4M38A

Crystal structure of trypanosoma brucei protein arginine methyltransferase 7 complex with adohcy and histone h4 peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
334
structure length
334
Chain Sequence
DAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKSKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDIPRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants for the Strict Monomethylation Activity by Trypanosoma brucei Protein Arginine Methyltransferase 7
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase/transferase substrate
molecule keywords Protein arginine N-methyltransferase 7
total genus 106
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4m38A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m38A01
5EEHA 4HSGA 2CWWA 4PNEA 3BGIA 1KPGA 3T7TA 2NYUA 5EPEA 1G8SA 1RI5A 3BUSA 3G88A 2CKDA 3I64A 5FHQA 4V0QA 5DM0A 3T7RA 4A6EA 3HP7A 3H2BA 3KHKA 4QTTB 2AOTA 4F84A 4RV9A 2NP6A 3GRYA 3KPWA 4P7KA 3DMFA 3BGDA 4DA4A 3I5UA 2ZLBA 3VYWA 1R6AA 3BKWA 5GIOE 1KXZA 3DLIA 2G70A 3ELYA 4KIGA 5C9ZA 1UIRA 3TKYA 3X0DA 5CUQA 5DRYA 3FPJA 2OB2A 1WY7A 4IV0A 2I62A 4U7TB 2ADMA 4AZSA 5KYGA 3FUTA 4YMGA 4Y2HA 2BZGA 1T43A 3A7EA 5C1IA 1JSXA 3JWIA 1VQ1A 4FS8A 3G2MA 2EJTA 3DH0A 3HCDA 4MIKA 4PINA 4AUKA 4E30A 4RX1A 4PYJA 2VDUE 2ZIGA 1BC5A 5HIIA 4YV2A 2NNWB 3GGDA 1X1BA 3QOWA 2PT6A 4FZVA 5LQAA 1O9HA 5DX0A 4IWNA 4WXHA 3EVAA 1QYRA 2LD4A 3KQPA 4ER3A 3FYDA 3FUWA 3NTVA 1F38A 1X1AA 4P7GA 2CL5A 4PIPA 3KQYA 3ELDA 1JG1A 2DPMA 2PSSA 2AN5A 1R8YA 1O9GA 2Y1XA 3CVOA 1VL5A 1WXWA 2BM8A 3SSNA 2BR5A 3SXJA 1P1CA 4EQZA 5LQUA 5DWQA 2F8LA 4MTLA 2EX4A 2FPOA 2CMHA 2WA2A 4GOND 5EEGA 1N7JA 2VDVE 2ZBPA 1VBFA 5CVUA 1L3BA 2XVAA 3BXOA 3BWMA 2ZSUA 3GRUA 3QV2A 2GLUA 1IM8A 3P2IA 3HCFA 4CTKA 2Z6UA 1EAMA 5K0NA 3UA4A 5EZQA 4OBXA 1VPTA 3D2LA 2OPBA 3G5LA 1M6EX 2A14A 1WG8A 5P8WA 3KQWA 1FBNA 3A26A 3AY0A 2GS9A 2PWYA 4PGHA 5E1OA 3MTIA 5GM1A 3EPPA 5EKXA 3B3GA 1UWVA 3UJCA 3RW9A 4DMGA 4QQKA 3HVIA 2HR1A 4HGZA 3MAGA 1RJGA 2VP3A 2PXXA 2C7RA 4P58A 1XCLA 4JXJA 1BOOA 4B17A 4HC4A 5HOQA 5K0JA 1I4WA 3UFBA 4C04A 5H02A 2UYOA 3U81A 4ISCA 3BT7A 1NBIA 2JHAA 2IIPA 4EMSA 3MERA 4QDJA 3UJ9A 3E7PA 1DL5A 3ER9A 3PS9A 3G7UA 3TM5A 5K01A 3TR6A 5EMKA 1KP9A 1NV8A 2ESRA 2UYQA 3E23A 1EJ0A 1SUSA 2JHPA 3GWZA 5DXJA 5E9WA 3MTEA 2PV0A 4QPPA 2ZZNA 5E8RA 1F3LA 2OBFA 4X41A 2B2CA 3I58A 2BM9A 4ER0A 3CCFA 3MCZA 2VS1A 1FP2A 2JG3A 4O29A 5FULA 5DLYA 4GOLD 2ZBRA 1PJZA 4PYQA 4RTLA 5EMLA 1SVUA 2AOWA 3EEYA 4RTPA 4AZWA 4HGYA 3G8AA 2P8JA 3T0IA 4C4AA 3A27A 4RVHA 5FTWA 5LQKA 3CJTA 3OFJA 3CKKA 5DPMA 5DSTA 5E2AA 3R9XB 3LBFA 2G8NA 4R6WA 4PYKA 3SMQA 4PYIA 3HCBA 8MHTA 3JWHA 2WA1A 3GU3A 4PONA 4RTKA 3KPJA 3TM4A 3PX2A 3G2QA 3P9IA 3TPZA 3B3JA 2GA9A 3PFGA 2AOVA 2JJQA 2EJUA 5FQNA 3KR2A 1H1DA 3EGEA 3M6VA 3RODA 5BXYA 2PLWA 5GINE 3HVKA 4CTJA 3A25A 1WS6A 1RI1A 3CC8A 4CKBA 1YZ3A 1JQEA 3KQQA 3WSTA 1YB2A 5EIFA 5E2BA 3SGLA 4F85A 5EMJA 3IHTA 1ZGAA 1FJXA 2C7QA 2ZCJA 1JTEA 4Y30A 3M6WA 4PCLA 3KR1A 2O0LA 4GBED 2JH9A 1BHJA 2P3QA 3BGVA 3DXXA 4XUDA 1DCTA 3NWBA 4P7FA 4CKCA 1OR8A 2P3LA 3O7WA 3HNRA 2PKWA 4KVZA 3HCAA 5CIYA 2B25A 1SKMA 4HG2A 1QANA 2OKCA 2PY6A 5KS2A 3E8SA 3LCVB 3FUUA 1SQFA 4MWZA 1D2GA 4UOEA 3EEOA 1R18A 4DCGA 1G6Q1 2ERCA 4YUWA 2H11A 2R6ZA 1JG3A 2GPYA 1MHTA 2B9EA 3L8DA 3P97A 2KW5A 4EVIA 3FYCA 3E05A 3KQOA 3ER8A 2PX4A 2QRVB 2WK1A 2XYQA 5K8VA 3UBTA 4R8RA 2IGTA 3LDUA 4DQ0A 1RI4A 5FCDA 2XBMA 3REOA 4YUYA 2YVLA 4RTJA 2Y1WA 1P39A 1X1CA 3P9NA 4QPNA 4EKIA 2FK7A 2ORED 5CVDA 1ZKDA 4H0NA 4GEKA 5ICGA 1L1EA 4R05A 1JG4A 5BP7A 1M0EA 4YUZA 3ERCA 4KRGA 5DTRA 2YUIA 4C06A 1FP1D 2Q41A 3A7DA 4K6MA 1D2HA 2OZVA 3GXOA 3MHTA 5FA8A 2JH8A 3HVHA 1NW8A 2OB1A 2AZTA 5T6BA 3R6TA 3LKZA 2XVMA 1O54A 3JWJA 1D2CA 1X19A 4CXMA 4E2WA 1NW7A 4BLVA 1YZHA 4KIFA 2GB4A 4Z2YA 2IFTA 5HEKA 4YUVA 3LKDA 1KPIA 2VZ9A 2QY6A 3IEIA 4E32A 4RTNA 1VP9A 2IBSA 3Q7EA 1RJDA 4ATNA 1NKVA 3B89A 3DP7A 3KPYA 5E8JA 2AOUA 2AVDA 1WXXA 3KQMA 2XYVA 5EKUA 1L3CA 3UA3A 1VLMA 5CVVA 3VC1A 4FT2A 4POOA 4OQEA 4BY9E 2DULA 5K03A 4DM3A 1M6YA 3THSA 4BLWA 4AX8A 2PXAA 7MHTA 2PT9A 3O4FA 1DUSA 3PLAE 3DMGA 3CBGA 2ZTHA 3LL7A 1XVAA 5KVAA 3DR5A 1QAOA 1U2ZA 2IH5A 1Z3CA 3PTAA 4FGZA 5F2KA 3GO4A 4G56A 4EK9A 5DM4A 1WZNA 2OO3A 3UJ8A 3CJQA 3C3PA 5LR6A 5JUWA 2FRXA 3FPGA 1I9GA 3BWBA 3I53A 3KQVA 3ID6C 2I7CA 3FTEA 5CVJA 3GRRA 3NWEA 5DXAA 3C3YA 5CCXA 4PIMA 3TKAA 5GIPE 1NE2A 1FPQA 4QTUB 4RVGA 4C05A 1TW3A 3EMDA 4OX9Y 4RTRA 2OY0A 3NW9A 2QM3A 2PBFA 1R8XA 2AS0A 3LPMA 3P9CA 5CM2Z 5EOVA 5MHTA 2O57A 5EIWA 4PYLA 5EVJA 1ZG3A 3VSEA 1KYWA 3DXZA 3P71T 4RTQA 2AR0A 3OE4A 2E5WA 4PGGA 3FPFA 4C08A 4M37A 1JTFA 1XDSA 1L9KA 4X1OA 5E1MA 5F2NA 5LQNA 3F4KA 1AV6A 2R3SA 2IDJA 3LDFA 3AXTA 2YR0A 4M38A 3FRHA 1KR5A 3LCUA 3MCTA 4MQ4A 2PX2A 1I1NA 3M6XA 4QVKA 4M36A 3LCCA 4CKEA 1EG2A 1Q0SA 1SQGA 5GP1A 4BLUA 4L7VA 1Q0TA 3EVDA 5DX1A 4NECA 3TFWA 4GUAA 5HILA 4BP3A 1RJEA 3DULA 4RSRA 5KQSA 2HTEA 4AZVA 5DX8A 3DLCA 3KKZA 5K0GA 1NW5A 2FCAA 3G5TA 2ZW9A 5FHRA 2B3TA 3LECA 1XCJA 1KYZA 1RI2A 4PYNA 2ZVJA 5C0OE 5K0LA 4GQBA 2C7PA 3TLJA 3DUWA 5T67A 1ZHFA 5CCBA 5CD1A 3OZSA 2ZZKA 4WVLA 3EMBA 5GM2A 3HA5A 1SG9A 4C03A 