4M2LA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in nucleotide-free form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
409
structure length
398
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGITIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
publication title Conformational transitions in the gamma subunit of the archaeal translation initiation factor 2
doi rcsb
total genus 97
structure length 398
sequence length 409
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4m2lA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m2lA01
3F8TA 3ICEA 1W0KA 3T35A 5JEDA 2JLYA 2XZPA 2RGBA 3SOPA 3ADDA 1H8EA 3VO1A 4HZUB 3CCUB 2F3RA 5JWRA 1YRAA 1UEJA 1ZCBA 2CL7X 2BGIA 3OHMA 5DHAA 3JZMA 1FFHA 2NOAA 1XTJA 3I92A 3IQXA 2P6UA 3PFIA 4JT2A 4Q4JA 3AQ4A 4FMCF 3W3ZB 1D2MA 4PO1A 4NL4H 5EXTA 4JLDA 2PCLA 1U98A 5D3MA 2V54A 3T12A 1RW4A 2FA9A 4AF7A 4UAJA 4Q1DA 2XZLA 3QSYA 3CX6A 3LQQA 2QAJA 1CS4C 1Z0AA 4DQLA 4G5GA 2VO1A 4GOJA 4XSHA 4DLSA 4GRAA 4DCSA 4OJQA 5EUMA 5P21A 2WMNB 3B82A 4G5OA 5HZKA 5EE1A 1ZD1A 4AG6A 1CBUA 1Z0KA 2G88A 4LCBA 2WSSD 1U2RA 4LZZA 1FTNA 4A4DA 1HQCA 4OBEA 3U7HB 3VKHA 1U8YA 2FGJA 3CRW1 3AUXA 4HAVA 3DVLA 3GJ0A 4D6PA 3U44A 1X1RA 1KO8A 3EZ9A 1NBME 1Z06A 2ZSAA 2DYKA 1LF5A 2JJ1A 4JVNA 3QF7A 4V0KA 3P4XA 2NG1A 2WPDA 3LX5A 521PA 3SYKA 3TIFA 3IGFA 3O8DA 3HU1A 2H5EA 2HJGA 5BYJA 3EWAA 3KXIA 4ILEA 4PAMA 2DR3A 1E1QA 1U0LA 4D80A 3ZS9A 2QL6A 3DKVA 2XGJA 4V0ME 3BGWA 1LF0A 4HDQB 2PEZA 3ZBTA 4HYYA 2UKDA 3AGPA 5JLJA 1OGIA 3TUJC 1PLLA 5HXBA 5B30A 4C0SA 5AK0A 4AKHA 4A0HA 3THWA 2W00A 2VYQA 1VDZA 1ZU4A 3CCMB 4OI2A 3OZWA 4TYNA 2OK7A 4YDHB 4C7OA 5J5CA 5KUTA 5IRCD 4I81A 2ZAOA 1UKZA 3R7WB 3NH9A 3CCSB 3U3OA 1P62B 1W7AA 4K81B 2D74A 1M2OB 2QAGB 3KDSE 3AVUA 2CCKA 3VKWA 4BFZA 2HT6A 5JHGB 4UNRA 3LVBA 2WWFA 1MKYA 2WWXA 1ZYUA 4EPXA 2GJ9A 1YHNA 3I3SR 1S96A 4M1OA 2J41A 1RZ3A 2AFHE 3AF4A 3K0FB 3U6KA 2BBWA 3AVWA 1JXMA 4GZLA 4B2PA 1WE2A 1VG1A 3QF4A 1XPUA 1XEXA 1E2GA 1FUUA 5FR2A 1ZP6A 4OQXA 421PA 4N0EA 1G41A 3TSOA 4JLPA 4ZDIA 1E0JA 2QM7A 2PZEA 3UKDA 1F5NA 5FI0B 5J4YA 2YC4C 4L8GA 4A9AA 1E6CA 3CXCB 2ZRLA 3JZAA 2GHIA 5KNBA 4JBYA 1YR9A 1NN0A 1NKTA 4TLEA 3FKSA 4JLMA 1HYQA 2YV5A 3ZZUA 3W2EA 2QA5A 3TMKA 1GKUB 5JJLA 2J0UA 4QNRA 3FVQA 4QFMA 1XDBA 3MFYA 1KJYA 2XB4A 3QPWA 1AIPA 3TSWA 3UG7A 4GZMA 5IK2A 4DCNA 3BORA 5J47A 3AB3A 4HB0A 4B71A 5JJIA 5GJCA 2WV9A 1E69A 1M7BA 3RWOA 1M90D 2R2AA 1AN0A 3PCRB 4Q21A 3THOA 2KBFA 2PX3A 1BO6A 1DARA 3IIMA 1VQ8B 4Q19A 3RSLA 2ZJBA 4AKIA 4BPRA 4PZYA 4OI1A 1NJID 2V9PA 1VQ7B 1QGAA 3THWB 4TLDA 3W5IA 1W48A 3LXXA 2R44A 1NBMA 4LYJA 4LC0A 3SE0A 4TLAA 3MMPA 1S3GA 3K70C 1KD1D 4FMCB 1CJVC 2P5SA 3B9PA 2O8DA 4HAWA 3QE2A 3K8YA 1AK2A 1ODFA 1BMFD 4HEJA 1WF3A 2L0XA 4YONB 4TL8A 2DFLA 3AVYA 3G6EB 1DO0A 4TSFD 3EG5A 5C4GB 2G3YA 5ELXA 1XU4A 3IDQA 3A6PC 1FX0B 3QPUA 4F38A 3G0HA 1G8HA 3G71B 3K0AA 2VZLA 1Q20A 3OW2B 3CC4B 1KI6B 3QKSA 3IIJA 5FUXA 2IBMA 4YLGA 4DC9A 2QBYA 1QRAA 3QVVA 1RRFA 3QBTA 3LO8A 3BXZA 2CDNA 1YZGA 2WHXA 1SVIA 2VP9A 3MHPA 1MABB 4M0LA 1G5PA 3L0PA 3C4JA 1CRQA 5B2ZA 3CRVA 2ZUBA 5C18A 2OAQ1 4YMSA 3GLHE 1KAOA 1DO2A 1QBKC 2J5XA 4MUAA 4A0GA 3Q9LA 4JBWA 4XWAA 1R6BX 2FN4A 4CF7A 4MRNA 2KSQA 1ESMA 1Z0JA 3N70A 1RC8A 4F4JA 2PLRA 1EFRD 2QI9C 4KBGA 2WJGA 2J0QA 3CF2A 1KNXA 1OH6A 1HT1E 1I2DA 2JCSA 3GJ5A 3CMAB 4HAXA 1ZC3A 2W0MA 1DPFA 1S9HA 3IKJA 3VHXA 4F7WA 4KFTA 3FKQA 3I5YA 2GJAA 3RNLA 2O0JA 4JVMA 1D9ZA 1TF5A 3A4NA 1R5BA 1XTSA 4KFRA 3W90A 3ECCA 5BW8A 5G40A 3PEWA 3T1TA 4BFYA 4YAFA 2A5DA 4B6EA 5E3HA 4HAYA 2F43A 2MSCB 1NVVR 2LCFA 4ARZA 2WOJA 1BMFA 5IDVA 1ANKA 5TMPA 4M9XA 1XXHB 3AKDA 1E9DA 3EIQA 5EP2A 3X1ZA 2CNWD 1R10A 5JJKA 4W5JA 3FFAA 4XJXA 4Q4LA 1ZM7A 3FHOA 4C4PA 2CBZA 5J40A 4Q7LA 2QDXA 1N0UA 1II9A 4IRUB 5UKDA 4QKQA 2ASEA 1A8PA 2AX4A 2NQ2C 4QGAA 4Y7CA 3MUFA 2IYTA 4LWZA 1J9ZA 5TB5A 3VNUA 1MO4A 2A9KA 1BKDR 5AUQA 3GLFE 1BOFA 5G3ZA 2C98A 3DOFA 3NEYA 2JLVA 1Z0FA 2ZI7A 1YZNA 2H57A 1KK1A 1ZMXA 4MRRA 3ADKA 2ECKA 2ZQ5A 4PHTA 3W2IA 2CK3A 4QJ5A 3WY9A 2C03A 2I3BA 3CRZA 4Y0VA 3RS5A 1OFTA 4FINA 3QJYA 3SBDA 1SGWA 4CRWB 5C4MA 2XXAB 2NTYC 1MT0A 2IYZA 2CLCX 3K09A 3MGCA 5CK5A 2UZIR 3UMSA 3GQBA 2BJWA 4HB3A 5DH9A 2QTFA 4LY6A 3RLFA 1P7CA 2IXEA 4DLYA 3QNUA 1D6JA 3BS4A 1E0KA 4A82A 1G3RA 2P67A 3HP1A 4RD4A 1KSFX 3T34A 3FJOA 4BEJA 3ASZA 1QHXA 1DBSA 2GEDA 2ODBA 1IJFA 1TL7C 2FEMA 1KMHA 1N5LA 2HLDA 2ZI4A 4Q4AB 1TQDA 4EJSA 2YINC 4V0LA 2ODEA 1SM4A 3AH8A 3ZVLA 2ZRPA 4XH9B 1ZD8A 2XSZD 2WKQA 4W7SA 5DIFA 4OHYA 2OFOA 5AJYA 3ZGXA 5CITA 1GAWA 2AKYA 3QXXA 1WP9A 4HDCA 4TMWA 2GVZC 3AF3A 4FW9A 4M9ZA 2H7VA 3Q3JB 3LV8A 1K8AD 2OAP1 4QGFA 4EUNA 3ZD6A 1N0VC 1G19A 1G21E 4HI0E 4KCGA 2WOOA 3D3QA 3P20A 4JBXA 1M7HA 3CCJB 2RGEA 4KO8A 5KDLA 4CVNA 4DT1A 3D7MA 1VMAA 3BJIC 1NNEA 1DVRA 1ZC4A 3WRYC 1TU4A 4E07A 3AVPA 1YHQB 3ZVNA 4ZCLA 2F6RA 4QC2A 2RB4A 3AF0A 5CJPA 5L3QB 4PO9A 1Q12A 1TEVA 3VFDA 4TYYA 3TR0A 1KK2A 2OO7A 3AVTA 4IFBA 5D3QA 3RS3A 5EMNA 3OAAD 1EP3B 4MITA 1CXZA 3DKPA 4LX0A 4TTQA 3QXJA 4B33A 1FP7A 1IJEA 3NBYC 3AP1A 4IJMA 4A36A 2HJVA 1OKKD 4LJ4A 1LNZA 1DAIA 2B6HA 2G83A 4A6XA 4E5UA 1G20E 3K09C 1W4CA 1HY3A 1S2MA 