4M1RA

Structure of a novel cellulase 5 from a sugarcane soil metagenomic library
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
296
structure length
296
Chain Sequence
MVAPITTSGNKVLFGGQQGSIAGNSFFWSNTGWGGEKYYNAQTVAWLKSDWKSSLVRAAMGVDESGGYITDSYNKTRVTTVVDAAIANNMYVIIDWHSHHAEQYQSQAIAFFKEMATKYGNNNNVIYEIYNEPLQVSWSSVIKPYATAVIAEIRKIDPDNLIVVGTPTWSQDVDVAANDPITGYANIAYTLHFYAGTHGQSLRNKASTALSKGIPLFVTEWGSVNADGGGSVATAETNSWVSFMKTNNISNANWALNDKAEGASALVSGASANGGWTSSQLTASGTLAKSIISGWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a novel cellulase 5 from sugarcane soil metagenome.
pubmed doi rcsb
source organism Soil metagenome
molecule tags Hydrolase
molecule keywords Cellulase 5
total genus 121
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m1rA00
3ARWA 2QV4A 3KEHA 2XGIA 1QI5A 1KXTA 1AVAA 2VZSA 4MAVA 3CIVA 3CTTA 2BY1A 5KZ6A 2HVMA 1H0IA 1B2YA 1LL6A 1UKSA 1HXJA 2FGZA 1VBRA 5DT5A 5I6SA 1TUXA 3A4AA 3AJ7A 4PCSA 4MADA 4JHZA 3K8LA 2WKGA 3BCFA 2WHJA 5ABFA 3CBWA 1E4NA 1QNRA 3AICA 4HTYA 1IZJA 3BAKA 1OM0A 8A3HA 1VFOA 1KR0A 3VINA 3UG4A 1DWAM 1G1YA 2XTKA 4PUDA 1V6VA 3BGAA 3PTMA 2FGLA 4C7FA 1NWTA 1OD8A 1BG9A 4TX6A 3CZEA 1HL8A 1E6SM 1M03A 2JF7A 5CPTA 1G5AA 4OBSA 3GXIA 2VCCA 3FNDA 3N04A 3WNOA 3ZT5A 4WSJA 3WNLA 2WZEA 4M24A 3UEQA 4OZOA 4WJXA 1RP9A 2Y8VA 4XUYA 5E70A 1XRVA 1SR0A 4LPCA 1C7SA 1E4IA 4W5ZA 3KE0A 5FKYA 3IAQA 3CZKA 1W3KA 4DWSD 3ARXA 1US3A 2XGBA 1EO7A 2G4FA 3G6MA 4KGJA 2XFFA 1WZAA 2FH8A 1ISWA 3DHUA 3MSDA 3SCTA 3A47A 4CD5A 4MB1A 4D6IA 2WVTA 1C3FA 2AAAA 4EK7A 4UOZA 3OBAA 2ZX8A 3WF4A 5EFFA 5F7UA 3OLDA 2YDRA 4JCLA 3EDEA 2HISA 3PTKA 1AQ0A 3D3AA 5I77A 5FL1A 4BQ5A 3A3HA 1CENA 2O92A 4W7VA 2G3IA 1GOOA 4E2OA 3S6TA 1VEOA 4HPHA 4PSRA 1V03A 1XV8A 3W6LA 3CZ8A 2J7EA 4HU8A 5AC5A 3GBDA 3CLWA 3W6MA 5I79A 4MAZA 3PHAA 4B9YA 4E8CA 4HZ6A 1UH4A 1W9VA 4QCFA 1UWQA 1TE1A 2VQUA 3AMGA 1W1YA 1HJXA 4D1JA 4W87A 4IM4A 2BXYA 1EQCA 4IISA 2WSPA 2YL6A 5BXSA 4ACZB 2WHLA 2WSKA 2DT2A 2J74A 1JZ6A 1W1VA 1C90A 3WNKA 2XPKA 1VFUA 3K4AA 4UQAA 2VUYA 2B31A 2FHFA 4W8BA 1H2JA 1C8YA 2W61A 4GIAA 4YPJA 3WDIA 2XWEA 4U3AA 1LG2A 3IJ9A 4TVCA 1QVBA 5M3WA 3VD3A 1SMAA 2EPNA 5M03A 3W24A 4JL1A 3HN3A 4A3HA 3O2LA 4H2CA 2QLYA 1QBAA 1V3LA 4UOJA 4F66A 4FK9A 5E09A 4PYSA 2WANA 4JFWA 2WM0A 1BAGA 1KGWA 3AHXA 1UD4A 2VOTA 1R87A 3L4WA 3SURA 3RM9A 3GNOA 5DMYA 2EPKX 4QDMA 2EPLX 1B3WA 1EH9A 1NOWA 2BVYA 1DWHM 1MVYA 1NP0A 1HP4A 5CGMA 4AW7A 1WO2A 4CVUA 1EHAA 2GJXB 4NRSA 3N1AA 1CGXA 3EYPA 1Q4NX 2X1IA 4C7DA 1Q6CA 4CN6A 3PZMA 1JG9A 2VR4A 3O6AA 4HU0A 5A3HA 1UR8A 3WEOA 1MW2A 3DYPA 5A8QA 2DH3A 3VIIA 1TR1A 3U5UA 2DT0A 2WC7A 1ESWA 1RPKA 1TMQA 2D2OA 2GDUA 4JHOA 5EB8A 4CD7A 4JFVA 1RP8A 4CKQA 4CUCA 2YA2A 3RCNA 2QF8A 4A3YA 4AD0A 4M80A 2V38A 3AMDA 3VGFA 1KBBA 4WK9A 3BMVA 4JAWA 4ACYA 1UKTA 4CU6A 4DUXA 3CHEA 4R5EA 1OSEA 2DSVA 1OINA 1CGVA 3NDYA 1G0CA 1PIFA 1JZ7A 2XVLA 3UESA 2EJ1A 3WD2A 2X0HA 3ECQA 3WMBA 3OIHA 1UQZA 4AZ7A 3NJ3A 1JDDA 3AYSA 4CD4A 3IAPA 1J0KA 1UR1A 5IDIA 4KRTA 2YKKA 4UR9A 3VVGA 2OSYA 4BF7A 4D6CA 1JAKA 4AEEA 3VM5A 3CUGA 4X0VA 5A6BA 3A6OA 4LYPA 4MB4A 3ZMRA 2VJXA 2E4TA 5CG0A 3SEPA 1UZ4A 4P8UA 3FHQA 2YLLA 4LYQA 1OD0A 1ZL1A 1JL8A 1GQKA 5DO8A 2VZTA 3UR8A 1CZ1A 2YBTA 3AHTA 3FW6A 3VMOA 4P8VA 3VIMA 3EDKA 1NARA 3GM8A 5EBAA 4J3TA 3WUBA 2XIIA 2X05A 5D9NA 5JIWA 3AS2A 1CIUA 3AIVA 4ZXOA 1BYCA 5BRPA 1GJWA 1ISXA 2PWHA 4LX4A 5GNZA 3IK2A 4JZ5A 3ZJ6A 3RPMA 1OIFA 2BY3A 4H8HA 3KL0A 4TOQA 3AXXA 2WPGA 2VMFA 2D23A 4BS0A 2PB1A 5A2AA 1ZBVA 3VGBA 2J25A 4CD8A 3OZPA 3W29A 3ARYA 4J28A 3LPPA 3MS8A 1S46A 1GOKA 2ZICA 4AZBA 2OLHA 3OB8A 1V08A 1EQPA 5AC4A 1E5JA 3K1DA 1EDGA 1JI2A 5ABGA 2CBIA 3BLPX 4CCCA 2E9LA 2ZUVA 1TZ7A 2YDQA 1WDPA 1EXPA 1LL4A 3WELA 2E40A 1ECEA 3THDA 1U2YA 4HOXA 3MUIA 1FFRA 4F8XA 7CGTA 4X0NA 4P8WA 1MW1A 1BLIA 1V3KA 4BQ2A 1TVPA 1BVZA 2NT0A 1ZBCA 3LPOA 4JKKA 1BG4A 3BAXA 4AD2A 5FCZA 2PWDA 2YL8A 3MV01 1GHRA 4V28A 4PBGA 2UY4A 1CPUA 4D1IA 3PZIA 1U30A 1NP2A 2OYLA 1CLVA 1CTNA 2JIWA 1UH3A 1CGTA 3T2PA 2PI6A 3AIQA 1TA3A 4E8DA 5HBFA 4F9JA 3VMPA 2WVSA 1W9XA 3FHAA 4GPNA 3PZQA 1QI3A 3NYDA 4RL3A 4RE2A 4PUEA 1PAMA 1QW8A 3MMUA 5D9OA 4NRRA 3VIFA 4W85A 2CHNA 1C8QA 1TA3B 4MB5A 1I75A 1B30A 3BAYA 1B3YA 5A8OA 4Z2KA 5I2UA 1O7AA 2QMKA 2V5CA 3T0DA 4P7QA 4EKJA 2NT1A 3SCRA 1JYXA 1V0LA 2WMGA 4TTGA 3WQ6A 1XCXA 3WY1A 1KFWA 1ZJBA 2OYMA 5A6AA 1JZ4A 4EAMA 2DSUA 3WDHA 2ZIDA 4XZWA 3VTRA 3ZJ8A 1VF8A 2ZUSA 2G41A 1MQPA 2YBUA 1KB3A 3AISA 4GQQA 3WDJA 3ARPA 2FH6A 5GPRA 1V3MA 3FAXA 3WF2A 1W9BM 5HNNA 4MTVA 1MWOA 4M8UA 1NQ6A 2A3HA 2DSWA 4AD5A 4S3KA 2RGMA 2CKSA 2ZXDA 2BS9A 1OWQA 4ATLA 1Q6EA 5ABHA 5A6BD 3FN9A 3W38A 1KGUA 1WE5A 1Z32X 3WFZA 1W2PA 3QHMA 5A1AA 1UD8A 4J3WA 3VDCA 2C0HA 3N12A 1HKKA 2XJ7A 3SIMA 1DTUA 4MNMA 4D6DA 3WBEA 4D72A 1KCLA 2XUCA 3QHNA 4XZBA 1JDAA 4XV0A 2Y24A 4UOQA 3TA9A 4WKHA 5D9MA 3ZSTA 1IT0A 5D9PA 3WH5A 1BPLB 3B8SA 2UY5A 3NDZA 4AC1X 2XFRA 1RH9A 3MANA 4BZYA 4W86A 2EPMX 4ZENA 4X9YA 1E43A 3AIUA 1R8LA 3K8MA 1DWGM 4CCEA 3VGHA 4P7OA 1PZ2A 2MANA 4MJ2A 1JF5A 1GCYA 3DC0A 3WMSA 5A8MA 4Z2GA 1A3HA 2V3GA 1UKPA 1W3LA 2DEPA 1EDQA 2PWGA 4GZJA 4Z2LA 4LQ1A 3CUFA 1FH8A 1HNYA 1GHSA 2WWCA 4H8VA 1IZKA 2BNJA 3SCVA 3W82A 