4M3JA

Structure of a single-domain camelid antibody fragment cab-h7s specific of the blap beta-lactamase from bacillus licheniformis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
116
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGSISSITTMGWYRQGRELVALINSVGDTTYAGSVKGRFTISRDNAKNTVYLEMSSLKPEDTAVYYCNAFMSTNSGRTGSFWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camelid heavy-chain antibody variable fragment cAb-H7S
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Lama glama
molecule tags Immune system
total genus 27
structure length 116
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m3jA00
1BREA 4NSKB 1G1YA 4G43B 1JHKL 5E6IA 2AEQL 2PTTB 5HYFA 1SBSH 3BDYH 4P2RB 1A2YA 2YPKB 1Z0NA 2ID5A 1KN4H 2FH6A 1AGDA 4RGNB 1D9KC 3FN9A 4WI9A 1PLGH 1YNLL 4YNYA 5AUMA 3ARPA 2H45A 2MQCA 3HLAB 4DKDC 4NQUA 4QRRD 4MJIB 4JPIB 4P9ML 2V2WA 4NFDA 1YMHA 4Y5YB 5GS0L 4JN2A 3VG0H 2X09A 4KROB 1EVTC 1NC2A 2WSKA 5GRVL 4Q9RH 4LOUC 4CBPA 5CEZL 1BZ9B 2CDFB 4TSCH 3HMXL 3MRGB 4OJFH 2HFFB 3OPZL 5EZOL 5HHPB 2VLRE 2BRQA 2JK5B 4M03A 3VFNB 1FZOA 3TJHC 5TGBB 4LEOA 5L7XL 3MXVL 1MCDA 1NAMB 4WDIB 2VC2L 3IFNH 1XF2B 5TDOB 2B1AL 3QRGH 3AM8A 1MRDL 5EZIH 3O11A 1F97A 3HAEG 4FN0A 5CHNA 4XCYA 3HUJF 4ZXBD 4NC0B 2CLRB 2WIIA 4N68A 1T2QH 1KCUH 1FL6A 1NCDH 1N6QL 1K6QH 2YPVH 1CLYL 4JCMA 3V6ZB 1QRKA 5KVEL 4XBEL 2DMKA 4EJ1C 4D0BA 1IMHC 5GSRB 5IROA 3RHWF 4JFED 3W9DA 1FZJA 5C9KA 1LO2H 4PB0L 4O5LL 5E5MB 2OYPA 4PBVC 2AJXH 2RB8A 1FIGL 4MD5B 3C6LA 3ZDXE 1S7RB 1I9RH 1UZ6E 2IH3B 2V5RA 2VYRE 4Y19A 3GMPB 2YRLA 5AZ2L 2IPUK 4Z7UE 4R4BB 4JRXB 2VABA 1SMOA 4J2XA 2EDYA 1CFSA 4YXLL 4M7ZC 3WHE1 4ZFGL 2R56H 3BW9A 5IFAH 1EGJA 4L29B 4QRRE 1D5XB 4FQQA 1IEAA 4P59L 3ABZA 3NFSL 2B2XH 1ZSDA 4G6AD 3LHPL 5F7DA 1TTFA 1Q72H 3LRHA 4UT9L 5K33A 4RGMC 5C8JB 1DQQB 5IHUL 5ABDE 1UA6H 2I9LA 3C9NB 4RGOH 4XP4L 4YHPA 4Y4KA 2EEAA 3DRTA 2CRIA 4LP5A 5EH1A 2HG5A 1CFVL 3PWPA 4ZUUA 1A2YB 1WVZA 1IAIH 4FQXA 1AGDB 3KPLB 1FVEB 5AUMB 2Q6WB 3OKLB 4OZHF 3VXRA 1EMTH 5DO2D 1WAAF 3UJJH 3V8CA 5IGXL 4GXUM 3FO2A 2HN7A 3KHQA 3SDDC 2V2WB 2CXGA 4KUZH 1H3UA 2XTJC 4WWKC 4JN2B 5FCUH 1JNHB 3DI2B 3WV0A 1NC2B 1OARH 1PAMA 1RUQL 3E6FA 4PJAF 4LSTL 4XBPA 3OTTA 4KJYA 5DRXA 2H8PB 3SQOL 5DA0B 2YXMA 5IHZB 1IGJA 4LLUA 3U7WL 3GSXA 1C1EH 3MRHB 4LEOB 2ZG3A 1T7YA 5F7KC 4UDUA 4CMHB 3KAAA 5JIIA 3PNWA 1FL5A 4W4OA 3STZB 1QD0A 2EYRA 1JV5A 4XCNA 5HXMA 4LSRH 4ZDHA 5CHNB 1H5BC 2A6JA 4XCYB 2WIIB 2LABA 4DFIA 1A7NH 1FL6B 1Q1JL 1DFBH 1BFVH 2EXYC 4D0BB 4AEHL 2X5PA 5GZND 4LHUD 3TZVA 1FZJB 3UTZB 2V7HB 4AENB 5JOFA 4FFYL 2PTUA 1IGMH 5DD0L 1MI5A 4OIIL 5JW4Q 1EK3A 2DQUL 4PP1C 1CLZL 1ZS8A 3WXWH 1JWMA 4JO3H 4MD0A 4BQ6A 2FX8H 2FIRT 4KY1L 3QHTC 4PJ8A 4Y19B 4EBQH 3QIWD 4KKNA 4Y0GA 1JYWA 2MCPL 2XQYG 1EHLH 4DUVA 2Y36H 3BKJH 3PV7A 3BW9B 4FS0A 4PY7B 3RTQA 2I26N 4NM8L 1NGPL 4FQQB 3SJVA 1IEAB 4ZAKA 5D5MA 1ZSDB 4TN9A 4U4BA 5F7DB 2PXYA 4PJIF 4HXBH 1HHHA 2ZSVB 4Y4KB 3DRTB 2KH2B 3MLWL 1R5IA 2HG5B 3PWPB 4NQCD 4KK5D 4FQXB 2DJSA 2FNBA 4G8GD 4YHNB 2AW2A 2OXHA 3VCLA 3QXAA 4Y4FA 3MNZA 3ZKQD 3UC0L 3VXRB 3D3VA 1O0VA 2JB5L 4MJ4A 4IS6A 2J3SA 1CGSH 1MCRA 3FO2B 4NJ9H 2HN7B 3IU4H 3O4LA 3ULVE 1RMFH 2F58L 3T0EA 2CDGA 3BQUA 4OM0H 1MREL 4XBPB 4GG6A 4HPYL 2YD4A 5DRXB 2F5BH 2OTUB 3P9LA 1L6ZA 1T0PB 2Q76B 1P5VA 1IGJB 4LLUB 4LLMA 5L2KE 1QFUL 3U9UA 2DM7A 4WUKH 3NA9L 5KSBF 1YN6B 5DI8A 1AKJB 3MOAH 1MH5B 3PNWB 4UTBL 3I6GA 4HIIA 3F6LA 3QDGE 3BPOC 1JV5B 4KZEL 4XCNB 2JIXA 4D9LL 2V6HA 2A6JB 1I9IH 4QXUL 4UI2A 3RIFF 4K07A 5KVDL 5FUCE 2WUCL 3INUL 1E4XI 4NQSB 1A3QA 4I4WA 1JGUL 5DR5L 3HZMB 4S11A 4N0UE 2CQVA 3TZVB 2CRZA 2J8OA 4OGYH 2VZSA 1CK0L 4LCIL 1MI5B 5CJOL 1DVFC 5C0BA 5IUSA 4ZUSA 4RCAA 3REWA 5I1EL 2GW5A 4P46B 1ZS8B 1RJZB 1JWMB 4MD0B 4HAGA 1OGAB 4KUCF 1F42A 3G6DL 3GEWB 3MRLB 2PYEB 5F89A 1MCFA 4PJDF 4GBXD 5D1QC 1B2WL 4G8GE 1YC7A 5DD6B 2HT2D 5C6WH 4LKCA 2VDNL 4V1DA 4LSQH 1A3RL 3RTQB 4P23D 4ZAKB 5D5MB 3UJTL 1UWXH 4MQXD 12E8H 2R9HC 2QQKH 3O9WB 5A2IH 2HH0H 3QXDA 1HHHB 2Z31D 1RZJC 2EC8A 4UQ2B 1Y18A 3OG6B 4YBHA 5I8KL 1QKZL 5ENWB 1U9KA 2O5ZH 1TETL 3VCLB 3NIDF 3QXAB 3D3VB 2DWEB 2HTKC 2E7LA 4KHXH 3RX8A 2HMID 3KR3L 1MEXL 4M8VA 4WY7L 5FDWA 4TRPH 5C0ND 3T0EB 5D71H 5F7HA 2CDGB 3BQUB 4MXWL 4GG6B 4NO0A 1ZLVH 5CJQL 3OV6A 3P9LB 2YC1A 4LPYA 1ETZA 5IMKB 3V0AC 3U9UB 3MRJA 3QCUL 4KC3B 5DI8B 4LP4A 3RVUD 5EWIL 1QACA 2NXZC 2WBJD 1Q8MA 4Z0BL 1W0WA 4OCXH 4LIQH 2OJZL 3QIUA 1VPOL 1ADQL 4PRNA 5GGVY 2VXTL 3JUYA 4QXTA 4S1RL 4BK5A 4D9RD 5JXEA 5GHWL 5C07A 1EAPA 3HMXA 5J9PA 4U1HA 1AR1C 5FGCE 4XP5H 4L3CA 4I4WB 5DLMH 3T04D 3QAZC 3DARA 1EEUA 2WANA 1Z3GH 4P2OC 3DYPA 4E0RB 1K2DB 1CWVA 4GW1B 3WN5C 5DDHA 1IC5H 1FBIH 4BA8A 2BNUA 1QRNB 2ZUXA 5C0BB 5I1KL 1MJ8L 1TZHA 2QADB 1HDMA 3B8YA 1KTLB 3HB3D 2Y25A 3QUZC 4FQJL 4XPHL 1NFDA 5IK3A 4OUOA 1HHKB 1HSBB 3QXVA 3L3OA 1D5IL 5HDLA 1NCAL 4LKCB 1FV1A 4V1DB 2W91A 4O02H 5I8EA 3VWJB 3ZKXC 1QO3A 1K4DA 4LHQB 5B8CC 3MRCA 2ADJB 3QEHA 1L0QA 1A6UH 4NHUA 5E2WL 2XZZA 3MRDA 4DKAA 3QXDB 3UTOA 2HFTA 5J13B 1F8TL 2QV2A 4D8PB 1Y18B 1AGEA 1H3PL 2DN7A 2ESVD 3FB7B 3U4BH 3FB5A 7FABL 1T1ZB 3ROLA 5TDNB 2N56A 3N50A 2D9QB 3O2WL 2GAZA 3BT2L 1NCTA 3KLDA 