4M2LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in nucleotide-free form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
409
structure length
398
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGITIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 97
structure length 398
sequence length 409
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m2lA01
3I73A 5J40A 1T9HA 1ZW6A 1UM8A 1UBEA 1PJRA 2QI9C 4EJSB 4RD6A 2Q3MA 1ZAKA 2HEIA 2ZI9A 3FHTA 3OZWA 4Q5IA 3AVTA 3AKYA 2O8BA 3LVBA 5TXGA 2JDID 1QHGA 2QP4A 4MRNA 4OI0A 1BKDR 3CCJB 3ZBTA 2V9PA 1F2TB 3LVRE 3QF7A 2J59A 3QBVA 1IN7A 2QMHA 1DELA 4JLBA 4KBFA 4KLZA 2F6RA 3VR6A 2B7BA 1P7CA 3KTAA 3PIRA 4HLCA 3UWOA 1AS3A 2F3RA 1QVFB 2WWGA 4URXR 2JIZA 4BLOA 2QGNA 5DISB 1XJQA 1UF9A 3VU9B 1DBSA 5FPSA 5AJWA 5M04A 1OH8A 1XPOA 1GOTA 2OK7A 1N6LA 2DYKA 1KO5A 3CUEF 5F9HA 1UMKA 5FL7A 5KDDA 5FH9A 3BH0A 1NMXA 4OYHA 4LPSA 5J4KA 2ODWA 3ZYCA 1RYHA 3D3QA 2RCNA 4QBGB 1TUIA 1M2OB 2QBYA 1RRPA 2HJGA 5JI2E 5L3VA 2ZRNA 2YC2C 2B7CA 3C41J 2F43B 4BLSA 1GAQA 4DUGD 4XWKA 1E2EA 2NO6A 2AKYA 2OILA 2ZR9A 5HKKD 2AXPA 1HEIA 4B34A 1W35A 3F3YA 1IXSB 1HT1E 2FN4A 2XEXA 2NO1A 2JLQA 1QUEA 1SKYB 3R8CA 1TNDA 1NNEA 3EWAA 3K8YA 1TADA 1KI8A 3N5CA 2N46A 3IPXA 2A5JA 2UZIR 4M22A 4Q4HA 2ZROA 3BERA 3UMSA 5KDLA 2FH5B 5JWOA 4B3GA 3SJAA 4WZ6A 2VEDA 3VAAA 3A4LA 4II7A 4R2HA 2JEOA 2ATXA 4OHVA 2PJZA 2JLWA 3AUXA 3MWYW 2C9CA 2XTNA 4HLDA 4PSAA 2J0SA 4B3BA 2WZQA 4CEHA 1ANKA 1Q3TA 1T3LA 1N6RA 2DFLA 4UNNA 2J45A 2C95A 1NG9A 3AVWA 3NKVA 2AK2A 3U6BA 1S1MA 1OXUA 3ZIAA 4TMVA 3AKEA 3A8TA 3L0IB 2RGCA 2OAQ1 3B9PA 1XF9A 2BOVA 2RHDA 4A2PA 1KMHA 3ZGXA 2V8OA 3B7GA 2BBWA 3C7KA 1E62A 4V0OA 2VYFA 1IY0A 1SXJA 2CVFA 2FMXA 1MKYA 2CEAA 3UWKA 4TLCA 4P6VF 2G3YA 1QGZA 4IOMA 1OB2A 4NH0A 2D06A 5UKDA 4DCSA 2YOHA 1G7TA 2VP6A 4Q02A 4EPWA 1UKYA 2CE7A 2MSDB 1E2DA 4JZKA 4KXFB 2WM9B 1BS1A 4DCNA 1W2BB 4YAOA 2HLDA 4DZZA 1CXZA 3HU2A 1XMJA 4MGIR 5FA6A 2OBNA 4MRVA 3IBYA 3NC1C 3W2GA 1F2TA 1WDTA 2CCGA 5CJ2A 5AUNB 3AUYA 4MGKR 1ESMA 1KK1A 5EP2A 3SFZA 4D4LA 1SVWA 2JASA 1OFTA 1SM4A 2C77A 1NIPA 3GJ7A 4TMKA 1T3HA 4QXAA 3DDCA 1QFJA 4OI1A 3SBDA 5JJKA 3A37A 1Y3AA 2YKGA 2FFQA 2QP9X 1ZUIA 2YHSA 4RVCA 2WHXA 3P20A 5HE8A 3THOA 3X1ZA 5CK5A 5GJBA 4DLSA 4BASA 4GZMA 4QBFA 1E9DA 1S2MA 2A78A 4B75A 2B92A 3W6NA 1NSTA 2X3UA 1NBMA 3IUYA 3DKVA 1N8RD 2A5DA 4LGMA 4Q1FA 3Q8XB 3ADDA 4C0KA 3RDPA 2F43A 5FOVA 1W36B 1YVDA 2O8CB 2DFTA 1CR0A 1AM4D 4HAWA 1CJUC 1QVAA 1XBTA 2XGJA 1P2TA 1W7AA 4N0DA 1RFLA 5JCZA 3L0SA 3I72A 2HYDA 1H8ED 4MRRA 1GM5A 3CNOA 2NGRA 3MG9A 4TQ9A 4IVPA 5E3HA 4XD7A 1YJWB 4YAUA 3QE2A 5EJEA 5IK2D 3ZBUA 4YC7A 3RS5A 4ZO4A 1EFUA 5LBIA 5J4LA 3B1YA 3UKDA 5KNCA 4JKIA 4D26A 2CNWA 1JPJA 3U4QA 3KL4A 3CC2B 4NZYA 5DI3A 2ECKA 4JYCA 5DN6D 2XZLA 1JR3E 2QPAA 4OQNA 4TYYA 1JAHA 3AF0A 2FPMA 1XEXA 2VH5R 1EGAA 1II9A 1LB1B 2REOA 4NYJQ 2VRWA 3RC8A 4LWZA 3P27A 1P72A 4QBHA 3IIJA 2BPOA 2QTHA 3ICEA 1W46A 2HCBA 1ZU5A 3DZDA 3BWDD 5DLQC 3SS8A 3BK7A 1AQYA 2WOOA 4F4CA 4RZUA 1HURA 3EA0A 2YWHA 2Z5FA 2F3TA 4OQXA 4E09A 4B6EA 3C5CA 3SYNA 2Q3FA 2IUTA 3FKSA 1RRGA 3KKMA 1NL3A 2ASEA 5EE0A 1IN8A 1QG2A 2P6RA 4OKSA 1L4UA 4YMTA 1FZQA 3FDIA 4HB4A 3X2SA 4GDFA 3TIFA 5LD2C 4P4TA 4ZI3A 2RGEA 3EZ7A 2ODBA 4IXNA 5G3YA 2ODNA 3FMIA 5SZIA 2QSYA 3EIEA 3WHKA 1P75A 1RE0A 4PQYA 4XTRA 3RS2A 5HZHA 3K0SA 2XXAB 1W87A 2YWGA 2V55B 2X19A 5CDFA 2V3CC 2OV2A 1I2MA 3LX8A 1L2TA 1QHHB 1ZM2A 4G0NA 3SNHA 2JJ2A 1A7JA 2GILA 4A1FA 4QC2A 3WNBA 3CCLB 3OE7D 3M4YA 2B8TA 5EZ6B 3QFTA 4DT1B 3OIUA 4QJ3A 1GUAA 2BCGY 3WNDA 1XCMA 1KMQA 4DVGA 1OXXK 4OQMA 2VO1A 2D7CA 1BO6A 1WXQA 1F6BA 2WV9A 2QN6A 4L9WA 4ESHA 1KQSB 1DDGA 4I1OA 3ZLJA 1AQUA 3OJXA 2AN9A 2VNKA 1DAIA 3IILA 2EYQA 4LPKA 4YXWA 1Q7YD 5L8VA 5KHOC 4HLUC 2IYSA 3O8BA 5TMPA 3QE0A 3IHWA 4RZ3A 3KFXA 1YZTA 1RZ3A 1FDRA 1Z3IX 2XAUA 1ZM4A 1VG1A 3WMGA 1Z47A 4WA7A 3NIBA 4G01B 3I4LA 4LYHA 2AK3A 2R6GA 4CW7A 4QBIA 4AK9A 4BFZA 3TSWA 3BH6A 2R9VA 2H18A 3DZ8A 4H9GA 4JS0A 5J4HA 3F5FA 1GNPA 1MR3F 3D6TB 3EWSA 4Q1AA 2P5SA 3R7WA 1QHSA 3LVQE 4IDPA 2GXQA 4B71A 2QRZA 2FSGA 4YONB 3ZD7A 4S2EA 2ZSDA 4TT3A 2GPJA 1IM2A 4IKEA 4CT5A 4DCVA 4AKHA 4NU0A 1ZCBA 3MCAA 2OBMA 3QXSA 5D3QA 1JJVA 1YR7A 4TYPA 1FP6A 1OXTA 1DADA 1U94A 2Y8EA 4G5SA 4IHQA 1Q20A 3EC2A 4BFVA 2FZ4A 4F4IA 1I4LD 4M8NE 3AV0B 4RD4A 2WWFA 3PR1A 1JJ7A 4OL0A 4BLTA 2NO7A 4FW9A 3REFA 4NYIQ 4MKGA 4ARZA 1GVNB 3REGA 1EP2B 4C4PA 4F4JA 1GAJA 4Z1MD 1DG1G 2Q21A 5DHAA 3TK1A 2DEUA 4A2QA 2FV8A 2R65A 4EPVA 5CB8A 4CGZA 5GV7A 2XNSA 3DMDA 3VFDA 4BLRA 1GILA 1KC8D 1N5KA 1SQ5A 3J81k 3OF5A 2HT1A 4HDCA 2EW1A 2ZRIA 4ZIRA 1Q81D 1FMLA 1R0WA 3QPVA 1HQCA 5KU1A 1JR6A 3ND9A 4RFSB 3THWA 4A0RA 5JHHB 2XXAA 1J7KA 2FZLA 3MRSA 2EFGA 4E03A 4AD8A 1B23P 4K81B 3CCRB 1II8B 4TN1A 2PCJA 2QAGC 1Z6XA 3CRVA 2GEDA 3K70C 1QHHA 2BJWA 4BPRA 3QSYA 1CEEA 1FW6A 4AG5A 4WXRA 1DDIA 5CLLA 1AKEA 1MABB 3QOFA 4LZZA 1W36D 2QMUA 1ODFA 1Z0KA 3WYGA 5CIWA 3CC7B 5DE3A 4DCUA 2X2EA 3K0FB 4LYAA 4M9SA 4LHWA 5DYGA 1VECA 2O8EB 1U0LA 1P4SA 4Q9IA 2ZS9A 3BBPA 2AHOA 1KNQA 4AF6A 1VPLA 2R2AA 3KKQA 3Q5DA 5JS8A 2WJHA 3LNCA 1BYIA 3CR8A 3CWZA 4JLKA 3Q72A 