2A 5I24A 4W85A 2BY1A 1X6NA 3AIRA 4UNIA 1BYDA 1WZAA 5FL1A 3T2OA 3T2QA 1D3CA 3AS3A 1O6IA 1PBGA 1QNSA 2OLHA 4CCEA 5F7UA 3EYPA 5CSYA 1W3HA 2W63A 3UETA 4XUYA 1BQCA 1E6ZA 1E15A 4JHZA 1IV8A 5HDRA 1BFNA 3L4TA 3F4VA 4AZ5A 2FHBA 2QPSA 4ACZB 5FCZA 2RGLA 4NSBA 1ZJBA 3FAXA 1HP4A 2DPEA 2XVNA 4CVUA 1TG7A 3GBDA 2QMJA 2WBGA 1K6AA 1MQPA 1AQHA 2V3EA 3WDQA 2EBNA 4X9YA 1VB9A 4H8UA 3WY1A 1CPUA 2VZUA 4J28A 1JDDA 4J7RA 4BF7A 1H1NA 2DIEA 4P7NA 5A69A 2PC8A 1XCWA 3OB8A 3ZM8A 3WQ5A 2WMJA 4J3VA 2VX4A 1I1XA 4P8WA 5LA1A 3N1AA 2J62A 1JAEA 3K8MA 5GNYA 3UEQA 1HL9A 2YDSA 1ZBVA 4TXEA 1JFXA 1GJWA 4AD1A 1UZ4A 1E1FA 3KEHA 2VMFA 2CNCA 5ECUA 4LYPA 1W3LA 2J47A 4MNLA 3VPLA 5FD0A 3WH7A 2Y5EA 3WUFA 3WUGA 1JD7A 2DSZA 2WHJA 3VD3A 4AMCA 3PTQA 1UZ1A 4JIEA 2DT3A 2ESCA 1GOQA 4AZCB 3LMYA 2DQXA 1M53A 4R5EA 1CEOA 1VEMA 4PTVA 2HVMA 2WMFA 1KBKA 1MW3A 4H8HA 1EOMA 1J0ZA 1V3HA 3MV11 1LL4A 3EDDA 1H09A 1ZL1A 5M17A 4YN5A 4WKHA 1MXGA 3MMWA 4CD6A 4UTFA 1JNEA 4JHOA 4B3KA 3I3DA 2YDQA 3PZIA 2Y8KA 1KBBA 4LQ1A 2D22A 4Z2HA 4M81A 3VX0A 1UA7A 1DWHM 3MMUA 2WZIA 3TA9A 7A3HA 4NRRA 3VIOA 3WDJA 3VILA 3AHYA 1IZJA 3ZSTA 2D0HA 1J01A 5M3WA 2W61A 4HA4A 3U5YA 9CGTA 2WWCA 4W7UA 1FP9A 2YL6A 2XYLA 2GDUA 1UOKA 1VENA 1VEOA 3ARVA 2J7CA 3O9NA 5E6YA 1EIBA 4BCEA 3SUSA 4FK9A 1KXVA 4AWEA 1NARA 2CHOA 5BXPA 2WNWA 5DFAA 1UH2A 5IHSA 4NZCA 4KGLA 1FHLA 3SUVA 1QHPA 3O2LA 1JYWA 2DSWA 8A3HA 1XSKA 4TTUA 1JYVA 5A6BD 3F5JA 3TP4A 3U7VA 3GYCA 1JI2A 1OM0A 3W28A 2PBGA 4CN1A 2FDMA 2ZUTA 1B2YA 2ZOXA 1K9FA 1E4MM 2NSXA 2F8QA 4JFWA 4JCMA 3KL0A 2ZUMA 2VTFA 3BLKA 2WMHA 1UQYA 4JL1A 3IAQA 3RIKA 2WCGA 4DUVA 1GZJA 1RP8A 3ARUA 3HN3A 1BG9A 1UD6A 3VMOA 1LWJA 3VOCA 3WBEA 2J25A 1VAHA 3PZTA 1E6XM 3VIIA 3WUBA 3CZ8A 1GHRA 1J9YA 3CZJA 1PX8A 4W7WA 1S46A 4D72A 3WELA 2VCBA 1FA2A 2OYKA 3AMDA 2F61A 3THCA 4N42A 4WSJA 3SCPA 3A4XA 4U3CA 4UQCA 2XWEA 5JUVA 4EAMA 1KR0A 1W1PA 1QVBA 3AI0A 3AYRA 3GXMA 2DDXA 1AVAA 4IPLA 4PUEA 2J8FA 1EO5A 5CQ1A 4AZ7A 2YKKA 3WEZA 1XH2A 3VDCA 1I1WA 4AD0A 5HBFA 1ZBWA 1H11A 4QAWA 1XCXA 2MANA 4CN4A 2EPLX 1V03A 1RD6A 2XWDA 3POCA 2D0FA 5IDIA 4B3LA 3ZIZA 2XG9A 5E09A 5CPSA 1E55A 1J0YA 3GDBA 1FH9A 4AXNA 1J10A 1J18A 2J77A 4HTYA 5ABFA 2YLAA 4ATWA 4E8CA 1CLXA 1XC6A 2ZUUA 3IJ8A 3PTMA 3L2MA 1CNVA 3OZPA 3DHPA 4MTVA 2WVSA 1CDGA 2FHFA 3WD1A 3AS1A 3PZ9A 3AIWA 3WQ8A 4HZ8A 4DUXA 4UQBA 3K1DA 4UQDA 3VNZA 1PEZA 2VCAA 3NSMA 1XH1A 2BY2A 1HX0A 4P7QA 4DM2A 5I23A 4D6JA 1QBAA 4P8UA 1NWSA 4UFJA 1E43A 1ISVA 2BV9A 1WP6A 4DWSD 4UOJA 1ITCA 3SUWA 5A3HA 4M24A 5CPQA 1US2A 5BXSA 2D3LA 5D9NA 2DEPA 3VGDA 1C8YA 1FH7A 5E0FA 1EQCA 1IZKA 4E4PA 1MXDA 1EO7A 3FHAA 1EXPA 5JBDA 3AS2A 3VDAA 3KZSA 1VFOA 2GSJA 2ZXDA 2X0YA 4CU6A 3WMBA 5KZ6A 1JGIA 1W91A 1U2YA 1HN1A 1OB0A 1V3JA 4WSKA 4M8UA 3L4VA 4ACYA 1US3A 4GO8A 1R85A 3GTNA 4WIWA 3WF4A 1UHVA 3CBWA 2GUYA 3WNPA 4KRTA 1UUQA 4W8BA 3SCWA 4GI6A 3SUUA 2VRQA 4UOQA 1ZU8A 1CLVA 2WVVB 1FP8A 1E72M 2OWXA 3WF3A 2VRKA 3OLGA 4CKQA 1BVNP 2ZE0A 1DWIM 2DGAA 2J7EA 4JZ5A 4YHGA 3MU7A 3ARQA 1JDCA 4GI8A 5JIWA 1E1EA 1QI4A 2EQDA 2FHCA 1HJVA 4TX8A 2WXDM 4W86A 2WCAA 1UWIA
chains in the Genus database with same CATH superfamily
4LY8A 4XIAA 3AROA 2Q3OA 2GGGA 3P8JA 3EX3A 1KR1A 4UFMA 3FOKA 3XIMA 1UZDA 1VFUA 3VAVA 3ABOA 4XAFA 4HK5A 2FFCA 1KLZA 1IWBA 3KCLA 2BVWA 1ZCOA 2XFFA 1ALDA 2C71A 2QMKA 3P2VA 4N2YA 3ECQA 5L6UA 3VE9A 1B4KA 4IIEA 3W6LA 2VFGA 3GFZA 4ZB0A 3N3MA 3EWYA 1Z9AA 1LOSA 2DZBA 2ZX7A 2GZXA 5C54A 1GVIA 1VZWA 4KS0A 2VR5A 5I03A 3GTXA 3QF0A 4TX9A 3S6OA 3DGBA 1UWRA 3RR1A 3TYCA 5K4ZA 1ISXA 4EWJA 4AMAA 2PA6A 1JRCA 2HXTA 1KXQA 3PZGA 3ZJ6A 1QK2A 5I78A 2VDHA 4JN6A 2C14A 1AUSL 2QCEA 1W6TA 5F4XA 4M82A 5EGRA 1SZEA 2FB3A 4F0KA 1KGWA 5BROA 3M9YA 4J3UA 3BE7A 3E2VA 5E93A 4EACA 4J40A 2G5WA 4ZB5A 1GQKA 2ACUA 4JR5A 1W9XA 3FA3A 3IUHA 3TYAA 3TH6A 4D6CA 2DVXA 3ES7A 4GY1A 1GPWA 4BQ2A 5DCDA 3WQ4A 1W9PA 4JAWA 2NUXA 1YDYA 2OSXA 