3AJDA 3O31A 4OA5A 5DSXA 3I9FA 5U4XA 4GF5A 3MQ2A 4PYMA 5D1HA 2PGXA 3FPEA 3FTCA 2ONZA 3HA7A 3M6UA 5E9JA 2P7IA 1UFKA 2EG5A 3C6KA 3HCCA 4FR0A 5ICEA 2OYRA 1INLA 3TMAA 3G89A 3V8VA 4MHTA 5KQRA 2I6GA 5LQRA 2CMGA 3IYLW 4X63A 2FHPA 2V7EA 3ANXA 3HM2A 4YMHA 5K05A 1AQJA 3B7PA 3BWYA 3B3FA 2BH2A 3PVCA 3OZRA 3UJ7A 2BR4A 3NDIA 3ORHA 2ONYA 2NXCA 3R3HA 3SM3A 2VDWA 3TOSA 2IH4A 3GJYA 5T64A 1NW6A 4HTFA 3UJDA 4RYLA 5FUBA 3P9KA 3MB5A 1B42A 4HH4A 4RVFA 2P41A 5HIJA 4XUEA 2PJDA 2C7OA 5HFJA 4C07A 3OU7A 3DMHA 3EVBA 2NXNA 1KPHA 1ZQ9A 2ZWAA 5G02A 3OU6A 3LSTA 2P40A 5LSAA 3OFKA 2O05A 3QOXA 1VE3A 2AOUB 3UJAA 4E33A 5ICFA 4LECA 2ZFUA 1G8AA 3HA3A 1R74A 4CWAA 5FWDA 2NXJA 3AXSA 3EVGA 3GRZA 3PX3A 5DTMA 4DF3A 4RTMA 3EGIA 1Y8CA 2HV9A 4LG1A 3FTFA 4DCMA 2GH1A 3NJRA 4RVDA 5K0FA 3P2EA 3GDHA 3DTNA 3Q87B 3CGGA 3R24A 5B1SA 1P1BA 1NT2A 3UWPA 3B5IA 2P35A 2FK8A 3FTDA 1KIAA 2H1RA 3ELUA 3FUVA 3OU2A 5ICCA 4X60A 3GRVA 5E1BA 3JWGA 4PCAA 3NVMB 5FWAA 4ER6A 2AN4A 2YXEA 3OZTA 4GC9A 3UJBA 4XUCA 4R8SA 1JQDA 2IBTA 3PT9A 2P3OA 1YFJA 3UJ6A 9MHTA 3EVCA 5K0CA 1SUIA 2HWKA 4QVGA 5ERGB 4IKPA 2NP7A 2GAFA 4HRAA 3HCEA 2QRVA 2Z6QA 5CVEA 2YX1A 3KQTA 3LHDA 4RWZA 3THRA 2AOTB 3FZGA 4GOOD 2AVNA 4ZTBA 4YV1A 2G71A 1G38A 2HNKA 4FT4A 5LQCA 2V74B 3HVJA 5DRTA 4LWPA 3RIEA 4E2XA 5D1NA 5DTQA 1EJ6A 1JQ3A 3A4TA 5K09A 4E2YA 3UZUA 3V97A 2PXCA 3G2OA 1NBHA 5F2OA 2PX8A 3C6MA 3S68A 3EVZA 5EGSA 5K0BA 1R00A 5E9QA 5FA5A 1VP3A 3NDJA 5EZSA 2UYHA 1YFLA 3EVEA 4FSXA 2HMYB 1AF7A 1XDUA 2FYTA 4BP1A 2JHCA 1NV9A 2N47A 1HNNA 5IH3A 3HTXA 3G2PA 4PWYA 4OQDA 2BR3A 3G8BA 3LBYA 1HMYA 1PRYA 2YTZA 5EC8A 2NXEA 4FSDA 5HIKA 5K0EA 1VIDA 2QYOA 3EVFA 3KU1A 1P91A 1JSZA 2YXDA 4A6DA 4ER7A 1L3IA 1BKYA 1XDZA 2YXLA 4GC5A 2ZBQA 3GIWA 1KHHA 2IPXA 3LX6A 3EGVA 3FRIA 1XJ5A 3BKXA 4U7PB 3K6RA 4RTSA 4LWOA 1AQIA 4AZTA 1N2XA 3HEMA 2XYRA 5JR3A 2B78A 5EHGA 1G60A 2OXTA 1IY9A 2PVCA 5GOZA 3SSMA 3DOUA 4OBWA 3IV6A 3M33A 3R0QA 4KW7A 1N7IA 1QZZA 2K4MA 2ZZMA 4F86A 2UZ4A 1MJFA 1EQAA 1XTPA 4GOMD 4V0RA 3SX0A 1JG2A 3BWCA 5FQOA 4PYOA 4YUXA 3KPVA 4ER5A 3C0KA 1G55A 4DKJA 2PX5A 2ZULA 3P2KA 4OA8A 5E1DA 3BZBA 3ELWA 2P7HA 1ORHA 1QAQA 5EMMA 3AWIA 2IDKA 4XCXA 3OPNA 5HZMA 3CJRA 3PB3A 3TRKA 3LGAA 3VC2A 3KR9A 1JR4A 2UYCA 4YV0A 4E70A 4IV8A 5EG5A 4E2ZA 4HTFB 3GCZA 2AN3A 2AOXA 3P8ZA 5HIMA 10MHA 5IKMA 4M7RA 1TPYA 3DXYA 3ME5A 1RI3A 5EHIA 3NVKI 4X61A 2I9KA 2YQZA 1XXLA 2O07A 3OE5A 3SSOA 3T7SA 5LQJA 4RTOA 2Z6AA 3KQSA 4EKGA 5GWXA 1RJFA 2G72A 3TQSA 5M5BA 5BW4A 1QAMA 3M4XA 5BW5A 4E31A 4KDRA 2QE6A 3SR4A 1NW3A 3MGGA 4QDKA 5EQJB 4KDCA 4R6XA 4KWCA 3GNLA 5DM1A 1TW2A 1X1DA 3FPHA 4P7JA 3K0BA 1ORIA 1YUBA 5DM2A 2G1PA 3LDGA 3NMUF 2ZIFA 1EIZA 3KPUA 1IXKA 2EFJA 2PWPA 2O06A 3KR0A 3M70A 1ZGJA 5FADA 2ZIEA 3OCJA 2P1DA 3FUXA 4QQNA 1V39A 3SVZA 2H00A 4DZRA 2IP2A 1YF3A 4FP9A 5DT2A 2IH2A 3PFHA 2ZWVA
chains in the Genus database with same CATH superfamily
1OV6A 3U4GA 4TXNA 4JXZA 2QRJA 4YYZA 2DOKA 2GJAA 2J5XA 3BGIA 4MKXA 2GERA 3WDSA 4E03A 1DQYA 2X0EA 1HFKA 1R0BA 1VB5A 2VAVA 3P1JA 1I2CA 2Y77A 1L5SA 5EN4A 3X2EA 5FHQA 4D4JA 5DM0A 3O03A 3HY4A 3C3MA 2G9ZA 3S2GA 4UEWA 3D0QA 3H2BA 4QTTB 3T8YA 4KWEA 3WMGA 4C2TA 2P5UA 3L1IA 3DMFA 5KC9A 3AFNA 3NT4A 4K5QA 1X38A 5B2ZA 3D2CA 1R9JA 3GJ4A 3VA7A 5KNCH 3QEAZ 2HCRA 2G63A 1T36B 2G06A 2WPDA 5D51S 1VPDA 2HSZA 3O4GA 3DONA 5DRYA 5FFMA 5HTKA 2ZBDA 4B82A 4HNUA 1DKQA 1E5TA 4QYSA 2BBWA 4BJ6A 4YJ3B 2CHUA 3QLJA 2HCBA 2DHRA 3KTFA 4J0DA 1ODSA 5AJXA 2FWBA 5J63A 2C3MA 4QFCA 5JY1A 5C1IA 1X9HA 1R4MA 1EUCA 4I19A 4QPDA 1Z45A 4TKUB 2ERXA 2QWXA 1DAFA 3KOOA 4MA4A 3FOZA 1E5QA 5AUPB 2WF7A 3SXUA 3QTTA 3C5CA 2HHLA 4IQGA 4P08A 3F90A 5TX7A 1NP6A 4PLCA 1SB8A 1P80A 4KNVA 3ZWAA 2PE5A 4R2XA 1L8OA 4KN5A 5TVGA 4C4SA 1B0ZA 1QP8A 2W6QA 5IVKA 1HK7A 4EJ6A 4DJTA 4HO1X 2FPGB 5C7YA 1M72A 2I4NA 3ZDDA 4P7GA 4MDEA 3RVSA 3LKBA 2JHGA 1JG1A 2O0MA 3MEQA 1Z5NA 2RONA 4MWBA 1RC0A 2Q1YA 1UWCA 4WESB 1WXWA 2ZRJA 5ALOA 1JHXA 3W9UA 1KEWA 2CMHA 2XOKA 1V9LA 3CT4A 1A3CA 2V6FA 4YMHA 3ENVA 4D99A 3KVRA 8LDHA 2X2FA 4CTKA 1U7UA 4F6LA 1U4SA 3P2IA 3GUZA 4NBNA 5DULA 1M1YE 3QENA 4WZAE 2WVHA 1ZNWA 3MJRA 4OQQA 5DN6A 1U3GA 3D2LA 3GK3A 2IGBA 3CBQA 1R16A 4INAA 5D3MA 3UGKA 2YXBA 2BVNA 2W48A 4P0TA 3Q7IA 5FFFA 1VCMA 1TUEA 1X9IA 1Z6YA 2REBA 3GMSA 5EE9A 2VDJA 4HGZA 1IZ8A 2PUJA 3DE4X 1EFDN 2DLNA 3TH5A 3ZGZA 4LHSA 4OGGA 4OGFA 5HQ3A 4ISCA 4WLUA 2D2VA 4XEUA 5DISB 4NULA 3WV4A 1NBIA 4CETA 1I3KA 5JYEA 5JJCA 1Z13A 5F5LA 2I6FA 3LRXA 3OCYA 1PTJC 5JHHB 2R1ZA 3PS9A 4CM4A 1Z4KA 3QF4A 3PIIA 2IOYA 3T0FA 5EMKA 1KP9A 1WO8A 4P81A 4G81A 3QPVA 3WLHA 3H86A 5DSZA 3K09A 4AF6A 4IIXA 3RIXA 3ZDEA 1LFAA 1EIWA 4YXFA 3I01A 4ER0A 4XTCS 2H51A 3K94A 3KYBA 3PDIB 2JG3A 3WQBA 5AJHA 2Y0PA 3RJ5A 3ENWA 2PX6A 1QFSA 1PZEA 2WJ3A 3ANYB 2DWPA 2Y1CA 3U31A 5KREA 3KQKA 2EKBA 1J70A 1ZAKA 2GVDC 4IXWA 4X90A 2EXXA 1UINA 1PEKE 3DA8A 2VXCA 1PJSA 4O3FA 4WHMA 4ZICA 1Q57A 3A27A 3MPOA 1K2WA 5ALMA 2IHYA 2H1CA 4Z8YA 5BNTA 3D5QA 5KVSA 2GZAA 2YJNA 3TTVA 2DSNA 4O6VA 5IT9A 4WN9A 2IHTA 1PR3A 1YKSA 2CVPA 1PR0A 3PUKA 3P2JA 2J31A 1XA4A 5I4BA 1YQXA 4NH4A 4WZBB 1SIBE 3O8OA 2CDAA 4UREA 2L18A 2Q27A 3I6ZA 3V9PA 4DAOA 1U98A 2NNLD 4UHCA 1I4DD 3QQPA 3EGEA 1WSWA 3I05A 