3EDFA 3RMEA 1XYZA 1X6NA 3MKKA 1ISVA 3UG3A 3E1F1 3CUJA 6CGTA 3AZTA 1XGZA 5BWFA 3QOMA 4BQ4A 3I3EA 4HMEA 4D6GA 1HJUA 1KXVA 4JIEA 3VX0A 1CYGA 2G3NA 3VGEA 2WCAA 2XFYA 4J3SA 1V3HA 4KH2A 4AXNA 1V3JA 3KL3A 1LL7A 3WEZA 5IFTA 3CHFA 1FA2A 2VNCA 2V3EA 3AXHA 3N17A 5DT7A 2OWXA 4WF7A 2GVYA 3W0KA 3OGRA 2VZOA 2WZHA 2J4GA 3B9EA 3CZJA 1LJYA 5D4YA 3ZO9A 1D2KA 3BAIA 3WSUA 1LQ0A 1NWUA 3VIOA 3CH9A 4W8AA 2V3DA 4W89A 1OIMA 1B9ZA 1CNVA 3TTQA 4LGXA 3FY1A 3VNZA 1PPIA 5I0DA 4B9ZA 5BCAA 4GXPA 1FP8A 2G3MA 1GNXA 4FMVA 1QHZA 2ZX7A 1HL9A 1HP5A 3BXWA 2CCRA 1YHTA 1VENA 3AS3A 4XB3A 5JIPA 5D8WA 1UKQA 4YHEA 1EIBA 1WCGA 2X2YA 4HA1A 1DWIM 3SCUA 1WDRA 1ZU8A 1B3VA 5KEZA 1ZBKA 1P6WA 4RE4A 3AROA 3GNRA 1DWJM 1B31A 1PX4A 2VX6A 3GNPA 1H49A 3L4XA 4PTXA 3T0BA 1B0IA 1JGIA 1JZ5A 4W88A 2QHAA 1BVNP 2WLZA 3ZOAA 1MW0A 4AISA 4AMCA 5HPOA 1AMYA 1XC6A 4Z2HA 1UWTA 1E6QM 2XVGA 3VUPA 4LYRA 5GQBA 2E9BA 1E70M 3WENA 1X6LA 2WC3A 1E71M 1WDSA 2WWDA 3AIEA 5BYWA 4GZIA 3TOPA 1EOKA 3A4XA 3ZT6A 3L4YA 3DECA 4UFHA 3AFBA 5IHRA 1CECA 1G01A 3UETA 1E56A 3MUZ1 1JNEA 1E1EA 1PX3A 1HIZA 1XHGA 2VR5A 1EO5A 5IHSA 4GKLA 4R27A 2VQTA 3W25A 5I78A 2WCSA 5CQ1A 2CBJA 3L4ZA 1K9DA 2NW0A 4EANA 1ZS2A 4DUWA 2BHUA 3WQVA 2G3JA 3OZOA 1MXDA 4HPGA 3UG5A 3WF3A 2WK2A 1JF6A 4Z2IA 1ISYA 2OWWA 2ZUUA 1CGYA 1UWIA 1V02E 3W4RA 1BQCA 4MNKA 2W92A 1V6YA 1NWSA 4PTMA 2CERA 3U7VA 1ZJAA 6A3HA 2O9OA 5BROA 1KGXA 2VX4A 2VVSA 5FL0A 5I3DA 3DYOA 1UG6A 1XSIA 3G6LA 2CXGA 1LWHA 4UQCA 4CU8A 4DWSA 3CO4A 5A6MA 5FIPA 1QBBA 1UYQA 3IJ8A 4W5UA 2OSWA 2ZUNA 3AIBA 3BAJA 5D8ZA 1N82A 3GH7A 4CGTA 2CITA 2YA1A 2WXDM 1PBGA 1QPKA 2CNCA 2OYKA 3VIPA 1CLXA 4BA0A 5M5DA 2JFEX 1GUVA 3ZQ9A 3OLIA 3N9KA 1Q6DA 1KQYA 3L4TA 3VKKA 3WNPA 5DF0A 1NM9A 5CJ5A 1KWKA 1E0VA 2X09A 4TVDA 2XSBA 2VC9A 1NOFA 3WDPP 3IANA 3ARQA 3WIJA 4AD1A 1JFHA 3WD1A 2CESA 3WDQA 1MQRA 2W66A 4K68A 4HP5A 4QFUA 2XM2A 4PMVA 1H3GA 2W63A 4QAWA 1QI4A 4PEEA 1OGSA 5A6KA 1JIBA 4HOZA 2GSJA 4L4PA 1TFVA 4YHGA 4UZSA 1E9LA 1QHPA 2O9PA 2DQXA 1CGWA 1E6PA 1DHKA 1K9TA 3I3BA 1BYAA 3PZNA 3EDDA 3T2OA 5C71A 2J7HA 5A6JA 3S2CA 2WMJA 1B3ZA 1K9EA 1CXFA 2FHCA 2D0FA 1PIGA 1QOXA 4CN4A 1UD5A 4P7LA 1UOKA 2EBNA 1E72M 2Y8KA 4OOUA 4HA3A 4WKAA 1JYNA 1BSIA 3K8KA 3QOKA 2EQDA 2J78A 3VMNA 1XD1A 4TX8A 3LPGA 5I5RA 1HVQA 1ODUA 3KWXA 2OSXA 3WUFA 4EE9A 4GINA 1IV8A 4UCFA 2D1ZA 3TP4A 5I23A 1W91A 1BGAA 3WD0A 1QNPA 4AEFA 4WKFA 1W3HA 1E6XM 4W8LA 1QHOA 2ZWZA 3UERA 3WQWA 1UZ1A 2CYGA 2C7FA 1LLOA 2J79A 2VZVA 4B16A 3U7BA 1VEMA 2JIEA 3U5YA 2WMFA 5JUVA 3SCOA 4B3LA 4P8XA 1JZ2A 1LWJA 3F5LA 2Z1KA 2V5DA 1L0PA 2J7DA 3MSGA 3TONA 2VCBA 4ZEPA 2PC8A 1H11A 2W67A 3AHVA 5AYIA 4MDPA 4PN2A 4UNIA 5ABFB 3AIWA 3B9AA 4URIA 2EO7A 2D0HA 2PF0A 3NUKA 4AWEA 3PZUA 4XX6A 4BCEA 1OT1A 3WUGA 1UUQA 4UFKA 4ZE4A 1C8XA 3DYMA 2E0PA 9CGTA 4V2XA 1VBUA 5DFAA 3TTYA 3WQ4A 2JEPA 3L4UA 3II1A 2GFTA 4AIUA 2CEQA 4WIWA 5HDRA 3AS0A 2O9TA 1OT2A 4AZ6A 2ZX5A 1AQHA 3K4DA 1UR4A 2BFGA 2W5FA 3SCSA 2XVKA 4CVWA 3VM7A 4JCMA 3WL1A 1QNQA 2AOSA 2GK1B 4H8UA 3CMGA 1QNSA 1GOWA 4D71A 1W9UA 4D6JA 3NSMA 1CXEA 3CUIA 1SMDA 1J0HA 3MUAA 1KBKA 3OGSA 4IPNB 2WVUA 1CBGA 1J10A 2A3CA 2TAAA 1G94A 1XH0A 1M04A 1HJWA 2UWFA 2NSXA 2F61A 4W7WA 1V0KA 3W26A 1JZ3A 4U31A 3GXDA 3PN8A 4UQBA 1C92A 3N13A 3ALFA 1SYTA 1H41A 1B1YA 4C7GA 4PSPA 2QPSA 3VIKA 3MU7A 1FOBA 5A69A 2A3BA 2DT3A 3PTQA 4OIFA 3WKZA 2WYSA 2YIHA 4UQ9A 4TXEA 1GW1A 2D3LA 1E15A 2DDXA 5ECUA 2GUYA 3BSHA 1Q6FA 3VGDA 1J0JA 1ITXA 1BTCA 4ZXLA 3BAWA 2GDVA 3CHDA 5CGTA 5JBEA 1MW3A 3GYCA 1R7OA 1UD3A 4UFMA 1SFSA 5E9AA 3AHYA 2DIJA 3WH6A 3RDKA 1E40A 3CGTA 2ZXQA 4D6HA 5GNYA 4P7NA 4AZHA 2W91A 1XCWA 2Y4SA 4QLJA 3QGVA 4MNLA 1J18A 3W28A 1XYFA 5A6LA 1VB9A 1QW9A 1J0YA 3AYRA 1DEDA 2DPEA 4AZCA 7A3HA 4J3UA 2XIBA 3LMYA 6TAAA 3SCNA 5FD0A 1E4MM 3T09A 2EEXA 1H0GA 5BRQA 2BY2A 1E55A 1HKMA 3NSNA 2VX5A 2WAGA 2WZIA 2JF6A 3PZOA 4S3JA 3VD9A 5BXPA 4ZE5A 3VIGA 1FH7A 2CHOA 2YJQA 2VX7A 3FXYA 3EMQA 4NSBA 2WBKA 3BMWA 2CETA 3CZGA 2FHBA 1I1WA 4W7UA 2VRKA 1H09A 2EPOA 4HZ7A 3BCDA 2O9RA 5TD4A 3WD3A 1JXKA 2A3AA 1JAEA 3EMZA 2JEQA 2VO5A 3ALGA 4Z2JA 1HJVA 5E6ZA 5CXPA 1JI1A 2IXVA 3ZJKA 3M6DA 1VFFA 1WZLA 2ZE0A 2J7FA 5CPSA 4D6FA 3PZTA 1PEZA 1QI0A 1VIWA 2YDSA 2DSKA 4E4PA 1MYRA 3GH4A 2ESCA 4UFIA 3AQUA 2ZXAA 3SUVA 2A3EA 3OG2A 3ARRA 3RJXA 5GNXA 1M53A 2AMGA 2C8NA 3ARVA 2CBUA 1K9FA 3K46A 3RJYA 1XD0A 4GO8A 2W4XA 4U2ZA 1H1NA 1KXQA 4GI9A 1WZMA 3WF1A 4HMDA 3HJEA 1D3CA 1E4LA 3WBAA 4PMZA 1UKOA 2J47A 1GONA 5AY7A 1HKIA 1W1TA 1GOMA 3KL5A 5HPCA 3M07A 1GJUA 4D6EA 1FHDA 1DWFM 4AIOA 1FFQA 5IXEA 2E9MA 4AYSA 1WZKA 5IFPA 2VCAA 4TTUA 1FP9A 4AIEA 4AD3A 4PMDA 3SUSA 4DM1A 1X1NA 1UWSA 3TTOA 1GZJA 1TVNA 3T0AA 2YLAA 4CN1A 4JL2A 4TUFA 3FAWA 2J8FA 3RM8A 4DM2A 2WB5A 3OA5A 2XG9A 3WUEA 4A4AA 4IUGA 2VTFA 4V27A 3OGVA 5LA2A 4PMXA 1OCQA 1GORA 3ZSSA 3L2MA 1GPFA 1AQMA 1J0ZA 1E6NA 5A8PA 2Q8XA 4JKMA 3WF0A 2XVNA 1EHNA 3M46A 4NZCA 5EFDA 2RGLA 3SCQA 1LF1A 1XSJA 4UZUA 5C8BB 2GK1A 3BLKA 4ZFMA 4MB3A 3UR7A 3U57A 4H04A 1J11A 5A2BA 4M56A 1L8NA 3ARUA 3EMCA 2CBVA 4UQDA 1KWGA 1ZBWA 3MMWA 2J75A 3RO8A 1R86A 1VFMA 4OOZA 4WSKA 1V02A 4GQRA 3HU7A 3AMLA 4PMUA 2WBGA 1H4PA 2J8GA 1EOMA 1HJQA 1CXIA 1FHLA 1UD2A 3MV11 4H7VA 4J7RA 3VU2A 1JD7A 