4M22A

Crystal structure of small molecule acrylamide 16 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
160
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTARDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
total genus 59
structure length 160
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m22A00
3GLIB 4CVNA 2RCNA 3MG9A 2J1LA 4FCWA 3KFVA 3KKPA 5KPDA 1X8LA 5J40A 4MKGA 4DC9A 5HTKA 4RY2A 4FXPA 4A0RA 3CIOA 2Z4SA 5FL3A 3FHTA 4C0QC 4ZIRA 2UVQA 3TAHA 1W48A 2AHOA 1YZUA 4UNNA 4NYIQ 5J47A 1XMVA 4HLQB 4BPBA 3MSXA 3QXXA 2W2TA 2OO7A 2C8VA 2I1QA 3WNBA 1GNPA 2NQ2C 3LBIA 3QBTA 4UKDA 1TAGA 3OHMA 4AKEA 4JVSB 3CF6R 2WWFA 2ZJAA 4LK2A 4XSHA 3AP3A 4PPGA 3WRYC 2QAGB 2GBLA 1A4RA 1QVRA 4XVRA 4Z51A 2N42A 1CP2A 2ODWA 2PCLA 5KNBA 3SQWA 1OB5A 1Z2AA 2WV9A 3B2EA 4ZIRB 1P75A 5AJVB 3P4YA 2BMDA 2VQSA 2ZI6A 4UNQA 2G0NA 4PO8A 1E1RA 4ASUD 4G5QA 2FX3A 4IVQA 4ZDJA 1NIJA 1DAEA 3BFXA 2JJ1D 1N3BA 3NC1C 3BRWD 2A3RA 3CZPA 3F0TA 3FHCB 5FPHA 2ZRMA 1YR6A 5FUWA 4CEIA 5FBLB 2WJGA 1QZXA 1ZU5A 2XNSA 3I8XA 4MRNA 4IOJA 1FTNA 3LBHA 3H0KA 3CWZA 1LFDB 4V0MA 5HCIA 1TF2A 4ARZA 2WPDD 2RGNA 1E69A 1G17A 3KFXA 4TSFD 4DEXA 4X8LA 5J4YA 4PC3A 1N6NA 2JLXA 3TMKA 1BMFD 4XD7D 1VMAA 2HCJB 4FINA 4B48A 1IY2A 3AF2A 3CZQA 1H65A 2RH5A 3KUCA 3OE7D 4M22A 3F3YA 3BWDD 3W34A 5D3MB 3QXJA 2NGRA 4DRZA 2QORA 3EPKA 4Q01A 4IEEA 3U2QA 1N6KA 2IYTA 2OILA 4N1AA 3EASA 4PQYA 4TL8A 1KMHB 2SHKA 3QPVA 2IEZA 2QROA 4L15A 3B1YA 3KJHA 1KJWA 1Q1ZA 2CCGA 3K09A 4LYHA 3T61A 3TW4A 3V4RA 2HXSA 4Q9JA 3RVBA 4YDSA 5KTYA 3K70B 4QHTA 1RW4A 2J59A 2JAQA 1FNMA 2J0VA 1DARA 4ZCIA 2GILA 1XX6A 3C5HA 2ZS7A 5EE0A 2ZR0A 3ZVMA 5JJIA 1W1WA 1CU1A 1PLLA 3UATA 4TZ6A 3L0IB 4NYMQ 4R98A 1CEEA 1U9IC 4B73A 2ZRJA 2FZ4A 4HAUA 2W6JA 3U4QB 2HJVA 3EAQA 1E0AA 1HH4A 5EP2A 1BYIA 4A92A 3AVWA 1FTSA 4B71A 5LD2C 5H68A 3REGA 3Q5DA 4LYAA 4M9ZA 1G5RA 4LJ4A 3FMPB 4D26A 3KDSE 4XIGS 4OHWA 1GNQA 4PPNA 3A1UA 1AQUA 3GJ8A 2ZJ2A 2ZYUX 3QXSA 5C4GB 5J4KA 1W7AA 4GOXA 4KVAA 2O8FA 4C30A 4PC6A 4QHSA 5CIQA 3HJNA 1BS1A 2V3CC 4PXAA 1W5TA 1GNRA 3RHFA 4CRWB 4HLUC 1XTQA 2O5VA 4Q4JB 3R9XA 2YVUA 1A2BA 3TR0A 2FE4A 1QG2A 5CDFE 3E70C 1E2HA 1YR9A 1NBMD 4NU0A 3WNDA 4B3DA 2ZRGA 5JJKA 4EJSA 4H1VA 4LJ9A 3JZAA 3V9PA 1ZMXA 4IDPA 1R5OA 4QJ4A 3HU1A 4AI6A 3PUVA 1ZIPA 3MWJA 3K0AB 3IQWA 3REFA 3RAPR 4UJ3A 1KI9A 1U98A 1AJEA 1DO0A 1XEFA 1E4YA 4LHZA 3ZLJA 1Z6TA 1VHLA 3NHAA 1IJEA 2VRWA 4NHOA 1XPOA 5F9FA 4EPXA 1EX6A 4Q4LA 4X8OA 4ZKDA 4TMZA 2QGNA 4KYIB 5KNCA 2ZEJA 1XXHB 1AA9A 2IK8A 4ABYA 2XGJA 4HI0E 1H8HD 3L0PA 1IOZA 2HDNB 4LOAA 2X8AA 1DOAA 1OFHA 4HLCA 1RYHA 3EARA 3GFPA 4Z54A 1N0WA 5FTJA 4BRWA 2XAUA 3FGNA 3WP0A 2KJQA 3SJBA 1LW7A 3IHWA 4DVGA 2F43A 1OSNA 1EGAA 1JR6A 1RZ3A 5DLQC 1KOFA 4F4IA 1WE2A 1YVDA 2TMKA 1RYFA 2IS2A 1G19A 5CJPA 4MRSA 3SOPA 2YZ2A 1Z0FA 1NVVQ 4UXHA 2OCYC 1UKYA 2ZROA 3WNCA 1ZUNB 2AD5A 5TARA 2WJYA 1CULC 1KDTA 1GM5A 2O8EB 4B3XA 2CEAA 3BOSA 4Y0VA 3C5CA 1F2TA 1CS4C 1RIFA 4I4LA 1I2DA 4EQ6A 2XOKA 5GJBA 3U6KA 1TNDA 2KB0A 4DDUA 1N5IA 1M7HA 3WHKA 1N6HA 4TYNA 1NVXQ 1B23P 2R8RA 4GPTA 1F3OA 1FQJA 4Q9LA 4OKSA 3KQNA 5AK0A 4U02A 3D8BA 3MJHA 3ADBA 4N0EA 1T5IA 3T34A 4TTRA 1YZGA 2VHCA 2Z6VA 1G3RA 2FEMA 3G0HA 1VCIA 5HPYB 4HDCA 4PQRA 1SGWA 1F2TB 4W5WA 2D7CA 2QMHA 1UDWA 2WJJA 1CR4A 2JASA 1SKYB 4P4UA 3LWNA 4QBHA 3CX6A 3MAAC 1N6IA 3UG7A 1BIFA 4TLBA 1U81A 2ZRKA 4KBGA 1KYIA 1KK1A 4V0LA 1Z6AA 4LDJA 1I4DD 1QG4A 3GFOA 3TK1A 3OIUA 1A7JA 5JRZA 2ZRFA 3HPRA 2XEXA 4CEJB 2JLWA 1QHGA 3QVUA 4D4LA 3TW8B 4KFSA 3U6BA 3THWB 2DWOA 5EQTA 4GL2A 3R7WB 2REOA 3RS0A 2QPTA 3GEHA 4KCGA 4GDFA 2RMKA 3I4LA 1XTJA 3A8TA 1TF7A 1FX0B 3B1XA 4DUGA 2CDNA 2QNRA 4YMTA 2W2VA 4UNPA 3Q9LA 2IYSA 4I1SA 2GEUA 3SHWA 1ZINA 5BN3A 3V4FA 3GPLA 4GZMA 3IKJA 5FPYA 4Q48A 2AK2A 4P32A 2QG6A 2YC4C 5LPNA 1T0HB 1XZPA 1W2HA 3BB3A 2QGZA 3LA6A 2V7QD 1IY0A 3AF4A 2EFGA 4WXRA 1DPFA 4DHEA 5AUPB 2CE7A 4N3NA 3IPXA 2CLCX 5CDFA 4F91B 3GJ3A 1HUQA 4HB0A 4HDQB 5EP4A 1OE0A 4GI7A 2IUUA 3KQKA 3DPUA 1D5CA 2D06A 5IF9A 5SZKB 3QENA 4HAWA 2W6IA 1Q1BA 1VG0B 5CLQA 3DM5A 1ZC3A 3ADKA 1GTVA 3TUIC 1G7RA 3FTQA 1GG2A 4I81A 1ZIOA 4LJ8A 4NCKA 3MUFA 3BD9A 5BN5A 5EZ6B 1CR2A 3Q7PA 1G18A 1KO4A 1HA3A 4M9SA 4A0GA 2IF2A 3SQXA 3IBGA 3W8RA 4UXIA 4L5BA 1K8RA 1X8KA 2F9LA 5DIFA 2H7VA 4PTLA 3W8NA 1G7TA 2WWHA 1ZUIA 2BMJA 1GP2A 3LD9A 4ITRC 5AUOB 1WBBA 2PEYA 2IYZA 5JWOA 4NBSA 3TSWA 3UPUA 3RRYA 3K0CC 3NTUA 4XD7A 3T35A 2AL7A 1RVDA 1KI1A 4A8JB 2F9MA 2ZXUA 4XWAA 1D2NA 4J0QA 3AVTA 4C2TA 2XZOA 1DADA 1COWD 3EC1A 2D74A 2IXFA 4BLTA 2D2FA 1U99A 3K0SA 1QHIA 5EUMA 1VYTA 2FFBA 2QT1A 3SR0A 4DB2A 1X86B 5K8UA 1KNQA 4JBYA 2NO1A 1AGPA 1ETUA 1UF9A 2X2EA 1JR3A 1P4SA 2HUPA 4TT3D 3IHLA 3VHLB 2ZYWX 1NL3A 2YJTD 1G3UA 1T5LA 4GMDA 3RLFA 1PUIA 1Z3IX 3W6NA 2ODEA 2DPXA 4QBGB 1EESA 1W0KD 1VYUA 4A2WA 3K70D 2F3RA 1G7SA 3PQCA 4BFXA 2ZUDA 4G1UC 2EW1A 5DI3A 521PA 3WMGA 1FFHA 4AIIA 1YKSA 4P31A 2P0EA 1P2VA 1ZCAA 3A6PC 1GRRA 2ANBA 3K1JA 1W46A 2WOJA 3FFAA 1P9WA 1W44A 4JL8A 621PA 5B30A 1XB2A 1ZVQA 4KVGA 5JWHA 4JLJA 4WOPA 2HLDA 5KSPA 4LHYA 5AUQA 3SJCA 2O52A 2Q3MA 2REBA 5L8VA 4Q00A 4P4SB 3CR7A 4DWJA 4QGAA 1D2MA 1YZQA 