4M22A

Crystal structure of small molecule acrylamide 16 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
160
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTARDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 59
structure length 160
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m22A00
5HZHA 2R6DA 1X86B 4JLAA 2WSSD 1XMJA 2OE2A 3DEFA 1ZD8A 3LNCA 4Z8XA 1FUKA 3AVUA 1JB1A 1E2GA 1G5RA 1Z6GA 1XTIA 2VPPA 1A2KC 3GEEA 3CM0A 4BECA 4M21A 1G3MA 4G3XA 4Q9KA 1Z07A 2GZDA 3I92A 1G19A 1HT2E 3V4RA 4LHXA 2QTHA 2VTKA 5J40A 1SVIA 3GLFE 1EFCA 3NXSA 3QKUA 2EQBA 1SGWA 1AKEA 4V02A 4TQUS 1DAGA 3SFVA 3T15A 4ZDWA 5DNYB 4LJ5A 1NMYA 5B30A 1KI6B 2G88A 1LTQA 1N5KA 1T5IA 2GEUA 1NL3A 3C16C 4KV9A 1EFTA 2P67A 1HQYE 5AR1A 3NC1C 1YZNA 1ZUNB 3GMTA 4B32A 1ESMA 4B6EA 3LDAA 3EA5A 3Q5EA 1Q1EA 3WNDA 4ACAA 3ZH9B 2IUTA 2AXNA 1XPOA 2CLCX 4MYHA 2CVHA 2ANBA 1VPLA 2YOGA 3TMKA 1E9AA 1Q3HA 3WY9A 5BN4A 4OHYA 4HAWA 1W36C 3VHXA 4TLBA 4DLRA 5JS8A 1NVUQ 1J2JA 1NLYA 4KSBA 1CJMA 1EFRD 4PPNA 4XVRA 4MKGA 1F2UB 3LBHA 3UWOA 2F1HA 3Q85A 3OE7A 4DJTA 4DSTA 4AG6A 3QNUA 4LV6A 4V0MA 3EAQA 1J8YF 5BWMA 3MMPA 1GILA 2QP3A 4D0LB 1W2GA 2XITA 2QAJA 3ETLA 4I1OA 4PZYA 5AUOB 4LK2A 4A9AA 3BFVA 2QT0A 4I99A 2O52A 4V0KA 3BB3A 2C9OA 3QKTA 1W4RA 2W6ID 521PA 1M7HA 4CEJB 3HYTA 2FFQA 3LXRA 4MGKR 1X3SA 5EP2A 4HATA 1E32A 1HV8A 2XOKA 4Y0VA 2GCNA 5L3RA 1KY3A 1XX6A 2PT5A 4LHWA 1ZJ6A 2R44A 2VO1A 1XEFA 4BLTA 1FP7A 1K6MA 2WJJA 2O8CB 4E22A 3P4XA 2BM1A 4ZKEA 1CF4A 5KNCA 4NBSA 1QHHB 1U2RA 4FMBB 3AVYA 2DCUA 3TSZA 1XNJA 4P4TA 1P2VA 1VG1A 1X8LA 1BS1A 2FZ4A 2YINC 5KOYA 4CZ2A 2IT1A 1SXJB 3OEHA 2W6JA 1A1VA 3OE7D 2XZLA 2ZUCA 3SHWA 2OG2A 4ESHA 3LWNA 2WJYA 3QEOA 5GVSA 3G0HA 5IHPA 1RKBA 1MH1A 4LYAA 2PLFA 4A15A 1QZXA 4O25A 1E9EA 1NRJB 2C99A 4EQ6A 4ABYA 3FVQA 3WHLA 4TYNA 2ZVPX 4DDWA 5FR2A 2V55B 1U8ZA 4DDVA 2VL7A 2ZJBA 1U99A 2Z4SA 3TUZC 2XOKD 4CRWB 4C2UA 1VIYA 2REBA 1SKYE 3E5HA 1ZBDA 3IHLA 4BWYA 1E9BA 5LD2C 2QUZA 4U02A 1W2HA 4UXIA 1LNZA 4TYQA 3OIWA 1N6HA 4HAZA 1VECA 2JLYA 1UBFA 1T0HB 1KI1A 1WBBA 3ASZA 4KI0A 3BC1A 2OBMA 2ZRMA 1CJUC 3AV0B 2R62A 1SVWA 2ZE6A 4MKIA 2GXUA 4NKRA 3TBKA 3OEHD 2W6JD 2O8BA 3UKDA 1Z0IA 1KSHA 4CGZA 2JASA 4A6XA 2H7VA 5CJPA 4NDZA 2Z4RA 5GJWC 3GLHE 4RFVA 4BLRA 2IS1A 4FMCB 1D6JA 3EASA 5LDDC 1XB2A 2ZYUX 1US8A 3PG5A 1P5ZB 2YNMA 3QXCA 2ZRLA 2ANCA 1N6RA 2JLRA 2XGJA 4IDPA 3NHBA 2V3CC 4JBYA 4TQAA 1Z2AA 2P3SA 4M0LA 1RYHA 2GF9A 4LHYA 4NCHA 3R7WB 4DB4A 3CF0A 1CU1A 1GZSA 2ZRCA 2B7BA 121PA 1E2DA 3JVVA 4TQ9A 4KBGA 4RD6A 3FHCB 1UADA 5IDVA 5FUYA 1T3SA 1VYTA 3KUDA 1GRQA 1IXZA 4PAQA 5G40A 4I1UA 5A0FA 4BFXA 1E9FA 3W6NA 3DL0A 3FFAA 2NQ2C 5FBRB 2AWOA 2O5VA 5FUWA 3DVLA 4NL4H 5FPHA 3SQXA 5JI3E 5H8WA 1P7CA 2R6CA 4US2R 2FOLA 5BW8A 4ZDKA 3B5JA 1TU3A 3RDPA 4DT1B 3AQ4A 1KI2A 4DCTA 1BYIA 3NBZC 3RSLA 3FKSA 3CRMA 3AGQA 1KO8A 3K9HA 1L8QA 3QXJA 3AVOA 2ZI9A 2MMGA 3KXLA 4F7WA 4M22A 3OAAA 1TADA 4WZAE 4LRWA 5LBIA 4EJSC 5CIQA 1KAGA 2V6JA 1KI7A 2BM0A 5CLLA 3CX6A 2JATA 1ZIPA 4G01B 4M1OA 4NYIQ 5L3QA 1TNDA 1MRNA 1OE0A 2CE7A 1XMSA 3EPHA 1IAQA 1W36B 1P72A 2G0NA 2AK3A 2KI5A 4GSYA 3RAPR 4PPFA 1ZNZA 2FPKA 4QJ5A 2G83A 4R2HA 4RZUA 2PCLA 3AB3A 3NEYA 5AK0A 1PJRA 2AD5A 3RWOA 4PHHA 1PVOA 5EQTA 2GEVA 3Q72A 1QF9A 4BASA 1COWA 2ZS9A 4HI0E 1KNQA 1NMZA 2FX3A 1YR9A 5G41A 2E9SA 3LW7A 1HE1C 1I2MA 1FOEB 2YOFA 1N25A 1SULA 1ODFA 2ZE7A 4JSTA 1LB1B 1P9NA 4R9UC 4JJKA 4KFRA 5FUVA 3CH4B 4KCGA 4Q1DA 3BGWA 4BEBA 3EC1A 5ELXA 3SFZA 3FKSD 1P9WA 1RW4A 1NJGA 1PV4A 5H70A 2A2ZA 3ZDQA 4YQFA 1IJFA 2A5FA 2GBLA 1ZNYA 2ODNA 3LY5A 4PSAA 5HCNA 3AKEA 4Q4HB 5CJ2A 1RFLA 4M1TA 1N5IA 2CJWB 2PMDA 2UZ3A 3CR8A 2DBYA 4IFBA 4KJZA 2HF8A 5CYPA 4A2QA 3KQNA 5J47A 3MWJA 4JLJA 1JR3E 2ZJ8A 1W44A 2VRWA 3UK6A 1CP2A 3R8FA 4M2LA 4JZKA 4POAA 1COWD 1NP6A 1G7CA 2GJ8A 2BMJA 3P26A 2RGGA 4C3ZA 2RGBA 3TH5A 2QEQA 3IPYA 4RZ2A 2ASEA 3ASYA 4AYTA 1Z0JA 1S1MA 3RS3A 3AKYA 2LKCA 4HUTA 1OFTA 1NG1A 4KITB 4PPQA 5FOWA 2ZEJA 4PO1A 4OK5A 4LCBA 5LPNA 1IY2A 1N5JA 2BHRA 4NCJA 221PA 1P75A 4OHVA 4BFTA 4U00A 5LD2B 1OF1A 2HT6A 2WWHA 2HF9A 3B1WA 5M04A 3BJIC 1E9CA 4RJLA 3KJGA 1S4QA 3BOSA 4Q9HA 3I61A 1S8FA 2J87A 5E7MA 1C1YA 3L0IB 4M9QA 3NBYC 5JHGB 2GVZC 1G5TA 2QMEA 5A4JA 4A1FA 3QG5A 2ZRNA 3CB4A 1EK0A 4B3BA 1KK1A 3QKSB 2CLDX 1CR1A 2N42A 2KWIA 4YXWA 4JT4A 3LFUA 2IK8A 1ZU5A 3LRPA 3JZMA 5FTKA 2QBYB 4BFWA 4OJKA 1AJEA 2WIAA 2XSZA 4PC7A 4LSGA 3IKJA 3BK7A 4HAYA 4P3YA 3WYGA 3UWKA 4URUR 2WIBA 4NMMA 3AH8A 1DOAA 4WAUA 4C9BA 2TMKA 1Y63A 1P2TA 1Q1QA 2ZRHA 3K9GA 5FOSA 2DYKA 1SVSA 3K9LA 3N70A 4G5QA 3PUZA 1TQ6A 4TL8A 1CIPA 3I3SR 3U44B 4RZXA 1OLOA 3FWYA 5C18A 2RGNA 5HE8A 4J0QA 1K5DA 2ZJ5A 4L8GA 2PMKA 3CWZA 4IXMA 1CRPA 3RABA 4RD2A 2CCKA 5JSZB 1W46A 3NG1A 3CO5A 2FJUA 5B2ZA 3K09C 1U0JA 2BJVA 2Q21A 1OT3A 3L0PA 4MITA 2IWHA 1NBME 5EUMA 1L7VC 1P9RA 4P0TA 5K8LA 2ZS7A 2ZM5A 2J5XA 4MUAA 1ZM9A 4B71A 3UATA 1W5SA 4DLXA 5CDFE 2F1IA 3MWLA 2C95A 4Q1FA 4YXWD 1NN1A 1YQTA 4QJ4A 3PR1A 2H1LA 4PO8A 2GAAA 1E0KA 4BRUA 4MDFA 4DLUA 4LBWA 4TMTA 3KTAA 2A5JA 2XSZD 5KPDA 1VHLA 2ZI7A 3D7MA 3KQLA 1SHZA 5FI1B 4A0FA 3CW2A 2C78A 4KFUA 2GILA 2ORWA 5E3HA 