4M22A

Crystal structure of small molecule acrylamide 16 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
160
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTARDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
total genus 59
structure length 160
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m22A00
3MD0A 4UNNA 3SJCA 3SR0A 4BFUA 5HPYB 2NOAA 2CDNA 2IW3A 4RD3A 5FOSA 1FFHA 1DADA 5D3MB 4A9AA 2J41A 3NXSA 1LTQA 1OFUX 1SXJB 2OCPA 3K70C 2D2EA 1IXRC 3L0SA 2OFOA 1GITA 1X3SA 3GLFE 3GFPA 1OSNA 1XD2A 2YKGA 1ZNYA 3NDPA 4B32A 4CT5A 3FYHA 3MLEA 3KQUA 3IIKA 1A1VA 2IEYA 4DZZA 2PZGA 2AL7A 3BIFA 2J9RA 1II8B 1ZM9A 3NEYA 4FD2A 1J2JA 4D81A 1LS6A 4HZUA 5TVKA 4LC1A 3OIUA 1NSTA 2JIZA 4GBMA 5K8IA 1KOFA 4BLRA 1R5NA 2J46A 3U6KA 2FSFA 2GJ9A 1PLLA 2BIFA 4QGFA 2FDCA 1JR6A 2QSYA 2IUSA 1KJZA 3ECCA 1NN5A 2ORWA 3TGPA 2QROA 4RD1A 4MGYR 5G53C 2XXAA 1J70A 1HTWA 1OFHA 2ZRFA 4TT3D 3K9NA 2VHQA 2H5EA 3FHTA 1N0WA 3TUIC 1HY3A 2GF0A 1ZD8A 4MA4A 2LKDA 3OE7A 4JLDA 1UAAA 4OBEA 3U4QB 1WBBA 2CK3A 4EQ6A 1S9HA 3TUJC 3D7MA 3ZVNA 2A5JA 1ZBDA 1S4QA 2V54A 4HB3A 1KI6B 1TU3A 4FCWA 1VIYA 3PEVA 5FPHA 1TQ2A 3AF2A 2RGNC 4HAWA 2AKAB 3Q7QA 2OV2A 4DDWA 1WF3A 3THWB 5CK4A 1E9EA 1CJVC 2OAP1 2CVFA 2D7DA 1OW3B 1OYYA 1ZNXA 2D62A 3LRPA 3QKSA 1DAEA 1A7JA 2I4IA 2VP6A 3WHKA 1NI3A 3R8FA 1YJ5A 2GCNA 4Q18A 1MV5A 2OE2A 3BS4A 2EVWX 4LSGA 1G3UA 5FUVA 3VR2A 2BCJQ 1CRQA 1E2QA 2V6IA 1W0KA 3L0OA 4XWKA 3VHXA 4U7DA 2ZU0C 3JZMA 4YONB 1H65A 1TAGA 4MITA 1KTVA 4MUAA 1CKEA 3EASA 1BKDR 3GLIE 1DG3A 2C77A 5FPKA 3QF7A 1KI9A 3VNVA 2ZRLA 3WMFA 4C7OB 2HJGA 4AURA 3HJNA 3U5ZB 5DYGA 2RGNA 1Z8FA 1KSJA 5L3VA 1E1RA 3LDAA 3SC3A 1GL9B 2WOJA 4DSUA 2AD5A 2GBLA 3TAUA 1ESNA 3BK7A 1MR3F 3LFUA 1KK3A 2ZI9A 3MFYA 2ZI6A 1HYQA 2R2AA 1U2RA 5JS8A 4K8OA 4ZI2A 5KNDA 1TQ6A 1T4GA 2W2TA 3TIFA 4F93B 3IQWA 3TR5A 4ZKEA 1T3SA 4D26A 1VG9B 1NMZA 4D82A 1Q0UA 3LXXA 3NHBA 3J81k 2FX3A 3I1FA 3QE0A 4I1UA 1IN7A 1KI4A 2DFNA 4BEJA 5AUOB 4PO9A 3PUZA 4RFVA 4KO8A 4LJ8A 3ADDA 1NN3A 1SVKA 3TW4A 1DBSA 2EYQA 4TYYA 2NTYC 2RGCA 1D2MA 1DAMA 4WXPA 5HE9A 2FZLA 1MH1A 5L3QB 3P4YA 2EYUA 3E5HA 4YXWD 3CNOA 1VCOA 2VP2A 1M34E 1OJLA 2ZJBA 3ZZTA 5IHPA 3RS4A 1E99A 2BMDA 2ZRAA 1T6NA 3I8XA 3VTKA 4Q02A 4XWOA 4FCTA 2WAXA 3W8NA 2HXYA 2CNWD 3UATA 1NKSA 4TTPA 3K0CC 1P2TA 2BJVA 3SBEA 1ZM7A 4UNRA 4A2QA 2QE7A 3VKHA 2GVZC 3TJZA 4DCUA 3BFVA 1VPLA 2W6ID 4BECA 3SJAA 5DIFA 1JXMA 2QTVB 3TVDA 2ZJZA 5J4KA 4JYCA 3IILA 2Z4RA 1LB1B 2W6JD 4O3MA 3CR7A 3THXB 3QVVA 2QSZA 1R5OA 1KDRA 4IFBA 2NO7A 4MKIA 2ZIAA 2DHRA 3C16C 3T1TA 3FOZA 2WWHA 2ERXA 4WXRA 5EP1A 4M2LA 4OI0A 4LHWA 1ZC4A 3PEYA 3KJIA 2HCJB 1GG2A 4LGMA 2WJIA 1U0JA 3ASYA 3GLHE 3AP2A 3TMKA 4XWAA 2FG5A 3OAAA 4HLQB 3U3KA 3UK6A 4ZV4A 3GJ6A 5JEDA 3LQRA 1CLUA 1NLFA 4WOPA 2J0UB 3CLVA 5JHHB 2ZS8A 1J90A 3BC1A 3F8TA 2QQ0A 3GD7A 1LFDB 1R0XA 1F2UB 4HLUC 1BS1A 2C04A 2FA9A 4TLEA 5DI3A 5FOWA 3RS5A 3RLFA 2WWFA 4BFWA 2IS6A 1HH4A 4II7A 5EUQB 5JJKA 2IYUA 3FMIA 1QG4A 4PPQA 1ZIPA 2D3WA 4JJKA 1YR9A 4FMCF 4BLOA 3AVWA 3K09A 2CMKA 4JLMA 1WBDA 2A3RA 4P0TA 4PQRA 1S96A 1SKQA 1OXVA 1T5IA 4EPWA 1J8MF 3V9PA 4Q7MB 1QBKC 3W3AA 4YMSA 2QM8A 4RD4A 2PMKA 1E2JA 3PUVA 4I1OA 4W5JA 2ATVA 1KO7A 1RC8A 5FI0B 1KKMA 4BPBA 4EQ6B 3SS8A 1FP7A 4WW0A 1ZYUA 2QGNA 4B6EA 1FQJA 4D4LA 3SYKA 1R0ZA 2C78A 2GJAA 1R0YA 3OFND 4OI4A 5JFGA 5FI1B 4A15A 3FFAA 4KFUA 1GNRA 5FTLA 3LLUA 3L2OB 5L3QA 2V3CC 1WDTA 1YHNA 1NVWQ 3NKVA 3D31A 4EFLA 3EPJA 1XTKA 3AUXA 1AZTA 1G8FA 4QOSA 4DB4A 1KI6A 3KX2A 2G83A 1GNPA 2ATXA 3X1DA 4B2PA 4KLZA 4NBSA 3MWLA 1I4LD 4PC7A 4C3ZA 3U7HB 4Q19A 4ON9A 1IN4A 221PA 3VU9B 4B34A 3BD9A 2VP0A 3AVVA 2JLVA 4A6XA 3NH6A 3KQKA 1OKKD 1OXUA 2PL3A 5E7IA 1Z6AA 1U99A 3MWYW 2H17A 2ZSFA 1E0JA 1XU4A 3U3RA 3P27A 2BBOA 5DNYB 3ONWA 2W2VA 4C7OA 2GXSA 4BLQA 5CDFE 2WTUA 1YZQA 4KFTA 5FTNA 4PHFA 1XZQA 3R9WA 2EFDB 1TF2A 4NYIQ 1X86B 5H1YA 1E9SA 4IFEA 2CL0X 1NY5A 4LRWA 3CRQA 4RD2A 2FEMA 2JIZD 5FPYA 1E2NA 1NLZA 2CNWA 3OAAD 1UEIA 1M1YE 2WKQA 2FSGA 1RFLA 3R7WA 3PEUA 5IK2D 2Q9CA 3QVUA 3LBHA 2NO6A 5EXSA 3UXMA 5LB4A 3QI2A 4KJZA 2QE7D 1P61B 3RC8A 2OFXA 1AGRA 5FOTA 3MJHA 4A82A 2GKSA 2FN4A 521PA 1AS0A 5BYJA 4F4CA 1DAIA 1NL3A 1AJEA 3H4MA 2IYYA 2ZS9A 4NYJQ 4Z1MA 2C2HA 1SVWA 1TEXA 3K53A 1XMJA 1XBTA 1E2DA 1ZJ6A 2UVQA 2ORIA 3FPAA 1KMQA 1IN5A 3CPHA 3B85A 4E5UA 1Q22A 2BBSA 2FE4A 2NO1A 4KBFA 1Z0FA 4UJ5A 2GJSA 2A5GA 2QENA 4AKEA 4EJSA 4PTLA 1E4VA 2F3RA 3BH6A 1XJCA 1FNNA 3B1ZA 1VYUA 5DN6A 1HURA 3VNUA 1W4CA 2L0XA 2VHJA 3HYTA 4I4LA 2IF2A 2OXRA 4G5GA 2P0EA 3M6AA 1NN1A 2WPDD 2IF0A 4G5OA 4OYHA 2EWVA 3TQFA 3UMRA 3TE6A 4ZCIA 1GRNA 4H1VA 4NKRA 3RSLA 2ZITA 2GAAA 4TYNA 4D0LB 3PEWA 3A58B 4XTCS 2PT7A 2ZSDA 1ZC3A 3CX6A 3QQ5A 4D80A 2YZ2A 2QU8A 3NBXX 1NVUQ 1Z0JA 1Z6GA 5SZJA 4D2IA 4DSOA 4B3GA 2QL6A 4Q9KA 1II8A 1E2LA 5HR5A 5G3ZA 1KJWA 4GP6A 5F9HA 2JLXA 3WY9A 1XMSA 4G01B 2XNDA 1XMVA 4FXPA 5DLQC 2GZAA 3F5FA 1YR6A 2RHDA 1O87A 4B35A 2ZRGA 3ASZA 3EZ2A 4DB2A 1CEEA 1E2IA 4XTRA 5DYIA 2PCJA 2PX0A 1VG1A 1EX7A 2DWPA 1X8LA 1W36C 4C30A 3L82B 1QHXA 2IT1A 1MO5A 5A4JA 1PV4A 4NE2A 4RY2A 4XH9B 4DSNA 2W0MA 4XVUA 2ZE6A 1XTQA 1RJ9A 4Q1EA 4QHYA 