2W62A 2VL4A 2VI0A 3ZIZA 4AY1A 3ZR6A 5CLTA 3ARZA 1KR1A 1UR0A 5DEZA 1GQLA 2E8ZA 3AMCA 1XH2A 4UFLA 2XWDA 2BHYA 1CWYA 3MUY1 4FLOA 1VAHA 3AZSA 3WN6A 3F4VA 5LA0A 3EDJA 1GQIA 1BGGA 3OLEA 1JFXA 2J77A 1B3XA 4HMCA 4GO9A 1BYDA 2J7BA 2WC4A 4UFJA 2WMIA 4AZ5A 1H5VA 1TG7A 2JALA 1BF2A 1UWUA 4U5KA 1UWRA 5BXTA 1FH9A 3RILA 1B90A 3W27A 1VJSA 1V6WA 1ITCA 2D0GA 3VIJA 1V6XA 2E3ZA 2ZX6A 4PTVA 2WHKA 4PMRA 5FOOA 3QHOA 3GXFA 8CGTA 4DUVA 2VRJA 3WD4A 2GJPA 1C7TA 1KQZA 3VGGA 2J62A 1O6IA 2ZOXA 1EA9C 3VOCA 3BSGA 1ZB5A 4GZEA 4JFUA 4P7RA 4QLKA 2WMIB 2WKLA 1CDGA 1UD6A 3WH8A 1EGZA 1GVIA 1GQJA 2D24A 1ISZA 2UY3A 3W53A 2F8QA 3VPLA 1JDCA 1OGBA 3NSXA 1WB0A 5LA1A 4J27A 1JXJA 1J9YA 3VNYA 4W93A 2X8RA 3WQ5A 3MMDA 2DIEA 3N15A 3WQ8A 4PMYA 3VD4A 1PX8A 3BC9A 4HA4A 1HT6A 3GTNA 1VJZA 4PMQA 4KRUA 3SCWA 2VZUA 5LYRA 3POHA 4PCTA 3A4WA 1V0MA 1LG1A 4L4OA 5BXRA 4ML4A 1UR2A 3CMJA 4MJ4A 1UHVA 3ARTA 3ZM8A 1K6AA 3SCPA 3M7SA 1UA3A 3WH9A 2VVNA 1V0NA 3RIKA 1E0XA 1E6RA 1EDTA 1C93A 2E8YA 5CZKA 3VILA 4GI8A 4MDOA 1JYWA 5CLWA 4M29A 2QPUA 1R85A 3B9DA 1HKJA 4OKDA 2ZUMA 1E6ZA 2UY2A 3WMCA 4J3XA 1W9DM 1E5NA 1V6UA 2BY0A 4B3KA 2WNWA 2XHYA 1VEPA 4QLLA 2BVDA 4AZGA 1E73M 1Q6GA 3T08A 3BH4A 2DT1A 1E1FA 1BFNA 2PBGA 3F5JA 4JKLA 1WAWA 3L2LA 4AZCB 2BVTA 2CPUA 2CKRA 1WNOA 1R7AA 5I24A 3THCA 2IUZA 1NOUA 4N42A 4ATDA 3EBVA 1M7XA 2EXOA 3QR3A 3L4VA 5A6SA 4IPLA 1HX0A 4FLQA 1MFUA 4M1RA 3AHZA 1WKYA 3T2QA 4M82A 1QI2A 4F9DA 1XH1A 1HF6A 1OBAA 1MQQA 2G8ZA 1E0WA 3DHPA 3VX1A 2YL5A 4QP0A 3SUUA 1J12A 4N0RA 5E0FA 1RD6A 3J7HA 1C91A 1NH6A 2PBOA 3O9NA 3F5KA 1JZ8A 2F2HA 1J01A 2ZUTA 1PZ3A 5A94A 1W32A 1BYBA 1HVXA 3APGA 3IJ7A 3AIRA 3AOFA 3WH7A 5E0CA 1V3IA 4KWUA 4WLCA 3VDBA 3VDHA 4U2YA 4Q22A 2GJXA 3GH5A 5A2CA 2YA0A 3W81A 5JBDA 1CXKA 5JBFA 5A95A 3UCQA 3WNNA 5M17A 5HOSA 4AD4A 2OWCA 4CCDA 1WP6A 2FDMA 2WVVB 5A8NA 1PJ9A 1HN1A 5HXMA 3PZVA 4PMNA 4YN5A 1KCKA 3PZ9A 1E3XA 3PZGA 2YOCA 4UTFA 3AMKA 1WDQA 3HMCA 1TCMA 1JNDA 5AYBA 3CUHA 1F4AA 4RE3A 3PBGA 3VIHA 2PWFA 3RM4A 2DH2A 4F79A 3WNMA 1US2A 2WLYA 3KZSA 3SUTA 3ZR5A 2X0YA 2Z1SA 1CXHA 1ODZA 2VT0A 1U33A 4HOWA 2IXUA 1J0IA 3N18A 1JYVA 3VD7A 2DSZA 3MO4A 3TTSA 4KMQA 2XYLA 1XSKA 2Y2WA 3WL0A 3POCA 1KXHA 4CU7A 1CEOA 4DWSC 2D20A 2ZWYA 4GI6A 4W84A 4PRWA 1M01A 2WVVA 3CHCA 3NCOA 1W2VA 4Y7EA 4ATWA 4AZIA 3GZAA 4JFTA 1HJSA 1UA7A 2VRQA 1DP0A 4PMOA 1GOQA 2XSAA 1BHGA 3GBEA 2BXZA 5ABEA 1F4HA 3GXMA 1CGUA 4U3CA 2WCGA 4OBRA 4KGLA 1G9HA 1UQYA 4UQEA 1E3ZA 3W37A 1JD9A 5E6YA 4MNJA 4PTWA 4B15A 4H41A 4TVUA 1GOIA 2WHMA 4FLSA 3ZT7A 3JUGA 1MFVA 3AS1A 1QNOA 1GVYA 3CZLA 2XVPA 2BV9A 1OGGA 1VRXA 4NF7A 3VO0A 2DGAA 1W3JA 4CD6A 2VURA 4HZ8A 2ZXBA 2WMKA 2JE8A 4FF5A 2J7CA 2XM1A 1WPCA 4FLRA 3N11A 5CSYA 7TAAA 1MXGA 4U5IA 2WW5A 4U33A 4MPKA 2GJRA 3ZJ7A 5C70A 2QMJA 4Q7NA 3VDAA 4M81A 5CPQA 4ACZA 3LPFA 2PWEA 1Y7VA 5EMYA 3AXIA 1CXLA 4OJYA 2CIPA 4JFSA 3D5HA 3WFLA 1A47A 2YL9A 4DWSB 2D3NA 3WDRA 2V3FA 4BQ3A 3CPUA 3VD5A 3AZRA 1D7FA 4QCEA 1OB0A 4NI3A 4J3VA 1UH2A 2WMHA 1W1PA 2ZUWA 3NIYA 1W9PA 2D22A 1I1XA 2ZX9A 3SUWA 3AI0A 1NWRA 3ARSA 3WEMA 2Y5EA 4LXFA 2BHZA 3OLGA 1YQ2A 3I3DA 1UR9A 2J7GA 4OUEA 5CSUA 3GDBA
chains in the Genus database with same CATH superfamily
2Y88A 4L4LA 3MVIA 3IUIA 4O1EA 3G1SA 5KZ6A 1H0IA 4C6CA 3LXBA 1A49A 5DT5A 1TPEA 3KVJA 2W6RA 4DJDC 3BCFA 2PGEA 2VEFA 2WHJA 4HPJA 1PKYA 3A3WA 3CBWA 9XIMA 3UQNA 3SY8A 2C16A 3VOJA 1IZJA 3BAKA 8A3HA 1S3TC 3VINA 3VDGA 1G1YA 5DMLA 1ZJHA 4C6BA 2FGLA 1NWTA 1BG9A 2E1WA 4ZTYA 3CZEA 1V8EA 1FVPA 3ZT5A 4JNYA 1XLKA 3WNLA 4IJRA 2R82A 1OX5A 1UZDA 4M24A 1RP9A 1S38A 4I7UA 2D2HA 5I7GA 1T7LA 2VYOA 1E4IA 3STCA 3CZKA 3W1TA 3LM7A 3U9IA 4DWSD 3FJ6A 2XGBA 3EKLA 1G7UA 1WZAA 1A5MC 3A47A 1KM6A 1C3FA 2AAAA 2PDNA 3EEGA 3MC5A 4I90A 4S3CA 5C5YA 4IGSA 3OBAA 1RQBA 3OLDA 2HISA 2B7NA 1AQ0A 2HJPA 1L2UA 5AHLA 3QYSA 3D3AA 1TB3A 1SW0A 3W71A 4BQ5A 1CENA 1GKRA 1GOOA 1I4NA 4XTDA 4WR3A 3I7SA 4OTKA 4RXGA 4AF0B 1SJCA 1DJQA 1Z8AA 4HA0A 4MAZA 4B9YA 2BSLA 1UH4A 1UWQA 1QK0A 4DZ5A 4PTNA 4W87A 4IM4A 1DL3A 4O1DA 2BXYA 1EQCA 3N4AA 3ZWTA 2WSPA 4Q4RA 4J4KA 3H7VA 3M41A 1C90A 2NWSA 4O12A 4R7WA 1AW5A 1POKA 1VFUA 1WQ5A 4RDYA 5LIUX 3LNPA 4C6DA 1M1BA 3QN3A 1AQFA 3UA3A 2XWEA 2LLEA 1OZMA 3CIWA 2OGJA 3NOEA 3IJ9A 6PTDA 1QVBA 2GQ3A 4DZIA 5K3VA 1SMAA 4JL1A 1F8IA 4DI8A 3O2LA 1VFLA 2PA6A 4BKNA 1XI3A 3VCNA 2QLYA 1QBAA 1XKYA 4JY9A 3FXGA 4NAFA 1KGWA 3LYEA 1UD4A 3C4UA 1O94A 2OELA 3SI9A 4ECLA 2Y63A 3FEMA 2WOQA 3K5XA 1B3WA 1EH9A 3KLKA 3ABXA 1FHUA 4FNTA 4A22A 4CVUA 3T78A 4NRSA 2VGGA 1EJVC 4B90A 1V4YA 1CGXA 3EYPA 2X1IA 7REQB 4C7DA 1Q6CA 3B8VA 3PZMA 3NOYA 2RKXA 3NPVA 2DH3A 3PJUA 3E0VA 3EB2A 3U5UA 4BJHA 3FA5A 1UUOA 2D2OA 3NAVA 5EB8A 4CD7A 4Y8EA 3R79A 4GY7A 1IEQA 4CKQA 5EA9A 1EL3A 2YA2A 1LT7A 4Q6XA 1TPDA 2QF8A 4A3YA 3C5QA 2O7SA 2ABBA 1SGJA 2X41A 2FJUB 3JR2A 3UNTA 3AMDA 3VGFA 1KBBA 2E6FA 5E9XA 1KM4A 3BMVA 4LF2A 4CU6A 3CHEA 4R5EA 3BG9A 3W75A 1PIFA 1TTQA 1A0CA 1TPUA 1OX4A 4LUSA 2XVLA 3C2YA 2EJ1A 3WD2A 2V5JA 2X0HA 5AZ0A 3ECQA 1VC4A 3OIHA 1LP6A 4AZ7A 3NJ3A 1JDDA 3AYSA 3SRFA 4PCPA 1Z3NA 3OU8A 4REQB 1T99A 2PTZA 1J0KA 4Z1DA 2OSYA 4D6CA 1I45A 1JAKA 3WJWA 2KX9A 2NXGA 4D9PA 3EWXA 1ONXA 5JU6A 3ZMRA 2VJXA 1K70A 2E4TA 5CG0A 