4M3MA

Influenza neuraminidase in complex with a stereomutated analogue of oseltamivir carboxylate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
390
structure length
390
Chain Sequence
GTYMNNTEAICDVKGFAPFSKDNGIRIGSRGHIFVIREPFVSCSPIECRTFFLTQGSLLNDKHSNGTVKDRSPFRTLMSVKVGQSPNVYQARFEAVAWSATACHDGKKWMTVGVTGPDSKAVAVIHYGGVPTDVINSWAGDILRTQESSCTCIQGDCYWVMTDGPANRQAQYRIYKANQGRIIGQADISFNGGHIEECSCYPNDGKVECVCRDNWTGTNRPVLVISPDLSYRVGYLCAGIPSDTPRGEDAQFTGSCTSPMGNQGYGVKGFGFRQGTDVWMGRTISRTSRSGFEILRIKNGWTQTSKEQVRKQVVVDNLNWSGYSGSFTLPVELSGKDCLVPCFWVEMIRGKPEEKTIWTSSSSIVMCGVDYEIADWSWHDGAILPFDIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, structure and inhibitory activity of a stereoisomer of oseltamivir carboxylate.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Hydrolase/hydrolase inhibitor
total genus 119
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 4m3mA00
2AGSA 4QN6A 1INVA 4MJVA 3H73A 4XJUA 1XOEA 4HZZA 4GDIA 4K1HA 3H6JA 4XHBA 1W8NA 2VK6A 5F9TA 3NSSA 1E8VA 4FPEA 4WA3A 3T1EA 1W20A 4XMAA 2W20A 3TIAA 1L7GA 4GZOA 4XJAA 2C4AA 1SLLA 3TICA 3K37A 4MWLA 3GVJA 3JU4A 1W1XA 4SLIA 4UF7A 2VWDA 4CPMA 4XJZA 3NN9A 4MWUA 4X6KA 1EUTA 4MZAA 4X47A 4WEFA 4FPOB 2F29A 2YA5A 4HZXA 1E8TA 2VW1A 1F8DA 4FPGA 3OPZA 1NCBN 4KS2A 3H71A 1Z50A 6NN9A 2HU4A 1INGA 3K39A 3CL0A 1VCJA 4M4NA 4XHXA 3ALWA 4X49A 2QWIA 2QWBA 4JF7A 4QNPA 2VSMA 2QWAA 4FPCA 1NCDN 4XIKA 1N1SA 3TI3A 3SLIA 1N1VA 1DIMA 2F27A 1V3DA 1KITA 3INBA 4HIZA 1N1YA 3A71A 4CPYA 3TI4A 7NN9A 2HT5A 2YDPA 1INYA 3K38A 1NNAA 2YA4A 1W21A 1MR5A 4FP3A 3K3AA 1IVEA 4FPKA 5B2CA 1B9VA 2XZKA 1XOGA 1NNBA 1Z4XA 4FOWA 2HTWA 2HTUA 3H72A 3PJQA 4XIOA 2VSKA 4NC5A 4HZVA 4MWXA 2JKBA 4J9TA 5HX0A 4FZHA 4GZQA 4HZYA 4WA4A 4XJ8A 2ZB5A 1N1TA 2ZB6A 5HUMA 4YW3A 2W38A 4I00A 