2GBFA 3W6UA 1RI1A 3GZNB 3R4VA 1ZM7A 2Q8NA 3HB5X 2OXIA 1OGIA 1N4DA 2WF9A 1H9AA 3TQTA 2GHQA 2C3PA 2XWBF 3PPIA 3WK6A 4B80A 4PQFA 1S8OA 2H2GA 4BQQA 3EPHA 2L0XA 5BSRA 5D01A 1B8VA 3QLTA 3BGVA 3F98A 4FZRA 1KFEB 3ZY6A 1K86A 4CIVA 1QCZA 5LKRA 4G0WA 3BJEA 1OR8A 2IYAA 4IX9A 5NULA 2ZI6A 1F48A 3A0RB 5HW0A 4PZLA 1H2HA 3OIYA 2FEKA 2ZZNA 2WFMA 2BF4A 1DG3A 2PY6A 1H8HD 1M2NA 1MH1A 2BFFB 2P6UA 2X3YA 3H9QA 3HSKA 3LCVB 4B76A 5JJLA 2P2DA 4XDYA 1EK2A 4Y1RA 1J1IA 3ZCQA 4IKEA 1LF0A 3PXXA 2H11A 4J91A 3EZNA 4NABA 3FMPB 3H65A 3AVTA 3PPXA 2YWHA 2RGGA 3N0VA 5K3BA 5JQGA 4A0GA 5L3QA 3AP3A 1NONA 3L8DA 3R3ZA 3R44A 2O0KA 5FEUA 3KQOA 4TVSA 1ZMBA 2RH5A 2XKJE 3DNPA 3SYLA 3WGZA 4BFUA 1VTKA 3GLTA 1ULHA 1NQWA 5C7LO 4QKQA 3ESRA 2A5YB 1NFQA 1ZYUA 4JITA 2GX6A 3W05A 4QARA 1TA9A 5JSUA 4J07A 1E6LA 1MXHA 1ZN9A 2CDRA 4J0IA 4LE2A 3ETEA 3GA5A 5AHRA 4W5HA 2G8LA 4Q6BA 2P68A 1OFUA 5ALPA 3RSSA 5IJ9A 3PGKA 4CKXA 2WJVA 3ROKA 1MX3A 1PJ8A 3EH2A 1JALA 5CDUA 1QHHA 4HZIA 2VRBA 3P19A 1WVMA 3JRNA 3P0HA 3Q7PA 1NC3A 4QODA 4WW0A 2VA8A 2VP4A 3U19A 1OI3A 2YC4C 2DC1A 2JFPA 3QPBA 4YROA 1M2EA 3LKDA 1KPIA 2R4TA 1P31A 3KEQA 4LS3A 3UGQA 1JVSA 4RVOA 2FW7A 2KPOA 2LV8A 3LOPA 2MINA 5DK6A 1N5KA 3G0BA 4FE3A 4GUDA 4TKMA 1XPUA 2J9FA 2DUMA 3GAMA 5I9LA 4D3FA 3PHGA 5JI2E 5I7OA 2RCYA 1SBNE 4M83A 5CA1B 4Q37A 4MRPA 1H2ZA 1RLTA 3BZUA 3UUWA 3UA3A 2GUWA 1QH1A 1I7LA 5E7JA 1J2UA 2YMQA 4JAVC 4NCAA 2B4RO 3MINA 5I9BA 3UB3A 5BVGA 3AZQA 2QL9A 4OB6A 1TU3A 3CVVA 3ZU2A 1DC5A 3ZZNA 2AJCA 2BGLA 2YHBA 1AM4D 1VRVA 3TECE 4EGAA 2YN4A 1VMDA 5AKGA 5AVSA 1E63A 3N2LA 4FB4A 1E79D 1YNOA 2VDKB 2X1HA 2OYCA 1MPTA 2IHVA 5DM4A 2QBYA 5H4GA 2BFBB 1RRKA 3I2YX 4HZGA 4MQMA 5DHAA 5CFZA 3FPGA 5TQ2A 2FP4B 2PUBA 4BAGA 3SQLA 1JQAA 2Q5HA 3A6EA 4FHGA 4B3RB 3M1AA 2Y67A 4LKOA 4JP1A 3BAFA 5CPFA 2OO5C 3NW9A 1GNRA 2HV8A 3UB4A 4YBZA 2FSSA 3ZQJA 3AEKA 2OV4A 3CZRA 3RIYA 4ROTA 2FR8A 2Z1DA 3W4IA 1N1DA 3LZDA 2ZRAA 4DM4A 1K6MA 4RZ3A 1W29A 1Z9BA 4OG2A 1W44A 2V7PA 1FXWA 4MPDA 1K88A 4ZT4A 3DXZA 4YS6A 4QOSA 1NU8A 2K2WA 1R0YA 3UK1A 2QTFA 2IKSA 4DXHA 2PUGA 3N8IA 4DCNA 3BA1A 2IZ0A 4C08A 4X1OA 1U0EA 1WMDA 2WJWA 4NQRA 4XX0B 4FJ1A 1B7GO 3FRHA 2FEWB 2C4MA 1N2HA 3PKJA 2XT6A 4JOCA 4MS3A 3LUBA 4RGQA 1UKZA 1A69A 1KEUA 3Q8XB 1L4UA 3R6DA 4Z0NA 3UT0A 3OQ6A 3G59A 3LPLA 1I30A 5CNKA 2VJQA 1L7XA 1PGNA 3P9XA 4PRZA 1IMJA 5CBKA 1W88A 5DYTA 3VR6D 3ZLJA 3B3QA 2ZW9A 1G6KA 1SC1A 2YS7A 3OA0A 4FOLA 2XTAA 3T4UA 3V80A 4EO9A 5ESWA 4PU0A 4GQBA 2H3EA 3TLJA 4BVEA 1GXSA 5EYPB 4CN9A 3GHYA 5CD1A 1SPBS 3MIZA 4WVLA 1NHWA 1U2QA 2FW1A 3W0LB 3RUPA 3DHEA 4F4HA 1QE3A 5H59A 2IHZA 3ZCRA 1BS9A 2V55B 3EXFA 5D1HA 1LPNA 2PGXA 4NPAA 2GBLA 2H1LA 5KDOA 2BKXA 4P0QB 1G7CA 4Z1MA 3TNLA 5JTTA 3DAYA 1P8JA 4I99A 3GD5A 7AT1A 1NNEA 5A5FA 2CUZA 4BFZA 1GVNB 4JELA 2VQSA 5CX4A 1GCAA 1H5NA 4OP1A 4F2PA 4KMMA 4NY1A 3H0EA 2C57A 2WFZA 1X77A 3PUYA 2PGNA 4UQPA 4DB2A 3MYRA 3PVCA 5FUXA 3TRJA 3HC7A 1KZYC 1EDZA 3DHYA 4RHUA 3UTDA 2HU2A 3VZDA 4C89A 2IH4A 4GZLA 4DLYA 5REQA 1GG2A 4A10A 3T61A 4AU1A 2Q0XA 4MKHA 1BROA 5JZ9A 1UXOA 3P9KA 3W8DA 3THYA 4A9AA 3ZHXA 4XUEA 5DYWA 3SMVA 1NQUA 1G2OA 3K9HA 4PBTA 4QXMA 4D46A 3FZNA 1T9CA 2QNIA 3DMHA 2WIJA 2ZOSA 1YB1A 4BOYA 4EI7A 4LDAA 1W7AA 2WJZB 4YCDA 1ECPA 3D3KA 2AOUB 2YH2A 3A10A 2CNOA 3WYAA 1LZLA 2E6KA 2R4QA 4II2A 4NG5A 3RREA 5AVOA 4WN9B 5EJ9A 2MYPA 3RHSA 2JH3A 2HV9A 3DTTA 3FTFA 3NJRA 3O6VA 3EA5A 1C41A 2GEVA 2XW6A 4ZOLF 4ZO8A 4XJVA 3OZCA 4GWGA 1Q17A 5F5NA 3A9RA 4UHEA 2VBGA 4ETNA 4PCAA 3WWCA 3WE7A 2AN4A 5C32A 4DR5B 2JIQA 2Q2OA 5LMUB 4AJOA 3WXBA 2FZVA 4M4SA 4I1SA 3NI2A 5F3WB 2NU7A 4F6CA 4F8JA 3VX4A 3ZHCA 3L6OO 1SQ5A 2JJ8A 4H3HB 2PN1A 3LX5A 2IYYA 1KZ1A 1DKUA 3LYHA 3THRA 4GE0A 4TYNA 1NJ1A 4J0HA 1CYDA 2O8DB 4JU8A 4KX5A 1ESMA 1Z0IA 1TF5A 4JLUA 4RACA 3RIEA 1FTSA 1A95A 2VP5A 5D1NA 1R1DA 3WHIA 4MX8A 2XD9A 3ODGA 3NANA 2AD5A 3ITEA 3UZUA 1UBRS 1X7ZA 3Q9SA 1M1UA 1P4HA 2GBCA 4ABTA 3T52A 1Y7HA 1IWBB 2R66A 4IHJB 5BWMA 2JBAA 3JWEA 2HK7A 2NO0A 3GLIE 1Y9EA 4R81A 1ZC4A 3ETDA 3T4PA 3VR5H 3PEVA 4TMFA 1NOJA 4JQSA 4QREA 1D6NA 4N3NA 4X7PA 4AQ7A 2PJRA 5B1IA 4G5HA 4JC0A 4RFSA 1DJQA 1KYXA 2NXEA 4ZI3A 1JJAA 8OHMA 1G9TA 4HGQA 4MVJM 4J9UE 4OHWA 3NHYA 3TD2A 1L3IA 3IV7A 4RQAA 3P0FA 4TXMA 3U9LA 3MTDA 3RSGA 3UC5A 3QELB 1KKUA 3UHPA 4AS3A 1RS0A 3F6BX 3HXMA 1F8XA 1RXEA 4HDKB 1AQIA 4H7HA 1QO9A 2BEVB 3AY7A 1DIAA 2X76A 3SHTA 3JYOA 4KL8S 1GQSA 1D6MA 1I6KA 4M1ZA 3VDMA 4YK7A 2ETVA 5IDVA 4DLUA 1YIOA 2XYPA 2WAYA 1D7OA 1W5AA 2W0SA 1KQOA 2GXSA 3IKTA 4PZ0A 1Z5OA 3FE2A 2I3DA 4I4TA 3BVPA 4AFNA 1O0SA 2FV8A 1XD2A 1XL1A 4Z0PA 1L4EA 2EZ8A 3A4YA 3NVAA 4PLWA 1YTLA 2AG1A 5IK2A 4AJPA 1HT0A 3E3LA 3G8DA 4EB6B 1O6CA 4Q4AA 4BX9A 1Z5UA 3RIGA 4Y7CA 5C80A 3BICA 3DL4A 3EQ6A 4KPUA 1E3DA 5E38A 1ZD3A 3DOHA 3WB9A 3VC2A 4ARUA 3TRKA 2P9CA 3BD7A 3IA2A 4D9EA 1K5GA 4IJQA 3K3PA 4LW8A 2BT4A 2G9VA 3JRWA 4HWSA 4TLDA 1B2RA 4X6YA 4DPKA 2CY0A 3WLIA 2I6QA 1H2WA 2P9YA 1ZHOA 4P4TA 1ZJ4A 4KR0A 1UL1X 3FJYA 2HA4A 2FRDA 2WV7A 4IV5A 5TS2A 5HX7A 3RLFA 3ZV6A 1JDNA 3PCXA 2I2CA 3PC3A 4HCJA 4LYJA 5HJ7A 1XHFA 2VDLB 2WYHA 1EG7A 4OHUA 1UKBA 4BN5A 4FC6A 4OHCA 1YB7A 5CG2A 2OHGA 2O8BA 2PSDA 4C7XA 3MAJA 4KDRA 4DMKA 3RUEA 1A1VA 3JQGA 