4YHYC 3Q5TA 3RWDB 2RGSA 4TVPE 5DD5H 4OLZH 4D9RE 3B9VA 4OQTH 4M5ZH 2CD0A 4J3VA 3KPSD 3PL6D 4NO0B 2M1KA 3WS6C 1U8HA 4M48L 4TVSa 4EKXA 2YC1B 5D2LA 1JZ5A 4B41A 1ETZB 4MVBC 3VXMD 1JPTL 2DDQL 4X98A 4WV1B 3SE3A 2X9XA 5ITFA 4I0PA 1PDKA 6FABH 2Q8BL 5EIQA 2A9MH 4I5BB 4MNHA 5EU5B 5GS1A 1RFDL 2VZ1A 4X6DF 2B1HL 3KLAA 4N0CD 1IBGL 1OCWL 1EAPB 5C07B 3GJEA 5J9PB 2HT4D 4U1HB 1WISA 5MI0C 2GK2A 3LKSA 5DEGA 3EYUH 4NRYB 4IJ3C 1DLFH 1B6UA 2P5ED 3FN3A 3L5IA 4KU1A 3TVMA 4W6XB 2HTLD 1X5KA 2ED8A 3BX7C 3L3DA 4UIKL 5DDHB 5ADOL 1A6ZA 3MBXL 3WDJA 4YHKL 1ODAA 1IM3A 2BNUB 5EUOE 1ZA3A 5I8OL 4X7SH 1TZHB 1BJ8A 5D9SA 1HDMB 1FNGA 3LEVL 3O0RL 2Z4QA 3U2SA 3V4VL 2ESVE 1NFDB 3DIFA 2EXWD 3IDUA 3IFOB 3C6SB 2FBJL 1ZHNA 5ILTL 2VISB 1FV1B 1A6VL 5I8EB 3ARDA 4GKSB 3T1FA 1F45A 3GNML 4NHUB 1DSFL 5GS3A 5HJ3A 3MRDB 2DLIA 3QEQD 5F3HA 3VFGL 3X3FH 2XFXB 3MRMA 1CFNA 1I3UA 3CVIL 3PWNA 4F15B 1XF3A 3IVKA 1AGEB 4UZGA 2EE3A 3FB5B 3TIDA 5B3NA 1YPZF 3V5DA 4S1QH 3OZ9H 1N64H 1UB6A 4JFPA 1SY6L 4JM2B 5SWZA 5A40E 4B5EA 4LBEB 5FOJA 4XNZC 1Z9OA 2NYYD 3SY0A 1A7OL 2IBGA 5HI3C 4U1JB 3VDCA 2RHEA 5DVNA 4FQLL 1FH5L 4PGZA 4R97C 1BX2A 4JFFA 1X5IA 5E8DH 3NCJH 1U8HB 1UJ3A 2B4CC 2E9IA 3HI1B 3D48R 1WLHA 2Z8VC 2DQIH 5D2LB 1NCCH 3CLFL 4R6UA 3WE6A 2R1YB 2OL3H 2VLLA 2R4SL 3FQTA 1AHWA 2QHRL 1PG7W 4RRPG 5ITFB 4I0PB 4WO4D 1JI2A 4HMEA 5INDB 5T1KB 1P9MC 3W81A 4MNHB 3ARFC 4YHIA 1CLOL 4K7PL 4RAUB 5TQ0L 4EDXA 1Q9OA 2E27L 2IAMC 1RIHL 3HA0A 5EOTA 2W07A 1XGYH 5HD8C 3F12A 3GJEB 3LKSB 4K7PX 5DEGB 4JY6A 1KB9J 2RJMA 2B7DT 1WJ3A 1JNNL 5GISL 2X2YA 3QDJA 4U6VL 4X6CE 4OT1L 1YUHA 4OLXH 5I8CB 3TVMB 3GSVA 4KQ4L 3WFEH 5CD5C 3QHFH 3GSRA 3NA4A 3L3DB 1JTPA 5D1XA 4F8TA 2Z9TA 2KKQA 4NKMB 1QFWL 3DRQB 1IM3B 5FHAH 4ZS7H 1KLUB 1IJ9A 3UO1H 2X4PA 4RMUA 4JZJA 3UTTD 3BUYA 4R4ND 5D9SB 1OLLA 3U2SB 3S3SA 2F54D 4PJEE 5I1LA 2CR6A 3DIFB 2YD2A 2ITCB 4L1HA 1ZHNB 5DHXB 3KPMA 4ZMAT 4FZ8L 1M7DA 2NY1B 1NQBA 1CQYA 5HYSG 3BE1H 2P8LA 2N4IA 3T1FB 1VADA 4N5UA 4AMKL 1S5HB 3BDBA 2IPTL 3TFKD 5HJ3B 4KQ3L 5F3HB 5DJXA 3MRMB 1FG2B 5C08A 1CFNB 5JA9A 1SVZA 3PWNB 1S9YB 1XF3B 3IVKB 3G6AB 4TOYL 4K3EL 4WIQA 4XH2A 3TIDB 4RGNC 2BVEA 2DD8L 2Q3ZA 4P48A 3I6KA 5IEKB 4C55A 1UB6B 1EHAA 1I8MA 4KRPD 2MPAL 4XGZA 2V2TA 1YC8A 2RR3A 5IVXB 3EDDA 4Y5YC 3PQYA 4HKBA 3SY0B 4P2CG 25C8L 3ZKND 1AO7A 1C08B 2BOBA 2VXUL 1JNLL 2W9DH 2A6KA 1YEFH 2ZNXA 3ZKMD 1UJ3B 5F88A 4HKZA 1MAJA 2OR9L 1KJVA 4QHKI 5DHYA 4JHAL 3S96B 1XGUB 4HH9A 2J6EL 2B0SH 3WE6B 1YEGL 2VLLB 5CP7B 1AHWB 5JW5A 1AXIB 1WTGT 3WXVL 4ZUWA 3DVNB 1QG3A 2NY6B 4MAYD 1JGLL 4RX4A 4LLAA 4YHIB 5ITBL 4EDXB 5JMRA 5EOTB 2F54E 3DSFH 3MV9A 3F12B 3BZEA 2UV3A 4LIQE 4HLZH 3EW3B 3CNKA 3V8OA 1X6NA 4JY6B 4MLIA 2AJZA 1OTUD 4M3JA 5C2UB 1YUHB 3CUPA 4ETQA 3GSRB 2CMRH 2YSSA 5E2UH 4LSSH 4R96A 5IG7A 3L5WA 4HKXB 2X4PB 4JJHA 4EXPX 1ADQA 4JZJB 4LPTA 1INDH 2CIKA 3K4DA 4Z7VF 5I1LB 4XPFL 4CKVX 4MB5A 5E99L 4H88L 2C1PA 4OCLC 2A77H 4IRSB 3MBED 1U8KA 1FGNH 3MLPA 3QFDA 1YEKH 4J4PD 1WZMA 3TV3H 1N0XH 1R5VA 3G5XA 1PZ5B 5LCVL 2P8LB 3HG1A 2APVA 3SDCB 5TF0A 1AQKL 2Z0BA 1FVDB 4PGDA 2UZIH 4I2XA 4YHMH 4NT6A 1S7VA 5C08B 1D9KD 4IDLA 3RA7H 3K2UH 5IB5A 5E6IC 1GHFL 4HUMB 4Y1AE 1OTTC 3QA3A 4LARL 3U6RA 4YDLB 1IGCH 2I5YH 4X6BA 3QWRD 2EYSA 1NBZA 3Q6GL 1H0DA 4G9DA 1I8MB 4UT7H 4NM4H 4XGZB 2V2TB 1HKLH 1I8IB 3I02A 4LOUD 5LVEA 4YZFF 3ALXA 2VZUA 3PQYB 4HKBB 4M6NL 3EYVA 4YDKL 4AT6B 1N2RA 1RK0B 3VJ6A 3HRZA 4WCYL 4YEEA 1DBKL 4YO0A 8CGTA 3QRFM 2A6KB 4WRLA 3L3GA 2BFVL 2EKSB 2LVCA 3MLXL 3TJHD 4PLJD 4F33A 1E4JA 4HKZB 5DK3A 2QEJA 3VA2C 4KK8D 4JDVA 3WIFA 4HH9B 2VTFA 4CMHC 5KANG 5GGUB 3LN9A 5JW5B 4OLUL 4KKAC 4G6FB 3AM8C 3MRPA 3QI9D 5E2TL 5KOMC 1HOCA 4Q2ZA 2I60H 1RK1A 3ZT7A 5F7NC 5K9KA 3LS4L 4P3CL 1GRWA 4TPRH 3MV9B 3SKOA 1IZKA 2J88L 5D7JB 1BBJB 4OB5H 1A3LL 2FZ3A 5KG9A 2VDLL 3VI4F 2AJZB 5IROC 4PRDB 4HIHA 3MC0A 1J1OL 4WW1A 1P4BH 1WEJL 2LFGA 5IBUG 1DTUA 5BS0D 4K9EL 2YSSB 3C6LC 4R96B 1DDHB 3L5WB 1HHJA 5DSCA 4NZUH 5I15H 3V7AE 4LLDA 1KELH 1DBML 1BQHA 5HI5C 5JQHC 2BMKA 2R8SL 1UKQA 1RUAL 2PO6B 3WFBL 1V8HA 1IAKA 2ZKHL 4OTXL 5DC0A 4XNMB 1BVKB 3GBMH 3WO3B 2C1PB 3VD7A 5KW9L 4P5TA 2E9BA 1UZ8A 1U8KB 1OPGH 1U41A 2WWKO 4U7SA 3T09A 5L9DL 1KUMA 4FQ1L 3I2CH 1UM5H 5F7UA 2G75B 2IG2H 1WWBX 1XGQA 1R5VB 1OAYH 3BKMH 3G5XB 3HG1B 3BXNA 1HIML 5A2JH 5T3XL 5HY9A 3LB6C 4PG9A 5DHVA 4HC1H 4OZIF 4Y4KC 2P44B 1F58L 4PGDB 4NT6B 2MHAA 3MV8E 4NYLA 1FQ9C 3Q48A 3QZWG 4Z7VB 5J11C 5IB5B 2BHYA 1LE9A 5EC1A 5L88L 5T3ZL 2ZCLL 4M61A 4FQXC 1EO7A 4DKFL 3QA3B 4DQOL 3U6RB 4X6BB 4L8CA 2EYSB 1NBZB 4WWKD 4G9DB 2YN3A 3T4YB 4DZ8A 3CFCH 3I02B 4L4TA 4LSVH 5EU6A 4QOKD 4OGXH 1M7IB 4ZOBA 5I1AA 3G6JE 1N2RB 2I9TB 2XZQH 1VB9A 4DOHB 5FA4B 2GSIB 5EG6C 4YO0B 3BMWA 4WI2A 4N90D 3L3GB 5DMKA 2ADIB 3K81A 4F33B 2WWMD 1CS6A 2H32H 3QP3A 3TN0B 3WIFB 1WZ1L 1CXEA 1QSEA 3QXTA 5EOQL 1KCVL 5BS0E 4HS6A 1SY6A 2F53B 1YEDB 2V17H 3K8MA 4XAKE 4W4OC 1MFAL 1PKQE 4G7VH 4A6YL 2H2SC 4MJ5A 1HOCB 4Q2ZB 2O61A 1RK1B 1QBML 2EE2A 5K9KB 2AKRA 1MRCL 4U1LB 4XMPL 2E8ZA 3SKOB 4Z78A 2EXYD 3EJYC 3MRKA 3P2TA 4J3OC 1FIEA 2EIEA 1J1XL 3TZVC 2AXFA 4FHBD 4HIHB 1IC7H 4I77L 4RFOH 3IXAA 3QEUA 3ZTJH 4R7DB 4PP1D 5T5NG 4LGPB 4HWEL 1Y0LA 4PD4J 