5FUXA 1MR3F 2GCOA 3K53A 4UNQA 3I5YA 3DDCA 4CT4B 1Z8FA 1KDOA 4Q1BA 2FN4A 2ZITA 1JXMA 2NO9A 421PA 4LDJA 621PA 4PPGA 4G5OA 4GNKA 1J8MF 1E98A 1N6KA 2ZQ5A 4G5GA 1UJ2A 4DCSA 5TARA 1S3SA 1IOZA 1NKTA 3M0EA 5EZ5A 2ZI6A 3SNHA 1C9KA 1U90A 1NN3A 1Z5ZA 1OXVA 2RB4A 2WSMA 1RE0A 4PC6A 1DAEA 3AKCA 3AEZA 4TL9A 1VG0B 1VKJA 3N2EA 4TLAA 4ZIRA 1R8SA 5HE9A 1XD9A 1E1RA 5DSZA 1E2IA 1AZTA 1IXSB 4L16A 3TQFA 1TL7C 3SQWA 3I32A 1FX0A 1OPXA 3VR6A 4C0QC 1BO6A 2ZYVX 5JECA 1FFHA 2OLJA 3KQUA 3RYTC 1H8HA 3FYHA 4JLMA 1FMLA 3PCRB 1GNQA 3H4MA 3TJZA 3Q3JB 2QE7A 4OYHA 1XMIA 3K0CA 4P4SA 3RRMA 1GM5A 2FV8A 1ZM2A 2YZ2A 4I1SA 4IOMA 4B44A 5KSZA 2GNOA 1H8EA 3WNBA 1KMHA 2Y8EA 3KDSE 1JAIA 5K8TA 1E9SA 3DPUA 2VEDA 1KHTA 3AF3A 4X8MA 3EWAA 2OM2A 4H9GA 5EE0A 2QM8A 2OXCA 1XEWY 1TF7A 4KLNA 4PHGA 1OYWA 2GETA 4O2RA 3EIQA 4RCYA 1XTKA 2Q9BA 4C30A 2HT1A 2MSCB 1Q20A 2W83A 4B35A 4XVUA 2Q3MA 2QZ4A 4IOLA 4YDSA 3VKGA 1E1RD 4Q1CA 5CLQA 1E4VA 1KKMA 4B47A 1NSFA 5KDOA 1CBUA 1ESNA 2WM9B 1MOZA 1N0VC 1H8HD 3KKPA 3V00A 3VR5A 2VSFA 3AUYA 1QVRA 3W5IA 1YR6A 2QE7D 3L8YA 1XD2A 3SI7A 4Z54A 3F3YA 4UXHA 1R2QA 5JJIA 1OFIA 2YV5A 2IYZA 3L82B 2WHXA 1SQ5A 2IBMA 1RC8A 1GL9B 1HH4A 1M34E 2BBTA 3NC0C 2NMVA 2WWYA 5FBLB 1HYQA 2Z6VA 3R20A 2OCYC 1DG3A 2QP9X 4Q4AA 4D0NA 3I5XA 2EFEB 3DHWC 1J99A 2WMOB 4AY2A 5FFMA 3U4QA 1BH2A 2EFCB 5IT5A 4GT1A 4IDQA 1JBKA 2JIZA 1KKLA 2HJVA 2GBLC 1X1RA 3MD0A 4Z8YA 1N6LA 5C2JB 4KVGA 4MYTA 2K5UA 3KZ1E 3VKHA 4GPTA 5JS7A 1B0UA 4Q00A 1OXUA 1DAMA 1G1MA 4ARZA 3TR5A 2PJRA 1AS0A 2P5TB 3BB4A 5JZVA 2EYQA 4DEXA 3ONWA 1F48A 3ZS9A 2KBFA 2I1VB 4F4CA 5KSPA 4F93B 1OJLA 5JJLA 4LYFA 2GVDC 4W9MC 3BH0A 4DKXA 2B8WA 1YKSA 2FPMA 4MYUA 4IXNA 4UNNA 4QM7A 1SXJE 4B75A 4EQ6B 4LGMA 4A92A 2W2TA 1U81A 3MRSA 1XCMA 2FU5C 3B1ZA 3M6AA 2C5LA 2ZRPA 4M1SA 1OH6A 1KSJA 1Z2CA 2GXSA 2J0SA 3QPVA 4GOKA 2Q0HA 2QBYA 2JIZD 3RS0A 1D8TA 2DPXA 2WMNB 3WYFA 4TWZA 4LUCA 4B33A 2WKQA 4GMXA 2ZIAA 3VAAA 2DFKB 1Q21A 1U8AA 1VDZA 1XTSA 4L5BA 4LPKA 2XZOA 5KSOA 2ZSEA 4L9SA 1EG7A 3DZDA 1WF3A 4PSVA 1IN5A 4O0MA 3O8RA 4YDHB 1G8FA 4BFYA 4D4KA 2FZLA 2R6GA 2NPFA 3LQRA 2O8BB 1XPUA 1DEKA 1R7RA 5DIFA 1Z0FA 2H92A 3AVWA 3WRXC 3DKVA 1D2EA 3GJ3A 1E2QA 3P4YA 1US8B 3BIFA 4IRUB 4DDTA 4ZPXA 3U7GA 4LJ9A 5GADl 3W9YA 1QHXA 2BEKA 2BWJA 3IIKA 4QHYA 1TQDA 4JIMA 5B57C 2HYDA 3RNLA 5JEEA 5SZIA 1NI3A 1OKKA 4JVSB 3K0AA 1YZUA 1UBGA 4BPBA 3GLGA 3NTUA 4EJSA 4LC1A 1KI4A 2FF7A 3LXXA 2J7PA 2NGRA 3TSOA 2ZYWX 1J70A 1GITA 1LF5A 2DB3A 2QSZA 3SJCA 2PX3A 2WAYA 3O8DA 1PLKA 4GZMA 1ZP6A 2JJ8A 5BXQC 2CDNA 2JJ2D 5CITA 4PC2A 1KDTA 1GAJA 5BYJA 2RGNC 3E70C 3EPJA 2HCJB 4B3GA 1YZKA 1W4BA 2AL7A 2ATVA 1N3BA 3CRW1 4O2LA 2EWWA 2P6UA 4WBSA 5C4MA 2YKGA 4KFSA 1EX7A 3IO5A 2KB0A 3UIEA 4DVGA 2ZJYA 1R0YA 1S0UA 2QNRA 2IYXA 2XTNA 2EU8A 2VP6A 3FPAA 4RKFA 2VF8A 1Z0AA 3MFYA 1T5LA 2YWFA 1DAFA 3T34A 4F38A 3T1OA 1MABA 2DWOA 3JZAA 3FE2A 4M1MA 1XZQA 2ZJOA 3T1QA 1XU4A 3SJZA 4FCWA 4OBEA 3GCGA 5TMPA 4LYHA 1IN6A 5L3QB 1QHSA 2XZPA 4TMKA 1EFHA 1ZYUA 3IBGA 4GOJA 5EXTA 3UG7A 1OKKD 2O8DA 1Z06A 1NY6A 4OQNA 4RD1A 2GCPA 3X2SA 4BEJA 3MGCA 2J7PD 2IYWA 5JCZA 4C0LA 1F60A 3U3OA 5KNDA 4QKQA 1A2BA 4RY2A 4JL5A 3B13B 1GKUB 4TYPA 4BLOA 4CIDA 1P2UA 4QBHA 4LYJA 1JJ7A 3MG9A 4DDUA 1NF3A 2NO0A 4RKEA 5DE3A 4QHSA 2ATXA 3CZQA 3QBTA 2GEDA 4M9SA 3RRZA 2F43A 1OB2A 3GJ7A 1G3RA 3FMOB 4ZDJA 1QHNA 2H18A 1RRGA 2XJ4A 3HPQA 4JLPA 4LJAA 3NEJA 4U7DA 2REOA 3K0FA 3DOFA 4FWIB 5KU1A 2NOAA 3SDZA 1RRCA 5L3VA 1NVVQ 3O8CA 1VIAA 3CKLA 1GTVA 2X77A 3ZYCA 1E2PA 4L15A 4M53A 1SHKA 4UKDA 2VLIA 4OI0A 1KO7A 5EXXA 1UKEA 3U3KA 3QVVA 3AVQA 1KTVA 2W0SA 1Q0UA 2QA5A 3U61B 3T12A 2A9KA 2FGJA 3C14C 2FPLA 3IUYA 3K0CC 3DKPA 4LJ7A 3G82C 5BYKA 2E87A 4D4JA 5EP1A 2EFGA 3FTQA 2FSHA 2BMEA 1WCV1 4KHZA 1ELOA 3HWSA 3SBDA 3W34A 1V43A 3B82A 3QKRA 1VHTA 3HDTA 4JL8A 4LBYA 3PIRA 1OXTA 3K0SA 3GJ6A 3VR1A 4JVLA 1JR3A 4Q7MB 3RHFA 4AC9A 1DE0A 1R6BX 1HEIA 1FZQA 5EP3A 2GESA 3B85A 2OILA 1BMFA 1E0SA 2RMKA 2GF0A 1D9ZA 2FWRA 4LX0A 1Z28A 5HR5A 1DELA 2NZ8A 2IYLD 3G5UA 4OQXA 2WTUA 4NYMQ 2IX3A 1IY0A 5C46F 3NDBB 3C8UA 1GKYA 3EZ6A 1AQYA 1NVXQ 2G77B 3M1IA 3CNOA 3HYRA 5JBQA 3HPRA 1N6NA 2DFNA 4I1VA 3BFKA 3QJYA 2Z0MA 4GI7A 1Z08A 4KAXA 1DVRA 2RGEA 3EWSA 3K09A 5B64A 3F5FA 1R0ZA 1NJFA 4M9ZA 4PZZA 1ETUA 5FPYA 4XWKA 2D74A 4JMPA 1HT1E 1HY3A 1FNMA 3GD7A 4LJYA 2WJIA 3HR8A 3LW8A 4URZR 4HB4A 1UF9A 1G17A 5JI2E 2UVQA 5DLQC 3EZ7A 2WPDA 1OSNA 4HLDA 2V8OA 1U98A 5DI3A 1DAIA 3I4LA 1R8QA 3LLMA 2EWVA 1DBSA 1BMFD 4ASUA 2Q9CA 2FG5A 4P32A 2IXFA 3SYNA 3WYAA 2PZGA 1KJZA 1NVWQ 4DSUA 4G1UC 2ZS8A 4LY6A 3UANA 1TTTA 3REGA 4CVNA 1FNNA 2Q3FA 1J7KA 1LV7A 2WVJA 2D4HA 3OHMA 2P6NA 3WMFA 1Z83A 3W8NA 3BAFA 5F2EA 6Q21A 3RS4A 1Z6XA 2BDTA 5KYKA 3RS5A 3LA6A 4QXAA 1P62B 4QM6A 2ONKA 1I2DA 1WMSA 4HZIA 4DSOA 1LY1A 3AM1A 4TMXA 4TTPA 3IILA 4Q4JA 3SBEA 1RZ3A 2BKEA 2WZQA 1KO5A 3Q9LA 3F0TA 3KTAB 1YU9A 3ZGXA 1FQJA 2ZAMA 1T8TA 2WPDD 4GFDA 4KYIB 5KHOC 1F5NA 2QGZA 4XD7A 5EE1A 3H2YA 3U7EB 1ZCBA 2GCOB 2OCPA 2VHCA 3CRVA 4ASUD 3IQXA 4M4SA 4RD3A 2HEIA 1UAAA 2H5EA 5CDFA 3I73A 4LJ6A 1T3LA 2GA8A 4PC3A 4ZI3A 1S9DA 1TUEA 4II7A 4LWZA 1TMKA 3GEIA 2HV8A 4CEHA 1EX6A 4C0BA 