5A2GA 5A0TA 3L0IB 3P2MA 1HE1C 1C7QA 3KLNA 4B4DA 1PL6A 3K5HA 1HE3A 2QUJA 4GWKA 1HI9A 2YJGA 4WBSA 1WZ2A 4R1OA 4EO4A 4EHIA 4KR2A 1YJBA 2DQSA 4CRWB 1I36A 2H2HA 3THWA 3FHTA 2XE6A 2UZ0A 3AFIA 4MWEA 1JRLA 4TZ6A 5JJIA 4K2HA 3JATA 3I01M 4JT2A 5JV5A 1ADYA 3X43A 1LBTA 1XZBA 2C94A 2CNLA 3RFTA 4MIEA 2V7WA 4R7GA 1SZPA 2IUSA 5CK4A 2BKAA 2DKOA 3HJCA 3N6VA 4FPXA 4WBXC 3A2LA 2F3QA 4Q02A 2I7DA 2O2GA 4S35A 1V8BA 2QRKA 3OZUA 4LVCA 1NM5C 1XEAA 3GRYA 3L4SO 4ZVTA 3BGDA 1WPXA 5EINA 2GCEA 4DIOA 2QI9C 2LDBA 3ILVA 2VUSA 5K3SA 3S55A 5J2UA 1A2BA 4LY0A 2AW5A 2QL5A 4I50A 1F4LA 2HIMA 2AGVA 3DWFA 4MV7A 4D9IA 3S2SA 4Z53A 4DUGD 2K7FA 1ADBA 3WK5A 2BZGA 3LXMA 4GYKA 1ZCFA 4LQLA 1K6XA 4RVSA 2FFBA 3D8HA 2FR1A 3COZA 2PGLA 4B4KA 5K4GA 2HRRA 4RE6A 4B48A 4LC0A 3F9IA 3GGDA 4UC0A 4QFMA 3E9ZA 2HQ1A 4EA8A 5IJ9B 4N6OA 1EZ1A 1E0AA 2A9OA 5E1OA 1C8VB 4X5OA 3MGCA 3C43A 4XFJA 2CZCA 3K71B 3SYNA 3ZUGA 3AERB 3OO1A 4KXLA 3FOFC 1SCQA 4YB8A 5F52A 1JQBA 2FP4A 3H5LA 4C3OB 3PCTA 3HVUA 2AFHB 2OFXA 3I37X 3GB9A 4RK4A 2AN5A 3R9WA 3CVOA 2DBYA 3AILA 3ZZTA 4BKQA 1IOWA 5CXSA 4KPEC 2CVFA 4JLDA 1G7RA 5H02A 3BXOA 2C8LA 2H1HA 1IWOA 2HWUA 3BDAA 3HCFA 4TV8A 3V8RA 3RHFA 3WS7A 7ADHA 2E18A 5EZQA 1U7PA 3FGOA 2PMKA 4UM7A 1ZONA 1FUUA 1L8LA 4ZEOA 4REOA 1E9SA 1QYCA 1GZDA 3BCHA 4MVJE 3QE9Y 1PVOA 1T10A 2HJRA 3BQMB 4ZAZA 2HU8A 3RAGA 5HOQA 1OILA 4G1FA 3TCXB 3UH0A 1YJAA 4BEVA 2YIVX 4DB4A 4CM8B 2QQEA 3KOYA 1VBKA 4PG5A 4J2OA 1VI5A 1CNFA 2O1WA 4CMJA 3DQQA 3PGLA 4HAOA 2ZJ4A 4K9KA 5A5DA 2AHRA 3TR6A 3C48A 2DPGA 5HJ2A 1K9VF 1Q14A 4E2FA 3LXXA 1I13A 4MP3A 4DADA 1W0KA 2Y3IA 4OFWA 4WNAA 5AIBA 2UKDA 3BJRA 4O4IB 4FW8A 2VP6A 3I61A 2ZIXB 3K1ZA 4QAQA 2IV2X 1L5OA 1OXBB 2E3JA 2FUG1 4HH3C 4EY5A 1IEQA 2IEBA 1U2TA 2X4LA 3ONNA 2MHCA 4JJZA 13PKA 5IF3A 3L5OA 5JS2A 1C1XB 3ED5A 4R51A 3M4ZA 1DWQA 1FS5A 4UXJA 1TYDE 2OBLA 4JI2B 4Q3LA 3IUSA 3A2NA 3I9KA 3L6EA 2ODWA 3G8AA 4FFSA 5CP8A 5F64A 3DMTA 3I04M 1S7CA 3UNXA 4C6TB 5I5EA 3W5DA 4KFTA 3H2ZA 5FTWA 1QHXA 1O6BA 3D7SA 3M3DA 4RO0A 2VRCA 3LBFA 5BN4A 4FXPA 1DX4A 3FYTA 1FP7A 1E58A 1TLFA 4MR7A 1CIPA 4O4LF 3LQRA 1O5IA 2ZUBA 2XWPA 1Z37A 3GU3A 1LDMA 4QUHA 3WGQA 4DCVA 1TCCA 3N7UA 2WC1A 3OJOA 2QNBA 4BX2A 3U61B 1FFWA 3KQNA 1P4GA 1ZXBA 3E2IA 4PANA 4X93A 3BTVA 4NJMB 5K51A 4PX9A 4ZU1X 2B4AA 3A25A 2VSXA 3CW2A 3ZCXA 1JZTA 4YP9A 4PR0A 1XCPA 1NULA 2C5EA 4GGPA 1E6WA 1PCXA 1EFUA 1KKMA 1KOGA 1H2XA 3D3WA 3IHTA 2QP9X 2BKEA 2ZRGA 4F2DA 2WYUA 1C0EA 1CB7A 5EYPA 2P3QA 2JZNA 4Y3UA 1HC7A 3GFGA 3KWMA 3NNNA 4AICA 3I0ZA 1WMEA 4B7CA 1E2GA 1A8HA 5LIRA 2PKCA 3A1WA 4KVZA 4ZDKA 4ZZ0A 2WU4A 1KVRA 4LDZA 1Z15A 5GJCA 1T8WA 1L9XA 5JHGB 4LZAA 1SQFA 3Q2KA 3QFTA 4MWZA 5DI9A 2D5LA 3HZZA 5FUQA 5KYYA 4DUYB 2E4VA 1SCBA 1EXMA 4JS0A 1KJJA 2FVXA 1JXAA 5BQPA 3SZGA 2AYXA 2IS4A 1NZJA 1LX6A 1PJLA 4DCPA 5A0FA 5T4HA 4WY8A 3D9QX 3RSOA 3V46A 1N0VC 4PSAA 3HEBA 2NU7B 2NAPA 2J41A 1IK4A 2FMXA 4MV3A 1SIUA 2PX4A 3HFGA 1K0FA 3L4KA 2LCIA 4R8RA 1A9YA 4DFDA 2CFTA 3ZHRA 2G7ZA 4A73A 1LJLA 1EGVB 1JDTA 4Q3EA 4D9BA 4QPNA 1EFVA 2FK7A 3SIRA 3KAJA 5CVDA 2ECQA 4GE3A 2O1EA 3WK4A 2WHYA 4EEZA 5BURA 3MWEB 5KQMA 1EEXB 1RPNA 3X1XA 2PZAA 2Y1GA 4KPUB 1O95D 1SR8A 4NZ9A 1VJCA 1PTKA 2R85A 4R3UC 2DEUA 2Q41A 2QMHA 3MWLA 2P4SA 2RKBA 3ZXIA 4C87A 1M2VB 4O1MA 2VPIA 4CEJA 1RYBA 3AR5A 3HVHA 2D13A 3CUUA 2AXPA 4WMLA 4HUTA 2FX2A 1P7PA 3SJBA 4K9NA 3EOBI 1VLHA 3UCFA 1Z25A 4HVCA 5CFNA 5HTOA 1VKJA 2DF8A 2R1VA 3ITDA 1ZNQO 2HPHA 2HJVA 3O47A 4DA8A 4JROA 2Q3CA 3HP1A 4KIFA 2F1KA 3QP9A 2CLMB 3RC2A 2HWYA 1U3UA 2C03A 1WCXA 4S12A 2FPIA 3QUQA 3ZVNA 4E32A 1IH8A 3UK6A 3PFWO 2CJXA 4JY7A 3MT7A 1UR5A 3ETLA 3NC0C 4GPD1 4JLNA 4MEJA 2WJHA 3D7KA 5I9NA 2CCJA 4HRYA 4NBRA 3SCZA 3U2QA 3LCRA 2R97A 1KO4A 1I5RA 3Q41A 4QNMA 5LFAA 4AJ4A 4PSVA 3T7JA 4POOA 2GCGA 2QRZA 1WHSB 4X20B 1AK9A 1E1DA 1ZK4A 3Q85A 2UU9B 3RQIA 2HYDA 4FJ2A 2ZJ7A 2M9MA 2BE9A 3TQQA 1CHNA 4C6SA 4IHJA 1Y81A 3LK7A 1FZQA 2JAPA 1G2IA 3M3HA 5EE0A 4RS3A 3HJUA 4XX1A 2HMAA 4HQRA 4Q4AB 5BT9A 1E1LA 4LIPD 1J07A 2RK4A 1Z68A 1YQUA 1Z5WA 4PFJA 3F3MA 2P4EA 4G1EB 1V8PA 4ZT6A 4OKIA 1MDFA 4LF9B 2YC2C 2WPNA 4TV9F 1E0DA 4K9LA 4YVFA 4IHQA 1W2HA 3LPMA 4QQ8A 5EIOA 4ZTUB 2JGNA 1FDUA 3NEPX 4RZXA 2ES4A 4LY6A 1YB4A 3PHJA 4HUQA 4V2UA 1KYWA 2OL4A 3UATA 4FVTA 1I3OA 1N2SA 2D0PB 4FE4A 4ZYYA 3QWIA 2BONA 3VSAA 4Q3KA 2HO5A 4E0BA 4E7OA 4EFMA 5M2QA 3ZXSA 4Y6RA 2W8ZA 2UYYA 3SJUA 3M6FA 3MCTA 3AKEA 3L7NA 5B7QA 4IF4A 3Q8KA 3H84A 5CVTA 1G59A 1T29A 3AHEA 4O2AF 4BWGA 1ACMA 1J39A 1ULUA 1OTXA 4QFBA 1Q0TA 1C0KA 1NJFA 3H17A 3EDCA 3O8BA 3G02A 4Y2YA 3TZ6A 4LOKA 4BRWA 1LI4A 1NFFA 4CF4A 3G5AA 1U1DA 3ISVA 3Q1KA 4FBLA 3QYFA 1TQ4A 3C39A 3VSCA 2XRFA 2EOAA 2EKPA 1LNZA 1EP9A 3ZWPA 4DABA 1IN7A 1KYZA 3M1IA 3BBPA 2FMKA 1XAGA 2RC6A 3GT0A 2BGGA 1EESA 3GCXA 1KOLA 1MBZA 1ODIA 2G5GX 2O48X 5T67A 1PDVA 2KM1A 5IK2D 1G41A 2R6AA 1YIAA 1E5LA 3SVLA 2MIIA 1J2RA 2QV7A 5HMLA 4YGYA 1B3BA 2RGBA 3OM0A 5F5XA 3VDRA 2ATXA 2ZRCA 3MRSA 4AKIA 3T95A 1FYXA 5F1KA 4DLLA 3FPEA 4PG8A 3BXFA 2GHRA 3ZZ0A 3P9PA 3IX7A 4HB4A 1IB0A 3OTHA 2IYNA 1XCBA 3AKYA 1JMYA 4EPTA 1BQEA 4TLLB 2EGHA 4CG3A 1Q83A 2OORA 1FFYA 2FZGA 4F84A 4HGOA 7GPBA 1JPNA 2F62A 1VCNA 1XZHA 1C4WA 5K3EA 1X87A 3FMGA 1HEYA 