4M2LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in nucleotide-free form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
409
structure length
398
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGITIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 97
structure length 398
sequence length 409
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m2lA01
1N5IA 4Q19A 2ZI5A 5L3RA 1E9CA 1DO0A 2GXQA 1PLKA 1XMIA 1KI8A 1VCOA 2J45A 1G3QA 4FXPA 5JECA 1W7AA 3BH0A 1KMHA 4B4DA 2IHBA 4F7WA 5DN6D 3QKRA 3CCSB 5HZHA 4M9SA 4Q03A 3TNFA 2YOHA 3Q5EA 4MITA 2QUZA 3LW7A 4XTCS 3P26A 3QI2A 1EWRA 1OSNA 2QTVB 5KOYA 1JNYA 5DE3A 3GLFA 3IIMA 4GI7A 4WW0A 3NHBA 3ZVMA 1N6IA 3TQFA 4Y9UA 3EWAA 2VNIA 1GNQA 4GRAA 3DOEA 5AJYA 4C0BA 4F93B 3GLGB 4L5BA 1H65A 3W5UA 1Z3IX 5HKKD 3BC1A 3Q9LA 4HUQB 2FFBA 1FTSA 4BFSA 1JB1A 3RSLA 3KB1A 1L8QA 3A4NA 4OYHA 4B73A 2IT1A 2JLYA 1K8RA 2ZE6A 3MWYW 3TUIC 4ON9A 3ECCA 1PUIA 1G5RA 2PJZA 4DSNA 2P0EA 1EFRA 1W2HA 4TYQA 4OQXA 2IF2A 3C15C 3L0OA 2QT0A 4I4LA 4PZYA 5KYKA 1N5JA 2QEXB 1K6MA 4DQKA 3CIOA 1YRAA 4BQSA 3CM0A 4LCBA 3ZVLA 3DMDA 1UAAA 3MUFA 5KO2A 4TZ0A 1VQ4B 3CMAB 1QFJA 1TLLA 2J0VA 1JR6A 1IHUA 3K70D 2ZRHA 2UZ3A 3ZS9A 5TXGA 2NTYC 3ZVRA 1EP1B 3CCVB 1GAJA 1QH0A 3LV8A 4KSCA 1D1NA 3RVBA 2WOOA 1WDTA 2JIZA 2XTZA 2QAGC 2ZQ5A 3C5HA 2V9PA 2ZR0A 3A4MA 3L2OB 2OFXA 1R10A 4LYJA 2GPJA 3IPYA 1KIMA 1M7GA 4RD2A 3SN6A 1OT3A 2ZYUX 3V9PA 4EPXA 2N42A 1GFIA 2W6IA 4PQYA 4TQAA 2DPXA 1HURA 1OXVA 2J0UA 1W2GA 1GILA 3JVUA 4O2LA 4B47A 1XJQA 1EESA 2XNDA 4JT2A 5HXBA 4A15A 3QFCA 2J7PA 3GJ6A 2KJQA 3HP1A 1T8UA 1ZM9A 2QL6A 2R6FA 2ZI4A 1M1KD 4QL3A 1MT0A 4CEIB 1QHXA 2A3RA 1TF5A 2H57A 4LJAA 5IK2D 1MABA 3SFVA 4WAUA 1E9SA 1W4RA 4KBGA 4HSEA 3SJZA 5KPJA 3T5DA 1F2UA 4DSTA 4ERNA 3EARA 2ECKA 3HDTA 4LHYA 1ZP6A 3PUYA 5KDDA 2FSFA 2BN4A 2DFTA 1EFUA 2E87A 4EPVA 3GLIB 4V02A 2BCGY 1FQJA 2GKSA 3GLGE 2PX0A 3AKEA 2KWIA 2BMWA 3GJ8A 1TVCA 3CF2A 2B7CA 4CT4B 4GOKA 5JRZA 2BBWA 4JBWA 3C41J 4V0OA 3TR5A 1OFTA 1PLJA 2R44A 2ZYWX 1G3IA 4PTLA 2IL1A 3QJYA 4AF7A 3UG6A 1IXSB 3F8TA 1D9XA 4CIDA 5CK4A 1GAWA 4CEJA 3KQKA 2MMGA 2IX3A 1R5NA 2WKPA 4TMZA 3KXIA 4YXWA 3EASA 2FPLA 1XEXB 1G8GA 2GA8A 1N6PA 3KX2A 2WVJA 4KFRA 1TEVA 5EXSA 1U0LA 2HUPA 3ZDQA 2H5EA 1F20A 1IONA 1T3SA 2WIAA 3LD9A 1KDPA 5FUVA 2YINC 2ZRPA 4MKHA 3N2IA 2OCAA 4DDWA 3QBVA 3WY9A 5FPSA 4HDOB 3THOA 1D6JA 1QGYA 1ETUA 1KO8A 1VTKA 3DKVA 3K0EA 3C8UA 4Q1EA 4POAA 2CNWA 1W0KD 1GVHA 1KD1D 1OFIA 1NG1A 5H68A 1EWQA 5FH9A 3IIKA 1Z6YA 2WV9A 5CIWA 1XPOA 4EPYA 1CP2A 3U4QB 4LX0A 3VO1A 2IF0A 3NBXX 1AKYA 5B64A 2FX3A 2Q3HA 2O8BA 2VA8A 4CT5A 3WXMA 3KKMA 3W90A 2YWGA 3IO5A 1TAGA 1SVSA 4XTRA 5DIFA 3ADKA 4ZDJA 1TPZA 3FFBA 1GZSA 2OESA 4OHWA 2ORIA 2W6JA 4G5QA 1COWD 1YZTA 2OTLB 2ZE8A 3K9LA 4ESVA 5FBQB 1E69A 3B7GA 1Z6AA 2BMEA 4QGFA 2JASA 4HAXA 4P33A 4HAWA 5DGXA 4JL6A 5K8TA 1FNCA 3NG1A 3TW4A 4YAWA 5TB5A 3FJOA 4LHZA 3FE2A 4CZ2A 4BE7B 3B8HA 1VECA 3VR5A 4EPRA 3TW8B 1OXUA 1VG9B 3K9NA 3RNLA 4DLSA 4B43A 1YR7A 1HV8A 4XIGS 2EQBA 4RD3A 5JI3E 4M22A 1N3BA 3CWZA 3GLIE 4Z1MD 1DO2A 3CLVA 4JYCA 1P2SA 3MSXA 1E6CA 4DWJA 2ZR9A 3W2HA 4PX9A 2QEQA 1J99A 1G8HA 1H85A 1WCV1 1YZGA 2D74A 3K09A 4ILEA 2CJWA 3QFSA 1Y3AA 5KSZA 2AWOA 4OQLA 2BPOA 1NG9A 4B71A 1U99A 1H8HA 3AP1A 3EIEA 3T5GA 5DSZA 1YKSA 4Q9HA 5H1YA 3LBIA 3MRSA 3NBYC 4NZYA 2NO7A 2RGXA 3DL0A 1NNEA 1A1VA 1L4YA 2KE5A 1N6LA 3TGPA 4H1UA 2NPIA 1ZU5A 5GVRA 3SHFA 1IAQA 4TYPA 4WIAA 4D80A 2BHRA 1G7RA 3KDSE 5IHPA 3CCMB 1KTVA 1G16A 3LWNA 3U7EB 8OHMA 4L15A 5FTJA 3LX8A 1DG1G 4LJ4A 4GSYA 4IOKA 3QEJA 1VYTA 4A2WA 3BH7A 5EUMA 1HT1E 3AVQA 1B0UA 1KSFX 5C4GB 5BQ5A 1R8QA 3LRPA 4QNMA 4QBHA 3KQUA 1F60A 1V43A 1E0AA 3RYTC 1F5NA 2X8AA 1HEIA 4BASA 2V54A 1KDRA 1OV4A 1ANKA 3RS0A 4BLTA 4IFBA 3X1XA 3OEED 1VCMA 3ZJYA 1VHTA 1KO7A 5P21A 3BB1A 1T9HA 1GL7A 2JGNA 4A0HA 4BRWA 4EPWA 3IDQA 2VTKA 1N25A 3UATA 4WQMA 3CPEA 1FRNA 1Z28A 2WWXA 1ZNXA 1Z08A 2R6HA 1CR2A 3REGA 1KKMA 1G20E 2A2ZA 4RZXA 3HYTA 4OK3A 4IDHA 5C4MA 4LC0A 3P27A 2B21A 4NHOA 2DWQA 2QP9X 4LYHA 4LV8B 4TQUS 4ARZA 1RKBA 4BFZA 3PUZA 1DELA 4B3GA 3VU9A 3BIFA 2IWHA 4PPGA 1G7CA 3OZWA 1E32A 1Q1ZA 2BKEA 4Q18A 4JZKA 2YZ2A 4G5SA 4A6XA 3QPVA 2OV2A 4BLSA 1FP6A 1AGRA 1DAGA 1ZNWA 2HEIA 4JIMA 4DSOA 2RGDA 1U9IA 3KQNA 2ODNA 3VX4A 5H59A 2ZANA 4DJTA 3FTQA 4MRNA 2PMKA 2AD1A 5FBVB 2EIXA 4QG7A 1CULC 1SVWA 4JLOA 1SHZA 3F5FA 2O0HA 2XX3A 3GFOA 4JBXA 2QA5A 3W9YA 5C2JB 5JFGA 1CLUA 2NO1A 1E0KA 4V0KA 2DETA 1E1QA 1XNJA 2G83A 3OFNA 5FOSA 3EPHA 3CCRB 1OB5A 1FUUA 1GNPA 1N2CE 2GHIA 2GJ8A 2WSSD 3I5YA 4C43A 2REXB 1IN7A 5FBRB 1N6RA 1KO4A 1P5ZB 1KJWA 1XFAA 1W44A 2R62A 4G5OA 1U8ZA 1CIPA 1SM4A 1FQKA 1P7CA 3VR4A 3SJAA 1XZPA 4LJYA 3CKLA 4DIEA 1DDIA 4IXMA 1OJLA 2QROA 5AJZA 4XVRA 3UK6A 3MGCA 3F0TA 2ZPTX 4Q9JA 5FPYA 2GJKA 1HUQA 4PAQA 2W0SA 4TLEA 4QGGA 5DYGA 3CUEF 3KUDA 5JSZA 3OIUA 2EWWA 2ZI3A 3E2IA 2PCLA 3KFVA 4URUR 1E79D 3PEUA 1GRNA 1T5IA 3SU8A 1IY2A 2PLRA 4FN5A 4FIDA 3VTKA 5JI2E 2AN9A 4OL0A 1YZLA 5LPNA 2GF9A 4EJSC 1AZSC 4JLBA 3R9XA 4MYHA 4LJ9A 4IJMA 4A8JA 4BLRA 1CJKC 4UNSA 4ABYA 3SJCA 3K9HA 2ORVA 4Q4JA 4OKSA 2XGJA 1UADA 1A82A 3QNUA 