2ZIDA 4H1ZA 4A3UA 2XFRA 4MKVA 3DAQA 5EMLA 1GQNA 1E4LA 1E56A 3MY9A 3SCQA 1ONXA 2QUMA 3VIJA 3CC1A 3CQIA 2O92A 3S47A 1H7NA 3G1FA 1LWHA 3LHZA 1RLDA 2AGKA 2G3FA 5CC3A 5CGQA 2VELA 3MI6A 4YMZA 5AHNA 3II1A 4ALDA 5I3JA 4R27A 4GYPA 3HG5A 2NVDA 5AZ0A 1WXJA 3W26A 4GJJA 4MNJA 1SR0A 5DLCA 3KLKA 3T08A 4PL2A 3K8LA 4F9JA 1XGEA 3LX9A 2XSBA 1WNOA 2WKGA 1GQLA 3FX4A 2H9AA 2PDNA 4KWUA 1H62A 4IQEA 4WRHA 3OZMA 2C91A 4JIQA 3VO0A 1W8SA 5F4SA 2PDUA 3W7DA 4HYWA 3P5ZA 1RCOB 4ECLA 2G97A 5G2WA 3L9CA 3GKFA 3WDIA 4AF0B 1Z7AA 3OPSA 2PDIA 1X1ZA 1LOQA 1P5BA 5AYIA 4LYKA 3NAVA 4GUGA 4RDYA 1K4HA 1XFBA 4QEEA 4PCNA 5U4NA 3ISIX 1SQ7A 4PTNA 3IUIA 3QV7A 1TIMA 4IMEA 3UD6A 3MWAA 2HE8A 2VX7A 3FLUA 1UYQA 3KVKA 4ZFCA 3VNLA 1DWGM 1V02A 1BF2A 3N9KA 4UTHA 4P5UA 4MGGA 4NX0A 1E71M 3AMGA 4Q8QA 3KE0A 4HKPA 3S5OA 4ZOEA 1PKYA 5D02A 4OECA 2WJZA 4S38A 3UERA 4KRUA 2BNJA 1OCNA 3AC0A 1XRFA 4FIQA 4LXFA 2QJHA 4GBUA 2G3NA 4LVGA 4D1IA 1AG1O 2HRWA 4AG0A 4B16A 1K9TA 4IG2A 4J5NA 4I6KA 1VH7A 5T9BG 5GPRA 3FK4A 5D04C 2R8WA 2QUNA 2GQ8A 4YTUA 1TWDA 4JTQA 4HNOA 5TF0A 1Q7MA 1IF2A 2ZZ2A 3QLLA 4HZ6A 4IMFA 4K8GA 1EDGA 4JIHA 1NDVA 1XLFA 4LJ3A 3G1VA 3NUKA 2WO5A 3OVPA 3DI1A 1CI1A 2IXVA 3R2GA 3VE7A 5E6ZA 1PKLA 5AC5A 3BGAA 1VBHA 3HGRA 3GNNA 1HUVA 1YXCA 4X60A 5KSWA 1UUMA 3KVMA 4JFTA 3SZ8A 1G5AA 2WHLA 3I68A 4ZQNA 4Y90A 1MQQA 2G3IA 3CV2A 3F5LA 4MSSA 3VD7A 1IXQA 3VM5A 1P4CA 1ESWA 3VOJA 4DM1A 3HPZA 3R7MA 3PTKA 1G4SA 3B8UA 4QCFA 3BICA 4MNKA 4Q8WA 2GFTA 3C8FA 1UR1A 2EG7A 4H9UA 5CC6A 1EBGA 3TMQA 3WZ0E 4AD5A 8RUCA 1O66A 3S1WA 1G9HA 2ATSA 4RUBA 3DENA 4FAMA 1KNWA 1ZQ5A 2VENA 5FKYA 2GJRA 2VO5A 3MUY1 1PIFA 4JL2A 1XYFA 4JHMA 3AXIA 1TR1A 1WXZA 5B80A 2YDRA 3T0BA 3OZOA 3ITLA 1RJQA 2UY5A 3LB0A 3EDJA 3PM6A 3CZLA 3DYPA 5DCEA 5EU9A 4BHYA 2BG5A 4F0SA 1HNYA 1B31A 1UWQA 3UCCA 3H2NA 3UWEA 1JYNA 3RM8A 2W62A 4AZCA 4CLMA 1V7AA 1J6PA 2V9DA 1S38A 2B81A 2H3BA 3D3AA 4S3FA 3LCXA 3KOWA 2DW6A 3FJLA 2Z29A 2BP1A 1G6CA 1S2AA 1HIZA 1YTDA 3HOJA 3APYA 4H6RA 1F4HA 3C2RA 1J6OA 2XH0A 1YIXA 1V6XA 1G67A 4DYKA 2E7FA 1M03A 1LZOA 1RBAA 3UJRA 4PMRA 3E0IA 1O5RA 2UY3A 3IVTA 2JIWA 3KTXA 1TV5A 3TR9A 4G7FA 4C1KA 4HSHA 4N4QA 6XIMA 2PLMA 4GGBA 4AZ6A 1ITXA 5DY2A 1JQXA 1X7IA 3W70A 2JKEA 3UJ2A 2YCKX 2GDVA 4OU1A 1NELA 4XZBA 3QQWA 4H2HA 1L2QA 5C9RA 2BOEX 3LLDA 3TZFA 3VOGA 3URNA 2IS7A 3T55A 1EC9A 3NTYA 3RAOA 3JZUA 3V18A 2WVTA 5DBUA 2CW6A 4R34A 3FAWA 5M2FX 4B15A 3SGGA 1O5XA 4H9MA 1O5QA 3ZT5A 2XH4A 5BYWA 1GEHA 2W67A 3T0TA 1HP5A 3KS6A 3H4GA 5KZMA 4IIGA 1QI5A 5B7YA 4CCZA 2PC4A 3STPA 5D2XA 4JTKA 1BLIA 1XKYA 2ZE3A 3H22A 1F7BA 1FWGC 1P6WA 5C71A 2W0UA 1OFAA 4FZIA 2BVYA 3WUEA 2E9LA 4LALA 2CFFA 2XTKA 5HWJA 2DZUA 2J6VA 1Q3NA 3T6CA 4MB3A 1JUEA 1JDFA 1LP6A 5HXMA 1E9LA 1NDYA 1OX5A 5B7ZA 4FLQA 4H01A 4QLJA 4ILSA 3C2OA 2J79A 1OC7A 2H9AB 2XVPA 1J93A 4HB7A 1R3SA 1W5OA 2R9RA 3WH6A 4S3GA 2ZXQA 4RPQA 5IBXC 3E5PA 1AJ0A 3QN3A 3TFXA 3WD2A 3I6EA 4CQAA 3CYJA 1OVDA 1VYPX 1AJ2A 1DJNA 3N6JA 5FAJA 3WH9A 4NNBA 3WFAA 4N6FA 1VIWA 1EL3A 1HKMA 1EHNA 3FNDA 1R38A 1W3TA 4AWUA 3VKBA 3QR3A 3HJZA 5H8UA 2YSWA 1OK4A 3CV1A 1O7AA 4A05A 4AY7A 3NQDA 1PKMA 1M1BA 1QOPA 3AFBA 4GX9A 1J0JA 3T0AA 1UOZA 1OF8A 3W02A 3W7NA 3EB2A 3M0YA 4Y9PA 1QBBA 1CB7B 1LL7A 3BMXA 2WPGA 4WXYA 3FA5A 1GWJA 4NHVA 4DUWA 4I5XA 1IT8A 2XIIA 1XBYA 3LCGA 2O55A 3RLVA 4NZ4A 1CYGA 2J75A 4I9MA 3UPWA 2QDDA 2ZVIA 2OSYA 3WLSA 5CAKA 1BHGA 2D23A 1EUAA 2EPHA 2ALDA 4UR9A 4BI5A 4W93A 3KVJA 4MWAC 2YXGA 4HP5A 2Q3RA 5C5YA 3M7SA 4NILA 1WE5A 4JTSA 3ZR4A 3IGUA 3IGSA 4IMAA 4O1FA 4PBGA 4A3QA 1HJSA 2A3HA 1V3KA 4DBDA 2ZA1A 1UD2A 3SO7A 3AHTA 4RE2A 3M0ZA 3OODA 4CNPA 2VFHA 2P3ZA 3VM7A 4H4IA 4IG2B 4NJHA 2QZRA 4B92A 1HGYA 1O95A 3OLDA 5DMNA 3M6DA 1KXHA 3AO0A 2Z25A 4U3AA 3TW6A 1JZ2A 3RPMA 3ZO9A 3P8IA 2X30A 3EX6A 3HQNA 4ZO8A 2WVVA 2C8NA 3TYDA 1W9BM 3W7MA 5HWNA 2ZX8A 3NZPA 3CMGA 2PWDA 1JL8A 4PA8A 3D46A 5CLWA 2FMNA 5KITA 