5H68A 4YDSA 2AN9A 4MRSA 4TZ0A 4CGZA 2PX3A 3JZAA 2ZJOA 2ZSEA 2J7PD 4ERNA 4Q9JA 2EFHB 3B5JA 4Q4AB 3W34A 1I2MA 4JVSB 5AUNB 2VIIA 3KKMA 3C5CA 4KFSA 3AVXA 1KDOA 1SXJD 4IDPA 4BLSA 5IF9A 5G3YA 3Q3JB 2R6FA 1OIVA 2VP4A 3THXA 2JLUA 2GWHA 2Z5FA 5AUPB 3IQXA 1GL6A 1Q1EA 2YYZA 1N6PA 4Y0VA 4OQMA 2GXUA 1W5TA 1OB5A 4PANA 5CB8A 4JL6A 4DLSA 3X1YA 3EA5A 2QMEA 3ND9A 3VAAA 3PFIA 4DUGA 1U9IC 2GHIA 4C0HA 1FUUA 4NYIR 1M7GA 1KMHB 3FHOA 1DOAA 5KO2A 4A92A 3FB4A 4DIDA 1X1SA 3BERA 3DOFA 4JT4A 3NDBB 3ZVLA 4A8JA 1AKEA 1RRCA 3PUXA 2YV5A 1DARA 2HV8A 1NY6A 5IDVA 4FWTA 4LWZA 4OHZA 2QAGA 3T34A 3K70D 1XTIA 5EE5B 2XB2A 1Z63A 3VQTA 1U98A 1DVRA 4BZXA 2F3TA 3QSYA 2WWYA 3M4YA 3A4LA 3WYGA 3ZVRA 3B60A 1YZTA 4PSKA 4AKIA 4FI3C 1OH7A 2QAGC 4Q47A 2BBWA 3RC3A 1NBME 3CRMA 4JLOA 4PPNA 2V4ZA 3JVVA 1OFTA 1KAOA 2AXNA 1GKYA 2WVJA 3FMPB 3ICQB 1S9DA 4Q4HA 3VR4A 3HU3A 4MRRA 1FP6A 4B74A 3DDCA 2A30A 1E2MA 1O3YA 3B1WA 2ZJ5A 4FW9A 5EE3A 5HZKA 4LHVA 1AIPA 1HA3A 3AGQA 2W0SA 3IPXA 4CVNA 2QGZA 3IPYA 1SKYB 4AYTA 4BLPA 4TL7A 2RAPA 4G3XA 1W2GA 3TQCA 4AG5A 2J0UA 5GADl 4Q66C 2QP4A 1XTJA 3ZDQA 4PZLA 3LAWA 4LJAA 3RAPR 1U90A 3SYNA 1E9AA 1J99A 1U8AA 4GNKA 4M9SA 4QBHA 2V8OA 2C03A 2YVUA 4XSGA 4GL2A 2O8DB 5FR1A 1GZSA 1W1WA 2ZU6A 2QPAA 5GVRA 3V4RA 3A4NA 1G3MA 1RJ9B 2BJWA 1A2KC 1LY1A 1XEXB 1L2TA 2P65A 5TARA 5JI3E 4TQ9A 2XSZD 2R62A 3AF4A 1KI2A 2DCUA 3QKSB 4TL6A 1E0SA 3HPRA 2QP9X 2KI5A 4JLJA 2ANCA 2MMGA 4A2PA 1NMYA 1F60A 3KKPA 1XB2A 4PC3A 4RCYA 1OXXK 2QMUA 3KXKA 4QGAA 1P2UA 1FPMA 4BRWA 2V1UA 3GPLA 2IHYA 2P6NA 2O8EB 1UDWA 2HLDA 1IJFA 4OQFA 1OE0A 1FL9A 1YVDA 3U3OA 2ZAOA 4DVGA 1QZXA 1TPZA 3QNUA 3GLGA 3UIEA 5A0FA 3IBGA 3U4QA 1Z07A 5JWRA 1UBCA 2WSMA 2F1JA 1S0UA 4AI6A 1MT0A 3NVAA 4TLDA 1OIWA 1KO1A 4QJ3A 1CJTC 4OQXA 1RPZA 1RYHA 5FUYA 3FDIA 2ZYUX 3OIYA 2OCBA 2EWWA 4KITB 3AH8A 1YR8A 4NTZA 5C4GB 1P2SA 2IA5A 4URUR 1MABB 4X8MA 2XX3A 3QKUA 2R65A 4PC2A 3ADBA 2QBYA 1I4TD 3CW2A 4IEEA 2CK3D 2GEUA 4P31A 5JWHA 1HT1E 1W0JD 2AK2A 2DPXA 2ZVQX 4GFDA 5BXQC 3AVOA 2YOGA 1EFRD 1L8QA 4JIMA 2P5SA 4URYR 3RS3A 2ZI3A 3T15A 3BXZA 4OL0A 5HCIA 3CONA 4LK2A 1N6HA 3ZH9B 5KNCA 1T5LA 1XFAA 2XJ4A 5EP4A 4OQLA 4EPTA 2Q0HA 1KIMA 1J7KA 4Q4AA 4BRUA 3VKGA 2JA1A 4X8HA 2KJQA 2J7KA 4WA7A 4TTQA 4Z8XA 4C0KA 1ZNZA 5KDLA 1BH2A 2DBYA 2D2FA 2F1IA 1OHHA 5K8LA 2Z83A 2WMOB 1P5ZB 2VA8A 4IVRA 4D25A 3UKDA 3B7GA 3EIHA 3Q5DA 4HZIA 4KV9A 1W7AA 3NTUA 4G1UC 4IOLA 4S2EA 2CLCX 1QHHB 2CE2X 1L4UA 3ZVMA 1ANKA 5JRJA 3BH0A 5CB6A 5CJ2A 4XVQA 4R71A 1T0JB 3NG1A 2PMDA 1LW7A 2IYQA 2B8TA 4XSHA 2ZAMA 4G5QA 3QKRB 4F38A 1RKBA 2E1RA 2F9MA 2BKEA 1CR0A 2PT5A 3EC1A 1DELA 1UJ2A 4OJKA 4RZXA 4F4JA 2I3BA 3THYA 4KAXA 4LX0A 5FOXA 4YQFA 2VPPA 3VMFA 3SYLA 4TMKA 3A4MA 3RRYA 2JASA 4UXHA 2ZI7A 1BMFD 1IY0A 4CIDA 1FUKA 5A5GA 1Q12A 2C98A 3ADCA 3ETLA 3O47A 2IS1A 1G1MA 1JR3A 3T12A 1E1QD 4ESHA 4ARZB 3GFOA 1HT2E 3LH5A 1ZUNB 3REGA 3WBJA 3WNDA 1X6VA 3K1JA 5TMPA 3KJGA 4Q1BA 4W5WA 4HATA 2R6GA 4MYHA 1CR2A 1YKSA 4LC0A 5JJIA 4GOJA 8OHMA 2GETA 5C2JB 1W44A 2JJ1A 3BB1A 2C9OA 2JATA 3A1WA 3QXJA 3UWKA 3KTAA 5EZ5A 1P72A 4JVMA 1Z47A 1FNMA 4V0OA 4A4DA 3PJRA 1EESA 4O2RA 4TSFD 3FKQA 4BWYA 1W36D 2VBCA 4US0R 4AYWA 3KQNA 2B7BA 4TQAA 3WP0A 4EPRA 4URZR 3SOPA 2AD1A 4HZUB 4KYIB 3CF0A 1COWD 1G21E 2WJVA 1BYIA 4IRUB 3CPEA 4DSTA 5SZKB 1AKYA 3GJXC 1MO3A 2GF9A 2C5LA 1U0HC 2WIBA 3CM0A 4E22A 1I4DD 1XCGB 3VHLB 1NSFA 4GMXA 2ZANA 1TQDA 4I99A 3K70B 5KSPA 5LB2A 1G6HA 1SXJA 5M04A 1R4AA 3OHMA 1PZNA 3EA0A 3TVTA 4CYMA 2OT3B 1TU4A 2FEOA 3AEZA 4LHYA 2FSIA 3TW8B 1M74A 3A1VA 1VYTA 4FMBB 2UZIR 2KSQA 3GEIA 4L16A 4ASUD 3TBKA 2BC9A 3T1OA 1IONA 2IS4A 2XTMA 1OFIA 4LHZA 3GJ0A 2ZM5A 2DFLA 4QGHA 5GVSA 1TNDA 2JCSA 3AF1A 3PENA 2BOVA 4FINA 4NCJA 4EUNA 4AWXA 3MWKA 3T1QA 3K8YA 1UBFA 2GRJA 1CU1A 4B6FA 5JCPA 6Q21A 3CWZA 3O8BA 3LY5A 2XOKD 4HUQB 3GLGE 4Z51A 3MRSA 3R8CA 4BZQA 1PUIA 2QBYB 4IOMA 1E2FA 5J4YA 1CULC 2WM9B 1IXSB 1FTNA 1N2CE 2Z4SA 4DLUA 1G20E 4IKEA 2G9NA 4C2TA 1P9NA 4ACBA 4OKSA 2O8EA 3K0AB 2G0TA 4P4TA 1QF9A 2ZRHA 1VCIA 2P6RA 3DPUA 3GJ8A 2O52A 4LI0A 4TT3A 4QJ5A 1A82A 4JT2A 1E9RA 4YMVA 1XWIA 4OI1A 3L8ZA 4CEHB 3VR5A 2N42A 2O0KA 1KI3A 1UKEA 5H8WA 1G8GA 1OYWA 2ZRPA 3E2IA 4NZYA 4A0GA 5IRCD 3DOEA 4UJ3A 2JJ1D 3C15C 3EIQA 4JLPA 3AVUA 3BOSA 1RRFA 1Z6TA 1QG2A 1Z83A 3F0TA 3TSOA 4OK5A 2NPIA 3ZD6A 5CIWA 1D9XA 2MSDB 2QZ4A 3M1IA 3P32A 2OXCA 3MWJA 4LBYA 2V6JA 5HCNA 3SEAA 1FX0B 3T5DA 1ZNWA 1KZ7B 2W58A 3RANA 4FCVA 3SFZA 1NBMA 1K8RA 5ANRB 3BGWA 4G0NA 1MO4A 2P67A 4NU0A 3FWYA 2WWGA 1WB9A 1KAGA 2LCFA 2IYTA 2ZJYA 1X8JA 1E0KA 3SBDA 1MKYA 2J87A 2D4HA 4I1SA 3W8RA 3TSWA 4B76A 3ZS8A 1P62B 5AR1A 2BKUA 2IBMA 4A36A 3EXAA 4D0NA 4DEYA 2W00A 4UNSA 4OHYA 3OF5A 2CE7A 4JLAA 3UG7A 3N2IA 1LS1A 2YHSA 3L43A 4HLUA 4LHXA 1YZLA 2OG2A 3TLXA 4B73A 2IX3A 4B33A 1ZD1A 2OLKA 3GEEA 4IVQA 1XPUA 2JLSA 2RKOA 5FL7A 2ZUBA 3NC1C 5FR2A 1MO6A 2ZE5A 2OM2A 2JDIA 2V1XA 1E6CA 1US8B 2MSEB 3HP1A 1KY3A 3IEUA 2IL1A 2V55B 3IO5A 2G0NA 2O8CA 1XF9A 4CEIA 1WRBA 4IOKA 2QT1A 1Y3AA 1VCMA 4JKIA 3SE0A 1KDPA 5L3SB 5C4MA 2OBMA 1E79D 3IHLA 5EP3A 4JKYA 2GEVA 1IY1A 4US2R 1ZU5A 4DLWA 3VR6A 3PITA 1Q44A 5UKDA 1IXZA 2YWEA 