3FJOA 1YI2B 1DO0A 3U7GA 1W4CA 1LFDB 4HE5A 2OTLB 1NY5A 2GK7A 2PT5A 1T0HB 1ZD9A 1KO1A 1XTIA 1CRQA 2RMKA 1E2GA 4U9UA 5BQ5A 4HB2A 1SVLA 2BEJA 2DETA 1XTKA 3IO3A 4IVRA 1EK0A 5KNBA 3BB3A 3CMEB 1R7RA 2ZRBA 3RS0A 1G5TA 2ONJA 2ZVPX 4Z51A 1JAIA 3E2IA 3FWYA 3L8YA 1FFHA 3EPLA 1XEFA 2OCYC 5CM9C 4ACBA 2BVNA 1MO4A 1UADA 3OEEA 1HV8A 5L3SB 2VHCA 5KSZA 1AGRA 1YIJB 1W5TA 4PO9A 4RKEA 2ZRPA 3C15C 5AUPB 3B8HA 1OH6A 3OZXA 4HAVA 2Z43A 2VSXA 5GJWC 3EC1A 4V03A 4MH0R 3CLVA 3JZMA 1F2UB 3OIVA 1S3SA 2WKQA 1VMAA 2BC9A 1U9IC 2NPIA 2OTJB 3U3MA 2IL1A 4QHYA 1SZPA 4JLOA 1E6CA 2H16A 1QF9A 2C8VA 4HAZA 4OJKA 2W6ID 2WWYA 4BPBA 3PUYA 2RC6A 4EPXA 2FOLA 3BXZA 5FUWA 4HUQA 1GKIA 3LDAA 3QKRB 4XH9B 5KSOA 4GBMA 2ZI6A 1MT0A 3WNCA 5EMNA 5H8WA 2C78A 1SXJE 2PL3A 1UKEA 4KVAA 5FOSA 2O0KA 3KQUA 5THXA 2G6BA 2FEOA 1E1RA 4MRSA 3E70C 4IFBA 1HUQA 4ACAA 3PUWA 2GA8A 1M7GA 3W6OA 5BXQC 3AVVA 2ORIA 1M1KD 4F7WA 4RFSA 4US0R 1NLFA 1YE8A 2CNDA 1VCOA 5GADl 3KDSE 3UXMA 4MKFA 1SKQA 3RYTC 2VF8A 2AXNA 1VQNB 3SFVA 3OEHD 1VKJA 2W83A 4NMMA 4C0QC 4JSYA 3GJ8A 3R9IA 2BDTA 5H59A 2QEQA 2PX3A 2JLSA 1MABA 4A6XA 1YRAA 3QY0A 1E79D 1N3BA 2ZR7A 3ZVMA 1G3QA 3WY9A 3K0FA 3ADKA 2JA1A 2H1LA 4HB3A 1P60A 3W2IA 2ZS8A 2OE2A 3PEVA 1RKBA 4HAXA 4TSFA 4Q1CA 1GIAA 4NL4H 4PC3A 1WBDA 1H85A 3RRNA 5FOWA 4NYMR 4DDUA 4A36A 1DTSA 4RZXA 1JB1A 1FP7A 1QGAA 1S0UA 1D9XA 1AZTA 3N70A 4LYFA 2ORVA 1NBME 3KB1A 1TMKA 3LFUA 3LRPA 4P33A 4PANA 4LJ4A 1PZNA 4KSBA 1W0KA 1R5NA 2ONKA 2GEUA 2JJ8A 4IVQA 4GOKA 1E2PA 5K8TA 3K0AA 2V1UA 3FE2A 2G83A 2VNIA 2G9NA 1ZNYA 3K09A 3MHPA 4F7DA 3N2EA 2VP0A 1HQYE 3ASZA 4D82A 5TY0A 4RCYA 1G21E 1MRNA 2QSZA 5JZVA 3G82C 2WSSA 4RD2A 1YHQB 1W48A 2ZANA 1FPMA 1D2EA 3T5DA 3CPHA 1XJCA 1VG8A 3NBXX 1EFCA 1XCPA 1DPFA 3GFPA 4Q7MB 5FBVB 1G7RA 2IXFA 1QX4A 4C0SA 4O25A 4D81A 1EX6A 3PCRB 3MWLA 1KTVA 5L3SA 2RC5A 2FWRA 4V0NA 1NVVQ 4OK5A 1MOZA 4DSUA 1LS1A 2PZEA 3OAAA 1VQ9B 2FFHA 1Q3HA 1FQKA 2H17A 4HSEA 4QNMA 4YMSA 5EZ5A 1NRJB 4R71A 3S1AA 3SOPA 3KKNA 4M1SA 1F2UA 1XMIA 4A8JB 2XOKA 3ZQ6A 3LQRA 3Q3JB 4KCGA 5C2JB 3W5UA 1U8AA 4A15A 5ANRB 3A36A 4MYHA 1WF3A 4PAOA 1U0HC 1FTNA 4HATA 1GKUB 2BKEA 3U60B 3A6PC 5AR1A 2WPDD 1YJNB 3QKRA 2VNHA 1VYVA 3C16C 3MD0A 4GSYA 1V5WA 2O52A 4IXMA 2JCSA 1S3GA 4FCTA 5EE5B 4DCTA 5B57C 3Q85A 1NVWQ 4EIWA 4MYUA 2YOFA 2VSOA 4LHVA 4R98A 4ASUD 1Q21A 2C03A 2FFAA 2Q9BA 4DEXA 1WQ1R 3TW8B 1G8HA 2REXB 4DDTA 3KKPA 5AJVB 2BMJA 1VDZA 4R2IA 2JDIA 2VIIA 3LBIA 2BF4A 2JATA 4NONA 4TZ0A 4ZCMA 2RB4A 3THYA 2R44A 3W2EA 2ANBA 2CCKA 4KFSA 3B1WA 2GCPA 2Z6VA 4PC1A 4J0QA 2B21A 1K6MA 4HDQB 5CDFE 1CF4A 1UAAA 1G18A 1YZKA 3M6AA 3KQKA 4URUR 1O87A 2RGAA 2ZIAA 1XXHB 5HE9A 3U3RA 2IF2A 2IBMA 3JZAA 4B33A 2OK8A 1ONBA 1YZQA 2CMKA 4EJSC 3SJCA 4C30A 5IHPA 1EG7A 3QXXA 3L8ZA 4ZCIA 4XIGS 2BCJQ 3I8SA 4KVGA 1CJKC 2C98A 3AKCA 4MGZR 4MUBA 3TUZC 3WBKA 4UKDA 2ZRMA 3RANA 1F5NA 1GNQA 3B13B 1KZGB 3QF4A 4Z54A 3FFBA 1W5SA 2JLUA 1JXMA 1YQTA 2HUPA 4LBWA 2VF7A 2ZE7A 1JALA 3UK6A 4DUGA 1RC8A 1W0JD 5HKKA 2PLFA 2NZ8A 4Z8YA 4DLTA 2BBSA 4YALA 4B44A 2RKOA 1OF1A 2Z0MA 3HJNA 4IDOA 1RVDA 3AVOA 1UBGA 1GO2A 2J46A 4DLXA 1VQ5B 2BMWA 1GRQA 3ASYA 1ZM3A 3ZVRA 5HPYB 3X1XA 3PJRA 5JRZA 4QGAA 1KRHA 1E4VA 1GNRA 1U8YA 4NCHA 1VQPB 4ZV4A 1G3MA 1QBKC 4TL9A 1N6KA 5J5CA 5FPTA 1TPZA 4CEJB 3QXCA 3MGCA 4Q9LA 4D0NA 5HCIA 2QG6A 4LBZA 2ERYA 2VP5A 3QEJA 2RGDA 5G40A 3I5XA 4B2IA 3TSZA 4CZ2A 3TAUA 2VP9A 3B85A 1OSNA 1I4DD 3RRZA 1ZC4A 2PZGA 4PZYA 2ZR0A 4JVSB 3RS4A 4EKDA 1NVVR 1J90A 1SVSA 4PXAA 4U7DA 1HYQA 2ZEJA 4PQFA 2LKDA 4A8JA 4BE7B 4LV5B 3AB3A 2NMVA 1N6OA 3CH4B 3NWJA 4B32A 2IX3A 4YQFA 2E1RA 1E9EA 5LPNA 5L3RA 1KIMA 1Q22A 4OHXA 1IY1A 3RNLA 4PGOA 2KWIA 3MAAC 2EWWA 3W5HA 2HXYA 2QU8A 3FVQA 4Y0AA 3RRYA 1KJZA 5DSZA 2ZU6A 3OIYA 3QG1A 4DRZA 2RAPA 1KO8A 5FR2A 3LLMA 1KK3A 4PO1A 4UJ5A 3DMNA 3GFTA 4Q1BA 2ZTSA 3UPUA 4V0MA 1CULC 3BGWA 3AVPA 1E0KA 3E5HA 3LD9A 5BW8A 4KODA 4HUTA 2A30A 4TMWA 1QUFA 1MO6A 2GK6A 2QENA 2W6JD 2VLIA 5FUVA 3H2YA 1H8HD 4LK2A 3R8FA 4AKIA 3QKSB 5C4GB 2UVQA 2ZJ5A 2GXUA 4KO8A 1VIYA 4PC6A 4P4UA 1GVHA 4XSGA 2I1QA 2QORA 1XXHA 1NG1A 4IFEA 1M8PA 5JLJA 1KI1A 1L8QA 2ZJYA 1OH7A 1E9SA 3VKWA 1AK2A 4BZQA 3L43A 2EFEB 3KJHA 5J4VA 1G6OA 3VR1A 1RRFA 2B8WA 1G8YA 3LV8A 4B3DA 5JRJA 2IYWA 3AP2A 2FNAA 2IYVA 4YHBA 4XWAA 5BYKA 4CVNA 1G41A 3F8TA 3I1FA 5KNDA 2GEVA 3VR2A 3DOFA 4IW3B 4TMTA 2PBRA 4BQSA 3KQLA 3I61A 4EFMA 1CRPA 1XD8A 3ECCA 2VNJA 4D6PA 3SYLA 3AGPA 4PHGA 3C5HA 3U7FB 3BS4A 5DI9A 1FNCA 2ZRLA 4PHFA 4C0LA 2J5XA 5F3WB 3WMFA 1KY3A 1KSFX 1SVIA 5CYOA 4Y0VA 4WXPA 1H8EA 1XMSA 2ZYUX 3FKQA 4V0KA 2H57A 2OCBA 4KFUA 3C4JA 4BFXA 4DEYA 2WWXA 3LX5A 3KX2A 2KI5A 2CLSA 5IK2A 3W5VA 3GJ0A 4P0TA 1FTSA 3T1QA 1ZRHA 1W4AA 4UNSA 4CEJA 2GJ8A 3KXKA 3WBJA 4XSHA 3FFAA 3SJZA 3WP0A 1JB9A 1Z6GA 5DN6A 2KJQA 2QE7D 4DDVA 1W36C 2J0VA 3C14C 3TR5A 4Q4LA 2IXGA 1DG3A 4EJSA 1XP8A 4PPGA 4EH1A 1T8UA 4TLDA 3PENA 2P2LA 1Z83A 4FMCF 4N0EA 4AWXA 1XRJA 4W7SA 1KI9A 3BFXA 2NPFA 3EZ2A 4PPNA 4URWR 3CZQA 1K8RA 1A1VA 1TU3A 2E87A 4OK3A 1IAQA 1LTQA 4M9ZA 4EFNA 1IXRC 3QFSA 3TLXA 2IUSA 521PA 4AYXA 4B2LA 3AKDA 3LXXA 3ADBA 1I4TD 2W00A 4UNRA 1KK0A 4Q9JA 2RGGA 4HZUB 