5A95A 1TO3A 1UP0A 3UGRA 1XIMA 4Y6GA 3P14A 3N2TA 4QX4A 5H8MA 1JYXA 3TTSA 3QV9A 1TWZA 5FA5A 1E51A 4U10A 2W92A 3R8GA 1ZGDA 3CIXA 6TIMA 5HATA 4HNNA 3R6IA 1WDRA 2V2HA 1B54A 4ZOBA 1H0GA 1WAUA 1J11A 3PSVA 4Z2IA 1WX0A 5D9OA 2W27A 2C15A 3T1GA 2WK2A 3EMQA 2CZVA 2PRHA 7REQB 1E0XA 4XZMX 1BTCA 2OWCA 4KKXA 4LVBA 1W1TA 3UWUA 1ECEA 4GQQA 1EUNA 3MUCA 4TVCA 3WQCA 1W37A 1U30A 3D3FA 3QC3A 4AX7A 4OWGA 4ZQMA 4IPJA 3PAJA 4PULA 3P0XA 1SZRA 1WXYA 1S1RA 3DKLA 2NV9A 1TCMA 3G8RA 1FCBA 2AOSA 1CGVA 1H3GA 3WEOA 3NQVA 3ZT6A 4R53A 1IT0A 3REQA 1JPDX 2WZHA 3OA3A 4G7EA 1FHUA 2Z6IA 4KCTA 4HU3A 4C6MA 5FIPA 2BS9A 4W7VA 1CIUA 1GUVA 3TQ0A 1PYMA 1B0IA 1JCJA 1PYFA 4HPHA 3JU2A 1WBJA 2DIKA 3BANA 1P7TB 2BTMA 4D8AA 3RF9A 3GDKA 1KLYA 2DH2A 3BAJA 3RM4A 3QMSA 2VUNA 1RP9A 1PXGA 4Z2LA 1C8VA 3F5KA 5AHIA 4K8EA 3PZMA 3TCSA 4TMCA 4ZXLA 1PUDA 1DPMA 1B5TA 4IUGA 1OYAA 2HS6A 3ARTA 3G6LA 4OVXA 3OBAA 3I6TA 4YTQA 1W31A 3B0UX 2P1FA 3G1AA 1EB3A 5KMYA 1XIHA 4QM1A 1VBGA 1XIIA 2WBKA 4ZSTA 1SFLA 4NY2A 3ZJ8A 5A6BA 1M68A 1BPLB 5EA9A 1JCMP 3HPSA 8XIAA 1JPKA 2O4QA 3WLNA 4FMVA 3UESA 3ZJKA 3GR4A 1Y7VA 1RSCA 3PF3A 1WAWA 4XD4A 3UXKA 4ZGYA 1VFSA 1LT7A 4L4PA 1OC6A 1X6UA 1TX0A 4GKLA 4P7OA 2NLIA 1C7TA 2C6QA 2I57A 1TYGA 1XLLA 3C2YA 1QPRA 3E0LA 2BWGA 1QHZA 1TJ1A 2JGQA 1M3UA 4WY0A 3PJTA 1XW8A 3U0HA 3L4ZA 3GSMA 3B0YA 1DEDA 1QCWA 3UG8A 1CX9A 1FWFC 1RK6A 2JEQA 3GH7A 2J6XA 1FWHC 1C93A 4LEFA 2ZICA 4LYRA 4MADA 1NP0A 1TTIA 1UH4A 2Y7GA 5C2GA 1BF6A 3FY1A 1FXQA 3W01A 3B97A 1HJXA 5F1UA 3XISA 4HCLA 4MWAA 3VABA 2X1TA 4N9DA 3EDFA 1V8EA 3CYVA 1ZBKA 4XISA 1GVEA 2HROA 2YBVA 7CGTA 2PBOA 4GH3A 4PUDA 1UPMB 3IGHX 3LRKA 1KW1A 3F03K 4IX2A 5F1VA 2FYMA 3MUAA 3LUTA 3QQ1A 4PB5A 3GDRA 3EWWA 2IXUA 2E8ZA 5K9CA 4H9TA 3NDZA 3P60A 3TNOA 3PUGA 4HMNA 4CCDA 4Z1DA 5T8GA 1TPEA 5A8PA 1JI1A 2D69A 1AFSA 2C1IA 2QR6A 4HHMA 1OFQA 3MMDA 2D2OA 4B5VA 4LS0A 1M7JA 3IRSA 3KBVA 1XLCA 1DJWA 2VURA 3E96A 3L4UA 4XTIA 1KQZA 4OT7A 4W5UA 3N2BA 4IH3A 1NVMA 2WNNA 3DG6A 4I9AA 3E02A 3IJIA 1O60A 1YTKA 3UY7A 3GC2A 4W9TA 3A4AA 3FN9A 5G2IA 4AAJA 2W4XA 3L4WA 3WQOA 3CHEA 3PJUA 1KRBC 1FQ0A 5CJ5A 4HJFA 4C7DA 1Z41A 3NQCA 3VOIA 1UBPC 1EQPA 3LBOA 3MC5A 1B57A 4CEXC 2YB4A 1RV8A 3KL3A 4HU4A 1ZP4A 1O68A 3GNRA 1WDSA 4D6FA 1CXIA 5J04A 1ICPA 1UC5A 1OINA 1QK0A 1G4PA 5CZJA 2Z00A 3VIMA 1JZ5A 2XGIA 3M0HA 1OZMA 4DRSA 2PFHA 1UKSA 3CNYA 1RR2A 1Q6LA 1XICA 2C0AA 3IIZA 4HYRA 4E2BA 1C3FA 2YLLA 4XD5A 4EOUA 1X38A 3LXCA 1P1MA 5BNKA 4HSNA 1Q2RA 3ITVA 1NFGA 3LNMA 5T91A 1KM1A 3HTWA 3PBGA 2HSAA 1VF8A 1XUZA 3MCMA 4FLSA 5AB3A 2V3DA 3GH5A 1IR2A 3NQGA 3JW7A 5BMWA 3P82A 4F0LA 4I8DA 1WDWA 4RNJA 3J7HA 3P62A 4QITA 4G56A 2EPKX 5LIUX 1VHNA 4MF4A 3C4UA 1EH9A 1XIFA 4OOUA 1S39A 2PGWA 1PTDA 1VGAA 4L56A 4KMQA 4WVXA 3DECA 1ISYA 4YL2A 3S1VA 4O4WA 4HN8A 3DGRA 2RGMA 4JNZA 4PMXA 3UZWA 3M07A 3LM7A 4JEQA 2GSEA 5C8BB 2XVLA 4PFHA 3MI2A 4Y9AA 4IQLA 1Q6FA 4TOQA 4I7VA 1HVQA 1H2JA 1KFWA 3BARA 3R43A 5I06A 4YLWA 3U3HA 1JIBA 2PF0A 5FSDC 4M51A 4MPKA 3GAYA 2TYSA 4A8LA 3WX7A 1HO1A 3BW4A 1EJRC 2XISA 5LHEA 2D2JA 1LUCA 2CZ5A 3CUJA 4JTFA 2DQWA 4K6AA 4CQ9A 4YTRA 4UTWC 4LUJA 1R47A 1U1HA 5M5DA 4AHPA 3TSDA 5KTLA 3ZFHA 3HJEA 4PMJA 1ISWA 3EXTA 3H7UA 4U2YA 1EF2A 4JYEA 3REQB 4E8GA 1EP3A 3QHMA 1GTHA 1WDQA 3RO8A 3FVMA 3NYZA 2GQ9A 3CT7A 3FKRA 1OBAA 2XDFA 4C6IA 2FTPA 4LS1A 4DYJA 3MO4A 3N19B 4PCFA 1PJ9A 2FH8A 4TX6A 3DCPA 1SJCA 3G1DA 2OZTA 3WDPP 3PZNA 5EBUA 2L5HA 1UWSA 3T78A 2Y70A 4GUFA 2X1RA 1Q6EA 4XSLA 1KWGA 4KEZA 4X3ZA 5J5RA 3H7VA 2X1IA 3Q37A 3TOPA 3ZVHB 3IANA 3WN6A 3AJ7A 1XYLA 1H5VA 2Y61A 3PPCA 3B8SA 4DPPA 3WNNA 3DYMA 3KCOA 3IIXA 1NP2A 2FJUB 4ZFMA 4K37A 1HKIA 1FHVA 1JZ7A 1JZ3A 2PDGA 4LU0A 4S39A 3H2OA 4W85A 3AIRA 1JPIA 5HUOA 4UNIA 1WZAA 3AS3A 1X1OA 1Q8AA 3RLHA 3EYPA 1Q6RA 1CLKA 1TZZA 3CWNA 1M5WA 2W63A 4LNCA 3R8HA 4Z1AA 2B7QA 1BFNA 4HSOA 3L4TA 2VDIA 2WJDA 3M5YA 2QPSA 2J9XA 2QJIA 2RGLA 4NSBA 