4M2LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in nucleotide-free form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
409
structure length
398
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGITIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 97
structure length 398
sequence length 409
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m2lA01
4NCIA 1CRQA 1N5KA 3CNLA 5G3ZA 1NF3A 2QSZA 1X1RA 2V1UA 2RHMA 1YJNB 1TADA 4QRHA 4V0OA 4MDEA 1NG1A 3LA6A 2D2EA 2ODBA 3PFIA 2GDJA 1FZQA 1LS6A 3DZ8A 3QXCA 5EE1A 4JLBA 1KC8D 2AXPA 3ZIAA 1E9RA 2P6RA 1RZ3A 1IBRA 3MLEA 4WAUA 5B2ZA 1G9XA 2O8FB 3NHBA 4B2PA 4L9WA 2RGXA 1S1MA 1CF4A 1B23P 3A1TA 5EMNA 3MJHA 3TW8B 4BASA 3UATA 1Z2AA 2BBSA 4Q19A 4TT3D 5B57C 4MYTA 1FDRA 2H8KA 2VHQA 1Z22A 4NHOA 4MKFA 2I4IA 1FTSA 3IUYA 3HU3A 3WNBA 3BJIC 3KUCA 3ZZTA 3A4LA 1OFUX 2Z83A 1NG9A 3ICQB 2ONJA 2UVQA 2WKQA 4HUQB 1F2TB 1RE0A 4Q5IA 4EUNA 2GZHA 4G5SA 2FNAA 4OL0A 4KVGA 3KX2A 5FL3A 2QA4B 3TE6A 1XF9A 2BV3A 2QPOA 1Q1QA 3C41J 4YXWA 5KNCA 1S2MA 4LBYA 1KDTA 3QPVA 4U9UA 4C43A 2WSMA 1G8FA 1G8PA 4NCJA 4CIDA 1U90A 1KI7A 4ON9A 4EJSB 5EP1A 2ZU6A 3QKSB 1P75A 1JB1A 1HY3A 1PUIA 3GFPA 4B33A 4JLNA 3CR8A 5H59A 1O87A 3EARA 3L0IB 3PEWA 1FNNA 4CEIA 1CU1A 4TL8A 2XTMA 3T12A 1SXJE 3T1QA 3WRXC 3HJNA 2O8BB 4N0DA 2DFLA 2QEXB 3C8UA 4I1UA 3AF4A 2DHRA 1OIWA 2QE7A 5IK2D 5FOWA 5DN6D 4WVFA 4II7A 4HAWA 4EFLA 2X1VA 5C4GB 5DGXA 1IONA 1A2BA 3I32A 4WZ6A 4HDOB 2HXYA 1XMIA 3KKPA 1MO6A 2QM8A 3S1AB 4AKIA 5JHGB 1NBME 1L4YA 1N0WA 3SYNA 5KTYA 3EIHA 3KKQA 1EFCA 2GRJA 1MABA 5FTLA 4TMZA 2XOKA 3B2EA 1F48A 1Q7YD 2PCJA 3W8RA 4DLZA 1ZM2A 3RABA 4AC9A 4Q9LA 4FMDF 1IN6A 3VR3A 1CQXA 1YZGA 1XXHA 4C0SA 1G3IA 1VHLA 4C0BA 3ZYCA 5DHFA 3A1SA 2FG5A 1IXZA 1ZUIA 4HSEA 4XD7A 1NLFA 4E07A 1QBKC 1GKUB 5DYGA 1US8A 2EU8A 4LBVA 1IY0A 3W6PA 2ZRGA 1Q44A 2OE2A 2O8CB 2ZJ2A 3LQQA 4QHSA 4C0HA 4I81A 4QJ5A 2W6JA 2ZROA 4HDQB 5LPNA 2O8EB 1ZD9A 4RD3A 2IWHA 1JNYA 3R20A 3IGFA 4BEJA 5DHAA 3FKSD 3CR7A 3LLUA 1DAKA 2WICA 3PITA 3UKDA 1DAEA 4LJ6A 1W49A 1XNJA 3E5HA 3PUVA 3IHLA 1I4TD 1PZNA 1ZJ6A 4L5BA 1FUKA 1VCNA 3RNLA 4PC2A 3GFOA 2BM1A 4TSFD 1BO6A 4RVCA 5FTMA 4ACBA 2RGEA 3WYAA 5FFMA 2BMDA 1OXTA 1UEIA 3QEJA 1TUIA 3T1TA 3K70D 1QFZA 1KJYA 2J59A 4Q7MB 1OH5A 4FD2A 2ZJOA 3ECCA 1T3SA 3I3SR 5A0FA 4OI1A 5GJWC 1SKYB 4BFUA 3CH4B 5JMTA 5AJWA 1E9EA 2HV8A 2OT3B 1C1YA 3B1XA 4HATA 3X1ZA 1WMSA 4HUTA 3KJEA 5HCIA 2G88A 3GD7A 4BFZA 2VP4A 4BZPA 1G8GA 3EXAA 5G53C 3MCAA 2YWGA 1TL7C 4GOKA 3TKLA 4EPWA 1H8HA 5JZVA 3U4QB 2D7CA 2QORA 2QROA 1ZC3A 4JIMA 4XVUA 3EC1A 2FSHA 3TSOA 4TQUS 3ZVMA 3NC1C 4YAOA 4PPNA 2GJKA 4UXJA 3OIYA 4EIWA 2H57A 1JEDA 3KJHA 3CCMB 3THOA 1Z06A 2ZAOA 2EFGA 3ES9A 1COWD 1ZW6A 2CE2X 2ODNA 3CONA 3MWYW 2A5FA 2ZR9A 3FHTA 2GESA 3T06B 4D0GA 2JLZA 1JR3D 1G5TA 2O0KA 4Q00A 3SU8A 4PAQA 3FPAA 3LW8A 3AKDA 1VHTA 3EW9A 1E64A 3NH9A 1BKDR 4L4UA 3VU9A 4QOSA 4PHTA 2QTVB 4Q9KA 3RC8A 2ZRCA 2HF8A 1W7AA 3K9LA 3FB4A 2WJGA 3S1AA 4BFXA 5FH9A 4QM6A 1A82A 4P4UA 4Q4HB 4G1UC 4QC2A 3N5CA 5HE8A 4Q7JB 5CB8A 4TYYA 2J0SA 4IDPA 1NKTA 2SHKA 1KSGA 1XB2A 1KO8A 5SZKB 4PQFA 4TYWA 3P20A 2PBRA 4B48A 2ZS8A 3Q3JB 5DSZA 1W5SA 4G5RA 1RJ9B 1UPTA 2GJSA 3DKPA 2WOOA 4HLDA 4JLKA 3MSXA 4M1WA 4NYIR 1UBGA 4QBIA 1M6NA 4M0LA 5C4MA 2FGJA 2ZVQX 1R2QA 3KQLA 2BM0A 1K8RA 4MYCA 3LV8A 1VPLA 5GJVC 4UNSA 3CPEA 4XWAA 1W5TA 4HB3A 1G7TA 3AP1A 1S9DA 3G4SB 1S96A 4WQMA 2JATA 2AXNA 1NJFA 3QSYA 1XBTA 2BDTA 3NXSA 2QU8A 2FSIA 2J0UA 1WA5A 3CZQA 4KFUA 4DLTA 3GQBA 3KXLA 2HUPA 1KK3A 4XTRA 4HLQB 3VKHA 1FNMA 3ZD7A 4E5UA 1YZQA 1CJUC 4HUQA 4LJ5A 3QFSA 1KI6A 2Z5FA 2DWPA 2XXAB 1W0KD 1E2IA 2MSEB 2OUKA 4BLSA 1M7GA 4LBWA 3I92A 2XTZA 4DSNA 5FTJA 1SVMA 4C0LA 4XIGS 1NJID 3CD6B 4PSKA 2O8EA 821PA 1QGZA 1T5IA 2ZYWX 5GJBA 2RKOA 3WBKA 4MGIR 3THXA 2OCPA 2AKYA 1AGRA 2ZR7A 3LY5A 1Y3AA 3ZVNA 5B58C 3ZVRA 2D3WA 2QMUA 3PENA 2GCOB 1NKSA 2RGDA 3N70A 2OCYC 2OLJA 3KKOA 4EFMA 5L3QB 4RKFA 3CMAB 4TQ9A 1U0HC 2WMOB 4TMTA 2CRVA 4TSFA 3FTQA 4C0AC 4DB2A 4URVR 2O8DB 1XTIA 1UAAA 5TB5A 1E2JA 1W1WA 3A1UA 1G7CA 4OI4A 2AWNA 4BECA 2NMVA 4MKHA 4BZXA 4ZKEA 4TYNA 1ZNXA 1JJVA 2KBEA 1OFTA 4ZCLA 1OXSC 4DDWA 1NLYA 4B43A 1OKKA 2FGKA 5CYOA 4GZMA 2QG6A 721PA 1PJRA 2GVDC 3NG1A 3W3ZB 3ZZUA 4NZYA 4XVQA 5FBWB 3L0PA 2ZRLA 4RJLA 2ZRHA 2AD5A 1RW4A 2F9LA 4KAXA 5EP4A 4JLMA 3BH6A 4MDFA 1U98A 3IEUA 2ZYTX 3B5JA 4ESVA 1OT3A 3BK7A 3G71B 1LB1B 1QF9A 2GCNA 1NN1A 2AK2A 1E94E 4QFMA 5E95A 1FP6A 1K5GA 4DWJA 4QGAA 4A8JA 6Q21A 1WF3A 4ZPXA 4PPQA 4C7OA 3B1WA 2QGNA 1VQOB 2ZRJA 3KDSE 5FI0B 2IYWA 1VG8A 1Z29A 3IKJA 1XE1A 3CRMA 2H16A 1NVVR 2GXUA 2ZI6A 5HPYB 4D4LA 4JKYA 4XSGA 3SQXA 3VHLB 1HE1C 3GEIA 3TQCA 2NO1A 4P3YA 3B85A 4QNRA 4Q4AA 3BBPA 4C0KA 4ERNA 4C2TA 4HAVA 3ONWA 1G7SA 1Q82D 1XTQA 4KO8A 2FH5B 2J87A 5B30A 3AGPA 1K8AD 1DAHA 4DT1B 4DCVA 2FEOA 2FZLA 4O0MA 3QG1A 4XWOA 4C0QC 2OTJB 1SVKA 2VHUA 1N25A 3LD9A 1FX0A 1NBMD 4DXAA 1CR2A 1QVRA 3BD9A 1WQ1R 1N6HA 2JLWA 2YWEA 4AG6A 1XWIA 1JXMA 5J40A 1CXZA 2NO9A 3ZC3A 4N0EA 2G0TA 2GBLC 5FPSA 3TJZA 1T8UA 4PC7A 2DERA 1JA1A 4O2LA 2GPJA 3IILA 3CXCB 2JLXA 1E99A 1H8ED 1NVVQ 2QAGA 2D74A 1BIFA 4Q1CA 