2OBMA 1KMQA 3K0FA 1Q1QA 4B44A 2WBLC 1ZNZA 5BXQC 4B43A 4R9UC 1OJLA 2BC9A 1QHXA 2QAGC 3MCAA 4HDOB 5KSZA 3DO6A 1E9AA 4MYUA 3X1ZA 2PH1A 4L9WA 1P62B 2J7PA 4M21A 3TNFA 3ZGXA 5HKKD 2ORWA 3A58B 1G9XA 1DO2A 2VP4A 1JPNA 1XD2A 1FNNA 3QI2A 4TL6A 5JBQA 3U5ZB 2QMUA 4JLBA 4NCJA 5CM9C 2OLKA 1Q21A 2O8EA 1N5KA 1KDOA 2AXPA 3ZQJA 2ZREA 5HE9A 1H8ED 2Q9CA 1P60A 1TUIA 1E4VA 2QTFA 1IM2A 4NCHA 3SEAA 3W5JA 4E22A 3EWAA 4AKHA 4S35A 2EFEB 3CPHA 1BYUA 5CYPA 2GBLC 1JB1A 1CIPA 4DLXA 1E1RD 1C9KA 1G5TA 4FWIB 1E2QA 2RB4A 2VSOA 1KSHA 4FD2A 1JBKA 3RRNA 3GLFA 1S1MA 1UKEA 1XRJA 2QE7D 3RC3A 4OQMA 1HQCA 5DHFA 1VG1A 4DLRA 3CPEA 1EWRA 5EXPA 1Z08A 4KLNA 2WWWA 1D9XA 1Q22A 2P2LA 2DCUA 3DKVA 1CR0A 5DHAA 1S9HA 1HEIA 4PZYA 4IDQA 5IK2D 5JEDA 2IYVA 4MGIR 3G5UA 3EPJA 3WBKA 3PUYA 1L4UA 2RGBA 3C14C 4MYCA 4XJXA 1MOZA 1F48A 1U0LA 5EXTA 1TQ4A 1KI6B 2ZSEA 3VR4A 4ERNA 1JQLB 3EWSA 4EPTA 3TR5A 4BQSA 3GLFB 2HF9A 3IIMA 2DBYA 2OZEA 4OYHA 4XTRA 1O3YA 3FOZA 1OFIA 2IF0A 3J81k 3N70A 2WWIA 3LY5A 3THWA 5HZHA 4G5OA 4EIWA 3U61B 3GLGE 1M2OB 3ZD7A 4W5HA 4KJZA 1NN5A 4BE7B 1R0YA 3LXXA 1NF3A 1OH8A 2GHIA 3BIFA 3NVAA 4XOIA 2WWYA 3EA0A 4TTQA 3UANA 1DE0A 2JDID 1VCOA 2FNAA 3QNUA 4Q7JB 2RGXA 3WMFA 2UKDA 4DCUA 1TQDA 5BWMA 2ZE7A 1PZNA 5E4FA 1QDEA 4A0FA 3TJZA 1UBGA 2XJ9A 4IOMA 2OBLA 3EXAA 1W4AA 2O0HA 3QE0A 2AR7A 3ND8A 2GK7A 2ZRHA 4L16A 3FB4A 3K9LA 2MSEB 4C0AC 4CW7A 2ORVA 5JHGB 5KHOC 1NN3A 3QEOA 2RGEA 4QNMA 3UKDA 3RS7A 1XEWX 1QBKC 4IOKA 1E3MA 3OIVA 3AM1A 3JZMA 4UNRA 2XB4A 2ZRPA 3PUWA 4UQOA 5E7JA 3EPHA 2QPAA 4NCIA 2QPOA 3ZD6A 721PA 2B92A 5LDDC 3OE7A 3NG1A 1KJYA 5DE3A 1G7CA 1DG3A 2EFHB 2V6IA 2C95A 1OIXA 4GNKA 4V0KA 4LBZA 4L8GA 4TMXA 1SHKA 3AV0B 2IBMA 5FTMA 4B2PA 4JBWA 2KBFA 1SVKA 3FWYA 4R7ZA 3I92A 3LLUA 2GCOA 4DZZA 5JI3E 5KPJA 2V54A 1Q20A 4B6FA 2C04A 2MMGA 1E9BA 1ZUHA 5EXSA 3K9HA 1BOFA 4KLZA 5BN4A 4OQFA 1VPLA 1G16A 4A4DA 2CVHA 4HLUA 4OK5A 2CJWA 4KV9A 4PSKA 4DUGD 1E32A 2BBTA 4NYIR 2QBYA 1NJGA 1G3MA 1W4BA 4M0LA 1R8QA 2FFAA 3VU9A 3ICQB 4QFMA 5AJZA 3GLIE 2BIFA 1GL7A 1ZW6A 4D4MA 1KTVA 3MGCA 3T1VA 2FGKA 5FUYA 2ZSFA 4I99A 5A4JA 3LLMA 3LDAA 2FH5B 2NZ8A 2G88A 2VA8A 2B8WA 4Q4AA 4JJZA 3I61A 1IN7A 1HTWA 5FH9A 1V43A 2CL6X 3WP1B 4O25A 1GFIA 3F8TA 2ZYTX 1MABA 4Q1CA 4C7OA 2WOOA 2ZJZA 2K5UA 1HT2E 4D4KA 1P2TA 2OT3B 1JR3E 2XTNA 5B2ZA 4PC2A 3KTAA 3SDZA 4BFUA 3NXSA 4RZ2A 2RKOA 3A1TA 2DFNA 1NY5A 5DI3B 1G20E 5KDLA 3T12A 2REXB 2F55A 2B21A 2ATXA 3QKRB 3GLFE 2GEVA 4TQUS 4IFEA 4F93B 1ZJ6A 4HATA 1AS0A 2NG1A 4FMDB 4XVQA 4ZDWA 5DYGA 5KNDA 2BKEA 3GJ4A 4LPSA 1EFRD 4OHYA 3U7EB 1ZD1A 3UWKA 5JSZA 2BBSA 1KDPA 2VP2A 4FCTA 2FG5A 3B82A 4G0NA 3VHXA 2ASEA 1VG8A 2CE2X 1N0VC 2J0UA 4M53A 4O2RA 1Z0KA 2MMCA 1TEVA 4KFTA 5EZ5A 4B34A 1LTQA 2C9YA 4GP6A 1HURA 1J8MF 1WXQA 1XJ0A 2C99A 5FOVA 4B35A 1P9NA 1EFUA 5FBVB 2N1BA 3EW9A 3JVUA 2QM8A 1OB2A 2PLRA 2A5GA 2GAOA 4QBIA 1SKYE 3SNHA 4QKQA 1GVNB 1RKBA 1NY6A 2FZLA 1Z5ZA 1JPJA 2ZRDA 1NN1A 3BK7A 1TMKA 4B2IA 4YMVA 4BGDA 5M04A 4BECA 1PJRA 2QTHA 3U7HB 1OXSC 3GLGA 3S1AA 3BFKA 2GNOA 4NCNA 4XSGA 2NIPA 1UEIA 2ZSAA 3SZRA 4R71A 3EPLA 3H86A 1E79A 3T06B 4AYTA 4MGYR 4WA7A 2HXYA 1L4YA 1VIAA 2UZIR 4HZUA 2VYFA 1MO5A 2P5TB 2Z43A 3DKPA 4MA4A 1Z06A 3LBNA 2BKUA 4C9BA 2XZPA 2OXCA 2OSBA 3R20A 4HUQB 3RRMA 4AK9A 4Q9IA 4JVNA 1E2GA 1Z2CA 3MWLA 1GL6A 4DLTA 3OEHA 1E2EA 3OEEA 3LVRE 1YRAA 1G6HA 3QXCA 4FMCF 1OXXK 3KJEA 3Q85A 3IGFA 2W83A 3EIHA 5FI1B 2X1VA 1KZ7B 3LAWA 4FI3C 4BLOA 5JEEA 4CT5A 1K5DA 1KO8A 1ODFA 1KY2A 4Q66C 3PITA 1YE8A 3K9GA 4YXWA 3FMIA 4U00A 3RDPA 3ZIAA 4GBMA 1DEKA 5JFGA 2A2ZA 4XVUA 2H57A 5JLJA 1XD9A 1XD8A 4URWR 5KDOA 2O0JA 5IHPA 2IT1A 4LJ6A 2HLDD 4M9XA 2IL1A 3PG5A 3SYLA 3AGQA 3H1TA 1S0UA 2VP6A 2C96A 4JKIA 4TYQA 4F4JA 3Q7QA 3WYGA 3B1WA 4OJKA 4TN1A 5KO2A 1NJFA 4CEHA 5JI2E 2A7QA 3VKGA 1Z6YA 3ZYCA 4IHQA 1JJ7A 2FA9A 1KAGA 4JLPA 5AR1A 2KSQA 1N2CE 1CJKC 2JIZD 3ADCA 2IYLD 1E0SA 4L4UA 2IYWA 2ZS9A 2AFIE 2WJHA 4Z8XA 1ZBDA 4C0HA 2BVNA 3CW2A 1XF9A 2F1RA 2MSCB 2DY1A 3I8SA 4JYBA 2WJVA 4A9AA 4MUAA 1KAOA 4C2UA 3NEYA 6Q21A 1E79D 2ZM5A 4PAMA 2ATVA 1Z0IA 3EZFA 4DLYA 1LF5A 1ZM4A 1F6BA 1IBRA 5FBWB 1NVVR 3T1QA 4P3YA 1PLJA 4K81B 2QP9X 4AYWA 1JAHA 1CXZA 4E03A 4PZZA 2VSXA 3TVDA 1V5WA 4D2IA 3HU3A 2ZI5A 3QKSA 2LKCA 4AY2A 4JLNA 1R4AA 3CX7A 1BKDR 3KX2A 3CX8A 1T6NA 1AS2A 3QKUA 2EWVA 1E2NA 1I2MA 3GFTA 1MO4A 2EYQA 1DAIA 4BLRA 1SXJA 2ODNA 1ZNXA 4US1R 2PZEA 5JS8A 3P4XA 1L8QA 3HYTA 5JCPA 3M0EA 3FMOB 1W49A 3ZZTA 1E9EA 3GQBA 4PO9A 5J4HA 1WBDA 2DFKB 3T5GA 3ZVLA 2V4ZA 2WAXA 5TMPA 4GFDA 4U5XA 3OESA 2IWRA 4D25A 3X1XA 1TQ6A 4TMVA 4IEIA 3TKLA 5L3SB 2CJWB 1VDZA 5D3QA 4KFRA 2OBNA 4LC0A 5LB2A 2W6ID 1KGDA 4GOJA 1XXHE 2V8OA 1XJQA 1T91A 4P4TA 2BM1A 3CNOA 1CF4A 1NMXA 4LSGA 5FOTA 2FEOA 1VCMA 1GKYA 1G5PA 3QIAA 1YR8A 4D0LB 3B9QA 4R2HA 2VH5R 4OK3A 4Q1BA 1CJTC 1YZNA 3SE0A 1P73A 4ZCLA 3HWSA 2BCGY 4OQXA 1G64A 2A30A 1E0KA 2O8CB 4DCVA 2H5EA 3BGWA 4HEJA 1GRNA 2OHFA 1KKMA 1R5NA 3CH5A 3DZ8A 5H70A 2R6GA 4CEIB 2IX3A 3RSOA 1UKZA 2ZU0C 2HCBA 2ZANA 1M74A 3BBPA 3I72A 3KZ1E 4PR0A 1B0UA 2W58A 3PVSA 3SFVA 3OFNA 3ZIAD 5LBIA 4G5SA 1SVOA 3L0OA 1A2KC 1S96A 1T8UA 4HAVA 1XMSA 4YMUA 1XCPA 