1W4BA 2W2VA 2IYUA 2GVZC 3VU9A 4JJKA 3N2IA 3B82A 2P67A 1E0SA 2WKPA 1ZD8A 2GJ9A 1M74A 5FL7D 1Z08A 5DYIA 1XEWX 4NE2A 3WXMA 3BC1A 2G0NA 3QKSA 1CQXA 3CCUB 2GESA 3SU8A 4AYTA 1ESNA 3K9NA 4QJ4A 3BD9A 4A6PA 2WJGA 5JJIA 4QM6A 2CHQA 2LCFA 1T6NA 1XZPA 5J47A 1E1QD 2IK8A 1Z6TA 3OE7A 1EWQA 1E0JA 1JXOA 1QHIA 2CK3D 4CDGA 4EDHA 1TTTA 1JNYA 4Y7CA 1XWIA 1G16A 3B9QA 2WMOB 4YDSA 2IYRA 4FN5A 3CKLA 3GLHB 3LO5A 1EESA 5SZJA 3CXCB 4LY6A 4Q9KA 5HTKA 1JECA 4FWTA 4HI0E 4EQ6B 5FBLB 1AKYA 2JLZA 4XOIA 1DVRA 2XJ4A 3CF2A 4LBYA 5D3MB 1E2QA 4YAFA 1MO5A 3OZUA 2DY1A 1OHHD 3QI2A 1OH5A 1OFIA 4RSGA 2J41A 4MDEA 1OE0A 2ODEA 1T5LA 1DE0A 3OFND 3T1VA 2ZM5A 5EP3A 1A2BA 2CVHA 2Q6TA 4Q19A 1OGJA 1W44A 3QNUA 3LO8A 2IYTA 4URYR 3TVDA 3GPLA 1IN6A 4HAUA 4U02A 1GITA 2J3EA 4TL7A 2QT0A 4TTQA 1M7BA 4IEIA 3UATA 721PA 4QG7A 1WCV1 5FOTA 4AG6A 3LAWA 5CB6A 4M53A 4K8OA 2JLVA 2IHYA 3FHCB 1KK2A 1UEIA 4JL6A 5TV2A 4HZIA 4TTPA 2WWWA 4TYWA 2Z4SA 4IDHA 4ZDJA 3L0PA 4NPHA 4Y9UA 1RYFA 2N1BA 3ETLA 3CB4A 2VHJA 4DSNA 1ZD1A 1E2HA 2WMNB 3ND8A 4QJ5A 5FOUA 1JI0A 1KY2A 5GJVC 4W5JA 3FMOB 2ZSAA 4BLQA 4PQRA 3T5GA 1NKTA 1BQEA 1YZLA 2FE4A 2ZU0C 3IIMA 1Q82D 4ON9A 1DAGA 2R8RA 1WBBA 2YV5A 3TRFA 4RJLA 1MH1A 3MLEA 4XTCS 4Z1MA 1KGDA 3AF2A 3RS3A 1M34E 2G1JA 3T12A 3TQFA 4LCBA 4BEBA 1IY2A 1IJFA 2QEXB 2XITA 3W8NA 3CPEA 3BB4A 4HZUA 2AL7A 4NCIA 1COWD 1VHLA 3BH7A 1NJGA 4LHYA 3VNUA 4RKFA 3SJBA 3GP8A 1GP2A 4LJ7A 1OJLA 1XD9A 1Z8FA 4UXHA 5FPHA 3QENA 4A82A 1BMFD 1UBCA 1Z0JA 2V54A 3SDZA 2XNDA 4FMCB 4BFYA 2XJ9A 4NHOA 3DM5A 3P1JA 5EP1A 3U3JA 2GJKA 1ZYUA 1XD2B 2G77B 4YMUA 3QFCA 3FGNA 3IEVA 2GZHA 2ZREA 2O8CA 4GI7A 4AIIA 4DKXA 2CHGA 1N5JA 4D2IA 3PV0A 1KI2A 1R6BX 5KPJA 2IYXA 2E9SA 1HY3A 1G9XA 3GLHA 3WMEA 4L8GA 4QOSA 1OKKA 2ZXUA 1GTVA 4FI3C 4EQ6A 3CF6R 2WAXA 3JQQA 1I2DA 2YVUA 2PMDA 2BKUA 3TAHA 3ZJYA 5D3MA 1NKSA 1VQ8B 4YDHB 1NVUQ 2WWIA 2VYQA 1FUUA 3EPHA 3ZZTA 1W2HA 2O8DB 3EXAA 4E07A 2DR3A 4RD1A 1PUIA 2ZJ2A 4GT1A 3BRWD 4DXAA 5C46F 2IC5A 5FI1B 1KDRA 2XNJA 4B4DA 1Q1QA 2GF0A 2D62A 1NN1A 4QRHA 1HH4A 2WKRA 2ZRDA 4WBSA 2I4IA 2J7PD 3I62A 3FPKA 4GNKA 4JLAA 5AUOB 1FX0B 1TX4B 1QVRA 1A5TA 2TMKA 3SZRA 2XNCA 1OFUX 4LC1A 3GLFB 3U61B 1KKLA 2L0XA 3HYTA 3T1TA 4D4KA 5KSWB 1U99A 2C5LA 3A1VA 3VO2A 3ZS9A 3IDQA 3Q9LA 4QHTA 2QA5A 1YR9A 4G1BA 2QTVB 3H0KA 2DBYA 4PO8A 1QHNA 2KSQA 3OZVA 3K09C 1IB0A 2CRVA 3W5IA 1HA3A 2J0QA 3T35A 1B0UA 2EQBA 2D74A 1ZIPA 1CR2A 2ZRCA 2W6IA 4KYIB 4G5QA 1RIFA 2EFCB 5EXSA 1VQLB 3I5YA 1KOFA 1UDWA 1P6XA 2H92A 2YWEA 4YLGA 3TJZA 1A4RA 1W49A 2VA8A 4BFSA 4DLWA 1OW3B 1GAWA 4UNQA 5LB2A 3NEYA 3IEUA 3B2EA 2OEPA 4KFRA 4JBYA 4DT1A 1Z06A 2FGKA 2CXXA 3ZVNA 1ZM7A 2OO7A 4PTLA 4K1XA 2EYUA 3QKUA 2HYIC 3W2HA 4NYMQ 1R2QA 2R6FA 1BOFA 1J99A 2ZJBA 2QAJA 2QTFA 3FYHA 4M1WA 3E1YE 3TKLA 4V0ME 1RRCA 4LV6A 1ZINA 4NCKA 2R6DA 1O3YA 1KAGA 1IN5A 3OEHA 1EWRA 4B48A 4JLNA 1HE1C 1A8PA 3CO5A 2VBCA 621PA 1E79A 4A0GA 5FBWB 1QFYA 1XXHE 1NI3A 2ZETA 4TWZA 5H70A 1G4AE 1AN0A 1C9KA 1D9ZA 4DDWA 1WA5A 1CNFA 1IQPA 2VP4A 1E9CA 1YZUA 2AWNA 2F1HA 3CMAB 3GFOA 3AEZA 2FGJA 4G1VA 2GCNA 1H42A 4HDOB 5B2ZA 2IWRA 4DSOA 1AIPA 2D4HA 1YHNA 4PSVA 5HXBA 3AVYA 3WYFA 3DHWC 3NTUA 1CR1A 3B1XA 3T61A 2O8DA 2AD5A 4MQBA 1FNDA 3MJRA 5HZKA 5JWHA 1G19A 4M2LA 1PLLA 1VYTA 3E20A 1CS4C 2ZJOA 5FFMA 2IEZA 1Z0IA 4C3ZA 4TLEA 3HDTA 4IOLA 3EAQA 3G0HA 3CRMA 2QQEA 4RD0A 5AN9A 5FBQB 1E69A 3B1VA 1FX0A 3T15A 1QHXA 1E9RA 5TVKA 2P5TB 4MYTA 1VIAA 2IS2A 5DO9A 2WIAA 2FPKA 3GLFA 3IQWA 4BZPA 3FMFA 3MSXA 3DO6A 1XU4A 2BBTA 2PEYA 5HCNA 2OFOA 3KFVA 1YRBA 1W34A 1FMJA 2IT1A 2SHKA 3IQXA 1NN0A 2A2ZA 5KSYA 1S1CA 1AS0A 2B6HA 4LRWA 4N1AA 3AH8A 4E5UA 4OI2A 2ORWA 1CKEA 5AJYA 5C1BA 4HE6A 4KFTA 4MITA 2DWQA 4US1R 1P5ZB 3A1WA 4D0LB 2WPDA 4C7OB 1II8A 4HYYA 3RHFA 821PA 3RSOA 4OJQA 4C2UA 3MWKA 5AJZA 1LF0A 3UG7A 1Q1EA 2IYQA 4GL2A 4FINA 3FOZA 2NO0A 1N0WA 1ZUNB 4ASUA 8OHMA 3VR5A 5EE1A 3LXRA 4IJMA 4PAMA 1MV5A 2EWVA 4L5BA 2O8EA 2ZUDA 4BGDA 3TGPA 1A82A 1T4GA 1TQ6A 4HAYA 3LW7A 4PZLA 4A8JC 4TTRA 4ZCLA 2NO9A 4JBWA 3K9GA 4DBLC 4OBEA 4F93B 4B2PA 3TUJC 1UJ2A 3X1WA 5IF9A 2ZAOA 5JMTA 2OUKA 1Z07A 1UBFA 1Q1ZA 3ZZ0A 1Y63A 1XDBA 3FPAA 1P2UA 2QRNA 1G17A 3AF1A 3KXIA 1EXMA 1T0JB 4JMPA 1P73A 3QUSA 3CF0A 3V9PA 2A5GA 3CNNA 1DOAA 3BAFA 5K8UA 3RLFA 1DO2A 4P31A 4LX0A 1SKYE 1RPZA 3NEJA 2HXSA 4DB2A 1IBRA 2OHFA 5FUYA 1XPUA 1V43A 4D4MA 4MKHA 1TEVA 2REBA 4GP6A 3OW2B 5KYKA 1FNMA 3VO1A 2ZRFA 2NZJA 2OFWA 4Q18A 1JJ2B 3QFRA 5EQTA 4LDJA 1W0JA 5EXPA 1SHKA 3U7EB 3QVUA 4CYMA 4ABYA 1G8PA 3QXJA 1S4QA 4PC2A 4FD2A 3MFYA 2HCJB 1E94E 1WB9A 2V7QD 3IBGA 1K9MD 3W90A 4BFTA 4D0GA 1DAHA 2ZRHA 4C0JA 1VQKB 2GCOB 4Y9RA 4IOKA 3SEAA 2AR7A 2GQFA 1Z29A 2JLRA 5EUQB 4LV8B 1KJWA 4GOJA 5L3QB 3NVAA 1Z0FA 4IRUB 1UFQA 1QG0A 1MRSA 4HLQB 2WJJA 1I7PA 5FI0B 1TAGA 5AUQA 4ERNA 4UQOA 1FRQA 4A92A 2A7QA 1XJ0A 5TDHA 2A9KA 2EFHB 3PVSA 1G3RA 2W58A 2ZQ5A 1HTWA 1F20A 3JQPA 3U6KA 4M1OA 5TARA 3RVBA 4JLJA 2CL0X 2QUZA 2W0SA 3KQNA 2IYZA 3QPWA 5SZKB 5BN5A 4DLYA 2XTMA 2NIPA 1BYUA 3FMPB 3VX4A 3QXHA 4Q9HA 2ZPTX 4B3CA 1CJMA 1G20E 2V1XA 3GJ4A 1E2NA 2ZRGA 1E32A 4HEJA 4D80A 2WJYA 3KTAB 1NN5A 1G4UR 1GRRA 3VHXA 2IS6A 4PX9A 4BLPA 