1D9ZA 3PQCA 1AQUA 2F1HA 2ZETA 2HXSA 2IYQA 1AZSC 3LO5A 1ODFA 4LI0A 1CR4A 1KI3A 1GAWA 1E79D 5CJ2A 2OAQ1 1IAQA 3CPHA 4IRUB 2J3EA 5EE3A 2AFHE 1ZP6A 2AHOA 1Z6YA 3OJXA 2TMKA 2IUUA 1OH6A 2GZDA 2PMDA 2JJ1D 3CWZA 3GEEA 4L8GA 3SYLA 1BJKA 2ZQ5A 3VR2A 3X1DA 5EXSA 2Q9AA 1W2GA 2UZ3A 5EZ5A 1F3OA 1GTVA 4FN5A 3AP2A 5G41A 2C8VA 3HWSA 3IO5A 1US8B 4P32A 5J4KA 3GLGB 1Q86D 1T3HA 1C4OA 1KDOA 2R9VA 1G8YA 3RS5A 1AQYA 2DPXA 2DWQA 1XEWX 3OEHA 2QMEA 3NEYA 2CLCX 3W5JA 2HMAA 1QFYA 4IFEA 1S3SA 4B3DA 1AKYA 1NRJB 1FP7A 5AJXA 2W0MA 5K8IA 3G82C 2C04A 2QMOA 2RGCA 3U7EB 3CRZA 3K9GA 2Z43A 1YIJB 2FPMA 2VA8A 3IIJA 3RYTC 3EPJA 3FMOB 2IS2A 4XTCS 4K46A 1XP8A 2CBZA 1FX0B 2ORIA 2CE7A 4JL8A 1B2RA 2XNJA 1VQ9B 2Y8EA 4M1OA 5CLQA 3SBEA 2QM7A 4H1UA 5E7JA 2HLDD 2BN4A 2XGJA 1ZBDA 1H8EA 3LX8A 3U3KA 1S8FA 4WBSA 1OYYA 4K8OA 3LQRA 1P9RA 4Q18A 2CNDA 3GJ8A 3Q5EA 2PZGA 1E2PA 2J41A 2WSSA 3MWLA 4ZO4A 1V43A 1YITB 4US1R 1N6NA 4IOKA 2GZAA 1VCOA 4IKEA 1F20A 2EW1A 4TLAA 1FFHA 5SZIA 4IVRA 1P72A 1Q3TA 1Z8FA 2FWRA 2RGNA 3GLFE 3CCJB 3QKUA 5HKKA 2JGNA 4GOXA 4LWZA 1Z08A 5EXTA 4B73A 3THWA 1JAIA 3T34A 2IYTA 2F3RA 4B44A 3I1FA 2LKDA 1OIXA 1OHHD 4BWYA 4Z51A 3G0HA 3OAAD 4JJKA 4LHVA 1EESA 2FFAA 3OIVA 1G3RA 3DOEA 2GNOA 3LH5A 4OHZA 3GJ5A 1E4VA 4BFSA 3FYHA 1DAIA 4MUAA 4UQOA 3B9QA 5ANRB 2Q3HA 4ABYA 1TF5A 2QPTA 1Q1EA 1OF1A 3GJ4A 4GFDA 2O8DA 5A5GA 3W6NA 2NQ2C 2ECKA 4RD2A 1QVAA 2FSFA 3AVYA 1SXJD 3WHKA 2B7BA 3TUJC 1IN7A 1SQ5A 5BYJA 4CT5A 4ACAA 1RKBA 1E2QA 5FR1A 2ZUCA 2FOLA 3KJIA 2RGGA 1AN0A 1W4AA 2FE4A 2H17A 5KDDA 2Z4RA 1AKEA 5FBVB 2NPFA 1U9IA 1RPZA 4YAWA 1YZUA 2ZI7A 4A6PA 2JLUA 4DCTA 1E3MA 4EPXA 1W47A 2V54A 2OK8A 1OGIA 4OJKA 3FE2A 2IS6A 1D2EA 3FVQA 5SZJA 1UDWA 1QDEA 4B76A 3EZ2A 4GMDA 421PA 1YU9A 4P0TA 2AK3A 3UG6A 1Z6XA 4CYMA 1JECA 1Z0IA 4ZCMA 3VR5A 2BKEA 3EPHA 3HPRA 5LD2C 4JT2A 3CBQA 1IM2A 4ZDIA 2GILA 3JQQA 2OLKA 1TMKA 1OPXA 4AYTA 4ZGNB 4TMVA 1KMHB 1SGWA 3E20A 1X86B 3OFND 4JL5A 2ZJZA 4W5JA 5E7MA 2YJTD 1QHNA 2R6CA 3SHFA 3I55B 1XFAA 1KI4A 4KJZA 1XMVA 1EWYA 1E2HA 2REOA 3PUYA 3TMKA 1N6OA 2FPLA 2W83A 1KMQA 3B13B 4CEHB 4KLNA 2H18A 2PEZA 1EFHA 1U99A 2DEUA 3EIQA 1WBBA 3D6TB 2YKGA 5DH9A 1EWRA 2ZUDA 4NMMA 3AVWA 2R6FA 3WP1B 1BMFA 4TMXA 121PA 3BE4A 1YHQB 1GNRA 1QHXA 2IBMA 3MRSA 4QM7A 5KHOC 4A82A 1UBCA 2VP5A 4BLRA 4M8NE 3GPLA 4RD4A 3IBYA 4LJ8A 5B64A 3ASYA 3Q7QA 3LBIA 5FL7D 1Z6AA 4G5GA 1E1QD 3K0CC 3ZS9A 2GF0A 1QH0A 1U0JA 4PPGA 4TZ0A 2JDID 1ZMXA 1W48A 1W4RA 1KGDA 4R2HA 2VRWA 3ND9A 1RRGA 1SVLA 4RFSA 4HLUA 2UKDA 2OBMA 2N46A 5BN4A 5JCZA 1CR1A 1ZC4A 1OB5A 1OLOA 4XH9B 4OQLA 1NVXQ 2IA5A 4PHGA 4LRWA 4BLTA 1P7CA 2N42A 4Z8YA 1TPZA 3VNUA 1GITA 3GCGA 4HLUC 4M22A 2O52A 3OIWA 4M1KA 4HLCA 1ZM7A 4C4PA 2FA9A 5H8WA 5DIFA 4HYYA 4DQLA 4D0NA 4UNNA 1WXQA 2FFBA 2PL3A 1P2UA 1XD2A 4BRWA 1BX1A 1GVHA 2REXB 3VX4A 1G18A 3L2OB 1W2HA 1Z0AA 1ZYUA 4A0FA 4WXPA 5DNYB 1EGAA 1CJKC 4O25A 3X2SA 3F0TA 3E1SA 1KI2A 2BMFA 2VYFA 2I1VB 3OZXA 3D3QA 1NNEA 3Q8XB 2V3CC 2FDCA 4Q1DA 2C9YA 1YZTA 1FL9A 3CUEF 1E9AA 5AN9A 3WNDA 2NG1A 2B8WA 5KNDA 1ESMA 1XD2B 2JJ1A 2JEOA 1XPRA 4LPSA 1PUJA 3B7GA 2MMGA 5H1YA 4HAUA 3BB3A 1DDIA 1N0VC 1OXUA 1Q21A 4LK2A 4XD7D 3VHXA 4C7OB 4Q1BA 2VNIA 4JVLA 4JL6A 5TXGA 1CIPA 5FL7A 2IYSA 1Z07A 1KTVA 3B1VA 4B2IA 2X2EA 4G5OA 4PAOA 2ZVPX 1BH2A 3KXIA 4D81A 1KOFA 1KI9A 2XX3A 3K9NA 1SKQA 3HR8A 3A6PC 2JLVA 1UADA 4KYIB 2XOKD 4QHTA 2FPKA 1DG3A 1I2DA 4RZUA 2V8OA 3FFAA 2ZSAA 3W90A 1QUFA 4BE7B 4KXFB 3QE0A 1G291 4LSGA 1E2NA 1MRSA 2VNHA 1VQ7B 1UKYA 2CNWA 2VHCA 3UXMA 5J4VA 3M1IA 2IEZA 4K1XA 2AN9A 4KV9A 4DKXA 3DDCA 1C9KA 3TVTA 1VTKA 1Z0KA 1H8HD 2B7CA 1WRBA 5H5JA 3CF2A 2WWXA 4JMPA 5DN6A 4E22A 4YMVA 3CC2B 1W0JD 1P5ZB 3OZWA 4QBFA 5TR9A 3OFNA 1ZRHA 1EG7A 1W0KA 4J0QA 2P0EA 4DLWA 4HAYA 4M9SA 4MGYR 3T1VA 2IYZA 3V4FA 3U5ZB 2GCOA 4NONA 4TZ6A 4UXHA 4BLPA 1E2LA 3ZJYA 5AR1A 4XWKA 1RYFA 4FXPA 1OHHA 1FUUA 3BOSA 1JEEA 4A2WA 2YV5A 2F55A 1MV5A 4B4DA 3W5VA 2IYVA 5GVSA 2ZRNA 2O8FA 4LC0A 2GTPA 4IVPA 1TEXA 1DADA 3AV0B 1W87A 2VHTA 3OF5A 2ZS7A 5UKDA 1YI2B 4DZZA 2WWGA 1M34E 1AS0A 3GJ6A 1GDDA 1OV4A 2ZE5A 4DRZA 2HCBA 3NKVA 1JB9A 4LYFA 4Q9HA 5ELXA 4KFSA 1JXOA 4IDNA 1CP2A 2RH5A 5GVRA 4EJSA 5KSPA 2V1XA 2VPPA 4RD6A 2J9RA 4MGZR 4ITRC 2P2LA 2WPDA 4DLYA 1SXJA 4U5XA 1KZ7B 1P4SA 2C95A 1E69A 3OIUA 2YYZA 3T15A 1XRJA 3DZDA 1MRNA 2QQ0A 4Z1MD 4LYJA 1VQ4B 3EZ6A 5F9HA 1MR3F 4Q7LA 2PZEA 3EC2A 1N6PA 2CHVA 1NIJA 4LJ4A 1KMHA 4G5QA 1UEJA 2IXFA 2HYIC 4X8MA 3H1TA 2ZIAA 1LVGA 1GRQA 2XTNA 1U8ZA 2XNDD 2OXRA 1IJFA 1A4RA 4Q1FA 5FUWA 1NJGA 4TTRA 4GPTA 5KU1A 3LRPA 3RVBA 3HDTA 4HZUB 3QPUA 1II9A 3SJZA 3L8ZA 1CULC 3L82B 2N1BA 5CB6A 3ADBA 3B78A 1XJCA 4MYUA 1AIPA 4ZGQB 4KU4A 3MG9A 2ZJBA 2ZRDA 3VR4A 3JZAA 3UMRA 3D31A 2AR7A 2K5UA 2ZI5A 1G5PA 5JWOA 2QPAA 1FMLA 2KE5A 1UFQA 2FF7A 2WWFA 2NO7A 5EP3A 2KJQA 2ORWA 3KKNA 5IF9A 2ZANA 1EFTA 2WIAA 4W7SA 1E32A 3AVXA 1R5BA 1Q3HA 1VKJA 1P3JA 2RGNC 1P2TA 1GUAA 3IHWA 1GAQA 4B6EA 4OI0A 3RDPA 1KHTA 4EDHA 1LTQA 1YR8A 3K70C 4S35A 2OK7A 3JZMA 1VYVA 2CJWB 3TSWA 2R6HA 1TNDA 1QHHB 3U4QA 2CHGA 1ZUNB 4EPTA 3CPWB 2GBLA 3EAQA 2YC4C 3MAAC 3LLMA 1KO1A 2JIZA 5JLJA 5JECA 5L3QA 1KNQA 1IXRC 