3N4FA 2DUZA 3JU2A 3FHQA 3PNZA 1JL8A 5DO8A 3UZZA 3N6HA 2YBTA 3AHTA 3FW6A 3VMOA 4P8VA 3VIMA 2OGYA 4GC3A 3F4DA 1HFBA 5HAOA 4J3TA 4WCJA 5JIWA 1CIUA 1TIMA 1YE4A 4CQAA 4TX9A 4ZXOA 5BRPA 3ATZA 2G4JA 1SO6A 3QY8A 2VEMA 5G1MA 4A05A 1OIFA 1PZ0A 3M5YA 2GYIA 2VMFA 4L80A 2D23A 4HK7A 4GCAA 4L56A 2IW0A 1E9IA 3GG7A 1QUMA 2C14A 3W29A 1TRIA 3WQCA 3UFYA 3ARYA 4J28A 4O4WA 1ZHAA 2ZA2A 1I9CB 2OLHA 4GJIA 5AC4A 1E5JA 2QDHA 4IICA 3KCOA 5CGQA 1EDGA 2CBIA 3BLPX 2V5KA 5KZEA 3P0XA 1TWWA 1RQHA 3MP5A 3UF9A 3TOYA 1BVWA 2X7VA 3KP0A 2XINA 5KTLA 4WOZA 4DEFA 1ECEA 3NPWA 2P0IA 1U2YA 3COTA 1FFRA 4F8XA 4X0NA 3C0SA 3VOFA 1MW1A 2V9DA 4OGZA 4BQ2A 3TC3A 3D47A 4JTJA 4BI5A 1I6NA 4AD2A 4TMBA 1GHRA 3MZNA 3NG3A 2QCNA 1LYXA 3PZIA 1U30A 1NP2A 2OYLA 4Z1BA 1CTNA 1FDZA 3PPGA 3VMPA 2ADAA 3GIQA 3CT7A 1YXCA 1EBGA 1TCDA 2J9XA 5EMKA 4QAIA 4PUEA 3EWDA 3DFOA 3MMUA 3RLVA 1HO1A 4UTHA 5K4ZA 3MT1A 3WQEA 4K7YA 1C8QA 1I75A 2NZLA 5I2UA 2V5CA 5JH1A 3S5OA 3NR0A 4B4FA 1ZAHA 4KKXA 1XIMA 3W1XA 1VJIA 3TROA 4NZ1A 5BOFA 4TIMA 2GJLA 3O3RA 1XLEA 2DSUA 1EC8A 2ZIDA 3MWAA 1VF8A 2ZUSA 2G41A 1MQPA 4GQQA 4HNCA 3WDJA 5BMXA 2FH6A 2ACSA 3FAXA 1XUZA 4NNAA 4S2BA 1MWOA 3QKZA 3WBXA 1NQ6A 2RGMA 1RALA 2CKSA 2ZXDA 3CEUA 1OWQA 3W02A 1LCOA 3FN9A 3QHMA 2Q3RA 4V33A 3WLQA 5DQPA 4M6VA 3VAVA 3KBMA 4DXVA 3LTYA 3IGXA 2RFGA 2XUCA 3MCNA 3QHNA 2WO5A 1Q3NA 4DBEA 2Y24A 4UOQA 4WKHA 4NHVA 4FX7A 4IJBA 3L23A 1GVRA 2A1YA 4UUIA 3B8SA 4AC1X 4L1XA 2XFRA 4E2BA 3FJLA 1NF0A 1OFPA 1RH9A 3MANA 4AU0A 4ZENA 1XIBA 2JGYA 1E43A 3K8MA 3O07A 1VRDA 3W1AA 1TTIA 4P7OA 1PZ2A 2MANA 1GCYA 4FPSA 4EWND 5CPLA 2V3GA 1UKPA 4PGLA 1MNZA 4GZJA 4CQDA 3CUFA 1V51A 3DI0A 2W3ZA 3W72A 1GHSA 2FB3A 2VC6A 4PC8A 3CC1A 1D3GA 4S3DA 1ISVA 4YCPA 6CGTA 3ONBA 4G8TA 5BWFA 2OJPA 1JPMA 3I3EA 1BWKA 1TV7A 4HMEA 4D6GA 2EGZA 3FVDA 4PUMA 3RR4A 1KXVA 1SFTA 4LV9A 1U5JA 3VX0A 1M9HA 1CYGA 2G3NA 2WCAA 4MY8A 2Z0IA 5F4XA 3EWYA 4Z1CA 1EJ7L 3KL3A 2MUCA 3WEZA 5IFTA 3OIXA 1TMLA 4PCNA 3N17A 3GZ3A 3XINA 1Q6OA 1F3XA 2HDJA 3B9EA 2J4GA 4JIPA 4LRTA 2HSAA 2HS6A 3WSUA 3BL3A 3H4XA 2ON3A 4H3DA 4W89A 3VE9A 5BCAA 2NQ9A 1FP8A 8RUCA 1GNXA 1SJAA 5EMUA 4FMVA 1QHZA 1HL9A 2VEKA 2CCRA 1VENA 1GG1A 4PFHA 3LMZA 5H91A 2JK2A 4EX4A 1A3XA 1RVKA 1MZHA 4YJ5A 1ALDA 4RNHA 2Z1WA 2PTYA 1ZBKA 3FV9A 4RXFA 3AROA 3HPFA 3GNRA 3P7YA 1XIJA 2VX6A 3L4XA 5EMJA 1A5CA 1JGIA 1JZ5A 4W88A 3DFPA 2QHAA 3A12A 3MCMA 3NZPA 1PYFA 3CJPA 3VYLA 3LGDA 2IPGA 1SO5A 3VUPA 4IMAA 2BG5A 3H21A 1E70M 3R13A 3D0CA 1G4PA 3WENA 1WDSA 1LQ2A 2WWDA 5BYWA 2GJNA 3A4XA 3QMTA 4GJ1A 4IOTA 3ZT6A 1XLBA 3DECA 1SW7A 5FJUA 4UFHA 1SZGA 3AFBA 1T8XA 4H6EA 5IHRA 1G01A 1JNEA 1E1EA 4RR4A 3TAOA 4ZB0A 1PX3A 1XDMA 2HROA 5D2XA 2VR5A 1EO5A 1RPXA 2PDPA 2V5LA 2WCSA 1O4UA 3DFSA 2CBJA 1V6TA 1K9DA 3ABQA 1NSJA 3Q67A 4DUWA 4JQ4A 3UG5A 5AOUA 3WF3A 2WK2A 3NO5A 4ZA0A 4IXXA 4R9OA 1B4KA 3W4RA 4ZQOA 3E38A 1PL9A 2PTWA 4E2VA 2OO6A 3FKKA 2PP0A 4ASTA 2CERA 3ME3A 3WLKX 2O9OA 1QR7A 1Y5VA 2VVSA 5FL0A 3NZRA 3B8DA 4WZHA 3CUZA 2OXNA 3FYPA 2VENA 4F3HA 3KBJA 8XIAA 4GIYA 1PDZA 2XN0A 1OFOA 4XBSA 4W5UA 2FVKA 1XRFA 1KRBC 2QAFA 2XN2A 3N9SA 5D8ZA 3Q37A 1KTNA 1MSSA 2YA1A 3KW3A 4KF1A 2DQWA 4JTSA 4F0LA 1X96A 5D32A 3ZQ9A 3UJRA 3HMJG 1Q6DA 4ZO9A 4J1OA 3VKKA 3QC0A 3WNPA 3JZUA 2DZBA 2CZVA 4LS2A 5CJ5A 1ZY9A 1KWKA 3S4TA 4TVDA 3WIJA 4AD1A 1GK8A 2W66A 4K68A 4QFUA 4WVXA 5HA7A 4V15A 3M0VA 4QAWA 1XINA 1XLMA 1O1ZA 4L4PA 3AU6A 3URQA 4Z17A 3S8HA 1XW8A 1R46A 2BOFX 3TZFA 2DVUA 4MJMA 1BYAA 3N2XA 2YCIX 3PZNA 4JDBA 1F61A 3H70A 4HHMA 2J7HA 4IMGA 5A6JA 4FOKA 3LCGA 4IMCA 5DXXA 2Q09A 3WQGA 1CXFA 5FEPA 2D0FA 2OX4A 5C9WA 3UYIA 1MRQA 3DOPA 3GVWA 3N6JA 3N6QA 1E72M 4OOUA 4RJEA 5G1TA 4WKAA 4HA3A 3W07A 2EG8A 2EQDA 1EPXA 3QZAA 1IV8A 2D1ZA 2IKIA 2AQVA 1QNPA 4RCXA 5AHIA 4E3TA 1XIGA 4YTTA 1ZCOA 1QHOA 2ZWZA 4HSNA 4GXMA 3CL6A 2PTXA 2DY3A 3KRBA 3GIYA 2J79A 2JIEA 4HBKA 3SCOA 3N2BA 4MOZA 4ADUA 4WJEA 3URBA 1J2WA 3F5LA 2Z2UA 3AC0A 2H9AA 2YGYA 1L0PA 2J7DA 3OHMB 2PZNA 4ZEPA 3DKJA 2UZ9A 1H11A 1EBHA 3C0LA 4RW3A 4PB5A 4URIA 2FZBA 3PZUA 4XX6A 3N34A 3S2NA 3WUGA 1TYGA 4ZE4A 1C8XA 3DYMA 3GFZA 9CGTA 5DFAA 4WGHA 4GVGA 4H6RA 2Y89A 4H7ZA 3MMTA 2CEQA 3RCYA 2J6XA 1ZCCA 3GVVA 2OU4A 2F9RA 2OTDA 2I5GA 2ZX5A 4KEUA 1B54A 4CVWA 2PGWA 3RF9A 1GYMA 1W1IE 2QCLA 2V82A 3G1HA 1GEQA 4DNMA 3NSMA 2WQDA 1CXEA 3CUIA 3ZVIA 3MCOA 3UY8A 1J0HA 3PBMA 4U10A 2QCFA 3LOTA 2FZDA 2WVUA 4JIQA 1CBGA 3TLLA 1HJWA 3LDVA 2I16A 3C0QA 1KM0A 4XZNX 4O50A 3HJZA 1ICQA 3N13A 4US6A 3HM7A 4ZBCA 3GE7A 1H41A 4DELA 3B8WA 1UPPA 5LHFA 1IT8A 4LWWA 1FOBA 5IBXC 5DLCA 1Q6LA 3NL2A 3H23A 2YIHA 3H7RA 1J8VA 2D3LA 4G9PA 3U2EA 1XLIA 3F4CA 3TSMA 3VGDA 5HUPA 1ITXA 5HULA 5CGTA 5LGZA 3WQFA 5JBEA 3FA4A 2Z29A 4TQTA 3REQA 4FNPA 5E9AA 5BU6A 3VOHA 2DIJA 3RDKA 2YFOA 3TAKA 3QGVA 1KLYA 1XYFA 1LDCA 2CWXA 1K4HA 5A6LA 4NXSA 2VFHA 4ZOBA 2DPEA 4CCZA 2YR1A 4XWUA 3SCNA 3T09A 1X1OA 3MP3A 1E55A 4S3JA 3GXNA 1F05A 3VIGA 1FH7A 1NIUA 2VX7A 3NTYA 3EMQA 4DO6A 4G7EB 4NSBA 2GVJA 1JCTA 2GWGA 5G2HA 3PG9A 3BMWA 2QQ6A 2CETA 3CZGA 2FHBA 3VCRA 3W73A 2PWUA 2NWRA 4MFDA 1P1MA 2VRKA 4HZ7A 4M51A 4UTKA 3WD3A 5CAHA 1JCYA 4CQ9A 4LANA 3C86A 1JAEA 1V79A 4LAZA 2JEQA 2VO5A 1SVDA 3ALGA 5LHEA 3G1RA 1TWIA 1HJVA 2QDDA 