1CJMA 1AA9A 3OEHA 4PO8A 5GJBA 3L8ZA 3K0FA 3BD9A 3TR5A 1P73A 2NZJA 5FL7A 2VHCA 4QRHA 3LDAA 1WDTA 1YITB 2G0TA 2GF0A 2IXFA 1U94A 3X1DA 2P65A 1XJQA 1I2MA 1J8MF 4ARZB 3B6EA 4QBHA 1EFHA 1W34A 3DM9B 1VQPB 1QF9A 3UPUA 2OEPA 1LV7A 3PEUA 5EP4A 1TVCA 4PAQA 4NCKA 3C41J 4C0HA 3SHWA 5JSZA 5DSZA 5J4VA 1QGZA 1TQ4A 4ACAA 2ZU0C 1IONA 2B92A 1Z6TA 1K9MD 2QA4B 2GCOA 2LKCA 1KC8D 2GXAA 4EFNA 3OZUA 2QGNA 2R6CA 1GZSA 4C30A 3TH5A 1GKYA 4CEHA 3GCGA 3V00A 1IN8A 1E99A 2P6NA 4V0MA 2F7SA 3LA6A 4DDUA 4LUCA 1JQLB 2GJ8A 4HE6A 4HLQB 4KSBA 1S1CA 1CR0A 3AKCA 4PAOA 1UAAA 2Q9AA 4TLBA 3I73A 5GVSA 3SJZA 2J45A 2WTUA 2VNHA 1E79A 3M1IA 1IN7A 4DEYA 1CKEA 1ZVQA 3KKNA 2CJWB 3VMFA 1TTTA 2IEYA 4OHZA 1FNMA 1R0WA 1PZNA 1SXJE 4DQKA 1E9BA 4UXJA 3DPUA 5DISB 4XD7D 4KSCA 4DJTA 1Q82D 2JIZA 1D2EA 3LD9A 2RGNA 4AKEA 4BFVA 2AN9A 4V0NA 1E0AA 1E1QD 4YAOA 4L9WA 3QBVA 4QM6A 3A1TA 1E1RA 1IB0A 3Q8XB 5J4LA 3W2HA 4P0TA 3CWZA 5AUNB 3B60A 2EFGA 2IK8A 1KSJA 1R8QA 1W44A 2ZAMA 4HLDA 3R8FA 4N3GA 1W0KD 3SR0A 1QVFB 1QVRA 3HU3A 4C0QC 4AY2A 3IQWA 1H8HD 2JATA 3I72A 1XE1A 4TQ9A 1E2IA 2G6BA 3CZQA 3ASYA 2ATXA 5FUWA 1CLUA 3SYNA 3VQTA 3PJRA 2BPOA 4BRUA 3KUCA 3RWMB 1Z22A 1KI1A 1XPOA 1XFAA 3OF5A 4JLBA 4C0JA 2NO1A 1TADA 1BX0A 5A0FA 3NKVA 1NIPA 1AS0A 4M1TA 3ZVMA 3GLIA 4G5RA 4EPTA 3WNBA 3RS2A 5CIQA 1FTSA 1K6MA 2RC6A 1DDIA 5DGXA 1Q44A 2FSHA 2OLJA 3THXA 4JYBA 1AKEA 4JT4A 2ZS8A 4Q4HB 4DUGA 2RKOA 4PX9A 3PVSA 3FHTA 2HXYA 4HSEA 1CQXA 1JR3D 1XX6A 4Z1MD 2IUSA 2JA1A 1ZUNB 2DPXA 2VF8A 1OPXA 1QZXA 2VP2A 4I99A 1VCOA 2CMKA 2OCPA 1J2JA 3O8RA 3NTUA 1G7CA 2CNWA 3TW8B 2QROA 5FL7D 4IEIA 4NZYA 2Z0MA 2X77A 3DOEA 1DS6A 1E4YA 4Q9IA 5H68A 2XJ9A 4O0MA 2J9RA 1WA5A 2AWNA 5BWMA 2ATVA 2IYLD 2ODWA 3K70B 1I7PA 2YHSA 2WJIA 2OBLA 2KBEA 1GP2A 1N6KA 1KO5A 2W2TA 2F55A 3GLGE 2DFNA 2ZJZA 5CDFE 2RMKA 4CGZA 4Q48A 4EQ6B 3QUSA 1XD8A 2D3WA 1DAMA 1GRQA 3BH7A 3C5HA 3BK7A 1VIYA 2GTPA 1J7KA 4B44A 4JYCA 3W6OA 3K70D 1VHLA 1UM8A 1DEKA 4US0R 4BFTA 3CO5A 3BB3A 1EP2B 3X1YA 1N6OA 2J7KA 1XTRA 2J0VA 1JQJC 4TTRA 5FR1A 5CB8A 1TX4B 5JRJA 1CRPA 1P9WA 1MR3F 6Q21A 2HCJB 5GV7A 1T91A 3KQLA 1W5TA 2PL3A 1Q1EA 5FTMA 4ZGNB 2ERYA 4ZPXA 2C99A 121PA 1P9NA 1LY1A 1ZRHA 3OEHD 1GM5A 1EFUA 1VPLA 2ZVPX 4QJ4A 1T8TA 3K1JA 3EPKA 2IYUA 4RZ2A 4CIDA 1OHHD 3UMRA 2Q9CA 2ZE7A 1KHTA 5LB2A 4M1MA 3EXAA 3QOFA 5JBQA 2BV3A 2O8FB 2JLWA 3OAAA 3PUXA 2WZQA 2VHJA 1FMLA 3FKSD 4M8NE 1JJ2B 1E2NA 5B64A 5KO2A 1DTSA 4R98A 3QEJA 4NMMA 1E1RD 2BJVA 2QQ0A 4DCTA 2R6HA 5TARA 1LVGA 2Y8EA 2QPAA 3VR4A 1YZTA 2GK7A 2J1LA 4MGYR 1NSFA 1S3SA 3UMFA 2ZSDA 5HE9A 3H0KA 4J0QA 3HR7A 1NJGA 3GMTA 4RKEA 2VSFA 3S1AB 3O47A 4M9SA 1M1YE 1EG7A 3FMPB 4L16A 3EWSA 3W5UA 1S72B 1I4LD 3K0EA 3OEED 1ZUIA 4RFVA 3AP2A 2DWQA 2Q6TA 4AIIA 4ZIRB 1E63A 4YC7A 5FOTA 3WMGA 1ZD9A 4G1UC 3FPAA 3GJXC 4BLRA 1VYUA 3E70C 2PT7A 1F6BA 2B8TA 1GL9B 2FFHA 2JJ2D 3CC7B 4PANA 2VHQA 5CM9C 4NYMR 4B3DA 2WWWA 1W0JA 2F9LA 2JLQA 1N6IA 2FV8A 2J3EA 2ZPTX 1KIMA 4XVQA 5SZIA 4B76A 4F4CA 5KSZA 1OH8A 1OIXA 3CF6R 2B8WA 3RVBA 1E2JA 5JMTA 1E2LA 1W36B 1W47A 2PJRA 2EQBA 3X1WA 1JECA 1ZNZA 1F2UA 1V5WA 1XP8A 4Q7MB 1RVDA 3AEZA 1E9EA 4KI0A 1NN1A 5E7JA 2WIAA 5E7IA 2JIZD 3SDZA 3SFVA 3T1QA 2OCYC 4IDPA 5FA6A 5KOYA 2CHVA 2G1KA 1CR2A 2WAXA 1VTKA 2GXSA 4Y0AA 2AXPA 3BFXA 3GFPA 4PHFA 4QBFA 1E3MA 2OCAA 1EX7A 1TAGA 4AI6A 1WBBA 4RFSA 4AKGA 2O52A 4ZIRA 3GEHA 4XTCS 2E1RA 3C14C 3LQRA 1CR4A 1SXJA 2N1BA 2VPPA 3KJGA 4GL2A 1GL6A 2ZYVX 4IDHA 2CCJA 1IOZA 2FNAA 2ZRIA 3QKRB 1KSHA 1HURA 1VCMA 1R7RA 2D2EA 2VNIA 2QQEA 2Q21A 3LBIA 3PQCA 2J0UB 3Q5EA 5HE8A 2GVDC 4DLWA 2GQFA 2BMFA 1H8ED 3CKLA 1G3QA 4B3XA 2PMDA 3L8YA 3IBGA 1E62A 3NHAA 3RSOA 3PEYA 1Z29A 1W36C 2QEXB 1N6HA 1K5GA 5HKKA 1XPRA 1GVHA 4RFSB 2W58A 1MOZA 1AJEA 3KXLA 4KITB 4DCVA 1YRBA 2CL6X 3KL4A 4URVR 1KTVA 2WSSA 2G77B 3G5UA 4B73A 5AJXA 4ACBA 2V6JA 3U2QA 3DZ8A 4F7DA 4B47A 4F91B 5CLQA 2IHBA 2J0SA 1W87A 1TF7A 1VECA 2KB0A 4KYUA 5IT5A 1MRNA 2ZI5A 2PCJA 2O0HA 2C77A 2RGXA 5GJVC 1Z83A 4TT3D 4AF6A 2BEJA 4LJ6A 2V55B 1H42A 4ZI3A 3HYRA 2R62A 4P4TA 1P61B 1P2VA 3B78A 4ZCMA 1P5ZB 1E32A 1UADA 1W1WA 1N5KA 1GAJA 4M2LA 1N6LA 2CLSA 1UDXA 3ZIAD 1SHZA 2Z5FA 2D2FA 4RCYA 4URXR 5EE5B 3I1FA 4IOKA 4RSGA 1GOTA 1M74A 1P2UA 2CLDX 4Q1AA 2ZRNA 3HJNA 1NY6A 4G1VA 2A5FA 3U7FB 4TLCA 1CP2A 2GRJA 2OUKA 4QGGA 3I56B 4LDJA 2ZYUX 4L5BA 4QHSA 2C9OA 3U61B 1ZNYA 3NC1C 5KDDA 4GOXA 3KJIA 5TVKA 4PPNA 2H92A 2WVJA 1U81A 5K8LA 4O25A 1KO7A 2OXCA 1UBFA 3ZDQA 2W6IA 4MH0R 5HKKD 3AV0B 4TL7A 2PX0A 2HXSA 1G3MA 1G8GA 1QHIA 2QE7D 2G0NA 5DN6A 4HUQA 4IXNA 2MMGA 4ZKDA 1OHHA 2EYUA 3RS0A 2FG5A 2QE7A 3B1YA 2JDIA 3M6AA 1OE0A 5FOSA 1U9IA 4JSTA 5SZHB 4C0AC 5JI3E 3KQHA 2XTMA 5EE9A 4W5HA 5FOVA 1HE8B 1E9FA 4MDFA 4C3ZA 2ZRAA 2TMKA 3H2YA 1JR6A 4GMDA 2V4ZA 1A5TA 3ZBUA 2BBTA 2XNDD 5C2JB 1VG0B 2FFBA 1H85A 1E4VA 4M9QA 2PT5A 1D5CA 3QQ5A 5FOXA 4ZDKA 5H70A 4NE2A 2ZROA 1W2HA 4Q1BA 3JQQA 4X8MA 3UK6A 3ZC3A 2WMOB 1GILA 1SKQA 2J59A 1PV4A 2UZ3A 2FF7A 2RHMA 4I1UA 4QOSA 3W5HA 2RGCA 4Q4JB 3HWSA 1RPZA 2QAGA 3A4LA 2IYSA 5JEEA 3FOZA 2D7CA 2VSOA 2D06A 3KTAA 1BS1A 5FOUA 3EZ6A 4TZ6A 2AD1A 1DELA 4MYUA 1QDEA 5F98A 1OB2A 1IAQA 1L7VC 2J87A 1N6PA 3WP0A 1VIAA 2ZUCA 