3L3JA 2DBLL 1PSKH 1HYRC 1CR9L 1OAQL 4LLDB 5F6HJ 1T03H 4ZO8A 2BMKB 3OWEA 4PJBE 4HS8H 4PJ8C 1IAKB 5IMMA 4X4YA 1JZ4A 4X5XA 4U3HA 3K2MC 4PRIA 1ZEAL 4P5TB 4DGYL 5CP3A 1G7QA 1ACYH 5T5NF 3RTQC 2X4NB 1YNKL 4QOKE 1YY9D 4ZAKC 1XGQB 4WTZA 1NBVL 2BNQA 1G7PA 1BD2E 4PG9B 3GKWL 4H5SB 1EHNA 4ONHA 1YN7B 5FM4A 2MHAB 4NYLB 3PGDA 2FO1A 1LE9B 3PP4H 5EC1B 4PRBA 4NKQB 4M61B 1A6TA 3ZHLA 5IWLA 1NUFA 4NGHH 4L8CB 1T6WA 3H42H 5C6TH 1AC0A 1AI1L 3GUTA 4ONFL 4D3CL 5C6PB 4L4TB 5EU6B 4XXCA 4BZYA 2GK0A 1YEIL 1TXKA 3QPXL 5D6CB 2DWDA 3TCLB 1ZANL 5I1AB 1KB5H 3T0EC 4AQ1B 1DUYA 5SWQA 1Z9MA 3BQUC 3D85D 5F3BB 1S7QA 1R6VA 2FEDC 5F9JA 5DMKB 3LEYL 4ZNEA 3VXNA 4S2SA 4GMSH 3ILPA 3RGVA 3O2VL 2BSRB 1EFXD 5KVMC 1BBDL 2EICA 3EYFA 4PJFB 1QSEB 3LRSB 1AFVL 4U31A 4HGKC 1CE1H 2UVEA 4DW2L 4JFDD 4WUUD 1FCGA 4MJ5B 3X13B 2O61B 4ZTPH 3ZTNH 3EBAA 4XHQA 2VL4A 3AREA 2AKRB 3O6FA 3AUVA 2AI0H 4WI6A 5FAAA 1HEZA 1GVIA 1MCPH 5C0JA 3U83A 3QFJD 1P4LA 1CBVH 3CSYA 5DQDL 1TDQA 3BDXA 3FO0L 1CDHA 1FNSL 1GOFA 2AXFB 1DVFD 1SEQL 2FWOA 1KV3A 3R0MA 3IXAB 4HIXH 3QEUB 1MWAL 4G5ZL 3DLQR 5IVZA 1Y0LB 3L3JB 1UWEH 5B39G 3TA3A 1NCBL 3PDGA 1FVCA 3V0WH 3BP4A 3BWAA 5D1QD 5GJSH 1B9ZA 3IU3A 3DX8B 1EBAA 3QDAA 4X4YB 3JWDL 3S35L 3IF1A 3KS0J 4IOFC 4HW6A 3CMOL 4P3WA 2A83A 5E94B 5A1AA 1G7QB 5GRJL 1Z9LA 2R9HD 3CFBA 2V5MA 3HCVA 1T66C 5TF1H 1A1OA 1I7TA 3MNVA 4RISH 3CSGA 3QUML 1I9JL 4TSBH 2YXFA 2BHZA 5J13C 4ONHB 1VCAA 1G7MB 1KEMH 3PGDB 1MFNA 1UH2A 4PRBB 5TPWL 3V4UH 4XP6L 1HYSD 5C0EB 2EDRA 3PWLA 4ZUVA 4RDQG 3H9SD 1J0KA 3TM6A 4F8QA 4UV7L 1MFBL 2C4FU 2PKDA 2WP3O 4JFDE 1QFPA 4PLNC 2R0ZH 3GUTB 4NNXA 2E7LC 4FNLH 2ZG1A 2UUDK 4AQOA 1AJ7H 4GAGH 2DWDB 1MF2H 1NC4D 4NWUH 4PRHB 3HAEA 3VW3L 2GJ6D 4XC3H 1KG0A 2D7NA 3OGCA 1HH6A 1S7QB 4ODWB 3QFJE 3QG6A 5F9JB 1GGBL 4KVCH 3FOLB 5E0QA 3VXNB 4CVXA 4S2SB 2ZNWA 5E7FA 3RGVB 2E9WA 3SEPA 2D7OA 3EYFB 1Z9SA 1C5DA 3ZYIA 2DIAA 2NY7L 4EI5D 2UY6A 4F80A 4FP8H 2OLDA 3O3EA 4YXHH 3VD9A 1T5XA 3ISWA 5GS0C 3QIUC 2P8PA 1UH4A 4HGWA 1T1YA 1AR1D 2FGZA 3AREB 3KS0H 5JXEC 2Y72A 3DXAA 4FXKA 1PG7H 4P2OD 3IRPX 3S3PA 1HEZB 1AC6A 5GGVH 3LSOA 1HN1A 1GPOH 5DZNA 5I30H 3CSYB 1SJEB 2HLFC 1T20A 4CN4A 1U93B 1P2CA 2FWOB 2ZSWA 3MTRA 5CZXC 3TA3B 3QUZD 3BP4B 5TE6H 3BWAB 1WFTA 2RQ8A 1XAUA 4MCYA 5LGJA 1JPGB 3VXSA 1EA9C 3IU3B 5HHME 2MWCA 1SQ2N 1RZ7H 4FQ2H 1I8LA 2YKLH 4PJAA 1TFHA 4FFVD 3MLUL 3LY6A 1RZFH 2A83B 1HKFA 3RIFK 5DT1H 4CMMB 2AK4A 4K3JH 2Y9RT 3HCVB 1TIUA 4JG0H 1A1OB 4LHUG 1I7TB 3MNVB 4CVUA 1C7TA 4XAWL 1NAMH 1KEGL 4X7TB 1O5DT 3GSOA 4PRPA 4ETYA 4XWOD 3SDXA 2DQJH 4X7DC 4F15C 4MQTB 3BHBA 2IH1A 4WI3A 3GBNL 3V6FA 3PWLB 4ZUVB 1TTGA 1NPUA 5LGHL 4S0SD 1KYOK 2YUXA 3FTGA 1MIEH 4FMFA 5F7EH 4DGVH 4M7KL 2WK2A 4KDVA 4GKOA 3A67L 5DRNB 1EXUA 2HWZL 3AMKA 3HAEB 3SKJL 5GQBA 4ZO6A 1KG0B 4ODHL 3OGCB 5HI4C 3F7VA 3W2DH 4U0QB 3QG6B 2EH7H 1R5WB 3DX9A 1IILE 4MVBD 1I3GL 4CVXB 3L3HA 3NFNB 1IGTA 2VDOL 5F7WC 2EYTA 5MENA 2HVJA 3C5ZA 3HRPA 1KSRA 3SE3C 5JHDB 1T04A 1KIRB 1TCMA 2VKXA 3KVQA 4I0PC 3S36H 1K4CA 2QSVA 4L9LA 1GIGL 5SX4I 2P8PB 1FSKC 1T1YB 1T1XA 3H3PH 1DE4A 5KZCB 1FGVH 5IHLB 3DXAB 4FXKB 4PJIA 2H2PC 4N8VG 4RZCA 3TC9A 3CMGA 4NRZA 4YHOL 1W0VA 2BX5A 4XB8A 5IMLA 1CDCA 1T20B 3U4EA 2VLME 1P2CB 3TVMC 1MAKA 2C7UA 2P5WE 3AROA 1F4HA 1NSNH 4OZFA 2P45B 3RGHA 1OAZH 2BC4B 4XPAL 4DGIH 5HHXH 2GTWA 4KPHH 2NR6C 1U2CA 2MMXA 1P7QA 4NO2A 5HYJA 5BW7C 4IRJA 3RUGE 3MYZA 3BP6A 4PV8A 1IFHL 5J0BA 4YDIL 4NO5A 2NY1C 3G5ZA 1CD8A 2AK4B 4PJ5A 5JW4R 1LK3H 4IMLA 1VFBA 3O6LH 4K3DL 1R24A 1ZLUK 4N8CL 3UJIL 2BNRB 2P49B 4HFWA 5KSBA 2DI9A 3CU7A 4ELKA 3GSOB 1NGWB 4PRPB 2XZCH 2X89D 5KBNC 2UWEA 5HVGB 2CO7B 3WSQH 3SDXB 1V7NH 4L8DA 3VG9B 3VXOA 4GRMB 3BHBB 5E6ZA 1F13A 3V6FB 1QSZA 3BESR 3ZT5A 4CVZA 1LO4H 1GZPA 1IGIH 5HGHA 1X5HA 3FTGB 15C8L 5ISZA 5C0RL 4KK6C 5FO9A 1AXTL 3DYMA 4QRTA 4XP9L 2XYCA 1EO8L 4XC1L 4YPGA 1EXUB 5E2VH 3F7VB 2ZZUT 1UJ3C 4K2UH 2FX9H 1DEEA 3DX9B 1JPFA 3C08H 3DMMA 1QNZH 1WBXA 3KPRA 3L1OL 3NH7L 4UV4H 5I1IL 1AGCA 4X4MA 2EYTB 1PW3A 2R1WA 3WLBB 5FIEA 1CGVA 3C5ZB 1Z6JT 1AHWC 4JFYA 1NBQA 1F2QA 1P4IH 3PABA 1Y6NR 5DMGC 3CDGB 5C0GA 5SWSD 4ELMF 5HD8D 1B0RA 5FHBH 2NY6C 4NQXA 4PPTA 3RDTA 2DQFA 4XXDA 3CSBA 5J1SC 4Q0XH 1RUPL 1W0YT 4JEGB 1G6RL 4MXVE 1A7BA 3MRNA 1F6AB 4NRZB 1W0VB 3QIBA 3UTQB 5CD5D 3UEZA 1M7XA 4TTDC 1GGCL 5C0AE 5KSUA 5IMLB 5L8JB 1FO0L 3QG7H 3U4EB 3RU8H 4EN3A 2XICA 4C83B 4DUWA 2C7UB 1RZ8A 5D1XC 1JGVL 3TIEB 3QISA 3KYNA 5HHVH 4F7MA 4G80A 3ARBA 5CCKH 1MFDH 3C8DA 2PR4L 2VXVH 4A6YB 3LRGA 1F4WH 5I1GL 5IFJA 4JZJC 3DURA 4GQPH 1SM3H 4MLSA 4J7RA 1DN2A 1NMAL 1P7QB 5DVMA 4NO2B 5HYJB 5IB1A 5BZWA 4BYHA 4C56A 3G9AB 3WIHH 2GT9A 3BP6B 4KK9C 3PGFH 4OCYH 3G5ZB 4PJ5B 5H37H 1JRHH 4H0GA 4IMLB 3TT3H 1MWAA 2C3WA 3GMOA 1W2KT 2A73A 1QLEL 4HFWB 5DVKA 4DK6A 2V9TA 4ZTOL 4ELKB 4QHUA 1FC2D 4P2RD 1YMMA 1ZVSA 2UWEB 4DVRL 5DEFA 2BOCB 4RGND 4L8DB 3F7PC 1MAML 4XPTL 4M1CD 3NPSB 1MCOH 1GOHA 2ENYA 4CW1A 4LNRB 5A16A 1NAKH 4F9PA 4MJID 4YGVA 4YDLC 3R1GL 4CVZB 5C0IA 2O5YH 3PHSA 3B6SB 5D8JL 4KROD 1OP3H 1MY7A 3DGCR 4RWHA 2C5DC 5SWSE 1BLNB 3NZHH 5ISZB 4HK3J 1HXYA 4QRTB 4JFHD 4O00A 1U8NB 3FT2A 3QUMA 4YPGB 3C2AL 4HWBH 4K7PY 3KDMB 4PTUA 4ZFOL 5E00A 