1U5VA 4UR7A 5AYZA 1HP4A 4ZSUA 2IPWA 2GUUA 3SBFA 3GBDA 4XZLX 3AJXA 1AQHA 3BLLA 1PB0A 2PZ0A 2R82A 2EBNA 2RH9A 3TN5A 1VB9A 4WY0B 3S1GA 3M0LA 2VZUA 3DFNA 5BWAA 4DJFD 1SFTA 3RU6A 4BF7A 1H1NA 2VWTA 5A69A 3OB8A 4J3VA 1LCOA 2VX4A 1I1XA 4P8WA 1OFOA 5IRPA 5GNYA 9RUBA 1XQKA 2YDSA 1ZBVA 4TXEA 1GJWA 1UZ4A 2CNCA 4BR1A 1W3LA 5G1TA 2YW4A 4PBFA 4O13A 5FD0A 3NNTA 4QE5A 1EC7A 2XZ7A 3MZ2A 4AC7C 3FJ6A 3WUGA 3UGVA 1V51A 1OFBA 3LHUA 3HB9A 4JTGA 4GYFA 3F1QA 3QZAA 2DT3A 3KW3A 3LU2A 2ESCA 3C2FA 3LMYA 2DQXA 3R8RA 1VEMA 4Z0JA 3EWBX 1XX1A 4PTVA 2HVMA 1EOMA 1EFZA 4XKMA 4XKYB 3M16A 1F74A 1ENUA 4N7QA 5FJPA 2Z1VA 4E0CA 1ZL1A 5M17A 1RLCL 3W86A 4L61A 1MXGA 1FBAA 5XINA 4Z0SA 3GVGA 2IPFA 1DYSA 4B3KA 2Q02A 3I3DA 3R0UA 3PZIA 2MUCA 5AN7A 3EA2A 4YTTA 3ERPA 2FIQA 5HQEA 3HPFA 2R1MA 4PUJA 1I0BA 2WZIA 3TA9A 3BLOA 4NRRA 5GVJA 3ZVIA 2NX1A 3MP3A 5JVLA 1XBVA 3U5YA 3O7UA 4GC3A 3DG7A 1A80A 4W7UA 4S3CA 3LCFA 1H50A 4JY9A 4C6BA 5XIMA 1XYMA 1K02A 5FESA 4GIYA 2FMOA 2VDGA 2HEJA 4HVXA 1NARA 2CHOA 5BXPA 1MUCA 1FX6A 5IHSA 4NZCA 4KGLA 4KWOA 3SUVA 2NZLA 1R3QA 1MI3A 1XSKA 2ICSA 1SSGA 4ERAA 1JYVA 3CAKA 2PU1A 5LNUA 1OM0A 2OQLA 3FJNA 1MDLA 2ZUTA 1B2YA 3VUSA 5JU6A 4KEMA 4HK6A 2WJFA 4JCMA 3B40A 4ORIA 5G2HA 2VTFA 2PLKA 4ZOCA 3RIKA 2WCGA 1R6WA 3HPAA 3A13A 1B3OA 4S3DA 2TPSA 2OG9A 2WOQA 3C2VA 1E6XM 3Q67A 3CZ8A 1GHRA 3CZJA 1VRDA 1KM3A 2F6KA 1PX8A 3BDKA 3KBNA 4W7WA 4R85A 3GC5A 2VCBA 2Z2AA 5KINA 1LBMA 4KEVA 5C2CA 3W2MA 3AMDA 5FF7A 2ZDRA 4N42A 4WSJA 2GSHA 3SCPA 4UQCA 1WKEA 3W72A 1T96A 3KVLA 1KC7A 1P48A 2V67A 4C6EA 3MKVA 2R94A 1RUSA 3AI0A 2FTYA 4IPLA 3K4WA 2J8FA 4UCGA 5CQ1A 1OFRA 1XH2A 3AXKA 3WEZA 3FSTA 1H11A 4QAWA 3WJWA 4KIEA 2XWDA 3S2LA 3POCA 2D0FA 4C1NB 1R30A 5E09A 4MFDA 3GDBA 1FH9A 2BGSA 2O0TA 4HTYA 5ABFA 2FTWA 2YLAA 4E8CA 2BASA 3O05A 4M6QA 1UJQA 1XC6A 2A4AA 3IJ8A 1BSLA 1R0MA 4AVNA 2QQ6A 2ZQ0A 4QE4A 1XG3A 4MTVA 3GVVA 4C6CA 3UVAA 2WVSA 3NO1A 4MLRA 5RUBA 3PZ9A 3WQ8A 1IXNA 3QMRA 3TW7A 4UQBA 3CQKA 3FXGA 1PEZA 1NFBA 2NXIA 1XH1A 1HX0A 4P7QA 4DM2A 2HPIA 2PRLA 2D2HA 1K77A 2PGRA 4P8UA 4UFJA 1K6WA 3H2AA 1ISVA 2DW7A 3HG2A 4IL0A 3EKZA 4UOJA 3SUWA 3MHGA 1SU5A 3NO3A 3SQSA 3WCZA 4ZMGA 2DEPA 1QPOA 3IWPA 1IZKA 3I7RA 3PY2A 4LANA 3LRMA 3KZSA 1VFOA 4OUIA 4DBSA 4Q4PA 2X0YA 5KZ6A 1QWGA 1HN1A 1TB3A 4NAEA 1VBJA 2EHHA 3WF4A 1LOLA 1I2RA 1ZZMA 3UPMA 4UBPC 4W8BA 1MMFA 8TIMA 3BG9A 4R7WA 1YADA 1JR1A 1TWIA 1CLVA 1BVNP 1J8VA 4ERIA 2VGFA 2H8XA 1PIIA 1U1JA 2ZADA 4Q33A 1RZMA 3MU7A 4JS3A 4QAIA 1E1EA 1ICQA 2EQDA 2FHCA 4RLIA 5I3IA 1RVGA 2HVNA 2Y89A 4LAUA 1R3WA 1UWIA 3M47A 4EIVA 1ZRQA 5EFFA 2JKAA 2J74A 3ZLGA 1WDDA 2IUZA 4PYSA 3NZ1A 1ZNNA 4S2CA 3TC6A 3GC4A 1BYCA 3ID7A 4UTJA 4XK2A 3QPEA 2V5DA 1HW6A 5DXXA 1W1YA 1LQAA 5G1YA 3SFKA 3DH7A 1GVFA 4FLOA 3QSRA 4OZOA 1AL8A 3ITTA 3LN3A 3WENA 3WBAA 4IICA 5G5IA 1QAPA 4CD7A 1U83A 2A3AA 4AUBA 2QXWA 3BC9A 1IGWA 3I4EA 1OG0A 1YPIA 3VKKA 4PCSA 3MV01 3IIPA 3GW0A 2GL5A 3LDVA 2CERA 2WWDA 4G5DA 3OJGA 4OUEA 4Z1BA 1NEYA 3HGOA 1W9VA 2Q8XA 2PODA 5PTDA 3D0CA 3B9EA 1JEZA 4C6QA 1P0EA 4NASA 4X9SA 4UQEA 4OE7A 1QNOA 2CZFA 2ZUVA 2PLCA 1OX6A 2DT2A 3MCNA 1OD8A 4A3HA 2QEZA 4XAYA 3MUZ1 1T5AA 2HK1A 1ISZA 2NUYA 2GVLA 3IJDA 3ELFA 3UBPC 4AW7A 3P3BA 4QE1A 1OCJA 1M7XA 1R9ZA 3VNDA 4JFUA 1T0OA 1JG9A 2WCSA 2YL5A 2CBIA 1WZMA 1WUFA 2CCRA 3RHGA 4DIAA 2PDPA 3B0XA 1XDLA 5CC7A 4O17A 3EB4A 2Z1XA 1QPKA 2G3MA 3FYPA 4D6EA 1GKQA 3NURA 1FKWA 3W7PA 2EJ1A 4PMNA 4E4UA 4Z42C 1B9BA 3LGEA 1F6KA 4X0VA 1QXLA 3W7IA 4B2DD 1RA0A 4Z1YA 2WB5A 1E4NA 4MJ4A 4W5ZA 4FP1A 2CHNA 3PAOA 3O16A 1TJPA 3CTLA 5TQLA 2I16A 3PBVA 1QTWA 3BOFA 4GD0A 1EPXA 2X09A 5G4EA 1UWAA 3S42A 4H9VA 5GNZA 3LPGA 4DWSC 4LT9A 3MZNA 4FNRA 2XH2A 2OZ3A 1JJKA 1F5ZA 3WMCA 2FGLA 2Y2WA 1HFBA 2XFWA 1J96A 3O6AA 5K3VA 3CWOX 1X96A 4HGXA 3H6OA 2OTDA 3B0VC 2PP1A 1N2VA 2PWFA 2PMQA 1FWRA 1HJUA 4U33A 3A3HA 1FHDA 4C6JA 3CAVA 1K9DA 4MOZA 5LA2A 