4DQKA 2IYRA 5KSWB 3U3RA 1M1YE 3SJBA 4YQFA 5BN3A 3T35A 1Z28A 1UF9A 1YVDA 2GEUA 2QNRA 2ZRMA 3PIRA 2GQFA 4V03A 4FCVA 2A9KA 4ESHA 3KJGA 2B6HA 4JZKA 3V76A 1EP2B 3VO1A 2WWHA 3M4YA 4Q7KA 2EFHB 3IDQA 3NWJA 4ZI2A 3P26A 4M2LA 2C5LA 3TLXA 2C99A 1IN8A 1KK2A 4Q4HA 4FCTA 3GJ0A 2XB2A 3EZ9A 3A1VA 4PO1A 2LWIA 1W35A 2C03A 4TLCA 1VECA 4WW0A 4AKHA 3QUSA 4YMSA 3AQ4A 5TY0A 1OJLA 2BF4A 2LKCA 1OE0A 3NIBA 1T8TA 4F7WA 3VR1A 1EX7A 3W2HA 1P6XA 2GJ8A 4AKGA 1R0YA 2DBYA 2OSBA 3CLVA 3EPKA 3AKYA 3HP1A 2FFHA 3KKMA 2ZI3A 1HV8A 3RHFA 4P4SA 4F93B 1EFRD 4QG7A 4A9AA 1TF2A 4AK9A 2DETA 1BOFA 3UPUA 4Z54A 1Z0FA 2QMHA 3ADCA 4DLXA 3OHMA 4JVSB 2BJWA 2QTHA 4LHZA 4QKQA 4IDOA 1L8QA 4OK3A 1EFUA 3SI7A 5LB4A 4CZ2A 3AVVA 3QFCA 1OYWA 2PLRA 2YOHA 2PT7A 1G3MA 3GLIE 3ZDQA 3QE2A 3IO3A 2YHSA 4LHYA 3RRMA 2GJ9A 1OKKD 3OJWA 1ZNZA 2WV9A 2QAGC 4JLVA 2J45A 1R5NA 4RY2A 4P31A 3LWNA 4Y0VA 3T61A 4KBFA 2VO1A 2ZTSA 3ADDA 3VQTA 1GOTA 2IC5A 4A2PA 1OIVA 3QKRA 4O2RA 3THXB 3C16C 4F91B 5J5CA 2NOAA 5HKKD 2Q6TA 4IEEA 1YR7A 3ADKA 5JRZA 2R6DA 2D7DA 4Z1MA 4WZAE 5FI1B 2GEDA 1FRNA 1GKIA 1IN5A 3FMIA 3QF4A 4QJ4A 4Q4JB 3PCRB 4K81B 1E62A 4PHFA 1D9XA 3TNFA 2AWOA 4UAJA 3TR5A 2QSYA 1BYUA 4B74A 4M1YA 1KZGB 4ZIRB 1ZVQA 4MRRA 2QDXA 5EE5B 1Z5ZA 1LF5A 4IW3B 4TQAA 3OZVA 5FBRB 5JJKA 3WP0A 4FIDA 2BCJQ 3AVPA 1HQCA 1Q20A 4I99A 2KBFA 1SULA 2WAXA 1VQPB 4CVNA 1GIAA 2GKSA 3JVVA 4Y9RA 2BVNA 4B3GA 2ODEA 3KTAA 2A5JA 1DTSA 5LBIA 2PJRA 1RRCA 3CWQA 2O8CA 1CNFA 2CK3D 1ZIPA 5FOXA 621PA 3LVQE 4R71A 5DI3B 1KYIA 4JJZA 3F3YA 1XD9A 3R9IA 3C7KA 2Z0MA 4RD0A 1I4LD 3CC7B 1AM4D 3Q9LA 1TQ4A 4YDSA 2GF9A 4D26A 1N6RA 3A4NA 2BC9A 2G6BA 1ANKA 4G3XA 3VMFA 2KWIA 5L3RA 3WBJA 3I8XA 4TL6A 3V00A 2L0XA 4B71A 1ZD8A 4D6PA 1X6VA 4GP6A 1D2NA 1LS1A 5AUQA 2RC6A 1VQ6B 3W5UA 4JLAA 4R2IA 3VU9B 1VG1A 1CR0A 4X8OA 4BEBA 2OCBA 2BPOA 4NCNA 1W4BA 1E6CA 1HE8B 3SZRA 2OFXA 2RMKA 1XPOA 2OBLA 1AK2A 1FNDA 2G77B 3AH8A 2CNWD 4BFYA 2OHFA 2J7PA 5JFGA 1Q0UA 2VEDA 3T1OA 2IHBA 3U44B 2CCGA 1XEWY 5JHHB 2R6AA 3TK1A 2QAGB 2VIIA 2EWWA 5C1BA 1ZNYA 4HEJA 4ILEA 4MKIA 2ZE6A 1LFDB 4CW7A 3TUZC 2ZPTX 2ZI9A 4NKRA 3M6AA 4BFWA 3BB4A 3EIEA 4P33A 4RSGA 5IT5A 4IXMA 5AJZA 3K1JA 4TTPA 4W5HA 3U61B 2IWRA 4LGMA 3QFRA 3F5FA 3QENA 4G01B 5G40A 2LCFA 1H42A 4ZI3A 4LJYA 1E2EA 1WBDA 3I72A 4LZZA 3LO8A 4URWR 4LX0A 1TEVA 3A36A 3AF2A 4EKDA 3E1YE 2ZU0C 3THYA 2B5OA 2P65A 2IYYA 1Z47A 1F2UA 3TH5A 4Q4LA 4Q9IA 2NO6A 3QBTA 5JS7A 1RRFA 5BQ5A 2QI9C 1R0XA 1OXXK 4M1TA 4RCYA 2F7SA 3WMEA 1N5JA 3K0CA 2X3UA 1KRHA 2E9SA 1QHHA 4TWZA 2V4ZA 3EASA 3P4YA 4V0MA 3SHWA 3TW4A 1R10A 3T5GA 2GVZC 1EX6A 2PX0A 2XNCA 2ZITA 4C30A 3JQPA 4RZ3A 1PLJA 3K09C 521PA 4P6VF 2WJYA 2IT1A 1A5TA 2VP2A 1GVNB 2QRZA 3FKSA 4PC3A 3I8SA 5CIWA 5CM8B 2VP0A 4L16A 3NBYC 1JQLB 3RRNA 2XZOA 2JJ2D 4KODA 2F1RA 1YZNA 3GEHA 1T0HB 4XOIA 3W5HA 2WVJA 1AS2A 4TL7A 3K09A 4HZUA 3QJYA 5CYPA 1E2DA 4AWXA 1BQEA 1GJRA 1T0JB 3EA5A 4Z8XA 4B47A 5FPYA 4OQMA 4G1BA 4BGDA 4CT4B 4OHYA 4FI3C 3R7WA 4YLGA 3VKWA 5FA6A 5AJVB 2ORVA 2EIXA 3CF6R 3CRVA 4LUCA 2F6RA 2IF2A 5LD2B 4NL4H 4TN1A 5JBQA 3B8HA 3I4LA 1QGYA 2BOVA 3Q72A 2WAYA 2JIZD 4GNKA 2R44A 2QGZA 2WPDD 4F4CA 4GDFA 4US2R 5LB2A 4OK5A 4LBZA 4DLUA 1TVCA 1XJ0A 1RIFA 1JAHA 4KFTA 2XAUA 4KFRA 4EQ6B 4IFBA 4PO9A 3QNUA 1ELOA 1MO5A 1F60A 2NZ8A 1EK0A 4URUR 1DAGA 4LV5B 4NYMR 2CMKA 4CDGA 4PTLA 1D1NA 4M1MA 3W8NA 2V6JA 2WOJA 4NYJQ 3E2IA 3WRYC 2JLYA 2XNDA 2D4HA 3CX6A 4Y7CA 2QZ4A 5AUPB 1N8RD 3NBZC 2F1IA 8OHMA 2FZ4A 3C5CA 2ZAMA 1NN0A 3IQXA 1IY1A 2Q3MA 4LOAA 1ZAKA 5JJLA 1R0ZA 1OSNA 2EFDB 4CRWB 1PLKA 3R9WA 1QG2A 4DEYA 5FPTA 3LNCA 3SE0A 1JPNA 2HT6A 2W00A 3LFUA 4RFSB 3D8BA 1GL6A 3RSOA 3U3JA 2WHXA 3CF0A 4UNRA 4DLVA 4AG5A 2XB4A 2CEAA 2PX3A 1KKMA 5BYKA 2ZSDA 3SFVA 1S0UA 2J0UB 1GP2A 2X77A 2DY1A 1R7RA 4POAA 1KAGA 3WHLA 3W2FA 3EWSA 4F38A 4DBLC 3GLHA 4DHEA 4H9GA 4MRVA 4R7ZA 4AURA 1KO5A 1CLUA 5FR2A 3CM0A 2HT1A 2YOGA 2RB4A 2CL6X 1VQNB 2P5SA 1J2JA 2X19A 2HF9A 1XCMA 2IYUA 1IB0A 2XZLA 1HT1E 4V0LA 1AMOA 1KO4A 1MKYA 1KI8A 1ZNWA 2PEYA 2XSZA 3H84A 4QL3A 4DCSA 3AB3A 5FOTA 3H0KA 1EP3B 1AA9A 1R8SA 3SN6A 2VF7A 3A37A 1QFJA 1E9CA 2GWHA 3RSLA 5AUNB 2ZRIA 2VLIA 2AKAB 2R65A 4TYPA 1NIPA 2QY9A 3RAPR 3AGQA 5KDOA 3CZPA 1XTSA 2QAJA 3MWJA 1FW6A 4PC6A 4MA4A 4MRSA 2ZUBA 3A1WA 2GEVA 4GZLA 4LJ9A 3TAUA 3RS7A 5L3VA 1E0KA 3THWB 3BXZA 3PUWA 4IDQA 2G3YA 3QVUA 4CEIB 3BWDD 2WSSD 5J4LA 2CXXA 3BB1A 3DKVA 1GAJA 2QT0A 1GO2A 2PMKA 1SHZA 4LV6A 4MH0R 3QF4B 2J5XA 4LHXA 2ANBA 4GL2A 5EXPA 2VF8A 3EG5A 2WKRA 5HTKA 5F3WB 1I7PA 2G0NA 2JJ2A 3V4RA 2EYQA 4Q1AA 3OW2B 2OEPA 2DFTA 2XJ4A 3DEFA 3K0EA 4XJXA 2XJ9A 2V7QA 2ZS9A 2WJIA 3R8CA 1E9FA 2HJVA 4YAFA 1FQJA 3THYB 3L8YA 2ZSBA 3CNOA 2WM9B 4CF7A 2QTFA 1E1RA 2ZM5A 1M2OB 3MJRA 3H86A 1XPUA 1YZKA 5FPHA 1LNZA 2CK3A 2V9PA 1XU4A 4OQNA 2ANCA 2WBLC 2D62A 3UWOA 3GMTA 3KQHA 2VH5R 3I61A 4GI7A 1YE8A 4LCBA 1D5CA 3QOFA 4M9QA 1WB9A 1H85A 1KK1A 1M90D 1KNXA 4DSOA 2YC2C 4TLBA 1CJMA 4QBHA 3CMEB 2RHDA 1U0LA 5FBQB 4B3CA 2QN6A 1DAMA 1KKLA 2BBWA 2EFEB 1GR1A 2EVWX 2YZ2A 3LW7A 5JEEA 2GK6A 1O3YA 2FU5C 4Y0AA 4HAXA 1W36C 4AF7A 2YWHA 1GZSA 2A78A 4EFNA 3AVOA 4KI0A 1AGPA 3CO5A 3KXKA 5KOYA 2DB3A 1P9NA 