5J40A 5LD2B 3RWMB 1B23P 2CHGA 4ZCMA 4V0NA 3THWA 2B92A 1W5SA 3AVQA 3FTQA 4KVGA 1TMKA 4TL9A 1LF0A 2F7SA 1E96A 2WOOA 2HUPA 3E1SA 4QFMA 4ZO4A 1XCMA 2YOHA 2Q9AA 2CCKA 2IC5A 5F98A 1SULA 1UBGA 2RCNA 1DPFA 3AF3A 4R2IA 1CR4A 3BJIC 5C46F 4QBFA 1K6MA 4GOXA 3TSZA 3QXHA 4TQUS 5J47A 3GLIA 1TL7C 2PH1A 3KUCA 4TYQA 2WZQA 4DHEA 1G16A 1ZUHA 4MYTA 2FGJA 5GJCA 1US8A 4C0LA 1W4AA 2QMOA 3WYFA 4PAOA 4BZPA 3KKNA 4B71A 4EPYA 3DZ8A 4O25A 1P3JA 1NIJA 4V0ME 4TMXA 1D2EA 1E69A 2FF7A 2ZUCA 1MRSA 4PQYA 4AG6A 2N1BA 2C8VA 1FMJA 5EXTA 4HB4A 2ODNA 3A8TA 4L15A 4RZ3A 4LYFA 3MSXA 4PAMA 3GLHB 3P4XA 4LV5B 1R0WA 2IS2A 1VECA 2AK3A 3ZIAA 1SHKA 3T1VA 3VKWA 2HT1A 4MDEA 3I72A 4ZKDA 1DAGA 3IDQA 4Q1CA 2ANBA 1JNYA 3W5IA 2QN6A 5KDOA 2J45A 2REOA 2ZRIA 4NPHA 1T3HA 2ZRKA 3B6EA 3H86A 4F91B 3IEVA 1G5RA 3K0FB 2O8FB 1LV7A 1TUEA 1H8EA 1XD2B 4TMTA 3ZJYA 1R6BX 2Q3MA 2WKPA 3TNFA 4DJTA 1GNQA 2QRNA 3AVYA 2R44A 4HLDA 4LPKA 4BFTA 4M21A 2ZRCA 2XJ9A 4NCNA 4W9MC 3GJ5A 5DO9A 4GI7A 4YDHB 3RS7A 3AP1A 1JR3D 1WMSA 2VHTA 1CF4A 3I4LA 3AVTA 2GNOA 1ZU4A 1AQYA 1N3BA 4NMMA 4LJ9A 5BW8A 1G19A 1KMHA 4NCHA 1SHZA 1XDBA 4CF7A 1AGPA 5JS7A 1Z5ZA 2E87A 1N6LA 1IJEA 1DS6A 1EFUA 3GQBA 1XTRA 2FZ4A 3RRZA 1XPOA 4LYHA 5HTKA 5B2ZA 4DEXA 5BWMA 4A0HA 1NJFA 5H70A 1AQUA 2H92A 4DLVA 4IOJA 1WP9A 2J1LA 5LD2C 5SZIA 3NC0C 4MGZR 2ZYWX 3KKQA 4P33A 1FZQA 1E2GA 2Q3FA 3I32A 3DMDA 5DHFA 4DUGD 2WJYA 3UG6A 2VL7A 1YRAA 3QXSA 3RDPA 4C0AC 3QF4B 2XXAB 2Z43A 3EG5A 3OEEA 3KXLA 4GDFA 1VYVA 3QIAA 4MDFA 4GT1A 1T91A 1GSIA 4GZMA 1DAFA 1XEWY 4L9SA 4IDQA 2ZR0A 2RGGA 3U61B 1G3QA 2HT6A 5BYKA 5FL3A 3IIJA 5E7MA 1CR1A 1T0HB 4MRVA 4LUCA 4N0EA 1QHYA 2J0VA 2OCAA 2YWFA 3CKLA 3MCAA 4LYAA 1GDDA 1N6NA 4JJZA 3WMEA 2JAQA 1SZPA 3IUYA 4AIIA 1AN0A 4BFXA 5KNBA 1OIXA 3I92A 3A6PC 1ZAKA 1UEJA 1TADA 2FFHA 4M22A 5EXPA 2CL7X 4JL5A 4XOIA 1JALA 4JBXA 4HB0A 2IYXA 4HAUA 5TXGA 5EQTA 4AKGA 3HPQA 3KFXA 4PSAA 2WHXA 3B1VA 2H57A 1Z22A 4QKQA 4NCKA 3GP8A 4V02A 4PC6A 4E07A 2FOLA 3B9PA 4PXAA 4HI0E 3U3JA 5D3MA 4AYXA 1EK0A 4EFMA 2WWIA 5KSYA 4E03A 4L8GA 3C7KA 2B8WA 2ZRDA 4MRPA 5CM9C 4BLTA 1N6OA 1FW6A 4BFYA 3WNCA 1SVSA 4NYMQ 5CM8B 4ZDWA 2J0QA 4O2LA 3UMFA 3HU2A 2J59A 2D7CA 3IGFA 3U3MA 2BBTA 3QF4A 4HDQB 1RIFA 2LKCA 2GDJA 2DFTA 1OPXA 4ARZA 2Q3HA 1E98A 1MRNA 2XZPA 1Z0AA 5JHGB 2IYZA 3EZ7A 2IYLD 4IXNA 1GTVA 2QPTA 4PO1A 5EE1A 3U7GA 1JECA 1F2TA 2O0JA 1GOTA 2QTHA 3EZFA 3JVUA 1IY2A 2OUKA 1W0JA 2NO9A 3EZ6A 1OT3A 5CIQA 4OI2A 3GCGA 4R98A 1A2BA 3RNLA 3HR7A 1UBEA 1E2KA 4Y0AA 1II0A 2B7CA 4R7ZA 2QG6A 4JMPA 4DDVA 3CPJB 2ZR9A 2AHOA 1KSGA 2D06A 4ACAA 1KZGB 3NHAA 4NONA 4GZLA 2GAOA 3SZRA 3AM1A 1VG8A 1XTSA 2ZVPX 3QKTA 3CBQA 5AJXA 3NH9A 3CZPA 2FWRA 3TK1A 4P4UA 4ZDIA 3LQQA 4B3BA 3U6BA 4CDGA 4ZDJA 2EQBA 4GP7A 1EWRA 1GL7A 2GZHA 2QQEA 4W5HA 4Q4JA 3CWQA 3QENA 3BWDD 2WIAA 2E9SA 5FBVB 2WAYA 3QJYA 4N3NA 1W36B 3Q85A 1R8QA 2O8DA 4DDUA 1PLJA 4CRWB 5FOVA 1LF5A 1R2QA 4FWIB 4UKDA 1T3LA 2BCGY 3LD9A 3B1XA 1TF7A 2J3EA 2O8FA 2V7QD 4P4SB 2NZJA 1VG0B 1C1YA 1S2MA 1N6KA 2QUZA 2ZSBA 3QG5A 3RS2A 1EX6A 1OF1A 2AWNA 2I1QA 3HU1A 4GOKA 1E79A 1WQ1R 1KSFX 1BMFA 4DC9A 3PUYA 4Q7KA 3AGPA 1G8YA 3GLHA 1XMIA 5K8TA 1GKIA 4DWJA 2F6RA 3LNCA 4Q9HA 1E9BA 4ZI3A 5FBWB 2DWOA 2FU5C 2PCLA 1KI7A 3O8CA 4NP6A 1KSHA 2J7PA 1NVVR 4RZ2A 1GVNB 1E32A 3NBZC 1UKYA 4Q4JB 2GXQA 2ODWA 3K0SA 2QNRA 4Q00A 1P73A 2FH5B 3LXRA 3L0PA 3MMPA 5FBRB 1IN6A 1C9KA 3CNLA 3H2YA 2YWGA 2XAUA 1Q1BA 2R9VA 4QL3A 5G40A 1J8YF 1COWA 3SHWA 2G77B 4MGKR 4L9WA 4KBGA 5JECA 1LNZA 1RW4A 3RYTC 1S3GA 2WSSD 4TL8A 2FFQA 5JSZA 3SDZA 3EC2A 2H18A 3DVLA 1N5KA 2JLRA 1CRPA 5G41A 3EPKA 4M4SA 4DRZA 2ZUDA 3UANA 4D4MA 3RRMA 2FFAA 5EJEA 4HUTA 4H1UA 2VSFA 2ODBA 4OHVA 3Q9LA 1EGAA 1EG7A 1KK2A 4NYMR 4ASUA 1OH8A 2B21A 3A1SA 1G3IA 1IAQA 1QHNA 1E94E 4BFZA 4JBWA 2ZR7A 2PLFA 2AFIE 3B8HA 2WMNB 4DCVA 1H8HD 5AUQA 1XJ0A 2XNSA 4JVLA 1CS4C 4MUBA 2GEDA 1W49A 3GLFA 2Z0MA 4TMWA 2XTZA 3GLFB 4V0MA 5IK2A 1P60A 4F4IA 3CIOA 4YMWA 4LJ6A 4JZKA 1QVRA 4D4KA 1KNXA 1CJMA 1RE0A 4LBWA 3RVBA 2HF9A 2IUUA 2VF8A 3NBYC 2P2LA 5HE8A 3P20A 4KHZA 5KPJA 3I73A 1S1CA 3ZQ6A 5JRZA 2JLWA 4M1SA 3RRNA 2XTNA 1W47A 1X1RA 4RVCA 2JJ2A 1GILA 1F5NA 1XD8A 2FSHA 121PA 3KQLA 1JAIA 3LBIA 2ZYVX 4F7WA 3T35A 1Z06A 2ZETA 3AKYA 3GMTA 4V03A 1EXMA 5JSZB 4A6PA 5FUXA 3BORA 5DGXA 5TDHA 2PEYA 2CHVA 1G7CA 3FMFA 3N5CA 5FTMA 5B58C 3CF2A 2X2EA 1EFTA 1UKVY 2BM0A 4BQSA 3QXXA 3H0KA 2PLRA 1VMAA 4Q5IA 1BIFA 3L0IB 3KJHA 4YC7A 1KGDA 3PXGA 3T61A 4A8JC 4M0LA 3ICEA 3ZD7A 2WJGA 5EP2A 5TY0A 4Q48A 1MOZA 4RD6A 3QEJA 2RGBA 3DMNA 1NBMD 3IBYA 4QHTA 3W6PA 2ZXUA 1VCNA 3WXMA 2CCJA 2YOFA 1GIAA 5JMTA 1V5WA 2CEAA 2VO1A 4EJSC 2HLDD 1G17A 4V0LA 3I8SA 2IXGA 2GTPA 2XOKA 3DKVA 5C1BA 1II9A 2A5DA 4J0QA 1UFQA 3LVQE 4PZYA 4A2WA 1Q3HA 4FIDA 3EZ9A 5DH9A 1E3MA 4LBZA 1LVGA 2XNDD 4HUQA 2FGKA 3KUDA 4NDZA 1PUJA 3LW8A 1JEEA 2YWHA 3X1ZA 1CTQA 2EU8A 4K81B 3O8DA 4KLNA 3W90A 1EFHA 3MG9A 5FH9A 1JEDA 1Z0KA 2MMCA 3MJRA 1E4YA 5JWOA 1R7RA 4QNMA 1K5GA 3QKRA 5BQ5A 2F1RA 2WKRA 2QORA 3ZZUA 4WZ6A 5AJZA 2XEXA 1HV8A 4BGDA 4QM6A 2GILA 3KXIA 4M1WA 5KU1A 3GJ7A 2JLQA 4EFNA 1CXZA 1Q57A 2WSSA 4RFSB 3CH5A 2OCYC 4RSGA 3X1WA 4DCNA 3CX8A 