3CR7A 1UDXA 2GAAA 4M1YA 5CJPA 4EFLA 1XZQA 3A1UA 1NJFA 1FRNA 1Z0AA 2GAOA 1ZM9A 3U3OA 3GLIB 2CDNA 3ZC3A 4TLBA 2CLDX 1TUEA 2V4ZA 2CJWB 4KI0A 2ZYWX 2O0JA 5J4YA 2OLKA 3OHMA 2AD1A 2QA4B 3LY5A 3KUDA 1Q44A 3FTQA 2W6JA 4GZLA 1TF7A 2RGBA 1VQMB 1KI3A 1Z6AA 4DC9A 1M6NA 1H8HA 1E0AA 2DWPA 3ZS8A 4U00A 3GLGB 2F55A 5EXTA 1W2GA 4U5XA 3DOEA 2VQSA 3TNFA 4Q7JB 1JR3D 2JGNA 3MUFA 4QGGA 1C4OA 1N5LA 3PXGA 2FSFA 2F7SA 1G3IA 2WICA 2KB0A 1G7SA 2FFBA 2D3WA 2GXSA 1BX1A 1YZNA 3GLHE 2CL7X 4QGHA 2PCLA 1LF5A 4ESVA 1Z28A 4Q4HB 4IDQA 1J8MF 3NBYC 1Z2CA 3B6EA 4G5RA 4ZDIA 4QL3A 4DQLA 4F92B 3U7HB 2HDNB 3EA5A 3EZ9A 5E95A 4RD3A 2UZ3A 4ZGQB 2J1LA 1R8SA 2OXCA 2X2FA 4TQUS 4JVMA 1E9AA 1US8B 2ZSBA 4KBGA 3CH5A 1PVOA 2CHVA 3C8UA 3P32A 4CEHB 4O0MA 3EARA 4AF7A 3WYAA 1Z63A 1G5RA 3VR3A 2Q9CA 1N0VC 2XSZD 1N25A 2WWHA 2WOJA 2XOKD 3DEFA 2GCOA 2I1VB 1LW7A 4W5HA 4AI6A 3LBHA 4DB4A 1KMHB 2OFXA 3QQ5A 4PC7A 3CPJB 3PQCA 5L3QA 2PIAA 4UAJA 1ZNWA 3GJ6A 4BRWA 2QROA 4TMXA 4RZ2A 1KDOA 2CL6X 2QE7A 2DB3A 4M1TA 4X8OA 4DIDA 4F38A 1R0ZA 3HR7A 4YAWA 5JJLA 4M1KA 4LJAA 4WQMA 4NBSA 2XX3A 4IOJA 4DLZA 2GJAA 3W3ZB 4JSTA 4AYWA 4LSGA 2GBLC 1X1SA 1AMOA 3OESA 1EFTA 1LVGA 1XEWY 4V02A 2IS4A 4KV9A 4X8HA 1NF3A 4UJ3A 1ZNZA 3NH9A 3VKHA 2V6IA 1TU4A 2BN4A 1EFRD 3AF4A 4OQLA 5FTKA 3ZH9B 4JLMA 4GP7A 3QKTA 5KUTA 3EPJA 4V0LA 4AC9A 1J8YF 3K1JA 1X8JA 1DEKA 2ZI3A 1T5IA 4XJXA 1ZP6A 1E2KA 2AWOA 3PUVA 4Q4JB 5E4FA 3GLIA 5A0FA 4P4SB 3TBKA 5C18A 1CU1A 3D8BA 3GJ5A 2BM0A 2Z4RA 2CJWA 2RH5A 1VQ4B 1J2JA 4WZAE 4CIDA 4LJ5A 4CT4B 2QM7A 1KDPA 2OSBA 2ZE6A 1TQDA 1C1YA 3GLGA 2XZOA 3W9YA 5KTYA 3G4SB 3AVQA 2HMAA 2ZRAA 2ZE8A 4JLDA 3QJYA 1E1QA 1ZUHA 4OHYA 3NDBB 2CK3A 3TSOA 2YWFA 221PA 1E99A 4JLPA 1Q0UA 3SHWA 4G1UC 5EUMA 1PUJA 2FA9A 3GMTA 4FXPA 2PJRA 3HU3A 3Q5EA 2JJ1D 3ES9A 1G64A 3G71B 1TVCA 2QPTA 2Q0HA 2QTZA 2HF9A 5JCPA 3K0CC 1DAKA 2DERA 3DPUA 3U3KA 5CIQA 4B3FX 1OHHA 5BWMA 1D8TA 1U90A 2GZAA 1P61B 1W47A 2BMEA 3R9XA 2GZDA 2ZJZA 5G3ZA 3AVXA 1US8A 3OFNA 3T34A 3U4QB 5DI3B 2R62A 2QMOA 1X6VA 3SI7A 2GNOA 4LJ9A 2D2FA 4K46A 3W5JA 1HE8B 3RWOA 1YR8A 1R5OA 2RGXA 1OLOA 4B3XA 4LHZA 3A4NA 1XEXB 5F9FA 4BWYA 4GOXA 3I92A 3AM1A 4TYNA 2W2XA 5JEDA 5K8LA 2FX3A 1P2SA 5CLQA 1TQ4A 4GMXA 3KJGA 3VHLB 1E2MA 3BOSA 1ZNXA 2OZEA 2GDJA 3SC3A 1YJ9B 1IHUA 2WBLC 4DLRA 3EASA 2FSIA 3LW8A 3O8CA 1TLLA 2GJSA 2PT7A 4LHXA 3VMFA 1G1MA 3SHFA 5B30A 1Z6YA 3GLFE 4IDNA 2VHQA 4M21A 1CBUA 3NBFA 5JS7A 4JYBA 1RJ9B 2GTPA 3CZPA 4A2WA 2JIZD 4BFUA 2FU5C 4FWIB 2O8FB 2IYYA 4TMZA 1QHYA 1S9DA 1SHZA 1YU9A 1R10A 1W4RA 2JAQA 3CX6A 5FOXA 5DHFA 3CCSB 1LNZA 2X77A 4RY2A 3PEUA 3TVTA 4BUJA 1X3SA 2PLRA 4BFWA 4I1VA 1OIWA 3W34A 4H1UA 2ZITA 1GWNA 2ZI7A 2C9OA 2ZJAA 4I4LA 1OPXA 3UIEA 3BFKA 1E98A 3QG5A 1E3MA 2H5EA 4NCNA 1K73D 3EW9A 3GEHA 3JVVA 2YNMA 4E22A 1JEDA 2PH1A 2ZS7A 4Q4JA 1ZJ6A 1COWA 1ZCAA 4P4SA 5LDDC 1VTKA 4LC0A 3MMPA 3AP1A 1VQ6B 1E2FA 4DSTA 1P62B 1D6JA 2CLCX 3PUZA 4FCWA 1BMFA 2PMKA 2IW3A 3QVVA 2BHRA 3NG1A 4TL8A 3P4YA 5A4JA 3CD6B 3HU1A 2AFHE 3RRMA 3VTKA 2R6HA 4EPYA 3UANA 3WHLA 3AQ4A 4N3GA 1N6PA 4PAQA 2P65A 4RCZA 3PEWA 2B5OA 3B1ZA 3TUIC 2DCUA 2ZSFA 2GRJA 3ZDQA 4PSKA 1BIFA 1DS6A 3D31A 4D25A 1G8FA 2O5VA 4QHSA 2OCAA 2BBOA 3OIWA 3CCMB 2BIFA 2GBLA 3BB1A 3GQBA 4MUAA 3SQWA 2V6JA 3ZIAD 2BWJA 1P3JA 1VG0B 4JKYA 4KJZA 4DLVA 5F98A 1G3UA 3R7WB 5FTNA 1XTQA 2VPPA 2K5UA 1JQLB 1VHTA 4LI0A 4BRUA 5EP4A 3H4MA 2C9YA 5K8IA 1XTJA 4M4SA 5DGXA 1SXJD 2BGJA 4AURA 4JIMA 3PUXA 3PG5A 5JBQA 4C0BA 5EXXA 4P32A 5TR9A 4KAXA 1GDDA 5DH9A 1E96A 1E4YA 5FL3A 1YKSA 2Q9AA 2IYLD 3GEIA 2FEMA 3F0TA 3QPUA 1OXVA 2CBZA 5AK0A 4DIEA 2J7PA 2W0MA 2OESA 1CJTC 1PLKA 2ZVQX 3GJXC 2BSAA 3HYRA 5KPDA 4L15A 5EE3A 2HLDD 2ZE5A 1SVMA 2CE2X 1NMYA 4UXIA 2A3RA 2A5FA 3BE4A 2PX0A 4S35A 5DIFA 4XVUA 1SVKA 4ARZB 2ZI4A 1N0UA 3KKOA 1IXZA 3LH5A 4AKGA 2IHBA 5CITA 2ZI5A 4PFSA 1TEXA 3CCQB 4PR0A 3CRRA 5CYPA 3GEEA 1XCGB 5FPKA 3CNLA 2P6NA 5KOYA 1RJ9A 4EAQA 2JLXA 1FQJA 4A0HA 5JHGB 3U44B 3QBTA 5FTJA 4JLVA 1G5PA 2X8AA 3A58B 4FK8A 3EZFA 2ZRJA 2O8FA 2H8KA 4ZIRB 3CIOA 1NLZA 2F9MA 4ZGNB 5TB5A 2BGIA 2EVWX 3K0CA 3WRYC 4DHEA 3K0EA 3ADCA 1LV7A 2C96A 1LS6A 4C43A 1CP2A 4MYCA 5GVSA 3LLUA 1NBMD 1OFHA 3O8DA 3UG6A 5KDOA 1OV4A 1EFHA 1P9RA 2HT6A 3O8RA 5FPYA 3FB4A 3K9LA 1OB5A 1XX6A 4JVNA 3M0EA 5FUXA 3ONWA 2C04A 4GPTA 3SE0A 3NH6A 3B78A 3HR8A 3I8XA 4PZZA 4G3XA 1GL7A 5CM8B 1ELOA 1WE2A 2KBEA 3THWB 4R7ZA 3WP1B 1L4YA 3IKJA 1YJ5A 2FF7A 2N42A 4JL8A 4QNRA 1JQJC 4XD7D 1KI4A 3TH5A 1TQ2A 1PV4A 1M7HA 2EFDB 4N3NA 3KJEA 4M9XA 2P3SA 4GRAA 4FMDF 2IA5A 3SN6A 3D7MA 3EG5A 1KSHA 1VCIA 4ZKEA 1QG4A 1E2IA 4URZR 2CNWD 3RSLA 1N6NA 1F48A 2IF0A 4Q7KA 1ZVQA 5LD2B 1KI7A 2P6UA 3GD7A 2BMDA 1NDHA 2W2TA 2YYZA 3IO5A 3SYKA 4CRWB 2BEKA 3RABA 2WTUA 1U98A 1KKMA 1P9NA 3IHLA 4TZ6A 1D5CA 2RGNC 4Q1EA 4JBXA 2ZYVX 1G291 1Z2AA 4XVQA 3PFIA 1OT3A 4WVFA 3THXB 3AGQA 3DVLA 3K9HA 1IJEA 3NC0C 3W3AA 4AKEA 5GVRA 3EPKA 3HWSA 2YOGA 2G0TA 4GMDA 1Z0DA 1E9FA 4FCVA 3FKSD 4B47A 3CX7A 4ZDKA 4WZBE 2PEZA 2ZYTX 1NIJA 3H84A 3NBZC 3NHBA 4PHTA 2IWHA 1VQOB 2QZ4A 4OI4A 5FR1A 4I99A 2MSEB 2PZFA 3SQXA 2GF9A 3CRQA 5GJCA 2QMEA 2GETA 1FNBA 2OG2A 2QL6A 5AWFC 1KZ7B 