3JVUA 3GLGA 4DLRA 2F43B 2XZPA 3KQNA 3PEUA 2CLSA 3NC0C 1E0SA 1SVSA 1G7RA 5TDHA 4C2UA 2OFOA 4LHWA 1I4DD 2WMNB 3EZ7A 2BMEA 1EWQA 2G83A 1N3BA 3LBNA 1KSJA 1Z3IX 2PLFA 4UKDA 1JA0A 3SOPA 1IQPA 1UKEA 5JS8A 4HB0A 4EJSC 1G16A 4JBXA 2RGAA 2WWWA 2OXCA 3CRQA 2Q21A 4GT1A 4I1SA 1GILA 3AKCA 3LDAA 3IQWA 4YMUA 4Y9UA 1L2TA 4JSYA 1D6JA 3W9YA 3LXXA 4KSBA 1NSFA 5F98A 1DG1G 3X1YA 3BFVA 3GLHB 1V5WA 3WY9A 4URYR 5BWMA 2GXSA 1PV4A 2XNSA 3W6OA 1G19A 2BGJA 4DVGA 1TTTA 2P67A 2OILA 5EUQB 4QBGB 2Z6VA 4MRPA 2R62A 1ONBA 4AIIA 1SXJB 1XX6A 1SVWA 1Z2CA 3IBGA 1OB2A 4URXR 2QUZA 3TUIC 1MT0A 1H65A 3ZS8A 1DOAA 4CEJA 3SEAA 4D4JA 1RJ9A 1I2MA 3TRFA 3UWKA 4AD8A 2EFCB 2HCJB 4MKGA 3VKGA 2F3TA 4FMCF 2IXEA 2C96A 3I5YA 1VDZA 3OZUA 4V0KA 2QTLA 3PJRA 4KSCA 3QEOA 1IJEA 4IOJA 3P27A 4F7DA 1W4CA 2H7VA 3W5IA 3PEYA 4MITA 4D4KA 4TL9A 3SS8A 4EH1A 4L9SA 1IHUA 1NMYA 4GSYA 3CB4A 2ERXA 2YWFA 4PZLA 2YOFA 4C9BA 2O0JA 1NDHA 5IDVA 1G21E 2IX3A 4TTQA 1RC8A 1ZCBA 2BEKA 1A8PA 2CJWA 4MYHA 3RS2A 5C18A 1W36D 1UDXA 1TQDA 1GFIA 1KDRA 4Q02A 2Q9BA 2OBNA 2OV2A 3K9HA 3QXHA 1SZPA 2OM2A 4FINA 1WE2A 2VYQA 1P2VA 5FUXA 4F4IA 1MO3A 2IW3A 2JLQA 5EE9A 3WMGA 4G0NA 4NU0A 2WWYA 3WNCA 1KI1A 5CLLA 3GLFA 1E98A 2OZEA 1ZUHA 2A5GA 2C77A 4LYHA 3CX7A 2R6GA 2BMJA 2QRNA 2AFIE 1VG0B 1U9IC 1TLLA 3BRWD 2J0QA 2BHRA 3I62A 3B1ZA 1KDPA 1NVUQ 3P1JA 3B82A 4V0NA 3U6BA 5CIQA 3REGA 1R5OA 1LV7A 1VIAA 1II8A 4DDTA 3BH7A 4YDHB 3SR0A 1J7KA 1N0UA 2H1LA 1NLZA 2EWVA 5BN5A 2R8RA 2XXAA 1DDGA 3L0OA 2BEJA 3HU1A 1QHIA 3L43A 5JSZA 1WDTA 3ZQJA 5LDDC 5EUMA 1OH8A 2VP9A 2Z4SA 3QBVA 4YHBA 5DI3A 2NPIA 4A4DA 4DIEA 4B35A 1DARA 3MHPA 4N3NA 1VQ8B 4IDHA 4X8LA 3OEEA 5KDLA 1M8PA 1YR9A 4PFSA 3NVAA 3A58B 1A2KC 1XZQA 2J7KA 3PEVA 2IF0A 1BYIA 1ZCAA 2GA8A 2P5TB 2IXGA 1II0A 1GSIA 1T91A 4NBSA 4Q01A 1XJQA 4HE6A 2VQSA 4IXNA 1YHNA 1M7HA 2WJHA 2ZREA 3GJ7A 2YNMA 1IOZA 1K6MA 2ZJ5A 3PUZA 4JLPA 4NPHA 4R9UC 4S2EA 3K0AA 3UIEA 4PSVA 1NI3A 3U6KA 4N1AA 5EZ6B 5IRCD 4A0RA 3GFTA 1HT2E 4PXAA 4DT1A 2UZIR 5CDFE 4DB4A 3KL4A 3CCEB 4DUGD 1N2CE 2ZRFA 2W6IA 4KITB 1XTKA 1E9SA 1RVDA 4PQRA 2OESA 2MSCB 5HCNA 3U7FB 2ZE8A 1NY6A 1E79A 1NSTA 1JPJA 2ZSEA 1MH1A 3DO6A 3C5HA 3KB1A 3NEJA 3ND8A 4JVMA 4PR0A 4Q21A 4TT3A 5CDFA 4I1VA 3BAFA 2PZFA 2E1RA 5THXA 4EPRA 4U00A 4ARZA 4ZCIA 1DBSA 2IEYA 3KQKA 1T9HA 3RLFA 4YC7A 3FFBA 1VG9B 3PG5A 4LY6A 2RAPA 1J70A 1NMZA 2VTKA 4U02A 4W9MC 1J90A 3SQWA 4YMTA 3CRRA 5KSYA 3U3OA 4CEJB 2WZQA 1T4GA 5EXXA 3RS3A 1Z0DA 3DMDA 5K8TA 4AF6A 4Q03A 4AYWA 3TSZA 3ZZ0A 1N5IA 3NBXX 3WMFA 4B3XA 4DSUA 4BFVA 1VIYA 4JVNA 2GK7A 2F43A 2QEQA 3HYRA 3AUYA 3IIKA 1M1KD 4H1VA 2W6JD 2CL0X 4W5WA 2DWOA 4DLSA 5KPJA 4Q47A 3GLIB 1D8TA 2ZYUX 1TQ6A 2ZI4A 4FWTA 1VYUA 4A0GA 3MUFA 1G4UR 1N6IA 2IUTA 3A4MA 2ZE7A 4ZV4A 2WJJA 3BIFA 3EA0A 1SXJC 3NH6A 1W46A 4L15A 4M9ZA 4BLOA 3MGCA 4NCKA 4ASUA 3IPXA 3I56B 1VQMB 1CNEA 1NVWQ 1GL9B 3K0FB 2B92A 1G5RA 1T6NA 1MOZA 1XD8A 3NHAA 3VFDA 1XTJA 1PVOA 3ZIAD 2IYLD 1AS3A 3LVBA 2YVUA 2WKPA 4A2QA 3O47A 1COWA 4IVQA 3U2QA 1HH4A 2HEIA 1W34A 2QENA 1N6LA 1EFRA 1G4AE 2H5EA 1UKVY 4PPFA 4KHZA 4HB2A 1IXSB 1U8AA 4LPKA 1HA3A 1DE0A 1TX4B 2GHIA 3K0FA 4Q4AB 5L3SA 5JWRA 5GV7A 2G1JA 5F2EA 1KAOA 2QTZA 4OQXA 2EQBA 4PZYA 4AY2A 4A15A 4NYIQ 1A7JA 1J8YF 2P6NA 5AJYA 4A8JC 5KSOA 1U8YA 4WIAA 5M04A 2PCLA 4PO8A 3R8FA 2ZEJA 1EXMA 3K0SA 1F2UB 3TGPA 1S4QA 2MSDB 3C14C 1P2SA 1JQJC 1QHGA 1Z0JA 4LJAA 3M0EA 1LW7A 1Q12A 3CCLB 1FQKA 4GRAA 1P61B 1DAFA 1B0UA 5DO9A 4JBYA 1G1MA 2ASEA 2W2TA 5HE9A 2A3RA 4EAQA 3OEED 3U7GA 2Q9CA 4XSHA 5BW8A 5EP2A 5JWHA 2ATVA 5CK4A 1KY2A 3RANA 4NYMQ 1M74A 4QNMA 2REBA 4N3GA 4PHHA 2O5VA 3UANA 3GLFB 4Q48A 5DYIA 2CCKA 3BS4A 3NDPA 3UMFA 1U2RA 5GADl 3HYTA 1K9MD 4FCWA 2V7QD 2FN4A 1IY2A 3BC1A 5EQTA 1XXHB 1BX0A 1FRQA 4JS0A 3NTUA 5KUTA 4B3BA 3CC4B 3CCUB 4B2LA 2CL7X 1XEXB 1QZXA 4P4SB 3QXJA 3DMNA 3TVDA 3QG5A 4BFTA 1GKYA 1RFLA 1FNCA 1XDBA 3AKEA 3FHOA 2J0VA 1L7VC 1TAGA 4OKSA 2OCAA 1S3GA 2GXAA 1R4AA 1L4UA 4F4JA 1T3LA 3ZBUA 4DCNA 2QBYA 2J7PD 1D2MA 3TBKA 2JDIA 2VNJA 2IYXA 3QKTA 4Q1EA 1GRRA 3DM5A 3FKQA 4BQSA 1KJZA 1CKEA 1UBEA 2GCPA 5KO2A 5KSZA 5JJIA 1NMXA 2RCNA 1XCPA 2W58A 4M4SA 4ZDWA 3UK6A 4HAZA 3SYKA 1UM8A 1HTWA 2BCGY 1M7BA 4PAMA 4PC1A 2QL6A 3SDZA 4PGOA 5CM9C 1GL7A 4WOPA 1E0JA 3GLGE 1QHYA 1OH7A 1KK0A 3AVUA 3CIOA 1DEKA 2P3SA 2G1KA 1GWNA 1RYHA 3I5XA 2VSOA 5IHPA 2PT5A 1UKZA 1KQSB 3QVVA 3QI2A 3DL0A 4NTZA 2BIFA 1KJWA 1YJ5A 4WA7A 1KD1D 1FTNA 1QVFB 4RZ2A 4ZIRA 5JSZB 3VX3A 4WXRA 1HEIA 2NTYC 3TR0A 3U44A 1CRPA 1ZM4A 1TQ2A 4GMXA 4CGZA 4PANA 4HB4A 5FOSA 5C2JB 5A4JA 3RC3A 1XMJA 2ZSFA 1BMFD 3NBFA 3KFVA 4NH0A 1KSFX 1N6KA 4QXAA 2BWJA 5L3SB 1CS4C 5AUOB 2XEXA 3VNVA 4A8JB 1G3QA 2E87A 3CCSB 2NIPA 4QGGA 4DIDA 4KVAA 1OXVA 1NN5A 1Q1ZA 1YKSA 1OFIA 4Q9JA 3QPWA 5JRJA 1XZPA 5TVKA 2JLSA 2VSFA 1F6BA 5AWFC 1FMJA 2J1LA 4KBGA 2QQEA 4ARZB 1CTQA 3W2GA 3N2IA 4JBWA 4A6XA 3K70B 3VAAA 3GP8A 2OFWA 3QQ5A 5FTNA 3K53A 3CX8A 1HYQA 2A5DA 2W2XA 4OHXA 5JCPA 2R2AA 5J47A 2P6UA 1E2KA 2H92A 4MQBA 1VYTA 3ETLA 4UJ3A 4BPRA 1NL3A 1W44A 4FK8A 2GAAA 5AK0A 2Q3FA 2W6ID 1K5DA 3PV0A 1LF0A 4OK6A 1Q22A 2AL7A 4RFVA 5H68A 3E70C 3QF7A 2KI5A 2IS4A 2IK8A 4KYUA 