3GG0A 4IT1A 3KUMA 3TTYA 1DE5A 2QCDA 3ARXA 1I8JA 1AMKA 4O12A 5CJNA 2Z1KA 1VP5A 1JGMA 3DI0A 2RDXA 4LAOA 1W3KA 3OO2A 2X40A 2YA0A 5DBTA 4Z2KA 5GJMA 1LG1A 3T2PA 2VVNA 3S6TA 4CU7A 3UJEA 3IAPA 3HM7A 2ATMA 4O53A 3NQ2A 1NF0A 3GXPA 3VIFA 3G3MA 4Q4KA 3WBXA 4B90A 2J7DA 8XIMA 4GLEA 3T0DA 3QR1A 3DG3A 1Q7QA 2DJLA 4UFKA 3W25A 1V6TA 3H21A 3WFZA 2QPXA 3QHNA 2ADAA 5A8MA 5ABFB 3W53A 1DTUA 1PSCA 4X61A 2HZGA 3OLEA 3HU7A 3DU0A 3SRDA 4JTJA 3WFLA 1XBXA 1G4TA 2XU2A 1H7XA 3WNOA 1E0TA 3R0DA 1H41A 2W79A 3VIHA 3AYVA 1RBLA 5DRCA 4X2PA 2NXHA 4PB4A 5HJYA 3LSBA 1NQ6A 4QBXA 1BRLA 3IVUA 2QDEA 2OR2A 2PDCA 5HPCA 4S3BA 4W8AA 1VFFA 3THAA 1FKXA 1L0PA 4TR9A 3PTDA 2RDUA 3C0JA 5E0CA 1HZYA 3M43A 1TMQA 2CESA 1F3WA 2NT0A 2O56A 2G95A 3W00A 3LV6A 3MT1A 1YTEA 1S1PA 1GQJA 3L4XA 4GIRA 2HVOA 1RHCA 4US5D 3UZJA 1F73A 3LZ5A 1MEHA 4NAEB 2Z28A 3C5QA 4U2ZA 4AEEA 4XB3A 4LBUA 2VUYA 2TSYA 2PUZA 3FXYA 1XR2A 4JTDA 1GYMA 1PE1A 3IJ7A 3IV3A 3FIGA 4PTDA 3BAXA 3HURA 3WBYA 3H2EA 4KT2A 4M19A 4PUKA 4AU0A 1SJAA 4N6EA 4WLCA 1SVDA 4GXPA 3TLLA 2GQ3A 2D20A 1MRQA 2EXOA 5A6MA 4Q7NA 3W7QA 4EANA 1KM4A 1XFCA 4AZIA 4AIBA 1L6YA 2E6YA 2Y5SA 5DT7A 4JQ1A 1FOBA 1IEWA 3GQYA 5AC4A 1HXJA 4HA1A 1H5YA 1ZAJA 3COTA 3WD4A 2YBUA 4JTTA 3C56A 3BLFA 1ADOA 1MFUA 4PTXA 1Q4WA 4IJRA 3XINA 1KFJA 4AVOA 3WLQA 3GG1A 1V4YA 1P1XA 4KH2A 4E2VA 1EZ2A 1WUEA 2OEKA 1TE1A 1TREA 2AQWA 4J3TA 1BXNA 1QI3A 2YGYA 3CQHA 4WXZA 5AYBA 1A4MA 1A5OC 4PUMA 1WQ5A 4KGJA 3TXZA 3VDBA 2YCLA 1RCQA 4H2CA 4S3KA 2QNEA 4L1XA 2TMDA 4R7OA 3T07A 4A3YA 2C0HA 1E1CA 3T09A 4DJDC 3GIQA 4K3ZA 3ALFA 5G1MA 5EBAA 2HE5A 3VA8A 2QCLA 5E1QA 3WDHA 4DBWA 4D6DA 2Z6JA 2HBVA 1ZALA 1S5VA 4F48A 1ME9A 3ZLFA 4B9YA 4LUTB 3HGJA 5C6MA 3BG5A 2GGJA 4U5KA 4YU1A 5E9XA 2X0SA 2Y1HA 2F38A 3FW6A 4PSPA 3NGFA 4AY1A 2R14A 4KRZA 1GW1A 5EFDA 4XD6A 2QHAA 2P0IA 1DIKA 1VJSA 3WJYA 3UJSA 1K7EA 8CGTA 5CPNA 1XGZA 1UP2A 2V5LA 4WK9A 2NQ5A 3SI9A 2A2IA 3AISA 3DFHA 1UROA 3VFLA 2D1ZA 2WLZA 4RNFA 2D3NA 3PZVA 1XF0A 5TD4A 3OEXA 3PPGA 1EP1A 4MY1A 2GYIA 4XUGA 1R7OA 1LRQA 2YL9A 3U2ZA 4OHQA 4MUZA 1EYWA 2PDYA 5D2WA 3LYEA 4Y9OA 3TUUA 4HOXA 1MDRA 1C8QA 3EA1A 1UD4A 4OV9A 3BCDA 1JPHA 1CZ1A 1MW1A 6REQA 1F4AA 3AXXA 2Z4GA 5EMJA 3M0MA 1XINA 3WQWA 5JQ9A 2Z0IA 3I7QA 3BAYA 3ABZA 4GBDA 2CKRA 4H00A 2NX3A 3OGVA 1GJPA 3RUBL 1XYZA 3SY5A 5EKYA 4BFAA 2ISFA 4B4HA 1JCYA 1R3RA 4ML4A 3CZKA 3C3NA 2WANA 3QBUA 2OEMA 5HAOA 1YXDA 3GE7A 3MO7A 3WQEA 4BWLA 2ODOA 3M0IA 1FDJA 1LWIA 5CG7A 1IGSA 1TV2A 3LXBA 4CQBA 5AECA 1UR2A 1Z69A 2X1SA 3W6YA 3BW3A 3EX2A 3S5YA 3NL6A 1XHGA 4TUFA 2OLSA 1T8XA 2WSPA 4B5TA 2QCDB 5J5DA 1ZSXA 3VNJA 5MF5A 2PTYA 2AL2A 3TEVA 5BW6A 1OGSA 1M04A 5DRIA 2GOKA 3OYZA 1XH0A 2I9EA 1EEXA 5F2GA 1G0CA 5H2ZA 1S5TA 3W84A 3GHSA 5E5CA 3N13A 4EE9A 1W8GA 1NM9A 4Q8MA 1YNQA 2H6RA 3I7SA 5A1AA 4BI6A 5HMFA 1W9DM 1O12A 3PUEA 3EMCA 4EP8C 5CBJA 4A3RA 3NWRA 3M64A 1IYXA 4NZ1A 4QJ1A 3HA1A 3CL7A 3C0QA 4K1GA 3RDKA 2J9YA 3ZR6A 2BY0A 2G37A 3ANVA 1REQA 4NP7A 5ENLA 4Z2GA 3UZZA 3GU1A 3OBEA 4FX8A 4HHLA 4Z08A 2CBVA 2O7SA 4G9PA 2ZZ6A 1XV8A 4HMDA 3L5AA 2VCCA 2HNEA 2ZUSA 1OSEA 4IIFA 3VDGA 2HV5A 1JF5A 3UG4A 1VJIA 1GQIA 1NU5A 1AD4A 1XDMA 2NUWA 2G41A 1UP3A 2CITA 2F2HA 4M1RA 1GVQA 2P10A 3CH9A 3SCNA 3WK0A 2VZSA 3W1NA 2E40A 2VI0A 3U5UA 1OQFA 2FPTA 3FGCB 4IGMA 6CGTA 2EPMX 4PN2A 3S2JA 3AQUA 1Q6GA 3QRHA 5H6HA 5BU6A 4DJEC 3VZYA 5BRBA 3PFRA 3NOEA 4LB4A 2WV8A 3BLIA 4RDZA 4QDMA 3W83A 4I7WA 1EJWC 4FSAA 4JQ3A 3OBKA 3G0XA 4FR1A 3P84A 4XQ6A 1TR9A 4GMEA 4HYVA 5FOOA 1PPIA 3IS4A 2GVGA 4DJFA 3NPWA 3KOFA 3KS5A 4DZHA 4O4VA 2J13A 3LGGA 4GINA 2IQDA 3MYOA 2B7OA 3D5HA 1XIGA 5CJMA 1YW1A 1GONA 3IJQA 3KP0A 3CV6A 3C0SA 1D9EA 4J2MA 3LLFA 3KM8A 3RN6A 3T7VA 3JRKA 3V5CA 2X8RA 4D71A 3ARRA 1A5LC 4UXDA 2ZUWA 3MBDA 2QCGA 1H60A 4L9YA 2EGZA 4HBKA 5FI8A 4BF9A 1N7KA 4O16A 2Y88A 1K8YA 4F2TA 1HO4A 2DZXA 4PMYA 2R6OA 2ZRWA 4HNTA 3QPZA 3E0WA 1L8PA 4US6A 5HANA 