1GKYA 1A2KC 4NYJR 1NVXQ 3CWQA 1OYWA 2VP2A 1E2LA 4Q4AB 2C2HA 3ZQJA 1U2RA 1S96A 3OJWA 1K5GA 5JI3E 4HUQB 1R0XA 4Q21A 1N5IA 3IGFA 3CW2A 4IEEA 1XB2A 3JVUA 2JJ2D 4FIDA 4C9BA 4EPTA 3U44A 3ZVLA 2X1VA 1SULA 2GXAA 2IS1A 1UPTA 5EE9A 3UMRA 4CEIB 2NG1A 4X8LA 4P3YA 5JFGA 2QTLA 1CNEA 2BM1A 1PLJA 1VCMA 2YINC 1YITB 2DPXA 3CX8A 4GFDA 1J70A 4KITB 3CCVB 3KQHA 4M0LA 1R8QA 2VHUA 2XNDD 4JL5A 4UXJA 3CRW1 1QFZA 3RAPR 1GG2A 4I81A 1XMVA 5HR5A 421PA 4YXWD 1FOEB 4LUCA 1XD2A 1JBKA 2I3BA 4POAA 2GKSA 2VTKA 2BMFA 2O0HA 2IXEA 3L82B 2WJIA 5B58C 4Q47A 1N2CE 2ZRKA 4L4UA 4MRPA 2FG5A 4L9SA 4B73A 4M1MA 5DNYB 1IN4A 3E1SA 1OKKD 1WP9A 4Q00A 3GLIE 4ITRC 4NDZA 4NP6A 5JSZB 3AVUA 3ZD6A 1KJYA 2YJTD 2Z83A 1UKVY 1S8FA 3CM0A 4LOAA 1T8TA 2HF8A 2J9RA 2FDCA 3R9WA 2HJVA 1Z22A 1BH2A 3H1TA 4TT3D 5SZHB 3GLGE 4B76A 2MMCA 2J0UB 3QEOA 3H86A 3CCEB 2QQ0A 3K0AB 1F3OA 1S72B 4C2TA 4MGYR 4B74A 5IT5A 1KYIA 3NHAA 5FTLA 1M1YE 5G41A 1QH0A 1KD1D 1JPNA 5H5JA 2BV3A 1D1NA 4WIAA 1NSFA 5JEEA 3O47A 2AFIE 4JVLA 4BEJA 1NJID 3P26A 1S9HA 4BECA 3WRXC 3THXA 3V4FA 4WAUA 2QAGB 3K70B 4Q48A 3W2FA 1QGYA 5JECA 3RS7A 1G6HA 1EX7A 3BIFA 1P2VA 4FMDB 1HT2E 2FSHA 2J7KA 3RWMB 4M9QA 1CIPA 2NTYC 3BFVA 1ZMXA 5LB4A 3TR0A 3B5JA 3PITA 1D2MA 1R0YA 2CCJA 1GJRA 3NXSA 2VL7A 4FMBB 4C0AC 2V7QA 3IIKA 3R20A 1VYUA 1CLUA 4WOPA 5FTMA 1ETUA 1QRAA 4G5GA 3S1AB 5BYJA 1YZGA 2C99A 1NP6A 1NN3A 3G6EB 1UEJA 3UMFA 4Q4AA 2P0EA 3I56B 3GJ3A 3NDPA 3BORA 4BZXA 2EU8A 3CBQA 3GCGA 4HLUA 3A4MA 1B2RA 4NYIR 1OGIA 3L0OA 4KYUA 4LJ6A 3KZ1E 3EX7C 1AZSC 2WAYA 3P4XA 3M1IA 4KHZA 2OLJA 1KSGA 3QIAA 4CF7A 4MA4A 5KO2A 1TL7C 3HPRA 4O2RA 1KDTA 5P21A 2RGNA 2QPOA 5E7JA 4CEIA 4EPRA 1X1RA 3A1SA 4O3MA 4PPQA 2GHIA 3THYB 3V00A 1XFAA 1NY6A 1VCNA 4B6FA 1GSIA 4JT4A 1EWYA 2YC4C 1GR1A 3T1OA 1CJVC 4LJ8A 1NLYA 1E64A 4RFVA 4NTZA 5C4MA 3SR0A 1KAOA 1QZXA 4I1UA 4TLAA 4US2R 2F1IA 4XWOA 1OIXA 2FJUA 5IRCD 1SVOA 1QVGB 3X1YA 1JEEA 4JJZA 1AS2A 1T91A 1X8KA 4KSCA 5AJXA 4W9MC 4KU4A 4NKRA 1F60A 5JSZA 5F2EA 4TL6A 4Z8XA 1BX0A 2G88A 1R5BA 1KSJA 1N6IA 2AX4A 2IEYA 2ZJ8A 4C0HA 2VZLA 3CPWB 5GV8A 1DAEA 3LQQA 3MWJA 4YMVA 2WVJA 2QGZA 1X8LA 2WIBA 1J9ZA 3DKPA 3OEED 3QF4B 4R9UC 2OCPA 2J0UA 4ZPXA 1JR3A 3K53A 1GL6A 5CK4A 2EIXA 1WMSA 4Q03A 4AY2A 4H1VA 2DFNA 2IUUA 4DWJA 1ZU4A 2OBLA 3KB2A 2WJVA 4OK6A 3TW4A 1Q1BA 3VR4A 2QY9A 4Q1DA 3A1TA 1GZSA 2F9LA 2LWIA 2OXRA 4OHWA 4Q7LA 4OHZA 3VQTA 4A9AA 3DM9B 5E7MA 1EP3B 2MMGA 3LBNA 3VKGA 4QKQA 4KLNA 4DQKA 3I55B 2QAGA 4QGFA 1KHTA 1KI6B 6Q21A 2JLYA 4ILEA 4Q01A 1U81A 3KJIA 4TYQA 5FBRB 1EP1B 1RW4A 4DLUA 1Z5ZA 1L7VC 2Q3HA 3CC4B 4W5WA 2DHRA 4ZDWA 1KO4A 4JT2A 4X8MA 2DWOA 1E63A 3TMKA 1G8GA 1KO7A 1WRBA 1E1RD 5G53C 2HV8A 2QDXA 1U0JA 1P9WA 1GRNA 5E7IA 1OIVA 4QFMA 5H1YA 1TF2A 2KE5A 2R6CA 3ZZUA 2OM2A 2XSZA 2VSFA 2BJVA 1XPRA 3ICQB 1FL9A 2XZPA 4WW0A 3PEYA 1JA0A 1IOZA 1DAMA 2O8BB 1AJEA 4LBVA 3EZ6A 1K8AD 1U8ZA 1D2NA 121PA 1Q57A 3BJIC 4D4JA 4C7OA 4TQAA 4O2LA 3TQCA 5A5GA 1CR4A 4PHHA 2GVDC 1NMZA 2XB4A 3X1DA 5JWRA 2QT1A 2NOAA 5IDVA 3RC3A 1XTRA 3CONA 1QDEA 3I32A 2ERXA 4QM7A 2VHTA 4I1SA 2NQ2C 1ZIOA 4EUNA 3V4RA 4TSFD 1JA1A 1H65A 3TE6A 4LJYA 1W1WA 1ZBDA 2AKAB 2ANCA 4NCJA 4PPFA 2H7VA 2F1RA 2GWHA 2ZUBA 1DARA 1EFRA 2J87A 1OYYA 2A5YB 3EIHA 4LYJA 3SBEA 1N6HA 3KUCA 2G1KA 1E2JA 1G7CA 1AGPA 3LWNA 5BN4A 2D7DA 3G5UA 4A0FA 2QBYB 1W0KD 1SXJC 2XB2A 3L2OB 5H68A 3LA6A 2ATVA 2DFKB 3Q7QA 2R6AA 3I3SR 1R4AA 4MDFA 3AP3A 4A4DA 1CTQA 5B64A 3W8RA 1TF5A 1DAFA 4G5OA 1XNJA 4Q66C 2QP3A 2WSMA 1U9IA 2KBFA 4UNPA 3CRZA 1II0A 4HB0A 2LKCA 1SGWA 2RHMA 2WSSD 4OQFA 3U5ZB 1VQ7B 3FHOA 3Q7PA 1GL9B 4DJTA 1AA9A 1X86B 2OT3B 2MSCB 4MKIA 3W6PA 1FNNA 3B60A 3IPYA 3K70D 1IONA 2ZUCA 3MJHA 5KSPA 1BJKA 2UKDA 3V76A 2YZ2A 1FUKA 4XVRA 4L16A 1LY1A 2D2EA 2XTZA 3HPQA 2ZAMA 1M90D 4F91B 5ELXA 3EIQA 3OAAD 3VNVA 2F1JA 2JJ1A 2QM8A 3VX3A 3JQRA 4ZI2A 3KXLA 1GFIA 1K5DA 1XE1A 4B43A 3HP1A 3AF3A 1KNXA 1Q86D 2OAP1 1E9BA 4ZKDA 1UKZA 1YR6A 1T3SA 4YMWA 1ZC3A 2FPLA 1KI6A 2QNRA 5BN3A 3U2QA 1MO3A 1XTSA 3DL0A 2ZSEA 4URVR 1SXJB 1Q12A 1VG9B 4B35A 1OXSC 3T06B
chains in the Genus database with same CATH superfamily
1JG6A 4G85A 2EZ9A 3NT5A 5J40A 4KSYA 5CUQA 2CXHA 2O3SA 2W6MA 3OPXA 4YJHB 4X06A 2UAGA 2ZWMA 4UFNA 3V7WA 5HP4A 5KWJA 5BRAA 1XQWA 4AZ3A 1ZAKA 4NCAA 2JW5A 3R3WA 3IS3A 2VDRB 4GWLA 4MROA 2M2IA 3AKYA 1F1JA 4GYKA 3R7BA 2DH5A 4CLOA 2QP4A 2I54A 3CLHA 3G0DA 5GQSA 3V8NA 1AKNA 3ZBTA 1GNSA 2V9PA 4IJQA 4WOCA 2Y0EA 3WLSA 1TT5B 3QBVA 4KWCA 4KLZA 4G7WA 4JLBA 4KBFA 4RDCA 2VEOA 2HO4A 3VR6A 5A9RA 3HVJA 3NWPA 2JL1A 2I6QA 4B5KA 1ZI8A 2QOEA 3VOTA 2CNKA 3DF7A 3DXZA 3PNSA 4URXR 3ZHBA 4HQFA 2OB2A 3P9IA 1FBNA 1P4AA 1GZ7A 1UF9A 3ABRB 5DISB 5CXXA 3VU9B 3B7WA 3LLSA 4TWRA 5AJWA 4Y2GA 4YRDA 4KG7A 2Y05A 5M04A 1B4DA 4ZJYA 1OH8A 4QOIA 3D5TA 1KO5A 4HS4A 1FUEA 2BI8A 4HDAA 5ETJA 2V5UA 3I58A 4DEVA 2OXIA 2ODWA 1RYHA 1NUUA 3NP7A 1V2HE 1MF7A 4G4GA 4QUGA 3TWOA 4D45A 4X3OA 3PGA1 2DQKA 3DCIA 4H3HB 5CYGA 1FTWA 1QM5A 3SQDA 2Y4NA 2XB8A 1RRPA 1YZVA 1JHAA 3RT7A 3ZZMA 2C8JA 4GR5A 3L6OO 1WZUA 3WVNA 2F43B 3T3OA 1GZ6A 3CUVA 2VNSA 1AKRA 1GYPA 2NO6A 3OO1A 2ZR9A 4RENA 5E6UA 4BVJA 1KRXA 1T5EA 2XKAA 3C4QA 