3AP3A 4OJQA 5E3HA 1SM4A 2IL1A 2F9MA 3O8BA 2GJAA 1E2MA 4Q66C 2J46A 3JQRA 1JI0A 4LDJA 2VP6A 3ZGXA 4D2IA 3BORA 4UNPA 4B6FA 2OAP1 3CCRB 5BXQC 3BH0A 3PUXA 5HZHA 3Q5DA 1E2GA 1E4YA 3CCVB 1X8LA 4JYCA 4B75A 3BFXA 4PX9A 1LY1A 3LBHA 3SC3A 3GLHE 2C98A 4OHWA 1F5NA 4C0JA 2GETA 2ODWA 4D82A 5FPKA 3B1YA 1WCV1 2KB0A 3RRYA 3FMPB 1J9ZA 3VTKA 1CJTC 1DO0A 2BBOA 1YRAA 5E7IA 4NE2A 5E4FA 2ZRPA 4URZR 2NGRA 1FOEB 4ASUD 3U7HB 2DFNA 3QKRB 3QKSA 2ZYVX 3HPQA 1ETUA 1VQ5B 3DOFA 5FOVA 5HZKA 2DCUA 4TLDA 1E0AA 3PVSA 4EPVA 1XXHE 3UG7A 2CLDX 1CJVC 1Q1BA 5FTKA 3SBDA 3G5UA 3QXXA 4KLZA 1GRNA 3HU2A 5FUYA 2WIBA 4BUJA 1N5LA 3H2YA 1X1SA 3TQFA 221PA 3ZQ6A 4D0LB 2WTUA 5K8UA 1GNPA 3C15C 4OYHA 2OTLB 4AI6A 3FOZA 1NBMA 4YONB 3O8RA 2V6IA 2VZLA 3FPKA 2VL7A 3KUDA 1TU3A 3QIAA 4UXIA 1X8JA 3AEZA 3OE7A 4IEIA 3KTAB 4RCZA 1MABB 1P73A 3AF3A 4GOJA 4I1OA 1TF7A 1ZU5A 2A7QA 1G17A 2CCJA 3P4XA 4ZDKA 2A5YB 1JR6A 2HYDA 3FMFA 3X1WA 2XSZD 1XTRA 3PR1A 5DI9A 1EP1B 2BSAA 1DS6A 1SVIA 4DEXA 4ZDJA 1Q57A 1FPMA 2BKUA 1NP6A 5J4YA 3ZD6A 1J99A 1CEEA 4HZIA 4AYXA 4FWIB 2CHQA 1JBKA 4QGFA 3AF0A 2O8BA 3MMPA 3EZFA 5DLQC 4NDZA 1BS1A 2Q0HA 4I4LA 1Z63A 5DE3A 1S1CA 3BFKA 3L0SA 4RZXA 3KB2A 1S9HA 1ZIOA 1XEFA 2FJUA 3ZLJA 4LJ7A 1G41A 1G8HA 3SJAA 1OGJA 3MD0A 2DR3A 3VO2A 1KIMA 2XITA 3G6EB 1X3SA 3AUXA 4PSAA 3FHCB 2ATXA 2QA5A 2JASA 4FW9A 4HI0E 4V0ME 4HDCA 1QVGB 3CNNA 4OQFA 3RS0A 5HR5A 3ASZA 2B21A 2X8AA 2I3BA 4YAUA 4D80A 3DVLA 3R9XA 3TIFA 4JLDA 3CH5A 1J8MF 2AD1A 2GAOA 4LV8B 4E03A 2VSXA 5JI3E 1W36B 1SHKA 3WXMA 2PH1A 2PIAA 3LAWA 2QP9X 2BGIA 1E1RD 1A1VA 3PXGA 1GNQA 3ZVLA 4A0HA 1Z6GA 3CW2A 4M1SA 5TMPA 1SVOA 3RWMB 1DPFA 4YALA 2W2VA 3N2EA 5C46F 4RKEA 4P4TA 3R7WB 5GJCA 2D2FA 2ZJYA 4M9XA 2YINC 1VMAA 4RD1A 1G6HA 3BERA 4PQYA 4QGHA 3A8TA 4JLOA 2A30A 2EYUA 2HLDA 2C78A 2B8TA 4GP7A 5P21A 2X2FA 2ZRAA 5FUVA 1Q81D 4FMCB 4A92A 4NYJR 4YXWD 2HJGA 1ZINA 3IPYA 4R98A 2W0SA 5KNBA 3IEVA 4PZZA 3U3MA 1YZLA 3DHWC 2PJZA 3SFZA 4D4MA 2QE7D 2WJVA 5IK2A 1DO2A 2FEMA 1QX4A 2JJ8A 1AJEA 1HUQA 3TAHA 2QBYB 1DVRA 1NN3A 3B60A 4US0R 1QG4A 2ERYA 3AVTA 4M53A 4DSTA 2BJVA 3OEHD 5DISB 4G1VA 3EWAA 4QJ3A 3KFXA 1U94A 3K8YA 1WP9A 1FNBA 1ESNA 2F1JA 3V9PA 4CEHA 2CVFA 2OG2A 3HR7A 3Q7PA 4KCGA 4B34A 2BBTA 1E9BA 4DUGA 3UMSA 1RRPA 2ZJAA 3OE7D 3QY0A 1G20E 1QGAA 3MFYA 1QUEA 1PLLA 1JR3E 1NY5A 2HDNB 5H70A 1E63A 1VCMA 1GM5A 3K0AB 2IUSA 1JJ7A 4AKEA 3CKLA 4JLJA 3FDIA 5EE0A 3WYFA 4NP6A 3CPJB 4EQ6A 4FMDB 2RC5A 3W3AA 1QG0A 1KO7A 3MWKA 4TMWA 5CK5A 2AX4A 1HURA 1P60A 4DDUA 5D3QA 2ZR0A 1X8KA 4BRUA 1U81A 2FMXA 4OI2A 4UJ5A 4ZKDA 1YJ9B 3OESA 1UJ2A 4TLEA 4TYQA 1E96A 1Z83A 3B6EA 3D7MA 4MRNA 4QHYA 5KYKA 2ONKA 3B9PA 2DFKB 5SZHB 3P32A 1W0JA 3BGWA 4JT4A 2C2HA 2JCSA 1SKYE 1E1QA 2C9CA 1ZM3A 4IOMA 5JI2E 3VR6A 3FGNA 5F9FA 2O0HA 3ZBTA 1CBUA 3F8TA 1YQTA 1II8B 2ZRBA 1E2FA 5G3YA 3H4MA 5EJEA 4GBMA 3SJCA 3CCQB 1VQLB 2WWIA 3RS4A 3QFTA 1IN4A 1JALA 1KSHA 5FBLB 3OAAA 2CDNA 2JAQA 1P9WA 2CVHA 4HE5A 3X1XA 2FV8A 2FSGA 1YR6A 4JSTA 4IJMA 2OO7A 5D3MA 4F92B 2NZJA 3KQUA 2VNKA 1ZD1A 2A2ZA 1G64A 4UNQA 4X8HA 5FOUA 3GJ3A 1G6OA 1T5LA 1XEXA 5CITA 1HQYE 4BZQA 2V55B 1F2TA 1MO4A 3RRZA 2C9OA 4BLQA 3W2EA 1YJWB 1UMKA 4M21A 1DELA 2FX3A 4WZBE 1YRBA 3QXSA 2IS1A 3LX5A 4B3FX 1QHSA 3ICEA 3W34A 2JLRA 3Q85A 1QRAA 3O8CA 1TU4A 1VCIA 4IOLA 3GLIA 4DCUA 3CRW1 1KY3A 4LYAA 1OFHA 1E9DA 5GV8A 4TMKA 3FJOA 2QT1A 3LXRA 4JYBA 4C3ZA 5L8VA 4V02A 2ZRKA 1TUEA 4A1FA 1ZU4A 3GJXC 2ZXUA 5J4HA 2G9NA 1XMSA 3AM1A 1Y63A 4IHQA 5D3MB 3SNHA 5CJPA 3RWOA 4YMWA 1OW3B 3T5DA 2BMWA 3DPUA 2KSQA 4O3MA 1GG2A 1K73D 4MUBA 2MMCA 1P62B 4BPBA 4U7DA 3AF1A 4OHVA 3EX7C 1R0WA 4Q4JA 1W2BB 3DM9B 1JJ2B 3AVQA 4DJTA 4EPYA 3EPLA 1XCGB 4OBEA 3I73A 1JR3A 2VHJA 1KI6B 3KZ1E 4JKIA 2DYKA 2QP3A 4B32A 5HXBA 5TV2A 2RGBA 4LC1A 3REFA 3WYGA 4DDVA 4MGKR 4DC9A 3NDBB 4D25A 1G3UA 4E09A 3J81k 4FMBB 1S72B 1ZM9A 1R6BX 2JA1A 3O8DA 5KPDA 2NO0A 3FWYA 4NCHA 2FFQA 5TARA 3C4JA 1AZTA 1Z6TA 3U60B 4A36A 3W2IA 3LVRE 2I1QA 2VBCA 1R8QA 3IIMA 2QP4A 2ZJ8A 3ZH9B 1UBFA 2D06A 2IHYA 5K8LA 5JEDA 4XVRA 2GXQA 1VQKB
chains in the Genus database with same CATH superfamily
5CTJA 3VH1A 2QUAA 4NCIA 4AS3A 1JIQA 1JLLA 1N5KA 2CLMB 4I4TB 2WM8A 1M1XB 1NF3A 4UCWA 4RL4A 4QQKA 1K7YA 4QRHA 1NG1A 1V45E 2D2EA 2J3DA 1LD3A 1FTQA 1XVTA 3N8GA 3TMYA 2P4UA 5CDUA 1EEHA 2H0AA 1FZQA 1LS6A 4AUKA 5EE1A 5FP0A 3KM0A 4V1CB 4JLBA 4JEHA 3ZDAA 2WDPA 1GQOA 4A16A 4WAUA 1T26A 1G9XA 3H1FA 5EERA 3F2VA 2XB8A 3NHBA 4UHKA 1XRNA 4B3MB 1ZD3A 1RYBA 2RGXA 2YV2A 3PHCA 5FQNA 5JBIA 1CF4A 3ELYA 2XUFA 5MGNA 1H4TA 3IOCA 4NE7A 2I65A 3ULKA 5LOVB 3TW8B 1Z2AA 1DC7A 4MV8A 1GXSA 2O2ZA 1ZLYA 2PYZA 4B45A 1E6UA 5IKMA 1N1GA 4N7JA 1FDRA 1V71A 2VHQA 1EGQA 1LDEA 3MILA 5L6MB 3AC0A 3A1EA 4BKOA 2I4NA 3JQEA 3WNBA 1AGNA 4R3WA 3SZLA 4D96A 1L5LA 4KNYA 4D3ZA 3BJIC 5L3ZA 3H99A 4MAAA 4ROSA 3VVMA 1NT2A 3VZCA 3EFOA 4FW8A 4MW0A 2AIRA 2VPIA 3VVCA 3OTQA 3WJ1A 3PP8A 2EWMA 3K6SB 2E4XA 2Z83A 3UC9A 5HP4A 3LUGA 2A9FA 1HPLA 1TW3A 2GNAA 3Q2KA 2V7BA 4Q5IA 1KMNA 4XYGA 3V3TA 2GZHA 3U13A 2FNAA 2P41A 2BGNA 1BXRA 3H3JA 1AE1A 1LX7A 1ECFA 2P2CA 5IH3A 3GA5A 4D98A 4CKWB 4YXWA 4ESOA 2C1XA 1CWUA 3NGLA 4IAOA 