4XH9B 4FMCF 3NC1C 1M74A 5FR1A 3MHPA 2J41A 3U2QA 4JKIA 4Q01A 3UMRA 3IEUA 3AVPA 4TT3A 2OSBA 3CRW1 1R2QA 4N1AA 3CRVA 4KODA 4KI0A 2CNDA 2ZE5A 2GXSA 4ZKDA 3QE2A 1DPFA 1U0HC 2JJ2D 2CCKA 4Q1CA 2V7QA 2V55B 2GVDC 3QF4B 3THYB 2G6BA 1QFYA 5KU1A 4CEHA 3TMKA 3W6PA 5CLQA 2WWFA 1XTSA 5JJLA 4RFSA 1UBGA 2R65A 4HDCA 3M1IA 1VQ7B 4HB2A 1DDGA 2VSXA 1US8A 2W83A 1OHHA 3HWSA 3AQ4A 4ZV4A 1ZM4A 5EMNA 3EG5A 3RC8A 4JS0A 4ASUD 1XCGB 4LSGA 3SHWA 4HE6A 2AFIE 2YYZA 4AI6A 2J3EA 2OFOA 3M6AA 3G71B 1E2FA 1A8PA 4BFXA 1GOTA 3VR1A 2XNJA 4GL2A 4DEXA 3DZDA 2WMNB 4TQ9A 1E9EA 5IF9A 1GR1A 4JVLA 2V1XA 5HTKA 3T35A 2V6IA 2QDXA 5KNCA 5EXPA 4P4SB 1SKQA 2F9LA 1VCNA 1J9ZA 2FWRA 3BERA 3K9GA 4GPTA 3TSZA 3WNCA 1XEWY 3ES9A 1D8TA 1KI6A 3LBNA 2IYUA 4KFSA 1KHTA 3I73A 2HXSA 5FTNA 3SJBA 1GSIA 1NBMD 3AP3A 1Z07A 1MR3F 2VP9A 2GBLA 2IEZA 1QVFB 2IUTA 1AIPA 3KJGA 2O8EB 3K0AA 1Q12A 3JQPA 1N0VC 2GCNA 5CB6A 2QM8A 4OI0A 1KI9A 2BKUA 5E7JA 4QBGB 2ZYTX 1E1RA 3M0EA 2VHQA 4DT1B 4CDGA 2GZAA 2JLXA 4ASUA 4R71A 2QQ0A 3EPJA 2QAJA 4MRRA 1IY0A 4US2R 1X86B 1ZCAA 2BVNA 1P4SA 1UF9A 1W5SA 2ZSAA 4OBEA 3B82A 3CCLB 4FMDF 4DC9A 2R2AA 3MWJA 3EZ2A 1CJTC 3LVRE 2IYXA 3BJIC 3W5HA 1MRSA 1RW4A 4DSUA 5E4FA 4D0LB 2HDNB 2VRWA 2WJYA 1MKYA 2G1KA 2NG1A 3QG1A 1YJ5A 5FOTA 2ANBA 3A4LA 4PFSA 4Z8XA 5J40A 2DERA 2BV3A 1S3GA 2IYWA 4B2IA 3SQXA 4RCYA 1KDTA 2CCGA 1QF9A 2A9KA 2FU5C 3VHLB 4EFLA 4DUGD 1QG4A 4B3DA 1TQ2A 1NP6A 1OKKA 3CC7B 1P62B 1VG1A 2CVFA 1EX6A 3EZ6A 1DAKA 4A4DA 2P3SA 1KDOA 1FL9A 1GUAA 2I1VB 2ZREA 3BRWD 4UNPA 3QE0A 2IBMA 4URWR 1J8MF 5FBLB 4YQFA 3AVOA 4LY6A 2GRJA 5F9FA 1IQPA 1CJUC 4HZUB 3C5CA 4Z8YA 5DHAA 1W36D 3VKWA 2REBA 1UBCA 1QGZA 2A5FA 5DYIA 2ZETA 3RHFA 4G5GA 3ZIAA 1DEKA 4M1OA 1II0A 1GDDA 1KMHB 3AF1A 4UJ3A 2PMDA 2HF9A 4D82A 1W4CA 2WWWA 3QKRB 1I4LD 1NLZA 3CRRA 3IO3A 4L9SA 1UBEA 2W00A 2J9RA 3NWJA 1YJNB 3I3SR 3KZ1E 2AXNA 421PA 3K0FA 3GLFB 2XNSA 2O8FA 2GNOA 1TADA 3TSOA 4HUTA 4KITB 4V0LA 3LO8A 3ZD6A 3KTAA 2O8DA 5D3MB 4O2RA 1G64A 3KUCA 2ZUBA 1Z83A 4F4JA 4M1KA 2ZRIA 4GMDA 4H9GA 3U61B 2FPKA 2XZOA 3BORA 4ZI3A 1XJCA 3QFTA 3IBGA 3IHWA 3LX5A 5LDDC 1T91A 4MUAA 4EAQA 3V76A 1OE0A 5FUYA 3AVWA 2WWIA 4L4UA 4HATA 4A9AA 2VP5A 3QKUA 4F38A 2XSZA 4LYAA 4TLAA 1H8ED 3AKYA 4UNQA 1EGAA 1D2EA 3U44A 3R8CA 3RAPR 1LS1A 2DHRA 5EXTA 5TDHA 5AUOB 1FNMA 1DAEA 3GFPA 3UMFA 3OZXA 3D6TB 5EJEA 4Z54A 2ZS7A 1ZD8A 3W2GA 1FW6A 1XE1A 2ZROA 3CW2A 3ETLA 4QOSA 1Z2CA 2KSQA 2QTLA 3AKDA 5KNDA 3WP1B 1XD9A 4M2LA 3V4RA 2KB0A 3SI7A 1DTSA 4HAVA 2BM0A 2RB4A 3RS4A 1XPUA 4A82A 2AKYA 2Q0HA 2DR3A 2XNCA 2D62A 1HA3A 1UMKA 1ZUHA 3CR8A 4URZR 1O87A 2AHOA 1CKEA 1W35A 3IKJA 3WYFA 3W5JA 4TMXA 3B1VA 2QQEA 1LNZA 3BD9A 1JR3A 3GJ0A 2XOKA 3VR3A 2ZSFA 3FDIA 4IVPA 4C0KA 2FFHA 3VHXA 5CITA 2YWFA 1OW3B 2HCBA 2CHQA 2A78A 2J0UB 4R2HA 5EXXA 1RPZA 1YJWB 1AKEA 1ESMA 4D0NA 1FPMA 5FA6A 4PHTA 4QJ4A 1HQYE 4BEBA 4B3XA 2OO7A 5L8VA 2RGNA 1SXJE 2QAGB 2BBTA 1BMFD 1UKYA 3NH6A 4WBSA 4C3ZA 2AD5A 1MABB 1QUFA 2QE7D 1SXJD 2P2LA 4ACAA 3HYRA 2FFAA 4IEEA 4PSAA 4UNRA 1D5CA 1XMSA 1U90A 4I81A 1F2UB 4X8LA 2V1UA 1J2JA 2WSMA 3CONA 3JQQA 3EX7C 2EFEB 4AYTA 3GLFE 1W87A 3P1JA 3KB2A 3CZQA 2RAPA 4TYYA 2IXEA 1QHNA 2FE4A 2O8CB 1DADA 4RD4A 1CU1A 1E9RA 2OAQ1 3HPQA 1KQSB 5GVSA 4G1UC 1PLLA 3DMNA 2IYYA 4LPKA 3CD6B 1VG8A 3I61A 1JBKA 1MV5A 1RJ9A 1E4YA 2BMJA 4C0HA 2VNHA 1W47A 3TAUA 4B6FA 1MO3A 3J81k 1OIXA 1SVOA 2FZLA 1VQ5B 1FX0A 3B2EA 5EZ6B 1J70A 1IJEA 2VO1A 4PAMA 2QMHA 3E1SA 1UBFA 2IUUA 3PCRB 3UIEA 5FR2A 4V0NA 4W5JA 3WBKA 1XD2A 3LVQE 2VP0A 4RD0A 1IN4A 1NMZA 4KJZA 1ZBDA 2D7CA 3SDZA 3PEYA 3THWA 1IM2A 2DCUA 4ZKEA 2BM1A 4CEJB 1Z47A 3DZ8A 4Q48A 2ZYVX 5EE5B 2YOFA 4HLDA 1HT2E 1JA1A 4MGZR 2YWHA 4UAJA 5CIQA 5SZJA 4ZDIA 4C0QC 4OJQA 3QKSA 3SQWA 3CO5A 1AS0A 4E03A 5FFMA 3DHWC 1IOZA 5BN5A 4JL5A 1NN5A 3SBEA 1E63A 1E0JA 1SKYB 3K0CA 3FYHA 3B1XA 4O0MA 5KSPA 2OXCA 5L3VA 2C04A 1E9AA 1YVDA 1Z5ZA 1G8FA 1ZAKA 1A4RA 2SHKA 1LFDB 2IA5A 4B2PA 2XB2A 3R7WB 2B92A 2O8BB 2ORWA 4EPTA 5DN6A 3ZD7A 5A4JA 3I55B 5JWHA 2C78A 3PEVA 3MG9A 5C1BA 1MRNA 2CEAA 2HYDA 3HU3A 1JEEA 2R6GA 3S1AA 2BBSA 2IYTA 3M4YA 2AWNA 4PC2A 3QOFA 4ZPXA 5C46F 1OIVA 1VQPB 3KKPA 4AG5A 1A5TA 2JJ8A 1OH7A 4B35A 4G1BA 3KJHA 1ZNZA 4QGHA 4YDSA 3A1TA 2F43B 2GCOB 2GZDA 3HR8A 4TLBA 5HKKA 2EWVA 4TMTA 1E94E 2FH5B 4Q7LA 1FMJA 3BFKA 2BF4A 2E9SA 4P31A 1G8PA 3WRYC 2GTPA 3QY0A 1Z0DA 4GZLA 4U02A 1KSHA 2ZSEA 5FOUA 4ESHA 1MH1A 2AX4A 1OB2A 1OFHA 2FJUA 5DLQC 2RGEA 2IYQA 1DS6A 1XCPA 1YU9A 3QVUA 4GOXA 3ADCA 3FOZA 3Q72A 3VO2A 2CJWB 4M1MA 5CDFE 5SZIA 4M9ZA 2HV8A 5ANRB 2CHVA 1G41A 2F9MA 3BFVA 1NRJB 4IXNA 4LGMA 1X1SA 3CRQA 1GITA 3OW2B 5KHOC 4PO8A 2OBMA 3O8DA 2QN6A 3B5JA 4XSHA 1YZKA 4QHTA 1AQUA 4JL8A 1ZIPA 3LNCA 3U7FB 4EFNA 4ZGQB 2IEYA 2WWGA 2VYFA 3MWKA 1K73D 1T5LA 2CL7X 3R9IA 1S96A 3VNVA 4N3GA 4Q7MB 5CM8B 4DLVA 4M1TA 4DLYA 4AKEA 3O8BA 1SKYE 4Q02A 3B85A 3BWDD 5AUQA 4IEIA 121PA 4MRSA 2ANCA 1FOEB 5LBIA 4RZUA 3X1ZA 1XPRA 1IXRC 1NN3A 4LHVA 1NKSA 3LXRA 621PA 4URXR 3NIBA 5FPTA 4TMWA 3JQRA 1Q1EA 1Q21A 2QP4A 2XXAA 3X2SA 1XTIA 4YAUA 1KO1A 3NDBB 2GK6A 1R0XA 4Q4HB 3V4FA 3QFRA 2EFDB 3RS5A 1E2IA 4M21A 4DXAA 4JJZA 4V0MA 1QHGA 