3F3YA 1FZTA 1HT1E 1UXJA 2ZCUA 3B51X 1DV1A 2FN4A 3OZAA 2G5TA 2NO1A 1SKYB 4REQA 3R8CA 2DYIA 1K28D 4OOFA 1NNEA 4YIHA 3EWAA 3VVMA 3K8YA 1KI8A 4K5QA 1V48A 4TKZA 2A5JA 2HJSA 1YIOA 4YRLA 2PLNA 1ND6A 5GP1A 1LI5A 3CZAA 3DV0B 3UMSA 2P1DA 5CBPA 5E3IA 5EWMB 4LXXA 2VEDA 1G8MA 2G80A 4X90A 4D9KA 4II7A 1QS0A 4RF2A 4UUOA 2JFXA 4DRYA 2BLLA 3LBAA 2O4UX 3JQ8B 2PJZA 4L1KA 3AUXA 3MWYW 2M6RA 3UWSA 2EQAA 4B3BA 1LRLA 1Q3TA 2XUPA 4BQQA 2DFLA 5JSKA 3C7AA 2X23A 4XIYA 2X1MA 1NG9A 1PZHA 1UXOA 2QE6A 3HCFA 3KQMA 4EW6A 3FUXA 1Z0SA 3ZIUA 4GD3Q 3L0IB 1DKMA 2IV3A 2OAQ1 3B9PA 1T9GS 1P0FA 2CD9A 1XF9A 3QH4A 4TM7A 4AJHA 5JADA 2VTBB 1WO8A 5A04A 1KMHA 1CV2A 1ZH0A 3ZGXA 5AXCA 3UAZA 4AJOA 4ZEVA 1PWYE 5FFNA 3ZK7A 4RULA 2WQ7A 1JIQA 3C7KA 3SQOA 1H4VB 1R8JA 4XPIB 1B26A 1QGED 4MO9A 4X1IB 3UJ6A 3VI4B 1R6VA 4QARA 4P6VF 2G3YA 1KJ8A 2LW7A 1OB2A 1L5GB 4Z7NB 1FVXA 2B4TO 2YOHA 1G7TA 4Z9YA 3V1YA 3G2LA 2KYRA 3IAXA 3CZMA 4JHLA 1TFRA 2G07A 1Z7GA 3NE5B 1U1GA 2WIDA 3IE2A 1VOTA 1ZMTA 2FP4B 2PH7A 3MT0A 1UKYA 4MUXA 3V80A 4R51A 2V7TA 4GLFA 3V4LA 4OHBA 4YV2A 1P18A 1TUBB 3K2EA 2YYSA 5ICMA 3N2LA 4H7EA 1UM9A 2ZIGA 4MGIR 3NTQA 4FYMA 1G20B 3LNNA 3W2GA 1GKLA 2J9ZB 4DLLA 1KK1A 1JT9A 1SVWA 2CDRA 1ORVA 3A1DA 4NWIA 2HNBA 1JQ5A 1SM4A 2A86A 1N5MA 2UZ0A 4UM7A 3VYRB 4ZI5A 4BIMA 1EQUA 3FCUB 1NBOA 1V96A 2GYWA 2X2OA 1GQ2A 2Z2JA 2P62A 3C3YA 3U62A 4UTZA 3WK7A 4YGYA 4WKPA 1JLKA 2FFQA 3D3JA 3PXEA 4JP2A 4WI1A 3H5NA 2G36A 4QUIA 3KETA 2X3FA 5DTRA 5GJBA 1ZGAA 5K3BA 1E1MA 5LLTA 1FIUA 4QBFA 4E5MA 1E9DA 2O50A 2A78A 1KPIA 1T4MA 3W6NA 4HGQA 4RSMA 3A3NA 2HU5A 1YNSA 4X05A 1X8XA 2V98A 4IJKA 3P9ZA 2OQ2A 3DKVA 4KXYA 4Q1FA 3JZIA 3Q8XB 4N7RA 4AZVA 3ADDA 1YBAA 3N2KA 2DPHA 3RDPA 3AR6A 1YVDA 3T6KA 4GI3A 4YACA 2EEZA 3R6LA 4DV7B 3GY0A 2GK3A 3LHDA 4HAWA 1DQYA 1GZVA 2D1RA 5TT1A 5CFZA 1CRZA 1EJ6A 3M6LA 1IM5A 4NENB 2F3PA 4N0DA 1VB5A 2BFPA 2Y2VA 2WJPA 2I7VA 4MRRA 1XNRB 4L4ZA 1AHHA 3OLYA 1HG1A 2PWAA 4F3RA 3MWDB 4XD7A 1XDSA 1YJWB 3QZUA 4YAUA 3RNOA 3WAGA 2B34A 4MI3A 4KLCA 3T7TA 2LIVA 2E3JA 4DREA 4ZODA 2HX1A 3ST7A 4JQZA 3T7KA 4EMTA 2I4RA 1A5ZA 5C51B 1GPJA 5D87A 3RTCA 1VBFA 3B1YA 3OOEA 3UKDA 1C1HA 2YHBA 3AFIA 4P5DA 3WQBA 5KNCA 3KL4A 3CC2B 1E4OA 4ZT5A 1VKHA 3HCRA 2QPAA 3DL7A 4OQNA 4BAUA 1QU2A 1JAHA 3O4RA 1REQA 1X94A 3KAPA 5JCJA 3UJNA 3R09A 4WY8A 2QPLA 1PK7A 4J94A 1II9A 4B6JA 4NYJQ 1YOVB 3GJYA 4RJJA 3JQAB 3RC8A 1P6QA 3MS2A 5FWNA 5EA2A 3P27A 4QBHA 1U0FA 2QTHA 3N2YA 1NNSA 2ACKA 1UKBA 1ZMBA 4UAVA 2ZSHA 3RG8A 4GOMD 3UN1A 5C7IO 5HZBA 3DZDA 3GFGA 3M3PA 4K6MA 4MWZA 3SS8A 4DM4A 3QEBZ 1KEVA 3G2QA 1U4SA 1RKUA 2BHLA 4DIOA 2YWHA 5JV5A 3K2QA 1PWZA 2WD8A 2GJRA 1NUSA 4B17A 3O0DA 4J3NA 2H2AA 2Q3FA 2GPTA 4QIHA 2FPXA 4KQXA 4XVCA 1Z62A 1TRKA 3DMYA 4KFCA 3HDGA 4CMEA 5DGTA 2P6RA 2C0QA 4HB4A 2H1WA 4LDNA 3HJFA 4P4TA 5DNWA 1QZTA 1F6WA 2ATIA 3EZ7A 1DDOA 4CIXA 3JQ7B 2ODBA 1Z0UA 1R3DA 4IXNA 5DTQA 1V7PC 3AWIA 5DBFA 3OQOA 1O08A 3KDAA 2P5UA 1EUDA 4PQYA 4WD3A 1TA9A 1DKQA 3TKYA 1W87A 2YWGA 1K75A 2NVOA 2PZJA 3FW1A 3QIVA 4Z7OB 4AP5A 2V3CC 5BVGA 1TJPB 3BWMA 3IH5A 4DYHA 1EHIA 4IIHA 3QBJA 4KQ2A 3W5SA 3SNHA 1WTCA 3O3OB 1V16B 1O9BA 4UREA 3MQFA 1KMIY 4QC2A 1DBPA 5D7BA 3CCLB 1JU9A 3OE7D 1T24A 3F90A 2O5CA 4AT1A 1RBQA 4S1VA 4QJ3A 5F5LA 2BCGY 3T4UA 5AW4A 1KMQA 5K0BA 3DE2X 1CDEA 5JALA 1GNVA 2D7CA 3J7TA 3R77A 4B3RB 1SQFA 3GT3A 1F6BA 2H1OA 3ZWNA 1B76A 2WV9A 2QN6A 4NZ9A 1YQQA 5JQGB 4CQNA 2BFWA 4I1OA 4KDCA 1RJGA 2AUTA 3G8AA 4L5YA 4NBWA 3RUIA 3V42A 3CCCA 2O57A 4KI7A 4CF5A 1UC4B 2EYQA 1WB6A 4MV5A 4U7TB 4R2KA 3ZVKA 3O1IC 5FX2A 2ZVDA 1J0AA 1NVBA 2IYSA 3ENNA 3HY4A 3KR9A 3LCRA 4QGBA 4RZ3A 1FDRA 2XAUA 5AOAA 3WMGA 5BSKA 5KYGA 4LXUA 1R9JA 2NM0A 3NIBA 5ECDA 4FR2A 1OLSA 2FR1A 4MA5A 1TMOA 2AK3A 2G71A 2I9KA 4UBOA 2G7ZA 3GAMA 4YP6A 2R9VA 1DC8A 1Y8QA 4HXEB 1ZK0A 2D8MA 2XH8A 4JS0A 4UCXA 3WLHA 1GA6A 3OPYA 1QOZA 1K1EA 4Z9BA 3EWSA 3KPVA 2YZKA 3NDIA 1T5OA 4I1PA 4B71A 2GXQA 3PKZA 1HMYA 4YECA 4YONB 5B7GA 3ZD7A 3OUTA 4IKEA 3EAFA 5KX5A 2VBTA 4M76B 1LSUA 3L7YA 1MQAA 2I4LA 2O2IA 1YCDA 2QZZA 1N36B 1YR7A 4O4JF 1O5TA 3K71B 2HIGA 4G5SA 3IPRA 5CLJA 1GSHA 1DO8A 4KKUA 2CUNA 2H3EA 4H1TA 4TZKA 4I14A 3ZDZB 2QXUA 3AV0B 4P2GA 1CE8A 2WWFA 5BSHA 5A9SA 4OL0A 1BRTA 1E18A 5JAOA 4LXGA 5KYYA 1USUA 4QSMA 1GVNB 1SQGA 2HBRA 4ARZA 4B4KA 4C4PA 5AK5A 4K86A 1B6RA 1DG1G 3GVLA 2Q21A 4LGVA 5K51A 4DMMA 3HVRA 1FLDA 4L7VA 4HV4A 3TLCA 4JQOA 4CGZA 4Y98A 2Q5HA 3DMDA 3KSBC 1GILA 5DNVA 2SKEA 4FNMA 4XYLA 4H7DA 1SQ5A 3G1UA 3G0OA 1PSZA 1YULA 2I71A 1HT3A 3ED1A 1GM5A 2EW1A 1U0NA 1X7WB 2ZRIA 1WHSB 3I2FA 4FW8A 1Y4UA 2M98A 3AJEA 4NBVA 3QEAZ 3EQ2A 4PGAA 3TZHA 1GZ3A 5DBHX 5KINB 2LZJA 1RWNA 3KLBA 4MR7B 4RFSB 2YDYA 3CUKA 4EGQA 4MVJH 4Q82A 5BSFA 5JHHB 4ZJUA 1J7KA 1QF7A 2FZLA 4E03A 1PG5A 5F5NA 1TZBA 2GPNA 5H83A 3ZE9A 1B23P 2WF6A 1II8B 3DD1A 2VATA 4B0PA 3AYZB 3PQ7A 4V38A 4LF8B 1QHHA 1U7OA 5JOQA 2HBQA 2DVMA 1XIVA 2OWEA 1NE2A 2DQSA 4QQKA 3TB4A 3WGYA 4AG5A 1MABB 1C30A 2NQTA 4LZZA 1E5QA 4CCWA 4EZIA 4XX0B 1ODFA 2HSWA 3WYGA 5DE3A 3CC7B 1ZHFA 3DDSA 4CM5A 2X2EA 3TIXB 4NOLA 2EGGA 2ZYAA 1YFKA 2HDHA 5DYGA 1VECA 1U0LA 4MPDA 1KJ9A 2ZS9A 1P1FA 3Q5DA 4QFCA 