4U02A 1EWQA 4EPXA 2ASEA 3Q5EA 3SJBA 1D8TA 2J5XA 3W5JA 4P3YA 2W6JA 3FHCB 3OIWA 4PSVA 1XJQA 1XCPA 2JJ2D 2QI9C 4PHTA 4XD7D 4FMDF 4HAXA 4JBYA 2JLZA 5BN4A 2PZEA 2KB0A 3BB4A 4B3XA 2ZSAA 2NGRA 2GBLC 2QT0A 1H8HA 4DIEA 2ZPTX 3G5UA 1E2PA 1FMLA 1TX4B 4B48A 5KHOC 3ZQJA 1G5PA 1VIAA 2RB4A 4NL4H 3U60B 4IXMA 4LV8B 2C95A 4KCGA 1C4OA 4L5BA 3KTAB 3MUFA 2FJUA 3F3YA 3LX5A 4IEIA 1E2HA 3WP1B 1NRJB 2AKYA 4URXR 2PEZA 4C0JA 1A4RA 1P9RA 2GVDC 2XITA 4LPSA 1OXTA 2V9PA 1L4YA 2G6BA 5F3WB 1ZW6A 1GKUB 5CDFA 4LOAA 5AJYA 1P9WA 1Y63A 4N1AA 3GEHA 3ZS9A 1T8UA 2R6CA 2RGAA 3V00A 2GCOB 4EIWA 1XEWX 1TQ4A 2A7QA 2CCGA 1WXQA 3B9QA 3LLMA 621PA 1XXHB 3C4JA 3VFDA 1JQLB 4A0FA 1GAJA 3K09C 4B3FX 4U5XA 4B75A 4EAQA 3EAQA 5EXXA 4C0SA 1Z29A 2MSCB 2Y8EA 2ZE7A 3CR8A 2BMFA 1G4AE 1UDXA 3NEJA 1D5CA 3GJ3A 3K0EA 2IYRA 4MQBA 5AWFC 4AC9A 1ZRHA 4B3DA 3CX7A 3P26A 5AJVB 1ZMXA 1QRAA 3DKPA 2VQSA 3B13B 1NJGA 3QY0A 1L7VC 4OHWA 5SZHB 4K46A 3O8RA 1DAKA 4RKEA 2O8CB 1NIPA 1HEIA 2OBNA 2IEZA 3SN6A 2R6DA 4KSBA 4M1OA 2YNMA 4QHSA 1XEFA 4Q03A 3DZDA 4PHHA 4ZIRA 5TV2A 1XZPA 1R10A 2UZ3A 5ELXA 1Z2AA 3U7EB 4JL8A 4BEBA 1SVOA 3R9XA 4AKHA 3EX7C 4E09A 2NO0A 4MGIR 3H84A 5BN5A 3EPHA 2P3SA 4RD0A 4MH0R 4TMZA 1DTSA 2NMVA 1TTTA 2LWIA 5EUMA 4JLBA 3NBFA 3GLIB 2ZEJA 3ZIAD 1TEVA 4Q4LA 3A1UA 2WJJA 1CBUA 4PR0A 3PCRB 1G6OA 5E7JA 2CJWB 4QM7A 5E95A 4DXAA 3ZZ0A 4MYCA 2RGEA 4NHOA 1GUAA 3LW7A 5GJVC 4M1MA 1FX0A 1H8ED 1ESMA 1GRQA 3AP3A 2C99A 3FMOB 3BE4A 2ZRJA 2W6IA 2XB4A 4M9XA 5CYPA 1AZSC 3KL4A 1Q1QA 1NF3A 5DI9A 1BYUA 4UNPA 1W2HA 4G5SA 4N0DA 1OLOA 1UPTA 1YZGA 2F43B 3BAFA 1G9XA 3R9IA 4AY2A 3LBNA 1G4UR 1NN0A 1XRJA 2Q9BA 2WPDA 4MKGA 4CW7A 4QRHA 3SQXA 2QRZA 1E2EA 3FGNA 1KKLA 1JI0A 2CL6X 2HYDA 3I61A 1G7RA 1P2VA 5L3RA 3W9YA 3C5HA 3IO3A 2N46A 4DCTA 1F48A 2ZJ8A 4DLXA 3U44A 3U7FB 2ZRNA 3SQWA 3A37A 4C4PA 5FTJA 1G5TA 2YC2C 3K0FA 4F92B 3EW9A 1G7TA 2C9CA 3D6TB 4TTRA 1E9DA 5FUWA 2KWIA 1M6NA 5JBQA 1KHTA 4LBVA 3KDSE 5L3SA 4WIAA 4DLZA 4OK3A 3S1AA 1UADA 3OIVA 4IDHA 1U94A 2NQ2C 2WJHA 4X8LA 4JVNA 4CEIB 4PX9A 4U00A 1XEXA 1ZVQA 4JLNA 4OQNA 4RKFA 2HXSA 4XVRA 5CK5A 5KSOA 3BH7A 2A5FA 1Z08A 3I5YA 3W6NA 2UKDA 1R8SA 4HAVA 2VHUA 3W6OA 3EWAA 4Q1AA 4HAYA 4A0RA 3ND8A 4DKXA 3C8UA 1HE8B 3UMSA 721PA 3DO6A 3IIMA 5KOYA 4WVFA 2IYSA 2VYFA 1XD9A 2BVNA 1YE8A 2W2XA 3FFBA 4H9GA 4I81A 3SJZA 3AKEA 3KJEA 4B3CA 4Q1FA 3SHFA 3OE7D 5BN3A 2AFHE 1IBRA 4QNRA 1HE1C 5L8VA 2C96A 3PQCA 1NG1A 1OV4A 4QC2A 3S1AB 4CT4B 3QOFA 4WBSA 3Q7PA 4HYYA 4Q21A 4TSFA 4DDTA 4RCZA 3SFVA 4Q9IA 3B1YA 5J4VA 1OH5A 5J5CA 1DEKA 3AF0A 3E70C 4JLVA 4KYUA 4B44A 4EKDA 4KI0A 2OZEA 5EE9A 4M1TA 2NIPA 5FL7D 2ERYA 4M9ZA 4FN5A 5HKKA 1ZCAA 3IHWA 4IDNA 3HR8A 4HEJA 2IUTA 3AV0B 2GESA 4GPTA 3UWOA 2BHRA 1M2OB 1Z3IX 1FOEB 2CBZA 1PVOA 3WHLA 1UF9A 1PLKA 1OKKA 1VHTA 1ZM3A 4Q1DA 2QTFA 1N5IA 5FPSA 4NH0A 1AK2A 4TYWA 4MRNA 4A8JB 4DT1B 1YZKA 2REXB 4QXAA 5JZVA 2X2FA 4IW3B 4PPGA 4B43A 4MKHA 2GXAA 2V7QA 4BFVA 2O8BA 1FTSA 1DG1G 2DFKB 3N2EA 3TRFA 1Q3TA 2IXEA 3X2SA 1ZIOA 2GCPA 2ZRMA 4R2HA 2ZJ2A 1RVDA 4P32A 1M7BA 3FVQA 2GA8A 4S35A 4KODA 3SNHA 4EJSB 3FE2A 2QPOA 1G3RA 1UKZA 4LDJA 2HJVA 4TWZA 1N5LA 4QJ4A 3THYB 1TUIA 2GK7A 3SI7A 4NYJR 4ZDKA 3Q72A 5FOUA 2BMEA 2ZE8A 1KI8A 3OEHA 421PA 1KNQA 2HYIC 1N0VC 3TR0A 1V43A 1ONBA 4XD7A 4ZCLA 4CEJA 2CHQA 4LYJA 3QG1A 4UQOA 2VSXA 2OEPA 4IHQA 3IKJA 5CYOA 3RWOA 3LA6A 1SKYE 2OSBA 3C14C 1ZINA 1KI1A 2G1KA 5EE0A 3R7WB 2P5TB 2D74A 1G41A 1SVIA 3ZGXA 2DR3A 4ILEA 4CEHA 2IYVA 4NCIA 3VR3A 4TN1A 5F9FA 1IQPA 3BRWD 3WNBA 2G1JA 2ZRBA 1IOZA 2GK6A 4B47A 2XSZA 2PZFA 4C0BA 2BM1A 2RH5A 2A9KA 3A36A 3BFXA 4V0KA 3K0AA 3C41J 1P4SA 2EFCB 2VLIA 3LV8A 4KVAA 1NMXA 2RGXA 4FMDB 1XXHA 5FPTA 1ODFA 1KO4A 2FPMA 3LVRE 4PC1A 1D6JA 4D0GA 5HKKD 1Z0DA 5D3QA 4YMTA 1P6XA 2CXXA 2QEQA 1P7CA 2F1HA 2F9LA 3SU8A 3W3ZB 1FQKA 3QXCA 1BOFA 4EPVA 1KYIA 4L4UA 5GJWC 3X1XA 821PA 1YU9A 3NIBA 3M0EA 4G5RA 1G18A 1OXSC 4DT1A 1JJVA 2HCBA 5KYKA 1F6BA 2XZOA 4ZPXA 4GRAA 1AA9A 1N0UA 4D4JA 1YZUA 2BWJA 2X8AA 2WBLC 3B78A 1VHLA 2Q6TA 1GWNA 3AKCA 3LO5A 2ODEA 5AK0A 2ONKA 3LX8A 4YXWA 2VSOA 4URVR 1ZUIA 4TZ6A 5HZHA 1PJRA 2TMKA 5J4LA 2ZROA 4UXJA 3NWJA 3WYAA 2DYKA 2FPKA 3D3QA 1CJKC 4LJYA 1XP8A 4JS0A 2DWQA 1WCV1 4MYUA 4C0QC 1CIPA 1JPNA 2OAQ1 1U81A 2Z6VA 4Q7LA 4WZAE 2IHBA 3ZLJA 4DCSA 5IT5A 1ZCBA 3Q8XB 4TLBA 3TAHA 5JCZA 4HDOB 3HDTA 1B0UA 1Z6YA 1SXJE 2JLYA 5F2EA 4Z54A 2VF7A 2X77A 2GJKA 5DE3A 4JSTA 3T06B 1G64A 1KO8A 3KB2A 2ONJA 5JLJA 4PQFA 2JDID 3FKSD 3CRVA 1SGWA 5AJWA 1XXHE 4WZBE 2ZTSA 2K5UA 3QPWA 4QBGB 3K9GA 1E9FA 1N6RA 1YR7A 1MABA 3QUSA 3KQHA 3WBKA 3VX3A 4UXIA 3DHWC 1KK1A 2CLDX 4OHXA 4BUJA 2PBRA 4PAQA 1DO0A 3EWSA 2VP5A 1KO5A 3GFTA 4ESVA 3QEOA 1U8YA 1NG9A 1ZP6A 2I1VB 4DLTA 1S1MA 1EFCA 3BBPA 3QPVA 1NKTA 4M1KA 5E4FA 2OHFA 4BFSA 2ZQ5A 5FBQB 3OEHD 3PIRA 5LBIA 1JAHA 5FFMA 1SXJC 1KK0A 3VU9A 4TYPA 1F3OA 2O8BB 1YZNA 3CUEF 4M9QA 1OB2A 3G0HA 4LV6A 3VX4A 1OHHD 2ZYTX 2AWOA 2DY1A 2FMXA 2EFEB 4W7SA 5B57C 2H7VA 3AVPA 3GJ4A 2KE5A 3AKDA 2OLJA 3RHFA 4KFRA 2NPFA 4BASA 3RABA 1AS2A 2HDNB 2XZLA 3PUWA 1HQCA 3MAAC 3T5GA 3V4FA 4M53A 3RS0A 1ELOA 2ORVA 2FV8A 2CLSA 2JGNA 2YINC 2BEKA 4LCBA 4BE7B 