1VYTA 1J8YF 2NZ8A 1SKYE 2FZLA 3GJ6A 1FRQA 1SVLA 2EW1A 4PC6A 1II8B 2FPLA 3GLFA 1YZQA 1JAIA 1L4YA 1DG1G 2B7BA 3EZ7A 1O87A 4URWR 1JR3A 4FCWA 1P2SA 1VCIA 4LHYA 2ZJOA 1FDRA 4OHWA 1PLKA 2Z83A 3OE7D 3N2EA 2QTLA 3CH5A 3NH6A 2LKDA 4NYIQ 1KJWA 1W49A 2ZJYA 3SHFA 3U44B 4XIGS 1DADA 2QSYA 4OJKA 4B6FA 1KNQA 2QPTA 2ZR9A 1M1KD 4Q66C 3T1VA 2O8DB 1XB2A 3R20A 3WNCA 1XCGB 3CB4A 2H1LA 2OSBA 2C2HA 3C16C 2G1JA 4C2TA 4JS0A 1SVMA 3JQRA 1N3BA 1ZM4A 1JALA 4D81A 4G01B 5EXPA 2FSIA 1C9KA 3ZH9B 2RC5A 2VHTA 3LFUA 4CDGA 5KNDA 4PC3A 5L8VA 1YR6A 1YVDA 5GVRA 2PBRA 4KVAA 1EFCA 3GEIA 2VBCA 3CPWB 2GWHA 3EX7C 2ZYWX 2O8CA 2BWJA 4LBZA 1KK3A 2OTLB 4JSYA 3TLXA 4D0GA 4LYFA 1NSTA 1OGJA 2IF2A 4P4UA 3W6NA 1T6NA 1E2MA 2NO0A 4B2IA 3KB2A 4B3FX 1Q7YD 2IYWA 4CT4B 4JIMA 3IO5A 3R9XA 4JLAA 3SI7A 3CPJB 3U5ZB 3OIWA 1TF2A 2Q3FA 4PTLA 1ZM2A 2IYRA 3NDPA 3OE7A 4MKIA 1ZW6A 2P3SA 3LW8A 4OHVA 2JLZA 1A4RA 1Q86D 1CTQA 5J4KA 1Z63A 1AS2A 5FBQB 4IDQA 5DI3B 3UIEA 2GJSA 4G5SA 4EJSC 2RHDA 1HE1C 1I4TD 3FE2A 2WIBA 2ZM5A 1Q1BA 4HUQB 3J81k 1W4RA 1HQYE 2P2LA 4URZR 2VQSA 3QE0A 1GRRA 3AM1A 2A2ZA 1SVSA 3WMEA 5L3SA 3CNLA 3ZVRA 5KDOA 4A6PA 1XEXB 3BE4A 5DO9A 4IKEA 3TNFA 1T3LA 3QG5A 1S9DA 1YJ5A 4AYXA 2GZHA 4LJAA 1SXJD 1QFYA 2BVNA 2GAOA 4A8JA 1DG3A 5D3MB 5HCIA 4WW0A 4B48A 1G1MA 1MH1A 2OESA 2IS6A 1SXJC 1NVWQ 1VQKB 2A78A 3MAAC 3QPVA 3TBKA 3PXGA 5LD2C 4RD6A 3R7WA 1AQYA 4JL5A 1QX4A 1Z6AA 4IXMA 5A4JA 3B7GA 2GZAA 5JSZB 1G64A 4NPHA 4C0LA 4R9UC 4MRSA 3CONA 4FMDF 2GJKA 2BKUA 1E64A 1UJ2A 2QU8A 2EFCB 2Z4RA 4EFMA 4B4DA 4FMDB 1QVAA 2YC2C 1FUKA 2OK8A 3U60B 2KWIA 4NTZA 4JLVA 5DLQC 2FFAA 2WSMA 5FPYA 3V4FA 1UBGA 4BLSA 1EESA 5EXSA 3MRSA 2ANBA 3EPLA 4TYWA 4TWZA 1Q0UA 1GL7A 1NG1A 1Z07A 1R5NA 2F9MA 2VP4A 3Q5DA 4PSVA 3RYTC 2QUZA 4XSGA 3FB4A 1G5RA 4BZQA 5BN5A 1G8YA 3JQPA 1ZNWA 5CB6A 2QT1A 1KOFA 5F3WB 1OXUA 3EPJA 4RKFA 2QP3A 4YDSA 2E9SA 1KKMA 3EW9A 3QFCA 2IA5A 2W6ID 2CJWA 2OZEA 3IIKA 4TT3A 2C96A 2XSZA 3SU8A 2ZRKA 1ZUHA 4V0OA 1N6NA 2VYFA 4MKFA 5FPHA 3I8SA 3WHKA 5DI3A 2F3TA 2HLDD 4DXAA 5FFMA 3PENA 3O8BA 1IXSB 3NEJA 2OFXA 2W6JD 2ORIA 3EIEA 3EARA 4KFSA 2EFEB 2FFQA 2RCNA 3K9GA 4WXPA 4YMWA 1M34E 2CHGA 3LWNA 4C0KA 2BDTA 4PHGA 2OILA 3PITA 4EH1A 4ERNA 5JZVA 1BH2A 4OK5A 2RGDA 4KAXA 2IYXA 2ZSEA 2JLRA 2BBOA 1AQUA 4GT1A 2BSAA 5KSPA 1M8PA 2OT3B 1RRPA 3EZFA 4MGIR 4UXHA 5HR5A 3KKMA 1T9HA 3EA5A 2WWHA 4KLZA 5KSYA 2R8RA 4BASA 2O8BB 2PMKA 4RZUA 4RZ3A 3IPYA 4Z1MA 2C78A 2DFTA 2VIIA 2AXNA 4YAUA 2A5GA 2GESA 3F0TA 1G3IA 4UQOA 2P6RA 1OXVA 2XNCA 4BECA 1XEFA 3BFKA 5FTJA 4Q18A 2GBLC 1IBRA 1NRJB 1E94E 2ZRJA 4PC1A 1RKBA 3ZQJA 1QHSA 3PEVA 1F20A 3PIRA 3Q85A 2ERXA 1E98A 4Q1CA 2C9CA 4M22A 3TVDA 1UF9A 4IVPA 1VYVA 5LBIA 2OG2A 1RYHA 2ZJ5A 1OF1A 1IXRC 4I4LA 3TAUA 3P26A 4BRWA 1OFUX 5C1BA 3KQNA 2VP5A 1CU1A 4BEBA 4E03A 4DSNA 2VLIA 1A82A 3MCAA 1GFIA 3VAAA 2ZSBA 4V02A 3UWOA 5KU1A 1F48A 2DWOA 1GO2A 3TQFA 1LW7A 3JVVA 3CCRB 4H1VA 4N0DA 4D26A 3IEUA 3L0IB 2GKSA 4ESVA 5FPTA 4U00A 5KSOA 1FZQA 3I62A 1Q3HA 4BFSA 4LI0A 2QY9A 1G8FA 1JPJA 4TL6A 3VR2A 4TMVA 3NBZC 2ZRBA 4Q5IA 4LJ9A 2V3CC 2EU8A 1UBCA 3KXKA 5H5JA 4Q9KA 1KYIA 1Y3AA 2QAGC 2XB2A 2G9NA 1Q22A 4OKSA 2W2VA 3HYTA 1TQ6A 3ZQ6A 4L15A 2ZI9A 3NG1A 4HAZA 1ZNXA 3A8TA 4KYIB 3OIYA 1W5SA 1LS1A 2REBA 2EVWX 2V7QA 4B32A 2VF7A 4U7DA 4EQ6A 1QHYA 4HB2A 1SQ5A 1SVOA 3RC3A 4IVRA 2N42A 3W34A 1XRJA 4LK2A 5E4FA 3AF1A 4MUBA 1JA1A 3W6PA 2VSXA 3CX7A 4POAA 1TUIA 2NO6A 3B1XA 5CYOA 4HB4A 1MRSA 4AD8A 1NMXA 3IBYA 4ZV4A 3NVAA 3P27A 2R6AA 2ZE8A 1RFLA 4JLJA 5EUQB 2EIXA 4DZZA 2A30A 1G8PA 2GF9A 4DWJA 2RGAA 2BMEA 3KQUA 1JI0A 4X8LA 2B21A 1G7SA 4ZO4A 2NMVA 5EZ5A 4FD2A 4ZGQB 3T06B 4PR0A 3LH5A 1CULC 1LFDB 4W9MC 1CF4A 4MYTA 5KPDA 1AMOA 3QKTA 1ZINA 3MWJA 4YQFA 2EWVA 4OHXA 3ZZTA 1KZ7B 2JJ8A 4OI4A 4JL6A 1T0HB 1GUAA 2OFWA 3FWYA 4Y9RA 3K9NA 1XXHE 5ANRB 4KXFB 4WXRA 4DKXA 3LBNA 2H8KA 4S35A 5HZHA 3WXMA 4M4SA 1KDPA 4FCVA 4DUGD 3U3JA 2WJHA 1G5TA 2FEOA 4R7ZA 3Q7QA 1XD9A 2HMAA 1E9RA 1E2DA 2CK3D 3R8CA 3VTKA 1Z47A 3U3RA 5TV2A 3CCQB 1OXTA 2REXB 1KI6A 1LB1B 1OKKA 1G7RA 4MKGA 4WZ6A 4PFSA 3L0OA 2PLFA 1W46A 4L9SA 2WPDD 5E95A 1EWYA 3I32A 4GFDA 4DRZA 2O8EA 2WJYA 5AN9A 3DDCA 1QVGB 3AUYA 5JCZA 4ZI2A 1E2QA 4Q1FA 4NCIA 4A0RA 2H17A 4Q47A 2VRWA 2XNSA 1E9AA 4PQFA 2ZRDA 1Z6XA 1FNNA 3BWDD 2CRVA 2A5JA 3CNNA 3EC1A 4YMUA 5JI2E 3Q7PA 3C5CA 5B57C 1UKVY 3BERA 4LPKA 2IHYA 4ASUD 2QP9X 5JECA 3REGA 3Q72A 1A2KC 3GEEA 2BF4A 1IHUA 3H86A 5CJ2A 4D0NA 4YAWA 3AVQA 4D25A 1F3OA 1HT2E 2NPIA 3B1VA 1IY0A 3I4LA 4PQYA 4JLKA 4PGOA 2GEVA 4GP7A 4Q4HA 5JFGA 2CEAA 4PZLA 5AUOB 2ZI3A 1VG8A 2FU5C 4DLZA 4IHQA 4LC1A 1QFZA 3TSZA 2FSFA 3THYB 3ZLJA 2AD5A 1YI2B 4UJ5A 1P3JA 4C7OB 1N8RD 2CHQA 3RRYA 2ZIAA 4D82A 3LX8A 4FN5A 1G9XA 2QNRA 4Q02A 1GRNA 1Q21A 1MV5A 2WKRA 4IFEA 1X3SA 4DLXA 1A1VA 4I1OA 5FI1B 1QG2A 1IN6A 2PZFA 3A1WA 4OQMA 2VP6A 1KY3A 4PXAA 1Q1QA 3B5JA 1GNPA 1SHKA 2BMDA 2XNDA 2KI5A 4NYJR 5JCPA 1GNQA 3ZZ0A 5EJEA 1G7TA 1JJ7A 1GNRA 1WRBA 5GJWC 3H84A 1R5OA 1OYWA 3GJ3A 3RAPR 3EA0A 4HAUA 4MQBA 2BN4A 1KJZA 5G53C 1QHNA 4EDHA 3EZ2A 4P33A 1OJLA 4GNKA 2WAYA 3KQKA 2JLXA 4CW7A 3THXB 2X19A 1XCPA 2QSZA 3SQXA 4TTPA 4AG5A 3CC2B 3VO2A 1BIFA 3MJHA 4LHZA 