5JEEA 2ZJ2A 5IK2A 3SNHA 2GZHA 1I2MA 3I62A 2GEDA 3FB4A 3C16C 5TV2A 4WXPA 1OIWA 2CXXA 1GTVA 4LPSA 4LYFA 3PQCA 1G6HA 4CVNA 1S9DA 3NDPA 1GG2A 5E95A 3C7KA 3CX7A 2H7VA 2IS4A 4ITRC 4UXIA 1QX4A 2GAOA 5IT5A 3SOPA 3WP0A 1FZQA 1ESNA 1CS4C 2F3RA 1QFZA 4KFTA 4BLOA 5K8UA 4DLRA 3TAHA 2WBLC 1N5KA 3EPKA 1ZNYA 2DYKA 3MWLA 3P4YA 3OHMA 4ARZB 5BWMA 1OH8A 1ZD1A 3U60B 1CEEA 3CNOA 3GLGA 5FPKA 5EE3A 3KKQA 5KSWB 4EUNA 4GFDA 4M1SA 1GO2A 2QY9A 4QGAA 5SZKB 4I1VA 4KU4A 4F92B 1U81A 3RS3A 1AK2A 5F3WB 5DH9A 1IN8A 4I1SA 4IOMA 3BOSA 3PG5A 1G19A 1UDWA 4GOJA 1D9ZA 2QSZA 4R9UC 1JAIA 3OIVA 2B8WA 2ODWA 2D2EA 1VQMB 3A36A 3K09C 3Q85A 4DBLC 1P73A 4TSFD 3SC3A 3W2FA 4QM7A 1YHQB 1UEJA 2CLDX 2ZSDA 1W34A 5AR1A 4YONB 2ONJA 2R6AA 2XITA 4NYMQ 1K9MD 2W0MA 1ZIOA 4KHZA 2GQFA 721PA 1IXZA 2VHUA 3FHOA 4BEJA 1W0KA 3UG7A 2NPFA 4LI0A 5JCPA 3VKHA 4MDFA 3EPLA 1XZQA 3GEHA 3AGPA 1YRBA 2GDJA 3AF0A 5JSZB 3VX3A 2ZRAA 1HE8B 4UXJA 4UKDA 1JA0A 4Q7KA 1N6HA 1T3HA 1VCIA 3A1WA 1NMXA 3FKQA 2RHMA 2VF7A 4ZCLA 3UWOA 4TLCA 1COWA 1DAHA 3EZ9A 4R98A 2ZAOA 1XTJA 4A8JB 2PEZA 1M2OB 4JLMA 1TX4B 2GVZC 2QI9C 2NO0A 2J5XA 1QHIA 5A5GA 2OCBA 1OFUX 2ZI9A 4D4LA 2Q3MA 5B30A 2RGBA 2IYLD 5GJBA 1N5LA 1OGIA 1G4UR 1L7VC 1V5WA 2PX3A 1BX0A 1II8B 1WE2A 3THXB 4C7OA 1QVAA 5L3QB 3PJRA 4N0EA 4WVFA 4EJSB 2O0KA 3DM5A 4Z1MA 5TY0A 1E9BA 1RYHA 4OI1A 1TF7A 4ZIRA 4P3YA 2DEUA 4MYTA 4NYJQ 3REFA 3P4XA 3RWMB 5IRCD 1NVUQ 3BAFA 4OI4A 2OZEA 4M8NE 1ZUIA 4LC1A 2C5LA 1KZGB 4KSBA 3SYLA 2Z6VA 3AGQA 1UDXA 3AB3A 3B13B 2BIFA 1TTTA 1W4BA 3AH8A 2CK3D 2GEUA 1XXHA 4TL6A 3PXGA 3MAAC 1G1MA 1U9IC 5DI9A 2HLDD 2HYIC 3AM1A 3FPAA 2VNKA 4U5XA 4WOPA 1PUJA 2HMAA 4BECA 2W2TA 3TR0A 2JATA 4CW7A 3SZRA 2HCJB 1YZUA 3CNLA 4N0DA 1T3LA 5FUWA 2DB3A 1TU3A 1DAIA 4EH1A 2WM9B 3CPJB 2OFWA 1NLFA 4QHYA 3VMFA 2WAXA 2WPDD 1E99A 1T4GA 1P75A 3SYNA 4IDQA 4BFUA 2C95A 4DVGA 4B74A 3TIFA 4B48A 1J7KA 4E09A 2EFGA 1GVNB 2PBRA 5GV8A 1S2MA 3I56B 2OK8A 5EP1A 1Q22A 5FOXA 4F7DA 3K0AB 1BQEA 1G3MA 1VIYA 1EX7A 2ZEJA 3U6BA 4UJ5A 1P9WA 3EXAA 3OEEA 4FW9A 1PV4A 4PO9A 2JDID 3PITA 1XJ0A 4U9UA 2D7DA 4PC3A 1R7RA 4B76A 1TQ6A 3I1FA 1P9RA 1Z6GA 3AVXA 5G40A 3TUZC 1YQTA 1ZVQA 5EUQB 3FKSD 2ZI7A 3HR7A 5FPHA 1QG0A 5JWRA 3ZVNA 1B2RA 2IXFA 2C9CA 4EQ6A 3NEJA 4WXRA 1K8AD 1R0YA 4PZZA 1JPNA 1E2KA 1N6KA 4L9WA 1NN0A 1HQCA 3NTUA 4A8JC 3LLUA 4GT1A 5DISB 4C0SA 3CCEB 3WNDA 3IUYA 2VSFA 1SVMA 3GMTA 3GJ4A 4IRUB 2BSAA 5KDLA 2YWEA 4KLZA 3NKVA 5HE9A 2XAUA 1XDBA 2ODEA 3I4LA 3VR2A 1QG2A 2ZJOA 4P4TA 4IFEA 3W2EA 2IW3A 3QIAA 3OEHD 1TNDA 4BFWA 3TLXA 1E96A 1LF0A 4DB4A 2F55A 1WP9A 1NN1A 3I92A 4YDHB 3W8NA 4RZ2A 2QPTA 1GKYA 3A37A 1R0WA 1XF9A 2W58A 2AR7A 1KSGA 5F9HA 4PO1A 1YZQA 1U2RA 1RRPA 1WXQA 4NBSA 3BK7A 3PUVA 4G1VA 2C96A 3G5UA 4GP7A 4YMVA 1Z22A 2P67A 2WSSA 1MO5A 1YJ9B 1AGPA 4A0FA 4OJKA 2EW1A 2KI5A 1S72B 4D25A 4B34A 2RGCA 4A0RA 4A0GA 5D3QA 1W0JD 5J4LA 4NCNA 3AKCA 3H1TA 5K8LA 2VIIA 3RRYA 3ZLJA 1PVOA 2WOJA 3A8TA 3OAAD 1CR4A 1BX1A 4C30A 1KI2A 5H70A 3OE7D 5LD2B 3W2IA 3NVAA 2O8FB 3Q3JB 1R0ZA 4ZGNB 4O25A 3OJXA 1RRGA 3KTAB 1J90A 4DHEA 1E79A 4TL7A 2O8DB 4XOIA 4L16A 4LOAA 5LB2A 2NZJA 3A1UA 1OYWA 3KKNA 4LJ5A 5F98A 4HLUA 5F2EA 1R5OA 3D3QA 4RFVA 2MSEB 1B23P 4WZ6A 3RLFA 2GBLC 5UKDA 1MO4A 1XD8A 2LKDA 4Q4AA 2VYQA 2ZE7A 1ZCBA 1ZU4A 4KO8A 3RDPA 3W5IA 1JXMA 2WZQA 4XD7D 1XB2A 4NYMR 4W5WA 1NJID 4KFUA 4CGZA 5K8IA 1TL7C 1BO6A 4HB4A 4US1R 4FWIB 4D81A 4OHYA 1Z0AA 3F3YA 4NCKA 3JZMA 3G0HA 4PHHA 2X77A 1EFCA 3GEEA 4AYWA 2WWYA 3U44B 2QGZA 1D2NA 2OAP1 2IS6A 2CDNA 2HJVA 1E2QA 3U5ZB 4HE5A 2IHYA 1P2UA 2BMDA 4BFTA 4JKYA 3B9PA 3ZBTA 2IS1A 2Q3FA 2JJ2A 1T0HB 1I7PA 2QORA 4LUCA 1GJRA 4AURA 3GPLA 2OLJA 4NYIQ 2AL7A 1IY1A 3NXSA 5EE1A 4MYCA 4URVR 4NU0A 5DI3A 1ZC4A 4B3BA 4B3CA 3PIRA 1OXTA 1XRJA 1LVGA 4HB3A 3O47A 2B5OA 3FMFA 4YMTA 4PHFA 2H8KA 1G3RA 5BXQC 4DLTA 4JVMA 1XMVA 4KLNA 2ZXUA 4ZI2A 1QHYA 3WRXC 1NJGA 2Z0MA 3WMEA 2QBYA 1OYYA 4XWOA 2IYSA 2FNAA 1Q0UA 3PVSA 3K1JA 5JZVA 1AM4D 3LLMA 4KYUA 3UMSA 1FP7A 1OXSC 3MD0A 3NBFA 4PSKA 2FF7A 2L0XA 3LQRA 4NONA 1RRFA 4NYJR 4F4CA 1ONBA 2XJ9A 2BJWA 2N46A 4HLCA 4JLKA 4P6VF 1NKTA 2B7BA 1W1WA 2P5TB 2JJ1D 1WRBA 1NBMA 1X1RA 2EFHB 4D6PA 1P72A 4CRWB 5GADl 4XJXA 4MKGA 2OBLA 2ZRCA 1JI0A 4LJ7A 3PUXA 1UKZA 4UXHA 2X19A 2AXPA 1CBUA 3RS7A 2PLFA 4QBFA 4YMUA 5LD2C 1VYVA 3THYA 2JLWA 2BBOA 2NZ8A 4G01B 2UKDA 1PJRA 3CX8A 4Q21A 1VG0B 4PAOA 2C99A 2QBYB 5JJKA 4ZO4A 1S4QA 4IHQA 4WZAE 5CK5A 2Z43A 2R6DA 2ZTSA 1SZPA 2QT1A 4TYNA 1XTQA 4C9BA 2R6CA 1XD2B 2Z4SA 3SYKA 5L3SA 5EP2A 2NGRA 3CWQA 4MQBA 5J4YA 3HU2A 4BLPA 1BJKA 4E07A 4A6PA 3FFAA 2FSHA 1RIFA 4RY2A 3FMOB 5AJWA 3ND9A 4YAFA 1P61B 4R7ZA 4TLDA 5EE0A 4DUGA 3QPWA 5CB8A 3JZAA 3KJIA 1T8TA 5GJCA 3R20A 3QKSB 4QJ3A 3SE0A 3QVVA 2G3YA 4QBIA 1JPJA 3W6OA 1C4OA 2REOA 2I1QA 2DBYA 1N0WA 4KVGA 3CPHA 3CMEB 1S1CA 1VMAA 4RD1A 1QVGB 1ELOA 2VSOA 3UKDA 4NP6A 2ZSBA 2VP4A 1KOFA 1TQ4A 1JJ2B 4C2TA 2FOLA 4JBYA 1EG7A 3DVLA 2F1JA 4TYWA 1E0SA 1RFLA 3QG5A 1G8YA 2VZLA 1BYUA 4K1XA 2BWJA 4IKEA 1DAMA 2X3UA 3B60A 1VHLA 5FL7D 2CBZA 1VIAA 1E9DA 3GJ5A 2N1BA 2WHXA 2QTFA 1LS6A 2J1LA 3OIWA 2ERYA 3CB4A 4W9MC 4NKRA 4D0GA 1R6BX 4DKXA 1VYUA 2RGNC 4CF7A 