3ARZA 3CB8A 1W1B1 1DJQA 1FFRA 3VUPA 1WB0A 1U33A 1WDPA 2XJ7A 3S9ZA 4L65A 4C65A 3CUHA 5D9MA 1UMYA 1VRXA 1PZ3A 1JULA 3U4FA 4JY8A 2EKCA 4ZZ9A 3UCDA 4WEVX 4XSMA 3N15A 3WK3A 4CD5A 1FFQA 3DFOA 3H55A 2H3DA 4JQ4A 1V0MA 3VX1A 1DWJM 2BY3A 1S5NA 2JF6A 1RH9A 4FHAA 2ISSA 2R1LA 5LHFA 5L9FA 3APGA 3W7HA 4L4OA 3W1PA 2QGYA 3KRUA 1FWJC 2WQDA 5HJLA 3BW2A 1SO3A 1KFKA 1RQHA 2X2GA 1B90A 1PTAA 1UBSA 1YE6A 1KGUA 1DQWA 4AWSA 5H8PA 1E0UA 1QNPA 1EOKA 5HK4A 1FWNA 2QUUA 3WD3A 3R79A 4V28A 2XH7A 1EJTC 2UY2A 2CWXA 1XUUA 4PMOA 1WV2A 1E4IA 3BQ5A 3CPGA 1XQLA 1OYCA 4U28A 3BGGA 5KETA 5FF3A 2J7BA 4IXHA 4JTAA 3AIUA 2XN0A 4CQDA 2PDXA 4KIRA 4HU8A 2A3BA 3SFWA 1UKQA 4ICMA 3W82A 3AZSA 4GABA 1PAMA 1SUXA 3H4WA 5EMYA 2QJGA 4Y8FA 3P67A 3TN6A 2Z26A 2HXUA 1PHWA 3R25A 4M56A 2C13A 4GNVA 4O14A 2JE8A 2B31A 3RR4A 3AMKA 3EWUA 3L5MA 4JGDA 1ZENA 5CLTA 3TYEA 4F0MA 2O9PA 3KDNA 4M7SA 1DKWA 1EKOA 3GVWA 3P7YA 4XZNX 1R8LA 2KZHA 4GVGA 4MZ1A 4IP5A 2VT0A 4FOKA 1LM1A 1R7AA 4IMGA 5A6AA 3W1TA 1HJQA 1YRRA 2YL8A 1G4EA 4R9XA 1D7FA 3BXWA 4QXIA 4JNYA 2VEIA 1I45A 1QFEA 1CGWA 4MYAA 2DUXA 2XSAA 3N29A 3FEMA 3WLLA 3CB3A 3UWZA 2YJQA 4QQUA 3KHJA 3KWSA 3U2CA 4HNUA 3GRIA 1AA1B 4TVUA 4GRSA 4IMCA 4RL3A 2QCHA 1HF6A 5DEZA 3ALGA 1XLGA 1ADDA 5MHBA 1C9DA 4ROQA 1BYBA 4N0RA 4LV9A 1B3XA 3DZ1A 3A5VA 4DY1A 1JXJA 1O1HA 2VR2A 1MNZA 1GVSA 2BVDA 4J27A 2OT0A 1BVZA 4QDPA 1SZGA 4JX5A 2IMRA 3QOMA 3USBA 3MBFA 4XBJA 2VWSA 2Y6ZA 1V77A 4KERA 1A50A 1R86A 3EDKA 2J88A 1PDZA 4MIMA 3QY6A 3EWXA 4JTIA 1UKTA 5FF0A 3L0GA 1MVYA 1XYBA 3LPFA 3LV5A 1TQXA 4RV8A 4V15A 4LW7A 5FEPA 3A21A 4O8RA 1R87A 4CNSA 1QWKA 2DUAA 3RFAA 2JBMA 2V5KA 3CUIA 3RRXA 1F8MA 4B5SA 4JFVA 3E2QA 3ATYA 1POJA 1YDNA 3W9ZA 1SO5A 6TAAA 4LAKA 3OG2A 4UFIA 1Q6DA 3G1YA 3VKCA 1LLWA 1F6PA 2PDLA 3HZ3A 2CIPA 4HOWA 5DXYA 3RX3A 4W89A 1O4UA 4ZR8A 3CO4A 3W6MA 4GH1A 1C29A 1OIFA 3HV9A 2P88A 1XPYA 4FEZA 3TR2A 2AAAA 1YBQA 4PRRA 3N14A 4MFEA 4IHCA 2VHLA 4Q4MA 2AMGA 2NWSA 1ECQA 3NDYA 1TV4A 2FZ8A 3SURA 4UZSA 2PRMA 4AZGA 1FDYA 2VP8A 3N2OA 1SFJA 3GG7A 1V0KA 4XIMA 4NQ1A 4E4FA 4WJ8A 5FEXA 2OGYA 4R33A 3RK8A 1ME8A 3EB3A 3WO8A 1UA3A 2BVTA 4UUIA 3FDKA 2YYUA 3B05A 5AC8A 2W6RA 3CHFA 3CLWA 3W73A 1CXKA 3H54A 4Y9NA 2NV2A 3U6WA 1Z44A 3HGSA 3GAKA 3E49A 1QHOA 4FNTA 3LERA 3F2DA 3PWIA 3EX1A 1X39A 2YB1A 3WLHA 3RILA 1C9WA 2F2KA 4GI4A 4QG8A 4ATDA 2HDJA 3R11A 2VFFA 3VINA 4F4RA 3ABQA 4BQ3A 4Q8NA 2BHYA 4B5WA 3M46A 2AAMA 2FJKA 3HMJG 4DWDA 1E5NA 4QG9A 4CN6A 2QCCA 4P8XA 1KKRA 4URIA 1T99A 2PCQA 1XRTA 1R5YA 1W3IA 3O15A 1BKSA 1TFVA 1ZJAA 1L6SA 2BGNE 5AOUA 3RLGA 1TQJA 3STFA 3QQ0A 1LQ2A 3FVDA 4L6DA 2I9UA 3TLQA 3PBUA 2A7NA 2ZRUA 3TJIA 2Y5JA 4QLKA 1KFLA 3MW7A 1VPXA 4LF1A 4RZBA 1CGTA 3BOXA 3TNBA 2OODA 3H8AA 4B2DA 4DPQA 2CYGA 3VIGA 3LZ3A 2ZX5A 2J7HA 1KV8A 2E3ZA 1XCFA 1Y65A 3S5NA 3RPTA 2PEVA 4YPJA 5D03A 3NIYA 2DZWA 3VC6A 4YJ5A 1XL9A 2GQAA 5I24A 4Q4RA 1X6NA 1MO0A 1PHQA 2DV0A 1PV8A 3P93A 1QJWA 2HK0A 1IWAA 3MJMA 2EJAA 4A21A 2DUZA 2ZZ5A 3OVQA 4I8YA 3IPWA 1EEPA 2CLEA 5D2VA 1MZHA 4AEOA 3F4VA 2VGBA 4HZMA 3S6DA 4G8TA 4DVOA 1ZJBA 3FAXA 4CVUA 1KBIA 1UPPA 1KTNA 1SJDA 3IV8A 4GK8A 4JN7A 5BZAA 3DERA 2V3EA 5HQMA 1UB3A 3WDQA 4V33A 3NZRA 4KF1A 3P0WA 3RITA 3APTA 3WY1A 1CPUA 4MUPA 2FVLA 3TKFA 1EX1A 2DIEA 4C1LA 4IP4A 2WMJA 3TVAA 4BI7A 1K03A 4LCQA 2J62A 1JAEA 3K8MA 3SSJA 4BF5A 1XM3A 3DXIA 1JFXA 1A5BA 4AD1A 3KEHA 1E1FA 3O6DA 5ECUA 4L1WA 2J47A 1D7KA 3BPWA 3HG4A 4WR3A 4XZ9A 2CZEA 3EPNA 2BZNA 2IQ0A 3KFTA 1JD7A 3S2NA 5LZLA 3NFUA 3QM3A 3PTQA 1RK5A 4JIEA 2QJJA 3MSRA 5XIAA 5HNUA 1TWWA 2WMFA 2A1YA 2OX4A 1V3HA 3MV11 3GR7A 3C6CA 3QZEA 3QKZA 3EDDA 1XPGA 2GJLA 5LKYA 2HNHA 1VCVA 2QUTA 4UTFA 1RA5A 1Q63A 1JNEA 4JHOA 4O0QA 2KX9A 4UIOA 2Y8KA 1FRBA 2D22A 4JD4A 4M81A 3LCWA 3WQFA 3GVQA 3GU9A 3CAQA 3WDJA 4PUNA 1P0DA 4F0HA 3TYBA 5HR7A 4ZTXA 2HJPA 1J01A 3SECA 4HA4A 5DN1A 9CGTA 1AJZA 1EBHA 4Y9MA 4A35A 2YL6A 2GVEA 3O9NA 