1SZPA 2IYYA 4P6VF 2R6FA 4NBSA 3I8XA 3QG1A 2NGRA 3B8HA 2IUUA 2J46A 4RZXA 4KODA 5FTKA 2DFKB 3REFA 4H9GA 2FE4A 4D2IA 3QENA 4U9UA 1T3SA 2LWIA 3P32A 4LGMA 1XTIA 5AJWA 1OYYA 3CRMA 1XNJA 4DDTA 2AFIE 3D31A 3DHWC 3V76A 3KKOA 2QPOA 5A5GA 2XOKD 1XZPA 4DSOA 2IWRA 1CEEA 3FYHA 3P1JA 1WB9A 3CR8A 1OIVA 4BE7B 2NIPA 1CJTC 2A3RA 1EXMA 1N2CE 4RJLA 2IEZA 4OL0A 2ZXUA 4EPVA 1KDTA 4UNNA 3OJXA 1Y63A 2H18A 2Q0HA 3QFSA 2C5LA 1ZM9A 2ZANA 4HLUC 1BQEA 3VR5A 1X6VA 1G17A 1KDRA 2OLKA 1KI3A 4B75A 3CRRA 4JKIA 3E2IA 3IO3A 3DO6A 4TMKA 3S1AA 3U4QA 1XEWY 1NKSA 1NG9A 3A58B 3B13B 4LRWA 3CD6B 1NLYA 4MRVA 5SZKB 4BQSA 4CEIB 1G6HA 1U0JA 3ND9A 1KI2A 3PUVA 3BIFA 3TKLA 2IS2A 3TJZA 3WYAA 4LPSA 3FMOB 2HF8A 2X8AA 3LO5A 4TSFA 3M0EA 3T61A 1VQMB 2HYIC 3OFND 4DIEA 3CMEB 4KJZA 3HPQA 1FRNA 3WBJA 2N46A 1YE8A 4RD1A 1EGAA 2W2XA 4GI7A 4LHWA 2E87A 3DM5A 3U4QB 3PV0A 3THYA 3B85A 2BEKA 1XMJA 3CWQA 1D1NA 3TRFA 2BMWA 2AR7A 1WCV1 2BCJQ 2ODNA 1QG4A 4L4UA 1T8UA 2FOLA 1VHTA 4QJ3A 4BZPA 4DT1B 4DBLC 1X86B 1B0UA 4KBFA 3ZD7A 3E20A 4FWIB 4LYHA 3BB1A 5H1YA 1NVUQ 1OFHA 5CLLA 4DSUA 1JA0A 2ZRGA 4K46A 3O8CA 2FX3A 1E2PA 2QRZA 2B5OA 3MWLA 4WVFA 1T3HA 1N5JA 1TMKA 1J70A 2ZEJA 3VX4A 3KJEA 5EE3A 2QN6A 2GCNA 2YWHA 4YXWA 1QHHA 2DEUA 1GKIA 2QTVB 2YNMA 2YYZA 2ZR0A 2ZYTX 3CLVA 1EWRA 2A7QA 1JEEA 1DAEA 3W5JA 4A8JC 4LJYA 4OQNA 2R65A 5FL3A 5LB4A 1KI8A 1G3UA 2GPJA 3H4MA 2QTHA 4IDNA 2Q3MA 3SBEA 4MA4A 5FBLB 5CM8B 1U9IC 4EJSB 4B34A 3QXHA 5BQ5A 3CNOA 4ASUA 2AK3A 2MSEB 2Q9BA 3GP8A 1E2FA 1II8A 2QMEA 4LV8B 3BAFA 3RDPA 2XX3A 2EYQA 4Q1EA 5LPNA 4NKRA 1ELOA 2VL7A 4AWXA 3CIOA 5IF9A 4QM7A 1KI9A 5IHPA 1GG2A 2ZSFA 1HUQA 2BOVA 1DAKA 1HA3A 1NJFA 3HDTA 4BZXA 2V1UA 1BYIA 1OSNA 1E2HA 4WBSA 1AZSC 3A36A 4TN1A 3FPKA 3ETLA 3RABA 2JEOA 3DMNA 5TY0A 1YJNB 1YKSA 621PA 3ICQB 3WRXC 4FK8A 5KNCA 3LVRE 5FPSA 1SXJB 1MO5A 3LXRA 1XJ0A 5DYIA 4TMXA 3CR7A 1NF3A 2ZRCA 3HU2A 1FNCA 2GCOB 2ZITA 2BKEA 2OM2A 1PLJA 2FPKA 1OB5A 4TYPA 4DCUA 2ZVQX 2VA8A 4EKDA 3C7KA 1F2TB 1TQ2A 4P32A 5EXXA 1GTVA 1F60A 4E22A 2AK2A 2OHFA 2IS1A 3CW2A 4URYR 3E1YE 5AJVB 4UNQA 3T1OA 2OTJB 5H59A 3UWKA 4TL9A 1ZBDA 2BM1A 2FJUA 4LJ5A 3FDIA 3WP1B 3PR1A 5JS7A 4B3GA 1S0UA 4YHBA 2CL0X 2ZRFA 1BJKA 4UJ3A 4EPRA 4G0NA 2CCGA 4G1BA 1TPZA 2FMXA 4CEJB 4G3XA 3ES9A 2BIFA 1KMQA 2PEYA 3F3YA 2ZTSA 1XCMA 2OCBA 2WKPA 4NONA 4DVGA 1F2TA 1P4SA 2EWWA 1P6XA 2VNJA 3A1VA 1NLFA 3SN6A 4Z54A 3SEAA 4XWKA 2AHOA 1KY2A 5J4HA 4DEXA 1Z2CA 4MGZR 4BFWA 3C8UA 1P75A 3VR6A 2O5VA 5DI9A 2IYVA 4GSYA 4RD0A 1YZLA 5FUVA 4AYWA 1E2EA 1KO1A 3SNHA 1IY2A 1HH4A 1VKJA 1FQKA 1O3YA 4IVQA 4QHYA 2ANCA 1EWQA 5C46F 3LLUA 2Z4SA 4UNSA 4UKDA 3CCLB 5JS8A 4DIDA 1MO6A 3CM0A 2YOGA 5BYKA 4GDFA 2BMJA 3QKRA 4US2R 1COWA 1U0HC 3MD0A 4II7A 1UBEA 2ZU6A 4QNMA 3N5CA 4BLPA 2A5YB 3TGPA 4B43A 3RC8A 2JASA 1OV4A 1Z3IX 3UATA 1AGPA 4IEEA 1COWD 4BLTA 821PA 3IPXA 4XVUA 5EP3A 1FW6A 1EK0A 2C95A 3VX3A 2IX3A 1YZKA 2PZGA 3K9HA 2ZRHA 2W83A 2OV2A 2P0EA 3IILA 2ZS9A 1HTWA 2MSDB 2WJVA 2DWPA 2VEDA 2YWGA 3P4YA 1WQ1R 1FNBA 2F43B 2ORWA 1EFTA 5KPJA 4I1SA 4O3MA 2ZETA 1P72A 4HLCA 1GSIA 4Q4AA 2PIAA 1GDDA 4GMXA 4OQFA 2D62A 4AK9A 4A0FA 3WNDA 4ITRC 3FHCB 1BX1A 4LBYA 1E9CA 1KMHB 2JGNA 3AP3A 4A2QA 1IXZA 1TEXA 2QEQA 3VR3A 1F2UB 2ORVA 3U3MA 1W4AA 3MLEA 3GJ8A 3BB4A 2ZR7A 3OIVA 2O8EB 2DY1A 3QI2A 3QXCA 8OHMA 1Q3TA 1OH5A 3LAWA 1OIWA 2IL1A 4IOLA 1EFRA 1H65A 4Q01A 3MWKA 4BUJA 5G3YA 1N0WA 3QY0A 1NL3A 5FH9A 4P3YA 1SKYB 4M1YA 5FBWB 3BBPA 1DAFA 3GLGA 4F93B 1JJVA 4H1UA 4MRPA 1ZIOA 3GD7A 4QHTA 4GPTA 4WIAA 5H8WA 1KI7A 2FSGA 3OIUA 4R2HA 1NLZA 1UKEA 5FTLA 1FOEB 4JVLA 4BWYA 3NIBA 4LHVA 4HE5A 3HR8A 4TQUS 1B23P 4ZKEA 3A1UA 4XOIA 5FUYA 4A1FA 3SS8A 4KV9A 2VH5R 5FBRB 5L3VA 2FWRA 3DMDA 2DETA 2V7QD 1XMIA 4LJ8A 1UPTA 4QL3A 4M53A 1TUEA 4BGDA 3K0AB 1YZUA 1X8LA 3GJ7A 3RHFA 5KSWB 5EE0A 2GETA 4JL8A 4N1AA 1NVXQ 1DDGA 4TQAA 2ZE6A 2REOA 5AR1A 5BN4A 1K8RA 2OE2A 2C9YA 5B58C 1Z6YA 1QHHB 1WBDA 3GLIE 4BFUA 1R0ZA 1VQLB 4M1WA 2B7CA 1QUEA 4MGKR 4M1KA 3FTQA 4KHZA 4NU0A 2YJTD 2QT0A 2X1VA 1QH0A 5F2EA 2VTKA 4URUR 3VKGA 2X2EA 4HUTA 1D9XA 2BHRA 2MMCA 4FMBB 1QGYA 5DNYB 3I5XA 2CVHA 3I55B 1NMZA 5DYGA 2IYQA 1E2KA 1L4UA 2Z6VA 3OZXA 3KX2A 3QIAA 4JVSB 4NH0A 5AJZA 2VP0A 4DB2A 3UANA 4OK3A 1T5IA 4MYCA 1FP6A 2FGKA 3W8RA 3L2OB 3W8NA 4Y9UA 5FTNA 1ZCAA 2PJZA 1UKYA 1D2NA 4PHHA 1W35A 1X8JA 3H1TA 1JB9A 3VU9A 1FL9A 2QMUA 4O2RA 2WICA 5DN6D 2X2FA 2QBYB 1FNDA 4FXPA 4A2WA 1U90A 1EX6A 1RYFA 1XD2B 3C15C 4NYIR 2J7PD 4X8OA 2AL7A 4B3BA 2QZ4A 3KKQA 3I61A 2IUTA 3QKSB 3RRNA 1FX0A 5FOWA 2OXRA 1Z08A 3VR1A 3ZIAA 5L3SB 1PJRA 4JLNA 1KK0A 3AKYA 2XJ4A 2C8VA 4Q03A 2Z43A 1UDWA 3BFVA 4LV6A 1PUIA 1CNEA 3U6BA 4E09A 1IM2A 1M7GA 2W0SA 4FCTA 3LBHA 3GLFB 1TNDA 1RJ9B 2BCGY 4Q00A 3X2SA 5BN3A 4HDOB 2QORA 1SVKA 4IOMA 4R2IA 3T15A 3GLHB 3KFXA 4KU4A 3HPRA 1US8A 3AVXA 4P4SA 4MYHA 3TQCA 2YWFA 1K5DA 4KFUA 1RRCA 1VQ9B 1CIPA 1U8ZA 3CZPA 3IHLA 1U99A 3R9IA 1E96A 3AGQA 1AM4D 1CJUC 3A4MA 2EFHB 2DB3A 1KRHA 4EFLA 1DE0A 3LLMA 3PUZA 3G82C 2XZOA 3GPLA 3OEEA 1DOAA 2O8CB 3LY5A 3AVVA 4UNPA 3E5HA 4EIWA 4NCNA 2QENA 4C9BA 2AWOA 2UVQA 3CRQA 4LYAA 3VHLB 2FDCA 1CR1A 4Q7JB 5JRZA 3QFRA 1ZM3A 1OFIA 2XITA 4KVGA 2HEIA 1OT3A 1AGRA 