2R6AA 1QHHA 2O0HA 1JR3E 1Z6XA 1W46A 1G8PA 3GLGB 1Z0IA 1IM2A 1KY2A 3EARA 3R20A 2ZI4A 3D8BA 4QGGA 1DAHA 4AD8A 3ZYCA 2OFWA 5KUTA 4HB2A 3KB1A 1KDTA 4PFSA 1M8PA 1NNEA 4CEJB 2W83A 2RMKA 3TH5A 4IDOA 3PG5A 3QBTA 5K8UA 4HAZA 1RZ3A 2A5YB 2Q21A 1JXOA 2QP3A 2O5VA 1ZM4A 5DSZA 4Q7JB 3KKOA 1XNJA 2G88A 1GP2A 3CNNA 5DHAA 4Z1MD 3H1TA 5CITA 3UPUA 3REFA 2ZREA 1WE2A 1E1QA 4PHGA 1JPJA 2AXPA 3B2EA 4LJ7A 5FBLB 5JI2E 5J4HA 5LDDC 2BDTA 3CRRA 3I5XA 1Q21A 5GJBA 3DM9B 1JB1A 2VEDA 2WV9A 5DI3B 5CLQA 4HSEA 5KTYA 4Q9LA 4YMUA 1F2UA 3DL0A 4JYBA 2GZDA 2F55A 2YJTD 2JJ8A 1JJ7A 1CP2A 2QAJA 3K9HA 4XJXA 2AX4A 4CZ2A 4ZIRB 4P4SA 2OILA 1N5JA 1Q20A 2FPLA 4I1VA 5C18A 2IYWA 4KU4A 1ZD9A 2X19A 1W4BA 1JBKA 3PVSA 5B64A 2BMJA 4RZUA 4AK9A 2VP9A 3KZ1E 2YC4C 1OH6A 2A78A 3U2QA 1IHUA 2WWWA 1G8HA 4US1R 1QHGA 3OEED 1T8TA 4DBLC 1U8ZA 5KPDA 3N70A 2ZJAA 1ZM2A 1HQYE 2QAGB 2CVHA 4Q4HB 3KFVA 1AM4D 1R5BA 4YLGA 1S8FA 1SQ5A 4GSYA 1ETUA 3HWSA 2X1VA 4D6PA 3U44B 1RYFA 5FTKA 1GRRA 2B6HA 5KDDA 4DLYA 5CLLA 3EPLA 1NVVQ 2VH5R 3CH4B 5DISB 3FKSA 4LY6A 3K0CA 4KSCA 4ABYA 4RJLA 2ZI5A 2F43A 4XIGS 3CRW1 1A5TA 3LWNA 2A2ZA 3CB4A 2RHMA 3CZQA 1EFRA 1QHIA 1RRGA 3BFKA 3AQ4A 2JEOA 5P21A 5E3HA 1BO6A 1N6IA 1VDZA 2VHCA 4M1YA 4TMVA 3P1JA 3VR1A 3CO5A 1UM8A 1KJYA 3B82A 5DN6D 3L8YA 1HUQA 1U0LA 3ADKA 4HDCA 2J0SA 4PPFA 1Q1ZA 2IWRA 2HEIA 1SVMA 1NVXQ 2WWXA 2DB3A 1D9ZA 1YQTA 2CJWA 3G82C 4Q01A 5B30A 1JQJC 2EW1A 4ITRC 3EIEA 1W48A 1W4RA 4TLAA 3A1TA 2QM7A 4C2UA 1IN8A 1N25A 4JSYA 4UNQA 3WRYC 2FFBA 1Z2CA 2KBEA 3AB3A 3I62A 4FMCB 5JEEA 2ZS7A 4DLRA 2KBFA 3THOA 1P75A 3WRXC 4B2IA 1U9IA 1XX6A 5KSZA 1E9CA 1NLYA 4IJMA 2PJRA 2NG1A 5TB5A 1SVLA 3RSOA 1VTKA 2BEJA 2H8KA 4B2LA 5CJPA 1YRBA 2BV3A 2G3YA 4RFSA 1D2NA 1G7SA 2IK8A 4OK6A 2R8RA 1QHSA 3WMGA 4M8NE 1XPRA 2REBA 4QBIA 4POAA 5LPNA 4X8OA 4KXFB 4C9BA 4PO8A 1S3SA 2NZ8A 1AS3A 2GJ8A 2RGDA 1GM5A 1DO2A 3TUZC 4IVPA 2H1LA 1T9HA 1VKJA 1WA5A 2SHKA 1RRPA 2P6UA 2EFGA 1Z28A 3CF6R 2XGJA 2FNAA 3I3SR 4R9UC 4MKFA 1QDEA 3DEFA 4HLCA 2OESA 5JJLA 2PJZA 1QVAA 4LJ4A 2IWHA 2VTKA 3TKLA 2GCOA 4PZZA 1G291 3PR1A 4WAUA 3OZXA 1I2DA 2H16A 4OJQA 2C9YA 3OESA 4LJ5A 4EDHA 1F2TB 1X8KA 1M7HA 2QA5A 3K9LA 4LZZA 1E1RD 2AR7A 3DM5A 4A1FA 5EZ6B 2IXFA 3OFNA 4URWR 3AUYA 2VRWA 3HYRA 1K5DA 3QBVA 2ECKA 4Z8YA 1DE0A 2QMHA 4O0MA 1NP6A 1E0AA 2QY9A 3MGCA 4QG7A 2OO7A 2HF8A 4JLKA 2WICA 1GFIA 3BB3A 1CJUC 1W0KD 3PV0A 4GMDA 1TF5A 2OBLA 3QPUA 4TLCA
chains in the Genus database with same CATH superfamily
4CM4A 3SR0A 3IDOA 5J43A 4ZAZA 2F64A 2R1TB 2NOAA 1O9GA 4JXXA 4RD3A 2C5BA 5D3MB 4IDEA 1KEEB 1K27A 1JDVA 4LK3A 1QF7A 4ONEA 3UWPA 4PPYA 4IGEA 1PBTA 4P5PA 2FP4B 4KVFA 2O2EA 2HSWA 3GP5A 1IXRC 3L0SA 5CH8A 5EGNA 5H02A 5TIIA 1E3WB 4U1RA 1NQVA 4YHHB 4BVAA 4WN9B 1OSNA 2FPIB 1XD2A 2HLHA 3H3XA 2XBUA 4UM7A 4UFPA 2I6QA 2SNIE 3D4OA 5FWYA 3QEBZ 4CT5A 5EEHA 3FYHA 2WU3A 3HJTA 3TL6A 3VA7A 1B6GA 4IAOA 5KNDD 5TS2A 4DZZA 3H2IA 4M46A 1YI8A 4U2CA 4XA8A 3NEYA 4XYGA 2D54A 5K8IA 4KX5A 5TVKA 3OIUA 1K4YA 5F35A 5ALEA 4ENWA 5LZ4A 4YRQA 3U9SA 2FSFA 2HL6A 1PLLA 2WSBA 1NT4A 2E5FA 2JANA 2P2ZA 4FOLA 5IJAA 1JR6A 2GEBA 1WPXA 4RHFA 2HN9A 1UWLA 3ECCA 5GM1A 2SKEA 1TPYA 5JR3A 1YCHA 4LOIA 3C8ZA 5A03A 4RD1A 2D00A 1F51E 1H9BA 1OFHA 1QC5A 3K9NA 3U26A 4X97A 5EKXA 3WIVA 2G9UA 1Y9ZA 2FR8A 3TUIC 1HY3A 3FTNA 4WMLA 4AY5A 4ENQA 3RQSA 1SNYA 4GZ5A 4GXTA 4LKRA 2JI8A 3KS9A 4RKRA 4YCNA 1AQ6A 3HZRA 2HW8A 1V7CA 4OBEA 4R0MA 4F71A 1T8SA 1YNOA 1WBBA 3G89A 5AVQA 3OE1A 3NKFA 3D7MA 4IQ8A 3AWDA 3V4VB 1XN4A 1ZBDA 1G66A 1WDMA 3T4UA 1NFQA 4J7CA 3KEMA 3PEVA 1JAYA 1H5NA 1TFRA 1BCSB 1W85A 3HXKA 4EYKA 4MVCA 4AJLA 3O7WA 1T0UA 4QDKA 2B5OA 4FR0A 2AKAB 2I4TA 3DR3A 3WYDA 4E2YA 1UMDB 4RKQA 4FOOA 3N2NA 4CNBA 4JBNA 1G55A 2DT8A 3ZY2A 1E9EA 1CJVC 1OYYA 1JILA 1KY5A 5AI0A 2I4IA 4EFDA 5GGXA 1NI3A 3G68A 3ROMA 1YJ5A 4LOHA 2PSJA 4CDNA 2OE2A 3G88A 1CRLA 2EVWX 1G3UA 3ZW8A 3SD7A 3G5MA 4GLOA 2XUFA 1QPZA 3K9BA 3MM4A 5AKGA 2WMDA 1RQXA 3LKVA 4XWKA 4AJ9A 4K3VA 5H59A 1NOKA 1KDYA 3I9MA 4HX2A 1H65A 3OZRA 3ZU4A 1FU8A 1KTVA 1Z0ZA 4RK4A 1JHPA 1TJYA 2VDPB 3AMVA 3TLAA 1DG3A 3NOOA 3I6ZA 4WLEA 4TUYF 2KLHA 2DF8A 3HJNA 5JXIA 5DYGA 2RGNA 3RVKA 3DLPX 4NDAA 4S04A 3SXUB 2X41A 2Z1MA 4I50F 2WOJA 3GG2A 2CUZA 3LFUA 1MR3F 1NZJA 1NLMA 3Q41A 2ZI9A 4R0NA 4MDHA 5IAGA 4ND7A 4ZI2A 5KNDA 3U17A 3TIFA 1V8ZA 2XMDA 3TR5A 4L4ZA 5ICMA 5JADA 1P3Y1 3QX3A 4D26A 4PCLA 3O82A 4DUYB 1NMZA 4UHHA 4CL2A 3LXXA 1PR3A 4PYRA 3J81k 2FX3A 2VKQA 3QE0A 3ULKA 2AFHA 5AUOB 4RFVA 5IM4A 4KO8A 3O3MB 4LJ8A 4CLEA 5CEEA 1NKVA 3PRYA 5FLKA 3ADDA 4DMUB 1DBSA 3DHEA 4W8OA 1IMJA 2RGCA 1JXAA 1D2MA 1DAMA 1NBWB 2XUHA 4UULA 5EI5A 5LNK1 5C0OE 4GVPA 4CQLB 2PHZA 3OCXA 1G8SA 4YXWD 4AM8A 1VCOA 4EHDA 1SIUA 1M34E 1Z36A 2WLSA 2ZJBA 1V45E 5IS2A 3HP4A 1N0HA 1E99A 4DG9A 3H4VA 5BR1A 1PTKA 4MVJM 1AA6A 3U7FB 1Y8ZA 1FRQA 1TKCA 2C20A 4Q02A 4FCTA 1TMOA 3L8MA 4X7MA 1UBJS 4CM9A 2OG1A 3OIGA 4ENRA 1ULHA 5HGJA 3KQPA 1XXLA 1C9EA 4E5PA 4FZ5A 1Q74A 1ZGGA 4V38A 3OOYA 2BJVA 4IIXA 3D64A 4UNRA 3AEQB 3QHAA 1N8TA 3OMXA 4EG4A 3OQOA 1QE3A 2IZZA 2QE7A 2FYTA 2Z8YA 4I1RA 4R6WA 4GMKA 5IDXA 3CHYA 3D2LA 3H9QA 4IV8A 3BFVA 4BECA 2W6ID 2X7XA 