1SVWA 4PHFA 2VYFA 2JLRA 2W42A 4IDGA 5B12A 2IHNA 2ZIXA 1GRRA 3LJKA 4JOSA 1SELA 5AKXA 1T1JA 3E0QA 5KOIA 3TJRA 2BV3A 1Z4PX 1H2RS 3K9GA 3NHSA 3PIDA 4U6QA 1G2QA 4Y9RA 2QF7A 1K08A 3K70B 1HTBA 4EY3A 3VH3A 5JD5A 1OH7A 1OW3B 3OFKA 3NX4A 4ZHQA 1WABA 2HA0A 1P0PA 4N5MA 4C88A 1W6RA 2BH9A 2WG0A 3VYTB 5BXYA 5CLGA 1TB4A 3PXDA 2DHQA 4Y6PA 4TYPA 2Z4SA 3IAS6 1M2OB 2FLWA 3ASVA 5DFAA 4ZI5A 4YQFA 2OTCA 2DGDA 1XHEA 3DZKA 4KKVA 1U5BA 3WRWA 5ECWA 2A5DA 3Q87B 1ZEMA 2YWGA 4N65A 2CJYA 3B3AA 5AJUA 3WG9A 4B43A 2FK8A 2JFGA 2XYHA 4BMSA 1E2KA 4Q7KA 4F1WA 5K45A 1NUTA 3WLAA 2ZQ5A 2Q6IA 4L8YA 3CEPB 3NOQA 4NI5A 1NLFA 4D4IA 2KJQA 2P90A 3AV0B 1L5RA 3KD3A 3LUKA 3WB0A 3QEKA 2XMZA 1TIKA 1TJ4A 4P32A 3TVDA 4PX3A 1U2DA 3MD0A 2HWKA 3EW7A 1GPKA 1Y4DE 2H8KA 1D0VA 4MJ7A 5A1JA 3KELA 4FFMA 1MB4A 1FQJA 1Q21A 2GAFA 3NH6A 4HRAA 2C99A 2XCOA 4P4NA 4E7PA 2QGNA 2ZXEA 1L7BA 4G8CA 1ZEJA 2R6GA 2WAMA 3E9DA 2AVNA 2C5LA 4MP6A 3UMJA 2FSPA 2XF8A 3KXIA 4F2HA 1NLMA 1YQTA 3ZK7A 3EWIA 4MVJA 5EUBA 1ETHA 3DVAB 2QTWB 2FZ4A 2BDTA 1QIGA 1GR1A 3ETCA 2CCGA 3G2OA 1DWPA 4NIMA 1WPRA 2B0JA 1KRWA 1Y37A 3CV3A 3D3EA 1T5BA 3HBAA 3MD9A 4Y1EA 1R2QA 4ZEXA 4EKYA 2J7PA 4UNRA 4ACAA 4R54A 2WICA 1WSDA 5KYWB 3PWTA 4FEYA 2X40A 5IDXA 5IZCA 4TV8B 1HQKA 2O19A 4L3WA 2WD8A 3HU2A 4BE9A 3QZUA 3KU1A 4OHOA 1EP3B 1O5OA 3KBBA 4ZQIA 4A2PA 3UGJA 4KXUA 1C7EA 2FJPA 3IV9A 3KDPA 3ZK9A 4CKWB 4D8TA 5BVHB 1GPUA 2PV7A 4OLHA 4B7UA 4PSCA 1UJMA 3GY0A 1KHHA 4ENRA 3A1CA 1GPJA 4HGPA 3AHDA 5SY9A 4C3ZA 5JXHA 3JQQA 2GEUA 5GVRA 3BFJA 3SP1A 1PEDA 4BGIA 1D3AA 4PZZA 5TC4A 2Z30A 4ZO6A 1NSYA 2LE0A 2XYRA 2J09A 3K6SB 3HYSA 2CK3A 3CZCA 3WMXA 3QH4A 2BMWA 5GOZA 1KY3A 1H5UA 1D5CA 1QGDA 1WLSA 4HMOA 2HX1A 3O3CA 2PIDA 5ILGA 1R8QA 5JCJA 4KW7A 3U4AA 4EB0A 1XRSB 2RKOA 5JRDS 5FEMA 1B8OA 3KT0A 5BY2A 3ZWVA 3WL6A 2OGWA 3VRHA 4MINA 2XMSA 4N7RA 4IQ8A 2PRIA 4EGFA 1ILWA 2PDAA 3GUUA 2QOEA 4MW4A 4RKYA 1Z0FA 4O5AA 1YA6A 4LOHA 5KTNA 4TT3A 3SF8B 2YDYA 3HJFA 3ASUA 2WQZA 3FLMA 2QMQA 1I5EA 4QNNA 1SVLA 1JR4A 1P60A 2OD7A 4ECAA 1BMFA 4IZIA 2UYCA 3H99A 5EG5A 2C2XA 4F5YA 4MS1B 4OQFA 1N8TA 3UFXB 2HMSA 3CGWA 4YJ3A 3DXYA 1JAXA 5GOTA 4G5RA 1WHSA 2E89A 5J2TA 3Q3GE 3T9AA 2PQ2A 5BN1A 1C9DB 1UAGA 3AR8A 5GZ6A 2SCUB 2F2TA 2BUCA 3D31A 3JQCA 4GYJA 3RVLA 4EKGA 5ER6A 1SN7A 2H52A 4HMPA 4FK8A 3O83A 4I36A 4U6NA 1DAIA 2PWZA 1I01A 4H9GA 4J0QA 4NJMA 4OHVA 2WNIA 1ZPDA 2C84A 1IBLB 2LNDA 4PS1A 3K6KA 4YAFA 2H7VA 4KDCA 3WLJA 1OBHA 2V8OA 1M54A 4FX5A 1KWKA 1U02A 4IFTA 1WBJB 1MZPA 2ZJYA 3NMUF 3OC0A 5FLXA 2AMVA 4QUKA 4K9RA 2C95A 1AK1A 2FEXA 2AH5A 3G2JA 2PKEA 1M8KA 3D7NA 4A0QA 4CV2A 3INGA 4WKBA 2XXAA 2UUBB 3T3MB 3AOEC 1RWWA 3W6OA 3C6QA 2BL4A 1YF3A 4YRDA 3TW4A 2IS1A 2JIRA 4D97A 5H8WA 5HM8A 1XRPA 1KFCB 4UNNA 3HRHA 5BRAA 4IBOA 2NYVA 3F8TA 1XCGB 2UDPA 4FOPA 5GADl 3ZNNA 1VXRA 3KHKA 4OP2A 2AOTA 1TU0A 1L7NA 5FXMA 1K97A 1LLFA 3OY2A 1M7GA 1NLZA 4XVHA 4EEXA 1PJ3A 3DLIA 3ESDA 4BNXA 4US2R 1L1QA 1WDMA 4TSRA 4UAVA 1CE8A 1UEXC 2QTRA 1RD4A 2OQRA 4I1OA 1G8YA 2X0JA 1EVIA 1YACA 2AJDA 2I62A 3LZCA 2HMWA 3QE0A 4L4UA 3GGSA 4PHCA 5HKLA 3I6YA 1ECCA 3LD9A 3B9BA 3HHPA 2G5PA 3B6IA 3KZOA 1M2JA 4JI1B 2M1ZA 3O2QB 3GA7A 4CIWA 5CLLA 3L0BA 2Z43A 1TZBA 4WK4B 4AUKA 1VSTA 3CH6A 3R5TA 3IOBA 2FDXA 2JZOA 4A0SA 3B9RA 2AMYA 3K4QA 1ICIA 4BNHA 3OOWA 5AM3A 4EX7A 1C9NA 2ODQA 1R15A 2O2CA 3ENQA 1ESNA 3T1TA 2IJGX 2JFVA 2WZCA 3TS1A 5IG2A 3NHBA 4UNSA 4A8TA 4G1BA 2HIGA 3GAFA 3GPBA 2Q4OA 4IJKA 3RAFC 3GFBA 3BXXA 4HK4A 1T3LA 3P7MA 2E4AA 3V4PB 3WDLA 2XCRB 4TL9A 1J0EA 2CL5A 3HKCB 2IEAA 3SX4A 1F9AA 3GLSA 2NUTB 3IDSA 5HGXA 1MP0A 1WXIA 4G0OA 5IBRA 2PPLA 2ZE8A 2LCQA 2C92A 3K73O 3V2IA 4QU5A 3BWMA 2W70A 3UWPA 4DYHA 4JJFA 4IAOA 2OAQ1 3UOWA 1R3DA 3D6JA 3LWZA 1DO0A 5GZ3A 3GZTB 2BSQA 5BWBA 2I7TA 1QU3A 4XD7D 4EP1A 4WKNA 3SS7X 1G16A 1UBJS 1VRCA 5HF5A 5LMCA 3M1YA 2X0NA 4J0KA 4REQB 1JHZA 4KFRA 4J6FA 4A8PA 1RFLA 4DNQA 1C9EA 3UJ9A 3DYIA 2WJ4A 3IEXA 4TKLA 1AY0A 2XB8A 3HY3A 4ZU6X 3SEFA 3ER9A 4YMVA 1U8CB 2RH9B 3B1ZA 3EXG1 2QD3A 4FUTA 4NOKA 3FBTA 2OO7A 5DXJA 5JU6A 3GVHA 3KCNA 4B40A 5CA1A 2WWFA 2FGKA 1FU4A 2IYQA 5TF4A 2NUPA 3AKZA 4MRMB 3M0EA 1DCMA 1E92A 3DHNA 1SHTX 2ONJA 3ZC3A 4BU1A 4ZVLA 4NAHA 3ZHSA 1J4AA 3LT4A 4EA6A 3K0CA 4PYQA 3G2IA 3TPFA 1YRLA 2WMYA 1OE0A 2H1SA 3VH2A 4E13A 5IX8A 3BMQA 4RABA 5AI0A 3VPDA 1FTQA 1S02A 2MSKA 4BGEA 4CTNA 1XOIA 1N2CB 2ZJ3A 1RBQA 4I08A 1XL0A 4R6WA 2WILA 3AF4A 3TTUA 3IUBA 4ND8A 1OVMA 5CJJA 4UU0A 3I5XA 4K9MA 1MB2A 2HAEA 3PHLA 4CM3A 2GA9A 1AOXA 2WNSA 3RODA 2X23A 1KVUA 4LMPA 5HKBA 3H9GA 1R0CA 1CUJA 1NASA 3DCNA 5JZSA 1DIHA 3C7CB 3LSYA 1W36B 4OQYA 3U3JA 3QIAA 2HPVA 4YJFB 5HE9A 1T5LA 1PFWA 5LP6C 4ZV7A 5DIZA 5A3VA 3RUIA 1JTEA 2H1OA 2OA0A 1U3FA 4K26A 3Q2IA 1L5GB 1JH8A 1NPDA 1QV9A 4TGLA 4GDFA 1NLUA 2X7JA 3CEAA 5AXBA 5E6SA 2DECA 4GLOA 5CMLA 4ZOQI 5E0KB 3A6KA 4PAWA 5FNVA 2X8BA 3MCUA 2I3GA 3KYDA 3KZ1E 2FEOA 2J9FB 1R50A 5AIAA 5G0TA 5B6IA 4G01B 3DJFA 3W79A 5DH9A 3DE5X 3UWSA 1Y1SA 1RPAA 4EGQA 3UW3A 2VXOA 4CCYA 4AULA 4RJKA 4EX6A 3G7SA 2F3RA 1R7RA 2Y93A 2ONCA 4CZ2A 4D5GA 1SAYA 5ANRB 4M7OA 3DDOA 3UBTA 3HFJA 4QYIA 4K28A 1IRIA 1LTHR 2GWHA 4O8CA 3W5HA 4O2BA 4R2JA 1XYYA 5J5CA 3T1OA 5CT5A 3FDIA 1HYEA 4X24A 