3JWPA 1P8AA 3TLBA 4C43A 1FK8A 2FWJA 4CNQA 1G8FA 4HWRA 1G8PA 5BNWA 1P31A 3UMMA 1TO1E 4Q37A 4XMYA 3G8BA 5EP1A 1P75A 3MMSA 3EG9B 2C3YA 5GGYA 4B33A 3L0ZA 2LIVA 3EARA 3NHRA 3PEWA 4UM5A 1FNNA 1LBQA 4UVHA 4KTVE 4BAGA 4RDLA 3FPFA 5CXUA 4K9KA 1SCQA 3VPSA 5HZAA 4FYPA 3CT4A 1JXQA 4OUKX 4B4KA 1N0HA 2Z1MA 2O8BB 1J39A 2ZVDA 4OA5A 2QRGA 3EFEA 1JYSA 4LXIA 4I1UA 4OXNA 5DJ5A 1E1NA 1PYOA 2DHRA 3EPPA 1H0SA 1NOKA 5IK2D 1AURA 2Q6IA 4RPBA 4II7A 3WGGA 4HAWA 4Z1OA 1ZWKA 2H2WA 2UUAB 1BEZA 5I45A 2FUCA 4A27A 4W63A 5DGXA 3WRXA 2ENWA 3GLUA 3ZDRA 3EBPA 1ILEA 3M2PA 1IN1A 1DBWA 2QLTA 3S1AB 1YV9A 2GD0A 3BMQB 5JHGB 4IY1A 3W3AD 4DJDC 3IJRA 1W25A 5LUAA 2PZBA 3JD3A 3GPCA 1EFCA 4W1RA 1MABA 4GXQA 5TSDA 4EGAA 4B4WA 1JHOA 3LIPA 1SCDA 2WM3A 1OY1A 4K9MA 2VHWA 3ECSA 3BKWA 3Q10A 1VSQA 4NZOA 4LECA 1AHHA 1W85A 5TE9A 5CCBA 3S7ZA 4AC9A 3T5PA 1IN6A 3HQ4O 3KRTA 3VR3A 1YZGA 1J09A 2PBZA 1ITZA 1XXHA 5KMGB 4HJRA 3H5NA 1TCAA 4C0BA 3ZYCA 3H8SA 4FBLA 2ZWIA 1IXZA 4XD7A 1VHEA 2FUKA 3R5JA 4UEQA 2X53S 1NLFA 3TX2A 1YK0A 3FBTA 4TV8A 1WVMA 2FCRA 2YICA 5JANA 4Q4DA 2EU8A 1Q44A 4MV1A 2O8CB 5HFNA 2DUUA 2ZJ2A 4ZOBA 1HMYA 3LQQA 3PX3A 2HNBA 1RKUA 2AE2A 2P0AA 2BE7A 1N5RA 5AXBA 4I81A 4FDAA 3PKJA 3W79A 2W6JA 1ULHA 2ZROA 1J1IA 3AERA 3EVDA 1DT5A 3CEMA 2O8EB 4PTYA 4RD3A 5E9WA 1JYEA 2Z58A 4L72A 5HDQA 1Q11A 3IGFA 2W2QA 2ZTMA 1YGPA 3CR7A 2WICA 3Q8MA 3FG9A 4R8RA 3UBTA 1TKCA 4LJ6A 2Y1GA 1W49A 2XCLA 4K6KA 3IHLA 4KXQA 4CTMA 5FFFA 1XSEA 1FFCA 4F12A 3P2YA 4IMRA 4EB8A 2JCYA 5EKXA 1UBSB 2EJBA 3FSRA 1O6BA 5DWQA 1UFVA 2RGEA 4YK7A 3WYAA 2J3JA 1TUIA 5F76A 3GZJA 3CRNA 2J5BA 4FD2A 2ZJOA 4BRZA 1XRSB 4FHCA 1YTUA 1QP0A 5JMTA 3FUWA 1ZR4A 1ESZA 2HV8A 5FRDA 4HATA 4YRSA 2WZPP 1KXZA 4ALIA 1S5PA 3X1ZA 4HUTA 3KJEA 2BFDA 2PVCA 5HCIA 3WSTA 1IBSA 1TUBB 1B8OA 1RD4A 1OMOA 3EXAA 2C4TA 3L0CA 5G53C 1T2FA 5F5XA 3TKLA 3O4HA 2D7CA 1V3UA 2QROA 1T6BY 4MJLA 4XVUA 3OOYA 3VMMA 2GFQA 4MI6A 3IELA 3NC1C 1UMBB 3ZVMA 4PPNA 2AEFA 3CURA 4G6IA 1M9NA 1PSWA 4JU9A 2H57A 3KJHA 4QYXA 4Y1GA 2ZAOA 1ZW6A 4U7HA 3CNQS 1I3CA 2YVAA 3VDXA 4LF6B 3FHTA 4RIGA 5AOVA 2O0KA 2W43A 2QUHA 2XDYA 2M9MA 4PAQA 5EEGA 2JFVA 3YASA 3GFQA 3LW8A 4D9MA 4EYGA 1VHTA 3HCNA 2OPBA 3LTEA 5MHTA 3ROXA 4E6PA 4EFKA 4K6CA 4QOSA 5EYPA 3T5BA 2ZRCA 3UAZA 2VQDA 1XZDA 3DE2X 3ABRB 4QM6A 1G5HA 1QV7A 2WA2A 3AI3A 3K8QA 4G1UC 4QDXA 4IF6A 4RK4A 1ZRNA 2J0SA 5FO1A 1NKTA 4CIAA 3HYNA 3R6LA 3HKBA 4WHMA 1KSGA 3N0VA 3NUZA 1KO8A 2X2PA 4RJ2A 4RVNA 1ZNQO 2WIKA 4XDYA 5JNRA 3Q3JB 1GA4A 5DSZA 1T1SA 2FN7A 5A7GA 4UTVA 3OX1A 3ABIA 1OFUA 1BHO1 2GM3A 3QJGA 4BBZA 3AEYA 3K2BA 4ZVLA 4FHDA 3KLBA 4Q6WA 3OOHA 1K8RA 1CUEA 3SM3A 1VHWA 4WFQA 1G7TA 5IAGA 4GQIA 1S9DA 3G4SB 3DJFA 4QUZA 4I4TF 3OFJA 4J1QA 3SC6A 2JATA 4POOA 1JN0A 1VL6A 2DKOA 4LZWA 4WY5A 1J0EA 1UAYA 2AXNA 1HRKA 3ZY2A 1XBTA 3I30X 3D3JA 2IHKA 4M54A 3GT7A 4DLTA 3K5IA 3L8HA 1CNMA 2VJBA 1KK3A 5I6DA 4HLQB 4J3JA 2ZP1A 1LWOA 1FNMA 3OH8A 3WWCA 4E5UA 2DU8A 4LJ5A 1CJUC 3ZD7A 3A9WA 2Y9MB 1UP4A 1KI6A 4YJGB 2DWPA 1YGYA 4DREA 1NF2A 2PQMA 4BLSA 1M7GA 1CQZA 3GC6A 4LBWA 3KKLA 4P26A 5E9QA 2EX4A 3HLKA 2C2GA 2XTZA 5CG2A 1SVMA 1RAFA 2ZBQA 2ZWOA 1ZN7A 4BNDB 5M34A 1NJID 1XLUA 2FMFA 3IR5A 2O8EA 1QGZA 5GJBA 1OAOC 3GFFA 1QV9A 1DUIA 2Q1SA 3KZOA 2AKYA 1AGRA 3GAMA 4PLTA 4IKPA 3ZVRA 4Y1RA 5AI6A 5F5NA 2QMUA 3DR3A 2QQGA 3LWBA 1GYPA 1B15A 4D8YA 1GTZA 1CFJA 5TRTA 3N70A 2OCYC 1PNOA 3CN7A 3KKOA 4J4BA 4EFMA 5L3QB 1VSBA 4TQ9A 4GX2A 2BGUA 3WB9A 2I7TA 1LJLA 4UOQA 4X3CA 4BNNA 5FNVF 4ECAA 4GL4A 3ZW7A 3U39A 5TB5A 3A1UA 3JWGA 5EGNA 3C8HA 2CV1A 4BECA 1NVEA 2B35A 2Q4BA 3NBKA 4MKHA 1XZBA 1IDN1 1P3Y1 1I6WA 3EY9A 3L04A 3WRVA 2VYCA 1L5HA 1YQQA 3L5OA 1JJVA 1D2HA 1Y48E 2KBEA 4YMGA 5TQ0B 2DTEA 2JFZA 3R6TA 3ENNA 4GZMA 4QDJA 2ZWPA 2CT8A 1TUBA 2HI0A 3C3KA 4P36A 1A7UA 4JY7A 2PGXA 2F3PA 2D6FA 2YN4A 2Q7OE 5M29A 4PRLA 4UZFA 1RW4A 4Q0MA 5FWDA 1DQSA 3FZNA 4JLMA 4NMLA 3IEUA 3TLMA 2R7AA 2PBLA 1SCJA 3BMNA 4GLFA 2F8TA 2IEIA 4TRJA 2QRKA 1USUA 3PPWA 4GNRA 4BN4A 4ESVA 2J32A 3PTAA 1YCHA 2G9RA 1OYVA 2QJWA 2H3EA 2GCNA 1QF9A 2I4LA 3ZU6A 5EJAA 3BCHA 4QFMA 1AC5A 1K5GA 3HS3A 3K73O 4V1CA 4CIXA 4QGAA 4A8JA 4K0KB 1WF3A 4AUNA 4H1HA 1I33A 1L4FA 4XLHA 3ZWNA 2OY0A 1B6SA 2ZRJA 3KEQA 4LNHA 5JVDB 1IZ9A 2IYWA 4PWZA 4OTZA 5CFMA 1RZUA 1P5RA 1DWUA 3CRMA 2IYAA 5DW0A 3TB6A 1R6TA 5HPYB 3OZIA 1Y0YA 4IIJA 4JKYA 4XSGA 4BCBA 1HE1C 3V5NA 2YHIB 2AYZA 5ALKA 2QG4A 5LQDA 3WV4A 3Q4GA 3O95A 2I22A 2G9UA 4XKWA 1O9HA 2VDVE 2X6RA 4HEA1 4ERNA 4YYEA 1Q82D 2A9VA 4HSGA 4MVXA 4A5SA 2FYTA 1I5EA 1VPTA 2J87A 1DAHA 4KREA 1AH2A 2V3VA 5IJ0B 1A76A 2FEOA 2FZLA 3GT0A 4NMWA 4O0MA 4BMYA 3E61A 1ZIXA 4L02A 4E7PA 3DFZA 1SVKA 1N25A 3LD9A 1FX0A 4MCJA 1NBMD 4WH0A 1CR2A 1XTUA 3GRZA 3BL6A 3Q3IA 4OOSA 3U60B 3BD9A 3G1TA 4L57A 4AG6A 4BFLA 5J40A 3Q6IA 1CXZA 4N0EA 4W4TA 1FFXA 1B73A 2AUNA 4RHTA 2YJ6A 2ZTNA 4O2LA 1JA1A 3DD1A 3PHHA 1TFUA 3CXCB 4CFZA 5CDTA 1E99A 1JDBB 2FW7A 4IJ5A 3ZV4A 1QRUA 2P6OA 5CA0B 1D9ZA 3PQCA 2O2SA 4WXYB 3S70A 1VJ5A 1VM6A 4UHDA 1AQUA 5JATA 3O9MA 2EF0A 1UM9B 1RQ7A 4QXOA 2OG1A 3SQDA 2XMCA 1BU8A 5JV5A 1YDHA 3TM5A 4Y2RA 1CR4A 3LE8A 2ESRA 4PLHA 4D02A 5HWSA 3BY2A 1E79D 