4YW4A 4YZ3A 1NMAN 1L7FA 4MWVA 3SANA 5JYYA 2F25A 4MX0A 5HUNA 4NCSA 2YA7A 4CPNA 4GZTA 1NCAN 4CPOA 4K1JA 2F13A 2HTRA 1L7HA 4YW5A 1EURA 4FOQA 4GZWA 4KS5A 4WEGA 1IVBA 4MWQA 2F12A 1V3CA 4YZ1A 1F8CA 3O9KA 2BERA 1MWEA 1MZ6A 1VCUA 1SO7A 2QWCA 2QWEA 2HT7A 4KS1A 2CMLA 4FOVA 1MS1A 1V0FA 4FQ4A 4X4AA 2XCYA 1MS8A 4CPZA 1MS3A 5NN9A 1Z4ZA 4QN7A 4YZ2A 4XMIA 3GVLA 2AEQA 4D8SA 4HZWA 2HTQA 4XOGA 2AEPA 2YDTA 4XJ9A 4Q6KA 1MS5A 1F8BA 2QWKA 1V2IA 4YW2A 2BATA 4FPYA 1V3EA 4FPJA 4FP2A 4GZPA 1EUUA 3TI5A 4YZ5A 2SLIA 5B2DA 4XJRA 1B9TA 2QWJA 2HTYA 4B7JA 2XZJA 1BJIA 4GZSA 4FPLA 1INXA 1NCCN 1W0OA 1A4QA 1INHA 4GJTA 1W8OA 3B7EA 4MZEA 2BF6A 2F11A 2SIMA 4MC7A 4QN3A 4FPHA 4K3YA 4WA5A 2FHRA 4B7NA 2VK7A 4KS3A 3K36A 3TIBA 2W5OA 4H52A 1IVGA 1NNCA 1NSBA 1E8UA 1IVFA 1INWA 2F10A 1F8EA 1NSDA 1MS4A 4QN5A 4XE9A 1W0PA 1NMBN 1USRA 3W09A 1WCQA 1V0ZA 1SNTA 4B7MA 3GVKA 2HT8A 3TI6A 4MJUA 1B9SA 1IVDA 2VK5A 2F0ZA 4K1KA 3A72A 2HU0A 3ALXA 4B7RA 4FPFA 4KS4A 2BZDA 1Z4WA 3D11A 4MWWA 1MS0A 5HUGA 3B69A 4BBWA 4GZXA 3SALA 3BEQA 4FVKA 3CYEA 4YW1A 2X9MA 1USXA 4MWYA 4B7QA 4QN4A 1V0EA 3CKZA 2A75A 4FJ6A 4GB1A 4YZ4A 2HTVA 2F24A 4MWJA 4M4UA 4XILA 4M3MA 2SILA 4MWRA 1V3BA 4GEZA 2YA8A 2VVZA 1NN2A 1NSCA 2C4LA 1S0IA 2VW0A 5HUKA 1NMCA 2RKCA 2QWHA 1MZ5A 1INFA 1Z4YA 1EUSA 1S0JA 1SLIA 1A14N 2AH2A 3D12A 2VW2A 1IVCA 1DILA 2YA6A 1A4GA 4CPLA 3TI8A 2QWDA 2F28A 4XJQA 3O9JA 2QWGA 4GDJA 2B8HA 1WCSA 4XJWA 3SILA 4XYXA 4M4VA 4H53A 2QWFA 4NN9A 4FOYA 3CL2A 5M1ZA 2F26A 4DGRA 1MS9A 4K1IA 1Z4VA 2XZIA 2W5NA
chains in the Genus database with same CATH superfamily