4AKHA 2LCFA 2FEOA 4B3FX 4Z51A 3T15A 1NMYA 3CX6A 1X8JA 2WMOB 5JMTA 2FG5A 1M8PA 1K5DA 3EA0A 4KV9A 3TRFA 2GCPA 4JLJA 5JBQA 4Q9KA 2BCJQ 4D2IA 2ERXA 3SEAA 5CJ2A 1YIJB 1H8EA 3PUWA 3KKOA 2Q9BA 2Z4RA 4DT1A 1SHKA 2IC5A 4NH0A 4KAXA 3VKGA 3TK1A 3FWYA 1IN6A 4V03A 4RVCA 3T1VA 5HPYB 3E5HA 5EP3A 3ONWA 2H1LA 2YNMA 3AUYA 3ZBUA 3TBKA 5C18A 3BE4A 2OG2A 4YALA 2RC6A 3QXXA 2QU8A 4MGIR 2UVQA 1HE1C 5FTMA 2QSYA 4F4IA 3PENA 2YJTD 3B6EA 3GJXC 5JHHB 5M04A 2X2FA 1RYFA 3LQQA 4M9QA 5EP4A 2IS2A 4IOJA 4DDTA 1Q86D 4B32A 2WAYA 1OPXA 4NCIA 1UKEA 1GRRA 2C98A 1JEDA 3GLHA 5A0FA 4E5UA 2ZRGA 3T12A 1E4VA 4Q9IA 4PQRA 1WB9A 5FTLA 1KI3A 1HYQA 4C0JA 3L82B 3I5XA 1VKJA 1F48A 4II7A 4X8HA 1JXOA 3K0CC 4PANA 4Q1FA 1FUKA 4MRVA 1KY3A 3D7MA 4JJKA 2P6UA 1EFRD 3U3RA 3H0KA 2XXAB 2R8RA 1DG3A 1CR0A 2JLSA 1GM5A 2CL0X 4NYIR 2ZRMA 1BYIA 3EAQA 1BMFA 2PL3A 1Q81D 4UQOA 1E2JA 1G6OA 4LJ6A 1N0UA 2QE7A 1FNNA 1SXJA 5DHFA 1N6NA 2ZJ8A 3U3JA 2BJVA 1WBBA 2OE2A 4TTPA 3TVDA 2XB4A 3CH5A 3C14C 3N5CA 1Q82D 4QJ5A 4OK5A 3D31A 4M1WA 5JEDA 1Z6TA 2TMKA 3NC0C 5JLJA 5KPDA 2IYRA 2UZIR 2ODBA 3N70A 4M4SA 3TH5A 3OF5A 2NO9A 1G9XA 1DE0A 1QVRA 1VDZA 3X1DA 1P2TA 4DLUA 4P32A 4LBYA 1KK2A 1Z0KA 4KXFB 2QTHA 2GXUA 2VLIA 2JA1A 521PA 5BW8A 2JIZD 1FTNA 3DO6A 5D3MA 2HT6A 4TMKA 5J47A 3TJZA 4GP6A 1F2TA 2AK3A 4Q7JB 1KI7A 2GAAA 3PR1A 4I99A 3W8RA 2H92A 2PIAA 5TR9A 2W6ID 5BN4A 2WKRA 3CPWB 5KUTA 2O5VA 2CVHA 3EZ7A 1Q44A 4FMCB 1KY2A 3AP2A 1U94A 2XNDD 3TQCA 3UXMA 2A5YB 3BB4A 4AK9A 4TMVA 2J7PD 2WJIA 5JHGB 3LAWA 2VEDA 1ZM3A 4RKEA 3LBHA 3VFDA 1Z0IA 4LBVA 3LFUA 1YITB 2VBCA 4S35A 1XEFA 4AF6A 2YV5A 3ZGXA 3VQTA 4KYIB 1T6NA 1YHNA 2ZVQX 4OI2A 3B1WA 1UFQA 3NH9A 3T61A 2FPMA 4JT4A 4EFMA 1OH5A 2G1JA 3CH4B 4UNNA 4BUJA 2D2FA 1QHHA 3AF2A 1EFTA 1R8SA 1U98A 2XZPA 1AQYA 1P3JA 2ZJ5A 4O3MA 2PEYA 4QKQA 1ZC3A 2GETA 3K70C 1GP2A 4W7SA 1DBSA 1RVDA 1XU4A 2F3TA 4MA4A 2RCNA 2VQSA 1XCMA 4NTZA 4C0LA 4G0NA 3ZZ0A 1E2EA 4AC9A 3QPUA 5E3HA 3IPXA 1CNFA 2GWHA 2WJHA 2CMKA 1M6NA 2P65A 4FCVA 1ZMXA 3U6KA 1TQDA 3BXZA 1XEWX 2EVWX 4N3NA 4HLQB 5H5JA 4LWZA 3CRMA 1A2KC 3H86A 2J7KA 4V0ME 1VQ6B 3RRNA 1D2MA 3CCUB 3MMPA 4YXWD 2ZUDA 1GRQA 2MMCA 2QAGA 2RH5A 4YMWA 3AVYA 1GAQA 1Z29A 3HPRA 2OHFA 3G82C 3O8RA 5J5CA 3LDAA 4C7OB 5HZKA 3DKPA 3T06B 3EZFA 5G3YA 4BZQA 4TL9A 3IQWA 5E7MA 2I4IA 3CCJB 2O8CA 4P4UA 2Z83A 1P6XA 3AVTA 4PQFA 2J46A 5FUXA 2V8OA 4ZIRB 1OF1A 2BEKA 2J87A 4HB0A 4NCJA 4BPRA 2O52A 3U3MA 4BZPA 2CLCX 2CNWD 2IUSA 4GNKA 3QXCA 3DOFA 3K0SA 5KDOA 1Y63A 3BBPA 3WBJA 3K8YA 3UWKA 4FMDB 2ZRJA 3H2YA 3TE6A 1I2DA 1NI3A 1Z8FA 2KBFA 1YR9A 5CDFA 2FZ4A 1EFHA 3WMGA 2W2VA 3QKTA 2A5GA 2W6JD 1C1YA 2NQ2C 4LHWA 5FTKA 1XXHB 2V3CC 1KAOA 1OH6A 4JLDA 3ZS8A 2JLVA 1KJYA 3BS4A 2YHSA 2FDCA 4MGYR 2QRZA 3LY5A 3U7GA 5H8WA 5FL3A 2C9OA 5KTYA 3KQLA 4LJ8A 1TUIA 3NBZC 1I4TD 2HT1A 5EZ5A 2QGNA 1AN0A 3RWOA 3VU9B 1VQ9B 1G7TA 2HJGA 2OEPA 4A2QA 3IEVA 3U7HB 2ZU6A 4RKFA 4JMPA 3GJ7A 4DQLA 4HUQA 2J59A 1TU4A 4DCUA 2H16A 1JAHA 3W5VA 3RS2A 1JQJC 5JJIA 1L4UA 4LRWA 4U7DA 1CJMA 1NY5A 3IIJA 4IVRA 3RRZA 3MJHA 3WNBA 4DCVA 1M34E 1NIPA 5FOVA 1DAFA 1LV7A 3I32A 3WMFA 1G291 2ZS8A 1QHSA 1XX6A 2KBEA 1DARA 1I4DD 3DPUA 1E2DA 1FDRA 2F7SA 2WKQA 4B75A 2A5JA 1JJ7A 1GL6A 2BC9A 2OUKA 3R7WA 1E2PA 1M7HA 1SVIA 2CL6X 2H18A 1H8HD 2D3WA 3Q7PA 5KNBA 3QXJA 4RD6A 2ZU0C 4PSVA 2OILA 2HXYA 1Z63A 4EQ6B 2NO6A 4Q1AA 3QQ5A 2MSCB 1CRPA 2QMEA 2WIBA 2PJRA 3BH6A 1G17A 1QRAA 1UJ2A 2EU8A 1NIJA 3E1YE 2ATXA 2RGGA 3R8FA 5BYJA 1KK1A 4QXAA 1M90D 3AUXA 2Y8EA 3BB3A 2XJ4A 1E62A 2VHTA 2Z5FA 4JYBA 4TTQA 1VQLB 3TUJC 4DB2A 2F43A 2GCOA 4DDVA 4LDJA 1ZRHA 1A2BA 4BFVA 4BZXA 4KVAA 4US0R 4URYR 1EP2B 4PPNA 3SBDA 5EE9A 2FGJA 3L0SA 2LKCA 4MDEA 4GMXA 3E20A 3GD7A 3DM9B 5TARA 3V00A 3NEYA 2G0NA 4LZZA 4D26A 1IJFA 1CJVC 1JJVA 1GNRA 3CBQA 4CEIA 4Q4JB 4BPBA 3LH5A 3FHCB 3ZQJA 1Q57A 2OBNA 3CZPA 2BGJA 4TSFA 3MFYA 4YLGA 1JALA 5FI0B 1XXHE 1E2HA 2ZRKA 4B2LA 1TUEA 1RE0A 2ZR7A 4OK6A 4AY2A 4OQFA 4ZDKA 2C77A 1WQ1R 2D4HA 1KNQA 3ADDA 3AVVA 2YC4C 4X8OA 4E22A 3CC4B 3GLIA 4CEHB 2ZI6A 4WZBE 2WWHA 3Q8XB 4NE2A 2QNRA 5JCZA 3LW8A 4RFSB 4L8GA 1CQXA 2VPPA 4Y0AA 5J4VA 2VP2A 4P0TA 4EKDA 4TWZA 2BOVA 2C2HA 1KKLA 1US8B 3ASZA 2CRVA 3QEOA 3ICEA 2F1HA 4I1UA 1NVXQ 3QXSA 1KSJA 2ZRFA 4OHZA 4W5HA 3KL4A 2X2EA 4PZLA 2C03A 5TMPA 1UKVY 4TTRA 2VH5R 2A7QA 1GL9B 1RZ3A 3W3AA 3B1YA 5EQTA 3PEWA 1S0UA 1KK3A 4MUBA 4EDHA 4DLWA 2DFLA 4WA7A 4Q4AB 2EYQA 2CHGA 2GXAA 2OT3B 4Q4HA 3T1TA 1ZM2A 4OQMA 1XEXA 4YAOA 4NPHA 1E1QD 1NVVQ 1HH4A 3OFND 5CYOA 1U8YA 2CLSA 1KI6B 4AD8A 2BMFA 1JECA 5IDVA 4DEYA 3W34A 2QTZA 5JRJA 4RSGA 2CCJA 4XVQA 2NOAA 3C4JA 3CF0A 3Q7QA 3A1SA 3TVTA 5KSYA 4GDFA 4CYMA 3H4MA 3R9WA 1KRHA 1LB1B 4Q66C 4LBWA 1UM8A 4Q47A 1IB0A 4HEJA 5GV7A 1VPLA 4JLAA 1Z2AA 5DI3B 1FRQA 5CLLA 1S1MA 3U4QA 3A58B 1Z0JA 1FNBA 1QBKC 3Q5DA 2RC5A 2GJ9A 1N8RD 4ZCIA 1E2GA 4TN1A 1Z0FA 2IXGA 4QC2A 2PT5A 5TVKA 2ONKA 3QUSA 2CK3A 1XTKA 2G88A 2F6RA 1KAGA 1SGWA 3QXHA 4PR0A 4AIIA 2LWIA 2HLDA 2RKOA 1E64A 4MKIA 3QBTA 3KJEA 3KXKA 2IWRA 4QHSA 3QF7A 5DO9A 5KSOA 4JLPA 4U00A 1KI1A 1YR8A 2DWOA 5SZHB 1U0JA 4QNRA 4KBFA 1O3YA 4LHXA 4XWAA 3EIHA 2J0SA 1FFHA 2WJJA 2F1RA 1TEXA 