2WKPA 3KKQA 4IJMA 4LV5B 3CNNA 1SZPA 3C7KA 1P3JA 3BH7A 3QPWA 3K70C 2P65A 2H16A 1KY3A 1Z22A 5G41A 5TXGA 2V1XA 5SZIA 4PHFA 2ZE5A 3PIRA 3CBQA 3UXMA 4KODA 4V0NA 4A6XA 1FQKA 1H8HA 5CK5A 1AM4D 1IXZA 5C4MA 5KOYA 4HB4A 1U9IA 4QBFA 1GZSA 5FR2A 1CRQA 4R2IA 4JMPA 2WMNB 2IS1A 1EXMA 2EU8A 1JXMA 2XTZA 3UG6A 3LH5A 4D81A 2ONJA 2O0KA 3VR5A 4HYYA 3FE2A 1KIMA 3OZXA 5DYIA 2ZYVX 1UBEA 3VQTA 5EJEA 5FOWA 1T8TA 3C8UA 1HYQA 1OH5A 3CRVA 2GCPA 4FCVA 2ERYA 4TLAA 5TV2A 5AUNB 1PV4A 4MITA 4JSYA 3MFYA 4LHVA 2F3TA 2FFQA 2VP0A 1OF1A 4DT1B 1E2IA 4BFSA 5HR5A 3RABA 1TF5A 1WA5A 2VO1A 2BCJQ 5EP1A 2F7SA 821PA 4M1MA 4EUNA 8OHMA 2QEQA 3CLVA 2PBRA 2R2AA 4PANA 4DCNA 4HUQA 1IN5A 1D8TA 3KB2A 1X6VA 4MDEA 2V1UA 3ECCA 2ZJOA 1UDXA 2QENA 5DISB 1M6NA 2BHRA 2JJ2D 2WWGA 5C1BA 1RRCA 2ORIA 2ZE8A 1N6LA 3SS8A 1F2UA 5CM8B 1HY3A 4LBYA 3B6EA 4DSUA 4MUBA 1EFCA 3LQQA 3NWJA 5F9HA 4NYJQ 4NDZA 4V0OA 3CKLA 1T0JB 1US8A 4IDOA 1G6OA 2IYQA 5EE9A 5G3YA 3VAAA 2AFHE 4TYYA 4X8HA 4DT1A 1XEXA 1FOEB 2Z4RA 4FMDF 3DOFA 4AWXA 3VNUA 3SHFA 1QF9A 2ZSDA 1IY1A 2GVDC 2J3EA 3H2YA 3IILA 2FGJA 2PEZA 3CONA 2ZSBA 1W36B 1E2LA 3CUEF 3EIQA 2WM9B 3E1SA 1IN8A 1XWIA 4JT4A 5BYJA 3PFIA 3L2OB 4QL3A 3BXZA 4A0HA 4RD3A 4JKYA 3K9NA 4QRHA 4JBXA 1PLKA 3HR8A 5CYOA 1P6XA 2JATA 5J5CA 1E1QD 1AK2A 5TDHA 2GJ9A 1LS6A 4QM6A 2D62A 5J4VA 4KFUA 1XPUA 4BLPA 1LVGA 5EE5B 3CF2A 1IAQA 2VTKA 4DJTA 4DLSA 1XXHA 4LWZA 1N5JA 1OYYA 4JLMA 4ON9A 1DVRA 1NVUQ 4A82A 1RJ9A 4MKFA 1T3SA 3ZDQA 2XB2A 2KBEA 3AF1A 1UJ2A 3VR2A 1E2DA 1TU4A 3GJ0A 3AQ4A 3DMNA 4RFVA 2GJSA 2Q6TA 5G53C 4OHZA 2P6UA 5GJVC 3EG5A 3QKSB 3MWKA 1FUUA 5KDDA 3LXRA 3ZJYA 4EDHA 4E09A 3D3QA 4BLQA 1EG7A 1Z63A 2Q3FA 2WSSA 4BFVA 1WB9A 1D6JA 1VTKA 5CB8A 4URYR 3KXIA 1JR3D 3R8CA 1IN6A 5HZKA 2OESA 1RJ9B 3BAFA 4K8OA 1OFTA 2ZQ5A 4BWYA 3KJIA 1DAGA 2GZDA 4B6EA 1M8PA 5ELXA 1ZM7A 4Q1DA 4QC2A 2OG2A 1BMFA 3FDIA 5L3QB 1ZD8A 4D80A 2RGGA 4TLDA 4ESHA 3N5CA 4EFNA 2AXNA 4M2LA 5IT5A 2OFXA 1XDBA 2VL7A 5IK2A 4GZLA 1WF3A 3NKVA 2VEDA 4EFMA 4HB2A 4DXAA 4C0BA 2PLFA 2RAPA 2FOLA 3RSLA 3THXB 4YC7A 1N6PA 4CGZA 2PX0A 1E0JA 2VSFA 2JLSA 2QI9C 3IO3A 3KJGA 3KUDA 4IKEA 2G1KA 2DR3A 2QAJA 1ELOA 1MH1A 3IQXA 5FOXA 2CXXA 4IRUB 2VLIA 3BC1A 4HZIA 2O8CA 2IYRA 2NPIA 5D3MA 4PPFA 5L3QA 2W2XA 3UK6A 3DOEA 1AZTA 1KK2A 1RE0A 2IC5A 3PENA 4M4SA 2FSGA 2XSZD 4RCZA 4Z8YA 4DCTA 2R6AA 3QUSA 1NN0A 4PX9A 4V0ME 3O47A 5DGXA 2J87A 5FUVA 4US2R 5HCNA 5JMTA 2GF0A 1Z6GA 3N2EA 2E1RA 2GXQA 2EFDB 2HT6A 2PT5A 5IDVA 3WRXC 1I4LD 4A1FA 1Z8FA 2QTVB 3B8HA 3I62A 3SYNA 4EJSC 4Y0AA 2P5SA 2OUKA 3AKYA 5JZVA 5FTLA 4BZQA 4KSBA 2LCFA 1L7VC 1JALA 1FUKA 1JQJC 4MRPA 2NO9A 2ZAMA 2AWNA 3I32A 2VHTA 2BEKA 2PJRA 4JVMA 1MO3A 2WAYA 1EFHA 1E2MA 1G41A 2C98A 3THYA 2GWHA 1UM8A 2JA1A 3EZ7A 1JEDA 1E1QA 3RS4A 5ANRB 4Z1MA 2GJ8A 3X2SA 2ZUCA 2ZTSA 4G3XA 3B60A 3AVVA 3U60B 3A4MA 4KAXA 2OCBA 1DAMA 4FWTA 4QG7A 3AKCA 4O0MA 2YOGA 4JYCA 3ZVNA 2X19A 1S2MA 1CTQA 3BERA 4DIDA 2NOAA 1KO5A 2O8FB 3PCRB 5F3WB 4CYMA 4KBFA 3QY0A 2BBWA 5K8LA 2MSDB 4WW0A 5GVRA 5P21A 1G8PA 1SVWA 3Q5EA 4QGHA 1KK3A 3TH5A 3WHLA 2J0QA 1NNEA 2F1HA 3UMRA 3HR7A 5FFMA 3WYAA 1WRBA 4DIEA 3QXHA 2GCNA 2GA8A 1NMYA 3PR1A 5DO9A 1R7RA 4IOLA 3QF7A 2IW3A 4A36A 2FPLA 1JXOA 1XTSA 1E9SA 2BMFA 1YU9A 3VR1A 4ACAA 2XXAB 4TZ0A 2IXGA 2WVJA 2J46A 2B7BA 3Q72A 3W3ZB 4MYHA 3AGPA 2HJGA 1M1YE 1US8B 2ZIAA 3K0AA 3UIEA 4OHVA 1NG1A 3A4NA 1XCMA 1DS6A 1P2SA 1XEXB 4OI2A 5FOUA 3TQFA 1YHNA 4A8JA 3U4QA 2PT7A 1C1YA 1E94E 3X1YA 2ERXA 4OBEA 2PZGA 3TLXA 4YONB 1BO6A 1MR3F 1C4OA 5F2EA 3NH6A 1AGRA 4OI1A 3VFDA 2A5DA 3EZ9A 1Q0UA 4M1OA 1E99A 3ONWA 2ZI4A 3GCGA 4M1WA 2RHDA 1R5BA 2ZVQX 3NH9A 3R8FA 1K5GA 4RD0A 1OLOA 4KI0A 4LC1A 3AVYA 1DTSA 1KK0A 5KSYA 1AZSC 4D82A 5CJ2A 4NE2A 3IDQA 4B75A 1K6MA 3PV0A 1JNYA 2DWPA 4PSVA 1P72A 3CRQA 4DDVA 1E2FA 1X3SA 1NRJB 2ZRBA 3NBFA 2CCJA 4Q4JA 1W0KA 3O8CA 1S8FA 1N6RA 1T3HA 3KXLA 3TSZA 4RD1A 1LB1B 5C18A 1Q3TA 4C4PA 1G8FA 1KHTA 3AH8A 1JJVA 2H17A 4OJQA 1NBME 4LCBA 3VR6A 4CIDA 4DSOA 4C0LA 2ZJ8A 3QG5A 4PAOA 1P5ZB 5DN6A 1KO1A 4HAYA 3ZZUA 4WIAA 1Q12A 3IPYA 3RWOA 1FMLA 2AKYA 3IEUA 3X1WA 1SXJE 2W0MA 4HLDA 2R44A 3GLIA 2FSIA 2IA5A 1KZGB 3PXGA 3E5HA 1T3LA 1NLZA 4JL6A 2GAAA 4V02A 2O8BA 4F38A 3QQ5A 1VKJA 4LUCA 1CKEA 2G0TA 2EVWX 2EFCB 1EX7A 1II0A 3NBYC 3M4YA 2BM0A 5CK4A 4X8MA 2A5YB 2F43B 2FFHA 2OM2A 4TT3A 2Z5FA 3OEED 3GJ7A 3OEHD 3V00A 3NBZC 2YOFA 2YHSA 1TUEA 3D6TB 3D7MA 3BH0A 3AVOA 2AKAB 2BMEA 4DLWA 1W36C 5FBQB 2QAGA 5HE8A 4XTCS 2J0SA 4GRAA 2FPMA 1FPMA 2JLUA 1D2EA 4Q5IA 4CEJA 1ZCBA 2HT1A 1YZLA 3U3RA 1UFQA 4G5GA 1GOTA 4ZCMA 1KO7A 3R7WA 1XTKA 2CBZA 4YLGA 3VX3A 1CJUC 1VG9B 2X2FA 4RKFA 1J7KA 2AK3A 5AWFC 4HSEA 1FX0A 1M7BA 1QHHA 3ADDA 2ONKA 2XOKD 2C9OA 3FYHA 3SBDA 2J45A 3B85A 3TE6A 4A15A 2OV2A 1A82A 3AP1A 3LQRA 3L43A 4FMBB 2CNWD 1KI7A 4IVPA 2NO7A 4DDWA 3VTKA 2A78A 4TTPA 4PHTA 2VPPA 3MLEA 1SVMA 3EIEA 3VNVA 2NPFA 3W3AA 3C4JA 1ZAKA 3ND9A 4URVR 2HEIA 3P32A 1E96A 3QPUA 2CL0X 3A1WA 4RZXA 4ZKEA 5JS7A 4ESVA 1QHHB 2LWIA 1AKYA 1H8EA 3O8RA 2B6HA 2JLVA 3THYB 4OHXA 5JECA 1DG1G 3FKSD 2G3YA 1J8YF 221PA 2NO6A 1G3IA 1Z6XA 3W9YA 1EWQA 1KMHA 1GRQA 2GEDA 2XZLA 1WMSA 1XTRA 4QM7A 2FU5C 