1DEEB 1JPFB 5KOVC 4DEPB 4JAMA 3HR6A 3KPRB 3M8OH 3GMRB 1MIML 3T4AA 2X4UA 4NQEA 2BZDA 3VGAB 1AGCB 2R1WB 4KMTL 4KRLB 5E9DA 4DK3A 3BIAX 3RWHA 2D03L 5C0GB 3TNNA 4JHWH 2YD3A 5HSFA 5J56B 4HXAH 2NTFB 4JFOA 2DQFB 4XXDB 2CUHA 2GQHA 3M17A 1KN2H 4PJHF 3VH8G 1B90A 5D7JC 5ADPH 1P53A 3MRNB 3D39B 3QIBB 4OLVH 1MUJA 1OD9A 5KSUB 3EYOB 2UUDH 4Q9QL 4EN3B 3PWUA 4LDEB 4NZRL 4NQDB 3WNKA 3H8NA 4ELMB 3MLYL 2XWBB 4F7MB 3ARBB 4P2RE 3BPLB 3DROA 2M2DA 4JRXD 4HX1A 3PGCA 5IFJB 1OD7A 1A9BA 2JCCE 5I1HH 5IB1B 5BZWB 3FT4B 4C56B 4OF3A 4FQIL 1MHPH 2GT9B 3HNVH 1KYOJ 5GZOC 1KF9B 2OSLA 3U9PL 2RAMA 1MWAB 2CRMA 3U48A 3HNSH 2A73B 4LSPL 2R0LH 4QHUB 1UM4L 3UMTA 1YMMB 1ZVSB 3F7RA 2GJZA 4KZDH 2FGWL 2O5XL 1FDLH 1OTTD 1YYLH 4GQ9L 4LAQL 2BY0A 4CW1B 4ODSH 5A16B 4YGVB 3RNQA 1TENA 3MPCA 3FQWA 1NC2D 4KKLC 4EI6A 2R0KL 1OB1B 2H6PA 1FFQA 3U0WH 2BY1A 4PJ7A 3O3BA 5E4EB 3KPQA 1HINL 1AIFA 1HXYB 2QQQA 3ARVA 3EFFA 4PS4L 3U1SH 1Z5LA 3A6CH 3D25B 1E6OH 2LU4A 5DJ2A 5JMOC 3QUMB 3TNMA 4WW2F 3H3KA 4MQSB 1MCNA 3GSNL 4PTUB 1JZ7A 4XMLL 5E00B 2XXCB 1U42A 1XH3B 5DURB 4PLKD 2W38A 4KKAD 1CXIA 1IC4H 2B5IB 1DBAL 4NQEB 1LO3L 3X17A 4OV6F 1CFTB 5E9DB 4OFYD 1R3HA 3WFCH 3RWHB 1DQMH 2QL1A 3HNTH 3IFLH 4JRXE 5FV1L 1DQDL 1INQA 4JFOB 3OAUL 2EDJA 4Z95L 2X70A 4P4RA 4MNQA 4Q6IA 3M17B 4PY8I 4LVOB 3H7LA 4U3CA 4JQXA 4U1NA 3OBAA 4OGAC 4WHDA 4O58H 2ZUYA 3HTLX 3OAZK 3QDMA 1I85A 3G9VA 2YZ1A 5B22A 3BD4A 1FYTA 1NEUA 5CSZB 2OP4L 5JUEH 4IDJL 5HI5D 3TPKA 1F5WA 1BZ7B 1AY1H 1XF1A 4Y19D 1I9EA 1A7RL 3DROB 3PGCB 4PJHB 1A9BB 1ND0A 4P5TC 2D0HA 2HAZA 5EN2A 1U8IB 4XPGL 2DBJA 1RPQA 4Q9BA 2F8VA 1JHKH 1IVLA 1CDYA 4Y4KD 2J5LB 3PWPD 3KJ4B 4JGUA 1JZ3A 5CLWA 1X5XA 2GJZB 5B3JE 4FQXD 4P9MH 1OSPL 5GS0H 3RKDC 4TSAL 4IOIA 3VXRD 1BQLH 1MCWM 4QRUB 2XG5A 3FQWB 3OPZH 4BH7A 3OGOE 3IETA 2H6PB 2AJYL 2DICA 3O3BB 1NFIA 4PJ7B 1AIFB 1CZ8L 1X5GA 1CICA 4RRPA 2IWGA 3TBVA 1NEZG 1Z5LB 4YXKL 5BVJA 5DJ2B 2BVOA 3TNMB 3NFPA 2VC2H 2B1AH 2XOTA 5FFLA 3X3GH 5C1MB 1AKJD 5C71A 5F1NA 1QR1A 1UCBL 2H2SD 1CVRA 3HUJE 4X4ZA 3LKPA 1ZLUH 1FJ1A 3GRWL 1CLYH 5GGTH 4L3EB 3ZYZA 4Y19E 3GK8L 1EDQA 4GSDL 4XBEH 5JW4N 5GSVA 3AS2A 2ZPKL 4PB0H 1PGRB 2X70B 4G42B 4P4RB 1WFOA 4KV5E 1DEDA 4U1NB 1FIGH 1MCHA 3FZUC 5CUSH 3OAYK 3TZVD 1A1MB 5M94B 2XI9A 3VXUB 4HFUL 2FHCA 3KNBB 2LU3A 4OZ4A 2NW2A 3QDMB 3LS5H 4KKBC 1FYTB 3MACH 1I7UA 5AZ2H 1QA9A 4JZOA 2CR3A 3MLRH 4YAQA 4P46D 5I1CL 4MJ6B 3V2AR 1OGAD 3BJLA 1FFNA 2UVFA 5HHOA 4YXLH 4ZFGH 3VI3E 5HYSA 3KYKL 2PYED 3TH3T 3T0AA 1C7SA 5L0QB 2OI9B 4NIKB 4P59H 4NRXA 5FDYA 3FHQA 4KI5C 2F9BT 1A6AA 1MJUH 2J4WL 3NFSH 1M1SA 1G6RA 3RTQD 1ND0B 5IHUH 1CE6B 4NOFA 4OUUA 4HEME 5EN2B 4ZAKD 4LLWB 5C09B 3O9WD 1FO0A 2IPUG 1G9ML 2GEEA 4ZPTA 3EKCA 1MCWW 3WFHA 2OR7A 3I85A 3PXHA 4L5FL 4PJGA 3QNYA 5HGBA 2GTZA 5IGXH 3ESVF 4OZHE 2BDNL 3JV6A 3I50H 5LQBL 1WAAE 5ECJE 1LP9F 3D3VD 1BAFL 4EIGB 5GRWA 2J8UF 4LSTH 4UDTA 5IWLC 3UPRB 5J6GA 3B8SA 4BH7B 4CDHA 3L3IB 4WEUD 3P0VH 3VFPA 2GJJA 3T0ED 3IETB 1NLBH 1CTOA 3BQUD 3IJSA 4NN5B 1WBYA 4XXCC 3U7WH 3FRUB 1TMCB 2FEDD 3OX8A 1KJMA 1RIUL 2DYPB 1G7JA 1NDGB 5DD1H 3MO1A 1FAKT 3V7AG 2WLYA 3RGVC 5IW3A 4K23L 4ERSL 4DTGL 1ZGLM 3LKPB 3GSQA 1FJ1B 3QUYA 1OGAE 4ESKA 1Q1JH 2PYEE 2E9JA 2XKNB 4H0IA 4K8RL 5GSVB 2C3VA 1LEIB 5GRYA 5BZDB 4KJWC 3FO1A 4PJXA 3B5TA 3AREC 4QGYA 3O6FC 1J87A 5DD0H 2QTEA 3Q1SL 4ZFOA 3P9WB 4PBWD 4WEBH 3TJEL 2DQUH 3QO1A 3B5GA 1J5OL 4LF3A 5KS9B 3KXFA 2BVTA 1CU4H 4HJ0C 3AY4A 3ZSSA 1JWUB 4KY1H 1QRND 5C0BD 1I7UB 1LEGA 1LDPH 2FLRT 3OKEA 2QADD 1ERNA 4YAQB 1EPFA 1A9EB 2MCPH 3TA3C 5HHOB 1FFNB 1DQLH 4F7PA 4W4NA 1NGPH 5I18L 4NRXB 4IOFD 2XY1A 3BD3A 4Y2DA 1FAIL 3EOAA 3N85H 1G6RB 1RIVH 1ZHBA 4G8EA 1MJ7L 3TYFA 3VWJD 2MOVA 3MRBA 1T66D 1YJDL 3MGTA 2JJWA 4UB0L 5ICYA 2Z92B 1JL8A 1FO0B 1L0XA 4UUJA 2VERN 5I73B 4GG6E 4ZPTB 4KGJA 2ZCKH 2ATKA 2LVEA 2X1XR 5D7KE 3WFHB 4G6KL 3HI6H 1S5IL 1T5WA 5FK9A 2FR4B 4PJGB 3QNYB 5HGBB 3NCEB 3ZHKA 2GTZB 3PIQA 1U3HA 4OLWL 4L4VA 5M95B 3MV7A 3VD4A 3MLVL 1ZWIA 2NLJA 4N1EA 4G9FB 4UDTB 1NGXB 1MREH 4HPYH 4OD3L 5J6GB 2NY2B 4I9WE 1F3DJ 2DKSA 3VFPB 3PF2A 1QSFE 5GRUH 4KVNL 5TFSL 3IJSB 1WBYB 1CFBA 2J12B 4NO0D 3O3UN 4M02A 3IRZA 3OX8B 3WHXA 1SEBA 2EDFA 4UTBH 3MO1B 4AIZA 4JPKL 4D9LH 4G7YH 3ULVL 3F5WA 1IRAY 1G7LA 1QRNE 2CUMA 2BRRL 1IAII 1U8OB 1P69B 5KVDH 3HC3L 5GS0D 5DJAA 4YR6A 2HYMA 3INUH 3QUYB 1WCBB 1OLZA 3BEWA 5DR5H 5C70A 5CEZD 5JXED 5IEHA 4BSJA 2JELL 5C07D 2C3VB 4X9GA 1KFAL 4PJXB 3P9MA 3QWOA 4LCIH 2P1YA 5LGKA 2HLFD 3GSNA 2KQNA 5C2BH 4ZFOB 5F21B 4OLYH 4PJBF 1S9VA 4JZNA 3QO1B 3LQAH 4LF3B 1V3JA 3MZGB 1YQVH 4JY5L 5CZXD 4AEIL 3BZDA 3W5MA 2VQ1A 3RKPA 4JVWA 3VFOA 1B2WH 2ZUVA 4OCMC 5JXAL 3RY6A 3BGFB 2ORBL 3CVHL 2VDNH 4PUBL 2R2BA 2QLVB 3OKDA 1A3RH 4F7PB 1U92B 2VLKA 4HCRH 4YH6A 5LAXA 2IFFH 4Y2DB 4GMTL 5HGAB 1R0AL 2DIBA 2F8OA 1ZHBB 1I8LC 3QZWA 4G8EB 1DQJA 1F3DH 3MRBB 4U6XB 4G3YL 5J6HB 3MGTB 3ZE2F 4LCYA 4UUJB 3V6OA 3ZYJA 1RZGA 4I0KA 4BZ1H 2ATKB 2FHBA 1GAFH 2X1PA 1QKZH 4K9EC 3QPQC 1TETH 5FK9B 5DFWH 4QXGL 3PIQB 1B0GB 2DM3A 5TH2B 2FECI 3OAZH 3MV7B 3KR3H 3M45A 3DHJA 1ZWIB 3ELAT 4JM2D 2NLJB 5BV7L 2WM0A 1F4YL 5CJQH 3SOBL 1J0HA 5C0CE 1TJGL 2CXKA 4HLZG 5HVWA 1ZHKB 5EU3A 3WKNA 3BDYL 4MQ7A 