2AGSA 4QN6A 1INVA 4MJVA 3H73A 4XJUA 1XOEA 4HZZA 4GDIA 4K1HA 3H6JA 4XHBA 1W8NA 5FNSA 2VK6A 4IFJA 5F9TA 3NSSA 1U6DX 2GVWA 5FNQA 2DG1A 1E8VA 4FPEA 4G3NA 4WA3A 3T1EA 1W20A 4XMAA 2W20A 3TIAA 1L7GA 5D9DA 1CQ1A 4GZOA 5GX1A 4XJAA 1X2JA 2C4AA 4AGIA 1SLLA 3TICA 3K37A 4IFLX 4MWLA 3GVJA 3JU4A 1ZI0A 1W1XA 4SLIA 4UF7A 2VWDA 4CPMA 4XJZA 5GX3A 3NN9A 4MWUA 4X6KA 3V65B 1EUTA 4MZAA 1S1DA 3SRGA 3G4HA 4X47A 2HQSA 4WEFA 2W8BB 3ZGCA 5FNRA 4FPOB 2F29A 2H2NA 2IARA 2YA5A 2IATA 4HZXA 1E8TA 2VW1A 1F8DA 4FPGA 1C9UA 3OPZA 4XMBA 1NCBN 4KS2A 2POOA 3H71A 1Z50A 6NN9A 2P4OA 2HU4A 1INGA 3K39A 3CL0A 2VAQA 2FP9A 1VCJA 5FNUA 3WN7A 4CH9A 4ZLRA 2Z32A 4M4NA 4XHXA 3ALWA 4X49A 2QWIA 2QWBA 4JF7A 4QNPA 2VSMA 2QWAA 4D52A 2FLUX 4FPCA 1NCDN 4XIKA 2ZWAA 1N1SA 3TI3A 4AHAA 3SLIA 1N1VA 1DIMA 2F27A 4HHOA 1V3DA 1KITA 2IAPA 4C1YB 3INBA 4HIZA 3V1SA 1N1YA 3Q6PA 4GNAA 4ASCA 3I1CA 3II7A 1S18A 3A71A 4CPYA 3TI4A 7NN9A 2HT5A 1IUBA 2YDPA 1INYA 5CGJA 3K38A 1NNAA 1K32A 4CHBA 5F72C 2YA4A 3WWAA 1W21A 1MR5A 4FP3A 3K3AA 1IVEA 2FPCA 5D9CA 4O5TA 4FPKA 4ZGCA 5B2CA 1B9VA 3IAXA 2DYHA 2XZKA 1XOGA 1WP5A 1NNBA 1Z4XA 4FOWA 1IUCA 2HTWA 4L7DA 2HTUA 3H72A 1SUUA 3PJQA 4XIOA 2VSKA 4NC5A 2IAOA 4ZY3A 4HZVA 4MWXA 1H6LA 2JKBA 4J9TA 5HX0A 4FZHA 1Q7FA 4GZQA 4HZYA 3ADEA 2ISMA 4WA4A 4XJ8A 2ZB5A 1N1TA 5FZJA 2ZB6A 5HUMA 4YW3A 2W38A 3TC9A 5FZNA 4I00A 5GTQA 3V64C 4YW4A 4GNCA 4YZ3A 3KGGA 1NMAN 3UC1A 2IASA 3S94A 1L7FA 4GN9A 4MWVA 3SANA 5JYYA 2F25A 4C1YA 4MX0A 5HUNA 3LI4A 3A9GA 4NCSA 1N6FA 2YA7A 2OJHA 4CPNA 4GZTA 5EO7A 1NCAN 4CPOA 4K1JA 4D52C 2F13A 2HTRA 2GVUA 1L7HA 4YW5A 1EURA 4FOQA 4GZWA 4KS5A 3AMRA 4WEGA 3LI5A 1IVBA 4MWQA 2F12A 1V3CA 4YZ1A 2DG0A 1F8CA 4PWZA 3O9KA 2BERA 1MWEA 1MZ6A 1VCUA 1SO7A 2WOZA 2QWCA 3FVZA 2QWEA 1IJQA 2HT7A 4KS1A 2CMLA 5GX5A 4FOVA 1MS1A 1V0FA 4FQ4A 4X4AA 2XCYA 4AGTA 4IFNX 2ZW9A 1MS8A 4CPZA 1MS3A 5NN9A 1PJXA 1Z4ZA 4QN7A 4CSDA 4YZ2A 4XMIA 3S2KA 1CRZA 3O4PA 3GVLA 2AEQA 4D8SA 2GVXA 3A9HA 2FP8A 2XN4A 1N6EA 4HZWA 2HTQA 4XOGA 2AEPA 2YDTA 4XJ9A 