2FEMA 2WJGA 3DDCA 1KC8D 2WPDA 3PV0A 2W2XA 3EW9A 4Q1BA 4TT3D 4PC7A 1LY1A 5J4HA 5HCNA 5B58C 4DCTA 3RSOA 2QRNA 4AG6A 5HCIA 4ZCMA 3W3ZB 1RRCA 2V7QD 2FSGA 1VQOB 5JS8A 4D4JA 5GJWC 2ZJYA 2QA4B 1GIAA 3FGNA 2VP6A 2YOGA 4TZ6A 2FV8A 2VHJA 2QMUA 1CNEA 1M7BA 1L2TA 1P2VA 1YR6A 2EFCB 1GKUB 2EYUA 2JDIA 3AF3A 1ZYUA 2ZRBA 4DLXA 1YI2B 1OHHD 2ASEA 3FKSA 3GCGA 1P9NA 1X8KA 2CE2X 3SS8A 4DCNA 2C8VA 4J0QA 4Y9RA 1MO6A 1CTQA 3DEFA 4XSGA 2PZFA 4JSYA 3CR7A 3WYAA 2JLZA 4HLUC 4FCTA 1BKDR 221PA 2Q9AA 3L43A 3AVUA 4AKGA 1BS1A 2QM7A 3D8BA 2IYVA 1AS2A 2FA9A 4HAYA 1QZXA 5L3SB 4ACBA 3IHLA 1ZINA 2E1RA 2G9NA 3LO5A 3K0FB 4PHGA 1T0JB 1EXMA 2BEJA 1WF3A 2GEVA 4Y0VA 2I3BA 1VQNB 2VHCA 2ZJZA 3VAAA 5DNYB 4YHBA 2ZRNA 2B6HA 3BFXA 2H17A 1II8A 3FVQA 3THXA 4H1VA 1G4AE 3EC2A 2G0TA 3EWSA 4JVNA 4OHVA 821PA 5L3QA 3O8CA 4EJSA 2WTUA 4NMMA 3I8XA 1NL3A 3OEHA 3OZUA 3OZVA 1IBRA 3K53A 5B2ZA 1KK0A 4FK8A 1RC8A 3T1OA 1E2LA 1FMLA 2ZJAA 2JLQA 3ASYA 1HY3A 2G77B 4AYXA 4AKIA 5BYKA 1A7JA 1KMQA 5J4KA 1G5TA 5CJPA 4NCHA 4Q9LA 3A6PC 1OGJA 3FPKA 1UEIA 2ZS9A 2QMOA 3LVBA 1AA9A 4HAZA 1X8LA 4LV5B 1E1RD 4C0AC 4DCSA 3ICQB 1GWNA 1WBDA 2C9YA 3AV0B 2V4ZA 4B44A 1YE8A 1M1YE 4Q4LA 1EP3B 1ODFA 2O0JA 1WMSA 4HDQB 4MYUA 1W36B 5GJVC 1OXXK 4HAUA 3GP8A 1VQKB 3AF4A 3TKLA 1NDHA 1W0JA 3I8SA 1X6VA 2DWPA 3KQHA 1BIFA 2A30A 3OAAA 3LA6A 1S8FA 1Q1QA 1W48A 1NJFA 4QM6A 3OE7A 5B57C 3QSYA 3CNNA 5CM9C 1SULA 3VR6A 4HI0E 5AN9A 4K8OA 5AJVB 3CC2B 2PH1A 3GJ3A 1NBME 2XEXA 3ZQ6A 1Q7YD 2ZVPX 4F91B 1OKKD 2ZRDA 5FBWB 1XTRA 2ZJBA 2BGIA 2OM2A 2AK2A 3NHAA 1W2BB 2JEOA 1XP8A 1Z6XA 2ZM5A 1LF5A 3BGWA 4MKFA 4ZDWA 4D4KA 2WJVA 1P60A 2ZUCA 4XD7A 3U3KA 4LBZA 2XZLA 2OXRA 4FCWA 3WHKA 3EC1A 1H42A 1XBTA 3GEIA 1U8AA 2D06A 2VNJA 1G7SA 5LB4A 3VNUA 2GESA 4BLQA 4I1OA 2DFKB 4MH0R 4NL4H 1R5BA 3CRZA 5E7IA 2JCSA 3L8YA 3QENA 1E2MA 3GFTA 1JB9A 3WHLA 4IOLA 1MOZA 3ZIAD 2XTMA 1II9A 2FGKA 2F1IA 1F3OA 2AFHE 1ZM7A 2OTJB 4LV6A 3OESA 2Q21A 4PC1A 4M0LA 4GZMA 1W5TA 2QZ4A 3EA5A 1E9FA 4QFMA 3SR0A 2FFQA 3HJNA 4BGDA 2OK7A 4XVUA 1Q20A 4DDUA 3L0IB 1HTWA 4FWTA 4HZIA 3TSWA 4XWKA 1RJ9B 3GLHB 1KNXA 2JAQA 3LXXA 5THXA 1J8YF 1FX0B 1NVVR 4DRZA 2VF8A 4B6EA 1AZTA 1W46A 1G3UA 2P6NA 4PC6A 2Q9CA 3X1WA 1NSTA 3ADBA 1CR1A 4JSTA 2RMKA 4BRUA 1X3SA 4DZZA 1ZW6A 2DFNA 1SQ5A 2XSZD 5FOWA 3THWB 3T1QA 4G5RA 4B33A 4IVQA 1W49A 4FD2A 4OHXA 4RZ3A 3W6NA 4DIDA 2FSIA 1TMKA 2JLRA 4HYYA 3WYGA 1CRQA 2CE7A 3CCQB 4RJLA 4Q1DA 5AUPB 2YKGA 2Q6TA 2PZGA 4MRPA 1K5GA 1NSFA 1SXJB 2JJ1A 2YVUA 3A1VA 1AS3A 4KCGA 1JQLB 5HE8A 1W36C 1QGAA 1EK0A 3QF4A 4A92A 2QG6A 3MJRA 1CXZA 2GILA 4A2PA 3KFXA 3B1ZA 1SVKA 3ZZUA 1TF2A 1ZD9A 3EIQA 4M9XA 3T34A 3X1YA 2V6JA 1WA5A 2NIPA 1NY6A 1AJEA 1QDEA 1Q3HA 4Y7CA 1JR3E 1NF3A 2YC2C 5AJXA 1Q3TA 3B78A 1YZNA 2GJAA 2IYZA 2OCYC 1F2TB 2PZEA 1JR3D 2XOKD 3N2EA 3GQBA 4C2UA 1G18A 1Z06A 2ATVA 1E2NA 1R4AA 3RANA 2OLKA 3G6EB 1SVLA 2RGAA 4G3XA 4LK2A 1C9KA 4PXAA 4BFYA 4PPQA 3FMIA 2PT7A 3RC3A 1DOAA 2ZIAA 4P4SA 3S1AB 3ZZTA 1VQ8B 4PPFA 1PZNA 3L8ZA 3IQXA 4K81B 1NLYA 3ZH9B 5JWOA 1LW7A 1QUEA 2IK8A 1KYIA 4D4MA 1KJZA 3I72A 1DVRA 2HF8A 3CF6R 3HU1A 1AMOA 2R9VA 4JLNA 4GBMA 3ND8A 3PFIA 1GKIA 5AUNB 2P6RA 1E3MA 2QPAA 2PCJA 1XWIA 4NDZA 4M53A 1BOFA 3B9QA 1ZJ6A 2O8EA 3RABA 4TL8A 3ZC3A 1S9HA 4DLZA 3OIYA 4PGOA 3UPUA 1QHHB 2P5SA 3RRMA 4X8MA 5ELXA 4FMBB 1FNDA 4JVSB 5G3ZA 2RHDA 5JS7A 2ZAMA 5HR5A 3KXLA 2JLUA 2X1VA 5FI1B 2ZRLA 3GLHE 2WICA 2B8TA 1OLOA 4S2EA 3MLEA 5AK0A 2K5UA 2AKAB 4FINA 5CYPA 4IDOA 1KO5A 1KZ7B 4C4PA 4Q00A 1NVWQ 1F6BA 3JVVA 2J0QA 4OQNA 3UANA 2FMXA 6Q21A 3P20A 2A5DA 3IILA 1KGDA 3E70C 3IGFA 1G21E 2VL7A 2FN4A 3H84A 1Q1BA 1W4AA 5FL7A 4M1YA 3MCAA 1G5PA 1KI4A 2GK7A 4QRHA 2QPOA 3K70B 3AEZA 5G41A 4IDNA 4JLVA 1IN5A 4EIWA 3P32A 4A36A 4MGKR 3OJWA 3G4SB 1XMJA 4YMSA 3ZYCA 4RCZA 3IBYA 2OCPA 2NMVA 1LTQA 3SFZA 3FMPB 4IDPA 4IW3B 3L0PA 1CF4A 2XTNA 2QP3A 2GJSA 4K46A 3FHTA 5AWFC 1SXJC 3CXCB 3U3OA 1ZUNB 4BWYA 1S3SA 1N6OA 4A1FA 1UPTA 2MSDB 2BDTA 2DY1A 4Q5IA 2QENA 4FI3C 1EWYA 4YC7A 1E98A 2GF0A 5G53C 4R2IA 2ZITA 4AWXA 5BN3A 1BH2A 4HZUA
chains in the Genus database with same CATH superfamily
1N5IA 1QIJA 1SVUA 2Z30A 1PHRA 3CX3A 4Q19A 4OHMA 2FP4B 4EMSA 4LF5B 1KI8A 1VCOA 3AXSA 3F74A 3JQ9A 2IXAA 4F9FA 3BH0A 1UJ5A 1HZJA 3D3JA 1XA0A 4HLNA 3VGJA 2IHBA 5DN6D 4HG2A 3QKRA 2GT1A 2HH9A 2ZG6A 3VYSB 4EG8A 5AW1A 2Z98A 5CDTA 3WIOA 4HYEA 4E88A 4PNZA 4BATA 3AJ9A 2BT4A 2QTMA 3P52A 4DJEC 1LSSA 4BMNA 3QX7A 5KOYA 4IAOA 1U0TA 1MBZA 4N5MA 3UAYA 1NTRA 2HAEA 1TRHA 4Q4DA 4WW0A 3ZVMA 1W0CA 2HHLA 3EWAA 3E9QA 5HVNA 2ZULA 4GRAA 3GLGB 5AJYA 4KKUA 3RV4A 4NG5A 4L5BA 4J90A 1WXDA 3KU4A 5DX1A 1H65A 1GGEA 3M3HA 4O3FA 3RC9A 3QEMA 4XW2A 2WTNA 3VKVA 1FTSA 1LZKA 3U4IA 2C3MA 3QFHA 4I3FA 5KX5A 3H3JA 5EXDA 2W2PA 3UNXA 4FEYA 4C0WA 3NASA 3KBBA 1Y4DE 2ZE6A 1E3EA 1RAGA 2P2ZA 3EQ2A 5EJ4A 3TUIC 4ON9A 3WK7A 5KNLA 4L7QA 4UE2A 1G42A 1P7PA 4F4FA 1RZUA 4UOQA 3L0OA 2W2LA 3HACA 3T7DA 3HO8A 3MB8A 3ICVA 4P58A 1IDN1 2QEXB 3MWGA 4WKOA 2E1PA 1FS5A 1LTKA 4B83A 5JARA 4EA7A 1YRAA 4BQSA 5EVCA 1V7CA 1JEJA 4JOSA 2E18A 2VDOB 3MUFA 5JQGF 5KO2A 3CMAB 3D5EA 1M72A 1A8UA 3PA6A 3QUQA 2AT1A 1ST2A 3IKLA 5H9VA 