3RS4A 4AMVA 1DTWB 5KYTA 3U4QA 1HT1E 1E7QA 3IESA 4GLBA 3GV0A 4WK6A 5FI3A 1DOAA 4J2HA 3IKJA 3NATA 3TSCA 4O5OA 2YMPA 3WGUA 4L5YA 5DHRA 1ZK1A 2VOEA 3OPXA 4YMWA 1YWGO 4ND5A 3PI7A 4BMOB 1Q1EA 3BK1A 4X71A 1Z88A 2R8BA 3JWJA 4ES6A 1A8QA 1MF7A 4LV5B 3H11A 1UFQA 2C5HA 2I66A 3CE6A 1S4QA 4E2WA 5B7GA 2FPUA 4NFYA 5CLJA 1HFJA 4WBNA 4BYGA 4RLQA 2GB4A 3GRAA 3JD1A 4CKWA 2QIPA 3B12A 3LUCA 4GMDA 1G5HA 4RIHA 2NIPA 1P5FA 3IMEA 4TTSA 3TXAA 1XMVA 3C3BA 4FEAA 1OFIA 3DDSA 2GAJA 1AHNA 3T9DA 1EFPB 3K9QO 4CF3A 3UHFA 4NJOA 2AOUA 3PJRA 3SDZA 3RVOA 5DTJA 4BS9A 3VDNB 4CM5A 1CDDA 1W581 4G8BA 3SC4A 5BRNA 3R7WA 1RRVA 2OSBA 2QR2A 3G1TA 4JN6B 2FRDC 4P4UA 2XXAB 1Y7IA 4IWXA 4JEUA 1SCIA 3X1JA 2ZWIA 4C0LA 1VXOA 2XADA 3N0WA 4JXKA 4F21A 1JHPA 2ZSKA 4RENA 3K9WA 3CF4A 4MICA 5KVAA 4M1QA 1FJGB 3VPGA 1WVGA 4X6UA 4AY6A 2IYFA 3A1TA 3C7DB 2GFQA 1ZINA 1VCHA 1Z6PA 5L6LB 4EK9A 2QUHA 2QDKA 4TVBA 1DVRA 2QZ9A 1UXIA 3F6CA 1ENOA 3PHIA 3ID6C 3KJGA 3K0HA 3H5IA 1N78A 4V3BA 5EI5A 4DOMA 4EY6A 1GZ7A 1U7HA 2QB5A 2AFIE 4LNHA 3PE3A 4I9FA 5K3CA 1YQWA 3IDZA 3RG2A 3VJLA 3HKEB 4KWIA 1BE1A 3ZHQA 1Z47A 3P9CA 3RNLA 3V7FA 1RC8A 4RDIA 1N36B 1FJ2A 3ZU3A 3DEJA 3LQKA 4BP8A 1MO4A 3K7EA 5AR1A 4GIBA 2CLCX 1T2UA 3CLSD 3QHQA 9GPBA 3FSGD 1B6RA 1PR2A 3P71T 3ZE0B 4G0UA 2J08A 4R31A 3I3OA 4AYXA 5ALIA 4RPGA 4AJ9A 1DEHA 1VJTA 2CFRA 4CMHA 1EB9A 3NUZA 4GOXA 4LSGA 1RRGA 1KK0A 2CJFA 4D41A 3NHWA 1S01A 4UUNA 2W7TA 2AQIA 4K3UA 3S1AA 1JEDA 5E1MA 3DEAA 4RPCA 1KJYA 2P9EA 3FFTA 2I3BA 1RWMA 5FWYB 5A9SA 4EENA 5CNJA 3RK1A 4GM0A 3F6SA 1NBWB 2L19A 1DJPA 4J0FA 4CKEA 1OAOA 2D54A 3D8TA 4C7KA 1NQOA 1FLDA 4HB2A 3GC6A 4BLUA 3UAXA 4A16A 2CLSA 3CW9A 3MOGA 3A6LA 3OZDA 4GUAA 4WA8A 3OZWA 4EHJA 3W34A 4FR5A 2O7NA 1JYFA 3AIKA 5K0GA 3UXYA 3CLRC 4RPIA 3RFUA 2JJ1D 4B4VA 2BJVA 3N74A 5B7NA 5FO0A 2EL9A 3ABOB 4KI7A 1JR3E 3II6X 4RJLA 3MTQA 4B0PA 1NTOA 1PZFA 3UY4A 1ODCA 3LAWA 1XWFA 3I0MA 2YJ4A 4IM7A 1EWTA 1CUSA 2JGMA 3NRCA 2JFQA 4DIDA 4DWVA 2GNOA 2XEDA 3DE6X 4BFSA 2WHXA 2LW7A 4I5EA 4L57A 1F6DA 2XB2A 2FZ5A 1Z5PA 3PHHA 2IOFA 1C7RA 1ZY2A 3C15C 3Q3HA 4IH9A 1KAHA 2ON6A 3HCCA 1ZSNA 4FFRA 2C3OA 4LE1A 3VPFA 1GU7A 3G89A 3VR6H 5IT5A 5JASA 3SBDA 3IYLW 4X63A 3MVEA 4O63O 2FHPA 3GLRA 2JATA 3HM2A 1RKQA 1DQRA 3KUXA 3EAFA 5KVVA 4CIDA 1DIGA 1REQA 2W8BA 1OPRA 4QA9A 1SKYB 4L15A 4HFJA 4F5DA 4Q82A 2PBLA 1MQ8B 3L7LA 4MRMA 5FPPA 4G0ZA 3REFA 1NVAA 2A5FA 4UW9A 2W6OA 4MULA 2ODNA 4S0ZA 2CV2A 4FYWA 1ZLYA 2XTMA 1QB7A 3L6UA 3TR0A 4ARZA 4C0BA 3EQ9A 4NE2A 2R84A 2PSFA 3ZDXB 5G02A 1CR4A 1D7AA 5J1TB 1S2IA 3QU5A 1I2AA 1JR3D 1PW7A 4HNAB 4JJIA 5LCXA 3HA3A 2W2KB 5FWDA 2AZ4A 3TX2A 4DN6A 2I8AA 4BBZA 4DF3A 2YNMA 4LXHA 2BWJA 2CXQA 5G40A 5LBUA 2JIMA 3NNDA 5TQJA 2HJGA 1JDUA 2C3UA 3ZWOA 5DHUA 4E5UA 1E2BA 3EEIA 3ITKA 2A9RA 4JJGA 1WXDA 4DTCA 1A9QA 1NT2A 4CIAA 1KC3A 1NQTA 3B6ZA 4FNAA 4NMXB 1V8DA 2ZS7A 5E6UA 5ICCA 5L53A 5KKAA 4MWCA 1PSWA 1T9GR 1N6RA 1W76A 3UJBA 5DNCA 4E4YA 3D6HA 1RSZA 3CNHA 4M1YA 2WSMA 1UJ5A 1YASA 4J16C 1M5TA 3O75A 1UQUA 5THXA 1PWZA 4M54A 3MQFA 5LYJB 3P0EA 5JYCA 4I4TB 2VHZA 2XUQA 1ULAA 3MWYW 3V4ZA 3E4DA 4LUCA 3IJPA 2ZSJA 4N9QA 4ZVRA 3FZGA 3WLFA 1ZD9A 3ZLUA 4H1WA 1X7DA 4U5QA 2FPSA 4J75A 1QCDA 4UCWA 2V74B 1HZZC 1T4MA 4LWPA 3OURA 4QOGA 3ESCA 1FSZA 5DRTA 1HEUA 4I4LA 4KO1S 1VIAA 5FUMA 1KEPA 2BHRA 3LYAA 1ATZA 1VE5A 3ED1A 3FPKA 4OM7A 1MO3A 4RZUA 4OREX 3VH4A 5IABA 3GI1A 3QPCA 1KOJA 3R4CA 4Q9NA 1XC7A 2P5YA 2Q50A 3ZS8A 4B6JA 2DR2A 2F8TA 5HBGA 1FLAA 2Q07A 3EVEA 4TLMB 2JLXA 2F8SA 4NWIA 1DIOB 2WW8A 4PIVA 3OWXA 2AK2A 2I55A 2QN8A 4REMA 1MRSA 1MGPA 1ZH4A 3D3JA 1HMYA 3DL7A 3ZOZA 1IIRA 2CDBA 4ENWA 5EC8A 1XROA 4FSDA 2GM4A 1XQYA 4W7HA 3DE2X 2WSSA 3MUNA 1BKYA 5CW2A 4M0CA 1R6XA 4MUEA 4CLHA 5C8ZA 4CLRA 3CSUA 3U4QB 3JQ9A 3E5MA 3VTFA 1DAPA 4X8HA 4A2WA 4YHHB 1OD6A 4NKRA 4XDHA 2VNHA 4YX9A 5KU7A 1IHDA 3KNZA 5A06A 2Z4TA 1B43A 1QH8B 2ZUFA 5M29A 1RM5A 3PYMA 1USGA 4IUYA 1QO0A 3PZRA 1RDFA 2HL6A 3K05A 4PM4A 1K8XB 2JLVA 1A2QA 2CNBA 2QRMA 4D9KA 2ECKA 2BZ0A 4QLAA 4YC7A 3O91A 1ADCA 5ESXA 1VSQA 3IPCA 1YCGA 3AHIA 4OA8A 5FNVB 3DO8A 3BCSA 3MMXA 3DE0X 3A4NA 5I7SA 2W2TA 1QOZA 1ZIYA 3G2LA 4UFNA 4D9MA 2UXDB 3CJRA 3PB3A 5KTRA 4R3WA 2O4UX 4G5QA 5JRJA 1IULA 1XU7A 3AB7A 5EIBD 4DCOA 5KZMB 5F77A 1ZOLA 10MHA 3BORA 3JVEA 4CBVA 1OAAA 2P6MA 3TVTA 4RGBA 2WWRA 2CYCA 3KFVA 2I9KA 3GW8A 3OE5A 3VMFA 4KH1A 1KMCA 5ALXA 2VT7A 1TGVA 2G4LA 1EMDA 2GAOA 1WDWB 1K0UA 3FVTA 3QE4A 5BW5A 1Z83A 2DR3A 1OCEA 2RKWA 5ALGA 3QA9A 4YP7A 5TPWA 4PICA 1F14A 1UT6A 4AI6A 4H17A 4TMXA 2ZSDA 1XLVA 2C9MA 2PZMA 1FFAA 1M2HA 1X1DA 3SJAA 1F6WA 3CM0A 1N9KA 2G76A 1Q7EA 2NVBA 1EIZA 5A4DA 2A78A 3PD0A 2MR6A 3C3CA 5FADA 4QUJA 1X7WB 2P1DA 3GDOA 3CQ9A 4IGKA 4MWGA 4MYCA 3ZCSA 1V39A 3JAWA 2H00A 3QNWA 1L1RA 1S5PA 2AD1A 1O97D 2WHEA 1PGOA 1DX9A 1SZCA 1GSOA 2LBPA 2WMNB 1JIKA 2ZIUB 2ZWVA 4GP6A 3W9BA 3JW8A 1L4LA 5DNWA 2CDCA 1KPGA 4ZYTA 1KJQA 3ETGA 3LU1A 3BUSA 1A27A 1BX3A 1NNI1 3IEKA 1D04A 1DAMA 2R1TB 1V11B 3KLMX 3PEFA 1SB9A 2LDXA 4P7BA 4XOUA 2UYGA 1T0PA 4IILA 3JQAA 1D9XA 3D1LA 1EXNA 4KZKA 4NF2A 5J4HA 1PD1A 2YWJA 3EQ2A 3GT3A 4YY3B 2HGZA 5JISA 2MSDB 3PUXA 1J42A 2WB4A 4A8JC 1ZIOA 3VTKA 4F4UA 1EFKA 2H16A 3F78A 5CIQA 1SUEA 3FPJA 