1E0SA 2O0KA 1ZU5A 3TW4A 5K8TA 4U02A 4Z8XA 2I1QA 3VNVA 3K0CA 3L0SA 4KLNA 3ZS8A 4OYHA 4XD7A 4TYQA 1RJ9A 4DHEA 5JWOA 1JR3E 3PG5A 1W36D 1KI4A 2XTNA 2ZREA 2J7PA 3D8BA 5FBVB 3PUYA 1XTKA 4PC2A 3EC2A 3B1WA 3AF2A 3SJBA 1OLOA 3LRPA 3SC3A 3W9YA 1GWNA 1KDOA 3A37A 5SZJA 5JWHA 3W5VA 4NP6A 3WYFA 1KAGA 1B2RA 5GV8A 1NVVQ 3D6TB 1R0XA 4B74A 3QEOA 1Z2AA 3RS4A 4C2UA 1VQ6B 5HCNA 3AVOA 3TUIC 3CPEA 1TLLA 1KO4A 1IN4A 3VU9B 3DZDA 4GBMA 4RD3A 3SQWA 3K0SA 2ZJ2A 2YZ2A 2IWHA 4D4KA 4CEHB 2C04A 5F9HA 1LTQA 3RS7A 4YMTA 3CCVB 4TZ0A 4TMZA 2JLSA 1A7JA 3KUDA 4Q9HA 2F1RA 1KKLA 2ZJ8A 3QKUA 2W6JA 3GJ4A 3RRZA 3K9LA 1GJRA 2IC5A 2R6DA 1UEIA 2GK6A 4MKHA 1IY1A 4PSAA 4Q7KA 4YXWD 4LOAA 4ZDJA 2GDJA 5TR9A 1C4OA 4PPFA 2HUPA 1US8B 1DAGA 4OQLA 1L8QA 3UXMA 1D8TA 3DL0A 4PPGA 1N5IA 4GOKA 2D7DA 3LNCA 4G5QA 4DDVA 4HZUA 3KFVA 3DEFA 1II0A 3V4RA 1T4GA 3EPHA 3FFBA 1G4UR 1JEDA 1LS6A 3BOSA 1I4DD 2AKAB 4EPYA 3TK1A 1FMJA 4D4MA 4I1VA 4ON9A 4B2LA 1WXQA 4C0BA 1VQOB 5LDDC 1GAQA 4EAQA 1NBMD 4MDEA 4K8OA 2JAQA 1OW3B 3BC1A 3K0CC 1VQNB 1G6OA 4DLRA 5TXGA 3MG9A 4CEIA 2WM9B 4U5XA 3FMIA 1J90A 3E1SA 2ONJA 3ADBA 2BGJA 1YR7A 2NO9A 2ZJAA 4FIDA 5L3RA 1UFQA 1XF9A 2I1VB 4X8HA 4XWOA 2IT1A 3CUEF 3QF4B 3R9WA 2RAPA 2H16A 3KTAB 4WZAE 1IN5A 1JXOA 1Q57A 3OZVA 3ADCA 4JKYA 3T5DA 4D4JA 3JVUA 3KJHA 1W0JD 4K1XA 2BM0A 3L43A 2XNJA 2KJQA 5JHHB 4C43A 1TU3A 1GVNB 1XWIA 1C1YA 5FPKA 3F5FA 1Z0IA 4M1SA 4FI3C 2ZS7A 4BLOA 4PQRA 2XEXA 1XZQA 4PPQA 2QMOA 2WWYA 1VG9B 3GLGB 5G41A 1CJKC 2GNOA 1QG0A 1R8SA 3WMFA 2GILA 1JB1A 2KE5A 2BBSA 2CE2X 1NIJA 1XJCA 1BYUA 1S8FA 4P4SB 2GBLA 4GP6A 721PA 2FPMA 1G291 3GLHA 2YOHA 1OXXK 4NCHA 1K73D 3OFNA 4PSKA 5HPYB 1KSGA 1KQSB 1VQ5B 2RH5A 2V6IA 5EZ6B 2GAAA 3NBFA 2R9VA 1A2BA 4AURA 5KTYA 1XD2A 1J99A 3ZJYA 4CZ2A 3MWYW 5GADl 3NHBA 1X8KA 1OXSC 4WZBE 5HTKA 2NO7A 2DCUA 1N25A 3EASA 3NBXX 2V8OA 1NN3A 1T5LA 2FZ4A 3QVUA 3N2IA 2IF0A 3UG6A 4BPBA 3LVQE 1R0YA 2GA8A 1E9SA 1AS3A 1NMYA 2QM8A 4CYMA 1ZAKA 1WMSA 1G16A 4DLTA 1AKYA 1G4AE 4CT5A 4NDZA 3BH6A 4RVCA 2V1XA 2XXAA 3ONWA 3IUYA 3MSXA 4XTRA 4A15A 4O2LA 3CBQA 1Q81D 1RIFA 4P31A 4F92B 1W4BA 221PA 5L3QA 4TMTA 1ESNA 1QFJA 2QTZA 1JAHA 2XOKA 2D4HA 3NWJA 3PUWA 1P9RA 1NI3A 5K8IA 1MO3A 3SYLA 1P60A 2SHKA 4M21A 4OK6A 5DE3A 2Q3HA 2CE7A 4HZIA 1E79D 1VQ4B 1G18A 2HDNB 1VCNA 3SJCA 4ZCIA 4QBIA 4QG7A 1QUFA 1HEIA 2XTZA 5BXQC 3KKPA 4AC9A 4HATA 4WQMA 4AYTA 1QHGA 1YR8A 3U3KA 2QRNA 1XXHA 4LBVA 3U7EB 4FWTA 2DERA 1R4AA 2HV8A 2ZUDA 4Q9LA 3CPHA 4BFXA 3W3AA 4F4IA 4LJ7A 3SFZA 2CVFA 2CNDA 1L2TA 3B2EA 1GR1A 1FQJA 2RGNC 4CEJA 2YWEA 3MJRA 4LSGA 1HV8A 1P2TA 3IHWA 4V03A 3X1XA 2O8BA 1SULA 5TDHA 4DDWA 2GXUA 1SVWA 5E7MA 2ONKA 5IK2D 3A1SA 1KZGB 4YMVA 4JJZA 4US1R 3RRMA 4JZKA 4RCZA 1Z0DA 5KHOC 1M6NA 1Z5ZA 1H8HA 1DAHA 2GEUA 1GIAA 2JLUA 4B3CA 3WHLA 2XAUA 4RY2A 4NHOA 1R2QA 2EFDB 2FH5B 5THXA 1PVOA 2BC9A 3LW7A 3BRWD 3GFTA 2HCBA 2YVUA 3SJAA 1V43A 1YJWB 1AZTA 2WJJA 3CF0A 5AUPB 2HF9A 1Q1ZA 2RGGA 4PZZA 3CCEB 3RANA 1FPMA 4WOPA 1X1SA 2ZE5A 4QBGB 2JJ2A 1Z6GA 3WYGA 4EPWA 3IEVA 4LBWA 3K53A 1S4QA 5CIWA 1Z28A 3EIHA 2HT1A 2F1IA 3NC0C 4JJKA 2WBLC 1YIJB 2IW3A 2VHUA 4Z51A 4B35A 5CDFA 1W2GA 3B1ZA 5EP1A 2GZDA 4LHXA 3EAQA 4OI0A 3KB1A 4DSTA 3OESA 3GFOA 4IW3B 4NYJQ 2JJ1D 4BLQA 4A92A 1YU9A 2JDID 4N3NA 4ZDWA 4R71A 1ETUA 3SZRA 5DHFA 5K8UA 4S2EA 4IOJA 4Z8YA 4DLVA 2X3UA 2F1HA 3TAHA 2YKGA 1UMKA 1ONBA 4A2PA 1NDHA 1JNYA 1RE0A 2QP4A 4JLOA 1W2BB 2VNKA 4RD2A 2F1JA 3OJWA 1XEWX 1GITA 3CX8A 5AWFC 3TVTA 1NP6A 2DBYA 2QMHA 1T0JB 3GLIB 3M4YA 3W2FA 2CXXA 1RRGA 4YALA 3G4SB 3U7GA 4ESHA 2PH1A 5F9FA 3W2GA 2P5TB 4Q9JA 3B9QA 5LD2B 5EQTA 1S1MA 2GCPA 4W5WA 2NPFA 2OBMA 3FMFA 1XBTA 3ZYCA 3FGNA 2IS4A 4PC7A 1NY5A 1XMSA 4A8JB 2YOFA 4NYMQ 1JBKA 2QG6A 3AKEA 3KZ1E 4NCJA 4QGHA 4LV5B 3L82B 1KGDA 5M04A 1EP1B 1PUJA 3TUZC 3ND8A 3QXSA 3V9PA 1JPNA 4QXAA 5CK4A 3NXSA 4XVRA 2IXGA 4D4LA 4DLUA 1U8AA 1NN5A 5CYPA 1ZIPA 2R6GA 1N6RA 4ABYA 1CNFA 3T5GA 1OH7A 1MABA 3WBKA 3QFTA 2I4IA 2OBNA 2WWGA 4WAUA 1XTQA 2WWIA 1ZJ6A 3TE6A 2O8FA 4JMPA 2ZI6A 2K5UA 1Z8FA 4IDOA 4D0LB 1YQTA 5KYKA 4HLUA 1YJ9B 3CH4B 2GXQA 2QGZA 4WA7A 1IQPA 4UXIA 4DB4A 2DHRA 2HYDA 1XMVA 2ZRMA 3BH0A 3NDBB
chains in the Genus database with same CATH superfamily
1WF6A 2PU7A 3KT8A 1W0KA 4FOLA 4ICIA 1YR3A 3SIPA 3T35A 3TRKA 2RGBA 4EMTA 3JQ9C 5LIRA 4UBIA 1GCAA 4QPJC 4HZUB 3CCUB 1DT3A 3ZK7A 5JWRA 4ID9A 1YRAA 1YQGA 3CF4G 1UEJA 1HXHA 2Z04A 3C4VA 2DPLA 4CUZA 2ISSD 2VDRB 2FLVA 3I92A 2XT0A 1XQYA 1R4NB 1O96A 3OFSA 2HO4A 4IF4A 4PIVA 3AQ4A 3ZV6A 3NO4A 4AUMA 6GPBA 3WIOA 4ZOBA 1D2MA 3I0ZA 4DCPA 1IHDA 1JU9A 2CJYA 2Y71A 5D3MA 1E3WA 1E3LA 4RPDA 2MOKA 2V59A 3PD7A 4U2GA 3T12A 3NTVA 2VUTA 4J43A 1QTNA 4WJLA 4YPOA 4D3ZA 3AWDA 3QSYA 3CX6A 4TPKA 2XOEA 3JASB 1CS4C 3C3CA 1CD5A 3G13A 2OLEA 3HY6A 4XGRA 4G5GA 2VO1A 1LKZA 5AK5A 3TZEA 4DLSA 1Z4IA 1Z36A 4OJQA 3DHVA 2WMNB 1W5AA 1NXSA 4QU5A 3BWVA 4D98A 4J0EA 1SEPA 3ML1A 5EE1A 1ZD1A 1TEHA 1JPVA 1N3LA 4NJOA 1PG5A 3LSTA 1U2RA 3KOWA 1QJCA 1C3OA 3VKHA 4UU0A 3S4YA 5KQPA 3U44A 1QQBA 1N7GA 3G1TA 1X1RA 2HSJA 1THTA 3HAGA 3EZ9A 4AZVA 3FNIA 4ZQHA 1A8SA 3FYTA 1HE3A 4YROA 1LF5A 3WE7A 4OYLA 1ZEJA 3PIDA 4V0KA 1OCEA 2X5OA 3FRIA 3OTHA 