4PJCA 1ZT7B 4KKCC 5EWIH 4HUWB 3WHXB 1SEBB 4Z0BH 3RVWD 2VL5B 1ES0B 1XZ0A 4AIZB 1FYHB 1VPOH 4MHHG 1ADQH 4Q58C 3VD5A 3RVXC 2E6JA 2BSED 3F5WB 4HBCH 1G7LB 4I0PD 4MNGE 5GHWH 4FQHB 4KWUA 5IQ9B 5T1KD 2CPCA 4AL8H 2Z91A 3C5ZC 3ULUH 4YR6B 5DJAB 4NUGL 3OR6A 4ZPVA 2R15A 3B9EA 4TSCL 2DLGA 5IBUB 4OJFL 4L9LC 2YEZA 2H2PD 1C5BH 5ESQA 3P9MB 3QWOB 3PDOA 2NY3C 4RFNC 4JRWA 3CK0L 3GSNB 1OY3B 3TVMD 1MJ8H 1S9VB 4JZNB 4U49A 3QRGL 1KTKE 2C1OA 4XVSL 2XZAH 5EZIL 1CD9B 1R3JA 2VQ1B 4NPYA 4DZBA 1Q0YL 3BD5A 3VFOB 2NR6D 3LMJL 1T2QL 1D5IH 2W59A 1KCUL 5EBLA 4M4RA 3FQNA 3PJSA 2AJVH 1NCAH 5HVHB 4WTXA 3OKDB 2YPVL 2NX5E 4KTYA 1JPSL 2VLKB 3W39A 4AG4L 3PV6B 4IRJC 4N0FB 4QWWD 1G7HB 3DPBA 5MEOA 2VDQL 1IAIM 2NY1D 1DQJB 3FMGL 1EJOH 3RY5A 3QEGL 3VFUA 1F8TH 3O6ML 4ALAH 3SDDB 2XTJB 4LCYB 1I9RL 3TPUA 1H3PH 4XBGA 1RZGB 4B0MM 3L5XL 5CIPA 1U91B 2OQJA 4J6RL 2I07A 4YHLL 3NABL 3OAYH 4OFVA 5D2LE 5DJ0A 3E2HB 5F72S 1RVFH 3P11H 3NPSC 4FTVE 2P46B 1BWWA 2EDBA 4Z5RA 2E3VA 4X6EA 1JFQL 1UA6L 2A6IA 4Z7UA 2D7PA 4MAUH 1KJ3H 3VXQB 1UYWH 2FSEA 2ADGA 5F70A 5EU3B 1Q9WA 3FFDA 1OP5H 4MQ7B 3CX2A 4WU7A 4UIMB 8FABA 4DEPC 4TVPL 3RWGA 3ALPA 1WICA 4AM0A 1IBGH 1OCWH 4LASL 2Z91B 5J4MA 3OR6B 5IVNA 1FFPB 5ANMB 3ZE1F 2YEZB 4Y5XA 1QR4A 5B39A 3M07A 2VMFA 2OTWB 2AAVA 5ESQB 3TBYB 2ZUTA 4GFTB 3PDOB 2HRPL 4UIKH 4O9HL 4HMCA 4TTDD 4OKDA 1HQRA 1C1EL 4NCC1 5C92A 4FZEL 3QIBC 2MKWA 1T7ZA 2C1OB 3K1KC 2YRPA 3O0RH 4EN3C 4NPYB 1VFUA 3V4VH 4LSRL 3GJFK 4QRPE 3VRIA 1EH9A 3H3BC 5EBLB 4M3KB 3FQNB 3PJSB 3ARBC 1E28A 3X12A 3BPLC 3OXRA 5IW1A 4M43L 2V5TA 4IRSD 4KK9D 3BZ4A 1BFVL 3ET9F 5IVXE 5MEOB 1DSFH 1FZMB 3VRJB 1CD1A 3VFUB 2EEBA 5F93C 3CVIH 4BZ2H 3SDCD 4XBGB 3WXWL 5CIPB 2F8XC 2FX8L 1D5ZA 2W9LA 5C08D 2OQJB 1SY6H 2O26U 1KJ2A 2IGFH 1YPZE 2XN9E 5KTEL 3VE0B 1A8JH 3HC4L 2Y36L 1A7OH 1NGYA 3S98A 5T1LA 2M26A 2Z8SA 3JWDC 4F9PC 2RIKA 4FQLH 1FH5H 3THMH 5IP4A 3O3DA 3PQYD 2PCPA 3EYQC 4HXBL 1OAUL 4X6EB 3SGEH 1N8ZA 3BPOB 2A6IB 4Z7UB 2R1XB 4MA7H 5E4EC 3DGGB 5EOCL 5FGBC 4JRYB 4DAGH 2CKBB 2J2ZA 3CLFH 3LIZH 2ADGB 1Q9WB 3IKCA 2ICCA 3FFDB 2QHRH 3K46A 3UP1A 4E42A 5ICZA 2FIKA 1A7PL 1KC5L 5FCSH 3CDCA 1A21A 1CLOH 4K7PH 5FYLL 3ZTJG 1IQDA 4NQTA 4G6FD 2VZTA 4M6MH 1RIHH 2B5IC 4P2YA 5B4MC 2XIDA 4X7CC 2UY7A 4D2NA 5CEXA 3IU4L 4JPVL 1FNLA 4RX4D 1ONQA 4OM0L 3MV9D 1J8HB 1JNNH 5IBLD 4U6VH 4Y5XB 4LLYA 4OT1H 5D7JD 5CKAA 4KQ4H 3L5JA 3PDDA 3JSSA 5D70L 4LVOC 4WHCA 4YHZH 3EOTH 2D3VA 5DGRA 5FYKH 2UYLA 3ZHDA 1FLTX 1QFWH 1HK6A 2JLLA 1N6VA 2VLJB 3MOAL 4OCWL 5KSAA 5JOPD 4HT1L 5ESAB 3RUGF 4Y5VA 3VRIB 5TE7L 4M6AA 1KPVA 2RBLA 1JWSB 2PO6D 4EEEA 1DANU 3E8UL 1S9XA 9CGTA 5C9JA 4LHUA 5L2KA 3ULUD 5EZJA 1RZKL 4AJ0A 4F37K 5CSGA 1PKOA 3IS0X 35C8H 4RMQA 3BZ4B 2BVYA 4AMKH 3QDGA 2IQAA 2IPTH 2VWEE 4J1UA 5GZOD 2F19H 2JJSA 1MCCA 1SVCP 3KPNA 4KQ3H 3HG1D 1FC1A 3KYMA 2NY5L 5CKGA 1S7UA 2FYYA 4TOYH 4K3EH 4JVPA 2DD8H 1AR2A 1D5ZB 5IIEA 4HIEA 3T2PA 5BO1H 5I74B 5FB8A 3CVHA 3CXDH 2MPAH 4PR5A 2HKFL 1X7QA 5JQ6H 1BF8A 3UTSA 5EO9A 3RIAF 5GIRA 1ZMYA 2DQEH 3EYSH 5T1LB 25C8H 1KIQB 4KKLD 1JNLH 3EDJA 3LQZA 3S4SG 4QF1A 3O3DB 2NXZB 3GKZA 32C2A 3B3IA 1E4WH 3H9HA 1U58A 2PCPB 2OR9H 4Z7WA 4C4KO 5GXBB 4G8GA 2F5AL 3TWCL 3ARYA 2J6EH 5IB3B 4B50A 1S7XA 1YEGH 1CDGA 3GMNA 2GY7B 4LCWB 3TN0D 2FIKB 4XCEA 2O5ZL 1JGLH 1WGOA 2AEPL 1BVZA 1R3IL 4N8VA 5ITBH 2F53D 1IQDB 1RU9L 4KAQH 3QNXB 2ADFH 4KDWA 3WN5B 2YPLA 4ZD3H 3RJQB 1DP0A 3ILQC 2ZUWA 1KNOB 1RUML 4D0CA 4JQIH 1ONQB 1QLFA 5CMAA 4GAJH 4R8WH 3FT3A 2DRUA 5BMFL 3MA9L 3ULUE 4LLYB 5JZ7C 4OGAD 3JWOL 5L8LB 2R2CA 3RWEA 3TBWA 4JQXC 5I17B 1T89A 2UYLB 4HZLA 3FFCB 3MA7A 3FQUA 4OZGF 5E24E 1MLCA 2AJSH 5KSAB 2AK1H 5BVPH 4OCXL 5B8CB 1BQSA 2P24A 3TBSA 3EO1A 4R9HA 5E4IA 2YD7A 5T33L 4H88H 2C26A 4Y5VB 5DK0A 3SCMB 3JVGA 1KPVB 4HKJA 3R06A 4Z7VE 1T80A 4R0LB 3LKNB 2YA2A 1ZKAA 1S9XB 4KTDL 3MZTA 5L2KB 5L0QC 2OI9C 5DLML 3SDYH 3CFKA 4P5TD 4GW5A 1MHHA 2PYFA 1Z3GL 3RWJB 1J0ZA 2JTDA 2GSGA 3HAEH 3QDGB 1GH7A 4J1UB 1YEEL 4OFPA 1AQKH 3IDNA 5C3LD 2APXA 1FBIL 2G5BA 1FNHA 1CG9B 4TULH 3A0OA 3KYMB 4DOHE 4GBXA 1S7UB 2FYYB 4PGEA 1FPTH 1GZQA 2ED9A 2VUYA 5IIEB 3VFRB 5IB2B 4AYFA 4XZUB 3RKDD 1AGFB 3TCXA 5FUOH 4PR5B 1NL0L 3KHOA 3UTSB 1H3XA 4M6NH 1J0JA 5GIRB 1ITBB 2F53E 4YDKH 4YZFE 4O02L 4ZSOA 3QSKB 4L4TD 5EU6D 5KN5A 1DBKH 3CD4A 3P4OB 4R2GB 2BFVH 32C2B 3B3IB 1A6UL 3H9HB 1U58B 3MLXH 1RAMA 4X5WB 1DQTA 2LQRA 1L9NA 4FA8A 4Z7WB 3BOVA 4NN5C 2W1NA 3ARXA 1CICC 1MLBB 5F1KC 5CZVL 1S7XB 4Z7QF 2XRAL 3GMNB 5I1DA 5MI0B 4OLUH 4NNYA 3U4BL 3BH9A 5C7XL 3EDFA 4MA3A 1QSED 1N5YH 1I1YA 4N8VB 3N0PB 3X14B 3LS4H 1E27A 3BKYH 3GZKA 4P3CH 3W5NA 3O41A 2DQCL 1ZK9A 4QHKJ 2YPLB 1G84A 5DD5L 2OZ4H 5BV7B 2OXGA 1CXKA 4OAWA 1A3LH 4D0CB 4OD1L 5CMAB 5CJ5A 2VDLH 5I6XC 2Y5TA 3FT3B 2BHUA 3GMMA 1MFEL 3FZUD 1PYWA 4NP4L 3RL2A 3BZFA 1GSMA 1J1OH 3VI4E 5SV3A 3UAJC 3TBWB 2WBJA 4W68A 3HFMH 4HZLB 4KKBD 3MA7B 1DCLA 3FQUB 3LOWA 1P1ZB 1TZIA 1OAXH 1MLCB 2R8SH 2CGRL 3OHXA 6FABL 2VKWA 3RQ3A 4HQQH 3UBXI 2ZKHH 3EO1B 4J12A 1JGEA 3OSKA 5DK0B 3LKRB 4HKJB 2PUQT 3R06B 1X5AA 4KI5D 4R7NA 5L9DH 4FQ1H 2ICWB 3UROR 1T0MA 3I9GH 4ODUA 4HLJA 3CFKB 4PP2B 4GW5B 4XRCB 1MHHB 1DLFL 1UXWB 4GXVL 3RX5A 4XP1L 2GSGB 5T3XH 