4RORA 1DXQA 3ZYZA 3JATB 1FBTA 1PR4A 3IHTA 4KQHA 3Q7EA 2XVZA 3RADC 1YBHA 1RQ2A 3U7QA 3VAYA 3LUGA 3E3NA 4HQKA 1JSZA 5AOVA 1QQTA 2OTLB 1PGPA 4J8PA 4RF4A 2GK7A 2ET6A 3FIJA 4H6PA 3BL6A 1ESEA 3FF1A 3LG2A 4HMQA 3K5IA 1LJUA 3BBLA 4I5EA 4EI7A 4ZYZA 1E6UA 3KHKA 1ACLA 3U4GA 3KKZA 4BU1A 3LC2O 4U9UA 1MRZA 2VBSA 1NXQA 4HB2A 2JFYA 1TK9A 1Q9SA 2WZNA 1M2GA 1SVLA 2R1ZA 2UZ1B 2YVLA 3IJEB 1NMQA 4QTZA 5BSUA 4MEBA 3UT0A 4KPEC 2QRUA 4XGRA 4FEEA 4FYJA 3EK2A 1F8UA 1ZRMA 1V4VA 3L8YA 4X91A 4DAEA 1RXYA 4WLNA 3EBLA 3RK0A 4UZFA 1SC6A 3ZV4A 3T56B 2BVNA 4ARIA 1DFGA 1Z33A 1PR9A 2FFRA 3L8FA 5H4HA 4JT9A 3D7RA 1PQWA 2OD2A 4HPJB 3BMXA 4CQMB 2IOQA 2QMQA 4PO9A 4MW2A 1SIOA 4DIUA 5HTOA 1ZUWA 2FLWA 1OR8A 2B1GA 1LFAA 2Z43A 4DJFC 2HDWA 1T9BA 1J9GA 3JZMA 1F2UB 2QVXX 3OJCA 2FEAA 3C39A 3C5EA 5JYEA 3ED5A 4JLOA 4BP3A 4ZK2A 1LPAB 4HAZA 4OJKA 2HWXA 4I6GA 5DOVA 4X92A 2QL7A 3OCWA 5GONF 4LDRA 5KSOA 2AN4A 2HI0A 2QN8A 5B3JC 3CEJA 3Q3CA 2OGUA 4L8LA 2IOYA 2P4EA 2ZSKA 4W99A 5EMNA 5DT2A 2C78A 5JMPA 2PL3A 4KVAA 5FOSA 3NGMA 5SY4A 5I9IA 4QWWA 1VSBA 1I94B 1VLQA 1IM8A 4ACAA 3BMCB 3PUWA 4E5DA 5AW1A 1WXGA 3DVQX 2UUAB 4BB0A 1NUQA 4BMNA 3EUEA 4F7WA 4BNGA 3RUPA 2GBPA 3IVXA 3VVCA 3ZTWA 4OUDA 3RFUA 3SXPA 3EXHA 5CEFA 5GADl 3O6VA 1MEJA 4LF9B 4RTQA 3QFFA 1JG3A 1ZX1A 4MKFA 1SKQA 3FGZA 1PU2A 3QA3E 4NRDA 3FETA 3EEBA 3CIFA 1KXJA 3D0RA 4NMMA 4C0QC 4JSYA 4DPMA 3NHUA 1DWOA 4UMEA 4PVDA 1HDEA 2BFBB 2JKZA 2QEQA 3OE1A 2JLSA 2P11A 4KRYA 5J2UF 1MORA 5ALPA 2I99A 4KQEA 4B8WA 1G3QA 2GPAA 3O83A 2XGGA 3ADKA 3RYHB 1K2WA 2XE6A 4PW0A 1P60A 2WUFA 3PEVA 1EFPA 3OJOA 1GIAA 1DX4A 3AIMA 3AWDA 1H85A 1WBDA 3DNPA 4DDUA 4A36A 4XM3A 4CF4A 3VMMA 3M5WA 1S0UA 1D9XA 4FDMA 1EDBA 4NBUA 3TSAA 4QU8A 3LRPA 1QRUA 3GAAA 2AT1A 1YI1A 3FNEA 3PD0A 4LJ4A 3OKXA 3HHPA 3QPCA 3I0MA 4XQ9A 2GEUA 1ST2A 2JJ8A 4MCHA 4KTTE 3J80A 2J3QA 4IVQA 5I9TA 5K8TA 4OB8A 1JKMA 5CG2A 3OLXA 2HRRA 1U1DA 3PI7A 2ZXEA 1G1AA 2G83A 2GX6A 2XTAA 1ZNYA 4I19A 4B7UA 3SDBA 5T8KC 1J2YA 1EZ4A 3F4LA 1G21E 2IOHA 1MRNA 1DINA 1LTHR 2ZBRA 2OORA 3O73A 2WSSA 3VVBA 1W48A 1ZKMA 4HDRA 4F6CA 1U4NA 5YASA 2Q2NA 4EA7A 5LQNA 2ZANA 4RZIA 1LPPA 2V3WA 4F46A 5B2EA 1XJCA 1VG8A 3OCVA 1XCPA 4GE3A 5FBVB 3AR5A 1G7RA 4EW3A 1EX6A 1K86A 1C80A 2RC5A 2FWRA 3K72B 2FKAA 4V0NA 2CV1A 4G0ZA 1N9GB 2AOTA 2OPBA 4O6VA 3D3KA 1MOZA 5E9WA 1LDGA 1HDGO 4W5QA 1LS1A 4QYIA 1XCBA 3OAAA 3Q0TA 1HNZB 2PWZA 2IHNA 2IVZA 3P7MA 5E8JA 2GLUA 1I3NA 3HGMA 3T0GA 4WKGA 1YDHA 3SOPA 3DMPA 4M1SA 4ZYVA 2FHPA 1XMIA 2C84A 3JXEA 1P4RA 2XOKA 4XDZA 5C2JB 2HF7A 1NJ2A 3W5UA 1HDXA 4JMQA 1MC8A 1G8JA 1U8AA 1Y0BA 3KAKA 4C7JA 2ZM6B 1LC0A 1M34A 1USWA 2DUNA 4RZHA 2EKPA 2WG0A 4NOMA 4ZVPA 2Q5IA 4FM9A 1B16A 3A6PC 4QTXA 1SBQA 2R7AA 4BAGA 3ZGYA 2OCGA 1U7WA 1Y1TA 4S24A 1VLVA 3MD0A 5KU7A 5EKTA 4E21A 4ETWA 2JI7A 5EE5B 4QVKA 2XCRB 1Z4MA 3Q85A 4FYKA 3D6NB 4MUNA 9GPBA 3BIWA 2JGEA 3R24A 3V4OA 4R98A 4J4TA 4XVHA 1RCTE 2C7QA 2Q9BA 2FFAA 1NB9A 4DSAA 5JH7A 1WQ1R 2C29D 1GPH1 1G8HA 1EZ1A 1WDMA 3O3NB 2HK6A 2UXDB 2AC4A 1QO9A 5BOSA 4R2IA 2JDIA 3LBIA 4DY4A 3CZ4A 5HUHA 1ZJJA 2JATA 5INTA 4WXEA 1S3FA 1Q0LA 1NI4B 3K31A 2HSDA 3W5BA 3W2EA 3MVEA 3NTOA 2VOJA 1G6KA 2CCKA 4DLNA 1ZITA 5GONB 5BSXA 2FG7C 1AGNA 2QJRA 1CF4A 3DNFA 3DP7A 3O26A 1PS0A 2NNWB 2YWJA 3KQYA 4LTDA 1O87A 3OKAA 5B53A 4E32A 4QOEA 2RGAA 1CQZA 5HE9A 2OHXA 4J4HA 5K2OA 3NHYA 4KC0A 4GXQA 1O6GA 3SEFA 4KB5A 1YZQA 3T3EA 4B8ZA 5JU6A 4FNAA 3FY4A 1E3LA 2DE0X 4FYIA 3OX3A 1JFSA 2CL5A 1T4DA 4ZCIA 2H5LA 2GI4A 3L8GA 8MHTA 3GVJA 4J29A 1J33A 2C98A 3KEMA 3PK0A 3TUZC 4ZU6X 4KRGA 1WULS 5C8DA 1YDEA 4UKDA 2EV9A 3OF2A 3L7JA 1F5NA 1S2LA 2IW1A 2ZAYA 1KZGB 3QF4A 5HK8A 1GFZA 2D0PB 5BT8A 2UUBB 1Y7IA 2VF7A 2HUPA 2ZE7A 2R86A 3LLCA 4K2HA 3PNQA 1IMOA 1W0JD 2ZYDA 4DA0A 5KYXA 5J2UB 1W59A 1QCYA 2VJOA 1G8KA 1M1YB 1T0BA 3LQEA 3KT0A 3UQZA 1GO2A 4HVLA 4UOQA 4BNMA 4DLXA 2BMWA 1ZM3A 4V0QA 3X1XA 1L7OA 4QGAA 1C3EA 1U8YA 2OVBA 1J21A 3NRBA 2YZNA 4WDRA 3MN1A 1G3MA 1JLSA 3X1KA 1K66A 4TL9A 5BSEA 6AT1A 3PXAA 1U6KA 1TPZA 1XWFA 2FMFA 4R84A 3I9NA 2P2NA 1F0PA 2J5BA 3MGCA 4D0NA 1SHJA 4DMLA 1ZVVA 1P2DA 2XWBF 3KOWA 1KPGA 2CMGA 2RGDA 2VP5A 3Q6MA 3TEFA 4BKQA 3AL3A 4ZZIA 3KKLA 5COBA 1HYGA 3I6IA 3TAUA 2ILVA 4NARA 1OSNA 1U5BA 1ZC4A 4HPWA 2FY8A 4Y67A 4OHCA 3RS4A 3ELDA 3DT6A 4DMHA 1WVMA 1J90A 5TPZD 4PXAA 4KE9A 1HYQA 3SYMA 4P1ZA 2CFSA 3DLCA 4ER7A 5HZMA 1SELA 2CNOA 3TTSA 1NOIA 2GS9A 4MSUA 3VU1A 1KGSA 3VM6A 4P84A 3VGJA 5EG5A 1B8PA 1Y3CE 1XROA 2GO1A 2QRVB 1L5NA 2PZBA 3BXPA 4ZRMA 4RM0A 2J9FB 3TEMA 2HMWA 3U0VA 2ZSJA 1O8BA 3Q2IA 4N5LA 1NPDA 4PGOA 4ZQCB 4AL4A 2EWWA 3G2KA 1A76A 2I8CA 1DJLA 2ISSD 4RABA 3RRYA 3V4VB 1DKOA 3BWCA 4MV3A 3OIYA 1A4XA 4NBRA 4R0NA 4DRZA 1ACMA 4LDQA 5TT0A 3SBOA 3KB8A 2PUVA 2DBRA 3L1KA 4EKIA 1ABBA 4MEAA 3DZHA 4QDUA 1VJ5A 3R0JA 2VG8A 1CULC 3BGWA 1T9DA 4HUTA 3NKFA 4F3YA 3FRHA 4TMWA 2WHPB 1AV7A 9ATCA 3A9RA 1DC3A 3ZW9A 3OQHA 3R8FA 3L0ZA 3KT6A 5A88A 4DQVA 4NECA 5L6MB 2PQ0A 5K0CA 1M2VA 1QIHA 1RBMA 2GXUA 1UJNA 2CLHB 5I8WA 4H6WA 1NONA 3ADPA 4P38A 1T2NA 3ZWWA 4BMPB 4QDKA 3L1HA 3A6LA 3P8ZA 1ZBQA 2BTQB 1M8PA 1MFPA 4IFEA 4WXYB 1Y9ZA 3AI3A 2ZJYA 5B5SA 4PWZA 1RYBA 4X66B 