5DM1A 3SYKA 4EHJA 4RQUA 3ZJVA 1IOVA 2D5IA 3HU1A 2HZBA 5IDWA 4KQCA 2NSLA 1L5MA 5BYJA 4PAMA 2X0JA 1HG0A 2VHEA 1PV2A 3QHQA 1X7WA 1RXYA 1UQTA 1YVEI 5T4HA 4DGSA 2VDQB 4P9NA 3TL6A 4INPA 1EM8A 3AGPA 2FW1A 1H0KA 3BRCA 3TUJC 4MVCA 5HXBA 3BGSA 4BRZA 4C0SA 3NASA 3E3AA 3PYMA 1UIMA 3VC1A 5B30A 1J5EB 2OC4A 2VYQA 4QREA 5G4LA 5LP6C 3CCMB 1ESZA 3P0RA 1RC0A 2OK7A 4J1NA 5JAPA 2VQDA 5L53A 4YDHB 4WOKA 4IS2A 4UD6A 3AL0C 3LT4A 3CZRA 1YA8A 2OB2A 1M2OB 2R4UA 2XIJA 1UPCA 4RDIA 2QAGB 3KDSE 2BMVA 4FVTA 4GX2A 4XMYA 4BFZA 2HT6A 3AB8A 3LHIA 1XVUA 2W43A 3NDRA 1MXHA 3R3HA 4R1PA 1K66A 3QVGB 4LOLA 1T6BY 3ZWBA 2JJQA 1ZYUA 1RAFA 1TECE 1E3ZA 2C3UA 1U2GA 2HCFA 1DHRA 3I3SR 1I2ZA 3BD8A 1UK8A 5EKUA 3RK0A 5K0TA 2I3ZA 1TGYA 3U6KA 4ZT3A 3BXXA 1OWLA 3BF7A 3O2JA 5KVSA 4V1CI 4K03A 3QF4A 1E3DA 1XEXA 2QR5A 3BFJA 2O59A 1Q77A 1VPTA 4X44A 5CDSA 1UOQA 1P5JA 2YMPA 2XXJA 1MB3A 4OQXA 4N0EA 1XNQB 3VO8A 3I4CA 5JXGA 1N7HA 1IULA 3UKDA 3GT4A 1ADJA 5EJ2A 1E0DA 2YC4C 2VOEA 4S1NA 1NZDA 1HK7A 3D3NA 4QOHA 3URMA 5A7FA 2GYVA 3WYBA 3JZAA 2GHIA 2AN3A 1HTBA 4AAYA 1E1LA 1P77A 4ZT7A 1OWMA 1UJCA 2X0IA 4GPBA 1NKTA 3EXHA 4AJEA 2GEJA 2ZWOA 3U31A 1XZMA 1EH5A 2W8BA 1GKUB 4RJ2A 3VHRA 4IUDS 4UHHA 2FP3A 2YBEA 3AM5A 5B3JC 1VRWA 1XDBA 1J09A 2VWHA 3SMVA 1KJYA 1UC9A 2XB4A 3DT9A 4HUJA 1AIPA 4HDKB 3AIOA 4DCNA 3W1WA 4UOEA 3AB3A 3DE3X 2C2GA 3RF7A 4Z4SA 1P8AA 1CUUA 1YK0A 2FQYA 3N86A 1BGVA 4PLHA 4U6NA 5BRJA 1P9OA 1KFCB 2RK6A 2I8CA 1KVUA 5CVDA 2ZJBA 3DEZA 3NR2A 1SOWA 4HPJB 5GMOA 3SYRA 3HJGA 2V9PA 4QNNA 1VQ7B 4WGGA 4BQPA 5EJ6A 1I0ZA 3PXDA 3THWB 1X7GA 2DWUA 2WYVA 1SH7A 4JHXA 4MZXA 1C1HA 3GF4A 3LXXA 3W7VA 2R7LA 3DXFA 4RH3A 5L51A 4F5WA 3L06A 4X1IB 5ADHA 2AUTA 2H0RA 4YLEA 4FMCB 1Z33A 4I2VA 3HRIA 3W9UA 2O8DA 3QE2A 2AJLI 2VVTA 2TSYB 3EHDA 1AK2A 3K8YA 1ODFA 4QASA 4ITVA 2L0XA 3HDHA 1WZIA 3MWEB 2HU5A 4AROA 1KEWA 4TWJA 1HG1A 2WWRA 4U2BA 1U2TA 3DWIA 4BMSA 3PWSA 2JVIA 3A6PC 1Q0TA 2BKXA 1G8HA 2CKDA 5DBEX 4IPTA 1Q20A 4MPJA 2OO5A 4NFHA 3EZYA 1ECFA 3CC4B 5DTJA 3P9YA 3TJMA 3TQQA 2QQGA 4C4XA 4TKZA 5JQWA 4K6FA 4KG7A 4M37A 5K6AC 4C76A 3LO8A 3BXZA 5DBFA 3CPSA 4AO6A 1LPAB 3HDQA 1U3WA 2VP9A 5DJ5A 3MHPA 1MABB 2HKIA 3CINA 5ALQA 4BKMA 4DIBA 5LQNA 4XQCA 3ZGZA 1I2CA 3FM9A 1FP4B 2WM8A 3R75A 3T3IA 1Y81A 3H97A 1PX2A 2OAQ1 3RT1A 4YMSA 1Z56C 4RLZA 1DO2A 1GQSA 4GQNA 1PJZA 1YMUA 4JODA 4BNTA 2JFVA 4D9CA 2FN4A 4NBLA 4CF7A 4N41A 1ESMA 2P41A 4YHHB 1RC8A 3II6X 4BV8A 1B74A 4J6FA 3OKXA 1TJPB 2PLRA 3KKKA 2VQEB 3ZXUB 4KBGA 3FLAA 2J0QA 2ACKA 3CF2A 3OT4A 4J0KA 1W88B 1OH6A 5BT9A 5CB0A 2HJSA 4HAXA 1I7QB 1HOTA 2FZKA 2HWWA 3EUEA 3OZAA 4HEA1 3VHXA 4RADA 5DLDA 1FDVA 3QWHA 5I5GA 2JGRA 3I5YA 2GJAA 1CB7A 3RSCA 4I3GA 3AW8A 1D9ZA 4KFRA 4Z3OA 3IVXA 4XJSA 2XE4A 3W77A 4JLUA 5I7WA 3T1TA 1JAZA 1A72A 3G89A 2UUPA 2BHLA 4PYQA 4KOAA 4QEZA 2M6KA 4D0GA 5JAIA 4C7KA 5DYTA 2MSCB 1D4ZA 5F21A 2LCFA 2TMDA 3KBOA 6LDHA 3BFPA 1BMFA 1ZLYA 2PLWA 3TB4A 2ZW9A 3H5WA 1ANKA 2C59A 5JY1A 3AKDA 1ZSNA 4M0CA 5CPBA 2Q49A 5TMPA 3PCXA 4YCBA 1XWFA 4JWTA 1MNQA 5JJKA 4U2CA 3W1EA 1ZM7A 3UT0A 3CVWA 2DXIA 2CBZA 4RK5A 3WR5A 3WFJA 4Q7LA 2XGOA 2GJRA 1KVSA 2HI0A 3REOA 4IRUB 3DF9A 2ASEA 4OHMA 1A8PA 2AX4A 4I1YA 2NQ2C 3CYFA 3UH1A 3VAYA 4Y7CA 1J33A 4MPTA 2Q99A 2JIRA 2ID7A 1MD9A 1OI4A 3MUFA 4J94A 2HSDA 1J9ZA 1ULZA 4LWZA 4PLCA 3VNUA 4CTKA 1BKDR 3CW8X 2BDUA 3BM5A 3G5LA 5AUQA 5JZBA 3GLFE 2DR0A 2H2GA 1YF3A 3U0VA 5G3ZA 1GT6A 1ZD4A 3PE4A 2JLVA 4F97A 1A4UA 2ZI7A 4D0RA 2P4HX 5CU7A 4HH3C 4NJEA 4MZDA 4ZP1A 3HSSA 1ZMXA 3E2MA 3ADKA 2ECKA 3OM0A 4UTXA 4QJ5A 5LDHA 3F4LA 1XU7A 1Z74A 2JKYA 1ENOA 3ANNA 3PCTA 1X87A 3SBDA 3VJMA 1FFYA 3OC0A 3QJYA 3ZCUA 1SGWA 3FPCA 5C4MA 4E5NA 3LBYA 2R8BA 3WLMA 4KN6A 5A3RA 3MGCA 1HYGA 2W8BB 5CK5A 3ZCVA 3K4HA 5D6NA 5BRAA 1Y1LA 3O93A 4NVRA 4OP3A 3HO1A 4HB3A 4X91A 3ZIUA 5LMNB 4Z4RA 1GGJA 1HRKA 2F3PA 2LE0A 3IRVA 2YXLA 2XUAA 3JD4A 4FFOA 1I36A 4FHEA 3RLFA 1DTWB 4HXYA 1D6JA 4WLFA 3BS4A 2ZTVA 4WHMA 3AUTA 1KSFX 8LDHA 1CQJA 2IOQA 1ZH2A 2GEKA 2GEDA 2NU6A 1IJFA 1TL7C 3HVIA 1N5LA 2ZI4A 4H3SA 4B4OA 5HZAA 1QORA 3WMXA 1SM4A 4ZGGA 1ZD8A 3HBAA 5M2QA 1BXKA 5DZSA 4W7SA 3BSSA 2F00A 4AF8A 4OPMA 3DFMA 1H2EA 1CSEE 3HU5A 3RFVA 3AY3A 1E89A 3ZTTA 4EA7A 3PNBA 2BGWA 4TMWA 2D0OB 2IE0A 2WF9A 3Q3JB 4QGFA 3VHXB 3MM4A 3ZD6A 2V7EA 1G19A 2X8LA 2X6XA 4L74A 4XPIB 4MLZA 1O4WA 4GC5A 3Q8LA 3HN2A 3KRTA 2DKFA 1M7HA 1A9OA 2YWRA 2RGEA 3GA5A 3OLQA 4FE7A 5REQA 4ZI7B 2UUCB 1U3CA 4J0GA 4LWPA 4N0MA 4AJLA 1NNEA 4YI5A 2AXEA 4DARA 3WRYC 2IPNA 3CF4A 2QXTA 4E07A 4NSNA 4FB5A 4JNKA 2BT4A 3ZVNA 4ZCLA 4HN4B 3R3XA 3BGIA 4OX9Y 3W06A 1HWYA 4B7ZA 3QOXA 1HR0B 2ETVA 3CVUA 2PMWB 1TEVA 3VFDA 4TYYA 3TR0A 1KK2A 1F12A 5IBRA 2JFFA 3O8QB 1MC5A 3RS3A 4MITA 4PQGA 3WS7A 4B80A 4EG4A 2RG7A 3N05A 4B33A 4IJMA 1BN6A 4MIEA 3AP1A 4MYSA 1DXHA 2IOHA 2HJVA 2WD9A 5I9SA 4DM3A 4A36A 2H5LA 2QD4A 1LNZA 3FHJA 1BGXT 3EA4A 4LJ4A 4MJ7A 2V7GA 3E8SA 4TN5A 1S4MA 4X7RA 1QLHA 1HY3A 1S2MA 1WSWA 3SQDA 4YCSA 4KR3A 3HNRA 3Q3GE 1M33A 2MINB 1BQ3A 1OOEA 2ZYAA 5JD6A 3PTLA 3P9QA 1BVHA 5A4FS 2HSGA 1P4AA 5DX1A 3K0FA 1JG3A 3LDUA 3E22B 1P73A 4MQ4A 3CMCO 5F3RA 4U2EA 4DIUA 2IXFA 3PA6A 4QT4A 1F7UA 3OKAA 5JARA 4YK7A 1P1JA 