4OZGB 5EU6E 2CJUL 2X1WL 3IDNB 5EBWA 3S97C 1F58H 2G5BB 3MRQB 5IFHH 3L7FA 1YY8A 1C12A 3P3YA 4OZIE 4X7SL 5T3ZH 5I73C 4LKXB 2ZCLH 3ZDZF 4PGEB 5FGCB 4MHHI 4DKFH 1Q38A 1XR9B 1ZT4A 3MOQA 1YECL 2NPLX 2EC9U 5CJBA 3D87B 3BISA 3F7YB 4PJFE 2Q87A 3P30L 2LE9A 4ZSOB 5EUOA 4RSVA 3MROA 5KN5B 4JO2L 1I3VA 3OJDA 4PRHD 3ARFB 4H26A 1UWXK 2IAMB 3X3FL 2EDWA 4LPVA 5DRWA 4BFIA 3RWFA 4B7LA 4J23A 1CGUA 1WZ1H 3MREA 4JG1H 5I1DB 4BQCA 3RGVD 4NNYB 3QQ9C 3BH9B 5F9AC 4A6YH 3CXHK 2C3GA 3A6BL 3VH8A 4MA3B 1N7ML 1QBMH 1CDBA 1P84K 1EHXA 1MRCH 1E27B 2AVGA 3GM0A 3Q6FA 4XMPH 4KMLB 1X44A 5GGQH 4CUCA 3H6JA 3QUYC 5BCAA 2CK0L 3ARED 1ZVHA 3QCTL 2Y5TB 3RL2B 2G60H 5HPMA 3AS3A 1KLFA 4Z0XA 3DECA 4HJGA 4HWEH 1HE7A 2DBLH 5GGSA 5DWUH 1X5LA 2SEBB 3W0WE 1CR9H 3T8XB 3PE9A 3GIZL 1RV6X 1TZIB 2BSTA 1ZVYA 3AY4C 5FYKE 1GJIA 3TA3D 1GC1H 5SV4A 5IQ7L 1JGEB 1NGQL 1U8JA 2X4OB 3B43A 5ID0A 3QCVL 1ZEAH 1XGYL 2VAJA 5FYJL 4DGYH 3BGFC 3U0PB 1T0MB 4ODUB 5IMOA 1BHGA 4Y2DC 4ZUTA 3CSPA 4WJ5A 4NZDA 4OLXL 5EO0A 5B3JF 3WO4B 5A3IC 1X5FA 2QQNL 4YFLF 2ZP0T 4PRHE 1C12B 3LKQB 4LU5H 1K8DA 4RWYH 4LLVA 3QQ3A 4ZNEE 1ZT4B 4TQEL 4LRNL 4X6CA 4G8FA 3VGGA 1AI1H 1U3HC 4O2FA 4UOW1 4ONFH 4D3CH 1YEIH 1O7SA 5JNYA 4Y2OA 5DS8A 5EUOB 3DO3A 1QBBA 3HZVA 2QHLA 3LEYH 3OJDB 4APQA 1I75A 4PJEA 3WMSA 5MEQA 3O2VH 4NN7C 1JMZA 4JO4H 5DRWB 4BFIB 2AJUL 1BBDH 3RWFB 1TTUA 5D2NE 1AFVH 1ZAGA 4WNQA 5DRZA 3MOBL 1F4XL 1GGTA 5D7LE 1U3JA 4KV5F 5SX5K 3FOMB 1DJSA 3CC5B 5JHDD 1MHCA 1BM3L 4XHJC 3Q6FB 2L7JA 4Y4HB 2IC2A 1I1CA 2VNCA 5HDQH 1OW0C 2WZPD 5DQDH 5KZCD 3UYOD 3DXAD 3LDBB 2VXSL 5HPMB 5DTFA 1MWAH 3VI3F 1OL0A 3MODH 4HJGB 4RNRA 5FV2A 4EZMA 3EO0A 5GGSB 1NCBH 2B0SL 3OXSA 2AQ3A 5D7IB 3FONA 5DD3H 5H37G 4U7MA 2BSTB 3D18A 1KCRL 3TO4A 4B7IA 3EHBC 3JWDH 1FNEB 5ID0B 1U8JB 2R2HA 2VAAA 1REIA 2YHGA 3LV3A 5L8KB 4KH2A 3DSFL 3CMOH 3RY6C 5HVHC 5GRJH 5E6IB 1O7VA 3KWWA 4J3TA 3T0VA 2DQHL 4ZUTB 1FHGA 4WJ5B 3QUMH 2BVPA 3IKKA 4YNYB 5EO0B 1GXEA 1IGFH 1CIDA 2AK4D 3DVIA 1SJHA 4QRQA 4M8QA 5ACMA 5EBGA 2BNRD 4I1NB 2N1KA 4FFZL 4LSSL 3JV4A 1YMHB 2F54A 4Y16A 3S88L 3QPQD 5TPWH 2R29L 3V6OC 4PRPD 4XP6H 1K8DB 4ZNCD 3MUZ1 4LLVB 2FJGA 2ZUUA 3QQ3B 4CGTA 3U36A 4RBPK 3CFEA 3C87A 1NEZA 4X6CB 3E2HC 3HZKA 1QVOA 4QYOA 1FZOB 3IFPA 1FGNL 3GHEL 4JFEE 5F9OL 1JHLH 5JHDE 1YEKL 5JNYB 3VW3H 5DS8B 1N0XL 4WWID 2P42B 3MXWL 1TJHL 3O11B 1GGBH 4BJLA 1FFOA 4APQB 1OQOA 2GCYA 2Q1EA 5T3XD 4S1DD 4KKCD 2UZIL 3C5JA 5BXFA 2J8HA 3K2UL 1INEL 1Q0XH 4GRWF 1T22A 5FUZH 5DJCA 2X05A 4WNQB 5DRZB 5T3ZD 3RVXD 4BELD 5D1ZA 2NY7H 4U1SA 2I5YL 1JP5A 3C5ZD 3W9DB 4NM4L 1MHCB 3EZ8A 1HKLL 1PX3A 3ETBF 5D5MF 3MV11 3C6LB 5CGYC 3N06B 4YBLB 3MUGA 1EZVX 4Y1AA 1AXSA 1CT8A 2FATL 4LMQE 1OVZA 1RUKL 2DLTA 2VABB 4P49A 4RNRB 3EO0B 1CFSB 4H0HB 3ZT6A 2AK4E 1SYSA 3OXSB 3FONB 4OZFG 5L6YL 3DNKA 2BNRE 5K9QG 2FEEI 3D18B 3TO4B 1NCUA 4Z9KB 3KPPA 4LFHD 2WWKT 2R2HB 2VAAB 3SDXE 1DR9A 3LV3B 3SE9L 2I9LB 4QNPF 4IEFB 3MLUH 4YHPB 3BIBX 1P7QD 2D7TL 5F6HI 4GG6F 3S9DB 5HYJD 5J11B 4OB5L 4N5ED 4ZUUB 3D0LA 3KWWB 4LPWA 4DCQA 4XAWH 2E8YA 2BVPB 1KEGH 3K0WA 1P4BL 4PJ5D 5I19H 1QLRA 4LK4A 5A2LH 4Y16B 4YK4B 5I15L 4R4FH 1KELL 2B20A 3GBNH 2G2RA 2FJGB 3E6FB 3MBEA 5IESH 2B39A 5EULV 2JJUA 4KJYB 3CFEB 3MYJA 1TQCC 3H0TA 5DJYA 1U8PA 3G5YA 4M7KH 3HZKB 4YJZL 1QVOB 3IFPB 1OPGL 3CXHJ 3IDIA 3A67H 3LH2L 3GSXB 4LRIA 3OKOA 1BIIA 1N59A 1P84J 4UDUB 1B88A 2D9CA 4YX2L 3BI9X 2IG2L 5ISZD 3BKML 1OAYL 3CU1A 4ODHH 1FL5B 1A14L 3MR9A 2EYRB 4GAYA 2MJWA 1FFOB 1I3GH 1D5MA 1HXMA 1HZHL 2GCYB 3B9DA 4ZDHB 5JOEA 1EFQA 1G9MC 4P4KA 2VDOH 1CCZA 4X83A 2VJXA 3TBTA 1EIBA 4AEEA 1T22B 3KPRD 5DJCB 4M62H 5D1ZB 4NCDA 4U1SB 2V2XA 3IDGA 2CDEA 3CFCL 5JOFB 3IGAA 3W11C 2ARJQ 5JIPA 3MV8A 3P0YH 2DLFL 5LBSH 2X44D 2XZQL 3P4MA 1YEJL 2HLAA 4Y5XC 4Y1AB 1BEYL 3B9KA 4HH8A 1CT8B 4NQCE 3STLA 4PJ8B 4GRWB 1YYML 3HKFA 3D39D 3QIBD 2CKNA 4KHTH 3QI9A 1MPAH 1KB9K 5C86A 1D6VL 4PJ5E 4EN3D 2UZXB 5AYQA 5AG9A 5DJ6A 4NQDD 3SJVB 3G6JA 3JXAA 1AE6L 5H35A 3ARBD 3NACH 4CU8A 2PXYB 5EUKA 1AH1A 5FO7A 3KPPB 1I1AA 1Q9LA 4F7CA 1BPVA 1IFHH 2NMSA 1LHZA 5DMYA 4K8RC 4NKIL 3VMOA 1R5IB 4NKOA 1F6FB 4C56D 1LEKA 3OB8A 4K3DH 3TF7C 3UJIH 4DCQB 1IC7L 4GUPA 1PKQA 4RFOL 4Y4FB 3MNZB 3PHOA 1A47A 3BP5A 3QT2A 4IS6B 4NQVA 3L3KA 1JZ6A 3V5KA 3JV5A 2F74A 1YMMD 3O4LB 4Z18A 3AC0A 3MLTA 3ZMRA 4ACPA 4NFCA 5DA4A 3BUTA 4L8BA 5DZLA 5I74C 3MYJB 4JFZL 1OAKH 2L4OA 1U8PB 3G5YB 3FB6A 4NJAH 4X4ME 5C0RH 3LZFH 3IDIB 4LLMB 3EYQD 1TVHA 2C4XA 5IW6A 4TTGA 4XC1H 3OKOB 1BIIB 3T1WA 1A4KA 4MA8L 1BFSA 5TQ2H 3NIFE 3I6GB 1YJDC 4Z76A 4HIIB 1ZXQA 3MR9B 4PJBA 1KXTB 1HXMB 2JIXB 3L1OH 5CJ8A 4PFEA 3GO1L 3SO5A 4P4KB 5I1IH 1UEMA 4I8DA 5IVOA 4HUVA 3D39E 2ENSA 4JANA 3PP4L 3WFZA 4CADA 2WQ8A 5DURD 1NFDF 5BJTA 1UEYA 3U7YL 2VO5A 5B4MD 1GGYA 3J7HA 4QOKA 2XA8H 3PHQA 1G1CA 3IDGB 2E7BA 2F15A 4N0YL 4NQDE 2IPKA 5E9DD 1MCKA 4ELME 1BD2A 3DETC 4IMKA 5K9OA 1RUPH 1NCWL 2R69L 1G6RH 4OI8A 4LPCA 3MV8B 4ZUSB 4ZQKA 3REWB 1H15A 5EBMA 1GGCH 1FO0H 3B9KB 4F58H 5F8RC 4KTEL 5F89B 2BJMH 5ICXA 2FEEL 1BECA 5F71A 1JGVH 5F1IA 2PR4H 1X5ZA 4NNPL 4OQ1A 5AWNL 3I6LD 4JM2F 1CE1L 3ULVC 5DJ6B 5KSAC 3G6JB 4PGCA 4S1SL 3OMZA 1NMAH 3ALWA 3FJTA 1Y6KR 1YMME 5GRZA 3L5HA 5EUKB 