3BLDA 4BCEA 3SUSA 3GLCA 1QO5A 4N4PA 1SR9A 4US5A 4AHOA 1KXVA 2NQZA 4AWEA 5LNWA 1VQTA 3GNXA 4K7VA 4WD0A 3CAWA 3V1PA 2DSWA 3IVSA 1XP3A 2GLKA 4TTUA 3H2MA 3TA6A 2XIOA 3F5JA 3TP4A 1R46A 3U7VA 3GYCA 4J9JA 4ADUA 4FNUA 3W28A 3O63A 3G77A 2PBGA 4CN1A 2ZOXA 4JFWA 3BVJA 4NYUA 3F2CA 3BLKA 1UQYA 3ENLA 4JL1A 1X8FA 4L9ZA 4YXGA 4FPSA 4DUVA 2WKJA 4JN8A 3H4XA 3LI0A 3HN3A 4PR4A 1FXPA 1UD6A 1RPXA 3WBEA 1VAHA 2E5BA 3PZTA 1E9IA 2IPJA 3WUBA 3KBSA 5I09A 1J9YA 3EXRA 4GVFA 1YBQB 2PAJA 7REQA 1A5SA 3WELA 4QRNA 2G50A 2YZRA 3W2JA 1EYEA 4DO6A 1TPFA 3THCA 5EMKA 4N9EA 3S3GA 2XWEA 3U9IA 2Z7KA 4EAMA 3S9IA 3W07A 4KFNA 3QYQA 4AY8A 3N6QA 4F40A 1QVBA 1LT8A 3BG3A 4AZ7A 3VDCA 1I1WA 1GYNA 1YPFA 4PEKA 3NGJA 3S46A 4HHHA 4KEUA 3ONCA 4ADSA 1V03A 2Q09A 1TKKA 3PANA 5IDIA 3P74A 2NWRA 1J0YA 4DLFA 3UF9A 1J18A 4LVAA 1S5WA 3TAKA 3PJXA 3KDOA 4XO6A 1A5CA 1PCWA 1PZ0A 4JTCA 2ZUUA 3K1GA 5CH9A 1P7TA 1YE4A 4O18A 5F4WA 1I9CB 2LLEA 1IIGA 1OCBA 3AS1A 4EPBC 1GG0A 3A5FA 4HQVA 3PP7A 4DUXA 3DFSA 1W3NA 2F84A 1SW7A 3UXIA 3R5EA 1FY6A 3VNZA 3NSMA 1BQGA 4EXQA 2PDKA 4O19A 5I23A 4A8RA 4ZB2A 1RXOB 2FQIA 1OADA 2ON3A 2DU2A 4CEUC 5EY5A 1EWDA 3L2IA 3W1MA 1XIEA 3A9BA 1FH7A 2DP3A 4E4PA 4PFMA 2B7NA 2ZVRA 4O1EA 4L6HA 3VDAA 3LGDA 4PZVA 2ZXDA 5G4WA 3RO6A 4CU6A 2AQOA 1W91A 2WZMA 1V3JA 1YDVA 3BV4A 4M8UA 1I2NA 3B8VA 1US3A 4GO8A 4WIWA 3B9NA 1UHVA 3WNPA 4ZOAA 2VEKA 4D2JA 5AHEA 3SCWA 2JGYA 3SUUA 1A49A 3TJ4A 1SGJA 2VRQA 1ZU8A 4M1BA 3CLMA 5G4HC 4LVDA 1AD1A 2OWXA 1FWBC 3WF3A 4NZ3A 3W7LA 1FCQA 4L4MA 1DWIM 2DGAA 4JZ5A 3ARQA 4J1OA 1RVKA 3RCYA 1QI4A 2ACRA 5KZEA 5DELA 4MMWA 2WXDM 2GJXB 4CVWA 3NG3A 3E5BA 2PSNA 3CPRA 1P6BA 4AD2A 1TTQA 1A0DA 2Q71A 1IEVA 2YR1A 2Y24A 4C6LA 4DYEA 4BEUA 1VFTA 1NAL1 3IK2A 3BQ6A 3TTOA 1TPDA 3KBWA 1TE6A 3ZXWA 3VCCA 2ZYFA 3ZWTA 1BGGA 3CWHA 2QLYA 3VNYA 1F8IA 1AQMA 3LCIA 3CTTA 1U5JA 4RCXA 3V0TA 4TU1A 1LG2A 5LXXA 3L0NA 3TYUA 1QNQA 3W24A 3CASA 1TZ9A 2ZWZA 1GNXA 3ME3A 5EYWA 4UNLA 4CD8A 2CLOA 4P2VA 3L21A 4A8NA 3SR7A 1XWYA 4J4KA 4LOCA 3SGZA 3KXQA 2SFPA 1E0VA 3MJYA 1F07A 1F9CA 3KX6A 3W7CA 1ZUAX 1CB2A 3NQBA 3KLLA 2OYLA 4DZIA 5D9PA 3DUGA 2BSLA 4PRTA 2O7QA 4D6HA 4GXMA 4JOMA 3OQEA 1OY0A 3AAMA 3DFPA 5CZKA 1WKFA 3RJXA 2JKPA 3E6EA 3HV8A 4MM1A 3H7RA 1HTIA 1PDYA 2EAWA 5U7SA 4PMZA 2ZBTA 4GZ7A 3LMZA 4Y96A 3AYSA 3LHWA 3MKKA 3AU2A 5MKGB 1G69A 2XFYA 1HG3A 2REQA 3V3WA 1MW2A 1TUFA 4W84A 2VOMA 3R0KA 3SCSA 3S8HA 2PDQA 1KGXA 1ZAHA 4JKKA 3JR2A 2XUCA 4FNPA 5H1WA 3M0KA 5BWFA 3EX4A 1OYBA 2NVAA 1E6NA 1D3GA 4XZWA 2QAFA 3RMJA 1NOWA 3LD5A 4V1XA 3GY1A 2WVUA 3S1XA 1FUYA 2BODX 3IK4A 3L7RA 4A4AA 4H9ZA 4HU0A 1RY0A 2Q6ZA 3M5ZA 3B9OA 4F3HA 1IEXA 1O1ZA 1XXXA 2A3EA 1J2BA 1IXOA 3K8KA 1JCNA 1NWTA 2NQLA 1A0CA 2FB2A 4CGTA 3U2EA 1LROA 3VCNA 3DDMA 5CPOA 3N73A 5FF2A 1W3JA 3VOHA 3P5YA 2Y8UA 2BFGA 1YKWA 5ABTA 5A6SA 5CZ0A 3BJSA 4OIFA 1KM6A 3F4DA 4HMCA 1TPH1 1C91A 1VBUA 2OELA 1CGYA 1E6SM 1ITQA 1E9ZB 1ZCCA 2E9MA 2OPJA 3SCUA 4R88A 1OIMA 1ME7A 3A22A 1E6PA 1O94A 2JQXA 3GBEA 3O6CA 1AQFA 2OZ0A 1XG4A 1EPVA 3CZEA 2FH6A 4YNGA 5EMUA 3FKKA 2Y0FA 2GGEA 3DC0A 5ABEA 1EZWA 4HPJA 2Y85A 3LTPA 3KRSA 1KB3A 5IFTA 1U5HA 3LXAA 5HQLA 3G6MA 3VGHA 4OTKA 3L4YA 1ADSA 1VBRA 3W29A 3M7WA 1AK5A 4OFCA 3CIVA 4LNYA 3EEGA 4PMUA 4A8IA 1FCUA 1H4PA 1MQRA 3S9YA 3G1SA 3CPUA 4XVEA 4GXWA 3PFMA 3M4HA 3W38A 3B3DA 5FEWA 3QFEA 5HOSA 4NNAA 4U31A 1Q6CA 3MSGA 1W0MA 3AS0A 1NY1A 2J4GA 5LIXX 4H8NA 1HKVA 2J24A 2ZFAA 4F79A 1QNVA 5CKSA 5HMDA 1NF7A 2UV8G 3BJTA 4O52A 3W7OA 4MDOA 4DWSB 1XIBA 1TJ0A 3ZVHA 2Y4SA 3T8QA 3KOZA 5D33A 4NJGA 2BBFA 1MYRA 3CEPA 1F3XA 5AFDA 1V3LA 2BXZA 3F4CA 1PO9A 4BA0A 3ZT7A 3KRZA 5AHFA 4J3WA 1RBOB 2XN2A 1DJZA 3WSUA 1MRAA 4HZ7A 1BTMA 2OOGA 4Q8PA 2YOCA 1GZGA 1OZQA 1P0NA 1GHSA 3HIJA 4HCHA 1GTEA 1Z32X 4HMEA 4Q3MA 3TTQA 1I2QA 4JTRA 1XYAA 4FS9A 3YPIA 1IIHA 3A9IA 3A12A 4QG6A 3U7BA 3WMSA 3SDOA 4DO7A 4ROPA 2VM8A 2PTZA 5CSSA 4IQJA 9XIAA 