1I2MA 2XB6A 1IATA 4ARZB 4BJHB 3B6EA 1BH6A 4A2CA 3DM9B 4FKMA 2K2WA 4B4VA 1IDOA 2X0KA 4AY3A 3UHOA 1JLHA 4ER0A 4FR5A 2XMDA 5GONF 4GOND 1VLZA 1GQRA 4FYPA 3ZGLA 4C0HA 5H81A 1N07A 2RCYA 4HS9A 1QGZA 1KVRA 2Q5OA 1WBJB 1NVKA 1U8CB 4IJUA 1PJ5A 2OBRA 3AY7A 4A91A 2BYTA 2H7XA 5YASA 1BE0A 4J1SA 3N0XA 4XSVA 2QGNA 2R6CA 5D1NA 3JU4A 5HWSA 2H29A 4HKTA 1D2RA 5A71A 3PGA1 1IUNA 3BJZA 4IV0A 3HJUA 3GUZA 1PP4A 2F7SA 4GE0A 1SUIA 2FR0A 3LA6A 4OF4A 5EJAA 4H60A 3Q7IA 4RH0A 1FXWF 2UYYA 1WOPA 3P8ZA 4JOCA 4PAOA 1M5TA 3EQ6A 1GTZA 3I73A 3SJZA 2ZQYA 2IDKA 2J45A 4S1PA 1A4XA 1YMQA 5GVSA 2G71A 4MYRA 4H3HB 3KKNA 1U2SA 3L40A 2IEYA 1VA5A 3JQFA 1R0WA 5G02A 3TZBA 1SXJE 5CAEA 2F1OA 3E15A 2HBZA 4NE7A 2LDXA 2VWGA 2XW6A 2H85A 3LY7A 4XD7D 5CP8A 4KR7A 3CLSD 2JIZA 2OYSA 1TW3A 2QDKA 3Q7EA 1D2EA 2N0SA 4YAEA 4KNYA 3NDIA 2FUCA 4BFVA 1Y6JA 1ZPDA 3E9NA 4V0NA 1P7WA 1N78A 4YAOA 5T5QA 4F06A 1I1OA 1E1RA 1IB0A 3IA7A 3RU3A 2X5XA 1V3VA 3NRBA 1I4OA 1ABEA 2IK8A 1WV1A 3L7AA 1KSJA 1R8QA 1W44A 1JTFA 4OPSA 4BP3A 5GZ1A 4QYSA 3ETCA 1QVFB 2DY0A 3MT9A 3HU3A 4L02A 4UEQA 3TCKA 1GFSA 4EW1A 3PFCA 2N47A 1NQTA 3HVKA 4HDNB 2RONA 4TQ9A 1E2IA 4A0SA 1IWOA 3ASYA 1WQ4A 1NVMB 1Z3CA 2B36A 3UCEA 2BPOA 2OORC 1IMJA 5J59A 4BRUA 3FPEA 3N1UA 2OHGA 2VF5X 3LDHA 3DE7X 4HDMB 1GYPA 2XBUA 4BDTA 1XPOA 1O97D 1PNQA 3Q8KA 1U28C 3PKZA 4C0JA 1JG6A 3MS7A 4Y0NA 2OV3A 2HGZA 1KJ9A 3GLIA 1Y1SA 3WAKA 2OXEA 3OX3A 3WNBA 4PONA 3WGLA 3VTAA 5CVVA 5D8DA 4YRTA 3U7QB 3DLCA 2JCBA 4ZICA 3G7UA 2EQ5A 4PZEA 4F8JA 1DDIA 3LHFA 2CMHA 5DGXA 4E2ZA 1PEDA 2Q5HA 2DTEA 4JYBA 1AKEA 1MAAA 4LX8A 1M67A 5K0EA 4HVAA 1NJ6A 1U0SY 5B1EA 1ENYA 2ZL5A 2HXYA 4FFLA 1CQXA 3RVOA 2OZKA 1TC1A 4WPGA 1ZUNB 2HA2A 3U4IA 3MYRA 3SYMA 4O4IF 1Q91A 2H51A 2I4TA 2OCPA 1LRKA 4L07A 3H2ZA 3IOCA 1V8PA 1UDAA 4B3JA 5JYEA 1V6CA 1TO1E 4CM8B 1K7XB 1SG0A 1X7ZA 4JUIA 1P5RA 1C8KA 4NZYA 3DDSA 5ALXA 3C70A 1DS6A 1E4YA 2BKAA 1EJ0A 3I9OA 3IB6A 5H68A 3S2SA 2J9RA 2AWNA 3FCCA 2PGOA 2ATVA 1CS0B 3K70B 3ZWXA 1A7AA 2XD4A 2KBEA 2F55A 1GPKA 4QZVA 2ZJZA 4G2NA 5CDFE 1YI8A 3EN0A 4Q48A 5F1YA 3V4SA 2CT8A 4CGZA 3S2YA 3TOXA 4MJLA 1B4DA 4DAEA 4BVLA 5L45A 5E6SA 1VHLA 5ERXA 4US0R 4BFTA 3CO5A 4TRJA 4FNMA 1PUXA 1E3SA 4YRJA 3X1YA 1SK8A 2XMRA 2J0VA 1JQJC 2B37A 5AIBA 2NXWA 1P9WA 2NU7B 4EVIA 1RC1A 1YHYA 3CNEA 4KXVA 5D3KA 5GV7A 5DMXA 6Q21A 1W5TA 4WFIA 4BZZA 1CE8B 3KV3O 1RLUA 2P0YA 2ERYA 3QVMA 1NV9A 3BTOA 2C99A 1JDJA 3IELA 2I76A 3A0UA 3DEHA 3OEHD 1EFUA 1VPLA 4MWZA 4NX2A 4CI9A 1KVTA 1MC8A 3PNPA 4BNFA 3S8YA 2PRKA 2WTBA 4LVOA 5AW9A 4C08A 3UMYA 1KIAA 1FFEA 3EUAA 1OHHD 1ZRNA 3AFNA 1KHTA 4UZFA 2VXCA 4MP8A 4OEHA 2QGGA 4OHCA 1R00A 5DNWA 2IHTA 5F2KA 3X2FA 4IG9A 4M1MA 4QPZA 1VPVA 1PWYE 4NOJA 5B55A 1NI5A 1AURA 2C2ZA 3CW9A 3HRKA 3RSQA 3ZZMA 3IAM1 1FSGA 1RYZA 4M8NE 3FCAA 3UTCA 1D4FA 3HY3A 1E2NA 1WHTA 3QUBA 2AW5A 2J3KA 5B64A 5KO2A 4X95A 1DTSA 1AUVA 3RT9A 3C2QA 2P77A 4C21A 1E1YA 2GN0A 4DCCA 5IYZB 1E1RD 1LZLA 2CNKA 1YBVA 1ZSVA 1SU6A 2W2LD 2J1LA 2IODA 4PZUA 3BX1A 3GD5A 5HE9A 3OPMA 3H0KA 4MQEB 3RQSA 1XA4A 1KC3A 1AQJA 2HWUA 1M1YE 3VPCA 3FMPB 4L16A 3EWSA 5IZ4A 2NQTA 1YCFA 3W5UA 3M81A 4J6EA 4Y2VA 2IU4A 3BXOA 3AP2A 5JIBA 1B14A 1NR7A 2Q6TA 1E63A 1CUWA 3O7MA 2I2BA 2OO5C 5FOTA 1DC5A 3ORYA 4BLRA 1ZJ5A 2CUTA 1EHIA 2PT7A 3E70C 1QBGA 1XNGA 2O8EB 3CC8A 2VQ3A 4M0UA 3WAGA 4NYMR 4QVKA 4XOUA 5ES3A 2F9LA 1YONA 3H9UA 3JD1A 3M6FA 2FV8A 2J3EA 1YB2A 3A6ZA 3AFMA 3IT2A 3PYXA 4KO4S 1JWAB 1SEVA 4OO3A 5JQGB 2I5PO 2BGLA 4FFBB 1E2JA 5JMTA 1R1DA 1E2LA 3Q39A 1NJSA 1W47A 2Q46A 4G8DA 4ZRNA 2FPWA 5EVJA 5JH7F 1W36B 1JECA 3H1BA 1ZNZA 3M70A 1RQ2A 1GTRA 3OFJA 3Q7SA 1RVDA 1IUPA 2CVOA 1S3IA 2F3SA 1J21A 4LW8A 1NN1A 1V47A 3OCCA 2NAFA 1YH3A 1N2CA 1DBQA 2JIZD 3A6JA 2CJXA 3IKTA 4AS1A 1XVIA 3H2BA 4MHTA 4QQNA 4XJVA 5A2QA 1AKNA 2C8KA 1ZMRA 1L0BA 5KOYA 1Z34A 2CHVA 4YRIA 1VKHA 2B6NA 2H00A 1ZI6A 1CR2A 2JD1A 1VTKA 3ISJA 3T54A 3K70D 2WDZA 3P4UA 1H22A 1X80B 2PK3A 1RAHA 5F4JA 3AR9A 1NYQA 3DNPA 3H9EO 2JIBA 4C0XA 1WBBA 4OQDA 1RLJA 2GD1O 4FDLA 2E1RA 5A4AA 2C31A 2N1BA 1W1UA 4W8OA 5TNXA 5LN1A 1TKAA 3QU4A 1CWUA 2PDAA 1GL6A 5DHPA 3GNSA 5IVDA 4BC1A 2P9JA 2FNAA 2JAHA 3FSRA 4WBNA 2O2ZA 3RPEA 4M38A 4C4AA 3RUIA 3W78A 3DWFA 3DG9A 3G0GA 2ZZNA 1KYQA 1GAXA 1GYRA 2FN7A 4UTNA 2PMDA 3UM9A 2OHIA 1S7GA 1QYVA 3IBGA 3ISVA 1DLJA 3NHAA 1AXEA 3TL2A 4LRUA 5HKKA 2QEXB 1KP2A 1SD5A 3DYBA 4DK0A 1X38A 3L1JA 3OZ7A 4PCAA 2DQSA 4BNIA 3HN7A 4K6OA 1E8DA 4RFSB 4NCAA 1RPJA 1USWA 1Q9SA 1PO7A 4PYLA 3HBJA 4KITB 3R7FA 2FUNB 3KD3A 4QOJA 4DCVA 5ITWA 2CL6X 2ADMA 5FWXB 2WSSA 3OD5A 4GLLA 5EXDA 2G77B 3OWHA 2QTGA 2FPPB 2IKQA 2Y67A 2ZWAA 4MARA 5AJXA 5IJXA 1CX9B 4F7DA 3GRAA 5GM2A 3ITNA 2JHPA 3EIXA 4P7BA 4B47A 5CLQA 2BI8A 4BAUA 1SC6A 2IPMA 1W87A 2KB0A 4G4GA 3U4MA 5IT5A 2ZI5A 1KF0A 4A26A 4OFZA 4MRMB 2ODTX 1TB4A 4L5YA 2C77A 3MTGA 1PG0A 5GJVC 4L4SA 1DSSG 1QYDA 4KDEA 4TT3D 1JYEA 4PY2A 4MA5A 3KEMA 5E6UB 2V55B 1H42A 3FGPA 1SCIA 2CXOA 3AILA 1Z45A 2HK6A 1L4LA 4ML3A 2XWQA 1P5ZB 4FGJA 1G1AA 4DG8A 4EZBA 4E70A 1W1WA 2RJOA 4MR8A 2WYWA 4M2LA 4CKWB 1SUAA 1FP2A 3WADA 2CLSA 4G1FA 1UDXA 5IYRA 2YW2A 2Z5FA 2ZBVA 4D3XA 4RCYA 4E30A 4H4EA 3OECA 5L3ZA 2X0DA 4URXR 1UJBA 