4IXMA 4URUR 3NBXX 3FKQA 2NMVA 1NIPA 3I5XA 3HDTA 4KYUA 2W0SA 2OEPA 3P27A 1LNZA 4B3FX 4AC9A 1W5SA 2H8KA 3M6AA 1YR7A 3RNLA 1Y3AA 3BORA 1A1VA 4D0NA 2JJ2A 2QU8A 3A36A 1T4GA 3DDCA 2ZVPX 3IBYA 1FL9A 3NIBA 3FFBA 4TMKA 4Q9KA 2BV3A 1KKLA 4IXNA 2X77A 1P9RA 1F5NA 1OXUA 4OQLA 5JJLA 2IUSA 1U0JA 4P33A 5FTKA 1G8YA 2JGNA 4A6PA 4M8NE 1NI3A 2E87A 2OXRA 2DFLA 2UZ3A 2XNDA 3RC8A 2R65A 2XXAA 2QSZA 2PJZA 3H84A 4LBVA 4LV8B 4MKHA 1CLUA 2E9SA 4TLCA 2XJ4A 2C5LA 5K8IA 3FHOA 5SZJA 3PJRA 5GJWC 2O8DB 1U94A 4WZBE 2P3SA 1GSIA 3HU2A 1M34E 4D4JA 1EFRA 4H9GA 3U7FB 4E07A 3PUXA 4PFSA 2L0XA 3K0EA 1R0WA 4A2PA 2YV5A 4LY6A 3VU9B 1XCGB 3GP8A 2Q9BA 4UJ5A 3TQCA 1Q1EA 4YXWD 1NP6A 1W0JD 1OH7A 1YZTA 4PZLA 2RGDA 2W00A 3R9IA 4OI0A 3MMPA 4Q7MB 4EJSB 3U44B 2QRZA 4M9QA 4OK6A 1ESNA 3AKDA 4Q7LA 3PEYA 4WXPA 3OF5A 4P4SA 4EPVA 4ZV4A 1FZQA 3NHBA 2I4IA 1IJFA 3SBEA 4QJ5A 4QGGA 3GD7A 3AVXA 4JLKA 5EP3A 4FN5A 4AKGA 1KI3A 1IXRC 1Q3HA 2GDJA 2YOHA 2FWRA 3F5FA 4URZR 5E3HA 3BH6A 1O87A 1GL9B 2FV8A 3B7GA 4RJLA 2CL7X 2WKQA 1Z28A 1OPXA 2FDCA 4QJ3A 2A9KA 2PX3A 2IEYA 1XPRA 4BLSA 3Q3JB 2VF7A 3U7GA 3IEVA 4W7SA 2FF7A 2ZJYA 2IYXA 3GLHE 3KXKA 3VR3A 2ZETA 4LGMA 4NPHA 1RC8A 1Y63A 5KU1A 3A1SA 2A5JA 1KSJA 2IXEA 1T9HA 4BEBA 1NBMA 3P1JA 1TPZA 4ZO4A 3HPQA 4TL9A 4IDNA 4JLVA 3VMFA 2Z0MA 1Z29A 2R9VA 1IHUA 4MDFA 3GJ5A 3IIKA 4Q1EA 2O8BB 3BE4A 3AUYA 4EPYA 1MRSA 2ZU6A 1E2JA 2OE2A 5BW8A 1OIVA 1QHYA 3FPAA 1PVOA 2CMKA 4WVFA 2WPDA 1Z83A 2BBOA 3ZQ6A 4EQ6B 2Y8EA 4DLUA 1JECA 3C15C 3TGPA 1ZRHA 2GJAA 4N0DA 121PA 3K0FB 3B9PA 1NG9A 3LRPA 3KB1A 1AS3A 1S3SA 2FMXA 4JIMA 2P6NA 1W2GA 4L9SA 1FW6A 5JCZA 2Z83A 3QVVA 4B74A 1EFTA 4JLOA 2QMOA 2GRJA 4LX0A 4B3GA 3SC3A 1E9CA 2R6CA 3AF3A 1JEEA 5CIWA 1GUAA 3CB4A 1UPTA 1DAHA 3B1ZA 1W4RA 3PEVA 1ZM3A 5FPKA 2NO0A 2GZAA 5JRJA 3G82C 4JT2A 4TQAA 3WY9A 2HV8A 1NKSA 4UNSA 3U3MA 2ZRCA 2R62A 1P61B 4MQBA 2I3BA 3K53A 5E95A 3EX7C 4C0SA 2WIAA 4POAA 5EE1A 4DEYA 2OCPA 4ZI2A 2XITA 5UKDA 1PUJA 4CT4B 1ZM2A 5GVSA 1R10A 2JLQA 3DZDA 4PHGA 3W5IA 2QP4A 3DVLA 4LHWA 4BEJA 4JZKA 2V9PA 3QKTA 1FP6A 2BJVA 5C46F 4CEHB 1R6BX 3B1VA 2OAP1 4LYJA 3M1IA 2R6DA 3QF4B 5CB6A 1KJZA 4F92B 3QG1A 3FVQA 2FSFA 4Q4HA 4P0TA 2JLZA 3T1OA 4JJKA 4IDHA 4F7WA 1QHSA 1FP7A 1ZU4A 5FI0B 1KI6A 1HE8B 2R6FA 2HYDA 3T5DA 1N6OA 1QHNA 3W6PA 3P26A 4RD6A 2GVZC 4W5JA 2CHQA 1NLYA 3LFUA 4RD2A 1DBSA 5G3ZA 3SJZA 2CLDX 3T1TA 3GEIA 2VIIA 5TVKA 1KI2A 2KWIA 2ZI3A 2RHMA 3OAAA 2BOVA 1XBTA 2WICA 4XWKA 4NONA 1GKIA 4E5UA 2QL6A 2IHYA 4EFLA 2GCOB 2QE7A 1WQ1R 3B78A 1SQ5A 5KYKA 4TMTA 4Q4HB 4LJ7A 1HV8A 1WCV1 4CDGA 4TLEA 1G3QA 1X8JA 3RS2A 5LD2B 1XP8A 1ZNWA 4LBWA 3X1DA 4KITB 2AWOA 2C03A 4LRWA 2QBYB 4TYWA 4HAZA 1N0UA 2B8TA 1R0XA 1XZQA 4BZPA 1SULA 1QVAA 5FL7D 1XMIA 5KUTA 1GDDA 4EPWA 3AVQA 3A4LA 1F60A 3NEJA 3I1FA 2QUZA 3SI7A 2H92A 4WZAE 1JI0A 4LV6A 3I3SR 3HP1A 1U8ZA 1U90A 2BEJA 2O8DA 1NSTA 3D31A 1TU3A 1GWNA 4M1SA 3THOA 2JCSA 1NMZA 2C78A 5FOSA 3WMEA 4KXFB 1J90A 1BH2A 1Q57A 3QKRA 2AX4A 1S9DA 4HAXA 5DSZA 4XH9B 3ICEA 1TX4B 4MRVA 1II8B 1XEWY 2WHXA 5DI9A 4YDHB 2YNMA 1D9ZA 1GITA 1N25A 2ZR7A 1UEJA 2IUTA 3PEWA 3K0CA 4Q18A 3U44A 3LW7A 1G8GA 1ESMA 2KI5A 2JDIA 5TB5A 5JSZB 3SN6A 2GJKA 2WIBA 4B47A 5CLLA 4FMCB 5FBRB 2IS6A 4Q02A 5C2JB 1HT1E 4JLDA 3HYRA 3MRSA 3GLHB 5LB4A 2J9RA 1S3GA 3LVQE 5SZHB 4DSTA 1UAAA 2DWQA 4PHHA 1HE1C 1IONA 1OXTA 2QN6A 5AJWA 1II8A 5GADl 2D4HA 3AF0A 4K46A 3JVVA 4MRRA 1KDRA 4FW9A 3R9WA 4Q03A 4CF7A 2VP9A 2ZRIA 2GXSA 1E9FA 3UMFA 4NL4H 4BUJA 1J99A 4Q4AB 421PA 2WSSD 1OYWA 2CVFA 1NSFA 1IXSB 1X1RA 1MT0A 3CRRA 1MABB 4C7OB 4WAUA 1P7CA 3CNLA 4ZPXA 3QSYA 2QQEA 3LW8A 3GLHA 4PSAA 3GJ6A 5FR1A 4AYXA 4US0R 2ZI9A 3CRW1 4ZI3A 3PUZA 1XD2B 2WWXA 3RS5A 3AB3A 3CPJB 1UADA 5FPSA 3RRZA 1SVSA 4JS0A 2V6JA 3RANA 1IQPA 1VECA 4KHZA 1QRAA 2VF8A 2QM7A 1U8AA 3OAAD 3U3OA 3KQUA 1NLFA 3PEUA 2D7DA 1TEXA 2IWHA 1R0ZA 1CJMA 3EZ2A 2JEOA 2QA5A 2OLJA 4I1OA 4LJYA 1N5LA 4WBSA 4B76A 2ZS8A 4GOKA 4QHYA 1MV5A 3NDPA 1GAJA 2G9NA 1OKKD 3LNCA 1LF0A 2AN9A 3E2IA 2QRNA 3GEEA 1ONBA 3GJXC 3A1VA 4O3MA 4PC1A 2PCJA 2QSYA 4YMWA 1TQ2A 1SVIA 2VP5A 1Z0JA 2GKSA 5B57C 4OL0A 2G77B 5H1YA 1DAKA 3EA5A 2OCAA 2V55B 5J4LA 2XSZA 1CBUA 1S1CA 1VHTA 2P67A 1HQYE 3TUZC 2F1IA 5H8WA 3TVTA 1ZM9A 3S1AB 1G1MA 2OAQ1 4Q7KA 4QOSA 1GKUB 1EK0A 1RRFA 1XTIA 4M1YA 1GILA 3LO5A 1Z47A 2GESA 2YC2C 4JVLA 1AKEA 1SHZA 3DHWC 5DH9A 2WMOB 3ETLA 5EUQB 4DLZA 5DNYB 4HZUB 2QY9A 3A37A 4BFYA 4AURA 3QJYA 5A0FA 1E2PA 5A5GA 2YWHA 1OW3B 1ZYUA 2VBCA 4BFZA 3QOFA 2ZJBA 2EQBA 3MWYW 2DYKA 2ODBA 3T15A 2PL3A 3VKWA 1YRBA 4B3BA 4CZ2A 1SXJD 1TL7C 1J2JA 2IHBA 1E6CA 3Q8XB 3QF4A 4WZ6A 4S2EA 1E9DA 3IUYA 1P2UA 2Q0HA 3VX4A 3BJIC 2VHQA 1M7GA 2YWFA 5JHHB 4AD8A 3KQLA 3TSOA 3BFVA 1Z07A 3CWQA 4JLAA 1JAIA 1UKVY 1NVWQ 1ZP6A 3QEJA 3KQHA 2QQ0A 2D2EA 3DMDA 4PQFA 3ZS9A 1SKQA 1XNJA 4GMXA 4V03A 5FUXA 2ANCA 4BZXA 1ZNYA 3ZVRA 2F1JA 4D0GA 3DM9B 2NTYC 4U7DA 3DEFA 5F98A 3GMTA 5EE3A 3AP2A 3KL4A 1RRGA 3BB4A 3RWMB 5L3VA 2Q3HA 1COWA 4TQ9A 4HB3A 2GETA 1S4QA 2DFTA 4HUTA 3MD0A 1OT3A 4MGZR 5E7IA 3VKHA 3AVPA 1CRPA 2GZHA 2C9CA 4NYMR 4QNRA 2OFWA 4FIDA 4DBLC 5L3SA 2JIZA 4BRUA 3BB1A 1AN0A 4NP6A 2J5XA 5TY0A 3U3JA 