5KYXA 1X13A 1SBYA 1SRQA 1IAQA 1RMQA 3AESA 3EQ7A 4JBGA 4NENB 5FHQA 5T67A 5JW6A 1C7EA 5KINB 4UREA 1ZP6A 3F2IA 4KQMA 4N5NA 2P79A 4A03A 3FWKA 2CB0A 3O8QA 5AP9A 2HC9A 3OLYA 3OIGA 3VR2A 3GEEA 2OV3A 2CWDA 1NR7A 5ALSA 1RPTA 1LDGA 2BAGA 4LN1A 5G41A 1W2GA 1Y9JA 3AP2A 5EZ5A 4LWOA 4N49A 4PXSA 5AYVA 2G76A 1UD8A 3HWSA 1M1ZA 2H08A 3KTOA 1SBNE 4MUJA 4OOEA 5DYYA 1Q86D 2DIEA 2R9VA 3T0IA 3ED5A 3EVBA 3RS5A 2CNBA 4O2AF 1W75A 1V2HE 3HN2A 3ORRA 3OEHA 4RHUA 4E14A 4L0MA 2RKWA 2W2PA 3Q0IA 4GPEA 5CAEA 2ZW9A 1ARZA 1NYTA 3KS9A 3IQZA 3N53A 1NRJB 3I5UA 4L2IA 4ND2A 4OXRA 3KJNA 3WR5A 4MXDA 2A92A 2C04A 3WL7A 3ZZMA 4MYDA 1IG3A 2IYEA 2XLCA 4TKUB 4QT4A 5K6AC 2Z43A 1YIJB 2PT6A 1WR8A 3FUCA 2FMTA 4OP3A 2FPMA 2HMVA 3SX0A 5FWXB 3FMOB 5TF4A 4JL8A 4IILA 2ORIA 4M1OA 2XNJA 4DLLA 2DFPA 2FWAA 3GRUA 3SBEA 4H1UA 5E7JA 1YBFA 1M3SA 2BN4A 1MDBA 2ZT6A 3K72B 4CLOA 2XGJA 3TZQA 1JDVA 4ENVA 4Z3KA 3U3KA 1P6QA 1Y1PA 4NY1A 3WOVA 1TAQA 4B8ZA 4Q18A 1L3CA 3GJ8A 2BUBA 3HCOA 4GYJA 5FHRA 4AP5A 5EHXA 5LOVF 2PVSA 4M7PA 2J41A 4Q3DA 1YQWA 3JQFA 3RYFB 3RC2A 4HQFA 3WC4A 2EF1A 4D45A 5JMOA 1N3IA 4U3JB 3AF6A 1N6NA 2VK2A 3HMKA 4IOKA 2IXAA 2ZJ0A 2GZAA 4ALKA 2AFIA 1VCOA 3DOIA 3JQ9A 2EW1A 2ZDQA 4B8YA 3F4LA 4F11A 1Q3TA 1Z8FA 3OQ1A 4BMCA 1ID1A 2VN8A 4HS4A 4XUEA 5JAQA 1O08A 3D7KA 3U17A 5EXTA 1SD1A 1P1BA 2C5GA 4I4CA 5FDFA 3T34A 1LSUA 3C3XA 1KP2A 5CW2A 1M2OA 4UUBA 3SS9X 3NHPA 1PT8A 5EJGA 3I1FA 1A97A 4HGYA 1U04A 3A3OA 4CKBB 3G0HA 1UJ5A 3CN9A 2CDBA 3LK6A 1EXNA 3I1YA 4QFDA 4F9GA 4LHVA 1LDYA 1IZ0A 2FFAA 2PT9A 1FZTA 1TXGA 3DOEA 5AVUA 3HRHA 5KWSA 3VHQA 2JFQA 4G1MB 3FDZB 3LQYA 3T4PA 1OCEA 2G9QA 3UCEA 2WLSA 3FYHA 4BFSA 3TTUA 3FDFA 1DAIA 3I05A 1IEXA 4MUAA 5CB6A 3CP8A 2QPTA 4LW8A 2PUGA 4WZLA 3ONVA 3E3MA 1JHDA 3DCNA 1E1DA 2OENG 1OZAA 3FPJA 2QW0X 5DM2A 1IFXA 1KFKB 1Q7RA 1SXJD 2CXHA 3A0UA 5DCLA 3WHKA 3V4SA 1SQ5A 1DRWA 4IICA 1KY4A 3OA0A 4WRRA 2BY4A 1XQYA 3RVJA 3F73A 3FPBA 4EO7A 3UV3A 1E2QA 2QTCA 1BQ4A 2AG0A 3EC7A 5DCUA 3CLKA 1UANA 4M0FA 5CVJA 2IHZA 4JMQA 3A9SA 3KJIA 2RGGA 2FE4A 1W4AA 2H17A 4TSRA 5LQMA 3SICE 1Y4ZA 5HKOA 4JXZA 2Z4RA 4KE9A 4P9SA 3V8VA 1F2VA 5FBVB 1U9IA 5A4DA 3A2NA 3EE6A 1JHPA 2JLUA 1PR2A 3ITEA 1RYMA 1W47A 1Z8DA 4DXDA 5C51B 4I1RA 4RVGA 4XEHA 3BG5A 4K9OA 3KVOA 2IS6A 3FVQA 5CVEA 1X7XA 1P6UA 1T34A 2P3OA 1QDEA 3PFFA 3O2SB 1BW9B 1N05A 2HO4A 3I58A 4CYMA 5BMOA 2G70A 3O4GA 3IOEA 3EPHA 5JJCA 3V4PB 2Q1TA 4V2UA 2DBZA 4FZ3A 2IOFK 4ZVKA 1NPYA 4MHSA 4ZDIA 5MN5A 1W52X 5IH7A 4CQLB 2IHNA 1F0KA 1TMKA 2ZCVA 5E8JA 3OWOA 1SGWA 1Z56C 3WWZA 3FIUA 1IHXA 1ZK4A 1X86B 3OFND 1THMA 4KQ6A 4C03A 5CB4B 2A9QA 5ARCA 2YJTD 3D2AA 3H1GA 3KJFA 1VKOA 3M6VA 1NZJA 3WQHA 4J0JA 2W6OA 4FNGA 4WV3A 1LWNA 1B74A 1NVKA 4GWGA 4CM4B 3JAKA 3FAZA 3PUYA 4FJ2A 1AHNA 4XRRA 4DMRA 5J35A 1TRHA 2MYNA 3S28A 4GO1A 3T7JA 3UJPA 2JKZA 5KJ1A 3O3MB 4QUDA 4HBGA 4Z0PA 3IP1A 4KLNA 1I0LA 1SIWA 2H18A 1KETA 2REQA 3H2BA 4ICIA 4P3NA 4OUDB 4QJBA 4MQ6A 1DNPA 4D9BA 3EIQA 3QYFA 4AJ2A 4R1TA 3B70A 3ZGNA 3LQ6A 3WLHA 3NETA 4WACA 1WBBA 1EWRA 2K6GA 1KFEB 3IMCA 3TLYA 3KUUA 121PA 3BE4A 2X6XA 3STWA 4KWIA 1AQJA 3F67A 2IKSA 3SVLA 3JASA 1UBCA 1KS2A 2VP5A 1AMUA 2GR9A 4OXQA 1H1LB 3GPLA 2FVGA 2G8LA 4WT7A 1V2GA 4J03A 5J2UB 2XUPA 4N3CA 2BHNA 1QH8A 5FL7D 4C4XA 1V3QE 3KL2A 3V42A 2AYXA 4F5EA 2ZZMA 1RLTA 2XVMA 3K0CC 1KU0A 4YASA 4EGFA 2ZZQA 1Y7TA 1QH0A 2VF2A 4RKQA 1JG7A 3F78A 4BZZA 3F5SA 3T53B 1KGDA 3DTYA 1KPHA 4GMKA 4Y2JA 1RRGA 2QOEA 2VEOA 2Z08A 4JP3A 2N46A 3W7AA 4DIMA 4M1EA 1KWGA 3QMMA 1OLOA 1YT5A 4NF2A 1M2HA 4FFDA 4OQLA 2XUZA 1V0JA 4PHGA 5BR1A 2I2AA 3P5SA 1UKBA 4QZVA 1L4EA 1EP9A 1OXMA 1T1RA 2DUNA 2EGHA 2F48A 4WN3A 5EVJA 5T6BA 5LIPA 4HLUC 2ZUFA 4JNCA 3M33A 4FLMA 4OGLA 3C48A 3B6JA 1I7SB 3Q8LA 1T5SA 3G2IA 2R8OA 4DQLA 1PQ4A 2NU8A 1EUYA 2XTAA 1RYDA 1BKYA 1P2UA 2C4VA 1WUYA 2J31A 1BX1A 1W5FA 4G8DA 4IGKA 4XSVA 5JD5A 1RABA 2PWAA 4R9VA 5AQEA 4EGQA 5TJ9A 1MRZA 1I3OA 2PZAA 3AEUB 3MXTA 1QQBA 1AOXA 4DBZA 5DNYB 1JH8A 4U7JA 3X2SA 3CESA 3RI3A 3RNOA 4D79A 2C0QA 3D3QA 1NNEA 1MXFA 3Q8XB 2FDCA 4P3OA 1X70A 1U8TA 1YZTA 4FEAA 2RGWA 3GRFA 5AN9A 1W6RA 5DGDA 3V4ZA 2WT8A 4NHEA 1HKHA 3PUMA 1Y3BE 2HQOA 4E51A 2HU2A 4Z7OB 1JHMA 1R6AA 3DDHA 3DXFA 1WHTB 3VHXA 1N0VC 4LK2A 1IQRA 1USVA 4M76B 3UOWA 4JL6A 1O95D 3C6QA 2UZ1A 1FDTA 4TLLB 2OR3A 2ZIWB 4ZQGA 1BXZA 2IYSA 5B7GA 2VK8A 4B2IA 2DM6A 4NIMA 4PAOA 1YI1A 1KI9A 1P1IA 2XX3A 1M5TA 4HWGA 4IX9A 5I7WA 3DXZA 3KYBA 1UMDB 2A5LA 2HRDA 2X0JA 2L42A 4EBBA 1UD3A 1GPBA 4RTOA 2XOKD 5FX2A 1I5RA 4XD2A 3GUYA 3SS7X 2OWDA 4BC0A 3CCBA 3KOYA 2IHJA 2ZSAA 3AEKA 4X90A 4FPXA 1QUFA 3L4BA 4S0ZA 3U4IA 4BE7B 2PQ6A 4BEWA 1G291 2FMKA 1EK6A 1MRSA 4WLVA 5G4KB 3WQBA 1KHHA 4M86A 3TL3A 2ACEA 4BO8A 5K01A 4K1XA 2AN9A 2YYAA 5LZ2A 4KV9A 3PS9A 1JFLA 3TVTA 3HO1A 1EAYA 3LYUA 4GWLA 1H8HD 4PZ9A 1ULBA 2GRAA 5BSYA 4DN6A 3CC2B 2VT2A 3TF5A 4J6EA 3ZX5A 4QBFA 2DHQA 3MT8A 1DBPA 3T9CA 3OFNA 3VVBA 2X8JA 4JC5A 2PSDA 3G2QA 5A1JA 1LNQA 5F1YA 4M9SA 2LTAA 3IP7A 1PNTA 2FUEA 4QPNA 2ZZFA 3BICA 5FAXA 4C5AA 4CTOA 4RMJA 5DNEA 1OHHA 3A3PA 4ESEA 3PQ2A 2F55A 2YV5A 4QUIA 5CVCA 5ENDA 4J0GA 3LC1O 2IXBA 1KZ1A 2GRUA 3V55A 2IYVA 3RF6A 1IZ7A 1TEXA 