2QE6A 3OPXA 1B15A 1PQWA 1IHUA 1X87A 3WYDA 1L9XA 3ETDA 3VV2A 3ZW7A 2UZ3A 4Y1GA 2NTYC 1A97A 2SICE 2VRCA 3W0LB 3CCVB 1MT3A 3LV8A 2O8VA 1AUVA 3MCZA 4QXRA 3IEIA 3RF6A 2ZQ5A 1NYRA 3ZV4A 3AY7A 3V6LA 2OV8A 5E9QA 4DL9A 3PXXA 4HMOA 3U7IA 1WV0A 3IJ5A 4QQRA 3IPYA 3GQVA 2EGHA 4EJ0A 4R31A 1OT3A 2ZYUX 3QU7A 3V9PA 3PRKE 1Y89A 4PQYA 2EF1A 2DPXA 1Z7BA 4LC9A 9LDTA 3CCBA 1AXEA 1OXVA 1W2GA 3OP1A 3JVUA 4O2LA 4B47A 4FU0A 4R81A 4JT2A 3HSSA 2HK7A 1T2NA 2IKSA 2HK6A 2HC9A 1ZHOA 5I4CA 1U3WA 1L4FA 1ZM9A 1T8UA 2CUZA 4C4YA 1MT0A 2IOFA 4PN7A 4CEIB 2PGLA 3L01A 4U2BA 3SP1A 3JV7A 3VNAA 3UB2A 2H57A 3GLKA 4PNEA 2O1XA 3BREA 4MWDA 3IALA 2P1RA 2WZCA 2I2FA 1E9SA 1ZGHA 3KJNA 4REOA 2IIQA 1JEAA 1W4RA 2IIVA 4KBGA 5GMOA 5KPJA 4X7DA 3ZY5A 1MA3A 5IFKA 1VRVA 5BV7A 2H4FA 1P29A 4HXGA 1G5HA 1V5EA 1NP3A 4CR8A 1TDJA 3PUYA 4IH9A 5ARBA 4OIFA 4L5YA 5KDDA 4I1IA 2VUTA 3JQ8A 1Z17A 3DBRA 3NUGA 4KIFA 4CF5A 4HRAA 5CT5A 3I4CA 5TQ0B 1CUUA 5I01A 4HRVA 5KYYA 1REQA 2BCGY 4JV5B 1FQJA 2I34A 4O59O 4YT2A 1IB6A 4ETIA 5CNMA 3UJPA 1P74A 2KWIA 1LC3A 3E84A 1HMPA 3GJ8A 4WXYB 1K75A 4ZMRA 2OAEA 2JFPA 3NX4A 1WXWA 3PNBA 2H3HA 1L5GB 4CT4B 1RHJA 4UTRA 1JT2A 1NUHA 2BBWA 2WSYB 2Z4TA 4PZ0A 5TEVA 3F6YA 2PSEA 3CEHA 2VJLA 3UJ7A 3WLTA 2R44A 3UHJA 4C5BA 1HNZB 1G3IA 4PTLA 3BHMA 4FYYA 3ER9A 5A5FA 3QJYA 4D3DA 1IXSB 3DNFA 3HJUA 1WQ4A 3A4YA 1D9XA 2BFWA 1T5SA 3CYFA 2IV3A 2H1RA 3BTVA 3SYMA 8LDHA 5DMXA 4TMZA 3KXIA 2CMHA 4UUMA 1USKA 2XV1A 4XUGB 2F8TA 5JZOA 1KAEA 1X80B 3SXUA 1BVRA 2MYNA 2WW8A 1CDZA 2PKRA 3V8EA 4C4OA 1TEVA 5DWQA 2QD1A 1NULA 1U9JA 4MSUA 2HUPA 3ZDQA 4OKNA 4JJ8A 3F6PA 3EGDB 2WIAA 4L27A 4EW2A 1ZWLA 2ZRPA 1GZHB 4MV0A 5DW0A 3GIWA 2NZXA 3QBVA 4I36A 4ONEA 1TO1E 2J5RA 3JAKA 5FFNA 3THOA 4CI9A 3U9SA 2AN5A 1YIOA 3CNHA 1UBHS 3DKVA 3EDMA 3K0EA 3KEQA 1BE8A 1N8NA 4P38A 4YPFA 2J6CA 1OFIA 5CXSA 3TDKA 3A70A 1XPOA 4EPYA 4DDMA 3EOZA 3H42B 4CMIB 4IHJA 3AIIA 2HMSA 2FX3A 2FRVA 2NZWA 5LWHA 2OGSA 1ZR4A 2PV0A 4KO4S 2YWGA 3CN7A 1SVSA 3TM5A 1Z6PA 1TPZA 4X54A 1GZSA 2OESA 2H4ZA 4LSWA 1RM3A 2EERA 4G5QA 1M8FA 1Z9BA 2D5IA 1COWD 4NV1A 4KXWA 1IEWA 3K31A 1VMIA 4F85A 2ZM6B 2R6ZA 3E1KA 4NOLA 5CFZA 3ZEAA 1PYGA 2Z5GA 1UP4A 4HAWA 4QYSA 5DGXA 3R76A 1E1KA 1FNCA 1UQUA 2C59A 4MB6A 3TW4A 2BKLA 5BURA 1G20B 2XLCA 4WGGA 2BGMA 1WZCA 4BE7B 3VR5A 1SA0A 3TW8B 4XYLA 1LDYA 3LT1A 1C1DB 2GZMA 1QNFA 3K1YA 4UEQA 5AK3A 3OOWA 4RF5A 4YB8A 3R6JA 3A35A 5DBEX 2GZ3A 4XCXA 3WX0A 4IICA 5HS4A 3TMYA 1U0NA 3UWPA 3CWZA 5K8VA 3GLIE 2ZBRA 2RAFA 4X1YB 2EEZA 5DU2A 1K3UB 1CUSA 3K2EA 3T56B 1TCVA 3DTTA 2R3SA 3UXEA 3G7SA 1R15A 2HO4A 2IEAA 2RBEA 2X0RA 3EXFB 3I83A 3LSTA 1W8DA 3EUWA 3TVYA 2AOUA 1HR0B 1J99A 1V11A 2Z2XA 4TSKA 1H85A 1TIKA 4FUTA 2D74A 2QKYA 4ILEA 1V9SA 5LLSA 4YUWA 1WUTA 3DF9A 5KSZA 1P0MA 4OQLA 4Q7EA 1DZIA 3RBXA 3VOSA 1THGA 3ZV5A 4DXDA 1U99A 3TDMA 4AJJA 4XWGA 4YPVA 1YF3A 3EIEA 3KLOA 5IH7A 3UA3A 3EFOA 5DSZA 1U5AA 4Q9HA 3QXGA 3LBIA 4KQ2A 1FFDA 4NZYA 3F49S 3F8WA 3HXLA 3RHSA 2A8YA 2IEBA 1NNEA 1H4VB 3LUGA 1L4YA 2KE5A 1KWKA 3TGPA 4PYNA 1L8AA 3ZUGA 1SQ0A 2I3AA 2NPIA 2QRKA 1P4JA 1D0SA 1SXHA 4ZRDA 1T9BA 1RAAA 4FUQA 4EYKA 4P54A 4WIAA 3KEMA 4IGEA 2DKFA 3E4DA 2Q0XA 4KTTE 4EGAA 3P9SA 1KTVA 5E8JA 2PYZA 1ZO8A 4L15A 1BQ3A 1QIKA 2W2NA 3QX9A 1CY8A 2HBRA 4QD3A 3O8QA 3HXOA 1VYTA 4A2WA 3DOIA 4JX9A 5EUMA 3AVQA 1KSFX 1C1XB 1DX9A 3C3BA 4D4HA 4KIUA 2IEDA 3D6NB 2XAAA 1F5NA 4DILA 3DKRA 2X8AA 1EGVB 1HEIA 1OV4A 3RS0A 3KVVA 1UBTS 3IP1A 3KCNA 4J3NA 2ENUA 3ZJYA 1N3LA 2GVNA 5GZ1A 1UD6A 4FHDA 4QU0A 2AG0A 5P21A 3VC7A 1AKRA 2DQYA 1USWA 1T9HA 3IOEA 5BSVA 2JGNA 2NM0A 3EDCA 3SE7A 4BRWA 3UJHA 3PX2A 2WIDA 4ZJPA 3IDQA 2VTKA 1N25A 2X8JA 4EHJA 3UATA 3A6HA 3KFLA 1FRNA 1FU7A 1DOZA 1ZNXA 2AJBA 3ISTA 5AMXA 6YASA 2B4QA 3REGA 5DNEA 4E30A 4RZXA 5CA0F 5LQAA 3WK6A 4FFSA 2OYNA 4IDHA 2WINI 1E4EB 1XFDA 4NHOA 1ULHA 2WNHA 3M6XA 4ZI5A 2QP9X 4TKUA 2IPNA 4TQUS 5BW4A 1RKBA 1C4XA 5EJ5A 1FXWF 3M6LA 1NU6A 4CLEA 1QIEA 2B5WA 4FS3A 3BIFA 4G67A 4EELA 2O59A 1YR1A 3OZWA 1Y37A 1E32A 1NNSA 1Q1ZA 1R0LA 1Z2EA 4Q18A 2JLYA 1L7MA 1ZMTA 2AGVA 2XTAA 4A6XA 5F1PA 2OV2A 4BLSA 4DQVA 1FP6A 3A2LA 5CJJA 2DUNA 4BGEA 1J23A 1ZNWA 4DSOA 3KEOA 4FHFA 1EZZA 2QD3A 3VX4A 5H59A 4XOPA 4TZTA 2XIQA 4DJTA 1T4MA 2GX6A 1SB9A 2FEPA 1W30A 2OCLA 2DECA 2BEVA 2XIJA 3GVPA 4BEVA 1SHZA 1W581 4JBXA 4HS9A 3GN2A 1Q92A 2QA5A 1COZA 3QUAA 4ROTA 4UBMA 5EGSA 3W9YA 4B80A 4KO2S 4E5YA 3F47A 1AUPA 2NO1A 4F12A 1IL0A 2P7HA 2W90A 2XBUA 1E0KA 1Z0SA 2YRFA 4EJ2A 4D97A 2DFVA 2G83A 5FOSA 3TI9A 1PW5A 4GXNA 2WSSD 1OB5A 5JROA 1N2CE 2GJ8A 3NHLA 3PNSA 3RE1A 4ND3A 1AMNA 1E7QA 2UUBB 3SHOA 3PXUA 2REXB 5FBRB 4RHFA 1MHPA 2AVDA 4G5OA 4M8KA 1SM4A 2NSLA 1P7CA 2VPXA 3II6X 3CVOA 4YYEA 1BXRB 5ERYA 3CKLA 1M2GA 3UJBA 5A4FS 2WYVA 5AJZA 1A8IA 1DI0A 4H7KA 3S28A 4CTMA 1WLYA 1ZISA 4Q9JA 3B3QA 5HX7A 3V1UA 2KQUA 5IZ4A 1EE1A 3I9LA 2ZB3A 4OFZA 1U8TA 4WK6A 2NV4A 3TPFA 1XQWA 4IGIA 5AO9A 2YIMA 2ZI3A 4C6SA 4JMQA 3NHRA 1DP4A 3BQMB 4YMSA 3EDQA 2JGIA 3HKEA 3GDHA 4B4VA 3PEUA 1GRNA 1JDPA 5LCXA 1UC4B 4FN5A 3VTKA 5C34B 1V1MB 1NASA 1YZLA 3JWPA 4OL0A 2GF9A 3ZOKA 4EJSC 5KTKA 3MGAA 4Q3BA 3MCTA 2RE8A 1USIA 4MYHA 4OH7A 4QYWA 