1XO1A 3R5JA 1DC4A 4R1UA 1NW9B 4W4TA 2WB2A 1W5TA 2O8DA 2WKWA 1WSBA 3CH5A 2AG5A 3O8QA 3V6LA 4NAVA 2ZXUA 1OREA 3CIOA 3OFNA 4Y6GB 1A5ZA 1C8BA 2QMYA 5AVXA 4N8EA 3W04A 1BC5A 3HJGA 3PC8A 4EFDA 3IMCA 2WU1A 2X8JA 4DSUA 2GN0A 3E3NA 4BB5A 3SZMA 5T7BA 1Z6GA 1P5HA 1V3QE 4QEDA 4YRKA 2VPXA 3NHLA 3S99A 1H2YA 3AUAA 3FYDA 3FFAA 3M6MD 4UZFA 1F38A 4L78A 2AJLI 5BQ5A 3SHWA 3ZBUA 1KE2A 1PQ4A 3HB1A 3GL9A 4DA0A 3ELDA 6GPBA 6AT1A 1O9GA 2GZHA 1UDXA 3WLPA 1YU9A 2NTVA 1KEVA 2Q6LA 3EXIA 2F8LA 1KQ3A 1ULSA 2HKIA 1NYRA 2Q5IA 2WKPA 2WA2A 4J0JA 4LVOA 4QXOA 4C7BA 1DUIA 1JKMA 1N7JA 4F06A 5CVUA 5I51A 2ZPUA 5CA0A 5MN6A 1IM8A 2HF2A 2ORWA 5IWAB 5K7SA 4N5LA 3E8MA 3SHFA 2ZETA 2R00C 3R7WB 1XMSA 1OLSA 4RW0A 2L82A 3HK2A 1CEYA 5GM1A 2WIBA 5EKXA 1NNUA 3MCVA 4OJMX 1DIBA 5DTEA 5JDCA 4CHTA 3H5TA 4R8VA 5FR2A 2ZRPA 3A1UA 3GVCA 2F1RA 4OLBA 2UYOA 4HNAA 4GEGA 5IT4A 1UMBA 3RO7A 2Q5LA 1U9IC 2PFKA 1LKZA 3BG5A 3NRJA 2NAFA 1MG5A 4URUR 2RGXA 4ACBA 4LDQA 4F3NA 2AJ8A 3OKAA 5DGDA 3R9XA 3L1HA 4YDQA 4MW1A 2JAWA 2JIOA 4Q4JB 1NLYA 1JWLA 2VNAA 4TN1A 3E23A 1L5ZA 2C78A 1EJ0A 1P5JA 1U1EA 2VI5A 2ZJOA 3H9CA 3MTEA 4NYJQ 4OV6B 3S29A 3TBHA 3BXHA 2QG4A 2OBFA 3A3YA 1AA9A 3H6GA 4JCOA 3RUHA 1J2TA 2PH3A 3K8OE 4L16A 4Y9SA 3MA0A 2ZE6A 5BORA 1H1TA 1OUMA 1FP2A 2VS1A 3M81A 1N7HA 4O29A 4PRKA 3ZNQA 5LA6A 3G9QA 4QECA 4TWIA 5LZ2A 3VKHA 1PJZA 2GZ1A 3LLUA 5IKXA 1X42A 3KEMA 4XXHA 1Z0ZA 4LQCA 1QDEA 4XQGA 5C4IA 4YJ2A 3QMWA 4KQWA 3ZV5A 5DGIA 4KK4A 1WZCA 1HDEA 2IT1A 3UT5B 5A62A 1VYTA 1YQQA 5FV7A 2XKBA 1L4BA 4NEQA 4U7FA 5JE8A 1GAXA 2W8BB 2DPLA 3BMXA 3HCBA 1AZLA 3BRSA 2J3LA 3A4VA 1NRXA 1VI2A 3I6QA 4G41A 1ID1A 3SI7A 3JU3A 3G2QA 3P9IA 1UPFA 3PX2A 1IFXA 1QIIA 2PPVA 3RV3A 4ZK2A 2QORA 4L28A 2CHQA 2NGRA 2WYVA 1US8A 2QR5A 4J4TA 4AKHA 1NG1A 2AWOA 2H65A 2Z56A 3AF0A 4D98A 1P8AA 4V02A 3N0XA 3A9VA 3NHUA 5E2BA 3UAGA 2FRVA 3LIIA 3EHDA 3PRYA 2Z3VA 2ZU6A 1QG6A 4IUDS 4FQ5A 4BC1A 2B3DA 2JH9A 1NPTO 4WECA 4XUDA 1XEWY 1RLOA 4F45A 4PAMA 3TLKA 3V4OA 4DG8A 1XV5A 3O7MA 4P33A 3TZCA 3M82A 4ZZ3A 2EG9A 4XR4A 4E09A 3ONEA 1XZ8A 2ACEA 4AMBA 1PWXA 3ZY2A 5EJIA 3W1EA 2JGDB 4FKZA 3TE6A 1CP3A 3E9EA 4RY0A 4AO7A 1G6Q1 4NENA 5IW8A 1WNFA 1T15A 2OHHA 4Z8XA 3HJNA 3GEIA 3Q7TA 1E3MA 4M99A 3NTOA 1XEWX 2L2QA 4KE8A 4AK9A 4R98A 221PA 2VKTA 1OT5A 2R5NA 3SG0A 5C5IA 4Z86A 1WOMA 2WSBA 3R0IA 4TWAA 5FTMA 3MGKA 2PZJA 1P61B 2XYQA 4CTMA 3FWKA 5ALEA 4RA6A 1H4QA 3KSUA 1XEFA 5DCUA 3A1EA 1YQDA 5H81A 4M3NA 1P39A 4ILKA 3CSDA 2OEPA 2YL2A 2GKOA 3G49A 3RRMA 2HSGA 1N2CE 2VFAA 3OJ0A 2AKYA 1GGMA 4HQNA 4N9WA 3G85A 3OX4A 4LBYA 5BQFA 1XXHB 1M0EA 3AETB 4C0XA 3TEFA 2PAAA 4N12A 1R64A 4YT4A 3DKRA 3CH4B 3EAQA 1JFVA 1Z26A 2OCXA 2Q46A 2I91A 3CISA 5DN9A 3MSCA 3NM4A 3CLVA 3I5AA 1WXFA 2D3WA 5DNEA 4IGAA 3L49A 5F12A 2IVZA 1ZIXA 5DYIA 3M5WA 4Y2PA 4WD3A 1Q0UA 1NVVQ 3TTYA 3IQWA 4HL6A 2Y9PB 4OI0A 1YFZA 1OLUB 4B84A 1HA3A 1R9MA 2JCXA 3DPSA 3CRZA 4CMEA 1MB9A 2EBUA 4CLOA 2X5OA 3D7MA 3IXMA 5IP5A 3JD3A 3IEIA 3OT4A 3RVPA 3GZNA 3SY8A 3TLCA 4EUFA 1S4MA 1XRNA 3ANNA 5GGXA 1QVAA 4ATNA 1YGPA 3B89A 3FKJA 4LWQA 2MOKA 2BJWA 1DE0A 3GFVA 4ZHQB 2RHLA 4L9RA 4U2EA 2XUOA 3I8SA 1D1TA 1Y6QA 4BO1A 3VNBA 4UM8B 2C1EA 4KXQA 4DLAA 3E35A 3USES 4GKKB 1E6KA 2AG0A 3UAOA 5HPYB 2QVCA 2YXNA 3O8LA 3PGXA 4FYXA 4HAVA 3K2BA 1CUFA 2Q5JA 1OH6A 1M9NA 2G0TA 3GPIA 5TRTA 1J8YF 1T3TA 4CN8A 3HBFA 2P2ZA 5IEJA 3CVYA 1E4OA 1NDUA 3INTA 4F9EA 5C35A 1ECFA 2EW1A 3DZJA 3O4RA 4QL3A 1S2OA 2Z08A 1TLTA 2WUEA 3GO4A 4JD5A 5G0UA 3TXYA 1B1AA 1K89A 1H4TA 2A9PA 2G4CA 3V34A 4BRZA 5IJWA 5EE5B 2R6CA 3IPXA 4D4LA 2RJ3A 3C3XA 1YI0A 1VKNA 1DJOA 3ZGVA 3ZKWA 3PUWA 3HUDA 1M0TA 3G0CA 2EF0A 5FTNA 3WP1B 4AZ3B 1I94B 4INJA 1OWMA 3T35A 4R16A 1KZ9A 4H59A 1RAEA 3L8YA 4PO8A 3NYWA 4LN1A 3NYRA 5C5EA 2R2AA 1VDZA 2FPXA 1E4VA 1WETA 4V03A 1ISPA 3A6FA 1GTZA 1Q19A 1K3UB 2E5WA 4TL7A 4TRJA 1F4PA 2HHJA 3OQVA 5JO9A 4YCCA 1WMSA 1U0HC 2J3DA 2Q9BA 2XOEA 4QHTA 4PTYA 5EZYB 2F7SA 2YVUA 4C0JA 4MVWA 5IXSA 4WGFA 4WXPA 1KR5A 1Q16A 2QZSA 5DDIP 3TW6A 1BGVA 4QVKA 4B1FA 3FHLA 8GPBA 1TUBB 1GN9A 1Q0SA 1HQYE 5TARA 2CL7X 3LVQE 3THXB 4N7JA 3V00A 4PCUA 3DULA 1L5KA 4QOJA 3C4VA 1DG1G 1XQ9A 3HXPA 5CA0B 1VFPA 4IYJA 3TMYA 4M1WA 1K7SN 1DNPA 2PL1A 4X65B 2O59A 1DTSA 1EFCA 4DMMA 4BAZA 3B1WA 3DQZA 2X0IA 3AKCA 1E61A 4YRCA 2HYIC 1OPXA 1SG9A 1BRMA 2OZPA 4OA5A 3OLVA 1Y0BA 4YT5A 5HFNA 2COUA 2DMRA 1F1JA 5DKFA 4M0FA 4UTVA 4FR0A 5DHTA 3B9PA 2RJOA 1T9ZA 1OLOA 3FBGA 2PZGA 3GBPA 2ZJ1A 5A05A 1MC8A 2D1YA 3RRNA 2GHTA 3KKPA 5K05A 2FSVA 1E79A 1OBCA 2ZR8A 5KOYA 3VZCA 3ORHA 5IWCA 4ND7A 5DHQA 2ZEJA 1F2TA 2AV6A 4P82A 3BQNB 4GKBA 3UUFA 3OZGA 5T64A 1ZNXA 1YHNA 3BRWA 2D2EA 1YRHA 2FSVC 4MS1A 1DWOA 1VIMA 2PH7A 3EXEA 3PENA 2D2XA 3S3TA 1KBZA 2P41A 3IP8A 5A02A 1DT5A 2GGSA 3AEKB 1N2GA 2O7RA 4X0EA 5K3FA 1RQRA 4OI4A 5BR8B 3GG9A 2MSWA 4MVJF 4E33A 3DMTC 3I42A 3PL1A 3PX3A 3OLQA 3UC9A 5AVWA 3RK4A 4ZA2A 2G9UA 3TL3A 1ZJJA 2D7JA 3LT0A 1AN0A 4Q66C 1E0KA 1H0HA 1ZUHA 2IPMA 3BDIA 3I5MA 3PRHA 4Q15A 5B1SA 4O1IA 4M98A 3PFBA 4XWOA 2XECA 4G65A 4U0JA 4KFCA 4GXRA 4TT8A 5E1BA 1BCRB 1Z34A 1CYEA 3AY3A 4LXTA 2E5FA 3NVDA 3QRWA 4KIUA 1IDOA 4R8SA 4YCBA 5CBPA 1L7AA 2VA9A 3PNQA 2W2MA 1E4EB 3VR4A 4XA8A 1W88B 3LC7O 