1FB5A 1GOTA 5IFLA 1FFBA 1NT2A 2D7JA 2FPRA 1ZWLA 2NYAA 1P2UA 3G88A 4I9HA 4RGBA 1E66A 5F78A 4JB2A 2A5FA 1CP2A 2GRJA 3CVXA 2OUKA 3OM1A 4QGGA 2X76A 1UXKA 3EB9A 4RLFA 4QHSA 4WL0A 3WYDA 3KSAC 4RHXA 3NC1C 2NUPB 3Q0TA 3SLRA 3HCOA 4PPNA 3NOOA 1XZHA 1PWZA 1U1CA 1U81A 2WVJA 3OQJA 4HNHA 1U2DC 1GKKA 4K28A 1WV0A 4O25A 1H9AA 2P6PA 4MH0R 5FNVA 2PX0A 1FFAA 1UJ5A 1G3MA 1G8GA 1G20A 5FP0A 3H3FA 2G0NA 5DN6A 2EX0A 4TTSA 3WJ1A 4HUQA 5AI9A 2C94A 1BD3A 1U3UA 3AO0B 5IUNC 1T4DA 2MMGA 2G9RA 3FVRA 3LCUA 2FG5A 4UZEA 2Y0EA 1DAPA 3HZHA 4LOIA 3DAYA 4MAMA 5A5FA 1I9CA 2I03A 1OE0A 1PJ4A 3IMCA 3OZSA 4RKQA 3OZRA 4EYKA 5J3OA 1U9IA 3SHTA 3WRYA 3N0VA 3OI7A 4FFVA 5JI3E 2VPZA 2RGRA 4FYWA 5CLIA 2YIMA 1HE8B 3ZWDA 2F62A 1OBCA 3D6FA 4KQIA 4PBRA 4R9RA 4YACA 3H94A 3FGOA 3HVJA 3LLVA 4MR9B 2UYOA 2X42A 3H2YA 4ZODA 5ETJA 5K3AA 4CKBA 5L4LA 2XNDD 3QITA 4EHNA 2KQUA 3G5MA 2BEVA 4KGVA 1E4VA 2XWJI 4PAWA 4XLZA 1XZLA 2B2XA 4PYJA 5JH7A 4ZDKA 4EW2A 2O0MA 3OJCA 5H70A 3TXAA 3V2UA 4C7XA 2FFJA 1FJGB 1J20A 1JHQA 4Q1BA 4B3TB 3FA2A 3JQQA 4X8MA 2B3TA 2R25B 3Q1LA 3I3OA 1GILA 5E7QA 3X1MA 1YFJA 4LQLA 3DE1X 1PV4A 1RPZA 2G1UA 3Q41A 4QOSA 4Q4JB 2RGCA 2FN3A 1Y48E 3H65A 4QRDA 1E18A 2OBTA 1E6UA 5HBGA 4XFKA 2G09A 1K3TA 1MTZA 2J3DA 3K05A 4ZVPA 3TL3A 2D7CA 2VSOA 4EJFA 2V5UA 3UC9A 4XLAA 2B5WA 2YN4A 3LUHA 4PLGA 5HOEA 5D5HA 5IM4F 3EZ6A 1YB4A 2AD1A 2E2WA 1Q7EA 1ZN8A 4L0MA 1L7MA 4PRZA 3RRBA 5F98A 1ID8A 3WP0A 3W4JA 4J3FA 1M66A 4R16A 1VIAA 2KMLA 4P26A 2PSDA 1MNAA 1OROA 2ZUCA 2NZ8A 3FIUA 3N2ZB 4EY6A 3DOCA 1E7MA 2AMVA 3KZCA 1V3TA 2O2IA 1II8B 3ACBA 3ZCQA 3OCUA 1YZQA 1TI7A 5KYUA 4YJKA 3UJ9A 1DG1G 1JV2B 2H9YA 3SX4A 4ZAZA 4ZYVA 2WQ7A 4EUEA 3PUNA 2ZZMA 3AEKA 2I2CA 4LYEA 4KIFA 4F1KA 5B3AA 4MW4A 2IYOA 4MWCA 2YNMD 4KVZA 4LHYA 5CAEB 5AW7A 1UD4A 3A27A 4BV2A 2IVFA 1E5DA 4W5TA 1PD0A 1PLKA 2CEKA 3MB8A 3N2EA 4GICA 5IKXA 3CH5A 4BMCA 5DTEA 4PS1A 4NYIQ 3UV3A 4DV6B 1GU7A 2XB8A 2OY0A 3L0ZA 1JMVA 4JOBA 1JH8A 1H9BA 1GTJ1 3FHLA 3HWX1 5JATA 1FBTA 2ZR9A 2JGAA 1DJMA 4M7PA 1A76A 4IJWA 3HB4X 2VDOB 3WDSA 3D8RA 3MNFA 1DX9A 4Y67A 4DV7B 1I7DA 2C2HA 3WOVA 5DGCA 1ZGCA 4C2TA 1E6WA 1RQ7A 1XVAA 4D81A 4Z4HA 3OM9A 3P2IA 5AIAA 1C9KA 3H7AA 2NU8A 2GBPA 1I6LA 4PC3A 1IQRA 1YR6A 3NWOA 1U5BA 3F46A 5JZOA 1YR2A 4BO6A 2F1LA 5IZCC 3RVNA 2NW6A 4CFZA 1LA2A 3Q2IA 4QELA 5A3VA 2ZZEA 2BWJA 3WLHA 3JTMA 2G4VA 1N2IA 4O2BB 5CDUA 5LMCA 1R4NA 1P0PA 1RAIA 1JI3A 1Q7GA 2FUEA 4PO3X 3AUKA 4D9EA 1OGJA 2IF2A 4P4UA 3W6NA 1AUPA 1RZVA 2QTMA 3KB2A 4R5HA 5AXAA 4CM5A 1Q7YD 2J6HA 2G9QA 4OYRA 4CT4B 1N2XA 5CG2A 4TT8A 2J5KA 3CPJB 4KN8A 1JG7A 1T0BA 2ZB4A 1L5HA 2VZ9A 2DFVA 4PTLA 4HJXA 4DILA 3OE7A 3GFVA 4MKIA 5EQJB 3MC1A 1Z5UA 5K3FA 1J9GA 4OHVA 1EDEA 1A4RA 3JQ8B 5DHSA 2JLZA 1T2NA 1AA6A 2ID8A 2ZB7A 1XZBA 3PUMA 4FKBA 1GAEO 5FBQB 4BY9E 2F4NA 4MAFA 3QFFA 1U1DA 4BVJA 3A70A 3KKZA 4XN3A 5KX5B 3RYFA 1Q1BA 2FWIA 3J81k 3MWFA 4HN2A 4OP2A 2FHPA 2VQSA 2VTVA 1O0BA 3AM1A 1CJCA 2A2ZA 5L3SA 3QGMA 2QV0A 3LBAA 1JSRA 3QV2A 4EGJA 4ZZ1A 3ZVRA 2ORYA 4MWGA 1U7DA 2P68A 4IKEA 3TNFA 5KJCA 2LPMA 3VV3A 2Q3EA 5IMSA 3QG5A 4OA8A 1U9CA 3FBTA 4B46A 1YJ5A 2H4FA 3D8UA 4AYXA 5KREA 2GZHA 4P5PA 3DXZA 4O6VA 4UHEA 1SXJD 3FUTA 2GAOA 3QUQA 3EEBA 5E0KB 4A8JA 4WDRA 3TW6A 1YQQA 2CGEA 3L7KA 1P1KA 2NZVG 2H48A 2OESA 4W4TA 5KJ6A 1T2UA 4W82A 4X62B 2IS6A 1WP4A 3DOIA 1K7CA 3TBKA 1FVOA 1O96B 4RMGA 4RD6A 4KQXA 2AHRA 1QX4A 1Z6AA 2BLLA 4IXMA 4I55A 5A4JA 3NJRA 2XLCA 2GZAA 1QV9A 2A1TS 2P1ZA 3HLYA 4NPHA 4YTEA 5LA6F 4CL3A 4FMDF 5GAJA 4D42A 1R8YA 2EFCB 3AT1A 1A9TA 3JVIA 3MIIA 4FMDB 3DQPA 3ROXA 4BMNA 1XTZA 1QVAA 2AYYA 1B0AA 2QVGA 2OK8A 1W5BA 1QCYA 5DHTA 4JLVA 3U16A 1FTWA 1XALA 2WSMA 1V4VA 3KQOA 1MJNA 1UBGA 3NC4A 3DV0A 4FW8A 4MWTA 3WA6A 2VTEA 2AMLA 1K2VN 4F8YA 1LPOA 2Q5QA 5BO5A 1R5NA 3DJFA 3HJCA 1KXZA 3Q5DA 4P5DA 3RYTC 4DCJA 5H9WA 3FB4A 1G5RA 5JSQA 2F48A 5I3ZA 1G8YA 4EX6A 1QHEA 1ZOLA 3B89A 3JQPA 4RPIA 1IMOA 2EDAA 2QT1A 3OQBA 1T1SA 3I5UA 4IRMA 3OQVA 3SZGA 3SKBA 1OXUA 5F3WB 8MHTA 1XA0A 1XHEA 4RKFA 2QP3A 4YDSA 2E9SA 2B1RA 4UHBA 5TQ2A 2ZWVA 2PO5A 3CXUA 3CX4A 4ZQBA 2FEWB 2W6ID 3JPYA 3IIKA 4GRDA 2VBIA 1T5DX 4A8PA 2C1ZA 1J2EA 2C96A 2CVPA 2XSZA 3K9QO 3STVA 2KLHA 1ZUHA 3O31A 3OHSX 4JXJA 1J0BA 2WZCA 4MKFA 4ALKA 4X20A 1MG5A 5KX5F 3ITDA 2ZGVA 5LOVA 4QTYA 4DV3B 2OP0A 3OJ0A 3RSFA 3R7DA 5FFMA 2F67A 4DLAA 3RARA 3UJAA 4BYGA 2ECOA 3NEJA 2PN1A 5K4GA 2OFXA 2EFJA 2ORIA 2W6JD 3EARA 3LE8A 2EFEB 2FFQA 2RCNA 1KZ9A 2COKA 3DVAA 3H2SA 3KVVA 3C3XA 3M1YA 3LWNA 3MRXA 4L5AA 3W7AA 3QE3A 1ESCA 2R97A 3NHSA 5EYPB 1Z0SA 2OILA 5D7BA 5FJJA 3CP2A 3PFNA 3RAGA 1LBQA 4RTKA 4Z4VA 4AU1A 1QP4A 1BH2A 3PXXA 3I42A 1WLSA 3WLEA 2RGDA 3E8MA 2XYPA 4XNFA 1PSWA 4TXHA 1AQUA 3ENZA 1ORRA 3AW9A 4L57A 4ND1A 2O2XA 2RHTA 1RXCA 4N82A 2OT3B 4XKVA 1RRPA 4UXHA 4L51A 5E38A 3CFYA 4CU2A 3M6LA 3SX2A 3UKJA 1Y0RA 3L7BA 2PQ0A 4WUTA 3TZQA 2O8BB 3SICE 1YIOA 2DFTA 3CZCA 2Y27A 4V1CB 2WYOA 4JP1A 4JB0A 3HB9A 3EFHA 3HGTA 4RAQA 4RKWA 4A5OA 1IIBA 3NLLA 3RJ5A 3E7XA 4BECA 5IXYA 3SWWA 5FTJA 3HBNA 2ZRJA 1QO7A 4PC1A 3ZQJA 2ZDHA 1QHSA 2D59A 4KQEA 2ERXA 4JC0A 3TVDA 3PRYA 1NVBA 5LBIA 4IVPA 4BWGA 2OG2A 1RYHA 4JP5A 5F23A 4UATA 1KYTA 1IXRC 4I4LA 4ODIA