5CXPA 1JI1A 3ITXA 2BLEA 3ZJKA 1VFFA 5CPSA 2A79A 4FNUA 1LT8A 1MYRA 2ESCA 3GH4A 4R33A 3SUVA 3TW9A 2H8ZA 4ZR8A 2A3EA 2VHLA 1FY6A 2CU0A 2ZC8A 1WXYA 3RJXA 1V77A 3FGCB 1K9FA 1XYMA 5FF0A 2PDBA 4U2ZA 1H1NA 3ABZA 1R47A 4HMDA 1EC7A 4FOJA 4NZ5A 3O8AA 5RUBA 3H7UA 1O1HA 5AY7A 3C3UA 4KEMA 1JEZA 2OEJA 3VA8A 4ENLA 4RLIA 1DIEA 3GK0A 1GJUA 4D6EA 4ZOEA 4G5DA 3OBKA 1FFQA 3OZMA 2OG9A 4O4VA 3FLUA 4HU3A 3SUSA 4DYEA 1X1NA 5BU9A 2G37A 3FSTA 1DIKA 3NA8A 1UWSA 3TTOA 5IBXA 3BGGA 1H51A 1DQUA 5MKGA 1XP3A 2J8FA 2WB5A 2XG9A 2QIIA 2VTFA 4V27A 4QS5A 3OBEA 1OCQA 3QV7A 4ICCX 1GORA 3UXIA 1AQMA 1DJZA 4L5ZA 2FZ8A 3M46A 4JBRA 2I57A 1T41A 2WNZA 1DBTA 3IIVA 1MMFA 4CNTA 2V81A 3R1ZA 2ZKMX 5C8BB 1K7FA 4RDVA 2GK1A 4ZFMA 3U57A 4H04A 1J11A 3NNTA 5A2BA 4GXWA 1ADDA 3SB0A 2IMRA 3T07A 2CBVA 1KWGA 3R0KA 1LUCB 1EWEA 1SZEA 3C52A 5EPDA 3TDFA 4MJZA 1K7XA 3EX3A 1V02A 3AMLA 4A8IA 4B2DA 2B4GA 3ISIX 3RLUA 1W5QA 3QW4B 1RR2A 2WBGA 1FWBC 2J8GA 4JDYA 1EOMA 1HJQA 1VKFA 1FHLA 3MPGA 5FEWA 3IGHX 2DVXA 2OMAA 4IP7A 2W62A 1M3UA 4PMJA 5M2FX 4QEEA 3ZR6A 3ELFA 4LB3A 5CJNA 1KR1A 1UR0A 3SN4A 4DZHA 3SN1A 2E8ZA 5TQLA 1CWYA 4I5UA 1QOPA 4O52A 3WN6A 2I9UA 3EDJA 1BGGA 5DY3A 4GG9A 1KA9F 4JN6A 1ML1A 1YIXA 1FWFC 2J24A 2P3ZA 3D46A 2HXUA 4L1WA 1BYDA 3MYOA 2J7BA 3GYEA 5U7SA 3TW6A 2WMIA 1LBMA 4C5ZA 2GQ9A 3ICJA 4AZ5A 4QSHA 1H5VA 1TG7A 3NQAA 1BF2A 1UWUA 3O6CA 4BI6A 4O13A 3RILA 4C1KA 3IVUA 3WLMA 2D0GA 2W9MA 4PTVA 2WHKA 4PMRA 3QV9A 3HGSA 2QCEA 2Q3OA 3GXFA 3WD4A 5XINA 4AVOA 4S3BA 1LQAA 2J62A 1R6WA 2X1SA 2ZOXA 1EA9C 3G1YA 3VOCA 2BOGX 1PUDA 3KX6A 1OCJA 2WKLA 2DZVA 1WDWA 1QPNA 3S9IA 3P6LA 2D24A 1ISZA 2UY3A 3M5ZA 3W53A 4N7QA 2PLMA 4QQUA 3NQMA 3VPLA 1OGBA 3FFSA 1RK6A 5FF7A 4HCDA 1ME8A 3VNIA 4MWAD 1P1XA 3BV4A 4W93A 3G1AA 3D6NA 4OHQA 3E5BA 3ITOA 1HT6A 3GTNA 4KESA 4D8LA 4PMQA 3S9ZA 3ZLHA 1TJPA 2E6AA 2NVAA 4C6KA 1IHIA 4LAKA 1V0MA 1LG1A 1BKSA 3A5FA 4JTKA 4ML4A 1UR2A 4M19A 4MHBA 3IIOA 4OBTA 3W7OA 1UHVA 4HJWA 3NFUA 4XAZA 4YL2A 4NAFB 1BKHA 3WH9A 2VVNA 4MPQA 5JVLA 3RIKA 3KLLA 2HWGA 1EDTA 1C93A 4O0KA 1SPQA 2YCLB 1E6ZA 3CO8A 3RX2A 1W9DM 2BY0A 1SM9A 1R3TA 1UOZA 1QATA 2ALDA 3KHDA 3PBUA 1E73M 2VEIA 1QWKA 3UJFA 4S3EA 1GVFA 2HE8A 1E1FA 3NZ1A 1G4EA 2PBGA 4JKLA 3GVRA 5TAOA 2GOKA 1M7XA 2Z1VA 2I1OA 3W3OA 2GGIA 4XSMA 5A6SA 1FWIC 3HPXA 3TYBA 4M1RA 1PKMA 4GOAA 3SSZA 4F9DA 1DVJA 3M6YA 1HF6A 1KFKA 3DHPA 3RG6A 2QCDB 4JTAA 1OYAA 4UTTC 3R7MA 4AFYA 1GJPA 1JPHA 2CZDA 3OA3A 3J7HA 3O9NA 2INFA 2ATMA 3F5KA 3BANA 3ITYA 3L9CA 5BMWA 1W32A 2V2HA 5CC6A 1BYBA 4RPQA 2EG7A 1KFLA 1P43A 3AIRA 1JCMP 5HMEA 1QOQA 1YEYA 4ZOCA 2OODA 1CXKA 2PGFA 4J35A 5JBFA 2RDTA 3QGAC 3ONCA 4MYXA 2QJMA 4IP5A 3C2VA 2A85A 4CCDA 3GNXA 5A8NA 2NUYA 1PCKA 5HXMA 4PMNA 4YN5A 4QJ5B 4IQLA 3PZGA 4NXKA 3RITA 2Y5JA 4ZZ9A 2ZZ4A 4YLWA 3SGZA 4UTFA 2A5HA 1TCMA 3HMCA 3M0IA 4NJJA 5AYBA 3CUHA 1OY0A 1F4AA 3RU8X 4RE3A 3TR2A 5D38A 2DH2A 4DJFC 1PYMA 1Z42A 3KBSA 1J0IA 2QCHA 3VD7A 2DUXA 1L6SA 4UB9A 4IL0A 4AY7A 4NJIA 1W8GA 2XYLA 4KMQA 3TLQA 3R58A 3LTPA 1FDJA 1AODA 1TE6A 2A6LA 5LIWX 1SSGA 2C79A 3IRSA 4GH1A 1CEOA 4LF1A 3RK8A 3H22A 4JS3A 3TMLA 4GI6A 4XKYA 4J40A 3OQ8A 4W84A 4PRWA 1M01A 4I9TA 1B4EA 4BEUA 1W2VA 4S3AA 3A3XA 2I9EA 1HJSA 1UA7A 3KAOA 1HTIA 2VRQA 1DP0A 1QCWA 3WLNA 3GBEA 3T8LA 5G4EA 3T55A 1V7YA 1CGUA 1YXDA 4RUBA 2G97A 3PNUA 1G9HA 3CIXA 1HGWA 4NZ4A 3N9RA 3O6DA 3HV9A 4JIIX 4MNJA 1H61A 2OOFA 3PVFA 3ITGA 3JUGA 4HSHA 1JCLA 3BG5A 1M7PA 4I9AA 3H2CA 1AL8A 1JCNA 3LCFA 1WA3A 1R3SA 3VKDA 5REQB 1XIEA 5FAJA 1OFQA 4Q4MA 4OV9A 3PTDA 4G2DA 2EPHA 2VURA 4HZ8A 2ZXBA 5C9ZA 2XM1A 3LXCA 3UNDA 4RZBA 1KFCA 1MDLA 1F6KA 4GUHA 5CSYA 1UROA 4YVPA 3M1ZA 2E5BA 2WW5A 2GJRA 3ZJ7A 5C70A 4UR8A 2PD5A 2QMJA 4LC6A 4ACZA 1Y7VA 2XZ9A 5I02A 3GC2A 4JFSA 4HHPA 4B5XA 5HWNA 1A47A 2AL1A 4BQ3A 3CPUA 2G3FA 2X30A 1OB0A 4FF7A 4NI3A 4L65A 4EP8C 2ZX9A 1VQTA 3SUWA 1A5UA 3AI0A 4FIQA 4GBUA 4LXFA 2ZZ3A 1UR9A 1BTMA 3ARWA 4EPDC 4DVOA 2CLHA 2XGIA 1QI5A 1KXTA 1W31A 3H4WA 3CIVA 2BY1A 1HKVA 3RMJA 1W56A 1YYAA 1LL6A 3ES8A 5BWAA 3M0YA 3S1VA 4O1AA 1DIOA 4ZFCA 5FJRA 5I6SA 3AJ7A 4MADA 5CC5A 3K8LA 4FB7A 1X38A 5ABFA 1H5YA 3RPTA 4GLEA 1QJWA 1OM0A 5FF3A 2UV8G 1DWAM 4AG0A 5JQ9A 3BGAA 5ECVA 4TX6A 3EWZA 1M03A 3KUMA 1G5AA 3GXPA 2I5IA 3GXIA 4QSFA 1TREA 3FNDA 3WNOA 1JJKA 2WZEA 4J2PA 3IWPA 5FJIA 2ZFAA 4DJEC 2QKFA 5E70A 1MXSA 3CPRA 1C7SA 4W5ZA 4MVAA 4US5D 1S5TA 1KKOA 4L6DA 2H8XA 3ARXA 1I0DA 4H83A 1EO7A 1KBIA 3RO6A 3DEQA 3GFXA 2G4FA 4CD5A 3DU0A 3MSDA 2FH8A 4LNCA 4CQCA 1EYEA 4MB1A 4D6IA 2WVTA 1UC5A 4EK7A 4DQWA 2ZX8A 3WF4A 5EFFA 3LM3A 2YDRA 3HOJA 3A3HA 3B04A 3CWNA 3LLDA 2C18A 3B0XA 4Y2WA 3WLTA 2ONEA 4PSRA 1XV8A 2Z28A 3GBDA 2PP1A 3CLWA 5I79A 3MUCA 4IIDA 2VQUA 1Q66A 3USZA 2J66A 4D1JA 5BW6A 3QFWA 5HMDA 2GVLA 2UBPC 4Z08A 2WSKA 2WV8A 2J74A 3IVTA 1JZ6A 2RHGA 3WNKA 5AC7A 2PGRA 2XPKA 2CLFA 4NY2A 1S2CA 2FHFA 4W8BA 1H2JA 3S1GA 1C8YA 3WDIA 4K8HA 4HYWA 4U3AA 1TQXA 1LG2A 4TVCA 3E3HA 2V68A 2EPNA 3OVRA 1YLVA 3W24A 4A3HA 3HN3A 4S39A 4H7CA 3QLDA 1ZRQA 3RU6A 4L64A 1V3LA 4UOJA 4PYSA 4EF9A 4JFWA 2WM0A 1BAGA 2OKOA 2FTYA 1YE6A 3SURA 3RM9A 2PDFA 1VYRA 4F0MA 3GNOA 1UBSA 1REQB 4QDMA 1D3HA 5LKYA 1NOWA 4A8LA 3BZGA 1RLDA 1W8SA 3G77A 1IEIA 2VM8A 1OCNA 