3P20A 2WKRA 3BS4A 1A5TA 1G291 4JSTA 4PC7A 3MJRA 4F4CA 4RZUA 4LI0A 4NZYA 1KI8A 4O2LA 4I1UA 3CRMA 2CK3A 4NTZA 2GF9A 2GXAA 4Q21A 2H1LA 4MGKR 2OFOA 3RS3A 5K8TA 4XWOA 3KKOA 4A2QA 4IFBA 3AEZA 4NMMA 1UBCA 4C0KA 4B3CA 4TL7A 1G21E 5L3RA 4RFSA 2FSHA 1RRPA 4DKXA 1AQYA 4BASA 1SXJB 2H18A 2YINC 4A8JC 2J7PD 2W6JD 3THXA 5E7MA 2HF8A 1OHHA 2C2HA 1U8YA 5IRCD 2GXUA 4MYTA 1KSFX 1FMJA 2FPKA 1TTTA 2Q21A 2YWEA 3CM0A 3B13B 4DDTA 4M1KA 3TBKA 5KSOA 3K09C 4IW3B 3ZZ0A 4II7A 4PAQA 2ZRNA 1E2KA 3K8YA 4DB4A 3LX8A 4Q9HA 3KTAB 4URXR 3OIWA 1GIAA 2XX3A 4H1UA 4Q1FA 4RFSB 1KSGA 2RGCA 2ZJ5A 3L8ZA 4DCSA 4EPRA 4LJAA 4LHXA 3ASYA 2XTMA 2IYUA 3NC0C 5JWRA 2C77A 4ARZB 1VYVA 4GP7A 2PMKA 4RCYA 4C3ZA 5FPTA 4Q19A 3CH4B 4YMSA 2BWJA 3AKEA 1RFLA 4AKIA 1W36D 3EZ6A 1G4AE 1U0HC 1ANKA 2B7CA 2QMEA 3W90A 1RPZA 4C0JA 2BJWA 3C41J 4GT1A 3ZS8A 1DELA 3DL0A 4KU4A 3OFND 3KKNA 4QGFA 1OXVA 3UMSA 1XMJA 1OFUX 4LZZA 4W9MC 4OQNA 3O8DA 2J0UB 4Q1AA 1E98A 1W0JA 4RKEA 5FL7A 1SXJC 4MH0R 5BYKA 2QZ4A 3SU8A 4Q47A 3CF0A 4MKIA 1WDTA 4B33A 1W4CA 2WZQA 5DN6D 1YZKA 3C16C 1OH6A 5BQ5A 4LYFA 3U3KA 4NKRA 4NYJR 1KNXA 1II9A 1W47A 2EWWA 2D3WA 1DAFA 3N2IA 4JL5A 2F6RA 2QP3A 3GLGB 2V7QA 2CNWA 4KSCA 2FJUA 4RD4A 1ZD9A 1MO6A 2WSMA 2ZRAA 2DHRA 2CHGA 2Q9AA 3WBJA 2XNDD 4AG5A 1ZC4A 4ZDKA 4RVCA 4B2LA 1CR1A 2CHVA 4D6PA 2VHUA 4OI4A 1VCNA 2GK6A 3LV8A 5CITA 3TRFA 4I1VA 2RGAA 2ECKA 2CK3D 1MKYA 1WP9A 3WXMA 2ZR9A 3IO5A 4EKDA 4RZ3A 1OV4A 3WYFA 1TADA 2CLSA 3TIFA 4AG6A 3EC2A 3FMFA 2KE5A 3RYTC 2YWGA 2ZITA 4TYPA 1LY1A 4BFTA 3B5JA 4DSNA 2ZRLA 3I73A 4QXAA 4Z1MD 2RGNC 1OIWA 4RSGA 4ZDIA 5FTNA 5G40A 4LPKA 1UBFA 1CJVC 4ACBA 2JJ8A 4G01B 3CO5A 2I1VB 2ZUBA 1KI4A 2VHJA 1XU4A 4ILEA 5EXXA 3SJAA 3AVUA 2N46A 3I5YA 3O8BA 4LJ5A 5B58C 1OHHD 2J7KA 2HYIC 2CCKA 2ZE6A 4TSFA 2WTUA 2IS4A 4EAQA 4TWZA 2PMDA 1G8HA 3OIYA 1XFAA 4YQFA 1YQTA 1LS1A 2QT0A 4KO8A 2YYZA 1R2QA 2G6BA 3ASZA 1OKKA 3IIJA 3FKSA 2ZI7A 2WJIA 3W6OA 4BFWA 3L8YA 1L2TA 1F2UB 3L82B 1NKTA 1X1SA 1VIYA 5HKKA 3L0SA 4UXJA 2GTPA 3H4MA 3TAUA 5AJXA 5B64A 1Z0DA 2P6RA 1LV7A 2ZAOA 4NH0A 3SFZA 1XJCA 2NZJA 1Z0AA 3TUJC 3UWOA 4ASUA 1SVLA 2PZFA 1AIPA 2ZPTX 4IVRA 2AD1A 4B32A 2FN4A 2JLRA 1E9RA 2JJ1A 1MRNA 1YJ5A 3NDBB 4M1TA 2IYYA 4PPQA 4G5RA 2YKGA 3CR8A 5GJCA 2G1JA 3LX5A 1R8SA 2G83A 4GSYA 2DB3A 3ZH9B 2EYUA 1IN4A 2J41A 2LKDA 4DLVA 1I4TD 4TMWA 4PO1A 2JLYA 2A5FA 3AUXA 1Q44A 3QBVA 1G4UR 3SYKA 2BDTA 1J70A 3KKMA 1U2RA 5AJYA
chains in the Genus database with same CATH superfamily
1M6WA 1Y7HA 4QOJA 2QN2A 5A3SA 3GLIB 1K89A 2J1LA 1D5WA 1KQNA 4IJWA 3RTDA 5T4HA 1E3TA 2R6R1 3EY9A 3K96A 2H11A 4KQFA 4UTZA 2R7MA 4FDTA 4A0RA 1JDBB 3FZNA 1QVVA 2Z4SA 5COQA 1USWA 5FL3A 3BIXA 4L7QA 4C0QC 2EL9A 3PDWA 3T7JA 2PSJA 4AMVA 1SOAA 5LM3A 5DM60 1GEGA 1OI7A 2XBUA 3CJRA 1FW8A 1U11A 4HLQB 3QXXA 2WWVD 1IBLB 4JHXA 2DAPA 3DVQX 2I1QA 1GFZA 1W1IA 1SK8A 3WNBA 4UEWA 1DIOB 3LBIA 4YAEA 5JANA 4DABA 1DV2A 3KYCA 3R5FA 3Q8MA 4J0EA 4NNJA 1U0SY 2HWXA 3VSAA 3PQFA 4TWIA 2J8ZA 5I7FA 5F12A 5EQFA 4B17A 2XWBF 4H7PA 4GKBA 4YRTA 1CP2A 3PIDA 5KNBA 3SQWA 1EPUA 5GPBA 1N5OX 1NUPA 2BMDA 3MILA 1PHRA 2VQSA 4KMOA 4UNQA 1ZQ9A 3IKLA 4PO8A 1DAPA 4G5QA 4A6DA 4ASUD 2FMUA 2O9JA 3IOEA 3QPDA 4C7XA 3BT7A 1XZLA 4CMKA 4GYWA 2JJ1D 2XQGA 4D8YA 1TECE 4EG8A 3DBOB 1Y9AA 2O2IA 5EJ8A 1VE7A 1P18A 3NTXA 1TGYA 3SKYA 3F0TA 1VCHA 3D4BA 2XCTB 2E4YA 3LQ2A 1JU9A 1YR6A 3J7AC 4CEIA 2WJGA 4O5AA 1ZU5A 3I8XA 2I7TA 4MRNA 4CN9A 1FTNA 3LBHA 2H3HA 3PUKA 3QHPA 3CWZA 1BA2A 2XF8A 1LFDB 2VJNA 1WMEA 2JIOA 2B4AA 2PGDA 3IQHX 3G7SA 3PQEA 3SIRA 4AWBA 3HKDA 2V3VA 2WPDD 2CNKA 2WMDA 3M3HA 3QUTA 3M8KA 3SYTA 1E69A 2DUWA 4AJ2A 2XPCA 3ICWA 3JD1A 4YP7A 4ZJUA 3D8SA 3A70A 3IVRA 5JTUA 4EYSA 1JQ3A 4XD7D 5IH7A 2C2WA 3RAFC 1IY2A 1UFKA 3WQHA 1RI5A 3AF2A 2RH5A 2QRJA 1AUQA 2HK7A 4EA6A 3DEYX 4MRMA 3KSAC 2HSEA 4QASA 4QOEA 1EFDN 4W8HA 3RD5A 4LTNA 3LUPA 2PKEA 1GT6A 5JDIA 1N6KA 3TXXA 4C4ZA 2HRDA 3JQ9A 3JATA 4FGKA 5JYDA 3EASA 2Q5OA 4GX5A 1JG4A 1K3UB 3O7WA 1KMHB 3CTMA 3AXSA 3OY7A 3PQ4A 4HWRA 3KNZA 4EDFA 2IEZA 3PI7A 3JZFA 3V4RA 2CCGA 3A6GA 2IHVA 3K09A 3MMNA 4UFOA 3T61A 4ZHQF 1YUNA 3IE1A 3EFEA 4QDOA 3K70B 1IPEA 5DXFA 4BKOA 1Z0UA 1DARA 2XOXA 2E7ZA 1NOKA 2GILA 3C7DB 3QFTA 5JJIA 3IVAA 2X13A 1W1WA 3BK1A 1FRVA 2QUBA 2CFCA 1UC4B 3LX6A 4AJOA 4EFDA 4UTOA 3TTSA 5I48A 4MP6A 3D7SA 1YDHA 4MYRA 4NYMQ 4R98A 3B6KA 1EI9A 2DPGA 4MGEA 1OYVA 3ZGYA 1A4XA 2HJVA 1WSAA 3HRKA 1DRVA 2BW0A 3MUNA 1HH4A 2J07A 3O0DA 3WIDA 5ITZA 3P2KA 3IEXA 1T5BA 2G82A 2NX2A 1MVLA 2ZB3A 3FTNA 3QVJA 1JMKC 1FTSA 1XRLA 2W71A 1KJQA 3QW4B 1UFVA 4B71A 5KOIA 4DBVO 1XMOB 2ODPA 5H68A 4J3NA 3UGTA 1T2FA 2DP4E 3REGA 2GAJA 3D8RA 3ESQA 4D26A 1ZN2A 2J9XB 3FMPB 1KF0A 4PWZA 1IE3A 5B6IA 1GL3A 1GZ5A 4DWWA 1CUSA 1TTQB 3HN6A 3PPYA 5J4KA 3FGOA 2HQ1A 4GOXA 3SP1A 16PKA 4KBYA 3J80A 3G2HA 1VMDA 4I50F 1V4NA 3AL2A 3N5KA 1SUDA 1TYCA 4PC6A 1XZMA 4HVAA 4QHSA 2CT8A 5ECYA 3DTYA 1T9BA 4F3RA 4ALNA 4F9EA 4PXAA 2OXIA 3W77A 1W5TA 3AUFA 2GN2A 1T1EA 2OR3A 2ZIVB 4O4IA 5AJTA 4EMSA 3GMIA 2ZUWA 3FSGA 4FLEA 4PNPA 2X8BA 4L4YA 4JUFA 2FE4A 1QG2A 1J21A 1XN1A 4JFAA 5D5PA 3QLVA 1X74A 1FFXA 3GBVA 2HL6A 5H3HA 1ZH6A 2Z98A 2P9QA 3LKDA 