3D26A 1C8KA 2CMGA 4V38A 4CM7A 4D74A 1CJKC 3AI1A 4G1FA 2NQTA 3FR7A 4D9KA 4LF7B 2HJWA 5CFNA 3ZWVA 3LQYA 2ORVA 2VJQA 4MV3A 1BLIA 4K6MA 4ZAWA 3Q8KA 1UADA 5SV2A 2V7VA 1PFKA 1VYHA 4XH9B 3HCRA 2VJMA 4FMCF 4NH4A 3ILYA 3MHPA 3RRJA 5T5QA 5IKPA 2C7OA 1FY2A 2JH3A 2ZB4A 3JTMA 3CVYA 4LDQA 3B12A 3CRVA 2ZXIA 2XUKA 2AOTA 2M98A 3FYUC 3D7NA 1WQ3A 4KODA 1U7ZA 4X9XA 4Q1CA 1DWPA 1XYYA 3T3DA 1B4DA 3R7NA 4EHFA 1QFYA 5KU1A 1KQFA 5IVDA 2ICAA 1Y8QB 5CLQA 1JEYA 5JJLA 1PI3A 3FGOA 3OHPA 1UBGA 4BX3A 5LOVB 4JFAA 3M1IA 1M1XB 3OMLA 1E3XA 3HWSA 4AP5A 4DZRA 4ZV4A 4OLHA 3TINA 3BUSA 4L4YA 4QXQA 2J5KA 4HFJA 5LQNA 3A3KA 4XM2A 1QMGA 2ECQA 3WGKA 2YYZA 2FPIB 3E8SA 1A04A 4HBGA 2IW1A 2CYCA 3A04A 1GOTA 4MQMA 3DMTC 3EEYA 4XQEA 4HQFA 2BGWA 1GR1A 1U5BA 2GO7A 4EBBA 3CZ5A 5FA8A 3VYWA 1AOXA 3SR3A 1HTTA 2O5RA 2IV2X 5KNCA 2XZTA 5I9LA 4KDRA 3LYHA 1BC5A 1PBTA 1VCNA 1J9ZA 1TKAA 3AERA 3G5AA 2Y9MB 1G60A 3K2IA 3K9GA 3KSZO 3WNCA 2Z2IA 3ES9A 3ORQA 4X7RA 3TEJA 2NQ8A 1Z7GA 4IR7A 3CVVA 1E1CA 1KHTA 4NULA 3LZCA 2V59A 3SIPA 1S2NA 3GUVA 5JMWA 3DOHA 3N7UA 3TFQA 4BBZA 2Q3DA 3SJBA 3DBLA 3AP3A 1RHKA 1GGFA 1Z07A 2JH9A 4RE5A 1HOTA 1EGMB 4HPWA 1CS0B 1XKQA 5EPOA 3CO0S 1XKTA 4PYOA 2VDVE 3VPGA 2O8EB 2P4HX 2VI5A 3TLJA 4AY4A 4BHTA 1UWCA 2CVZA 4XKWA 1TM7E 2IOHA 5DBOA 1NONA 4BXOA 2O2CA 3A9WA 3E5NA 1U8EA 5GIPE 1E1RA 2I9PA 1N7JA 3KP1A 1E61A 4L0QA 3FLAA 2WE8A 4R3NA 3UGKA 4AKTA 2W11A 3WIEA 4Z0NA 4G41A 4ASUA 4LNHA 4LFCB 3DTVB 4ZN6A 3BAZA 4MRRA 4YS6A 4CQLA 3EPJA 1GPJA 2XYRA 1X86B 1ZCAA 1DBVO 2P9BA 4OHBA 1QSGA 1UF9A 4XQGA 2ZL7A 2RHJA 3Q11A 2EQAA 1K8QA 1DV2A 2DU8A 1S2LA 3O4FA 1C9JA 2QZPA 1XL0A 3MWJA 1CJTC 3SS9X 1P5RA 3LC2O 3BJIC 3LVRE 4PXYA 4DFDA 1MRSA 3JQAD 5E0OA 5EKUA 4BNJA 1EYZA 2QRQA 1B14A 1WHSB 4JP1A 3JASA 1FMCA 1MKYA 1MJGA 1UDCA 1CF2O 2G1KA 3OT1A 1YJ5A 4IXDA 4WVLA 3G85A 1O9GA 4K2HA 2YMMA 5G4KB 3TNYA 3PYMA 3O38A 3G49A 4R8MA 3UGQA 2C7RA 2DERA 4NS4A 1S3GA 1L5KA 4B2IA 4RCYA 1G0OA 1T2EA 2CCGA 2A9KA 2FU5C 2DGDA 4JA0A 5THQA 4MHSA 3PTAA 1PDVA 3RVMA 4XIIA 5C8YF 1QG4A 3K5WA 1HLFA 3U48A 4B3DA 2QQGA 2CVOA 3BMQB 4HAIA 2CVFA 2Z09A 2XBLA 2QNIA 3DTYA 4YV0A 3IBCA 3L05A 1I4OA 3D3WA 3G0DA 3K6RA 1KDOA 2DF8A 1FL9A 1GUAA 3B38A 1K68A 3CT4A 4LQ4A 3BRWD 1NURA 4DPMA 2RDMA 4M0CA 4UHEA 4YY3B 3ZDAA 1C3XA 5JNVA 4OHUA 4YQFA 2WHRA 2YXPX 2J08A 3DZGA 3A3GA 4HWSA 1QLJA 1RQGA 1BPLA 3A7EA 5EAIA 3ACBA 4RJKA 4YDRA 1ZR2A 5DHAA 5AVQA 1Y5RA 4XUDA 1HVXA 2A5FA 3B9BA 4R3UC 1HOXA 1DEKA 3PNYA 2QD2A 4RX1A 2A1TR 2MDTA 4PGFA 1HNWB 1PVVA 1U1CA 4D42A 1SELA 5FNVA 4DJ5X 1VA4A 1YDFA 2R6JA 3KYDB 3FOFC 3NWJA 1RJFA 2J9RA 4QEKA 4B4OA 1X1AA 4CHGA 2E4WA 3KZ1E 4EY8A 8ABPA 3GLFB 5L3ZA 4EYOA 3HC7A 4HN4B 4JUCA 3TSOA 1XRSB 1ISMA 5KNDH 1JJAA 5EIBD 1U7OA 1M1NA 4L28A 1QIDA 1G64A 1KHHA 3DFFA 2FWIA 2ZUBA 4NOMA 2VJDA 3C24A 1HG0A 2I6SA 4GKAA 3VDMA 1VMDA 1MEEA 3KD2A 3N58A 3U61B 3BORA 4ZI3A 1XJCA 1M5RA 3IBGA 1UKBA 4MLZA 4DNXA 4FLFA 3MC1A 1BU5A 5LDDC 3V76A 1OE0A 5FUYA 1JKFA 2A86A 3EQ8A 3NWOA 4RGYA 4TTAA 4ZAZA 3RUDA 4GYKA 4BC1A 2R7AA 1N9KA 3GJRA 1ICIA 4F38A 5BV0A 2YXEA 4LYAA 5DOZA 2HA5A 3N3AC 4FYKA 4TLAA 4P1VA 3H6GA 1AK1A 1EGAA 3A3PA 2W7TA 4UD2A 4II3A 3WYCA 2PUVA 3UMCA 3PIIA 2CXRA 2XUAA 2BLNA 3P9ZA 5HZBA 2DHRA 5TDHA 1ISIA 5J2TA 1RR6A 3GFPA 3UMFA 3L4BC 4ZVKA 3WFZA 5EJEA 4WOBA 5I7EA 3AYZB 3NWPA 3H97A 5KMGA 2YNMD 2O2JA 3TOZA 3CW2A 2JNWA 3ETLA 4QOSA 2GSWA 1O95C 2Y1LA 2QTLA 4LTMA 4WCFC 5IWCA 1C4KA 3LL7A 2PXAA 3QVJA 1XD9A 4M2LA 3V4RA 1DTSA 1IULA 4TWRA 4KX3A 4BVJA 3HWWA 5AHXA 4MV8A 2Q3LA 1UMBA 3Q8LA 5BNIA 4X97A 5CG1A 3STUA 3CR8A 4ZCTA 4DGSA 2CJPA 2IKQA 5CLJA 2IE8A 3IKJA 3WYFA 5JBIA 2IY8A 2Z1MA 3W5JA 3GJ0A 1XLWA 1LNZA 1EJ6A 1YKGA 4M1QA 2XOKA 5HMMA 3A8KA 2ZATA 3EVTA 1VBMA 1NRWA 2V0NA 4YP7A 1BN6A 1TLTA 5LA6F 4ZOAA 3ZHSA 5EXXA 3OPOA 2E4XA 3ZYCA 2ZCJA 2JBWA 1RPZA 1CQJB 1ESMA 1HLGA 1V8BA 1FPMA 1CK4A 1QR6A 4ER3A 1JDBC 5LUAA 1JQDA 1HQYE 4BEBA 4B3XA 4KQMA 5L8VA 1SXJE 1JEQA 2Q3JA 3FWHA 3OOHA 2IY7A 4XDGA 4IF4A 2OVBA 1SXJD 1H1DA 4IMRA 3TLBA 5AKKA 4MB0A 1BD4A 3JQ9C 4UNRA 5JJCA 4DMFA 1YVUA 2P9ZA 4O1MA 1F2UB 1E1YA 5LUBA 1UIMA 1J2JA 3NPAA 3AR7A 1LBEA 4R1LA 1CQIA 1B76A 4ZQFA 1YL6A 2J85A 3P1JA 3C1UA 3CZQA 3N8KA 4EJMA 1DKUA 1QS0A 3EXIA 1ITZA 1RYNA 1ZPDA 3ZWXA 5IH3A 2QB5A 1KOLA 4BOYA 4G1UC 4D79A 1Z5OA 3BC9A 2IYYA 3WGOA 1EFKA 3DR3A 2IP1A 2C5BA 5CBKA 5SY4A 1W47A 2ECFA 3H65A 4JYMA 3TAUA 1GQSA 1YAJA 1VQ5B 4LDZA 1NNI1 4PXSA 2POCA 4H4CA 5EZ6B 2VO1A 5T67A 1EBBA 4P86A 2ZJ1A 1AT1A 6REQB 1UBFA 2CL5A 3IS3A 2JKYA 4V0NA 5DNDA 2HEGA 3MWEB 4RABA 5EJFA 3RASA 3LVQE 4R2JA 1WTCA 1IN4A 1NMZA 4KJZA 5JCJA 5FLEX 3PYXA 5ETJA 3THWA 4UFOA 1TCUA 4F4DA 3SSAA 1PWHA 4ZKEA 5KYXB 4H08A 2XI4A 4Q48A 3M8KA 2G17A 3WKEA 3OEWA 3M9WA 5F2KA 4DR7B 4GNRA 1Q9SA 4JC5A 5WRFA 3QVMA 3GAAA 2FUNB 2TECE 3K1ZA 4FFLA 3SJ7A 4CLRA 3IA2A 1ISPA 1AS0A 4DVJA 2W4QA 3M1YA 4M0PA 5FFMA 3GJYA 3CSSA 2WUGA 2I4TA 3GGOA 5K3EA 4GQNA 1HFJA 2PX4A 4RK6A 4CU5A 2VVTA 3FYHA 4YLEA 4LWQA 3RYCA 4M6WB 4KHPB 5DLPA 1PL8A 2NNWB 4BMVA 3CZ9A 1YVDA 3FYSA 2G82A 2XEDA 1Z5ZA 1VE9A 1G8FA 1Q7GA 1ZOPA 1A4RA 3DDOA 2PMFA 2ID8A 3BF8A 4Q9AA 1FA9A 1Y1QA 4P7JA 2YW9A 1RCTE 3ASUA 2C07A 