1HP4A 1PTGA 1WO2A 2QCCA 2GJXB 1N7KA 2Q02A 3N1AA 1Q4NX 1IR1A 3GU9A 1RLCL 3QBUA 1JG9A 3O6AA 1F7BA 5FJPA 3TSDA 5A3HA 3WEOA 1MW2A 3H2AA 5A8QA 2ZCGA 1TR1A 2WC7A 1TMQA 3WLSA 1G4SA 4YWSA 3ENLA 1RCOB 3RCNA 3P14A 1G69A 3BICA 4IGMA 3LHTA 4MYAA 1GQNA 1M7JA 1WX0A 5C0QA 4JAWA 4QISA 1UKTA 3BE7A 3NDYA 3V0TA 3UESA 3VK5A 2TYSA 4I5RA 3U48A 3AU2A 3U2OA 5IDIA 1I8JA 5I3HA 4QROA 3R25A 4IFKB 2OX1A 3TU9A 1RUSA 4LVFA 3VM5A 5A6BA 3A6OA 4LH8A 1K6WA 1FWEC 2J6VA 5G2WA 3SEPA 1NFGA 2YLLA 3D3FA 1IWBA 1ZL1A 2FMNA 1GQKA 2R8WA 2VZTA 3UR8A 1CZ1A 4A29A 3WQPA 1E1CA 3GM8A 1JUKA 1Q7MA 4DJDA 2WSYA 3AS2A 3AIVA 4E5TA 1EIXA 1BYCA 4JQ2A 1GJWA 2PURA 3VFCA 4LX4A 4JEQA 3ZJ6A 1L9WA 2E77A 4H8HA 3KL0A 3AXXA 2WPGA 4BS0A 1EYWA 1KV8A 1K1DA 1W5PA 3VGBA 2PWVA 4N9DA 4HMNA 1O60A 2YYTA 1QW7A 4UIOA 4GE8A 1FCVA 3P81A 1A5KC 5KZDA 2OZ3A 5DRCA 1P5BA 2E1DA 1U5VA 1V08A 3MHUA 4BY3A 1IXPA 3T44A 1RZMA 4FXFA 2XIJA 3B05A 3WJXA 1OZQA 2AQWA 3SQMA 5CBJA 3GTHA 2E9LA 2WJEA 3LCWA 1TZ7A 1IGSA 2PODA 2YDQA 1EXPA 3L0KA 1PIIA 5F2IA 3KZPA 1LL4A 3WELA 2E40A 4GUFA 1EPVA 4DX3A 3W2UA 4HOXA 3MUIA 4G56A 2ZRYA 4P8WA 4L1GA 3VC6A 4XIAA 1TVPA 5AYZA 2NT0A 3L66A 1ZBCA 3LPOA 4JTGA 4I8DA 3SGUA 3BAXA 4PULA 4QJ4B 4L9XA 4Q8NA 1WXZA 1P0BA 1CPUA 5AC6A 2E28A 1KM5A 2JIWA 1UH3A 2YDAA 5LGXA 2XIQA 3AIQA 4OVXA 5HBFA 3LBOA 1X8CA 1E9YB 1J5TA 1SJDA 1VPYA 4RE2A 3NQGA 2IKJA 3QW3A 3RX3A 1QW8A 5D9OA 4NRRA 3BOXA 3KCLA 3C6CA 4M3PA 1XQKA 1B30A 3BAYA 1B3YA 4NAEA 4E8GA 1QAPA 5A8OA 3I7RA 4GVIA 3UPWA 3TYEA 1QPOA 2QMKA 4ADTA 4EKJA 3HV8A 3IJDA 3GAKA 4XO6A 4JX6A 1ENUA 3H2FA 2E6YA 2TSYA 2OYMA 4DBUA 3SY5A 1R2RA 2ZZ1A 4NJKA 1JZ4A 4UCGA 5AHNA 2EG6A 3NYZA 3WDHA 4H00A 1ONWA 4PFMA 2YBUA 1KB3A 3N29A 2Y7EA 5GPRA 1BXNA 5HNNA 3LI0A 4M8UA 3R0DA 2DSWA 1Y0EA 3KVLA 4LT9A 3LX9A 1Q4WA 1TKKA 3TMQA 3WLLA 2CLLA 1KGUA 1W2PA 4C1NA 3Q45A 9XIAA 4DPQA 5D02A 3NGJA 2C91A 4WD0A 1NFPA 2QW5A 3N12A 2P88A 1X7FA 1DTUA 4D6DA 4D72A 1KCLA 3EX1A 4XZBA 1Z9AA 3ORWA 4M7TA 4F0SA 1TV2A 3P60A 5T9CE 3VFLA 1OABA 3ZSTA 1FWCC 4Q8WA 3WH5A 3NDZA 3MBFA 2UY5A 4ZCWA 3CQKA 3UZJA 1J93A 3TA6A 1FRBA 4W86A 2EPMX 1YNYA 4X9YA 3AIUA 3RCMA 1U1UA 1R8LA 1DWGM 2YB4A 1OYBA 2R1KA 1LM1A 1TJ2A 2WNNA 4MJ2A 3HBLA 3DC0A 1PHQA 4GNKB 1A3HA 3NQ7A 1EDQA 4QR6A 4C1LA 4Z2LA 4ICNA 2YCKX 3SCVA 3MO7A 4XBJA 3EDFA 4QRNA 5F4WA 1XYZA 3K4WA 3MKKA 3UG3A 3E1F1 3AZTA 1ONEA 5EBUA 5PTDA 3WQDA 4MKVA 2ICSA 4BQ4A 3W7EA 2YXGA 4QE4A 2YX0A 2B81A 3N3MA 4JEJA 1NVMA 3H8AA 4MM1A 1NAL1 3GTFA 2XFYA 1A4LA 1QK2A 5H2ZA 4NZJA 4DAFA 1XLAA 1YNPA 1V3JA 3CHFA 3W7PA 1IIHA 1YXYA 5AN7A 4ZL1A 4JTEA 1WBHA 3K2GA 2XN1A 3W1UA 4HPXA 4R88A 3T40A 6XIMA 3VE7A 1MEHA 1RAKA 4WSHA 4G1NA 3NQBA 3I6TA 4AC7C 2WJZA 1LLWA 3UZ5A 2V3DA 3ZLGA 1CNVA 3TTQA 2C1HA 3APTA 5FJTA 1PPIA 5B7ZA 2GL5A 2G3MA 3TWBA 2GOUA 2ZX7A 1H7OA 1KNWA 4PE8A 1A3WA 4PB4A 3I10A 4F2BA 1US0A 3OG3A 4CEXC 1R3QA 3H2EA 1YTEA 4F4RA 1FWNA 3RR1A 1R3RA 3SCUA 1WDRA 1TVLA 1B3VA 5KEZA 1P6WA 3O06A 1B5TA 1N55A 5E5CA 1VCVA 5BZAA 1AZ2A 4YYFA 1PX4A 1B31A 1H49A 2WZMA 4PTXA 3UY7A 3T0BA 4BF9A 3VZZA 2ZVRA 1MW0A 1VHCA 1F74A 5HPOA 1AMYA 1XC6A 5CPMA 2F6KA 4AWTA 4IIFA 2XVGA 5FJOA 3MYPA 1AD4A 5CZ0A 4O19A 1X6LA 2WC3A 3TOPA 1RJQA 1U1HA 4HVXA 1P6BA 3B9OA 3HIJA 2POTA 4JTQA 3UETA 1X6UA 3MUZ1 5L6UA 1DV7A 4GYFA 1XC4A 3LGGA 4Y9MA 4GKLA 4R27A 3OOQA 1XYAA 2L5HA 2P0OA 2H90A 1ZS2A 2BHUA 2OVLA 2DZSA 2AAMA 3BLDA 5DXYA 1JF6A 1BF6A 4S38A 1UWIA 2Z6IA 4RDWA 1V02E 4TR9A 3Q94A 4RE0A 1SZNA 3KTXA 4MNKA 5EMLA 4ZGYA 1CT5A 3VCCA 4FR6A 4AWUA 3STEA 1XLHA 4ROQA 3CQ0A 5BROA 1KGXA 2F6UA 1TJ0A 1FHVA 4Q33A 5I3DA 3SIZA 1XSIA 1L2QA 2E09A 2CXGA 1LWHA 4GHRA 4KEVA 3W84A 2IQ0A 3GHUA 2MNRA 4UQCA 3CO4A 2HXTA 5A6MA 5FIPA 1QBBA 2PCEA 4WXYA 4L7ZA 5CBBA 4R53A 3QH2A 1MUCA 1FKXA 4CGTA 4HB7A 4C6IA 1OFEA 1VBJA 3DKLA 4KT2A 1DIDA 3NZGA 2JFEX 1GUVA 3NQFA 4MSSA 2X1RA 1U1JA 4H9UA 3CPGA 4LVDA 1NM9A 5G4HC 3IACA 2XSBA 3PB0A 2OZ0A 3BVJA 5AYYA 2CESA 1MQRA 4HP5A 3WLPA 3USBA 1J96A 3WQOA 1JPIA 5LNUA 4LNYA 1BRLB 3H55A 2HQAA 1EKOA 4GVFA 1QI4A 1WKEA 4PEEA 1W1ZA 3AWOA 2A2IA 2GGEA 1JIBA 4HOZA 4FI4A 2RUSA 3DG7A 2GSJA 4YHGA 4UZSA 1VD6A 1DORA 3DDMA 3DBPA 1E6PA 1DHKA 1K9TA 5C7VA 3AALA 3T2OA 2AGTA 5D2YA 4H9ZA 1U83A 3W7KA 3S2CA 5I03A 5C2CA 1K9EA 2XH2A 3E2QA 1PIGA 1QOXA 4FNRA 1DQXA 1GKQA 1UD5A 4P7LA 3G22A 2Y8KA 2DORA 3TH6A 1J4EA 4FNSA 4UMCA 1BSIA 1DJIA 3K8KA 1ZP4A 4PRRA 1A0DA 3V35A 1ODUA 3KWXA 1H60A 2CZ5A 3WUFA 3HG5A 4EE9A 4UCFA 3WD0A 2YZ5A 4HCHA 1XG3A 4WKFA 1W3HA 3ZXWA 1E6XM 4OE7A 3GQYA 4RW5A 1FBAA 1UZ1A 3P61A 4N02A 2C7FA 2J27A 3GTIA 3NXFA 4WGXA 6ENLA 2VZVA 1JVNA 2R1NA 2Y7DA 3EKGA 3U7BA 3U5YA 2WMFA 5JUVA 4B5NA 2YB1A 1RA5A 3W7MA 4P8XA 1JZ2A 1LWJA 2V5DA 1A4MA 3TYZA 4JXCA 2AL2A 3GKFA 3AHVA 3TSBA 2NX3A 3TN5A 2HPMA 3UCCA 3B9AA 2PF0A 2CLPA 3NUKA 3CASA 1QXLA 4BCEA 1OT1A 4JR5A 3UJ2A 1UUQA 2HBXA 4KERA 2NLIA 4H6QA 3TTYA 3WQ4A 4C5YA 1OF8A 2PRMA 3HGOA 4Q4QA 4WOQA 2GFTA 4AIUA 3O16A 1O95A 4WIWA 4LTSA 4CNNA 2O9TA 1OT2A 4ERAA 3K4DA 4IFRA 2W5FA 1I2QA 1X1ZA 3WJZA 1XFCA 3VM7A 4KFNA 1O66A 1XWYA 4JCMA 1DE6A 2AOSA 3TTEA 5I00A 2P8CA 3R2GA 1QNSA 1GOWA 2OEMA 3EWCA 4MF4A 1Q6RA 4LAOA 1JPKA 3UWWA 1FKWA 3L5AA 5GJPA 1DE5A 2X2GA 3P3BA 1Z89A 3QYQA 3E2RA 1B9BA 1RSCA 