1ZD9A 1KY2A 2FEOA 4P31A 3N2IA 4C2TA 1TU4A 4ZIRB 2AFHE 3A1VA 3D8BA 2WOOA 5CM8B 2JLXA 2QU8A 2QMHA 4FN5A 3BERA 5EUQB 2CL7X 3PJRA 4MGYR 1S1CA 1GWNA 2ZROA 5EXSA 1JPNA 4FINA 3CRQA 4YMUA 1FX0B 1XTQA 2DWQA 3UMRA 4M1KA 4DSNA 4DZZA 2C98A 3VTKA 1E69A 3LBIA 4AKHA 4M1YA 1KMQA 3A1TA 3ZD6A 4JBWA 1KK0A 3THYA 2DR3A 1ZNXA 3A8TA 3KX2A 4NCKA 1BIFA 4XD7D 3ZS8A 2A5YB 5JEDA 4P4SB 2D2EA 1IN7A 2YHSA 3HU1A 4ZI2A 3WHKA 1UEJA 1S9HA 3CNLA 2GRJA 4B6FA 2D7DA 4JJZA 5AUQA 3RRYA 3W8RA 1E3MA 4BLPA 3R9XA 1KMHB 5AJYA 1Q22A 3WRYC 1MO3A 5CB6A 3SC3A 3AP2A 1A7JA 5SZKB 4QL3A 1OFUX 3EZ2A 4QHTA 1G4UR 4QBFA 4D4LA 2CL6X 1QVAA 2NPIA 2FE4A 3W6OA 5FL3A 1KI3A 2GJAA 4N1AA 2GK6A 2J59A 2YWEA 3QBVA 1CR2A 4EUNA 1XPRA 2V9PA 4CYMA 3OAAD 1NLZA 3KL4A 1X8JA 2X1VA 1XXHA 4US1R 2AK2A 1K5GA 4KO8A 4BRWA 4FI3C 5HZKA 1ONBA 1UBCA 1ZRHA 2IF0A 2XB4A 2ZSFA 5D3MA 2RGAA 3PEWA 2BBSA 2ZRBA 2CCGA 2PT7A 1XD2B 2WWWA 2ZAOA 3FKQA 5TY0A 4C0SA 1AK2A 3ECCA 2VHUA 4QOSA 5CIWA 2J0UB 2JLQA 5KO2A 5KDLA 2PBRA 1JECA 2ZI4A 5B58C 3PEUA 5J4LA 3EIHA 1FMJA 3VU9A 4Q4AB 4V0ME 4GL2A 2QN6A 4D26A 1WP9A 3REFA 3SEAA 3U4QB 5JHHB 3S1AB 4MRPA 3A4MA 3AVXA 1IXRC 4FD2A 4OK3A 1E99A 1F2TA 2IEZA 5F9FA 1GRNA 1P60A 2IHBA 2NG1A 4TLEA 3DM5A 3B78A 2QI9C 1E2JA 4A2PA 3A1WA 2B8TA 2ZYTX 4Q9IA 2GTPA 2R65A 3EZ9A 1ZM3A 4ARZB 1NNEA 1FUUA 4PQRA 3U3MA 1OB5A 1ZCAA 4AKIA 2VHTA 1VCOA 1AQUA 1FW6A 1YZGA 2GJKA 3OEEA 3VQTA 2W58A 4CW7A 5K8IA 2FEMA 4C4PA 3PEVA 5CB8A 3SS8A 3LX5A 4JLBA 4RZ3A 3RANA 3X1DA 3BFXA 4Q9LA 1DPFA 4XIGS 2B6HA 3MSXA 1KYIA 4IOJA 3RSOA 1GG2A 2OESA 3VNVA 2V54A 3CZPA 3GFTA 4Q03A 2WJHA 2VP4A 2QPOA 3NBXX 2CK3A 1CJVC 2C9YA 4AKEA 3OIVA 1RVDA 2BEJA 1OHHA 4AD8A 1R0WA 4EAQA 4I81A 3U60B 4QGFA 4K81B 1W5TA 2OBNA 3LO5A 4TLCA 4TZ6A 4Z1MA 4PHTA 4DLSA 1OIXA 3ZD7A 5DN6A 4TYWA 2R8RA 1Q1ZA 1A4RA 3L0OA 4DCVA 1KGDA 5LB2A 3B8HA 3BWDD 4XSHA 1R5NA 4BFSA 2A7QA 2F3RA 4NH0A 2J9RA 1N6PA 2AHOA 2IYSA 3EW9A 4HSEA 4JLKA 4W5WA 4WW0A 5EP4A 2Z83A 1ANKA 3EPLA 3U5ZB 1GSIA 2YJTD 1IHUA 1GFIA 3OEED 5AJZA 1R5BA 4B43A 3KKMA 4W5JA 2IW3A 1VCNA 4HLCA 4Q01A 5JWRA 3IQWA 3WXMA 3J81k 3CWQA 2ZU6A 4EPXA 4QC2A 4MA4A 1CKEA 4Q9JA 1I4LD 1U0LA 1SKYB 3CPJB 4Q02A 3BRWD 5SZJA 5FBVB 1RYFA 2V1XA 1WQ1R 5EZ6B 4TMVA 2CK3D 4N0DA 2H16A 5EXPA 2NIPA 3K0AB 1OHHD 3BBPA 4CEIA 3GLGB 1NSTA 3KQKA 4EJSB 5DGXA 3I8SA 1KI9A 1S2MA 2VP2A 1SVLA 2XTMA 1PZNA 2ZSAA 4Z1MD 1M1YE 1WDTA 1DAHA 1GKIA 2I4IA 5DN6D 4HEJA 4OL0A 1B23P 3D6TB 1VCIA 1V5WA 3K8YA 5FOTA 5J4HA 2ZRGA 3QOFA 3V9PA 2N46A 3BD9A 1O3YA 1E1QA 4PX9A 3C7KA 4HAUA 4NHOA 4N3NA 4XOIA 2FH5B 1SVKA 1G4AE 2X19A 2YOHA 4OQFA 4IDNA 3QXXA 2BBOA 3GLIA 3RS7A 1UDWA 3VFDA 2Z5FA 2YC4C 3QSYA 721PA 5FI0B 4C7OA 2XJ9A 2XX3A 1MABB 1T91A 4DCUA 1Z22A 2B21A 2IYVA 4KVAA 1EWQA 2VP5A 3C4JA 3CUEF 3A58B 2O8DB 2EFHB 1M7BA 2EVWX 2I1QA 1TAGA 4YMWA 2ERYA 4Q1EA 4PZLA 3M4YA 5C1BA 1JQLB 1RJ9A 2CEAA 3WNCA 4JLVA 2PLRA 3QUSA 4OJQA 4BE7B 3I72A 3K70C 4GBMA 3CF6R 1YZQA 3CONA 3C5HA 1UBEA 2ZJZA 3V4FA 1E1QD 4PQYA 1N0WA 1ZINA 2UZIR 2N1BA 3HU3A 5J4VA 1AIPA 3LVRE 1G6HA 2F43B 3W3AA 2KE5A 4X8HA 2FSIA 2PZFA 1IONA 2GHIA 4B2PA 4DLVA 821PA 1E2FA 3B7GA 1WXQA 3FB4A 1YR8A 2VYFA 4OKSA 4TL7A 3CX8A 2HCBA 1FTNA 3QIAA 4KBFA 5FPSA 2BBWA 3K0FB 1IN8A 3CF2A 1KOFA 2WOJA 3L2OB 5FBWB 4UXJA 1X1SA 2OCAA 2CMKA 4IJMA 4NCNA 2OAP1 4GRAA 2A3RA 4OHXA 1ZAKA 1KSGA 3CPHA 3GLFA 1DG1G 3WBKA 2IF2A 4EFLA 2O0KA 4OI1A 3ZZUA 1DARA 1T4GA 2ZRIA 4JLNA 3WMEA 2Z43A 3B9QA 3L0SA 4BGDA 1DS6A 1UEIA 4URXR 1P4SA 2CVFA 5E95A 1ZUHA 3NIBA 3LLUA 4B3FX 1ZC4A 4L9WA 5EE3A 3B60A 4OQMA 5EE9A 2F7SA 1SVOA 4D4MA 1HE8B 3MWKA 5P21A 1DTSA 3AP1A 3GPLA 1AA9A 2A78A 3QKRB 1Q1BA 1JEDA 2J0UA 1E2NA 5G3YA 4YMTA 4IOKA 1H8ED 3PITA 4ON9A 3ZVMA 1XWIA 4HLQB 3LQQA 5EE5B 1DAKA 3U7FB 2QGNA 5DHAA 2WV9A 4PC1A 1GDDA 1MT0A 4ZO4A 1GP2A 3FDIA 3THWA 2V6IA 3S1AA 3THXA 4XTCS 1XTRA 2X8AA 1E0JA 2J0VA 1W0KA 2IHYA 3AF1A 4ZV4A 2ODWA 5F98A 2XTZA 1JJVA 4P33A 4HDOB 4CDGA 3K9NA 5BQ5A 4Q47A 1FPMA 3GJ4A 2JCSA 4HYYA 4E5UA 3KXKA 4YLGA 2AKAB 3B6EA 1R4AA 2BOVA 4PAOA 1SZPA 4BFUA 2AD1A 1U94A 1RRFA 1VTKA 3B9PA 4FCVA 3R9WA 3L43A 4QNRA 2IYQA 1J90A 1GRRA 2NZJA 1R5OA 2WAXA 5CK4A 1E2KA 4QG7A 5FTMA 4YMVA 1IN4A 4NU0A 5HCIA 4PQFA 4AYWA 1P6XA 1N2CE 4KFTA 4EPTA 2BCJQ 4AWXA 5DI3B 4KYUA 2OSBA 2P0EA 1YRAA 2YC2C 2IS2A 3QVUA 4GMDA 2BMDA 2C77A 5DISB 1YZTA 1OXXK 3FHOA 2IEYA 4PXAA 4JL6A 3EZFA 1W0KD 2X2EA 5KNBA 2JLSA 1AKYA 2IA5A 4AG5A 4TYYA 2WJGA 5UKDA 2MSDB 2VH5R 4IFEA 5FTNA 4C0JA 4Q7JB 3HP1A 1QBKC 3TVTA 4DIEA 4KSCA 4ERNA 3GFPA 3ZJYA 3FOZA 3T1VA 1KI8A 3NVAA 1WA5A 2JLVA 4DB2A 2F1JA 4MYCA 3SHFA 2ODBA 3AF4A 1MO5A 2D62A 3TQCA 3U6BA 1FL9A 3B1VA 4FIDA 3KKQA 3W5JA 1KJWA 4HZUA 5G3ZA 1DO0A 2CE2X 2NO7A 1CULC 3AVTA 3MCAA 4Q4JB 1VYVA 3VR3A 3NDPA 4F91B 3P27A 4PO9A 2GZHA 4EPRA 3ADBA 3Q7QA 4E07A 4MQBA 3PEYA 3NKVA 2NO6A 3THOA 4DBLC 2QG6A 5JFGA 2R6FA 2IS4A 3SZRA 2OXRA 4XVQA 2ZREA 1EWRA 2X2FA 3NH9A 5HKKA 4LHZA 2ZVQX 1HUQA 2AX4A 3BB1A 4QJ3A 1D5CA 1GNPA 1YR7A 4E03A 2QTVB 1XRJA 4GOXA 4MDEA 2GJ9A 3GLHA 4U5XA 1X6VA 2FFBA 2RHMA 4C0HA 3KQHA 2ZJ2A 4Q4LA 3QQ5A 2ZSDA 5H1YA 4CEHB 3LAWA 4V03A 4A2WA 1YJ5A 2OV2A 2IYTA 3TNFA 1Z29A 1JALA 4IVRA 