3ZTNL 5KAQF 1I1AB 4Y5VC 3SCMC 4R0LC 3IAQA 2NZIA 3O6KH 4QTHA 1MCPL 3MJ7A 1II4E 5SX5H 1CBVL 1LEKB 4E41A 5D2LF 5EU7E 4L4JA 1QLEH 1F3RB 5E1HB 4GUPB 1PKQB 1M4KA 1E0OB 2JJSC 1XGTA 3PHOB 3BP5B 5B21A 3E3QE 4OV5A 4NQVB 2R4RH 3L3KB 3HHRB 4J3SA 1G9NH 1MAMH 5KVGL 4XPTH 3V5KB 5FUCC 5T5FL 1KBGL 2F74B 4POZC 5FDWB 3MLTB 4MWFA 2WP3T 4DN3L 3EDEA 1FORL 5D8JH 1TITA 3NAAH 1NMBL 4P9HH 2P47B 3BO8A 3MNWA 2ARJA 2H26A 3G08A 4GS7C 3VA6A 3FB6B 1NMCB 4KXZI 4M9OA 5MERA 1RHHA 5DFVD 1TVHB 3MRJB 2ZWLT 4ZOEA 3C2AH 2AV1A 2WUBH 4R2GC 4RISL 4PB9L 4Z76B 1CXLA 1E4XL 1MCJA 1W0WB 3QIUB 4KK5C 4RQQA 4TSBL 1PD6A 4PRNB 1DUZA 4QXTB 3R4DA 4JB9L 4HUVB 1KEML 3RPIA 4JANB 1LGVA 4XT1C 4P5MA 2J7LA 3O2DH 1PY4A 5BJTB 4L3CB 1MCSA 1XF5A 2IEPA 1MHEA 3I6LE 5F96L 2PNDA 2IPKB 3ILQD 3EOBA 1MCLA 1T7WA 2W60A 4L3ED 5D7SL 1ZV5A 1BQUA 3D85A 1BD2B 4OSUH 5DZOA 3TLRA 3SGKA 1AJ7L 4RBPH 5BV7C 1MF2L 4PJHE 4ZG1A 4XC3L 1H15B 3T3MF 3LPWA 1EFXA 4QXWA 4KRMB 2EDHA 3T2QA 3UYPA 4Q9QH 4C54A 1C8PA 2DMCA 1XR8A 3VXUD 5ICXB 5IK3B 3K7UA 4JFDA 3QDMD 3L3OB 1T89C 4NHCH 1FYTD 3CDYA 1J0YA 3L6FA 4M5YH 3OJ2C 5IVXF 1QO3B 1K4DB 4LAJH 4FP8L 4YXHL 3MRCB 3QEHB 3TO2A 3QFJA 3WCYA 1EEYA 3JVGC 5JHLL 4FQIH 3KPSE 5E1AA 4TUJA 4RA0C 3TT1L 1PG7L 4QTHB 1J9CT 3H2WA 2WINA 3P73A 3MJ7B 5I30L 3WFDL 3OQ3B 4E41B 5IBTH 3BGAA 2APTA 2Z93A 3HN3A 5C09D 3VXME 4LSPH 1DL7H 3SE8H 4M7LT 1UM4H 3ROLB 4X7FC 1XGTB 2EIZA 2GAZB 3CPLA 4OV5B 1QHPA 3VFTA 2V7NA 4R26H 3LCYA 2EDQA 3RWCA 2FB4L 1UVQA 5HHNA 2FO4A 4GQ9H 4LAQH 3VGHA 4MWFB 2ICEA 4HDIA 4GO6B 1RI8A 1AP2A 4QRSA 1J05A 3BO8B 2R0KH 2ARJB 2OMBA 4P99A 2GYSA 1IKFL 1GGIL 1HINH 2P5EE 4MQXC 2OCFD 1RZFL 1RHHB 4LGSB 3WIIH 4I18A 4L3EE 1UB5A 4K3JL 4YIQA 1D3CA 4X98B 2VN7A 3GSNH 2AV1B 5EB9A 4M4PA 1VGEH 2KZ1B 1YZZA 1JK8A 2DYPD 1TQBB 1FSKB 5HYEA 1DUZB 5GS1B 1JRHI 5A2FA 1DBAH 4PJ9A 3KLAB 3VXUE 3DUSA 3QDME 1WQVT 5D96B 5FXCH 2VRAA 4N9GA 4JLRA 3OAUH 5F7EL 3EOBB 3AAZA 2ZUSA 1A6ZB 3BRFA 1P7HL 4RMVA 1ZA3B 3RIAK 3SPVA 3QEQE 4XCFL 3PG2A 3UAJD 1WIPA 1G7IA 1FNGB 2Z4QB 2EH7L 5IB4A 1XR8B 2WBJC 5C09E 4EI5A 3MQIA 4UBDC 1A7RH 4HWZA 2G5RA 3T3PE 3S36L 3RRQA 3ARDB 5CZKA 3M1BA 5HHOD 4PD4K 4P2OA 3RY4A 2YMXH 5ACZA 3HPLA 4X0KA 3TO2B 2NQCA 1FGVL 5EPMA 5E1AB 4TUJB 1W72L 5IJVA 3S37L 3P73B 2EDTA 3IDJA 3SKUD 5ESVA 2H32A 2Z93B 1I4FA 3V5DB 3EAKA 3QUZA 1X4YA 4JFPB 1NH6A 3WO4C 5SWZB 1NSNL 2EIZB 3CPLB 5F8QC 3VFTB 1OAZL 1PJ9A 3RWCB 1RZIA 1R3KA 5HHXL 4PRAA 4TSAH 2FO4B 5DJDA 1KGCD 1ZOXA 4YDJA 4EVNA 3AMLA 4FFWC 1BX2B 2IANA 3QYCA 4JFFB 5K93A 4OIBA 5I75B 1AP2B 4QRSB 3U30C 1J05B 5IOPA 5LXGL 4G9FD 2AJYH 1MCBA 2P5WA 1CZ8H 1WITA 2NY2D 1SJVA 4I18B 1UB5B 1LK3L 2ED7A 4YIQB 3FQTB 3VXTA 4DKEL 3O6LL 1EEQA 3O8XD 4QO1A 5HHMB 1JK8B 3SN6N 1JVKA 4X80H 3UTTE 1CF8H 2IQ9L 3NZ8A 1Q9OB 5C3TA 3QQ9D 3RUGA 1V7NL 3LVEA 5CBAA 4PJ9B 5DJZA 1UCBH 4G6MH 5K9QI 5KS9E 2WNGA 3DUSB 1LNUA 3ARTA 3GRWH 3I75A 2VR5A 3PWVA 3ULUF 1CL7I 1OHQA 1LD9A 3GK8H 1LO4L 2KPNA 3QDJB 5KSVA 4N9GB 3QUYD 3GSVB 4Y7MA 3AAZB 3MJ9H 4Y4HC 4K71B 5D1XB 1QZ1A 5IR1A 2Y06H 1KPUA 1MFCH 2KQMA 3SPVB 4LCCA 2G9HA 1FRGH 1A64A 3AVEA 3BUYB 5CEYA 1G7IB 3LDBC 1OT1A 3MJ8A 1QNZL 2E7MA 1URLA 5CIPH 2EDOA 1P6FA 4U2YA 4UV4L 4Q9CA 1RJLA 4I0CC 3KYKH 3KPMB 3UXFA 2D7MA 4HWZB 3D69A 1M7DB 1FLRL 1X4XA 1GCFA 2FD6L 1SMAA 4BUHA 1IAOA 2CH8A 2KDGA 4YUEL 5ACZB 1VADB 3Q2CA 3STBA 4R3SA 1N4XH 1H3WM 1V7ML 3AS1A 4RAVA 4OF5A 4P5KA 4Y2DD 1H3GA 1S7WA 5DJXB 4JKPH 5IJVB 2YD9A 4G9FE 1XFPA 2HTLC 2YD6A 3RBGA 4I3SL 3IDJB 1S8DA 1NFKA 5A3ID 2CKBH 4PYHA 4XH2B 3SKMA 2X4SA 2H32B 4U0RB 4G6JH 3I6KB 4HUUA 2EKJA 1KT2A 3U4AA 5HGDA 3T77A 3QQNA 1KLGA 5EORL 3S4SA 1I7RA 1L9MA 5LQBH 1RZIB 1R3KB 2VXVL 4PRAB 1AO7B 2BOBB 5DJDB 4YDJB 5E56A 2IANB 1LP9E 1QP1A 3EZJB 3MV7D 5C0AA 5F88B 2J8UE 5IOPB 1KJVB 3WIHL 5IT2L 1RZKC 1RSFA 2P5WB 3AB0B 5DHYB 4M7LH 5EU4A 2X89A 3V4PH 2GUOA 3TT3L 4HWUA 4U1MA 2XKUA 4ZUWB 4ODVH 4APQC 3BRDA 2OMNA 5I1JL 2NY5C 5F7LB 1QTYT 1VFAA 5CBAB 4DTGH 1S3KH 1TJIL 3BZEB 2VDRH 1MELA 1QYGL 1MCOL 1LNUB 3I75B 2XNAA 1NAKL 3P40A 3PWVB 4XHJD 2VITA 1LO0H 1RZJH 2NYYC 2X9WA 1IL1A 2BVUA 1SJXA 3BH8A 5INCA 3IJHA 3K8KA 3CUPB 2Z8RA 1DBJL 3MUHL 3NZHL 4ETQB 1CI5A 3TYGH 4HF5L 3Q1SH 4MXQC 2VZ3A 5IG7B 4HK0A 3TJEH 4PTTA 4YBLC 5MHSD 1CD0A 3ZL4H 1HI6A 4HWBL 4LCCB 2O93L 1N5AA 1N6UA 5CEYB 1TPXB 3NCCB 1CIUA 2CIKB 1UADC 2VDPL 1CGYA 1KCSH 4BKLA 4JN1H 1QBAA 1RJLB 2CLVA 3QFDB 3EHBD 4LSUL 3D69B 2FDBP 3F62A 1QBLL 1A7QL 4OCSL 3TO4C 1IAOB 4XNXL 4NBYB 4HXAL 1FAIH 3I3BA 4GLRH 4R3SB 1ACZA 4RAVB 2VLKD 4ODTH 4P5KB 1YJDH 4I2XB 1S7WB 2R0WL 1S7VB 4UB0H 5ADPL 3KJ6H 1KXQE 2BK8A 4OLVL 2HJLA 4Y88A 1BIHA 1S8DB 3JWOC 2XT1B 3SKMB 2X4SB 3SDDD 1S5IH 4XMKL 2XTJD 4PJFF 4QCIA 2PW2A 1H0DB 4MB3A 1KT2B 3IDXL 1KLGB 4Y16C 4YK4C 2YR3A 4M9PA 3MLVH 3WUZA 3EYVB 5DUBA 4HUKB 3HE7A 2AXGA 4HS3A 1WIUA 3VJ6B 3HRZB 2MKLC 5MP6L 5GS2H 3BKCH 5GJTL 5C0AB 1F02I 4E9LA 1UG9A 1MHPL 5TFSH 4JDVB 4DUXA 1NLDL 5J1TC 3UYRL 4G43A 4P2RA 2YPKA 1C5CL 2NY4B 2AP2A 3MRPB 4U1MB 3HNSL 3T2NL 3VRLE 3D9AL 2R0LL 4JPKH 1CL7L 2JCCA 5FYJU 3HLAA 1J1PL 3ULVH 2I27N 1FDLL 3TEUA 2BRRH 2JJTA 1VFAB 4KI5F 4H1LG 5JTWA 1UACH 2XNAB 2CDFA 5D1ZC 2FZ3B 2VITB 5KG9B 4YLQT 3RWIA 5H2BA 1IL1B 4RAHA 