2VGFA 4IPNB 1FCUA 4M1BA 5XIAA 1G94A 2E5CA 3GXDA 5D2VA 4S23A 4AEOA 4KBXA 2QJGA 3PN8A 2BVWA 1UP0A 2QAPA 3THAA 1SYTA 5FF4A 1B1YA 5KINA 2CZFA 3OHIA 2QPSA 3MU7A 4GX8A 5A69A 5BOOA 3HQPA 4RNIA 2G96A 4WY0B 3WKZA 3MI6A 3HPZA 4TXEA 1GW1A 1E15A 5ECUA 2GUYA 1BTCA 1W5MA 4LCSA 4ZXLA 3F03K 1MW3A 1MEIA 5K4XA 1UD3A 4UFMA 2VDHA 3FGCA 2X42A 3AHYA 4Z0JA 4D6HA 4GI4A 1VPXA 3N2TA 4AHQA 3TQKA 4XISA 4HPNA 2ZA3A 1J18A 1F5ZA 4MNLA 4O14A 3W28A 1MI3A 4QDWA 1R9XA 2VD8A 4AZCA 1H7XA 4WEVX 3LSBA 5F2MA 1E4MM 4KWWA 1W3NA 5BRQA 1D8CA 2VX5A 3MA8A 5T26A 1KRMA 3E96A 1AJ2A 4FS9A 2AMXA 1UJPA 2YJQA 3GG0A 3FXYA 4H9TA 4AAJA 3DC8A 4MZ8A 3S1UA 2PDGA 4Z42C 2X0SA 4LVBA 1EUNA 4G6CA 1TMHA 4H19A 2RJHA 3BCDA 2O9RA 1SR9A 2ISSA 5J5RA 3OP2A 3FA3A 4GC4A 4Z2JA 2HK0A 1U22A 5E6ZA 1XIIA 3E0IA 2X1TA 1PWLA 3M6DA 3SAZA 3VNJA 3PZTA 1PEZA 1VIWA 1XIDA 2DSKA 4F0KA 1RXOB 2O4MA 3HGJA 3NM1A 1UUMA 4LAMA 2VC5A 2PZ0A 3ARRA 3QPEA 3BUVA 4B92A 2C8NA 3ARVA 2FZNA 2W4XA 3S2LA 4GI9A 1VLIA 3WF1A 4EPBC 1I2OA 3HJEA 1E4LA 3CWHA 4PMZA 3B9NA 3LCXA 4GIRA 1GONA 2VGBA 1HKIA 3LSCA 1K77A 1GOMA 3KL5A 1K03A 4A3UA 5TNVA 4QG6A 4JTRA 3OVQA 5LNRA 2QUVA 2QCMA 4INFA 4YS1A 4TTUA 5IFPA 1ZUAX 5K9XA 3DGRA 3VXGA 3DN5A 5AVNA 3BLLA 1GZJA 5MHBA 3NURA 3T0AA 4CN1A 2ZRUA 2D69A 5J5DA 4K1GA 3QSTA 1TIWA 3RM8A 1W6TA 2WKJA 4NZFA 1OJXA 3TJLA 3LA4A 3OGVA 3W01A 3UWYA 2YXXA 2FDSA 4JX4A 1YBQB 2VFFA 4YNGA 1S1PA 5A8PA 5KETA 3WF0A 2I14A 2XVNA 3OZYA 5EFDA 5DCDA 1UR3M 1FUYA 3B0PA 3EWWA 3SCQA 2Z1XA 4UZUA 1R0MA 4C1NB 1KTBA 1YDYA 2WSQA 5I3FA 3E49A 3EMCA 2Y61A 3RO8A 1R86A 4R34A 3P5ZA 1W1A1 4EWJA 3UGVA 4HNNA 3MUXA 3AAMA 1H4PA 1DYSA 2POZA 1CXIA 3W7IA 1MEWA 4J7RA 3VU2A 3EB4A 2TRSA 2A0NA 3AXMA 4ORIA 2VI0A 4ML9A 4AY1A 3N2OA 3ARZA 1P6CA 4GYPC 1EEXA 3QQWA 3SBFA 2RJGA 5HQMA 4UFLA 1VYSX 2OLSA 3U4AA 1VAHA 1L6WA 3F4VA 5LA0A 1I2RA 4J2MA 3E0LA 3PAOA 5DN1A 1S5WA 1VYPX 2DVTA 3I68A 3HG4A 2E68A 1TELA 2ISWA 1HO4A 2PDYA 2P50A 4GO9A 4O0QA 2O7QA 2WC4A 4UFJA 2XDFA 3DBNA 5HNUA 1QDSA 3NEVA 1EC9A 2GGJA 3T8QA 2JALA 3BWWA 2NV2A 4IPIA 1UIOA 2IPFA 4NKCA 1QFEA 5D37A 5BXTA 1FH9A 1V6WA 3PSVA 1YBQA 5CCZA 5C2GA 1GZGA 4IGHA 1N8WA 4DUVA 3E5PA 5FEZA 2I56A 4QNWA 1WUEA 1ZB5A 3UWZA 3WJSA 4GZEA 4JFUA 4QLKA 4DF1A 1RY8A 2OEKA 1CDGA 1NTHA 3NEHA 1HG3A 3W1LA 1XGDA 4LALA 3S1XA 1OG0A 3MJMA 3P8JA 2DZXA 1NDYA 3B4YA 3GY1A 1JDCA 4GYJA 4FXJA 3VNYA 4GRSA 3GVQA 4JOMA 4PMYA 1NFBA 3S6DA 3HPAA 4Y9PA 5AHEA 2DZAA 5C7HA 1VJZA 1XISA 4KRUA 2EF9A 2V8ZA 4XAPA 3TXVA 3TC6A 2FJKA 2R9RA 3M0MA 5IDZA 2P53A 4MJ4A 4UR7A 4DZAA 3MTWA 1Y5XA 4LCQA 4E6MA 1AH0A 1TWDA 1O5XA 3QXBA 1SZRA 2C6QA 3W2KA 3KBWA 2OZ8A 3I4KA 3QEZA 5CZKA 3R11A 3VILA 2AKMA 4GI8A 3V75A 2XH7A 4M29A 1R85A 3B9DA 3QFEA 3GHTA 1HKJA 3WMCA 2FMOA 4J3XA 3S2JA 2PDIA 1E5NA 2QV5A 1BRLA 1N8FA 2WNWA 1P48A 1VEPA 1DXIA 1HQTA 4JYEA 4AZGA 3TJ4A 1AZ1A 3BH4A 4N6EA 1G67A 1BXBA 2BVTA 5I24A 4GZ7A 2QYGA 4B5WA 3WK3A 1RK5A 4H9YA 3OEXA 4AQLA 2C15A 4FLQA 1PZ1A 1XDJA 4G1KA 4XD6A 4M82A 1QI2A 3F2CA 1XM3A 2ZZ7A 3SRHA 1OBAA 2G8ZA 3VX1A 2C0AA 2DJXA 4LUTB 4GFSA 1SO4A 5E0FA 1RCQA 1C91A 2PBOA 4TO8A 4DJDD 1J01A 1J5SA 1PZ3A 5A94A 1VH7A 1KRCC 3APGA 3FDKA 4J9JA 4DYKA 1V3IA 4KWUA 4WLCA 3GU2A 2OO0A 4JICA 4ZSUA 1SFJA 4Y6GA 4Q3MA 3C0JA 1K8ZA 4JQ3A 3UCQA 3WNNA 1C9WA 1ME7A 5M17A 5HOSA 3HQOA 2BP1A 5LZLA 5CSSA 4OU1A 1LOLA 2OWCA 3NQDA 2FDMA 3E6EA 3KOFA 2PD9A 3R89A 2VEPA 1H7NA 3MY9A 2VOMA 4XVDA 5I07A 3MSRA 2QCDA 4Q6JA 3PBGA 4A2RA 3RLHA 1BWVA 5CPOA 2VT0A 1FWHC 1U33A 3RFAA 3A9IA 1XICA 3TNOA 5LIXX 4GYPA 2ZTKA 2OLAA 4RK8A 3TIMA 2FZ9A 3SFWA 1RBAA 3KHJA 4IQJA 1OFAA 4DWSC 1EUAA 2FB2A 1AL7A 2AKZA 2ZYFA 4QG9A 3LENA 4P61A 1WYIA 1GTEA 1WKFA 3NCOA 4ATWA 1O12A 3NQ8A 3GZAA 3FCPA 4JFTA 1Q8AA 3LEPA 4PMOA 1Z6KA 2VD9A 1GOQA 2BXZA 5ABEA 4YVVA 1IEVA 1REQA 1IXQA 5E6YA 3G8EA 4XQ6A 2PEVA 4LCRA 4PTWA 4B15A 3PB2A 4H41A 2WHMA 3FJ4A 4ZSTA 5B7YA 3AS1A 1QNOA 2VDGA 2XVPA 3C8FA 1ECQA 1P0DA 5I09A 4O57A 5M1TA 1VRXA 4NF7A 1DHPA 2DGAA 3QPYA 1W3JA 2QULA 1OX6A 2JE8A 1WPCA 1D8WA 1PSCA 4DJEA 7TAAA 3JVAA 3TCEA 1MXGA 3OW1A 4GQGA 1V5XA 1L8PA 4M6PA 4L61A 4D8ZA 3SQLA 3GDLA 3O0KA 4IIGA 5EMYA 3AXIA 1CXLA 3DFHA 4OJYA 3W7CA 3P84A 3D5HA 3TQ0A 3WDRA 2V3FA 4Y90A 3VD5A 3AZRA 4QCEA 3V1PA 3TEVA 5EGRA 3B3DA 3LUTA 2WMHA 1W1PA 1W9PA 3L12A 3ZVHA 1JQXA 3ARSA 2BZNA 3E02A 2BHZA 3I3DA 5LIYX 4P2VA 2HNEA 2Z26A 4B4HA 4RZ4A 3KEHA 2I5QA 2WZTA 3CTTA 1R3YA 2HVMA 2QGHA 3B0UX 3WLIA 2TPSA 3G3DA 3AJXA 1S2TA 2FGZA 3WZ0E 4PUWA 2G50A 2P5NA 4PCSA 3W7LA 4YTRA 5CSRA 4ONVA 1O5QA 4KEZA 1KM2A 4UMBA 1QNRA 4HTYA 2Y7GA 1M65A 3DGBA 3ATYA 1BD0A 1LRQA 1KR0A 3TC7A 4KS0A 1ZENA 3UG4A 3L0GA 3V0SA 4PR4A 3H2OA 1Y65A 3FK4A 4NU7A 4I9MA 1Q7QA 2XTKA 1V6VA 3L67A 4XBKA 3PTMA 2PDQA 1OD8A 2JF7A 4W9TA 4XTIA 2YZRA 4OBSA 2VCCA 4JTLA 2QCGA 1DKWA 1JRBA 3RX4A 4WJXA 1XYCA 3T4CA 1XRVA 4DPPA 4LPCA 1KV5A 5CG7A 3KRSA 3LLFA 5FKYA 3IGUA 1YMYA 1W3KA 4A8RA 1K8CA 4M6QA 3MW7A 3CQHA 1XLFA 4KGJA 2XFFA 2HE5A 3T1GA 1ISWA 3T4WA 3SCTA 4H9VA 3PUGA 4X61A 4UOZA 4CNUA 3TK7A 3EDEA 4JTCA 1AW2A 5I77A 4IMDA 3QQ0A 5FL1A 1UCWA 1XUUA 2EKCA 3LHUA 1QWGA 2G3IA 3JRKA 3S6TA 4ZO7A 1XKJA 3CM4A 1DJHA 2J7EA 4KFPA 5AC5A 4NJGA 3W6MA 2FZMA 2PPGA 1VBGA 3PHAA 1KM3A 4HZ6A 2W27A 4QCFA 2C71A 