2O8EA 1TPZA 2Q6TA 5AJWA 1MRSA 2YWHA 1NIJA 4ZCLA 1E9DA 2JA1A 4O3MA 1AM4D 2PL3A 1VMAA 1NIPA 4EKDA 3W6PA 2C2HA 4MRNA 3QF4A 3FMPB 3IO3A 4H1VA 2ZE5A 3ZIAA 1T9HA 4M1WA 2CBZA 3THYB 5JMTA 4P4UA 1GVNB 4PTLA 4OHZA 4D80A 5A5GA 2GK7A 1EGAA 1HURA 2QORA 5HKKD 5SZHB 1TF5A 1QHGA 5JWHA 5F9HA 8OHMA 3U3JA 1G7SA 4AIIA 4FMDF 3DM9B 3QENA 3O8BA 2CHGA 1IM2A 1SVMA 1VCMA 2ZSBA 4B2LA 3SYLA 3VKWA 4DLZA 2HYIC 1M8PA 1H65A 1G5PA 1E2HA 2ORVA 2ERXA 2ORIA 3F8TA 1G6OA 3LBNA 4OK6A 4K8OA 1ZM7A 3ND9A 5JCPA 3P32A 1G7TA 3TRFA 3CX7A 2G0TA 4RCZA 1AS2A 1EFRA 4CT5A 1XXHB 1XCGB 3WP1B 5D3QA 3X1XA 1M7GA 1G291 4NYIR 5D3MB 3SR0A 3ZIAD 1NY5A 1Z6TA 3GFOA 4X8LA 2QQEA 3C5CA 5GJCA 5FOXA 2C04A 2CXXA 1L4YA 5FOUA 3U2QA 1CTQA 4HDCA 4A36A 3FFBA 1WE2A 4Q21A 2DFTA 3CBQA 4OI2A 4A4DA 4MUBA 4Q18A 2QMUA 4YC7A 2ZUBA 3TW4A 4MH0R 3MUFA 3MAAC 4XSGA 4DEYA 3VU9B 1ZUIA 4NCIA 2W6IA 2IYYA 1RRPA 4HDQB 3EIEA 4DXAA 4EPYA 1N0UA 1XCPA 5AUPB 2FGKA 3B1XA 3EC2A 1G3IA 4LBVA 4MGIR 2FDCA 1JR6A 4KLZA 3SJBA 4MRVA 1F2TB 1G3QA 3IIMA 2JLUA 1OIWA 5L8VA 4XWOA 1G3UA 1E79A 1TEVA 3RRNA 1S3GA 2ZUDA 2H8KA 4GDFA 1CJKC 1M2OB 2YVUA 5DYGA 3DOEA 4C0KA 1VYUA 4JYBA 5C4GB 1CEEA 2ZETA 3TKLA 4PR0A 4E09A 2VP9A 2PH1A 2R9VA 4B2IA 4GP6A 4LI0A 2XB2A 1T0JB 5L3SA 3KKOA 5FOVA 3LX8A 1I4TD 4A8JA 2Q3HA 1L2TA 4JVMA 2GJSA 4QGAA 4TZ0A 5FBQB 5KUTA 3PUVA 4RD4A 1A5TA 1ZU4A 2R6AA 2LWIA 4TT3A 4URVR 3FMIA 1K8RA 4BLQA 3QPWA 1E4YA 4JLDA 1XEXA 1T8UA 2EYUA 4LZZA 4HLUA 2OAQ1 2P65A 4JBXA 1E6CA 4CF7A 1E79D 4Q66C 4BUJA 1Z6YA 2CNWA 3E1SA 1W47A 2F9MA 1JR3D 2VF7A 3WBJA 1LVGA 2UKDA 2V7QA 4A6PA 1AS3A 4QRHA 1P61B 1CRQA 4Z51A 2J3EA 1QHYA 4EDHA 1ZVQA 3VR4A 2KJQA 5GVRA 4XWAA 1G7RA 3RS2A 3SU8A 2D2FA 5JRJA 2H57A 2PZEA 1KSFX 1XDBA 5TV2A 1II8A 2EW1A 2HUPA 5FH9A 4YONB 5IK2A 4DCNA 3IDQA 2CL0X 2QAGA 2OEPA 4JLOA 1HA3A 4DRZA 1C4OA 1N6IA 3T06B 2QSYA 1AZSC 4A82A 3MJRA 4TT3D 3EARA 4B3XA 2LCFA 3TSWA 4CEIB 2O8FA 2GDJA 3KUCA 2R2AA 2GWHA 3IGFA 5TDHA 2GKSA 2G6BA 1N6OA 5FTJA 1TF2A 2JAQA 1OH5A 1XJ0A 2H17A 2NTYC 2CNWD 1HTWA 3ICQB 3KKNA 2AR7A 3HU2A 3BH6A 3GLGE 3PUYA 5DYIA 1I4DD 5FPKA 1G16A 1U9IA 3A37A 2J1LA 3P20A 2V7QD 1ZIOA 3DMNA 1KAOA 1XD8A 1ZC3A 1W49A 2PX0A 1LS6A 1NBMA 1E96A 3O47A 3LD9A 3H0KA 5FL7A 2QPAA 1NG9A 1QG4A 3NH6A 3QI2A 2FA9A 3SN6A 3GLIB 5KSYA 2BVNA 3KJHA 2QM7A 2ZJAA 4Q48A 4AI6A 3RLFA 1W7AA 3A1UA 3GQBA 1UKZA 2YYZA 4ZKDA 5IK2D 1AGRA 2QQ0A 5AJVB 4C7OB 3FGNA 2RAPA 2RH5A 2V4ZA 1Y3AA 3CNNA 2RGDA 4IDOA 1Z3IX 5E7JA 4UQOA 4JT2A 1E2EA 4G0NA 4TN1A 2JEOA 2W0MA 2RCNA 3CPEA 2VP0A 1OW3B 1ZW6A 2XNDA 3W90A 4JYCA 1RJ9B 4S2EA 3FHTA 3PV0A 2QP4A 4ZCIA 2VSOA 2WWFA 2HXSA 2AXPA 4QBGB 1D2MA 3QPUA 2IC5A 2ZRFA 3GJ5A 4LPSA 2AN9A 2B92A 4RFSA 2ZI3A 1IJEA 1II0A 1TEXA 2F6RA 3KB2A 3AF2A 1XTJA 5JLJA 3AP3A 1NBMD 4WIAA 1LF0A 2WWGA 2DY1A 3K70D 2GZAA 4PHFA 1NLFA 5FL7D 2XXAA 4A0RA 2A5DA 2OLKA 1BYUA 4LJ4A 4JKIA 4NYJR 2HJGA 3IIJA 4GP7A 1OYYA 4XH9B 4Y0AA 5K8UA 3UPUA 4ZCMA 3R9IA 1RIFA 3RWMB 4DLYA 2F55A 1OH7A 4IVPA 3RVBA 3GEHA 4HUQA 4R71A 1MO6A 1TQ4A 4D82A 2V1UA 1Z0KA 3VR2A 1Z0DA 4LV5B 3QE0A 4Q7KA 3ZVLA 3D31A 1GUAA 4R2IA 1D2NA 3GLFB 4B3DA 4B48A 4YMSA 1GL7A 3PQCA 1GL6A 3CIOA 3SYKA 2C96A 1KO4A 1G64A 1YRBA 2GXQA 1WRBA 2C03A 2J46A 4Q5IA 4F4IA 2XNDD 3H86A 1UFQA 1QG2A 1Q57A 4KODA 3OIYA 3C15C 1G8GA 4IDHA 1OXSC 2HDNB 2ZRJA 1S96A 4IW3B 4QFMA 3UG6A 3I8XA 1ZMXA 4QGHA 2ZR7A 1Q3TA 3OESA 2FSFA 1WBDA 4MKFA 1KI6A 1U8YA 3GJXC 2KSQA 3EX7C 1YVDA 2A5GA 1W1WA 4JVNA 4BZPA 3TGPA 5LB4A 3T1TA 4XJXA 3TW8B 2QPTA 4TTQA 1Q44A 2XEXA 1YHNA 5FTLA 3THWB 1UKVY 3CRRA 3THXB 1EESA 2WBLC 1W0JA 2W00A 3U7HB 3AKDA 3H1TA 3OIUA 4OHWA 5KDDA 1XJCA 2AFIE 5IF9A 4BZQA 4AYXA 1XJQA 4DLWA 4AKGA 1XP8A 4MRRA 2AKYA 4DIDA 4MKHA 1F2UA 5ANRB 3N5CA 4LHVA 2IXGA 1BOFA 5CK5A 4HB2A 3TUIC 4B73A 4PANA 2OCBA 5GJVC 3A36A 2I3BA 1NN0A 3BE4A 2GAOA 3SJAA 4TTRA 3UXMA 4GZLA 3AF0A 3X1YA 4NP6A 4DUGA 3UMFA 1CLUA 3SE0A 4BQSA 3RC8A 4IEEA 4CEJA 2WICA 2ZI5A 4JSYA 1FP6A 1G8YA 5KTYA 1QRAA 1NN5A 3FMFA 1KDPA 1W4AA 4F4JA 2YWGA 1W0JD 4NTZA 4M8NE 1XZPA 3QXHA 4D81A 2O8CA 4L4UA 1HQCA 4BLSA 1XBTA 3ZZTA 3TR0A 2QTFA 1P2SA 1QHHA 3U6KA 3ADKA 4HAXA 3JVUA 4DC9A 2PEYA 4A8JC 1SXJA 1MV5A 4FXPA 3B2EA 4A0HA 1GNRA 1TUIA 2W2XA 4D0GA 4S35A 4TSFA 2QROA 3TUJC 3KFXA 3PENA 4UJ3A 4HZUB 5DHFA 4AURA 2PJZA 4B76A 3Q8XB 2WWXA 3BH7A 3TLXA 3QXSA 3TAUA 1ZM4A 3AUXA 4N0EA 2FNAA 4F92B 4DUGD 1T3HA 4G5RA 2P5SA 3EA0A 2REXB 4EPWA 2IUSA 4LOAA 4HLUC 2L0XA 4PAMA 4URYR 2FMXA 3AVPA 3T5GA 2ONJA 2OHFA 1VG8A 4JKYA 4B3CA 5TXGA 4DLTA 4G5SA 3T35A 2RHDA 2BKUA 3A1SA 5TVKA 1AGPA 3U3RA 2ZR9A 5H68A 3GLHB 3MLEA 4IVQA 2VQSA 3LVQE 5J5CA 2C8VA 1D9XA 3NHAA 4Q19A 1XEWX 2G3YA 5BN3A 1R10A 5FR1A 4BFZA 1KK2A 4LC0A 5DH9A 1SXJD 2ZRDA 4KU4A 4UNSA 4D2IA 1P73A 2G1KA 4I4LA 3KB1A 4ITRC 4IEIA 4TSFD 2QAGC 3WP0A 3MWYW 4TL6A 3BS4A 2QY9A 2O8EB 1E2MA 3ZQJA 2GXAA 3HJNA 1CXZA 3EPKA 4UNPA 4ESVA 3PUWA 4FMCF 1F6BA 2RKOA 3IBYA 1KJYA 4HB3A 4NE2A 4OQLA 4LBZA 3K1JA 1SKQA 3QF4B 3R7WA 2WWIA 3VX3A 1TQ2A 2NO1A 2E1RA 3CH5A 3LV8A 4FMDB 2LKDA 5CYOA 4NYJQ 1UDXA 1IY1A 1G9XA 2OZEA 2W2VA 3GJ0A 1U9IC 2BMFA 3IEVA 1NMXA 3QEJA 1E94E 4Q7LA 2OO7A 2F1RA 2WKPA 2QRNA 1JEEA 2ZRKA 