2E1DA 5BXRA 1J5SA 3WF1A 4WQ6A 3UPBA 4UR8A 1F76A 3LENA 1AMYA 3O1NA 3WNMA 3PZUA 5CCZA 1P43A 4GUJA 3K4DA 3VMPA 4CD4A 4UTMA 3VIPA 1IEIA 2BHZA 2P5NA 1XSIA 3GZAA 4JCLA 1KFEA 1J2WA 1ITUA 4QLLA 3VZXA 3CHVA 3HG3A 1VC4A 4LCSA 3C86A 3DFYA 4S23A 3Q65A 3VTRA 1CXEA 4MB5A 3UQNA 1XLEA 1SYTA 4NAFB 4DZAA 2QCNA 3I6RA 5JBFA 3H26A 4IIDA 1K3UA 2ZRXA 1UWTA 4QIUA 2WLYA 1RAKA 2CEQA 4L80A 6ALDA 3GXIA 3FYOA 4XKYA 5DY3A 2C19A 2XZ9A 3ARYA 5I79A 4C6KA 2YA2A 4EK7A 2E28A 5GQBA 1QO2A 2AKMA 3TK7A 1BYAA 1BGAA 1HL8A 2V2DA 3VMNA 3RU8X 3NPXA 2X41A 1H0IA 4GACA 2V5CA 2Y8VA 3QC0A 5A2AA 3WLOA 4DN1A 1LBFA 2P50A 5I2UA 2CPUA 3OZYA 3VOFA 3BJFA 1HKJA 3TIMA 1XRSA 2DSVA 2EG6A 3WL0A 2X42A 2VOTA 3TU9A 3S5ZA 3OGRA 2UWFA 2CLFA 4MLJA 3S0CA 4RXFA 1IT7A 2WZEA 4LF2A 3RXZA 5I0DA 3TAOA 1RCXB 1TJ2A 3STEA 4QQ3A 1JUKA 4GUHA 4YYCA 4MHBA 2YXOA 3BSHA 3O0FA 1E0WA 3O8AA 3WLJA 5CGTA 1UR0A 4X22A 3CIWA 5I7GA 3B4YA 1FWTA 2QF8A 1YDOA 3CH0A 3ZLHA 1KWKA 4DELA 4H83A 1L9WA 3OW1A 3NR0A 2REQB 2INZA 3PZOA 1Z89A 4GISA 4JTUA 1UR8A 3PB0A 3VGGA 3WEMA 2OOFA 4WF7A 1R2TA 3L5LA 2OCZA 4NJIA 5TIMA 4B5XA 1LBLA 1XLKA 2A6LA 4XWUA 2GJPA 5LIWX 2UBPC 2YYTA 4E3VA 2G4JA 4DF1A 4Q4OA 1EIXA 1EDTA 5LSMA 4LYQA 2E1WA 3MWCA 4U5IA 1W1ZA 3WLMA 3FHQA 3EBVA 3PG8A 1A5NC 4IQDA 4JYDA 1S2VA 4AXKA 2DJXA 4UC5A 4QCEA 5BXTA 4JKLA 1KXTA 3LI1A 2CBUA 3ZOAA 4N02A 3ZWSA 4BEQA 7TAAA 2XVKA 1YXYA 1Q85A 1SJBA 2J8TA 3P80A 3H53A 2OO0A 1XBZA 4JXCA 3THQA 3TWAA 3TTEA 4AZHA 3QPYA 2E67A 4NZ5A 5I00A 2YCJA 4F66A 5I5RA 3K13A 5D4YA 4J3XA 4YCOA 1R2RA 5FJUA 4HOZA 4JFSA 2G8ZA 2OO6A 4FI4A 1E73M 2CKSA 4M3PA 4F9DA 2MNRA 4C1NA 2DY3A 2GWNA 2PWHA 1K9EA 2E6DA 4XAGA 2X05A 3B4UA 1DHPA 2OKOA 1SFSA 3ZQ9A 3QY8A 1OD0A 4H04A 2WSQA 4OOZA 1TJRA 2GK1A 5CGMA 4LB3A 3CQJA 3MHUA 2ANUA 5AVHA 2PDWA 4UMBA 1N82A 3MS8A 5TBOA 3AHVA 3W27A 4LS2A 1EHAA 3UR2A 2J66A 2ZX9A 4RV3A 4IM4A 2G0WA 5FJJA 3EOSA 2WNQA 2Z2UA 4MJ2A 4ZO7A 2FZNA 1NFPA 2NX9A 4GQBA 5LNVA 3SN4A 2DZPA 2ACQA 4DQWA 3F2BA 4JQAA 1VYRA 2Y7DA 4GZJA 1JD9A 2ZZ4A 4ZL1A 1Q2SA 3SAZA 5EB8A 1AH4A 3NPVA 2WMIA 4C7FA 4ZQRA 1YQ2A 3O0KA 1GOIA 4DHGA 1Z42A 4N9CA 4IMDA 2C1GA 4NT0A 1NJJA 5HPOA 2EPOA 1NQKA 1Z8AA 2EEXA 4Q6XA 3NSNA 1VCGA 2WW5A 1WKDA 2Y7FA 3T42A 3THUA 3DOPA 3PPHA 4O1CA 2WQPA 3A3XA 1PZ2A 3ARSA 5A5WA 3QV6A 1TELA 2DVTA 1K4GA 3EZ4A 2IKJA 2NV1A 2QT3A 2A6NA 4QEHA 3MUXA 4QNWA 3LLXA 3TDFA 1FVPA 3M5XA 4CNUA 4IPIA 3E12A 3W22A 1DJYA 6A3HA 2QPUA 4HTBA 2I14A 3ITYA 3A4JA 1CENA 2VEMA 4OBSA 4LUIA 1OFPA 3P6LA 5DT5A 2W66A 4PCPA 3QEZA 1UH3A 5M03A 3W4RA 4YIWA 1SW3A 3LHYA 1HJWA 3F4WA 4H7VA 4IZGA 1XSJA 5D32A 1JZ4A 1JAKA 3E2SA 4GQ0A 2EO7A 3EOEA 3BO9A 2PD9A 1AQ0A 4ZXOA 4I5RA 4LPCA 3NJ3A 4HK7A 1G1YA 1UKOA 1T7LA 5A8NA 2J27A 1WZLA 1PIGA 1VPYA 4GG9A 3UWYA 2QVHA 4MZYA 4WCJA 4X2RA 3QLDA 1DXFA 1LORA 2WC4A 1C90A 5A6TC 2VD8A 3C2EA 4ICCX 1DIEA 3ABXA 4ZE4A 3DHFA 3WDRA 3VNIA 3N12A 4LBRA 3OVGA 1OX4B 3BAIA 2C16A 5TNVA 2ABBA 2YA1A 3NCOA 1LDCA 1S5MA 3W3OA 1W56A 3G0SA 1L6FA 6XIAA 1TA3A 3JVAA 1A5MC 1GCYA 2ISWA 3RLUA 2ZCGA 1Q8JA 5E0KA 3PUOA 1AZ2A 3GU2A 2BDQA 1I75A 1V02E 3SUTA 1KCLA 3HQOA 4LX4A 4QP0A 4UFHA 3PZQA 1LL6A 2DFAA 3EMZA 3LY0A 3DN5A 1EP2A 2F9RA 1UASA 4XTDA 4XAPA 3GXTA 4UTTC 1D8CA 3PB2A 3UW6A 3AALA 5AYYA 5F2IA 3RX2A 5LA0A 2C18A 1JUBA 3W71A 4I5UA 2WSKA 2QIWA 2CWNA 1ZY9A 1LTDA 4KFPA 3L66A 2BMBA 3SM0A 1Z3NA 3I3EA 4XD3A 3H2FA 1J0KA 2C1HA 3AHZA 2FPVA 3U48A 3R1ZA 1SM9A 2ZZ3A 4DI8A 1EXBA 2CBJA 2TAAA 2EKGA 4H6EA 1ONWA 4JKMA 1RQEA 4BZYA 2GUBA 2ZDSA 1Y5WA 4GY7A 4PMDA 1XLDA 3P61A 3CV7A 3E1F1 3LRLA 1QRQA 4WKAA 5FJIA 1B3WA 5D05A 3W1AA 4JYFA 4P7RA 1SSDA 4NYYA 1E3ZA 4GCXA 4LUSB 2PTWA 3QW4B 2E9BA 3NQFA 1H63A 4IGHA 5CSUA 2GGHA 3IJLA 3MVTA 4ML9A 4LH8A 3BH4A 1KBLA 3TONA 2A85A 3WQVA 3WH5A 4Z1CA 1NIUA 1I4NA 1GKPA 2O9OA 2CHRA 5IHRA 4FNQA 2PDFA 1Y8BA 2XIQA 3UA4A 1T8QA 1BWVA 4AYSA 4C90A 3URAA 1BG4A 5A8GA 3A4WA 1E5JA 3ITOA 1DVJA 2EG8A