2QTVB 2RHRA 5TF4A 1ORDA 4JYCA 3GRYA 2W6JD 5JD4A 3UGQA 3AEYA 5GIOE 3THXB 3QH4A 1IM8A 2VAMA 4HLNA 4YP5A 4C3OB 3QPCA 1KDRA 4DBVO 4F9GA 1I4EB 4IFBA 2QX8A 4UBIA 1JHRA 4KSYA 4YV2A 3O8OA 1C2TA 2WUDA 2ERXA 1URPA 4K6OA 2HCJB 2PSEA 2HTFA 2WJIA 3TX2A 2CV1A 2EW8A 3TMKA 4EP1A 4XWAA 2AC2A 3U3KA 4HLQB 2WHYA 4ZV4A 2AN5A 2I80A 5G0SA 1ACLA 3T9EA 3UCEA 3II6X 1NLFA 1YZHA 2FSPA 3R3ZA 1JEQA 5DTRA 3CLVA 4PZEA 1J90A 2XA9A 1MX9A 3O9VA 5JAIA 3KETA 2GKGA 4HLUC 4FFSA 5FO0A 3K0BA 3HFRA 3Q0IA 2FA9A 5FOWA 3Q3GE 5E4TA 3KZOA 3OQVA 4B80A 3T7DA 3OM1A 3UHJA 1FYDA 1HH4A 5EUQB 3GDOA 3OCWA 2IYUA 3UYLA 3QWFA 4TQGA 4HC4A 1ZIPA 4NQZA 1JG2A 1YR9A 3OOEA 3PUHA 4L22A 4FMCF 3AVWA 4RXUA 2FVXA 4ED9A 4W9NA 4BL5A 4JWKA 4C4YA 3ZHXA 1Y9DA 4P0TA 1CUSA 1L5WA 2LZ0A 1SKQA 1KRHA 2IZOA 2OV3A 3F5QA 2ZDGA 4TV8F 4ETIA 4U63A 1Q1GA 3V9PA 1Z62A 3ZCTA 1B8NA 1SOAA 1TRKA 2H1IA 3PX3A 1A9TA 4I1OA 5HJ7A 1EWKA 3MMZA 3UMVA 1RC8A 1E59A 2BTEA 3SS8A 1X7WA 3QFCA 1PS9A 2G82A 4O4IB 4B6EA 4B31A 4UBKA 1PQWA 1X9GA 3IULA 2V5UA 3SYKA 2GJAA 4DDHA 4OI4A 1V0JA 1ZEJA 2DPYA 5FTLA 3E48A 3PQEA 1HFKA 3DE0X 3TLZA 3UHPA 2V3CC 3WMRA 1UFRA 3GLVA 5SYNA 1USVA 4RKYA 5BR4A 4RZIA 4EKIA 3WGMA 1FYWA 4EFLA 3NTOA 4TWBA 3EPJA 1I3KA 2I6TA 1G8FA 2VJKA 2V4UA 4FYKA 5JMPA 1M10A 1GNPA 5NULA 3PLNA 2QGFA 2WK1A 3B6JA 3ESRA 2WG1A 4KLZA 1NT2A 3NHPA 9GPBA 1RXCA 2F8MA 2B35A 3IUJA 1DQPA 2P9EA 5G1PA 4ON9A 1IN4A 221PA 1U7DA 3FNHA 3VU9B 1U8FO 2VP0A 2WF8A 3NVMB 2X7HA 2VJBA 4A6XA 3NDRA 2ZIUB 2W43A 1OXUA 2PL3A 2RAVA 1OWOA 3KQKA 2HDOA 4I4NA 4X6XA 3MWYW 3I34X 5FRDA 3P4UA 4QGSA 1JU9A 2Z2YA 4AJOA 5IVPA 3RU9A 4B6QA 1HNNA 1UXIA 1XU4A 1I3OA 2P3OA 3Q0TA 3DTVA 3P27A 5K6TA 3HHPA 1CY7A 2W2VA 1U1EA 4D7AA 5BMOA 1OU0A 4TUYA 3EGXB 4Y7CA 4C7OA 2NADA 3E22B 5DLYA 3SSMA 2GZMA 1QYWA 1YIOA 3CNBA 3OPQA 3PXDA 2GTIA 4H1WA 4H3KB 4H3HB 3R9WA 2VLBA 5K2OA 4O5OA 1E9SA 2W4IA 2EZUA 1QJ4A 4GYKA 4AAYA 1KQGA 1KFCB 1V6CA 1R8JA 2JIZD 1DEOA 2RB5A 2W11A 3BAZA 1WTCA 2CNWA 5ERYA 4BVGA 2VDOB 3IV7A 3WKDA 3WLAA 2WKQA 1HNXB 2MCFA 4C7JA 5JBNA 1A9RA 3FUXA 2VZEA 1J33A 3T3PB 1G5HA 3JW8A 4HFRA 4OHPA 5EXSA 1QX4A 1UWCA 3TD9A 5LB4A 3QI2A 5BUSA 1XFDA 1P61B 3N74A 5HA5A 3IE2A 2CXPA 4D9FA 2PXAA 4BNKA 3TGLA 4KHPB 2BH9A 2P7HA 2MR5A 1QAMA 3MJHA 4X84A 5KOHA 4GR4A 5DOZA 4E2FA 3AU9A 521PA 1XCJA 5BYJA 2R7LA 3ZVKA 3HGTA 2CDCA 2ZKIA 3H4MA 2YL2A 2QTWB 3AIMA 2XE4A 3K53A 1SVWA 4Z1MA 4EARA 1TIKA 1XMJA 4FYMA 1ZJ6A 1W85B 1YS4A 3OJCA 2D2VA 2PXHA 1IN5A 4RHCA 3B85A 1BU5A 5DRTA 3ZH2A 4BQFA 3QVTA 4S0XA 2FE4A 1O9HA 5HXAA 3FVVA 3EDCA 4G6ZA 2GJSA 1RMYA 2A5GA 4PTLA 4DUPA 2H4FA 1QIMA 5MFZA 2I6SA 3ICCA 2F3RA 4ZHSA 1AQIA 1QYRA 4CM5A 5M34A 5JXWA 3R40A 1DKUA 1IDN1 3C85A 1VYUA 4EZBA 2OFFA 2QD4A 5HS6A 1Z16A 3S4YA 2L0XA 4JXZA 1H85A 2VHJA 1AZWA 4K9OA 3WK9A 2XGGA 4TTJA 4BN0A 3I6YA 4R9RA 4KPFC 3T41A 2IF2A 5D51S 3HCDA 4LCJA 2P0EA 4E33A 4M98A 1FDVA 3TTUA 4M55A 2YJ3A 1B73A 3V8QA 2EXXA 3UMRA 4FHFA 3MJDA 4P8RA 1TT5A 1B3BA 2YV2A 3QBDA 3TKYA 4ZCIA 4BVKA 4KQIA 1MH9A 2ZITA 3OBBA 1PZXA 3QFFA 4BKOA 1DBIA 1FFDA 2V03A 4RGQA 4EW2A 3C7TA 1EEXB 1TEHA 3IEIA 1S2IA 3WHIA 4D9MA 3DWGA 2QL6A 3I2FA 1P33A 2Q5LA 1E2LA 2VPZA 1V39A 3BXEA 5HR5A 3HDVA 2OGUA 1KJWA 5G3ZA 3NUQA 1DFIA 4CR7A 5F9HA 4PTZA 4OA8A 3UA3A 3DMRA 5DNEA 4D4GA 4Q16A 1W88B 3WY9A 5JBIA 2JLXA 1XMSA 2HU5A 2XUQA 3HMQA 4G01B 4UBOA 5DLQC 5B4UA 3HVKA 5KQSA 2UUBB 2NX2A 2W37A 4ZVQA 3EBPA 1GPJA 2ZRGA 3Q1LA 4PHCA 1N1MA 3O95A 5EGSA 3FGOA 3N8IA 4IP0A 2PCJA 4FP9A 4V39A 1EX7A 2DWPA 4RM2A 3P9NA 2G07A 3MELA 3MILA 3RHZA 2ZZNA 2XMRA 2HA3A 3N87A 3OHPA 2VRCA 2IT1A 4ZXFA 4C30A 3A6GA 3UJBA 4G23A 3L7MA 3G9UA 1JE1A 1PV4A 3MYRA 3DZHA 3MQFA 1U0SY 4NE2A 2LCQA 2W0MA 3I64A 2Q6IA 4DSNA 1XTQA 1RJ9A 2EZ8A 4INZA 1R6TA 3H5NA 3EVBA 4E5MA 4I14A 4RPGA 4MRSA 4YDSA 2DTXA 2GM3A 4CGZA 5EY5B 1NRWA 2QN8A 2EFHB 2CLMB 4Q9JA 3SIWA 1H3EA 3PNLA 3W34A 3PNSA 2UV8A 2VIIA 1KVQA 2CNNA 2XWQA 5AKHA 1SXJD 1RI4A 4IDPA 2D5AA 5AHWA 4BLSA 4CMEA 5G3YA 5KTSA 3W5UA 2R6FA 2PMWB 1VI2A 2VP4A 3QU7A 4BO6A 1AHIA 1ZK0A 1IB0A 1A9XB 1GL6A 4LFCB 1L5HA 3RYCB 1L4FA 1JQAA 4PW0A 4OQMA 4E3ZA 3FPHA 2R11A 4OX9B 1JP7A 1YBMA 3KOYA 4PANA 4H77A 3X1YA 3EA5A 4RDXA 5K0TA 3B48A 3V2IA 3FHOA 3UB4A 1QP7A 2H2IA 5FBKA 4EHJA 4CKZA 4D96A 5KO2A 1X1SA 3BERA 3DOFA 2AZTA 1GADO 3KO8A 3T3MB 3NDBB 5CP8A 3TLKA 1RHRA 4UM8B 4WXEA 3HY3A 5KNCD 1DARA 3STWA 4K9QA 5LA6B 3DFUA 4KNYA 2EKBA 2XB2A 4NY1A 4LNUA 4JENA 1U98A 4PE5B 3SKYA 3SQLA 4BZXA 2F3TA 3AR5A 2WWYA 3M83A 3M4YA 5HDBB 3AOEA 3A4LA 3P5SA 3SLKA 3V4LA 2VJPA 4GO1A 4AKIA 1G6Q1 3PD0A 2QAGC 5KEIA 1M75A 1CY1A 2B69A 4J2TA 3RC3A 3CRMA 4AMVA 2ON6A 5AOAA 4BDSA 4IBOA 4GGMX 1C9DB 2AXNA 1KAOA 1RPNA 2E6KA 1C0LA 3N6VA 3DVAB 5K0FA 3T1NA 1ABFA 3DDCA 5A3JA 1XZJA 4B82A 3AUFA 5FA6A 5A3VA 4FW9A 4CIWA 3V7WA 2VYVA 3O93A 1ULSA 1AIPA 3F6BX 3KWLA 1HA3A 3JATA 3UBTA 1GZUA 2AQIA 2GEFA 5K8VA 1U8XX 2QGZA 4CVNA 1XGKA 1G2OA 2WT9A 4LOLA 1C8BA 3KAPA 4AYTA 1DLIA 2VAVA 3UB3A 4G3XA 1CHNA 1DTWB 3DAFA 4BAUA 4JT8A 1NI5A 5GADl 3FBWA 3VZPA 3ZDQA 3LX6A 1ONPA 1TYDE 2OO5A 3LAWA 4JC8A 3RAPR 1M5RA 4H7HA 1BC5A 2B78A 4LY9A 1U8AA 3DE5X 1GNLA 2YVUA 1OAOC 3IAAA 3M8KA 1AKRA 5FR1A 