2GVNA 2P1DA 1I7PA 1Q1NA 1XU7A 3AV3A 3RPEA 5C5DA 3H9UA 2A9OA 2C9DA 2W8BA 3DO8A 4D9NA 1LRKA 1FSPA 3MWJA 1XA3A 2CBXA 3IQWA 3K0AB 3REFA 3OUZA 4YP5A 4Q1CA 1U98A 5B1SA 1DO0A 4BNMA 1NQUA 1XEFA 2ZDHA 4LHZA 1KYWA 1DBQA 1VHLA 4RDXA 1IJEA 4WLNA 4NHOA 1K4YA 5F9FA 4DUPA 2PGOA 5MDHA 2G9VA 2R8EA 1QR2A 3A2KA 2QGNA 2GZ1A 1ZK4A 5T3UA 4H60A 2A9PA 3BF7A 4HI0E 5G02A 3W7VA 1P7WA 4C5CA 2EJBA 1C9DB 2NUAA 3L0PA 4QOFA 1GV0A 2HDNB 4KDRA 4BB9A 1I10A 1HF3A 1OFHA 3P45A 4HLCA 3AF6A 4Z54A 4Q4CA 2F64A 1XA4A 3AINA 2VZLA 2XAUA 3FGNA 2Q2OA 2KJQA 4MICA 3S4YA 2XRZA 1WZNA 3SJBA 4MW1A 4D9KA 4C1NA 4F71A 1M6VB 3NEPX 3VO2A 3O6VA 1RZ3A 2ONYA 3IJRA 4JBLA 3IULA 4DGQA 4DDHA 3RYIA 3A2MA 1PDVA 2ZDQA 4Q3KA 4XEUA 3BMNA 1G19A 5CJPA 5C1DA 3F1KA 4EG7A 1QLJA 4IFIA 1UKYA 4EKIA 3NLLA 3A27A 3WNCA 4WJKB 1ZUNB 3B8EA 2MYNA 4RV5A 1PGPA 3AR8A 5TARA 1WCWA 2P0AA 4CMCA 2J9FB 2CEAA 1IL0A 3L7KA 3LC7O 3K30A 5B3AA 4Y6SA 1RCFA 2BHSA 4ERXA 4M37A 3CVYA 2DXIA 1D2HA 4E5KA 1Y1RA 2ZG6A 2KB0A 5TPZD 4TS1A 1LX7A 3IP1A 2XGGA 4TVOA 1JHYA 1EP2B 4QXRA 3TD6A 4E14A 1EMDA 3EXG2 3N75A 1RMTA 3KYDB 1UZAA 1T5SA 4R2WA 5IAJA 3DZHA 1GG9A 3SFTA 1Z17A 4CFZA 5DTJA 1D6NA 1B23P 2F48A 1FQJA 4JOCA 3LZDA 1Q7BA 3U40A 3BICA 1T43A 1FE8A 1ZW1A 2P2NA 4FI3F 4OSOA 5JNWA 3CY6A 1W8IA 4IZIA 3NKLA 4NY1A 1ZUNA 4TTRA 1F7UA 3WJAA 1KP3A 4RVHA 1Q74A 3DMTC 3RUCA 4DV4B 1XAIA 2VHCA 2Z6VA 4NICA 2J9FA 4AMZA 4UAVA 3ZU5A 1JG6A 1QV7A 9LDBA 4PQRA 1T3GA 5KYXB 2VK4A 4PNEA 4BNWA 2DUMA 4K3VA 4WADA 4U9HS 4QUDA 2QMHA 3QWAA 4R41A 1MH9A 2WJJA 2JASA 3QYPA 1TTPB 3WVNA 2UDPA 3LWNA 4DMRA 1CSEE 3MAAC 4RW0A 3SEFA 5IN4A 3UG7A 3CG0A 1U0NA 3L1UA 2FF5A 2RIPA 4EF6A 5CP8A 2ZBGA 4V0LA 3RFTA 1OJ7A 1Q91A 3BFPA 4CM3A 3DBHA 4NENA 3S2FA 3WWOA 1PVVA 4X93A 2H48A 1A7JA 3BMCB 1D1PA 2YXPX 4V1CB 1IWBB 1PG2A 2QRVB 2ZRFA 4Z4GA 1JHZA 5AW4A 3ELUA 4CEJB 2JLWA 5ALNA 5LZ4A 3DDUA 3FCUB 4NAUA 2KQUA 1Z13A 4G9GA 3THWB 2DWOA 2JFHA 1XLTC 4XM1A 3LCVB 1B00A 1EZ1A 1Y33E 1I4EB 4I14A 1ZCJA 5CXUA 3W2HA 1QZTA 2W98A 2RMKA 4BBPA 1XTJA 1WJGA 3G6WA 3V4SA 3C4VA 5DYYA 3HJHA 4NQZA 3OOHA 4WFKA 3NU1A 4YMTA 2W2VA 2TMDA 3PR2B 4I1SA 1CZLA 2GEUA 1J56A 1ZINA 2ZCVA 1S2NA 5GONA 3UCXA 3R7FA 1N2ZA 3AK4A 2MSLA 1UPXA 2YC4C 3HR4A 4V2UA 1VRWA 1T0HB 2R6JA 4HDMB 2FPGA 4CQLB 4YCSA 1NNI1 3LA6A 1IY0A 4HWOA 2IPLA 4J9VA 1M2NA 3EEIA 3KFLA 2ZB8A 3OM9A 3DMFA 3NV7A 1HUQA 3V8BA 2R5NA 1AHHA 5KJCA 3KQKA 3DPUA 1D5CA 4C1BA 4Y6RA 3UMBA 4A26A 5TE9A 1TIPA 4M6WB 2WJ3A 4PLPA 4ZO7A 5DBEX 1Q1BA 5TJHA 4OHOA 3DM5A 2OHIA 3ADKA 3DE1X 4QUBA 4R2XA 2NVOA 4YIKA 3RIGA 1ZH2A 3GL9A 1G7RA 5T8KC 2YWBA 3HVIA 3GLSA 1GG2A 4I81A 4EGSA 3L8DA 4LECA 3VR6H 3BD9A 4X65B 1RQLA 4KGZA 2AFIB 1CR2A 5EZ6B 5LA6F 1G18A 1KO4A 4KQ6A 4FBMA 4HGNA 3O90A 3IBGA 3N0VA 3W8RA 1EX1A 2QTMA 2B8NA 4L5BA 1VDMA 1X8KA 2F9LA 2H7VA 4PTLA 2VBGA 2FOIA 3ORFA 1N5DA 3WL4A 3WGVA 3LD9A 1JA0A 4ITRC 5HZGA 5KOHA 1WBBA 4C6SA 1H2BA 2I80A 4HR7A 1FDIA 1G21B 4JU8A 4NBSA 3UPUA 3DQZA 5BV2P 2CV0A 3RRYA 3DXZA 3IA2A 2ZTMA 3Q6IA 4FDVA 2L82A 1P29A 3I0NA 5ECDA 2WKWA 4CJXA 2FZVA 1RVDA 3DL2A 3UMYA 2R8OA 1JQDA 2ORYA 3RVNA 3DL7A 2Q6OA 2ZXUA 4XWAA 2QRMA 1OLSB 2I1WA 3UCEA 2ZSJA 3AVTA 1COWD 4ZJYA 1FJ2A 3VPFA 1U99A 2F3UA 5DBIA 3QFHA 3AIKA 4JWTA 1HG1A 2BGKA 2G71A 3DZGA 1VYTA 3HJGA 5AH0A 5AKXA 2VJKA 2B99A 3FPJA 3CF4G 2NO1A 3D3WB 2QX6A 2OQVA 5HIMA 2W9XA 1UF9A 4ZU1X 2XT0A 3RT7A 4L0QA 4TVBA 2NN3C 4OM7A 4EUHA 5CDHA 4TT3D 3IHLA 3ZLUA 1NL3A 1JFFB 3LPCA 3JRNA 1ECCA 2ODEA 3V48A 3KWMA 2R3SA 4I4TA 1I8TA 1T9CA 2EKBA 4GWKA 2VSNA 4TXNA 3K9WA 3HCCA 1L8LA 4GX1A 4LXGA 4RA6B 3IERA 1V2GA 1RI4A 5T8KA 3MB5A 2CSXA 2P4QA 4V1CI 3RTCA 3S2GA 3K71B 2AXEA 2P0EA 2YWXA 2K2WA 4JCOA 1G38A 1P2VA 3K1JA 3UHAA 3FFAA 3HKEA 4Y1RB 4GO1A 1G5IA 1QAQA 5FOQA 4JL8A 3KSDO 2BGWA 1R0KA 3M81A 1JEYA 4KVGA 2XECA 4PIVA 2OZVA 3ORHA 4GL4A 4JLJA 2GT1A 3OQHA 4FYMA 3F78A 2POQX 5AUQA 1CLEA 1E59A 4Q00A 4P4SB 5CVCA 1J5EB 2G9UA 2QLJA 2OBMA 3WB1A 1KMQA 2EJWA 2WBLC 2BELA 2WYWA 1ZNZA 2R79A 3KR9A 1A88A 3PNQA 4MW5A 4R9UC 4RZIA 4ZREA 3CLUC 3VISA 4HDOB 2XNJA 4IIXA 4B43A 5AW0A 1MJFA 3BD8A 2I4TA 3DO6A 1UBMS 1K75A 4RA6A 1MVOA 3TCNA 1QUEA 2H08A 2PS9A 4P54A 4XLLA 2J7PA 4F3TA 2VSQA 1EGHA 2ORWA 3A58B 2B69A 1DO2A 2VP4A 1JPNA 3QI2A 1FNNA 3HKCA 4TL6A 4LVNA 4Y1RA 2O3SA 3DGEC 4GR9A 4QYWA 3U5ZB 1LPOA 1JXQA 2OLKA 2PUCA 3OPYA 1Q21A 2WY2D 3FCYA 4FGZA 4S1TA 1QFZA 1T15A 4TM8A 5CHYA 5HE9A 3DNPA 1QH1A 3FNHA 3RFVA 1QXSA 2PV0A 4FHZA 5ALGA 1E4VA 1XZCA 2QIPA 2QTFA 2WHEA 1FIUA 2OK7A 1NVBA 1V1MA 3OLXA 4B9EA 5U4XA 2PIDA 4AKHA 2EFEB 3F3KA 4ZMRA 2P2YA 1MX9A 1BYUA 2BL4A 4W1SA 5CYPA 1JB1A 1KOJA 4H7IA 3OEYA 5KWVA 1G5TA 3TIIA 1T9AA 3T1HB 3ZDXB 2YRWA 3UWSA 3F4KA 5GIOE 5IBRA 2JF0A 2V58A 3EDQA 3EXG1 2ZUTA 3RC3A 3G0DA 2C82A 1CC1S 1ZHOA 4JSRA 1VG1A 4ZHSA 4YP0A 4DIUA 3VR4D 2H1RA 1H0RA 2C42A 2OAEA 4B81A 2Q49A 1EWRA 1ZUWA 1ZK3A 5TF0A 3OJLA 3H5LA 2JGAA 2P2LA 5F7JA 2EEPA 3DKVA 5CVEA 5F7ZA 3T7AA 1S9HA 4N3BA 3ZBUA 2JAUA 3LOQA 2X8LA 5BSWA 3VVBA 3PUYA 3W6ZA 1LBHA 1NLMA 3C14C 3GRCA 3JQFA 4MYCA 4X90A 4XFJA 2VF4X 4MV7A 3R0XA 5KEIA 3KTFA 3EWSA 4YQZA 5IUNC 1T4MA 4EPTA 1B4DA 2B4TO 3WGTA 3O2JA 5I01A 2HF9A 4NAHA 1MLDA 