2OGUA 4ZI7F 2FQQA 4FIZA 5A7GA 1C7IA 1VL6A 2P2GA 3BF7A 3ZD7A 2C78A 1C3LA 2GI4A 3PGLA 4H7EA 4ID3A 4TS3A 2XUIA 2FMHA 4DNTB 1STOA 4ODIA 4F9EA 5IBRA 3COPA 4JQZA 2F9FA 2YN0A 2GPTA 2AOVA 1IQUA 1XAIA 3ITDA 4P4NA 5EXEA 3ZPXA 5BXYA 4ZZ1A 3N8DA 2XWPA 3MMZA 5C46F 1VQPB 1CLEA 4AG5A 1D2HA 2NWQA 5DHUA 1A5TA 1CSEE 1TAQA 2PUTA 2ZKLA 1SCBA 5BNTA 1RMQA 4G1BA 4EENA 3CLRC 3ZY2A 1ZNZA 2JAUA 4F97A 2F43B 3KQVA 5JUWA 3A26A 4XM3A 3HR8A 4FQ5A 3TTVA 4TMTA 3DV0A 1E94E 5JSQA 5C52B 4F8EA 4ZK2A 1DKQA 3VVCA 3PD7A 4MCAA 2VHZA 3T1YB 1MCZA 1NNLA 4HPXB 5FDFA 1E59A 1Z0DA 4BVLA 2ZSEA 1QU2A 3BICA 3MGKA 4PE5B 3ASPA 1G63A 1QK3A 1ZGCA 2PA3A 3K8ZA 3V1YA 4WCDA 4ESHA 5KC8A 4D3SA 1WEKA 5A4KA 4ZOLA 2IYQA 3URKA 1DS6A 1XCPA 1YU9A 2VAPA 3ADCA 3FOZA 1YI1A 2CJWB 4E11A 2JZOA 2YHIA 2WTEA 3W6ZA 4OKIA 1G41A 4GX5A 4KGDA 4IXNA 4QQKA 1ICEA 1WS6A 3QELA 1CJCA 5TPWB 4JUIA 4B3IA 4PO8A 5KHOC 3O2SB 2B2XA 3M7IA 3D3KA 4K5QA 1CV2A 2EZTA 3AUSA 4QHTA 3WGNA 3EZXA 5JVDF 1ZK0A 5DHSA 1ONNA 5JFOA 5JYBA 2OXEA 2PWBA 3BRCA 3VJKA 4FDUA 4O2AA 5AFSA 5JZBA 4ZGQB 3GL9A 3DZKA 4QTYA 1XKLA 2WWGA 3D8HA 1K73D 2AQKA 4TTJA 1YA6A 2OO3A 1S96A 1WU8A 2P1DA 3VC3A 2NZVG 5IW8A 4HV4A 1PFVA 4DR5B 5DTIA 3C6KA 1X2BA 2NVWA 4FSDA 2UYOA 1SKYE 2C2OA 2R2GA 2CLKB 3QQPA 1TT7A 3MQ4A 3M9XA 4IEIA 4BZZA 2IU6A 2OHGA 1WZEA 1JEOA 4W4TA 3TRHA 3KEFA 1NXQA 13PKA 1NOKA 2VQ3A 3LXRA 4LHVA 5ENZA 4C7KA 2D0PB 2PGAA 2QUKA 4TMWA 2C82A 2XXAA 5C1IA 3SZMA 1SHLA 4YAUA 3AFGA 2GK6A 2R5FA 2UYCA 4Q4HB 1UK8A 4KQHA 3V4FA 3D6HA 3GDFA 3AUUA 2ZJ2A 4M8IA 4YJHA 3SNHA 2LIPA 2GYUA 1OUMA 5KYGA 4ZO6A 3U31A 3OU7A 2GRUA 1Z2OX 2DMRA 2GEDA 1HRKA 2ILTA 3MBKA 4R2KA 5JG7A 5JSUA 4D7AA 1WOYA 4LPSA 1YHZA 3DYVA 3PQCA 2B0JA 3PQ3A 4X95A 1I1HA 1T1JA 4BYGA 1ADFA 3C7KA 3CX7A 3LPDA 3R5FA 4INAA 5FBZA 1QQ6A 1FXUA 3G6WA 4XPZA 1QV7A 3UT5A 4ZEOA 4HTAA 2GAOA 5A0VA 1J0XO 2QTVA 1RP1A 1Z25A 1UJCA 3R6DA 1ZL0A 4R2XA 4AXXA 5BSYA 5DNCA 1XN1A 1CS4C 1MVLA 4LNAA 2JH8A 4KFTA 4H1WA 4DLRA 2WBLC 3P4YA 4WWHA 3TRDA 4E0BA 4Z2AA 4H31A 1VHJA 4HHEA 4LSZA 3Q10A 4BO3A 5BMOA 5KYWA 3CVXA 3U60B 3A06A 1Y5MA 4P3OA 1ZOLA 1F8UA 2ZJ0A 1X77A 2EX4A 2EJTA 3F97A 3WGGA 4Q9NA 3KUUA 3UAGA 5IJ9A 2OBBA 4M1SA 3ZNNA 4U2FA 4GOOD 4L2IA 1T34A 4I1VA 1SZCA 2A9OA 1OLXA 3LBFA 1UXOA 2OBTA 1K63A 3HVKA 3WL7A 3IP5A 1D0VA 5F3WB 4I1SA 4IOMA 5CT8A 4GPAA 4KSYA 2AEFA 3C7CB 3KOWA 2SBTA 3PG5A 1G19A 5AKXA 2FR0A 3WZ2A 1XRLA 1UDWA 2ZZEA 5T3YA 4YYZA 2QSZA 4R9UC 1JAIA 4L8LA 2QZZA 3DB2A 1VQMB 3Q85A 2A9QA 2X5JO 2OD9A 2WT8A 3OLZA 4BO8A 3LGAA 3LX4A 1O0CA 2LIVA 1LFAA 3CUUA 3IMFA 2HR1A 4QVJA 3UZUA 1THMA 2ONJA 4BMXA 5KOJA 1J97A 2PTHA 3UB4A 3OJFA 4YEDA 4KE6A 2FUEA 4JP5A 1TUBA 4IIJF 3CZRA 5FWYA 2HSJA 5BNFA 1ODTC 1V7PC 2XYVA 3HUEA 2XUZA 1UPAA 2J3DA 3RQSA 5E2AA 4QUZA 4LRSB 3RF7A 3CRNA 3LCCA 5C1DA 1JNXX 1XQVA 3R41A 4L0MA 4LI0A 4BO4A 5JCPA 4MDFA 3KAJA 1YRBA 3AF0A 1BROA 3ABIA 1F2VA 1Q1AA 2SKDA 1KDVA 5JSZB 1JQAA 5A1TA 4E31A 1OZFA 1XV5A 1PTKA 1V37A 3A9UA 2G5GX 2WWTA 1N6HA 1VCIA 2MYPA 2PGIA 1WSRA 3A1WA 3NLLA 5I5EA 1SQGA 4LQLA 3D3NA 4O4JA 1P31A 2JFBA 1ZIDA 1YFLA 3JYQA 4JYAB 2I9KA 2OGWA 1XTJA 4M7PA 2PEZA 3RC1A 4JLMA 3UXHA 1TX4B 2B1RA 2DPYA 2QI9C 2NO0A 1XG5A 2AE1A 4XLLA 1RKQA 4FCCA 1SWVA 4RM2A 5A62A 4UPDA 5BQ3A 3PGKA 1HDGO 3WWCA 4MS4B 4BN5A 1QO9A 5B30A 2RGBA 2IYLD 1B16A 3QMWA 1N5LA 1Z3CA 2VEOA 1R4MB 3I34X 3ITEA 4UBJA 1V2HE 4ARCA 1RRKA 4R1UA 1OGIA 5TX7A 4E2WA 1L7VC 1NZDA 6CHYA 4L85A 1II8B 1SBIA 1SG9A 1WE2A 4WESB 1EFPB 3FUXA 2YDXA 4DGQA 3E3NA 2DPLA 1BDIA 2W2KA 1TF7A 1EAMA 3KYIB 2GASA 4PW0A 4MYTA 2B4YA 1JBQA 1MH9A 1T9GS 1UKCA 2BZ1A 3DXYA 2XT6A 3EGXB 3EXEA 3P4XA 4IDBA 4PEVA 1NVUQ 1ACJA 3VU8A 1L7DA 2ZSKA 4OI4A 2BZSA 2OZEA 4ZO7A 4M8NE 1Z4PX 1RYZA 2FPRA 3KR2A 1HE3A 2JBHA 1Q7RA 3HN2A 2EDAA 1VPTA 5IYRA 3ELYA 5IJ0A 5EHQA 4DG9A 2D2IA 2BIFA 3B13B 4KE8A 4TPKA 1TTTA 3AH8A 3ZG6A 5L4SA 1UC8A 2GEUA 2XF2A 3KHKA 3ZIUA 3EXG2 3DE3X 2RFLA 1QH8B 4JITA 3PXGA 3MWDB 3MAAC 4BUCA 1Y1LA 3GPDG 1SQFA 2HYIC 5T57A 3S8MA 1V8OA 1JG7A 3T3EA 2W2TA 3V4VB 4LFBB 3DG9A 4CW7A 3HFGA 1LDMA 3WMRA 4O1IA 4CLHA 1EFVA 1VLVA 4XDHA 5GINE 4HTFA 4N0DA 3IP3A 1AQ6A 2Z5LA 4INJA 4R68A 4UUPA 3R7LA 1KQOA 4LEIA 1RKUA 2VCYA 3PE3A 3CPJB 4YRPA 2F8SA 5I9SA 4Y6PA 2WAXA 2WPDD 2I7VA 2WKWA 3GMIA 4FR5A 1P75A 4O4HA 4E46A 4ETNA 4D9MA 4F04A 2C95A 4B6QA 1Y6FA 3EVAA 2Y05A 2EFGA 1UJ6A 1LI4A 3PHHA 4Y6LA 1WMEA 4Q24A 2FPXA 4ZT3A 1K6EA 1F06A 2V98A 3VJRA 1RI4A 5EP1A 1UT8A 2V8BA 3EFHA 3K0AB 5BV2P 1NF2A 3LUDA 1G3MA 4R8LA 2ZEJA 4EYQA 1JQ5A 3U6BA 5IKMA 4FW9A 4PO9A 3EIOA 2JDID 1XJ0A 4U9UA 2BJHA 2EJWA 5CGQB 4PC3A 1R7RA 5D6OA 1P9RA 3AVXA 1T4CA 1OOEA 4RGQA 3TUZC 1B0AA 1ODLA 4I5GA 5EUQB 4GBJA 1QYWA 2ZI7A 3HR7A 2V4DA 1IJKA 4MEJA 1IYZA 3OJCA 1V0FA 1B2RA 2NSYA 2QT9A 1I18A 2FMTA 1UUFA 1N6KA 4L9WA 1HQCA 3O93A 1JE0A 3LLUA 2IDMA 2C1EA 3X0DA 1I3KA 4EHNA 4C0SA 3GB9A 4GGPA 3WNDA 5I51A 5KWJA 3IUYA 2JCBA 3GH3A 2VSFA 2JD2A 1TZCA 1RRVA 1T3ZA 2LV8A 4HNAA 3V8QA 2YWEA 4KLZA 4UOZA 1ID8A 1AXRA 1TM4E 3BDAA 1AUQA 2AIRA 3D43A 4D8VA 4OUDB 1XHFA 4P84A 2GN9A 1TM1E 2YTZA 3ZX4A 4KQWA 4KEAA 3VR2A 4DV6B 5EMMA 5FPQA 3ROFA 4WZZA 1WKVA 2KHZA 5BSTA 3BWVA 3DFIA 4JCCA