3L6RA 4MQBA 1VE1A 1QFMA 1OC4A 2WAOA 4XLLA 2FPPB 1WULS 1W52X 3HCEA 3MBIA 3ZV4A 4BUZA 4G1UC 3ZVKA 3E7XA 4UNIA 1YDEA 3MJTA 2BCGY 1UZNA 1V7CA 2GM9A 3WYFA 2AOTB 3D81A 4GOOD 2WUVA 2QQ0A 4CMAA 1YAJA 3NHFA 2NLOA 1G42A 1OBVA 3TTTA 2HUPA 1BIFA 4JUIA 4FFBB 2PQ6A 1BH2A 4ZWNA 4YRGA 5SZIA 3TGLA 2PTHA 5GAJA 5MFPA 2JCBA 2ZS9A 1IL0A 3AVQA 4OMUA 1W25A 5F2OA 3F5QA 3GIDA 2QLBA 3LY9A 3S68A 3UPDA 4BKUA 4DR1B 4LYHA 2Q7XA 5IRCD 4P0PB 1AIPA 1KAMA 2LR0A 4OHXA 5JNUA 2RDMA 4FSXA 3QX7A 3X2SA 1XDUA 4UFPA 3SBXA 1HNNA 2RGNA 4AJ1A 3OM1A 5P21A 2O3UA 3PIRA 4B4OA 2P6OA 2YTZA 1Y3BE 1I10A 1JVNA 2A94A 1PT9A 4ZOLB 1JSZA 2Q3HA 2Z2XA 3OKFA 3T3GA 5CLHA 1Z4JA 3WL4A 2HB6A 4A6DA 4DMRA 4ZGGA 1IBRA 5JAIA 3U44A 1QK3A 1ULBA 3R0JA 2JIZD 1T4GA 1E6EA 1G0NA 3ZE6A 6LDHA 1GGNA 1EEHA 3EGVA 3OD1A 3QPAA 1V43A 3BKXA 4TS9A 3WYCA 5AHXA 1L7RA 4EB8A 1G2PA 3T1VA 2CF5A 1GZUA 3H9UA 4DSOA 1DRUA 1ZM3A 3AFGA 1LX7A 3IBSA 3HEMA 4ZEWA 4GPIB 1EHYA 4E14A 1ULZA 4TTPA 1ZP6A 2JF0A 3JASA 4Z3OA 1XZFA 2AE1A 2PVCA 1LNQA 2PRSA 3U4IA 1UWLA 4GXNA 4AN0A 2NSHA 2YINC 2B94A 3F73A 4W5NA 3QEJA 2JA1A 2CBGA 2DBVO 3IVGA 4MA0A 4Q3DA 5C5CA 5JMTA 3ZHUA 1BD3A 1R4NB 4LK3A 1VDMA 1YHZA 4PYOA 2QMZA 3ZZUA 2QLFA 1DLIA 1FIUA 2EQBA 4RK5A 2VJOA 1QR6A 3KSDO 1EVJA 4OB8A 4B83A 1QAQA 3T5MA 2GVZC 3AJ8A 3Q7SA 4LDPA 5EXPA 2VJBA 4YPFA 1GUZA 4OTZA 2CL6X 4Q4HA 2QPTA 2OHIA 3V7NA 3TGWA 2HWXA 1Q74A 1JECA 4HTFB 4QU9A 1JA9A 1Z33A 5IKMA 1EX6A 3TSZA 4KMRA 5EHIA 2VSFA 2YY6A 4HAIA 4X54A 4QDOA 5AVVA 5IASA 3NVKI 3C6YA 2CEAA 2Z0MA 2BGTA 2H4HA 3DOFA 5LQJA 5ALFA 4YRBA 4FEGA 3JS5A 1QK4A 1A8IA 3BB3A 5T5QA 5B55A 1PK7A 1XTSA 2Y1EA 3QVGB 5G41A 4GHWA 4RK6A 3A06A 1DTEA 2GF2A 3BA6A 1LC0A 4FE7A 3HCWA 2WQ6A 3IH5A 5M3BA 1XMQB 4QGBA 3RRBA 1RT9A 1XTIA 2J7PD 3H5NA 3VVCA 1AQNA 1RE0A 3GFPA 3KKMA 4NHEA 4BNKA 3LT5A 1Y8AA 2OWEA 3GJ3A 3KPUA 4QJ5A 5JC1A 2EFJA 4OB7A 3KT6A 3T3OA 2YN0A 4QXRA 4WVFA 4B2IA 3NTLA 1JLMA 3LCMA 4PTLA 1G7SA 2HXYA 2YHUA 4PBRA 5JSYA 3VPXA 2IP2A 2BUAA 4E88A 5BSUA 2IS6A 5LB2A 3N3AC 3DWGA 3CINA 3EIOA 2IQIA 3A3OA 3FCSB 1N5LA 1UDRA 3QPDA 1ZESA 2NXWA 4IDFA 1DC3A 3T3DA 3ZU6A 3AWDA 3CZQA 3NTRA 8ATCA 1G9SA 4YXWA 2OV3A 1S96A 4JBYA 5EUQB 2BEVA 2PUCA 4TZ0A 5CGZA 4HLUA 3JQPA 3CRW1 4TX1A 1M6VA 4RSHA 1VA4A 4XI9A 5JSZB 3KD2A 1LLCA 3CEMA 3ADPA 1H05A 3AT1A 3E5HA 2NVUB 2H2WA 1PV1A 5H16A 1OI2A 2PMWB 5C9ZA 1UIRA 2WSSD 3C1OA 2G80A 4HLUC 3EZ2A 3RTCA 3DVSX 4BKOA 5HKAA 1JLHA 4G6ZA 4IV0A 1AKMA 1Z5GA 1KO5A 2ADMA 2HRQA 3OPMA 1XGKA 2JB9A 4IDEA 4DY6A 1FDRA 2HSWA 2ZRBA 3F5DA 1GNSA 3UHAA 3DV0A 3QKRA 2JI4A 4FS8A 1NUAA 1FRQA 3ZWYA 1MV8A 3RUFA 3ICPA 1XR3A 3IAUA 4B6PA 1Y5NA 1Z6QA 2HJWA 3AUFA 1E2NA 1MEEA 4EARA 1X1BA 4EW1A 5SICE 3WYGA 4QPCA 1FYFA 1Q95A 2F9LA 1TC2A 4L22A 3VKWA 3ICEA 1RQNA 3N39C 4Q93A 3HCRA 1LQ2A 1IJKA 1H8ED 2H08A 1DKRA 1A2OA 1WUIS 3EXHC 4MVJG 4O1HA 1FFSA 3KK0A 3KFLA 4Q3AA 3ZXUB 2YWBA 2FWMX 3VR3D 1LSJA 1XKQA 5LLDA 1Z3IX 5LMZA 3LF2A 2Z8XA 1ORTA 1EB8A 1XP8A 2A3RA 2GN1A 2VF8A 4TZTA 4XASA 4XPIB 4D9CA 3GCWA 1KJ8A 2QSZA 4FXOA 1B41A 5DWDA 1PU2A 2QLJA 3M83A 1P45A 2OORC 2YBDA 5AK6A 2XVAA 4GP7A 4DE5A 1V3VA 4RQTA 1BVYF 1EAMA 2JL1A 3T7IA 1RACA 3CEHA 4LOAA 4I2NA 3G5LA 3AVOA 4WX2B 1EA5A 5JSQA 4DGSA 3KQWA 5IXYA 1OASA 2B8WA 2R9VA 4L8LA 2H4XA 3A9UA 3DBOB 2GZMA 3OT1A 3RW9A 3UJCA 1JS1X 3MAGA 3CLTD 1G20B 2GQ0A 2B0CA 4IFIA 3RS3A 2DTDA 1VHWA 1CQWA 1DS6A 1K27A 1I4WA 1PAUA 3D6MA 2WRZA 3ICCA 1RPTA 2R65A 3T5BA 2J9YB 5BRJA 1BJRE 4IIFA 1QJ4A 2XQIA 4RS4A 4N3BA 1XVLA 3E7PA 2QTZA 4KXNA 5JD6A 4KBYA 1YK1A 1CW2B 2YRFA 4BMPB 2RAFA 3ESBA 3K0FB 1SUSA 1DOZA 3ZLBA 5E9WA 1W0JA 1ZCBA 4AS2A 3TAUA 3RK0A 2VT3A 2DUNA 4MS4B 4XR9A 1YRYE 2FA9A 4P53A 5GQSA 5I9IA 2I80A 1AKVA 2ID9A 3PE4A 4MW9A 3T34A 821PA 1O1YA 4I50B 3SFTA 3RS2A 1KH3A 3GWGA 2Q5CA 4LK2A 1QGZA 3PWKA 4AY3A 4YRNA 3PNMA 2H18A 1FYVA 2DU8A 4ZCTA 5AQ1A 3M5PA 3KZNA 2G36A 2C61A 2CVOA 1HFEL 2WDZA 1K7CA 1ITZA 1UJCA 3GDWA 3ORSA 1FRFS 1XRMA 1T2FA 2AHOA 4G23A 1PJCA 3R5HA 1WUTA 3IAEA 3QXJA 1OTHA 1YSCA 4K0RA 2BSAA 5DSTA 3CG0A 5CXUA 4P31A 3VSBA 2CVZA 3GDFA 4IJ5A 5K6AA 3H5RA 1XEXA 3HB7A 1QTNA 5T6MA 2J0VA 4ZO7A 1C7JA 1J21A 2VJLA 2OYSA 1K4MA 2AOVA 2JJQA 1TF2A 2O52A 3KOZA 4A36A 3PBKA 2YZNA 2IWRA 2QSJA 1SUFA 1WS6A 2AQHA 4BN0A 4RE5A 3KQQA 1ST2A 4LJKA 2H07A 1YB2A 4MR7B 3WWZA 5EIFA 1PJAA 4BO8A 4QRHA 4U7DA 2V7XA 2Q6OA 3NCTA 4ZQCB 1IHUA 4DRZA 2WOJA 8ABPA 4UVIA 1FJHA 2VK2A 3M6WA 3RC8A 3KR1A 2O0LA 1A9TA 4GBED 3TYXA 2C7GA 1DCTA 2Q5OA 3FIUA 3W2IA 4WLNA 5KAPA 4G07A 4FW9A 3H6KA 3IHWA 1LW7A 1QIMA 1UZLA 3Q5EA 4MVJI 4CKYA 1C14A 1P9WA 1ARZA 1OMOA 1U4NA 2FPGA 1W75A 3ETHA 1XI2A 2DP4E 1VHJA 1VMAA 1SXHA 4OK6A 1F1BA 1KK1A 1R18A 4BKMA 4DCGA 2RHOA 1BCRA 2UVPB 5MN5A 2VHJA 3V1UA 3BMNA 1KR2A 1YKGA 4LY9A 3I8XA 5ERYA 5IDQA 2QVZX 2AFIA 1EE9A 3WDMA 3PDJA 4N3AA 1Z2DA 2B9EA 4UAGA 3P97A 1XTZA 5DGTA 5I4KA 2JLAA 3OJWA 4OXRA 2OGUA 3QW2A 3AQ4A 4DSNA 5A9RA 1WE2A 3AUXA 4JVOA 1U99A 4UASA 2C2WA 4NDAA 2PYDA 5FCDA 2OCAA 1R4NA 1E64A 1EDEA 1G63A 1TCUA 2AZDA 4XGKA 2YICA 1Z56C 2Z2ZA 4G0PA 4QT0A 1QOQB 5EE1A 3K2QA 6ABPA 4CYMA 2O20A 1KS2A 1AO3A 2YJ5A 3EUWA 1PNQA 2WU3A 3H5AA 4GZMA 4C06A 5TEWA 3ESAA 1ZJZA 3AHJA 5DOZA 4UCXA 1J5XA 1R12A 4HWTA 1DRJA 3QVOA 5H9WA