1ZNWA 3E2IA 3Q7PA 1DADA 3AVVA 2WKRA 4DT1A 2FFHA 4WZBE 4BZXA 1UM8A 2BJWA 2D06A 4C0AC 5JWOA 2CLSA 2B7CA 3B1YA 4KXFB 2IL1A 2C9CA 1Z63A 2QT1A 5GJBA 1KIMA 4B34A 2BC9A 1YE8A 3LH5A 1XF9A 1KO1A 4URWR 1P3JA 3KFVA 3ZVNA 2VHQA 4V0OA 1EFUA 4LV8B 4UNRA 2QRZA 4HAVA 1UPTA 1W48A 4V0NA 2IYUA 4EFMA 2CCJA 3TE6A 2RGXA 2XAUA 4IHQA 1Q12A 1JI0A 1CJTC 3MJHA 1XXHE 3GJ8A 1MKYA 4FWTA 2P6RA 1KK3A 1TX4B 5J4KA 2ZXUA 3H84A 3VNUA 4HB0A 4NONA 4MGZR 3T5DA 4EIWA 2D7CA 3L8ZA 2QENA 3KJEA 4A0GA 4D25A 1PLLA 5KPJA 2HLDA 1U0HC 3IHWA 3KJIA 4WXPA 4W7SA 1JPJA 4US0R 2F3TA 3NBFA 1OH8A 3ZVRA 4RD0A 1DO2A 2DFLA 2ZU0C 2QMOA 1W4CA 3A4LA 3QG1A 5F3WB 4WVFA 2DWPA 1XFAA 1PUJA 4IKEA 1NVVR 4Q4HA 1II9A 2ZANA 2D3WA 2CJWA 1W36D 2A30A 2QL6A 3A4NA 4B74A 2RGCA 4NZYA 3Q5DA 3ND8A 5L3SB 1WB9A 1O87A 4A8JB 4XTRA 4FW9A 1RPZA 1OIVA 4K46A 2IYRA 2VBCA 2CHQA 4R7ZA 4D6PA 1FTSA 1AN0A 3IPXA 2OT3B 2VHJA 2ZTSA 4TLDA 3ADCA 2O0HA 3BORA 5EJEA 2HXYA 2OFXA 1JQJC 2HLDD 5J4YA 4TMZA 4PFSA 1X8KA 1Z6AA 1XEXB 3OFNA 2CHVA 2FFAA 3I1FA 2P2LA 2G9NA 1OFHA 1M74A 2OFWA 4DWJA 4OI4A 2VIIA 3WMGA 1UKYA 3EXAA 4WZ6A 1IQPA 1OV4A 3SOPA 5JJKA 1MO4A 3D3QA 3W3ZB 1CR0A 3A6PC 4UJ5A 2J7KA 1VG9B 2ZE8A 3X1ZA 4ACBA 1YZLA 2JLWA 3TAHA 3TK1A 3QY0A 1E0AA 3TIFA 3R8CA 2F9LA 3K0EA 1G41A 4M9XA 4FCTA 2PEZA 3OZXA 3VMFA 2AWNA 4NYMR 1II8B 2VSXA 4X8OA 1R0XA 4WA7A 2MSEB 3AGPA 2QAGB 4MRSA 1NKSA 3VHLB 3QKSA 2J45A 4H1UA 3CR7A 3ADDA 1G21E 4TMWA 4WOPA 2IS6A 2FSGA 3T61A 3GP8A 2SHKA 3P1JA 2O8FB 1CS4C 4AK9A 1LFDB 3HR7A 3UMSA 1FQKA 5DO9A 3OFND 3X1WA 4WXRA 3NWJA 4LJ8A 5DI9A 1N5LA 2JJ2A 1GIAA 2O0JA 3PVSA 5E4FA 5FPTA 3EG5A 3KXIA 2PCJA 4RSGA 4NPHA 2JGNA 1GOTA 1LS1A 2JJ1A 4BFVA 4R98A 3U44A 4ZDIA 3K70B 1XMVA 5JRZA 5BN5A 2ODEA 1M6NA 3BXZA 3DMDA 4V0LA 1SXJC 3C41J 5JSZA 1G8HA 1KZGB 4EFNA 1G20E 1G8PA 2JDIA 2MMCA 1KZ7B 4Q1AA 4QNMA 5CM9C 5E7IA 2J41A 2ZRAA 3TVDA 5AJXA 3ICEA 2DHRA 5IRCD 3CLVA 4JS0A 2G1JA 3OF5A 3GLIE 2XNSA 2EFDB 3PUXA 2ECKA 2WSSA 4EPVA 5HPYB 4DHEA 1PUIA 5AWFC 2Q9AA 3ZLJA 2IUUA 1QDEA 1BKDR 1LW7A 4PSKA 1KDRA 1PLJA 5TB5A 3QF7A 1IBRA 1Z47A 1A82A 2ZPTX 2IWRA 2KBEA 2BV3A 1L4UA 3ZZ0A 1EXMA 1E9RA 1KNXA 3IEUA 4RFSB 2JLZA 3VX4A 4QBIA 2BCGY 4RVCA 3ZQ6A 2JJ1D 2WJVA 2J0QA 1CR4A 2XXAB 5AUNB 2OFOA 4QGGA 2VA8A 1JXOA 3DO6A 3DZ8A 1T6NA 4W5HA 3PXGA 1G18A 1F3OA 1ZD1A 2BIFA 2JDID 2OBLA 3PFIA 2ZR0A 4ILEA 2IXEA 4HUQB 1JAHA 3I62A 1E2LA 3RC3A 2OUKA 1QHIA 5G53C 1JNYA 5HTKA
chains in the Genus database with same CATH superfamily
5GONA 2OHJA 2Q0QA 2R5WA 2R6DA 3LO8A 1X86B 3LY8A 1NJ1A 2WSSD 3LPNA 4QQ8A 4ETIA 1JHDA 2OE2A 2XLCA 3K94A 3KQSA 3LNCA 4JDUA 3I9V6 3DE2X 4FFMA 2QTAA 3HADA 4BE9A 1TCVA 3LUFA 4O2BA 4ZAVA 4BECA 3U19A 2WYUA 4G3XA 4OMDA 2GZDA 2BD0A 3GP3A 1G19A 3NGXA 1P0MA 2QTHA 2VTKA 1BROA 2XCIA 4LHXA 1JQKA 3SYTA 3UGTA 1SVIA 1YZYA 5B12A 4XCQA 4QICA 2HPHA 1T35A 4BJ5A 4LGYA 2HCFA 1RADA 5AFSA 2EKQA 2VCHA 1AKEA 1T8YA 3MMSA 4V02A 3TDKA 3WICA 2C0PA 5BV7A 3QEAZ 3EULA 1DAGA 3T15A 1LBQA 5DNYB 1T2AA 3ZGVA 2NT4A 3HBNA 2V65A 3PC6A 4EY5A 1LTQA 2GEUA 1T5IA 1ZVMA 1KFBB 2HI0A 1YZNA 1ESMA 1U65A 4BQPA 1Q7TA 2GPYA 1Q1EA 2PX4A 2XMSA 4AMVA 3K71B 5FUBA 4BPRA 4MUIA 2XCUA 1C0KA 2IUTA 2AXNA 4KO1S 4A5OA 1ZXBA 1KH1A 4UW9A 1XDDA 2AVDA 1RQRA 3QRWA 1K2VN 1MCZA 1VPLA 2D54A 2Y1KA 3TMKA 3FTPA 2OHOA 3V46A 1GZ5A 1RQ2A 4ZQCB 2OGWA 1MJNA 3ET5A 1NTRA 3FCCA 3NB0A 2DZDA 1BMTA 5JS8A 1NVUQ 1J2JA 1MNAA 4ZOAA 1E1KA 5ALMA 3V4ZA 3QOXA 1UODA 1CJMA 3K05A 4UBJA 4CKZA 3NVKI 1P3Y1 2AX3A 2JD0A 3LBHA 2ZWMA 3PC8A 3SBXA 3Q85A 3UWOA 5E2AA 1U8TA 2HK9A 4JQZA 5MDHA 3G8DA 5EHIA 2H2FA 3MRVA 4ZHQB 4LKRA 5LLSA 1CHDA 3QNUA 4PIVA 2IE0A 2YHBA 2Z2KA 4RPIA 2D0DA 2QP3A 4D0LB 2H2AA 3I2GA 3W2EA 2R4UA 2QRVA 1DQSA 4DLKA 4E5MA 5KKCA 3EVZA 2QUAA 4JHLA 1K68A 1BGWA 4XEUA 3ZGZA 4FOOA 4POOA 1H2FA 2O2IA 2B4KA 5AI6A 2CLLB 2DU8A 4R2KA 4QA9A 3PK0A 5AW7A 3S68A 3WSTA 2C9OA 1FUYB 1N1MA 521PA 1GAQA 2P2CA 5JAUA 1UEXC 1XVVA 3RS9A 5FHRA 4HATA 3KT6A 4AP6A 2CZCA 2PT5A 3HJBA 1ZJ6A 2R44A 2YVLA 1XEFA 2PBFA 2VAMA 3A1NA 4A26A 4ZEMA 2Y0BA 2ZBFA 4AJEA 3CZ9A 2WP0A 1B8UA 2A9JA 4BO0A 5LQNA 1RWNA 3U31A 2PMBA 3QHQA 4AWBA 2Q7XA 4HDSA 3G79A 3GGCA 5H3CA 4OOEA 1GGEA 2A9FA 4YUAA 4FMBB 3L6EA 2VXOA 2R85A 2YINC 1RD4A 1MX1A 1QIGA 4O4IF 1SXJB 1XYYA 4KXVA 3G0DA 2XVMA 3ZI7A 3FA2A 1LRLA 2GD6A 1VCHA 4PAGA 3UHFA 3ZHXA 1XK6A 1RKBA 2Z1DA 3L40A 2DKFA 3CE9A 4LYAA 2R4QA 1PJAA 4LOHA 2NAFA 3PL5A 1TKRA 3NORA 4J6FA 5H4HA 2AH5A 1XZGA 2PL1A 3UJ8A 3VR5H 3JQ9A 3ZY5A 1OXKB 3IVMA 3Q7RA 4FYJA 1RLJA 4HX2A 4WN9A 1H1DA 2ZTLA 3MD9A 3WHLA 4EHIA 4Y6SA 4ENTA 4ZHSA 3QVWA 4TYNA 1ZSYA 3HKEB 4XLTA 2HSEA 5K03A 2X7HA 5AHKA 2GHTA 1JSCA 2K2WA 3G9QA 1H2WA 8ATCA 4QZVA 5DP2A 2ZKLA 2REBA 1TM5E 4ND6A 2OXEA 5LD2C 1LX6A 1E9BA 5AM4A 2Q2WA 5EY5B 4KXLA 2QD3A 2XMGA 4BY9E 4JBNA 4FGKA 3K1ZA 4TYQA 1SCBA 2J5RA 1QFXA 3RFUA 3B6IA 3HEAA 4CU2A 3RVQA 4ZRDA 2IV3A 5FBZA 5TGZA 3JQGA 2AYYA 2C8LA 1SVWA 3I9LA 3R0QA 3WKDA 4MKIA 2GXUA 3JCZA 3OEHD 2W6JD 5YASA 2O8BA 1HNXB 4WK6A 5CJPA 1NZFA 2JKZA 2W6PA 2WKSA 2JIDA 2ZT8A 3CR3C 5DBIA 3H6HA 1D6JA 3S2FA 2FCRA 5JR3A 2Y05A 3RJTA 1XLVA 3ZKWB 4N40A 4ZGGA 3QXCA 3MHTA 1WSAA 4YLEA 2ANCA 1U2PA 1N6RA 