1GZSA 4EITA 3K5HA 3B6KA 3BWMA 4BNTA 4ZAXA 4ZT5A 2A1UB 2QPAA 4ZVPA 5GVRA 3V4RA 3HJRA 1DJNA 1E5XA 2YTZA 2BJWA 4NECA 2HXGA 1LY1A 4Y6OA 3R3VA 2M6RA 4EBBA 2PRZA 5LP6B 4J9UE 5TARA 4JQCA 5CLHA 4MDYA 2WZCA 3UJNA 3C8MA 5ABPA 2OC9A 1EX1A 3CG4A 2H52A 4TL6A 1Y89A 2RH4A 3HPRA 1HTTA 2QP9X 4K6MA 4MVXA 1EP1B 5G4KB 2MMGA 4Y1RA 3TG2A 5JCOA 2Q2VA 5KX5F 4PC3A 2Z6QA 4XDGA 1W25A 4FUQA 1WSDA 4XEHA 1GUDA 3HCCA 4NJEA 3KT8A 4Q9NA 4BRWA 2IHYA 1SH7A 1U9CA 1RKQA 2P6NA 4WQMA 1VMIA 4HDAA 2HLDA 3Q2IA 2B0JA 1OE0A 3LYAA 3WDKA 1QZXA 4YI5A 3UIEA 3DZGA 3LY8A 4N41A 4QD3A 5JWRA 1RKUA 4YT2A 1IZ0A 4X20A 2ZUTA 4R1TA 3TCKA 4OYYA 4A2CA 3HB9A 1S0UA 1JLHA 5JO9A 3NVAA 4QYSA 4TLDA 1QO7A 1PL8A 4QJ3A 1CJTC 3LC7O 3OTGA 5FUYA 3JXEA 2ZYUX 4H31A 4KITB 4P81A 6REQA 1LDYA 1PJQA 1YR8A 2WFMA 2Z8ZA 3L6BA 3ONVA 5C4GB 4YI3A 1QRUA 3E0QA 3H42B 3T5AA 3EEQA 4BKUA 3DMFA 4X8MA 1I1HA 3L18A 5BQ3A 3QKUA 3DQQA 3F1KA 2AOUA 4NMHA 5JDIA 4L0DA 3HVJA 2H63A 2HRQA 4BAZA 4IXWA 5KIAA 4IEEA 3NRCA 2ZW9A 3MINB 5GINE 3GJZA 4IJWA 1W0JD 3WL8A 4QUGA 1CY8A 4AG3A 2HLPA 2P1DA 1EFRD 3AVOA 3LMKA 2P5SA 1L4HA 2V97A 4JGBA 3SXUA 1NF2A 3BXZA 2HIHA 4LZOA 1VB5A 3CONA 1PQ4A 5IP5A 5K99A 1UT6A 1N6HA 2CHEA 3KD3A 4WLOA 4UEKA 5B1DA 5EP4A 4OQLA 1R0SA 5FO1A 3GW8A 1UBSB 1KIMA 2BGLA 3N2KB 3OQHA 4LWOA 5EYPA 5EKUA 3VKVA 5DNUA 4RLHA 4O1MA 3DUWA 2JA1A 5F7ZA 2KJQA 1OR8A 1X1BA 3WVNA 2XR1A 5T57A 1ZNZA 3V7NA 1KXZA 3N7TA 2DBYA 3CSUA 3P7MA 1R50A 4YVFA 1TD9A 4HGPA 5JJ5A 3NOVA 1P5ZB 5JH7B 5DLPA 4DA4A 3RJ5A 4X95A 3B7GA 3CN7A 1A5ZA 3EPRA 2JGFA 4RENA 4AMYA 1JFTA 2C54A 1QHHB 3GELA 4XZ3A 4FD3A 2QTLA 3W1WA 1ANKA 4ZCSA 4D5EA 3L92A 1H0KA 3BH0A 4U6QA 3TLGA 1UPAA 4QAQA 4XVQA 1P74A 4ENSA 1RBMA 1PF7E 1DJLA 1T0JB 1Y48E 2HB6A 2RONA 2B8TA 3DV9A 3LUGA 3PJFA 1PT9A 4FN4A 5ALTA 4WJLA 4QVIA 2FE1A 2XTJA 3AU8A 3QYPA 4G0PA 2CXTA 4RULA 3IAHA 1AUXA 1DELA 1UJ2A 2ZBFA 4F4JA 1HBJA 3I52A 2I3BA 5T6MA 1JHQA 3A9VA 4KAXA 5FOXA 3KPUA 3CKYA 4UU1A 5JAOA 3VSBA 1IBCA 2VPPA 3TQIA 4FWBA 4RVFA 3VJKA 1HSOA 1T9DA 2JASA 3BHMA 4RADA 3SQNA 4FEYA 2VZLA 1DUSA 1Y4ZA 2UYYA 1Q7RA 1YACA 3IFSA 4XPIA 1Q12A 2VT7A 2OQIA 3O47A 5J1TB 5AK4A 1G1MA 3QFSA 1JR3A 4KYTA 3T12A 1GR1A 2UYCA 3GPDG 5FKJA 1ZUNB 1MB0A 3K1JA 4BZZA 3E84A 4DV0B 1IE3A 4Q1BA 2R6GA 1UZUA 4AJ2A 5JNLA 4LC0A 5K8CA 2GYWA 4HXEB 5ARDA 4BGUA 1WM1A 3DAGA 1E3IA 2GN6A 2IDZA 3IIIA 1DHTA 2EGHA 3MOSA 4WJKB 5C2JB 3DBRA 2OHHA 1SU7A 3NUGA 3A1WA 3QXJA 2VNSA 4P08A 5ENVA 5BSFA 2PUFA 1WJGA 3MCZA 4RS3A 5LJLA 1CE8A 4GMGA 1LDMA 1F8FA 3FKQA 1TJ3A 2VBCA 4E2WA 2B7BA 1O9BA 2NXEA 4JNCA 2AD1A 3JD1A 1RM5A 1TMGE 2WTAA 1Z15A 3BGSA 1BFKA 1Q0LA 1SAYA 4EO4A 5A2GA 2VBFA 4INPA 3G5AA 3I30X 4LQ4A 4AZWA 4BOYA 2Q6OA 2VYCA 1FS5A 1Z0UA 2P9BA 2C5LA 5JCJA 1XKQA 4H0NA 1LVHA 2FPGB 4KR6A 3K70B 1IFXA 2ZAGA 1SXJA 3LKBA 4XX0A 1K2VN 3HL0A 4WUTA 1T1GA 2ECOA 4MS3B 2JK1A 1F12A 2V58A 4L8FA 5T4FA 3QTLA 1EFDN 1OREA 5DXFA 4BIIA 2FEOA 4V0QA 2Q4OA 3G2QA 4XQ0A 1FXWA 4XPZA 3MS2A 4FLFA 3ZWKA 3G9QA 3ANTA 5F2OA 1N0IA 4RACA 5C34B 4P22A 5DP1A 2UZIR 2FX5A 5D86A 5IKEA 3C8DA 2FWJA 3DKRA 4AMGA 4WBNA 4PLGA 2BC9A 2ZAIA 2Z95A 1B1CA 1HFEL 3HFSA 4UM5A 5DW0A 2RK4A 2XTMA 5F2NA 1OFIA 3FDZB 5IJXA 2YDXA 4OTZA 3K9WA 4QNNA 3RTGA 2C5FA 1S5PA 1TNDA 5HEKA 4MO2A 2CMHA 4WOKA 4EUNA 4AWXA 6REQB 4IIYA 1GYRA 1RADA 4IHJF 1IVSA 4LZAA 1IRXA 5CBPB 3EUEA 1H3NA 4EYOA 3DOHA 5LN1A 4P36A 3CWZA 1TO1E 3LY5A 3O8BA 1NNI1 2XOKD 3PDIA 3FWHA 3U4GA 4POOA 4QEKA 5LKAA 3WLRA 4X20B 5J4YA 1ZX1A 2QLBA 1NJ5A 5B6JA 3LDGA 1CULC 2P9YA 3GGJA 4DLUA 1N2CE 1YIDA 1MC8A 5H4HA 2NUPB 4HN9A 3VNAA 4IKEA 1L3IA 2PZJA 3VDNB 3FI0A 1E6MA 4RTRA 1TZ2A 3QKWA 3ZWPA 2O8EA 3EOAI 1Z4MA 4LGCA 3WISA 1L8AA 3FKJA 2G0TA 4P4TA 1QF9A 4NJEB 4NS4A 4QATA 2YRFA 4R54A 1KMIY 5BV8A 5CLGA 3JRNA 3LUDA 4TT3A 5KHLB 1V11A 4QTZA 1SC1A 1A82A 1UEXC 3PDJA 4KUGA 1WHSA 1VRCA 3L8ZA 4CEHB 2CFIA 1QGUA 2WD9A 5HX7A 1WKBA 3BF8A 2N42A 2JFNA 2R6R1 5DJ5A 5H8WA 1KI3A 1UKEA 3AHDA 2ZRPA 3JQ8B 1BU8A 1JEOA 2X4IA 4OGGA 1IG3A 3C15C 1RXSA 1QG2A 4DLNA 1L1QA 2GOYA 3PXBA 4OK5A 2H1OA 4CQLA 4JOBA 4MJ7A 3MWJA 3MT9A 2CNLA 5HCNA 2V6JA 2YVAA 4WGFA 4ZCTA 2QS9A 1SBYA 3K9CA 1XDUA 2X22A 4UBMA 3T9AA 3SFZA 1SC9A 1E3JA 1R16A 1BX1A 1K8RA 2Q1SA 3PGXA 3G2KA 4W5NA 2P9ZA 1YQXA 3BGWA 2P67A 1KS2A 1HXHA 2WWGA 5CHEA 2VWHA 3UGTA 1T34A 4TVOA 4CV2A 1SRRA 2ZJYA 4GSKA 4MEJA 4WKNA 1UFVA 2PKWA 1KGSA 1MKYA 2BFEA 2IYOA 3SBDA 4B76A 4L72A 1P62B 4H27A 3OVMA 2J6BA 2ZTUA 3LUJA 2IBMA 3V1NA 4ZGGA 1ECJA 1RMTA 2AF4C 2EARA 2W00A 1KIFA 4WY2A 2CE7A 1R4ZA 4J0GA 1JDBB 1XAJA 5INTA 2B2XA 3W06A 3UG7A 2N9UA 4WLUA 2AI2A 2JFHA 2R2GA 2V7PA 1DIGA 1MZVA 3V8MA 4UBJA 2OLKA 3QI7A 3V3TA 3PX7A 2YMPA 5I5GA 4Z0TA 3EDYA 2RKOA 5JW6A 4YRIA 1QHEA 1R0KA 2OM2A 4FILA 3ANYB 1OBCA 1E6CA 2MSEB 4MINA 1KY3A 1LRJA 2FWAA 2GAJA 1QZZA 3AZOA 1XF9A 1E3EA 4MQFB 4PFJA 2GPNA 1H6CA 4X65B 2FMTA 2O7NA 1J7JA 4D4IA 3ITKA 1EH5A 1SIOA 1LK7A 3IHLA 4Y6PA 1IY1A 1R6UA 1YBHA 3Q3VA 4F2HA 4AZ3B 1QPBA 2B4KA 1LK5A 3HDGA 3I4FA 3VPDA 3UAYA 1QFJA 3BWYA 3CEJA 5EKTA 4ARUA 2II6A 1Q15A 5LD2B 1H1LB 3NVKI 2CHGA 4RTMA 2OM6A 4ZCMA 4IXDA 2W2QA 4KO1S 5THQA 2B92A 1W5SA 3JX9A 2CNOA 2Q6VA 4KVGA 1TMKA 4ZO4A 5CEFA 