4Z7OF 5EFIA 2HFFA 3BH8B 3ZKNC 3IJHB 5HHPA 1VFOA 4JDZA 4WW1B 1ORQA 1ZE3C 5CGYD 3VFNA 3SE4A 2ZUQB 3U1SL 4QTIH 5CINH 5TGBA 3A6CL 4XNUL 3GM8A 1HHJB 2VLKE 2WQRA 3ZZ1A 5DSCB 1H8SA 1HI6B 3NCBB 4LVNB 5BRZD 4JY5H 1BQHB 3EGSA 4AEIH 4FABL 1N5AB 5EC2A 4CVWA 3RI5F 5DJ8A 5ALBL 4XVJH 2XTJE 4BKLB 1UZ8B 5JXAH 2P48B 3QJHA 3VD3A 4NDMA 2WBKA 3WFCL 2ICWJ 3V6ZA 4GMTH 2CSPA 3HNTL 3IFLL 5GSRA 2PXYC 3BXNB 5E8PA 4CDGC 2HFGL 4OCRH 5HY9B 5DHVB 5E5MA 3VGDA 4N90E 1OTUC 1IT9H 4MYWB 3QJFA 3T0XA 1ZTXH 2HJLB 3ZE2E 2M8XA 4D0DA 3GMPA 3OL2A 4QCIB 2PW2B 4Y4FC 4UINH 4JRXA 5E8NA 5JUEL 4IIQA 4QXGH 4DZ8B 4RMTA 1AY1L 2A9NL 4NUJA 5T1MA 4M7JH 3HE7B 3N1MC 2AXGB 2DIJA 3MBEC 5BV7H 1F4YH 3U7AA 1W72A 4WI7A 5C8JA 2RCSL 3C9NA 4UMGA 1TJGH 3JTSA 4XNQA 4LRIC 3GI8H 2DQTH 5ANME 4HS6B 1QPPA 2W9EL 3KPLA 4JRYD 1EZVY 1FVEA 2Q6WA 4EDWH 3OKLA 5BRZE 1IQWL 2JCCB 3LAFA 4P4KC 1BMGA 4M1DL 3CFIC 4O2EA 3T65A 1JNHA 4Z78B 1KIUA 1N26A 4NUGH 3MRKB 1BQLL 2Y07H 2EO9A 3RWIB 5H2BB 3W11D 5EFIB 1T1WA 2H8PA 2DI8A 4JDZB 1ORQB 2HKHL 2YWYA 5CWSA 4QEGA 1CDJA 5ID1A 5IHZA 3NPZB 1J8HD 3CK0H 2P43B 3MRHA 3R8BB 4JM4L 4PLJC 3FL7A 1OP3K 2A2QT 4KK8C 3GB7A 4WENB 3EGSB 4XVSH 3STZA 2EDKA 5EC2B 3B9KC 2DLEA 4EUPG 5DJ8B 2GY5A 2VLJD 3X3GL 5IMMB 1Q0YH 4X5XB 5F6IB 4OFYA 3QI9C 3LMJH 1BGXL 4PRIB 4PGBA 2B4CH 3QJHB 3V5HA 3P0GB 1HHIA 5GGTL 4NDMB 3S35X 1JPSH 1ED3A 4V2CB 3VDAA 1CGXA 4AG4H 4BFGA 2BNQB 3ARGA 4K8RD 3UTZA 4HUXA 1G7PB 1I1AC 2VDQH 2V7HA 5E8PB 4AENA 3FMGH 1IC1A 4XCCL 2QSCL 1MCQA 3QEGH 2Q7YA 5CUSL 3O6MH 3ES6A 3QJFB 2EIBA 2BCKA 3HUJA 1CQKA 4JCLA 1A6TB 3L5XH 3LS5L 2HTKD 1B3JA 4D0DB 3MACL 4J6RH 4YHLH 3NABH 1QUNA 3MLRL 5E8NB 4JRYE 4IIQB 4ODXA 3DVFA 4XNYL 4WUUE 5JLZA 4YC2B 4NUJB 5T1MB 2GK0B 1EV2E 4PY7A 3DVGA 1MJUL 2KZWA 1DUYB 5SWQB 3MLZH 4LL9A 5JDJA 1JTTA 5T1LD 5FOBA 1W72B 1JFQH 1A6WL 1NMCC 1TVBA 2ZSVA 3ILPB 3JTSB 1S7SA 2NXZD 4FXGA 4XNQB 4OBSA 5ELIA 1J8HE 4X5LA 4YHNA 5DMIL 1CXHA 4TVPH 3U0TA 4C59B 4LCWD 3O6FB 2VLJE 3I50L 4O2EB 2DQDH 3QR2A 4LASH 3T65B 4BQ8A 3KGRA 4X9BA 5C0JB 1P4LB 1EUTA 3DETD 3RAJL 3WIHA 3DOSA 2NXYB 1U3ZA 1T1WB 3MMEA 5GS2D 3RL1A 5IHBA 1X6LA 3P0VL 2OTUA 5EOCJ 5GGRA 3ZE1E 2HRPH 5CWSB 2Q76A 1NLBL 4IMKC 4O9HH 3S5LG 5ID1B 1XEDA 4J8RA 3VMNA 3BAEH 5IVZB 4DN4L 3FB8A 5AZEL 4FZEH 4OZHA 1FVCB 1YN6A 2WWMC 1AKJA 1WAAA 3GB7B 1MH5A 4URTB 3V0VA 2H9GA 3FFCD 5DD1L 3SDXF 4OD2A 5I0ZA 3CH8A 3IF1B 3H9SE 3QB7C 3ULVD 5KSAD 4PGBB 4Z8FL 3V5HB 1HHIB 3CFDA 4NQSA 3SHSA 4L1DA 4M43H 3CFBB 3SCMD 1ED3B 3HZMA 2BXZA 4MA1B 2JKXA 3ARGB 5L2KD 4HUXB 2GJ6E 4YPJA 3IXTA 1FN4A 3DO7A 5E95B 1JZ8A 4YWGH 4HWBA 2Q7YB 2VDKL 3H7BA 4LHJB 3ES6B 4WEBL 5CFHA 2YA0A 3QDGD 3GIVA 2BCKB 3HUJB 1T21A 3B2VL 3N1QC 4P46A 2YD5A 1CU4L 1RJZA 1E6JH 3F7QA 1OGAA 2BY2A 1LDPL 3MRLA 2PYEA 5LG1A 5KTEH 4POZD 4ODXB 2VIRA 4OLEA 5DD6A 3PXJA 4NNXB 5JLZB 3HC4H 4XWGL 1DQLL 3B83A 4HPOH 5I0DA 4LCWE 4TUKH 2AABH 2ZCHL 3DVGB 3UTSD 2VB5A 4U6YA 1HH6B 2WAHA 5I76A 4LFHG 3N85L 3O9WA 5FOBB 3WD5H 1OAUH 1RIVL 1JYNA 4RMWA 1YY9C 1TVBB 4H8WL 2DJ4A 1I8KA 4YBQC 5EOCH 3BYYA 1S7SB 4FXGB 1DBBL 4R2GD 4UQ2A 5E8EA 3CLEL 2OK0H 1UENA 1L7IL 1U2HA 2GI7A 1C5DB 2ZCKL 1SHMA 1A7PH 1KC5H 1WBZA 3HI6L 5ENWA 5KJRL 3DX6A 3O3EB 1T5XB 3FHAA 3EO9H 1TQBC 3MGAA 4HGWB 5CLTA 5FYLH 2DWEA 5D72L 4RIRA 3S34L 5GS1C 4P2QA 3U0TB 1S78C 3FFCE 3MCLL 4IRZL 4I3GA 4Q74A 2IMMA 4GRLA 4JPVH 5CILL 3LSOB 2QJDA 4JPWH 4HG4K 1UGNA 2YPLD 5D96C 4HWNA 3EJZC 3MMEB 4JHBA 4UNTA 5GRVK 3RL1B 3O81A 4J3XA 2ZSWB 1J11A 5GGRB 5GRUL 5D70H 3N1PC 4J8RB 1KCLA 3SGKC 3FB8B 3ECBA 5IMKA 3N9GH 3C2SA 4OZHB 1G6VK 2WMPA 2UWEF 4OCWH 5JPNA 4MCYB 5LGJB 3V0VB 3VXSB 4HT1H 2H9GB 3JWNC 4OD2B 4F2MA 4G7YL 1PEWA 4JGJA 4PJAB 3DHMA 5TE7H 4XTRC 4FOMA 1L7TH 1QSFA 3E8UH 5JPMA 5F9DC 4UNVA 4D94A 3CFDB 3F58H 5HGGS 1RZKH 3ARDC 4I3RH 2Y5EA 3WDHA 4E0RA 1K2DA 4NZTH 5EIVA 4YGAB 4GW1A 5LWYH 3UTSE 3IXTB 1RULH 1FN4B 4ZO7A 3DO7B 2DTMH 1WF5A 4Y8AA 1LE5A 2E6QA 5C2BL 1VKXA 1QRNA 3H7BB 4OLYL 3GIVB 2NY5H 2IH1B 1T21B 3LQAL 1YQVL 4HULB 1KTLA 5I16A 4BUGA 4Z7WE 5HI3D 1K85A 1HHKA 1HSBA 2HKFH 2VIRB 1F4AA 4HIJA 2EDDA 3NIFF 3HMWL 2C9AA 3VWJA 1KULA 1F90L 2K7QA 2XQBL 4HCRL 4XVTL 3WNOA 3IT8D 2IFFL 4IBLT 4U6YB 2ADJA 5IV2A 5I76B 5FA3A 5I75C 1U8LA 1VEOA 5K9JL 2YPLE 3L3HB 1I8KB 4F57H 3G5VA 2A74A 2VH5L 2F5AH 4D8PA 1IGTB 4UTAH 4GKNA 5F7MC 3TWCH 4I18C 4F37F 5MENB 5E8EB 2HVJB 4PJDA 3FB7A 3ARFD 4BZ1L 1T04B 1GAFL 3WJLA 2IAMD 4NC2B 1K4CB 1WBZB 1WWCA 1T1ZA 1EGJH 3DX6B 4L9LB 2AEPH 5TDNA 1R3IH 3HR5A 1HYSC 1T1XB 1DE4B 4RIRB 1E4KA 1MQKL 1RU9H 4P2QB 1JCKA 3HS0A 4JO1L 2NY3B 4PJ9C 4RFNB 4NFBA 4PJIB 4GRLB 3RWDA 5T1DL 4RZCB 4X99A 4OBRA 1RUMH 2Q3AA 4WI4A 3MA9H 5BMFH 4EQ3A 3JWOH 4NBXB 4K71C 4OZFB 3ECBB 4M6OH 2RFXA 2GTWB 2V5YA 3NTCL 4WV1A 3SGEI 5CBEA 5JPNB 1CGTA 2HP4A 4OZGE 4UBDD 4I5BA 4F2MB 4JE4B 5EU5A 4IRJB 4A2MA 5T33H 1MRFL 4TVPD 3RFZC 1KIPA 4HBCL 4EI5C 5C0CA 4PV8B 1FG9C 4MMXC 4NN6B 1QSFB 5JPMB 4KTDH 4AL8L 3ULUL 3AFLA 4NO5B 4XX1E 3E1F1 2R2EA 4M1GH 1VFBB 4NRYA 1R24B 5KSBB 1C5BL 1H8OA 1YEEH 5JORA 5KVFL 3A6OA 4X8XA 5FGRA 1LE5B 4O2CA 1VKXB 1XIWA 1HILA 2Y23A 4MNGA 4PV9A 4ZSOE 3V52H 3VXOB 4F9LA 4JR9H 3S7GA 3JUZA 3PP3K 2XZAL 4U0RC 3WL9A 5I16B 2YK1H 3NOIA 3WLWC 1GZPB