4MEJA 1E1LA 2JLRA 3WL6A 4AIRA 3NHBA 2ODPA 3P5SA 4PO3X 1QKIA 4TQAA 1C9YA 3KLNA 4UQPA 4WESB 3SBOA 1LLFA 4E13A 3Q15C 4NCHA 2Q6VA 5JQGF 5JSYA 5SYAA 1E1CB 5FEUA 4D46A 4DB4A 3FOAA 1ZX1A 2FUNB 1R18A 121PA 3FWHA 3S8EA 2GS9A 2MINA 5SV2A 3WKBA 2XMPA 5T6BA 1IXZA 1HE5A 3A0UA 5A0FA 3S29A 1R16A 5BRAA 3M9LA 4I36A 4MVJP 1ZGAA 4OXYA 1O94D 4YGYA 3HZZA 4NEHB 1JEQA 5FBRB 2DBVO 5FPHA 2R68A 3SS9X 4UREA 1N5RA 5I7UA 4CJXA 4US2R 1S2IA 2FOLA 1YOBA 2PZLA 2ZPAA 3EIWA 1ZMOA 4FOTA 4L4RA 2TYSB 5DGDA 4HYTA 3RDPA 3RTEA 3JZIA 2OCLA 4DT1B 4H15A 1H0HA 3PD0A 3UAGA 4IV5A 4NZMA 3D2BA 4X6YA 2F3UA 1Y1RA 2QSJA 3FKSA 3FOWA 3AGQA 3AYZB 2J6IA 4WLEA 1L8QA 1NP3A 1OBOA 1VLLA 2CNDA 1WHTB 2MMGA 4BBPA 4BV2A 2PM8A 4F7WA 2VYQA 3GBVA 3QVMA 4HXYA 1AUVA 3JQDA 3FYUA 2PFSA 5CIQA 5D3ZA 4AM8A 1KH3A 2BM0A 1BX3A 4KAFA 5CLLA 1KFEB 4G01B 3AU8A 1XZKA 3I05A 3SOZA 5CTAA 1XMSA 3VYSB 1EINA 1M6YA 3HV0A 1LI4A 1IAQA 1YIOA 2AK3A 3HXLA 1R6AA 2KI5A 4GSYA 4OCZA 4QJ5A 4RJJA 4RZUA 3FNQA 3PPYA 3AB3A 3NEYA 4FDVA 1JSLA 4XVHA 3SXJA 3ZY4A 3UV3A 2AD5A 3FF4A 3FGPA 4L7VA 5EQTA 3H2JA 3RWOA 4BO6A 1RT9A 4X20B 4IG9A 3DBOB 1COWA 2HGSA 4HI0E 1KNQA 1NMZA 1V39A 2FX3A 3E9MA 3L7KA 4WQMA 3DYBA 2V7WA 1O95A 1N25A 3EXEB 2MWMA 2W9XA 2FEPA 1CEYA 3DDHA 1X9IA 1LB1B 1P9NA 5TX7A 2QZZA 4J4BA 5EOVA 4B7AA 1MVOA 1HDGO 1YXMA 1ZESA 4Q1DA 4EW3A 4DJ5X 4BEBA 1CY4A 3EDOA 1P9WA 4MQUA 2FZKA 5A6VA 2IVZA 1NJGA 3ZV7A 5FI3A 1GU7A 5H70A 2FQXA 1IJFA 5JAIA 3QEBZ 1VE3A 2WTEA 2A5FA 1ZNYA 3LY5A 4EGCB 4LS3A 1LSUA 2HNAA 1Z3CA 3DFKA 1SQ0A 2P30A 4ZEWA 4AUEA 3DVRX 4M1TA 2GKOA 1N5IA 3CS3A 2UZ3A 3CR8A 3E9ZA 4HYQA 3KQNA 5C7IO 4OFBA 3B51X 4F84A 1JTVA 3A4IA 1DFHA 2YRFA 3UK6A 2X0IA 2RJOA 3DZCA 3A9VA 1CP2A 3BF8A 3PNPA 4MPTA 4MR8A 5TE9A 3VO9A 4BX8A 6NULA 3HDGA 5KOJA 4POAA 4HN2A 4ZT7A 1IZ0A 2HB6A 3FOCA 1UZMA 5K0FA 2GJ8A 4URHA 4MDYA 3G02A 2RGGA 3AQIA 4C3ZA 2PH5A 1IJBA 1CUSA 2HU2A 3Q3GE 3DOIA 3IPYA 3Q6MA 5T3YA 4CIXA 2BFEA 4RLQA 3ZDEA 1NXSA 2DJIA 2LKCA 2AJDA 3WQQA 2VYCA 2WJAA 2DTDA 1NG1A 2AMJA 2OBBA 3OQJA 4EG5A 1AH2A 3T95A 3QVGB 2AMYA 5FOWA 4AJPA 4PYMA 4PO1A 1POWA 3GZTB 3GVCA 1N5JA 2FP3A 2H7XA 2ZJ4A 2D3TA 2DBRA 2X58A 1KVQA 3D0KA 4GR9A 1WHSB 4OV6B 4YQYA 5LD2B 3BTSA 3NTQA 2X7JA 5EJ7A 5KYYA 1YDMA 1JIUA 4D9HA 2EHJA 4O63O 5BMVA 3MVEA 5IF3A 5INTA 1CNFA 5M04A 1NVEA 1SCUB 1ZXXA 2C9MA 4RJLA 1ZGCA 1VPEA 3JRXA 4G0OA 3BOSA 1O5OA 3E6AA 4GWGA 3R6WA 1S8FA 1BN6A 3O94A 2NNWB 2GVZC 2ROQA 5JHGB 2M9MA 5A4JA 2EKZA 4A1FA 2N47A 4KPFC 4DCPA 1RSZA 3BGSA 3H7IA 4ND1A 2MR5A 3BKXA 1EJ6A 3KHSA 4MUYA 3WRXA 2E5LB 3TTTA 4NENA 4ATNA 1TW3A 2JFQA 3PRYA 1KK1A 2Q49A 2AOTB 2GFIA 4GO1A 1CR1A 3F2VA 2GN8A 4EEZA 5KYWA 1XKLA 1XI2A 2DUUA 3LFUA 2IK8A 2PANA 5FTKA 3T1NA 7REQA 4KQEA 2QN9A 3FN4A 1NQOA 2WIAA 4LSGA 3UA3A 1JR4A 2I2BA 5EMKA 1TKCA 3A6JA 2WIBA 4UU1A 2QL9A 1Y63A 1P2TA 2TMKA 3ITDA 3LUPA 3AIOA 5FOSA 5HYVA 1RM0A 1LTHR 5IN4A 2J9ZB 4H1TA 3U81A 4JR2A 4IQFA 1ODCA 3L7LA 1OLOA 3FWYA 4Q3DA 4DNPA 4J0QA 1K5DA 2MJLA 2NSYA 3GRZA 3N8KA 1GZVA 3R2JA 2I03A 4IXMA 5BN5B 3W77A 2DUJA 5C5CA 2CCKA 5IT9A 1EFPB 3CO5A 4R1PA 2FJUA 4K9KA 3HB4X 5EQJB 5T4EA 3ZN2A 3K09C 4HEA1 1JWLA 1EJ2A 1U0JA 1T5BA 2BJVA 2IWHA 1NBME 1RCFA 1L7VC 1P9RA 2ZIEA 1XCLA 3LPLA 3A9SA 2J5XA 1SUFA 1J2EA 4MUAA 5KEIA 1YFZA 2CMFA 3JVIA 5SICE 2E5WA 2WSYB 3UJ6A 4Z4GA 4TS3A 3UHJA 4C0XA 1ICIA 2C1ZA 3U9TA 4Y2HA 3PR1A 2H1LA 4NDAA 4HVAA 3PD1A 1X9GA 2GAAA 1R8YA 4GLFA 4RUKA 4IY1A 2Y9MB 3ZKWA 4BMDA 4D9IA 2GPTA 5ARBA 5L40A 3DE1X 1Q77A 2NUAA 2P9HA 2PT6A 2GEFA 2QN2A 2XNCA 4QG3A 1T2EA 1JJFA 1VHLA 3D7MA 1GO2A 3AXTA 1UKAA 3JWJA 1L5LA 5CX1B 3NYQA 3EDQA 3I2FA 3K20A 3ELBA 3G2MA 3AR4A 4B6QA 1XWWA 4UNQA 1D4AA 3OEYA 3MCTA 2NZ2A 4Q1BA 1JXMA 2NO9A 1NNI1 2AFHB 621PA 3PP8A 4PX2A 2QYSA 4PPGA 4G5OA 3SEQA 1BDIA 1J8MF 1E7MA 1SKBA 1ZK1A 4S3MA 5IFKA 2PZMA 4G5GA 4DCSA 3PBKA 1S3SA 3BXXA 2AJTA 3WGLA 2ZVJA 2ZI6A 4NY1A 4IYJA 3U56A 4LF6B 4TLMB 1QH8A 2RB4A 3PGMA 2N0SA 4PC6A 1DAEA 4TL9A 4ZIRA 2F9FA 5LC1A 3ZLTA 4DAOA 1G60A 2XWBF 3FIUA 4DY6A 5JZSA 4IICA 5HS4A 3TQFA 4RORA 4KSYA 4QRDA 4YFVA 4C0QC 1ZH6A 3HVJA 1MXFA 5F76A 1JDJA 1BO6A 5A1JA 2ZYGA 2OLJA 2NV2B 1IMOA 5KI6A 1K08A 1Z4OA 3FYHA 3Q2KA 4IDAA 5ALJA 3IELA 2WTAA 3TLKA 5DBEX 2HC9A 3FDXA 4DXHA 1AKVA 5C7YA 3WWYA 8ADHA 2BFPA 2KW5A 3MWEA 4KLCA 2CXRA 3H4MA 1WBJB 1XCBA 2PUJA 2QE7A 4OYHA 4MIKA 3EA4A 5EYPB 4P4SA 3VU0A 4E1AA 5TQ0A 1GM5A 2H48A 4FJ1A 1SB9A 2VSQA 4F3TA 2BF4A 3Q0EA 5CH3A 3U4IA 2BH2A 3OPMA 1JE1A 4M7RA 4B3TB 4P0QB 2UZ1B 3KDSE 1QQ7A 4GYWA 3I0ZA 4PZDA 3DPUA 4IJKA 4KLRA 5HJ5A 4LXXA 2OM2A 2Y1FA 4H9GA 3R7AA 1SBIA 4QTYA 1TF7A 2HWYA 4JENA 3IPCA 1NU6A 2EBUA 3GAFA 3OT4A 4RSMA 5SYNA 5IZCA 1HOXA 1TVMA 4DLBA 5JCOC 1NPYA 1XTKA 2A67A 2Q9BA 2YV2A 4DIOA 4XVUA 1QU2A 4K9PA 2QZ4A 3DHEA 3FFTA 4UAVA 4NEGA 3RLIA 1H2RS 1DKLA 1E4VA 3EDMA 1TK2A 3N28A 3W2FA 3OIGA 1QP7A 2O8VA 3G2HA 4RL6A 3W5HA 4B47A 4F9FA 3VR6D 1NSFA 4KXYA 3VHXB 1FNCA 4DIUA 1N0VC 1FLVA 1X7WB 2AOXA 2BN4A 2H51A 1W34A 4J4HA 3UT5B 1V1MB 2XCQA 3AUYA 4RESA 3M33A 5LP6C 3W5IA 5CEFA 3PRJA 1I14A 1A4UA 2A0KA 3KZKA 4K26A 3Q40A 2YV5A 1CFZA 2PL9A 4IO0A 3UOWA 1RWKA 5KX5B 2IUYA 4YT8A 2G9UA 1F7UA 2V7VA 4P86A 