3H2ZA 4IHAA 4TTIA 1JPUA 1ENOA 3IV7A 1BJRE 3N70A 2XIQA 1PNRA 3ULKA 3LY5A 3DFKA 1U3UA 4K1LA 3WHPA 4CUJA 5AVRA 4KPGA 3F71A 3LVBA 1GG5A 4G5OA 4H7JA 4UZFA 3X2FA 3GLGE 2ZTVA 3TW0A 2PKXA 3UAXA 1F1JA 3KVOA 1CRZA 2Y2UA 4ZXFA 3ZD7A 2YH2A 4LDAA 4HEQA 4PSDA 2OXFA 1SCBA 4M8LA 4G5FA 5GZ6A 4BE7B 3X0DA 1R0YA 1EIWA 3L92A 1YU6A 1EP1B 4OHCA 2GHIA 4IIYA 1KR2A 3FTPA 5BUZA 3FIUA 3OLCX 1I1NA 3B1JA 1K0UA 1XKXA 4LRUA 5EMJA 4ECEA 5B2FA 1QM5A 4C14A 1YZHA 3CJTA 4GSKA 1PJ8A 3T3HA 1VCOA 2FNAA 3IUJA 1L9XA 2H63A 4Q7JB 3WMFA 2W2QA 5B7GA 1VL1A 2A1TS 2XMCA 3MTQA 3PVCA 4L22A 2P3QA 4PY2A 5E4FA 5FXMA 5BWMA 2OHVA 5KTKA 2FN8A 3HRHA 4HNGA 3ILSA 4YCBA 1UBGA 1FNBA 3P4UA 4A0FA 4ESEA 2O05A 1JQBA 2OBLA 2VPWA 2O0HA 5M7EA 2O2JA 2X3UA 3QE0A 1BS9A 1GU0A 1HM5A 1M6YA 2GK7A 3ND8A 4FQ7A 3KQVA 5KINB 1ADJA 5NLLA 3V6MA 2ORVA 5JHGB 5KHOC 1MC1A 1NN3A 4GICA 4U0JA 4YCJA 4HMOA 1HDZA 1VE1A 3OIVA 5JO9A 1XCLA 2YXEA 2A33A 2XB4A 3NZEA 4P36A 4UNRA 3LY7A 4O02B 5ICEA 3QQPA 4FEEA 3O2SB 3ZWWA 4NCIA 1GSOA 1VP9A 1TCBA 2CXNA 2QPOA 5LDDC 2BSQA 2R7AA 4IIJA 2J33A 4MKXA 4RESA 1H4VB 1V1RB 3VSEA 1DG3A 1O9GA 2EFHB 3IDOA 2C95A 5JASA 1CQJA 3HNRA 1R6UA 5ICMA 3GBSA 4CF5A 5GY7A 3A7DA 5JXWA 1SXHA 3ACCA 4TMXA 3TAXA 3CN9A 1NI4B 5FTMA 1DCMA 1GZ3A 4L73A 4JBWA 2R68A 1OILA 3I92A 3MTBA 2C2ZA 5KPJA 5HGJA 1U2EA 2I6QA 4WNAA 2MMGA 2Y6UA 1ZUHA 5F5LA 3BWMA 1XLUA 3K9HA 5EXSA 5FADA 1DX4A 2C3MA 4KLZA 2Y1KA 2QN7A 2FMFA 4A4DA 4LZLA 1XALA 2BTQA 2CJWA 1PR9A 2I2BA 3H13A 1E32A 2BBTA 4QOHA 1EE2A 1F9AA 2QR5A 4C29A 4G84A 5D6OA 1OZAA 4AZ3B 5GZ1A 4RHFA 2ZUSA 2C7QA 3L1KA 3G88A 1SZJG 3VH3A 3VU9A 1W5EA 3K0BA 1X7XA 1EDZA 2BIFA 1PWZA 1KTVA 1SU4A 1SQSA 1Q7EA 2HBRA 1GLGA 1K5HA 3T1VA 2O59A 1RLJA 3NI2A 4I4CA 3KR2A 4CKZA 2C0PA 3AI3A 3F97A 2BI8A 4PFJA 1HTWA 1C9YA 2NUPB 3ELYA 5BSKA 1MABA 4C7OA 2WOOA 2XVXA 2K5UA 4EVSA 4D4KA 1P2TA 2OT3B 4KR6A 2XTNA 1BXZA 2BI7A 2OO5C 3UJ8A 1KYVA 4ZVMA 3H9CA 5ADWA 3A1TA 5AVSA 1NY5A 5DI3B 5KDLA 9GPBA 4AJLA 2JLBA 4MB2A 4GZ3A 4QECA 2B21A 2C3UA 4AZ3A 2FCRA 4CIYA 2IRWA 3JARA 4IFEA 4TQUS 4XB6B 4AP5A 3F9RA 4F9GA 3AMVA 1F38A 4HATA 7ABPA 2NG1A 4HH0A 2WW8A 4N9WA 3HJRA 3MNFA 4XVQA 2I7XA 2QL7A 4PYNA 4MDYA 5FUQA 1I5RA 5DYGA 5K4GA 5MHTA 4MV1A 1PR0A 1OBVA 1WXFA 3C3JA 5BW6B 3EVEA 1GKLA 3AM5A 3PGVA 1WKCA 3OIFA 4FYXA 3D2CA 1ZD1A 2HRBA 2EQAA 1D3AA 4W5NA 1JG1A 2JIMA 2VP2A 5U4QA 2J6HA 4H7HA 2J5KA 1YI1A 3IUBA 2IZ7A 1CJSA 1NJ1A 4G0NA 4K2HA 3TQTA 4C7JA 3RU7A 3F46A 3FDJA 2PWAA 3JQGB 1GXSA 1ZWKA 3G2NA 3JQCA 1VG8A 2BE9A 2CE2X 4MAFA 1EQAA 2QX8A 4M53A 4P3PA 4E0BA 3HXQA 4B5LA 4F2PA 1WXQA 3SSAA 3HC7A 1F4LA 1Y89A 1SUCA 1EVQA 4B35A 1VI5A 2G4CA 2H6EA 2G0AA 4JJFA 3RFCA 4BFCA 4ER3A 7GPBA 1U9JA 3EZYA 3HCFA 3V1NA 5IVPA 3ZCPA 4Y2SA 2CW5A 3U37A 3MINA 3THRA 4I08A 1YIOA 3HJAA 3AUTA 4E2WA 1YRQA 2PX8A 1JPJA 2D54A 1JR4A 3K73O 1TMKA 2OMEA 2CFRA 4B2IA 3KPUA 4YJFA 2ON6A 4C22A 2XWPA 4L50A 1T2CA 4MWTA 2I3GA 5ER6A 1P4HA 1CUYA 3GLGA 4XSGA 2GNOA 4IZOA 4LOLA 4NCNA 2NIPA 1UEIA 2ZBPA 4HFMA 3SZRA 4KL8S 4R71A 2AOUA 4ZXPA 3SZUA 4QREA 2OB2A 4RK7A 2Z5VA 3V46A 1NVFA 4AYTA 4MGYR 5JFTA 2NU6B 3L6UA 3G9QA 3GCXA 4QFBA 3GDOA 1OAOC 4HZUA 4YFVA 2G07A 5FD8A 3SICE 3NNNA 2XZPA 5JWRA 2R5FA 2XUIA 1UZNA 2FMIA 4O2BB 4REQA 4RTSA 3RRMA 2UUOA 3CVUA 3FRHA 1TU0A 2QVLA 4YPVA 5F2OA 1Z2NX 3UGJA 3OEEA 4BNVA 3DR5A 2GHTA 3FUVA 2Y1OA 3MXOA 1A76A 1ZK1A 1L7AA 2P9FA 3EIHA 3IGFA 2A8YA 2X1VA 4FI3C 2BT4A 1U28A 5AESA 4DRXA 1K5DA 3GZ4A 3M5WA 2C00A 4JLUA 5CU7A 4FGJA 1DINA 4MI1A 3F2VA 5BWCA 1PZGA 2Q7XA 3RDPA 4MJLA 4U00A 3C1TA 5CT5A 3BD6A 1XD9A 4E5VA 1WVMA 4XAQA 2O0JA 5IHPA 1IMJA 3DJYA 3FW1A 1DQSA 1N2SA 3ZCQA 4N03A 1KYXA 4M9XA 3OOJA 3EG9B 3AGQA 4AO8A 1S0UA 2VP6A 3CLRD 1GGVA 4TYQA 2H2WA 2VNHA 2O14A 2E1PA 5DGIA 2AZ4A 5KO2A 2R1TB 3L46A 3ONFA 1M1ZA 3VKGA 5EIOA 1JJ7A 2FA9A 2MHCA 2DOKA 4JLPA 2VYCA 3BMOB 4D6YA 1FDSA 3PICA 1YACA 4DIBA 3GEBA 1OT5A 1U3WA 1QP4A 3RTBA 1YZFA 2IYWA 4CDMA 1WCIB 2AFIE 4Z8XA 3ZY2A 4YRZA 2J3DA 1HKHA 2CV2A 1SHUX 3KDAA 2FPWA 4WY5A 4L9RA 2ZP1A 5EKTA 3VI4B 2WU3A 3LPLA 1RQXA 1Z2EA 2D8AA 2XCUA 2MSCB 2X0KA 2ZIUB 3BKWA 3NDIA 1KFBB 4NG5A 3IT2A 5LC1A 4AJNA 1HZZA 2Z2YA 2WJVA 3H75A 3TQHA 3DUFB 4C2UA 6Q21A 2ZM5A 1E79D 1E58A 2D5AA 2ATVA 1Z0IA 3EZFA 1B73A 3QVGA 1XZ8A 3O3NB 3IAFA 5FBWB 3ETJA 4YRPA 1YJAA 1PLJA 1LDGA 3P96A 4OMFG 2RIRA 3ZGLA 5JAPA 1Q0QA 1KYZA 1KY5A 1WXXA 2QP9X 3A3PA 3AFGA 1C4WA 2ZTUA 2PQ2A 2LIVA 1JHOA 1KYQA 4LX8A 2DBRA 4E03A 2W2LD 4LQDA 2FPIA 1V5WA 4UE6A 3L4KA 3HU3A 2ZI5A 2PUEA 5DM2A 4AY2A 3DYVA 5DRYA 1NUQA 1R4AA 3KX2A 4I6EA 4PGFA 1QYXA 3CX8A 1SUBA 3QKUA 4HDNA 5EPEA 2PBZA 3E53A 4UBMA 1Y9JA 4NMXB 1DAIA 3C3DA 4D3FA 2AFRA 2ZBQA 1NULA 2REQB 3C1AA 3FPSA 1PV2A 4YAWA 2JVIA 3UPDA 2C54A 4R5MA 2PZEA 3ZI4A 2HO5A 4WGGA 4OQ4A 4URFA 3UFXA 1DL5A 3KKZA 3HYTA 4DANA 2RK3A 4KQCA 2WV7A 2HPZA 2QYOA 1C1DB 4PO9A 5H4HA 3ZTTA 4G0UA 3RWBA 2WAXA 5K6AC 1QHFA 2BZGA 1M1YA 2FPPA 3LQKA 4AS3A 3I0MA 1SRRA 2Q0QA 3FUUA 4IEIA 3TKLA 4M8KA 3ZDRA 4ES6A 3FPKA 1S2OA 2A14A 5CAEB 2PLNA 3K35A 3DS8A 5FWXA 5HF9A 5BQXA 5D3QA 1LLCA 3ISVA 3H87A 4KFRA 5LB2A 1KGDA 4MQ4A 5J1TB 4OMCA 5H9WA 5IEBA 3A11A 4C3OB 1O6GA 1XJQA 4DV7B 3FSJX 1GQOA 