4R4JA 1GYPA 1WXDA 3BJMA 1XRNA 2XHZA 3NHSA 1GPWB 4X90A 1DPFA 4R2IA 2IEIA 1ESDA 1K6MA 5C4IA 1UANA 4YDQA 2CXNA 3RLIA 3W4JA 1YRHA 2XRFA 2I6GA 3D6AA 4TQUS 2RDMA 2YVKA 3GLIA 2W6OA 3QGMA 1DKMA 3QV2A 1U7OA 3KUCA 3MJFA 5IEJA 5E0KB 2A9RA 2QRVB 2C59A 1G16A 1R0CA 4KWTA 1XLTC 4XCXA 1W4AA 5JDCC 3LKZA 4JX9A 2V5VA 5AK5A 2GD0A 3WBFA 1XVVA 3WWPA 2GKOA 4O33A 4JGIA 4P1ZA 1PR5A 1VMDA 3ZJTA 1Z2PX 2HPHA 1I01A 3MCUA 2I4OA 4K0RA 4IMRA 2NUBA 3AFOA 3IOBA 4YJFA 2EX0A 3VOTA 4ETNA 1IEVA 5JS6A 1OTXA 3SXPA 2PLAA 4RZ3A 4XWGA 5CFNA 1UK9A 2CDRA 2QZJA 2JIBA 1FJGB 1B8PA 3X1MA 4U4AA 4C05A 3GLHB 1J4AA 1I13A 4JJAA 3RV3A 4O08A 1CVRA 3LF1A 1IZYA 2AG5A 3NFRA 1SHKA 3EB9A 3RC9A 4MDEA 1GUZA 1DAGA 4OL9A 4GMHA 1H2EA 2B1GA 2NT3A 5KKAA 2R79A 1G9TA 2QN6A 3FUUA 4PWZA 3ZXYA 3F9RA 4YRTA 2HUNA 2ROQA 2ZRKA 3R0VA 3GLRA 4KC0A 3VUEA 1IJKA 2O8FB 4PZAA 2BGJA 1O94D 3CKKA 1XD2B 2EBFX 4ZOLF 1SM4A 5DU2A 4DQUA 3TNFA 3ND5A 2QRNA 4DYVA 4HLDA 1CETA 4KQEA 4MCAA 2MINA 3PJDA 4KGXA 4X85A 1KJIA 3H83A 5I7VA 3GJ5A 4WTOA 4YCDA 1ND5A 4JOSA 3MTEA 5DO9A 4GI7A 5EXDA 4BX9A 1YBAA 3VZDA 3ANNA 3AP1A 3RS7A 1JR3D 4C14A 4PYIA 4GICA 2XHEA 2FKAA 3HK2A 2VHTA 3M7IA 1Y42X 4EUEA 5BR7A 3RJMA 5J23A 4JI7B 3DP7A 4HWPA 4C21A 3OM9A 1AQYA 1OWLA 2J07A 4LJ9A 4BU0A 5KOJA 1HDZA 2AS0A 4S1VA 1G19A 1FDWA 3DTVB 4ZCPA 4EB8A 1KMHA 5CCDA 4HCJA 2FEAA 1SHZA 4JQSA 4R2XA 3BWCA 3H65A 4KGVA 5JS7A 4JUDX 4PYKA 4I2NA 2E87A 1N6LA 3EF1A 4FNAA 1MAHA 4YNBA 3PNBA 2DERA 3E23A 3C6BA 2EP7A 4LYHA 3KEOA 4L50A 2YHBA 1NJFA 4A0HA 1AQUA 2H92A 4WWHA 5ILOA 1WP9A 2J1LA 4FOTA 5LD2C 3LCMA 2ZK7A 2ZYWX 5CH3A 3PEFA 2DPLA 3U37A 2Q3FA 1R12A 1IPHA 3DMDA 3D7KA 5L7WA 2I62A 2L82A 4K6GA 1YRAA 4REQA 1ENYA 1WXFA 1H0RA 3WYNA 2F1KA 3JQ9A 3ESAA 5E38A 2EW2A 4RK6A 4F97A 1XPJA 3H17A 1VE6A 3H1FA 1X70A 3PB3A 5HKLA 3TZLA 1DSSG 3UWMA 1XEWY 3DNFA 5EVCA 5IHXA 4WCFB 4L9SA 4IDQA 2ZR0A 4F9EA 4LDPA 5FL3A 4UCWA 1CZUA 5E7MA 1XQYA 2CV2A 4Z5XA 3T0IA 4QFDA 4LUCA 5IWAB 1QCCA 1U7UA 3DEHA 3IELA 4NZOA 4N03A 3MCAA 4LYAA 3TJRA 1F1BA 2AZDA 2PAAA 2FZVA 3EBLA 3FOWA 4YFYA 2XQIA 1QR2A 3IUYA 3VO8A 4AIIA 5AI6A 1AN0A 2O8NA 1MAWA 2I2FA 3VC2A 2JVJA 3BX1A 3I92A 4U2DA 3A6PC 5A5VA 3EUAA 3DDSA 2CL7X 4ZMRA 3AONB 1O0SA 4HB0A 1SBZA 1K1EA 4UW9A 2RD2A 3QVJA 3PD1A 5GONF 3UUFA 3VI4B 2FQWA 1ZICA 1IBLB 1N2OA 5DDIP 1FP4B 5G1NA 1Z22A 1CWUA 1NM5A 4R1NA 5IJWA 1G20A 3QUCA 4PC6A 1W73A 4E07A 2WTEA 2M1XA 3W9BA 3O4VA 2I54A 3MINA 1GCOA 4EYGA 4PFKA 1EK0A 1IXKA 1EDDA 4PYJA 3F90A 1FTYA 1HORA 1NAHA 1U7PA 3MW8A 4O1HA 2MDTA 3DPSA 4Y6LA 5E3JA 4I66A 3LUBA 2QVBA 1CUJA 3R77A 3MSCA 3ORFA 4JCCA 4AP5A 4BKRA 4GRIA 1DRJA 3P71T 1VHQA 5CM8B 5DCYA 1L5OA 3WLOA 4XWWA 3N0RA 3HU2A 2J59A 3PL5A 5JNUA 3U3MA 3QF4A 1JT9A 1ZMOA 1XTUA 2P27A 1FC0A 2LKCA 2A4KA 3P45A 5MFPA 3QSGA 1OPXA 5IFLA 1XK7A 4UUBA 1MTZA 1YL6A 4UAGA 3EZ7A 1IK6A 4BO2A 3TZBA 1GTVA 4B9AA 2IRWA 5EE1A 2I7TA 1JECA 1F2TA 2O0JA 2BZGA 4B85A 5DEIA 4ESEA 2QTHA 2JH9A 2W4QA 4G8JA 3BMCA 5T67A 3ZQUA 3PUJA 1OT3A 3JWEA 4RV4A 5CIQA 5A9TA 1SY7A 4E3WA 4R98A 5JFOA 3RNLA 3T9CA 5LQMA 3M4NA 4A5OA 3QVXA 1RWXA 2O3RA 1K66A 3WJAA 1CUZA 4EB0A 1T2VA 1T9GR 4DDVA 2ATCA 3CPJB 4BUCA 5AW2A 1J42A 2LVBA 4GKBA 4ACAA 5C9ZA 4BJ3A 1E92A 1YOVA 1LJLA 4E46A 3AM1A 1VG8A 3CBQA 5AJXA 3LA8A 1JG3A 3CZPA 5IFKA 1I2ZA 4RK5A 1X7WB 4P4UA 2DH5A 1M6YA 2BCEA 4WY5A 2DTEA 3WB9A 4B3BA 4RXTA 1QRDA 2JS7A 2XWSA 3QKIA 1ULTA 3KOXA 1GL7A 4JI6B 1T9BA 4W5HA 1UCFA 3LHKA 3QENA 1M0EA 1RXUA 2RBEA 1LPPA 3BWDD 2E9SA 1H2XA 4KB5A 3WGHA 1NDQA 2DOKA 1Z6PA 1W36B 3D4IA 1LA2A 5FWAA 4YV7A 2PTHA 5FOVA 1LF5A 4FWIB 1D2GA 3VR3D 3LOQA 3N2KA 3R7BA 4F5ZA 1I6LA 5KVAA 1HSZA 2J3EA 4CM1A 3UAVA 5DTIA 2O8FA 1YMQA 2H07A 3GROA 4CKEB 5ALRA 2NZJA 3OOHA 4ZJPA 4HVLA 1D6MA 4JC0A 2PYZA 5EG5A 2R66A 4EK9A 4D3FA 4CQJA 1XVTA 5ADVA 1EX6A 4P4GA 4KPUA 1OF1A 4UARA 2I1QA 4AMZA 5I7SA 1WQ1R 4E70A 1KYVA 1BMFA 2WM2A 2ZJFA 4G86A 3PUYA 4KPUB 1VA5A 2O7RA 2PGIA 4MAMA 4ML3A 5L3ZA 3S29A 5MF6A 1NE7A 4JU8A 2QN9A 2HO4A 3ZX4A 1HMYA 3ZOZA 1NF8A 2AX3A 1NXSA 1ODJA 2X0DA 4XARA 3VYWA 1GKIA 3UXYA 3BE8A 1UL1X 3KLBA 4OHFA 1E9BA 1LFAA 2W8BA 2FU5C 3CLHA 3O8CA 4QXQA 5FORA 5HF8A 2BFOA 2JRLA 1POXA 2ZSIA 2J7PA 4FNOA 3SYTA 1TCCA 1E32A 4AU1A 2ADOA 3NBZC 3PDCA 4B3JA 3WA6A 4CG3A 1NC1A 2WD7B 3GU3A 4JEUA 5BSGA 2QNRA 4CG2A 2GK3A 1I94B 4Q00A 4RHUA 4U9IS 3MMPA 1OI4A 4GF5A 5FBRB 1C9KA 2FZ5A 4AUMA 3TDMA 2AG8A 4LF6B 1KYXA 3VO9A 4HGQA 3GB9A 3HB0A 2XAUA 5G40A 3SF8B 3URKA 1OGJA 4RU1A 3EW7A 1L7BA 3VISA 1XVAA 1X7XA 2UZ1B 4GLJA 4J29A 1G2IA 5TMEA 5LZ9A 4MGKR 1Y4AE 1T2FA 2JAPA 2WSSD 4L4XA 2P0YA 3SDZA 3EC2A 2B9VA 3EIXA 3UJ6A 3IA2A 3WDSA 1N5KA 4C3UA 1KETA 4LHEA 3S7TA 1UK6A 3DLAA 2PSDA 5JD6A 4M4SA 3EPKA 3FTEA 2ZUDA 2W42A 4D4MA 4QYTA 4YRZA 4J0KA 3PQ2A 3LO8A 1JI3A 4KH0A 3REOA 2IXBA 1Y8CA 1Z5VA 4Z4IA 1F8XA 4C06A 2Y2UA 4M49A 1EGAA 2BSAA 1MN6A 1YFZA 4RABA 1U2TA 2Q27A 1QHNA 4FUTA 1YJAA 1SC6A 2AFIE 2I3ZA 1M0SA 3VH3A 2WMNB 5E9QA 4BQEA 5FF9A 2NSYA 5BNFA 2G5PA 1DDOA 1T2EA 4JVLA 1KEPA 1M1YA 2IYAA 5AKEA 1W49A 3GLFA 1ZOLA 3F47A 4JJIA 4DMHA 4KIJA 1TW2A 3GLFB 1U6JA 2ES4A 3GOQA 3A7DA 4Y7DA 4F4IA 1I32A 4LJ6A 1VPTA 3IEKA 3MBOA 4D4KA 1NUUA 2XV1A</