1Q2SA 3Q2DA 3CV1A 4YVXA 4WDTA 4MKNA 4K7VA 1UW9A 3EOSA 1KFEA 5BXSA 4ACZB 2WHLA 1IYXA 3F2BA 5CAKA 3QRHA 3PUOA 3LLXA 3BPWA 2R6OA 3K4AA 3PWAA 4UQAA 3W2JA 3G2GA 3SRDA 2OQYA 1FWSA 1R9ZA 2W0UA 3S5YA 5G1YA 4K1WA 2W61A 4GIAA 4YPJA 1ONRA 4ZVJA 3NL3A 4XZMX 4IT1A 3V4BA 3LS9A 3RAOA 4Q7BA 5M3WA 5DX7A 3VD3A 5M03A 3CTLA 4XD5A 4F66A 4FK9A 3V3WA 1F3TA 5DMNA 3AHXA 5D05A 4KQNA 2VOTA 1VIZA 1ITUA 1ME9A 3BJFA 1SO3A 4HSOA 2YSWA 4RZ5A 3TN4A 4DO4A 1XBVA 3M5XA 3KOZA 2NXIA 1Z41A 1DWHM 4XZLX 1ZJIA 2ATSA 3BDKA 3B0VC 1NP0A 3V5FA 4POCA 4HHLA 5CGMA 3WO8A 3LHVA 4AW7A 1EHAA 3QGKC 1U5HA 3CH0A 4LC8A 3UR5A 3WFAA 4CN6A 3LHZA 4HU0A 2CLMA 4M5PA 1UR8A 5HK4A 3PWGA 1DPMA 2ACRA 4IQEA 4FHAA 4S2CA 2DT0A 3P82A 1ESWA 1EX1A 1YADA 3RN6A 2PDWA 4IQDA 1RP8A 3XISA 2H3DA 3JS3A 4IFOA 4CUCA 4XK2A 4O0ZA 3C8NA 1JCXA 1ZALA 1AMKA 4ALDA 4WK9A 1FWWA 1KCZA 2QDEA 4ACYA 2Y62A 5T91A 3ABSA 3S46A 1CGVA 1G0CA 3ZYZA 1EJRC 1TUFA 3CAQA 4HZMA 4UNLA 4CD4A 3IAPA 5HANA 5DANA 1UR1A 5J8LA 4KRTA 1R30A 2YKKA 4UR9A 3NM3A 1EFZA 4GBDA 2Z1BA 1POJA 2V0TA 4ZQMA 4AEEA 3CWOX 4DBWA 1XFBA 4LYPA 4R9XA 4GH3A 5CEWA 1K4GA 3TYUA 3N25A 4NVTA 4P8UA 4XVEA 3L5LA 1WKDA 1OD0A 1LBFA 3UWEA 4O54A 1NARA 3AYTA 1UP3A 3WUBA 5FEXA 2XIIA 4PBFA 5D9NA 3GIPA 4K39A 4H01A 4LUJA 4UXDA 4ERGA 1ISXA 2PWHA 3EAUA 5GNZA 4JZ5A 3W2MA 2NQHA 2I17A 4O1FA 2PDJA 3IUHA 5HWJA 3C2OA 1PVNA 2PB1A 3QVQA 4O10A 4CD8A 4LSBA 9RUBA 3OZPA 1BEUA 1T8QA 2XH0A 3UJSA 4PUKA 1OC7A 3MS8A 3KM8A 1S46A 3UG8A 1KFJA 1GOKA 4GWEA 2ZICA 3M0XA 1Q5MA 1XG4A 2NUXA 3TZNA 3OB8A 3M64A 2GWNA 4XZHA 4HN8A 4LEFA 1EEPA 3K1DA 5H8MA 3R12A 4CCCA 2PDHA 2WJDA 3SQSA 1WAUA 3QQ1A 4AIBA 1FWAC 3MQTA 4IGNA 3GVGA 4E4UA 4LBSA 2NX9A 4UTWA 4Q8UA 1A50A 1BLIA 1V3KA 4JKKA 4C65A 4JIHA 3LCLA 3DFNA 5F1UA 5HR6A 3QY7A 4UMAA 2YL8A 3IEBA 4V28A 4MLRA 2UY4A 4D1IA 3LGEA 3LBMA 1CLVA 5D09A 2YYUA 4O11A 2PI6A 3KTSA 1IIGA 4E8DA 5H8PA 1W9XA 4Z0SA 3FHAA 4RV3A 3QTGA 2PF8A 3PZQA 4K6AA 1GG0A 1PXGA 3NYDA 3BV7A 3U4FA 4A3RA 4I3GA 3IARA 1PAMA 3VIFA 3ID7A 4DF0A 3G0XA 3IUDA 5LNSA 1CI1A 3DH7A 1DXEA 4KWVA 3M0JA 4JTHA 4K37A 3KFTA 4Z2KA 3BOFA 3RXZA 1O7AA 3T0DA 1IE7C 1CX9A 3S47A 5AZ1A 2R91A 1XIFA 3O7UA 3EOOA 4TTGA 2OB3A 3WQ6A 1WBJA 3WLOA 4EXQA 1KFWA 1ZJBA 2Z27A 3W23A 3GFYA 5A6AA 3M4HA 1O68A 3MKCA 2SFPA 3VTRA 1TPVA 3ZJ8A 4DIAA 3U6WA 3ARPA 4X2RA 1V3MA 3WF2A 4E3VA 3A4JA 1JUEA 2B7PA 4LBRA 4AD5A 3ZWSA 3LQLA 4S3KA 3BLEA 4HNUA 2BS9A 5JMUA 5ABHA 1HW6A 1DOSA 3W38A 1Z32X 4QJ3B 3K30A 1UD8A 3CV2A 3PG8A 1OK6A 3VDCA 3UPMA 2C0HA 3HGRA 2QGYA 2V5BA 3SIMA 4MNMA 3WBEA 3B06A 1TPH1 4DB7A 4XV0A 3AUJA 3FS2A 4FR1A 5CZSA 4MZ1A 2ZBTA 5AHFA 3UU0A 1IT0A 4FAMA 5D9PA 4Y9AA 4BZYA 2BX7A 3OQEA 3A5VA 2VKZG 2A7NA 5EKYA 3QLLA 4O53A 3L2IA 3CNYA 1JF5A 2X16A 1ITQA 3H12A 4GISA 4GY1A 4QITA 3WMSA 5A8MA 3GW3A 1W3LA 2DEPA 2YW3A 3RHGA 2QR6A 3C56A 1WOBA 5IRPA 5DBUA 1FH8A 3N14A 4Q8TA 1IZKA 1V7AA 5H6HA 3SZ8A 3STPA 3Q65A 4BEQA 3A21A 3CUJA 4QDPA 8TIMA 1XGZA 2ACUA 4QX4A 1RA0A 5D03A 3LN3A 4C6JA 4JIEA 1IEWA 2GSEA 2NVCA 1ZSXA 3RPDA 1EJSC 2Y8UA 4AXNA 3ANUA 3QY6A 2VNCA 3M9YA 4GCXA 4LUSB 1BQGA 5D2TA 2OWXA 4QGCA 3PBWA 3TFXA 4WF7A 2GVYA 2VZOA 3CZJA 3A64A 1A80A 1LJYA 2REQB 2Q8LA 4O15A 5D4YA 4AF0A 3AWNA 3ZO9A 1D2KA 3BAIA 2ZADA 3EKZA 1LQ0A 3CH9A 4W8AA 4E4FA 2BWGA 1OIMA 1H50A 3VNZA 3R4IA 1FWDC 3KVMA 5AKQA 4G7EA 3P93A 5D2WA 3BXWA 1YHTA 3TR9A 5JIPA 2D2JA 5U4NA 1LOQA 1SU5A 1WCGA 2X2YA 4HA1A 2BBFA 1ZU8A 4RE4A 4LFYA 4IIEA 1IT7A 4RPPA 4GQ0A 3ZOAA 3A23A 3PANA 4AISA 1AA1B 4AMCA 1DJNA 4GIEA 4Z2HA 1UWTA 5AECA 1Q6QA 4M0XA 1E0TA 3LRKA 4LYRA 3QR1A 5JH2A 3AIEA 2O4QA 4GZIA 1EOKA 4X22A 1XLJA 6REQA 1CECA 1E56A 3SW6A 1HIZA 1XHGA 4Y96A 3GU1A 4Q4OA 5IHSA 2VQTA 5H1WA 3LBCA 5I78A 5CQ1A 3TYCA 1XBZA 3P74A 3R5EA 4XSLA 1B3OA 3W22A 3TCSA 2NW0A 4XAYA 2DFAA 4KETA 1EJUC 1MXDA 2G0WA 3BTNA 5K2ZA 1C29A 2IKHA 1ISYA 2OWWA 3O15A 4NJHA 2W92A 3WLHA 1NWSA 4PTMA 3PFRA 3BSMA 3P62A 3U7VA 1ZJAA 1IXNA 6A3HA 2E25A 2VX4A 3IK4A 4JTIA 3VC5A 1QO2A 1PV8A 3DYOA 1XXXA 1UG6A 3TE9A 3G6LA 1IWAA 1XX1A 3IRDA 2FPYA 3LV6A 2CLOA 4E38A 1UYQA 3CAVA 4US5A 2OSWA 2ZUNA 1N82A 4YIWA 4GY0A 4PH6A 3GH7A 5F2GA 1PBGA 3DCPA 4NYYA 2OYKA 1CLXA 4BA0A 2ZA1A 1HZYA 4DXXA 3MDUA 3T42A 4F0RA 3N9KA 4N4PA 4C6NA 1KQYA 5F2LA 1T6MA 4LY8A 3L4TA 2VR2A 5DF0A 1A0EA 2CXEA 1L6YA 2PRLA 3WYZA 1E0VA 2ZTJA 2WM1A 4XD4A 1LLZA 3KXQA 3NL5A 1CCWB 4M6UA 4O1BA 3IANA 2ABAA 3S5SA 1JFHA 4WXZA 1C9DA 4CNOA 2X7WA 3DI1A 5C6MA 4PMVA 2W63A 1XYLA 3R6IA 1OGSA 2A4AA 4KPLA 1TFVA 2YW4A 3PK7A 1E9LA 1YDOA 2O9PA 3WLRA 4JQAA 3PR2A 3QR0A 5C71A 1UPMB 1B3ZA 2FHCA 3HO8A 1SJBA 4ZQRA 5A5WA 4ZQPA 4DAIA 4FIRA 3AO0A 1JULA 2DU2A 5LSMA 2YCJA 1IEXA 5L9FA 3K13A 3GR7A 1PKNA 1C8VA 3EPOA 1KC7A 4BK9A 3VMNA 3GDMA 1XD1A 4UTTA 3MB9A 4TX8A 3LPGA 1HVQA 3B8TA 1K8YA 2P1FA 1GTHA 4KFOA 5I23A 1W91A 4C6MA 3WBYA 3W7QA 5REQA 3JW7A 3MWCA 2ZDSA 4W8LA 2WNQA 4Q32A 1PS9A 3L21A 2CYGA 5TBOA 1LLOA 3GDKA 4B16A 1VEMA 4FXRA 2ZZ6A 3S83A 1TPWA 4UTLA 3GB6A 3DUGA 2VCBA 4QIUA 3W74A 1WV2A 2W67A 1NEYA 4H8NA 5AYIA 2G95A 4IIHA 3F2DA 4UNIA 5ABFB 2F2KA 2EO7A 2EJAA 4D8AA 2ZVIA 4N9CA 2JGQA 3G24A 1EJTC 4H2HA 4V2XA 1VBUA 3II1A 5D30A 1TRDA 3GC4A 4O28A 4MY9A 5HDRA 2CLIA 1OFBA 3T0CA 4AZ6A 4X63A 1AQHA 1TO3A 1A53A