4LE1A 1HH4A 3OFSA 4IFTA 4N0QA 3OJEA 3FDFA 3R20A 5IWAB 5EPEA 1W6UA 4X7PA 1YUMA 5C9ZA 3RK1A 4P8RA 1U9ZA 1J99A 2H29A 2NTEA 2I91A 4UTPA 4P6VF 4QOEA 2EFCB 4JQSA 1Z15A 3LDFA 3ORRA 4GT1A 1O0BA 3QVGA 1PBTA 4JDPA 2JIZA 4BEVA 4D8VA 5IYZA 5J2UA 2GBLC 3MD0A 2V6FA 4E14A 4AXXA 2CD9A 2XA1A 4MYTA 3QNMA 3KZ1E 3GG2A 2HQBA 3WIEA 4O8ZA 3TOVA 4CTJA 1KIAA 2V0GA 4JR0A 4DMHA 4D79A 1JU3A 1WHSA 4N0PA 3OTQA 4BIMA 3R3SA 2GAFA 1VGQA 2VJQA 4GKVA 2XCLA 1CZRA 1ZK3A 2C61A 3H2KA 2Q46A 4QPCA 4DBLE 5FO1A 5CDHA 2I9KA 4MUKA 2CV1A 1PJTA 2HZBA 5F4BA 3PTAA 4Q7EA 1XNQB 1PX0A 4IQ0A 3ESDA 3IAM6 4BKMA 2I1VB 5AVYA 4Z3OA 1OJLA 4FDTA 4OD0A 2OAEA 2JCXA 5DOVA 4QGBA 5JJLA 1M0EA 2GVDC 4DCCA 5K0BA 4W9MC 1YKSA 2FPMA 2XYRA 4QM7A 2XQIA 4J8PA 4WLOA 4EQ6B 5MGNA 4LGMA 3NU1A 4FFSA 3MB8A 2WIJA 3ZWMA 4JVOA 5CA1A 1ACJA 2FU5C 3M6AA 4C04A 4KLAA 2C5LA 2E6UX 2ZRPA 2XB9A 1UBLS 3MINA 4M1SA 4C21A 5KYTA 1DKMA 1P2BA 1VMDA 2R8OA 3DKIA 4F3RA 4QRIA 4XQEA 1ABBA 2PRJA 4ZYVA 2VH2A 3OQIB 5ALLA 3BULA 1I1NA 3L3BA 3QU9A 2A33A 5CM2Z 3C3EA 4D9CA 4F1KA 2DFKB 4LSMA 1Q21A 1U8AA 2FWBA 2ONYA 5KTMA 1FP2A 3DP7A 3BA1A 2XZOA 3EQ7A 3D1LA 3STYA 3WB2A 2PKRA 2Q5JA 1GCAA 3UUWA 2I6GA 1IN5A 4H3KB 2Y27A 3NAZA 1TRHA 1G8FA 2BEVB 1IZ9A 3OWHA 1X9HA 2FZLA 4ZWNA 3QV1A 1DT5A 3WWPA 2Y67A 1H2XA 4GUDA 3OICA 2A1TS 4H6XA 1NSYA 1K5HA 3PHCA 4P82A 5DIFA 3VOBA 4M0PA 3ZWAA 7ABPA 5I7VA 1D2EA 1ID8A 2CFSA 3SXUA 1US8B 3GOHA 1BSVA 1GPYA 1L5OA 1GNVA 3I6ZA 1CQXA 3MWFA 4LJ9A 4V3BA 1EVKA 4TSKA 3ZWDA 2BEKA 5KHLB 4HC4A 5C5DA 4QHYA 3F8WA 3GIDA 4JC4A 2P9EA 2W42A 1M1YB 3GT4A 5TPZA 4D7AA 1JQ3A 1XQWA 1Q7EA 4LZWA 1FNBA 3LLCA 4R8SA 5AXAA 1K27A 5CA0A 3RNLA 3K0AA 1YZUA 1UBGA 2IU0A 3ER6A 4EJSA 2DQKA 4ZCSA 2FF7A 2XKJE 1OI4A 2J7PA 3EVTA 3F4LA 3JZDA 4JU9A 3OCYA 4EVQA 1VI5A 2XE6A 2R8EA 4RKYA 3O8DA 4CKXA 1DEAA 2HA3A 3MW8A 1LLQA 3GFSA 4X92A 3TR6A 1JU9A 2FZGA 4B8YA 2GM9A 3N07A 3ZPXA 1E5DA 1KDTA 5JBNA 3RHZA 2LCIA 4UASA 2I34A 2EDCA 5KS2A 1GYRA 3OQPA 4NFHA 4WFKA 3HHEA 1N2GA 1N3BA 4CU5A 2YKGA 5C4MA 3RAEC 3ZY6A 1K92A 1S0UA 2ACEA 4FNGA 1VL6A 2XTNA 2EU8A 2VP6A 3BF7A 2NACA 1O4WA 4HDRA 4IIEA 4RKFA 1Z18A 4HNTA 3CWCA 3I5AA 4JBIA 3I6IA 4RHEA 3HJGA 3UB3A 2WU3A 4RMNA 2WMYA 4OSOA 1MABA 4C88A 3EEYA 2WUVA 3PWZA 2ZJOA 1XU4A 4MKXA 3EGDA 5HDBB 4YRJA 4G8JA 1NW3A 4TMKA 4GOJA 4BO9A 1UJ4A 1SWWA 2FEAA 4Y2QA 1OKKD 3HNPA 4EOGA 2H31A 1GNTA 2YHIB 3PF8A 3KSAC 5FTWA 2JEZA 3B5EA 4RD1A 2GCPA 4BEJA 2GNAA 3D8UA 1GZ3A 4ZICA 4AUMA 1CYDA 3U3OA 2B4AA 3EXHC 1SK8A 5LP6B 2VPTA 3TOXA 1Y8AA 2EEZA 2IITA 4TYPA 1IUPA 3H1BA 3LQKA 3N2KB 1P2UA 2L17A 3RUFA 4C6TA 4E15A 5JNSA 1JLLB 3T7RA 5JT1A 3O5AA 4EH1A 1G0NA 2XF2A 1NW8A 3CNQS 2XT6A 4LZPA 4OBWA 2F43A 2DM6A 3IP9A 5HXAA 1Z4MA 4DG5A 2ATIA 3E18A 2XUZA 5ADVA 3QUAA 2Q2VA 1QIKA 3TBFA 5LA6A 4JLPA 3RJ5A 4K6CA 3G0IA 1NNLA 2HFKA 5F21A 3TW6A 2EP8A 3K0FA 3G89A 1AD2A 4E4RA 3FZQA 1RRCA 1NVVQ 4I9GA 3K7EA 3ZTTA 5CP8A 4HH3C 5IM5A 1UIMA 2P79A 5PNTA 4GS5A 4M53A 3CZMA 1OREA 2EATA 4Z0NA 1UKEA 4QEKA 1POXA 3EEBA 5BOSB 2X8LA 4E5YA 3QVVA 2YCBA 2VXBA 2W0SA 4UCFA 5ICEA 3U61B 4TV8A 3T12A 3ZQ4A 2FGJA 3B48A 3FVRA 3UUFA 2MSKA 4MROA 1SA0B 1N2HA 3UWMA 5BYKA 3BEOA 2Q1YA 2FOIA 3JARB 5EP1A 2EFGA 2OD7A 4FZ5A 3R74A 3SG0A 5F2NA 4OHFA 1EE1A 4JP3A 1WCV1 1RE1A 3EQ6A 3U7QB 3ZCPA 3SBDA 4BAGA 1XWFA 1OLXB 1YE3A 3BJZA 1MOQA 2R4TA 4JL8A 4E0BA 3PIRA 1HMPA 2WVHA 4L76A 3K5WA 2CKDA 1Q17A 2DLNA 1PJ2A 1XZAA 2HNKA 3AR2A 3GJ6A 3OSZA 4CCWA 3K0SA 2HDHA 5FNVA 4JVLA 1N5DA 4M0UA 3TRIA 2FJPA 5HJEA 4KR7A 4RVUA 1JPVA 4YLYA 4Q7MB 1V6CA 3F6EX 4BX3A 4PEVA 2RI1A 5EP3A 1QGYA 2WTNA 2GESA 3HJRA 1SUCA 3Q1LA 1GCUA 3OPYA 4OHBA 3Q8LA 2CXPA 4LOKA 1SC3A 1V8PA 3H11A 2FWRA 1Z28A 5HR5A 5JNLA 4NZOA 3TLGA 3G5UA 4OQXA 3STVA 1IY0A 1P6QA 4IWYA 1KEVA 4JP5A 1ULTA 2C7VA 4I3HA 1HT0A 3KYDB 5CCXA 2EHDA 3IEMA 1U7TA 1AQNA 1WVIA 2FI1A 3D2LA 1T4DA 1U2DA 2DFNA 2VHWA 4RCVA 2FZ5A 2OR3A 3RAFC 1RQNA 2JFWA 1A97A 4TS1A 5BSMA 3A6EA 3ANXA 3G2IA 3K09A 5B64A 2LE0A 2WF6A 5DBGA 2YFKA 1N2CB 2ADFA 1R0ZA 4D6YA 3BMQB 3G5LA 2I87A 4F2PA 5H4GA 2VA9A 5AI9A 2YZMA 3GD7A 4LJYA 3DVQX 3G9TA 3JQAA 3TZBA 3B6ZA 1C9EA 3Q9SA 2VYND 3P9SA 2FZVA 3RKSA 3W4JA 4CT0A 4E2ZA 3L84A 4IMIB 4JU8A 2WPDA 3SR3A 2ZBPA 2A1TR 1OSNA 3FCUB 4Y2GA 5GTDA 2V8OA 1DAIA 2GPSA 3CLUD 3C3AA 4P7KA 1C4XA 4NFSA 4I4TA 1BMFD 1C5KA 3CISA 4RY0A 3ZU4A 2ZTVA 2Q9CA 1QB8A 2YMQA 1Q7RA 3SC2A 2PZGA 3PUJA 1A9XA 2WQ6A 2CJPA 1TTTA 2JKYA 3REGA 1EI9A 4KRFA 1MT3A 3BWCA 2ZDGA 3ICPA 4OIMA 5AXBA 3OHMA 4S2UA 4E12A 2B9EA 4LNHA 3GAMA 1NW5A 2C5SA 3NJ4A 1L4LA 1ZOPA 3KLPX 2CV2A 3EBOA 4F6RB 1K6EA 5COBA 5KYKA 1Z6XA 2LVBA 3G2QA 1B15A 2HLHA 5CLJA 3AM4A 1QAQA 3DFFA 4NK5A 1RHMA 4R6WA 1WMSA 5AM0A 4DR7B 4QM6A 4G4SO 4P58A 4G36A 4TMXA 3U5TA 3KE9A 4NNPA 4PHCA 3QKWA 1H3NA 2MT9A 3SF8B 2BKEA 2WJ4A 2WZQA 3U48A 4BGUA 4EKIA 3C97A 4KX3A 4B6RA 3F0TA 3KTAB 2W8BB 3LZCA 1VSBA 1JEOA 1T13A 3PSAA 1PGNA 2WJPA 2EG9A 3JQCA 3JD4A 2VJBA 4GFDA 4CKWB 5KHOC 1UKBA 4WKPA 3EXHB 3EGXB 4RIFA 4WY5A 3H2YA 3U7EB 3VH1A 2OO5C 3CRVA 4FFLA 2IYFA 4R1QA 4ASUD 3CV3A 4M4SA 4XXHA 1DJQA 2D1FA 1UQRA 4YJFA 2QTVA 4BNHA 4EG7A 3ML1A 1YRHA 3VR0A 4A16A 2PTGA 1XXLA 2GA8A 4PC3A 4A1OA 