1SVUA 3AV0B 2IBTA 2PSJA 2DQZA 1C0LA 1QJ4A 1YI2B 1EGHA 1PJ8A 2EG5A 2PFGA 3A9VA 5T57A 1CDZA 3GJ6A 2PSFA 3WKBA 1ZMRA 5D3KA 4JJGA 3I6IA 4B3SB 2BGGA 4F46A 1G4HA 5I9BA 5LMZA 2G8NA 4R7TA 3EJWA 4MIKA 3V8QA 5F7XA 2OECA 1CP2A 4CJXA 5GVRA 4EJSA 2UYCA 3QIVA 1N9KA 2HA7A 4MGZR 2WP8J 1XI2A 3OCYA 4KDEA 2BGWA 1HZZA 3AHJA 4EYEA 2WUGA 1D6NA 3BWBA 3H2ZA 1ISPA 5LZ8A 3GF4A 1JVNA 1F4LA 1VQ4B 1QNFA 1J2RA 1JMYA 3KUKA 3EC2A 2H00A 2V58A 2CHVA 2PKXA 3B1JA 1W9MA 1EX9A 2DLCX 1QLJA 4QVAA 1F12A 2GSWA 2AH5A 3B6KA 2NU6B 4HDMA 3WXBA 4R2XA 1A88A 2D5IA 1U8ZA 4R6XA 5ABPA 3T9EA 3BPSA 4TS1A 1Q5PA 4XB1A 5HDBB 3MS4A 4GBED 3V6MA 2JHCA 3R6KA 1L5WA 3LRPA 3MQ4A 4MS4B 2QTGA 3KO8A 5C8YA 3W8DA 4DQXA 4JUAA 2Y4NA 3QPUA 5ARDA 1X1QA 2RE8A 4AY6A 1MX1A 3H8JA 4OHMA 3B3JA 1CULC 2N1BA 3SLKA 3HVHA 3ADBA 2PXCA 2C5FA 2D59A 3E9DA 2ZSUA 5AKKA 5C3MA 2JD1A 4CN8A 3HDVA 1LLUA 3MBIA 3TZLA 3E23A 5HYVA 1GZ3A 3VR4A 2IEBA 1XAHA 3OSUA 3D81A 1YS4A 3D31A 1ADBA 3M4ZA 5A5DA 2V7VA 2ZI5A 1T15A 2VC2B 4MTCA 6ABPA 2FPGB 1U3GA 4Z5XA 2BKVA 3ZGZA 4FOPA 2WWFA 1KAMA 2JIBA 3C6ZA 3VV3A 3OUUA 4OHPA 3KKNA 2WTEA 1ADCA 2RHWA 4G0YA 3UW1A 3WLTA 2OB1A 2WIAA 1E32A 3AVXA 2J8ZA 2RGNC 3WTBA 2NTJA 1P2TA 1EE9A 5HRCA 2WNHA 3RDPA 4OI0A 1CT9A 4EDHA 1LTQA 2Z1DA 2I66A 3D2CA 4S35A 2OK7A 1QIHA 5WRFA 3CQ9A 4J94A 5BSWA 2CJWB 1XMPA 2ZVJA 3IKMB 2FY8A 3G23A 1J0AA 3II6X 3AEQA 1ZJYA 1QIEA 5D84A 1EDEA 3DHYA 4EPTA 4KIUA 2H5JA 1GTG1 2PYIA 4I1YA 5COQA 3KLOA 1FX1A 3K20A 3NM5A 3QFHA 3T95A 1EVZA 4HC4A 4R8VA 3ROGA 1R9NA 3CZMA 3L93A 1RJWA 1A5SB 3RVPA 4EDFA 2H1HA 4HH4A 4M0DA 4DCMA 1KNQA 4DWWA 3K1TA 2IYRA 4IHJA 4JJ7A 2OORA 1W96A 5GONA 5I01A 3SJBA 1SOUA 2CF4A 4M98A 4QODA 1UF9A 5BN3A 3C3BA 1P2FA 2Q2OA 2WUFA 3I34X 1OTXA 1PP4A 3JAWA 2I76A 2GQFA 5BSRA 1H2FA 1Y7HA 2A9KA 3OIFA 1WSVA 3IL2A 2XMRA 3K4PA 4JZKA 3V76A 3QWBA 5AW3A 9GPBA 4REOA 4Q7KA 4ZI2A 3IDQA 3EXHB 3NWJA 3PC7A 4HV4A 3K2QA 4ND4A 4MI3A 3TLXA 1CZUA 3NHFA 1Q0PA 1LJ8A 5BV0A 3RR2A 2JBAA 1ZLXA 2H1FA 2YUTA 2VK1A 3A3YA 3EQZA 4S2UA 3R7DA 2V4UA 2XB2A 4PO1A 5IJ9A 3N59A 1VL5A 3MJFA 4L76A 3L41A 4WW0A 1J5PA 2RH9B 3DPIA 4YRRA 5TY0A 3I2HA 1OJLA 2LKCA 3HHEA 2QR3A 2FEWB 1EX7A 4HEQA 2ENUA 2RHCA 5KOJB 1R0YA 2DPYA 4NSNA 4EKGA 2OSBA 4KPUB 4PZAA 3DVRX 3JQBC 3RADC 3HP1A 3OCWA 1BDMA 6NULA 3KKMA 2ZUVA 3RHFA 1BD4A 2CLOB 2GK4A 3HWX1 1EFRD 3R0JA 1DUSA 3JZDA 3SIPA 3HEAA 3OTWA 2XKAA 4FLEA 4H15A 2ZL7A 1TF2A 1G59A 4KXWA 2NZUG 3F71A 4OMCA 3T7EA 2Z2KA 1WY7A 1WV1A 3GBVA 2Y68A 3KV3O 2OXFA 4DLXA 5K0SA 4Q3NA 3EHDA 4IIBA 4P81A 4ZODA 5JZSA 1G5FA 5KOIA 3GT3A 3INRA 4IDOA 4QKQA 3UUWA 1UDAA 3GRAA 3SI7A 2QX8A 4CZ2A 1Q50A 3QFCA 2VJAA 2PLRA 3AIOA 3GWGA 3MMXA 1RPNA 4NEHB 4C7XA 1W0CA 3GLIE 3QK7A 1O95A 1N1MA 4H0FA 3QE2A 3EN0A 3NP9A 5DASA 2XCRB 1C4WA 4YJFA 4BL5A 1OKKD 1AF4A 1UMBA 2R87A 3D6JA 3L9WA 1FXUA 4DNOA 1PIWA 3FTNA 2J45A 2F3QA 4JLVA 2W98A 5CB4F 3ZK8A 5ALLA 1OI2A 4I4NA 1WW3A 1DHTA 2Q7DA 4PF1A 1U7HA 3A27A 1BQ3A 1VE9A 1CVRA 3VQTA 3LT1A 3T9BA 3M4JA 1JSRA 4W8OA 4A2PA 4U7WA 3TL2A 5IYRA 5DYWA 3ZYZA 1KMCA 3TRIA 3TOCA 4YUXA 3THXB 4II3A 4MI9A 5J5CA 5A2QA 1SR8A 2NOAA 4TUYA 3EF0A 5JRZA 2JLCA 1Y7LA 2R6DA 4ZI7B 4FE3A 4Z1MA 4DR4B 1H4QA 2IIPA 2PUFA 4RVOA 1IN5A 2IHUA 3CWCA 3OLXA 3TTSA 4E5YA 3KHUA 2V5UA 1QH1A 3PCRB 4IJ6A 3LWDA 1THTA 3A9UA 1D9XA 5AVKA 4XLAA 1CYEA 2DHCA 1U8CB 3TECE 5EHGA 4B6PA 2BGMA 1W29A 2QDXA 2RGYA 4L4XA 3F5DA 1JFRA 4QUBA 4IW3B 2J3LA 3V32A 4ZQCB 3NE5B 1E5LA 4KV7A 4J2TA 4I14A 3HFRA 2B99A 4I99A 2KBFA 3NTOA 1GIAA 3F1LA 3JVVA 2D0IA 4Y9RA 3OJ0A 4BNJA 3QPBA 3OLWA 1KL7A 1NMEA 3HWWA 4MW6A 1Y8ZA 2CVOA 4EB6B 1N2GA 4I08A 3DLAA 4PFKA 3LVQE 4R71A 3MFQA 4HWKA 4QU5A 3N39C 3SF8B 4DILA 5KTPA 3A1PA 3V1LA 1ZRSA 3B48A 3W8FA 2Z0MA 1V8OA 2AE1A 4RD0A 1I4LD 3B5IA 2AW3A 3JV7A 3ORHA 2E7ZA 4K0RA 2I2WA 3I8OA 2BC9A 4JBIA 2D9RA 3GBSA 4ZT4A 4WN9B 2VQ3A 3W05A 4HKTA 3OPYI 3WBJA 4X7MA 5EIFA 1XQ1A 2Y0EA 3V00A 1ZD8A 4E12A 1ZHOA 2V8BA 1WDMA 2AT1A 3BRCA 1X6VA 4UMEA 5AUQA 3OM8A 1VQ6B 4R2IA 4KPUA 2WJ4A 4L9AA 3VU9B 2R1VB 1X7GA 3VH3A 3ELDA 1ESCA 1W19A 1TW2A 4M6WA 2FPIB 3ZE1B 2V0NA 4NCNA 5I9IA 3AYZB 2A33A 2OFXA 4LOKA 4E21A 2BMVA 2HFJA 4D9GA 1SRRA 4PM4A 2WU3A 5C31A 1AK2A 4CTNA 1FNDA 3RSGA 1BDJA 2FWMX 3G0DA 5ADUS 4RMIA 1XXLA 1ZEMA 1M0EA 4GU5A 4XA8A 2Z3VA 3PRKE 2QLBA 1UPCA 2R6AA 5G02A 3AR2A 4BB6A 2QI9F 1TC2A 1ZNYA 1YL6A 3LLVA 4X44A 3K0KA 5C8XA 4MKIA 4TTVA 2BGKA 1Z82A 4C04A 1OVGA 2ZZNA 1ZH6A 5JADA 3TUZC 4X65B 4NKRA 2VTEA 3R8XA 2PKYX 1RHMA 4P33A 1PT5A 1ZFNA 2CLHB 2HTFA 3LT2A 3O31A 4LRQA 4RSGA 5AJZA 1VE6A 3WYEA 3F8WA 4G01B 5KKNB 1WBDA 2AG6A 4DNPA 2D5BA 4FYWA 4UTOA 3OQHA 2IYOA 4DRXA 4LX0A 1TEVA 3A36A 3AF2A 2C8JA 4G09A 3DULA 2BSQA 3E1YE 1UWVA 1N9GA 4L8YA 3GQBB 3FYTA 4CQJA 2P91A 2P65A 5A7FA 3DW3X 2WB4A 3TH5A 4Q4LA 2XT6A 4Q9IA 3RBXA 3VC2A 4J0DA 1XU9A 1YF3A 3MHTA 2J9FA 2I6UA 2XWBF 3QBTA 1AQLA 4RSMA 1WQ3A 4YLYA 4RCYA 1F51E 3WMEA 1N5JA 1QH1B 3K0CA 3F46A 5IS2A 2X3UA 4EHLA 4UMDA 4DV5B 2E9SA 3MGBA 2CSXA 3F6RA 2V4ZA 3P4YA 3EXEB 1ZJJA 3TW4A 1CPYA 1R10A 4LGCA 2XNCA 2ZITA 3JQPA 2FMHA 4HP8A 2FB9A 1PLJA 5DHQA 3QYPA 3X2FA 1YUBA 3GUVA 1U7ZA 3OCVA 1DL5A 1PGQA 2GF2A 5T4BA 3ZZNA 3FKSA