1T91A 5I7EA 4KK4A 3AOGA 2PZLA 1V7ZA 3FWHA 3M83A 1CF4A 3WDMA 4X5OA 3BTVA 1DWPA 3M3DA 2PRSA 1O54A 4RTOA 3IOMA 2FK7A 4OK3A 1QUFA 1E3WA 1EHYA 5IKEA 1P73A 4KR7A 1EXVA 4BNXA 5L45A 3WLQA 1MRZA 2H5EA 2VDMB 3I4CA 4BVGA 2K2QB 4DCVA 1GRNA 1EH5A 1YQDA 5BV1A 4BN5A 1KKMA 1SXGA 5BW5A 1RWKA 4HJXA 1R15A 4DVJA 3HADA 3ZJVA 1NM5A 3GROA 4IHJF 3DYIA 3KZ1E 1IC6A 3I72A 5K05A 3AL0C 5CCBA 1FP1D 1DCKA 4QZVA 9ABPA 5LBIA 1SVOA 2ZUFA 1L4FA 4IHJB 2B6NA 4HAVA 1T8UA 4MWEA 2DEUA 3KO8A 3JPYA 1IPFA 1A71A 4YMUA 2ET6A 3E7WA 4A0QA 4QUEA 4LC9A 1IBSA 5E4TA 1K86A 1PT6A 2YBEA 4O08A 3Q4GA 4QXOA 5EJGA 4UE2A 1HLPA 1JLSA 3CU5A 3O92A 2OTCA 2NNLD 2XA9A 3QPWA 1T2UA 4KQGA 2P65A 4WLFA 4DDKA 2I6SA 5KYYA 1LRJA 4WESA 1Z22A 3PC8A 2QU7A 2VTBA 1H69A 5G41A 5TXGA 4I9FA 2V1XA 1NDUA 3JAKB 1J5XA 5HF5A 5SZIA 2PYDA 3K6JA 4L9AA 4PZAA 2PS3A 4A6XA 4O4IF 5DOVA 1FQKA 1H8HA 1F0KA 1AM4D 2GPBA 5DX0A 3VGJA 2MTBA 2VPTA 4V3CA 2ZPUA 5C4MA 3LRXA 4HB4A 1Y8RA 3FI9A 2YIVX 3PC6A 4QBFA 2CFSA 5K0BA 4KN9S 4Z9BA 4J29A 4JMPA 4KO2S 1BQEA 1EXMA 2Q0SA 4P8RA 4ETMA 1JXMA 2XTZA 3UG6A 3R3XA 4FOTA 3B52X 5F3RA 4D81A 1V8DA 2R00A 5KOJA 2I4NA 4UBIA 3FYDA 5DYIA 1KIMA 3OZXA 3RR2A 4CNBA 1A9XA 1T8TA 1CQXA 1Y4DE 4I2NA 1OH5A 3CRVA 4FCVA 2DPLA 1RWVA 2HFJA 2NUTA 4KUEA 4I3GA 1OWPA 1REQB 4JSYA 3MQ2A 1PG5A 1IZYA 1IVNA 2NO4A 2WIFA 3EGDA 4H6XA 2FFQA 4X7RA 5IVHA 1JG2A 2ZT6A 1OF1A 2VVTA 1E2IA 4BFSA 1ULUA 5ITZB 2F7SA 3FAKA 1UP6A 3FTCA 1GPNA 2YR0A 4B3RB 1Y6GA 3F4BA 2Y1FA 1R0RE 1ZJJA 4LISA 4PANA 4DCNA 1D8TA 5FAKA 4O4HF 3RSFA 3C3AA 5KU7A 2V1UA 2BTEA 3LL7A 4IKOA 5T57A 3GUVA 4MUMA 5EPOA 3WSWA 3B1KA 2ZE8A 2ID7A 3P9KA 5I7WA 3PFGA 1J7JA 2VRCA 4PW0A 5CM8B 1U3CA 3IURA 3UYLA 3HXPA 4YCLA 5IFKA 4MUBA 2NU7B 4ZVOA 1R6DA 3V2HA 5F9HA 4NYJQ 2J6BA 4NDZA 4V0OA 3CKLA 1T0JB 4IDOA 3VAAA 4KR0A 1A8QA 5G3YA 3WI7A 2PZAA 4ETWA 4F3CA 4FMDF 4X62B 2EW2A 3DOFA 1NNSA 3A9CA 3U80A 2ZSDA 1SCUB 2OV6A 2J3EA 3H2YA 3IILA 1N9KA 1TK3A 1TGVA 4NS4A 5CH5A 3CONA 3R4CA 4HRAA 2J3KA 4TT8A 4C08A 1W36B 1G63A 4G9EA 1Q7GA 4WHMA 4P3NA 3E1SA 3FUCA 3PNOA 4XASA 4JT4A 2O2SA 3DMRA 1N2OA 2ZZMA 2VT2A 1QK4A 4IJ6A 4GR4A 5KQGA 1HTBA 5FHRA 3BXZA 2W8BB 3SSMA 4QSMA 4A0HA 4BPRA 1M3SA 5FO1A 5A06A 3MHTA 2PJDA 4JKYA 1Z2DA 2HBZA 4QRHA 3L40A 5SYAA 2YIDA 2GJ9A 4JXXA 4MWDA 1VOTA 3I9JA 1TKCA 4PU0A 4RM2A 3D0QA 3R5HA 1I0IA 3TI7A 4HQ6A 3MB8A 3O93A 1O8BA 5EE5B 4FFSA 3B3FA 4DJTA 4DLSA 1RWQA 5GV7A 3QKIA 2BM8A 5HFNA 3WQSB 4JLMA 1U2QA 1D0VA 4YRRA 1C9EA 3I05A 3UYKA 1T3SA 1AQJA 3ZDQA 5HIKA 5LMUB 1NMSA 3MCTA 1X80A 2XDYA 2DPMA 5JBIA 3EAFA 3N2YA 1E3DA 4QPPA 4RFVA 3QU5A 1TM5E 2OORA 2Z30A 5G53C 4KQKA 1N4DA 1DX6A 4OHZA 1SXPA 2KLHA 1KBZA 3QLVC 2PXAA 3EG5A 3DEHA 1FXSA 3MWKA 3MJVA 3BWCA 2EFYA 5KDDA 1T0BA 3EDYA 4EDHA 3D3QA 4MR9A 2B2XA 3N6XA 5AK4A 4BLQA 3V8NA 3STWA 5K1ZA 4CDRA 3R9KA 3VC2A 1NBWB 2AJ8A 4RSRA 1OFVA 5DXJA 5KYUB 5T67A 5HZKA 3B53X 3GEGA 3TD9A 1PN3A 3QI7A 1DJMA 3TW6A 3LSYA 3BQ9A 4ZRDA 4KIUA 4PZPA 4UBLA 5JALA 2QN9A 2TECE 1M8PA 1FJHA 3VHRA 5ELXA 3KJFA 2G7MC 4M1QA 5LBTA 1BMFA 1YQQA 2BMVA 3C6BA 3VDXA 5A5EA 3T4UA 4BQEA 1EM8B 1I3LA 5LUAA 2WTMA 4CV0A 4QYXA 3N5CA 4CTNA 1ID8A 3P5BA 3PA8A 1JDZA 4M2LA 2XYVA 4B4OA 4B8YA 4ND5A 1VM6A 1DEAA 3UA3A 5LWHA 1XTBA 1WF3A 3NKVA 1DTWB 3OP1A 2NAFA 2ZW9A 1C7FA 4G23A 4UCFA 4DSAA 3LXMA 4EJ2A 3BGVA 3N3BC 4YC7A 2HWYA 4BAUA 2AEFA 3DB2A 1KBQA 2PX0A 5I7VA 4TM7A 5KYXA 2JLSA 4L57A 2QI9C 2PWYA 3FYCA 3IO3A 4M0UA 2QE6A 4XUCA 1NKVA 3KUDA 3SOZA 2G1KA 2WABA 4RORA 2ES4A 2QAJA 2QRUA 5JJ5A 3IQXA 4RTJA 1PAUA 3E8SA 3DAFA 4DMLA 4H35A 1O9BA 1DC8A 1C9NA 3I6ZA 4J0DA 5D3MA 1P0QA 5AJHA 2Q2NA 3DOEA 5LLDA 1ETHA 4WOBA 1BFKA 3LRTA 4PICA 5MGBA 4PX9A 1NN0A 3FVVA 1L7QA 3KPWA 3FFWA 3O47A 1NUSA 4ITUA 2GYWA 4YJHB 4JI6B 4E6EA 4HQOA 2E4UA 2E1RA 3CMCO 2EFDB 4RPKA 2JFQA 4H7DA 4R9VA 4GI1A 3H1AA 5LQKA 4N8EA 1O89A 4B8WA 1Z8FA 4AW9A 2WD7B 2XUDA 3C1OA 1YAHA 4UAGA 4M55A 4E2FA 5J2UF 1L4HA 4L3WA 1IUKA 3I5UA 3O4HA 1ZVJA 5ED4A 5A3RA 4URHA 1VPWA 5JYBA 2NO9A 3EYWA 3T3GA 3I32A 4D5GA 5KZMB 2VHTA 2BEKA 3AIOA 1TM4E 4JVMA 4XQEA 2PJRA 4N8SA 1EFHA 2C98A 3C8MA 3L7CA 1Y98A 1UXJA 1UM8A 3NRCA 4JEUA 2QRKA 4K86A 1BNCA 3QEBZ 3C6YA 3URKA 1B74A 4CM5A 4YJHA 5JJCA 1E1QA 2GYYA 3KD3A 5ANRB 2BEWA 4E15A 4IDDA 1O6FA 2ZUCA 1RYYA 3HKDB 2ZTSA 2ZSIA 3R3HA 4G3XA 4C4TA 4L3VA 1G59A 3F7MA 1I6WA 1QZ3A 1YDEA 2YXBA 3A4MA 3HB7A 4KAXA 1ULSA 4L75A 3AKCA 3AWDA 2YOGA 4JYCA 4MWOA 1NRIA 4TOIA 2AN3A 4N5MA 5I8ZA 4PWYA 3DAOA 2C5BA 1EVLA 4Y3UA 2YASA 1CTQA 3DBVO 5JW6A 4DIDA 2H9AA 2GHRA 1KO5A 5IU6A 5DPMA 2O8FB 2HBQA 3E1KA 1ABBA 4CTMA 3DMYA 3JQ7A 5A4DA 4X92A 1L5KA 3NV9A 4M86A 1ZHFA 3WLPA 4F72A 4WW0A 5D6NA 5GVRA 1VJDA 1SVWA 1SJ9A 3UNXA 1KK3A 4LAFA 1QZZA 1PZHA 2C4KA 2D2VA 2J0QA 1WDMA 3AY0A 3IQFA 3LE8A 1PO7A 3QXHA 4N6NA 3RVJA 1XSEA 4FYVA 4YRFA 3DTNA 2ZBDA 1NM5C 1U8TA 3PR1A 1MO2A 2FE1A 4IOLA 2IW3A 3GUHA 3OQVA 4V0RA 2G80A 4EG3A 1JXOA 5DXAA 2QD1A 1NNLA 1YU9A 4ACAA 2CKMA 2Q2VA 2QD3A 1WTAA 3PJFA 5C7IO 1SU8A 2WVJA 2EF0A 2J46A 5IBQA 2R4QA 6ADHA 4EVQA 7YASA 1F1BA 1M1YE 1MIOA 1QGAA 1US8B 2HJGA 2ZIAA 3JQ6A 1F4PA 4BMZA 3CT4A 1DS6A 3TQFA 1XEXB 2WP0A 4QGBA 2WUGA 4FX5A 4GM4A 2PT7A 2JD0A</