1GG5A 3LUFA 4X65B 1YR2A 3PR3A 3L43A 3KJHA 1CZHA 3VR1A 3ZK9A 1RRFA 1G8YA 3FNIA 3PE4A 4AP9A 4O4IF 3OIDA 3A1CA 4FOLA 4XCVA 4XWAA 1L5HA 5BYKA 3RARA 5KNDA 3WV4A 3D8TA 3DOFA 2XCUA 4TMTA 4BQSA 4IR7A 3IP1A 1T1EA 2ZDQA 4WEOA 3VSDA 3T7JA 1MO2A 1FDUA 3ECCA 2VZ0A 4H4CA 3GT7A 1FFGA 1PE0A 1A98A 3PWSA 5K99A 2HLNA 4IIXA 3AGPA 1I3MA 2IXDA 3AZOA 4BB9A 1C7EA 2B25A 2J5RA 3BS4A 3O4IA 2JH3A 1TKRA 5DI9A 3IE1A 3VR3D 1NRKA 1SVIA 3GQBB 5CYOA 4CMIB 1XMSA 3KAQA 4DEYA 3C4JA 3RM3A 4OO3A 1QH8B 3HL0A 3OPOA 3LX5A 4NSNA 3KX2A 3VDNB 2AOUA 3E8MA 3L4EA 1ZRHA 2XA1A 3E3MA 1AF4A 1FUYB 4F6RB 3LRTA 1LI7A 4CEJA 4DR1B 4DDMA 1PHPA 2EP5A 1JB9A 5DN6A 1Z6GA 2REQB 2HUNA 4YROA 5AVYA 3UMJA 3ESQA 5LP6C 2OB1A 5B6PA 1XZNA 3GCZA 1BJTA 1WUIS 5C1OA 1G63A 1NF2A 1YR1A 5AMXA 3E8SA 2JNWA 4TLDA 1PJ8A 1UOPA 3E81A 3LYUA 3WLMA 1EQ2A 4FHGA 3G2PA 1F4VA 4L6AA 3GJRA 4CG2A 1Z83A 4N0EA 2ZT5A 3I52A 1LZLA 2FPGA 4AWXA 4PPNA 1IWPB 1K8RA 3OJ0A 3DFZA 2LIPA 1IAQA 1LTQA 4M9ZA 1NATA 3BTSA 4EFNA 1IXRC 3HUDA 5AXDA 3STYA 521PA 2X8LA 4AYXA 3CTMA 5H02A 3WJ1A 2EWMA 2X9QA 3L7DA 4R40A 4D42A 4UNRA 4XLFA 2RGGA 4HZUB 1KYXA 4Q9JA 1W4BA 5IPFA 1NP3A 1P8JA 1OX4A 2W6OA 4C4XA 3LCVB 4JJKA 5CLFA 3N2IA 3UH1A 3I6BA 4JJIA 1ZD8A 4O5AA 1XVUA 2PSEA 1MG5A 1M74A 3PTLA 3QLUA 4UPDA 3PUMA 5FL7D 1Z08A 4W4TA 3MB8A 3FUVA 1YQWA 4P12A 2DQYA 1D2CA 4HYQA 3U5TA 2BFMA 2D54A 2G0NA 3I1IA 3PYLA 3ONUA 1XQXA 2EL7A 2XNHA 1JDPA 1CQXA 4JGGA 4UEOA 5IDYA 3RSHA 5HQ3A 3FXAA 1EB9A 2F9FA 5F73A 3SU8A 3K9NA 6LDHA 1SRRA 2XWJI 3L49A 2WJGA 4EECA 1LPSA 1KFEB 4IDCA 1XZPA 3COYA 1E1QD 4TV8A 4EVQA 4BL5A 1E0JA 1QHIA 1H2AS 4NLLA 4QJIA 1V5VA 3Q38A 1JNYA 4Y7CA 2D3LA 4Y6LA 2IYRA 4K9LA 1C2YA 1DTWA 1UBUS 4K6FA 2C3UA 2UYQA 5CCDA 2IIQA 4FWTA 4F96A 1YS4A 4ZT6A 1EHYA 3R76A 4MTCA 1NMSA 1M2HA 3OF3A 2JLZA 1RAAA 2XJ4A 3CF2A 4LBYA 2RHHA 1EB8A 3DZFA 3IMKA 3IVRA 3QQPA 4YAEA 3TDMA 3ZIDA 5JBIA 5IKXA 1YMQA 4BV8A 3QI2A 1M2WA 1OHHD 2DFDA 4GHWA 1CUUA 4AZWA 4RGVA 2C4UA 2QUAA 4EHDA 3WNZA 4RA6B 2ZM5A 5HYVA 3R44A 1FYXA 1VZ3A 2CVHA 2GPSA 3BMOA 1EE1A 1RD4A 2ZB7A 1OGJA 1JBEA 2RK4A 2IYTA 4P3OA 3BXFA 4QPJC 3KEWA 3TVDA 1R0SA 3OOYA 3KYBA 4PZCA 3TRKA 4A8PA 1OFGA 2IIBA 3AV3A 2VDWB 1UC9A 2EX4A 4QU0A 3IMGA 3OLQA 4UFPA 1EEXB 2QT0A 5B3KA 2P79A 3UA3A 721PA 4JYZA 4O1HA 3PQDA 5ERYA 5FOTA 3LKVA 4BNZA 4BBZA 3HFRA 4GVPA 1OBHA 2DX7A 3GWGA 1XCOA 3IJPA 2C2YA 2ZUSA 4O4IB 1OLUB 3FHCB 1T3ZA 1KK2A 1UEIA 1Y1KE 1EGMB 3IESA 2QXTA 3PI6A 1JQEA 1V11A 3IEIA 3RB8A 4YCMA 1E59A 2NUAB 2OKCA 3ZDFA 3TD9A 4NPHA 2N1BA 3CTAA 2PIDA 4WKNA 3L6CA 1T5TA 4I8DA 4H0CA 4CTOA 1W4LA 3C3XA 1PFGA 2IDMA 4L4RA 4LDAA 1PEKE 1IY8A 3FMOB 4M88A 3LOUA 1C7RA 5CVVA 1HYEA 4BLQA 2RJOA 3CLTC 3I2JA 2VOEA 2RD2A 4P2BA 2G1UA 2YJ3A 3E3OA 1DAGA 2C4TA 3KPJA 2YV5A 1GG9A 2EZUA 2F1LA 3GZJA 4P82A 4DA4A 4Z1MA 1HNNA 4ZVNA 3NATA 5H7XA 1NVMB 3RS3A 1UFOA 5ARCA 3T12A 4LCBA 3TQFA 3WBBA 1WKCA 4EUHA 5C8VA 1BH6A 4XQ0A 4GE0A 2QEXB 1C1DA 2NT3A 1MUUA 3Q1KA 4NAHA 3MTQA 3JV7A 3NJRA 4KQMA 4N5MA 4XAQA 1RPAA 3HB7A 4ALNA 5HEKA 3ZOZA 4BC1A 2AUNA 3BH7A 2CEKA 3RJTA 1HX7A 2B36A 4LEIA 1IK4A 2AE2A 1L5YA 2YN2A 1BVUA 4LJ7A 1U5AA 1WQ3A 1VI5A 4AUKA 3QENA 1BMFD 2HOQA 4KACA 4UD6A 1PFQA 5LKRA 3CVXA 2A5LA 3Q12A 2X40A 3WQQA 1HMPA 2GPWA 2WKSA 2GJKA 1ZYUA 4IIEA 3QFCA 3FGNA 2G82A 3SEQA 5GZ3A 3IEVA 2ZREA 4FHEA 5EJ5A 4G36A 2I34A 1BXRA 1AUOA 1W1UA 4D2IA 1OY1A 4RY9A 5C3MA 2IYXA 1TM4E 2F1MA 2E9SA 1HY3A 2XVMA 4IRXA 1GDTA 2D1QA 4QOSA 3CU5A 5AVOA 5C7YA 4LJKA 2O5RA 1U65A 5CD1A 5AM2A 2UU9B 2XUIA 2OGZA 1BKYA 3QBEA 4ZO9A 2HF2A 5EHXA 4I9UA 3SZOA 1BEZA 3ZJYA 5D3MA 4RQBA 3WMFA 5GGXA 3SE7A 3V1TC 4NJEB 3H5TA 3A6GA 3GBSA 4HYTA 2PR7A 4MVJI 3ZZTA 2O8DB 1Z12A 1E8MA 3C3BA 1WCIB 3CUYA 2E4XA 4RD1A 2ZJ2A 2IH4A 5E3JA 4WUTA 1QSGA 1FDOA 1KDRA 2GF0A 3OLCX 3UXEA 1A69A 2D62A 4NXMB 2Y27A 1RHRA 1HH4A 2WKRA 2EDCA 2VJPA 1O94C 2I4IA 3AL2A 3HS3A 1FXSA 3PHCA 1XVLA 4WBSA 4EEZA 3FPKA 3I62A 4JLAA 4KE8A 5AUOB 5HOQA 5HZGA 3CR3C 2UDPA 2VDLB 3I4CA 1T8RA 2IYEA 4HHEA 2XUZA 3QGMA 3DZBA 1QTIA 1NVTA 1OFUX 2PN1A 2P8JA 2IELA 4WLOA 5LQCA 3OQMA 1VSTA 2L0XA 3U61B 3T1TA 4D4KA 1ETHA 1U99A 2C5LA 3A1VA 1SPXA 4HGZA 1R0LA 3CBGA 4RXTA 2P6PA 5DSXA 5DS0A 1H6CA 3ZS9A 2O3JA 5KOJB 2X85A 3QMPA 4O2AA 4QHTA 1YR9A 4G1BA 2DBYA 1O97C 3HHEA 2X0KA 1RI5A 2PUWA 2YWDA 5ICFA 4CFYA 4TTJA 2OBRA 2KSQA 2UVPB 3K09C 1IB0A 3T5BA 5C8XA 1OAOA 1CHDA 5LM3A 4KTVE 4LMPA 2V7WA 2B2NA 2I62A 3CH6A 3ZKWB 5KJ1A 1O4VA 2ZRCA 2W6IA 4ZVQA 2WNHA 3ENZA 1O9HA 4DBLE 4W5RA 2BFFB 4IDEA 3H5LA 4LKRA 2QN3A 5EXSA 1UDWA 4HDKA 4U3JB 4BFSA 2YWEA 2XOEA 3TJZA 5FBHA 2C2OA 1OW3B 4XOPA 4EVSA 1R4NB 5KYVA 2CBGA 3B2EA 1V45E 5SYAA 3SXUB 3AR4A 2WD7B 2WLSA 3Q9UA 1SUWA 2CXXA 2XRMA 3UBTA 4WCDA 1SCDA 1WKBA 2EYUA 4WK2B 2HYIC 5F12A 2VCEA 1F17A 2R6FA 1BOFA 3LOPA 5LQJA 1CUYA 3S68A 3W1VA 4C3UA 4OJYA 3TKLA 5A5VA 4HADA 4FZRA 4WFQA 5JUWA 1XTBA 3KALA 1ZINA 4NCKA 3U48A 3IMEA 1BE6A 1KAGA 1PCXA 3MWEA 4JFAA 9LDBA 1IN5A 3WLNA 1BQ4A 3HE3A 3OOWA 5LSAA 1Q50A 2NU9B 4B6GA 5DWQA 3IFSA 1Y8RA 5FUQA 2WF8A 1HE1C 5DNCA 2FPSA 1Z26A 5CU7A 5T4BA 3UGQA 3KVOA 5M7EA 3THSA 1KOGA 1QFYA 3H16A 4MQFA 1XXHE 2ID9A 3GLTA 4F3CA 2ZETA 4TWZA 5FKJA