5BQPA 1S9DA 3Q3IA 1IB0A 5EA2A 1TMKA 3GLKA 4CDRA 4F12A 1ENOA 4CI9A 2QMQA 4GL4A 5AKZA 1ZD9A 4BVGA 4F8EA 1N1GA 4WBNA 3KEFA 5A9SB 1XVIA 4HGNA 4RM3A 1OX5A 1U7DA 3ENNA 3ISVA 2JLXA 2B9VA 4ZYTA 4FN5A 5AKIA 2I78A 4W1RA 3PJRA 2VQ3A 1ZOSA 2HMWA 3A6KA 3W7VA 3ABZA 3GCXA 2JGIA 3RVNA 4YMUA 1DBIA 1KXJA 2FZCA 1ZK2A 2RHJA 2V7PA 4FEEA 3V6LA 1H9AA 5G40A 5GQSA 4DSNA 1WKBA 4DZZA 4KDRA 3E9EA 3VDXA 2C2BA 2ZPUA 3HYCA 4EENA 5KOHA 3ZD6A 3FAKA 1KK0A 3M7IA 2DR3A 4IQ4A 3A8TA 1KYZA 3DE4X 4NCKA 4BNWA 3E3MA 4C2AA 2PRYA 3TW0A 3CQ9A 4MUGA 4ZI2A 1IN7A 4UD2A 1CQWA 5C7OO 3H8WA 1UEJA 2D00A 3CNLA 4B6FA 5FA8A 4JJZA 2PV7A 4KO3S 3RRYA 2W2LD 3EK2A 3OKCA 3QIVA 4G8BA 4BLPA 4G86A 3OQHA 4MQLA 4KIFA 1UFRA 2B8NA 3WRYC 3IVAA 2YXLA 5CB6A 4HDKB 1DRKA 1IJKA 1A7JA 1WNTA 3AP2A 5AVWA 1JKMA 3A26A 3CZRA 1OMOA 1NVBA 3LNTA 2XQVA 4DV4B 4QHTA 1EA7A 1G4UR 3ODGA 4QBFA 3UZUA 4D4LA 2HQRA 5BT9A 2IE8A 4ZU3A 1PG5A 1Z4PX 4BJHB 1E1YA 2HJSA 2XYQA 2GJAA 4JJGA 1XLTC 1WUTA 4N1AA 2GK6A 3OLZA 2YWEA 3QBVA 4HD8A 5JW6A 3NZEA 2V9PA 1Z33A 3P19A 3ET4A 5EC8A 4FZJA 3VPBA 5F1KA 3LWZA 3GRFA 4TLLB 1XXHA 3M5DA 4US1R 1COZA 2AK2A 2F8LA 5U4XA 1K5GA 3X0DA 4HMPA 5A4MS 2OM6A 3NJ8A 3O4RA 1TZJA 5KBYA 3LP8A 1ONBA 1TQHA 1ZRHA 1J33A 1AGXA 1UBCA 1VRVA 1Y7PA 2GBPA 2ZSFA 4RHXA 3OKPA 4Z53A 4FFDA 3MTDA 2PX2A 3FR7A 2WWWA 4J7UA 4MULA 4QFDA 3WL5A 1C0PA 3BTOA 5E1BA 4IJ5A 4CKYA 2AV6A 3N7TA 4QOSA 1JR2A 2FPGA 5K3FB 4IINA 2J0UB 3GYBA 2G36A 2IY7A 3FPBA 2DPLA 5A0TA 4OXXA 5KDLA 4G1EB 1JECA 1T4BA 1L7MA 1VLHA 2Y93A 4CDMA 2Z6QA 3COSA 3HI6A 3EGCA 3V2GA 1YF3A 2DERA 4QNNA 4ZJYA 1GT91 1R4MA 3R3UA 4NQRA 4YCAA 2QF7A 4W5QA 3MJFA 3U4QB 1QGED 2CLIB 2XOXA 3HJCA 6LDHA 1DI0A 4DRXB 1DRWA 4MAAA 1MHTA 5ADUS 5EFZA 1E99A 2X3UA 3D0QA 1AF7A 4F4FA 3CVUA 1WX1A 5JNRA 3C0KA 3WRWA 2SKDA 1E2JA 3DMTA 2SKEA 4ZOCA 1QH9A 1PQ4A 2R65A 4C7JA 1Y3FE 2VTDA 4QDZA 3UF0A 3IT3A 1M67A 3O2QB 1NNEA 2ZQYA 4BP9A 5CXUA 4Z5XA 2X5OA 3RWBA 1X92A 1FW6A 1VCOA 1AQUA 1YZGA 2B94A 2NUBA 3AFNA 4MHSA 4L73A 1MIOA 5F73A 2IWRA 3VQTA 1Y3BE 3ZV3A 4BOYA 2E4AA 1PJ8A 3CF4A 2FEMA 2NX2A 3B3JA 3HCAA 4OO3A 1OZHA 1JDVA 1T8PA 4ZVPA 4RZ3A 3SS8A 3RANA 3MCZA 3KYDA 4RA6A 5GP1A 1JHOA 1Y6RA 2QIPA 5E0OA 1H4QA 4EX7A 3MSXA 1VXOA 4YRDA 4C3VA 1N36B 4XKJA 1TMYA 2V54A 3I09A 1EUDA 2Q2QA 4W63A 1XV5A 1OHHA 4EAQA 1T1IA 2ZJFA 5F4ZA 1GPKA 4IMRA 3ZHTA 4COOA 1WD7A 1OZFA 1W5TA 4C6HA 2H4XA 4TLCA 2XBMA 1SH7A 2R6ZA 1OIXA 2LUOA 3R3JA 3V32A 4XRGA 4TYWA 1SIUA 3HXPA 1Q1ZA 4L3OA 4GOMD 3GJQA 5LB2A 3EHDA 2A88A 3B8HA 4F4UA 1FUIA 1FYVA 1A3CA 1R5NA 2A14A 2QSUA 2F3RA 5EQDA 1ZMTA 1R4NB 3ZOZA 8MHTA 4R8KA 3EW9A 3QHPA 4FKMA 3WIUA 4M1ZA 2Z83A 1ANKA 4FQ7A 4G4SP 1N2OA 3KJNA 4OFZA 3EPLA 1JQEA 3T9AA 4NNOA 2YMPA 2NUTB 4R40A 5MN4A 3ZJ5A 3RFTA 4W5JA 1A7UA 1BGVA 3DT8A 1I3LA 2CYBA 3N05A 5JWRA 3J81k 3GC6A 1ZO8A 4Q9JA 3T5MA 3A9RA 1Y34E 1V8BA 1XEAA 3CPJB 1VFNA 3FCSB 4QAQA 5EWLA 5SZJA 5B58T 2MYTA 3USZA 4LF4B 1CY0A 9LDBA 3L6BA 2YFYA 3L04A 3GNSA 1WQ1R 5EZ6B 4ABTA 4TMVA 1NDQA 3N76A 2H16A 2C7OA 3FWPA 4FBGA 3LLVA 3ZDYB 3KQKA 2R3SA 1LQUA 1U7WA 1KI9A 2EJUA 2VP2A 5IJWA 4I5EA 2NSDA 2XTMA 5H16A 2P27A 2PS1A 2ONZA 4TRJA 3MERA 3T94A 3WBFA 1WDTA 3HS3A 4YWHA 3UH1A 5DN6D 3MYRA 3KO8A 3N0XA 4MINA 4CMAA 1W6RA 1AQLA 5FOTA 5JV5A 1O5IA 3C1TA 4NS1A 1A7AA 1EXNA 1GN9A 3QOFA 2N46A 4OQ4A 1JNXX 3BD9A 3P71T 4BN5A 4AJ1A 1CVLA 1M6EX 3SLGA 3C7KA 4EGAA 1NF2A 1AE1A 4XOIA 2YJ6A 2GLUA 3IPAA 2F8SA 4IIJB 4PINA 1G4AE 2X19A 2YOHA 3V80A 3B7PA 2WK1A 3HXMA 3WO1A 1ECBA 1IK6A 5ALSA 4QQRA 5HGJA 2JJYA 2X0EA 2G70A 3RS7A 1V47A 1P1CA 2Z5FA 3ISJA 1L5NA 1OX4B 2AIRA 5IDQA 3A3YA 1PE0A 4G26A 3TSAA 3V2UA 4R9RA 5EWMA 3VISA 2OCKA 3V8BA 1JV2B 3QTLA 4X9XA 5K51A 13PKA 1U7PA 2XJ9A 3D1JA 2NZYA 3H05A 1QVZA 3TQOA 3VR4H 2B21A 3VH3A 4DCUA 5D86A 1NYRA 1QFZA 1AKQA 4LF7B 3BQNB 3LKBA 3K15A 1AUXA 4MX8A 4NIMA 2ESRA 3V5NA 4CQJA 3C4JA 5KC8A 4YRNA 3A58B 2EFHB 2Q4TA 4FJ2A 4M3NA 2I1QA 5AKKA 5LNK6 2IW1A 5CBKA 1BA2A 1N3IA 2NZXA 2EL7A 4W6ZA 4D96A 1VIDA 1JG4A 2O1WA 5KWVA 3DZIA 5EMLA 4C7MA 1ESDA 4JLVA 3Q10A 3QUSA 4OJQA 5DXJA 3TPCA 2EZTA 5LYJB 1AY0A 4ENVA 3CONA 4K5QA 2FRVA 4ZEVA 1YMVA 3V1KA 1BX0A 1N0WA 1ZINA 4AJOA 2UZIR 4XFJA 1FYDA 4YT4A 5FEMA 2D2IA 4JI0B 4X8HA 2ZCUA 5E9QA 4W9NA 1PD1A 1LBSA 4RVOA 4J16A 3ZLUA 1ST3A 3AZPA 1ZRMA 3FB4A 4H60A 2O1SA 3N86A 1Q0QA 2VYFA 3N8IA 4O3FA 4OKSA 1KR2A 4TL7A 1Q0TA 1C7ZA 3CX8A 4XPIA 3W5DA 5JZ9A 4DMRA 4ND3A 3FCXA 3KDPA 2F90A 3ZNOA 1KOFA 2WOJA 1V96A 3UFXB 2OZLA 3UWPA 1ODLA 2XMDA 1T5TA 5FBWB 1GZ6A 2G25A 5B7PA 2OCAA 4JQCA 3WK7A 4U8HA 2CMKA 4N9QA 4NCNA 3VPSA 3ZE6A 2KQUA 4ZYWA 1YJAA 4Z9AA 3VNQA 1UJBA 1QCYA 3LOQA 3CPHA 4UAUA 3GLFA 1NOJA 3O3NB 2OCXA 3NHPA 5K09A 4F2GA 3WBKA 4D02A 2HLPA 4DA9A 5I4BA 1VBKA 1YKGA 2VJPA 2YH2A 3L9WA 2ZRIA 3ZW8A 4ZT5A 4JLNA 3OMWA 1J20A 3L0SA 2BAGA 1SRRA 2IHUA 2CVFA 2O3QA 5C8YB 3PXEA 4OSEA 3QOWA 1D7AA 3QKIA 1RWPA 5LZ7A 1ZC4A 1ZVKA 4IEFB 1SZCA 3GJSA 3RVRA 5BPFA 5JU6A 4OQMA 1EWYA 3KELA 1GGMA 1SVOA 3HL4A 4D4MA 1HE8B 1YC2A 1SKAA 3FDJA 5P21A 4RE5A 4IUCS 4WNCA 1AA9A 4ZI7B 1TMGE 2A78A 3QKRB 3MTAA 4N8EA 1Q1BA 4IWNA 2HHJA 1YMQA 2J0UA 2O2ZA 4OQYA 3ROEA 4K6KA 4YACA 4DGQA 4TX1A 2X6RA