4Q6KA 1MS5A 3S8ZA 1F8BA 3WW9A 2QWKA 5GX2A 1V2IA 4YW2A 5EO8A 4A0PA 2BATA 4FPYA 5D9BA 3P5BL 1V3EA 4FPJA 2IVZA 4HHQA 1N7DA 3HLIA 4FP2A 4JMLA 4GZPA 1EUUA 3TI5A 4YZ5A 2SLIA 5B2DA 4XJRA 3Q6KA 3HRPA 1B9TA 2QWJA 2HTYA 3KYAA 4B7JA 2XZJA 1BJIA 3DASA 2IAXA 4GZSA 2W8BA 2FPBA 4FPLA 1INXA 1NCCN 1W0OA 4HW6A 1A4QA 1INHA 4GJTA 1W8OA 3B7EA 4MZEA 5FWWA 2BF6A 2F11A 2SIMA 1X2RA 4MC7A 2IAUA 4QN3A 4L7CA 4FPHA 2ZZKA 4K3YA 4WA5A 2FHRA 4B7NA 2VK7A 4KS3A 3K36A 3TIBA 2W5OA 4H52A 1IVGA 4GN7A 3FW0A 1NNCA 1NSBA 2QE8A 1QLGA 1E8UA 1RWLA 1IVFA 4IYGA 5FNTA 1INWA 2F10A 1F8EA 3Q6TA 1NSDA 1MS4A 4QN5A 4XE9A 1W0PA 4D52B 3E5ZA 4Q1UA 1NMBN 4GNBA 1USRA 3W09A 1WCQA 1V0ZA 1SNTA 3NO0A 4B7MA 3GVKA 2HT8A 3TI6A 4L7BA 4MJUA 1B9SA 1IVDA 2VK5A 2F0ZA 3BYCA 4K1KA 3A72A 2HU0A 3ALXA 4B7RA 3WDZA 2H2UA 1V04A 4FPFA 4KS4A 3VNHA 2BZDA 1Z4WA 3ZGDA 3D11A 4MWWA 1POOA 1MS0A 5HUGA 3B69A 4BBWA 4GZXA 3SALA 3BEQA 3HLHA 1QBIA 1ZGKA 4FVKA 3CYEA 4IQKA 1E1AA 4YY8A 2G8SA 4YW1A 2X9MA 1USXA 4MWYA 4B7QA 4QN4A 3S8VA 1RWIA 1V0EA 3LI3A 3CKZA 4GN8A 2A75A 4FJ6A 4GB1A 4YZ4A 2HTVA 2F24A 4MWJA 4D4UA 4M4UA 2DSOA 4XILA 3SOBB 3SOVA 4M3MA 2SILA 4MWRA 1V3BA 4GEZA 2YA8A 2VVZA 1NN2A 1NSCA 2C4LA 1S0IA 2VW0A 2IAQA 5HUKA 1NMCA 2RKCA 2QWHA 1MZ5A 1INFA 2GHSA 4N1BA 1Z4YA 1EUSA 1S0JA 1SLIA 1A14N 4IN4A 2AH2A 3D12A 2VW2A 1IVCA 1DILA 1OFZA 2YA6A 1NPEA 2GVVA 1A4GA 4CPLA 3TI8A 3U0SA 2QWDA 2F28A 4IMBA 2IAVA 4XJQA 3VNGA 2V91A 3O9JA 3L6VA 2QWGA 4DG6A 5GX4A 4GDJA 2B8HA 3SOQA 3G4EA 2IAWA 1WCSA 4XJWA 5H47A 3SILA 4XYXA 4UOUA 4M4VA 4O5SA 4H53A 2QWFA 4NN9A 4FOYA 3SREA 3CL2A 4R40A 5M1ZA 3DR2A 2F26A 4DGRA 1CRUA 1MS9A 1N6DA 1C5KA 3AMSA 4AH4A 4K1IA 1Z4VA 1CVMA 5EX7A 2XZIA 2VPJA 2W5NA
chains in the Genus database with same CATH topology
2AGSA 4QN6A 1INVA 4MJVA 3H73A 4XJUA 1XOEA 4HZZA 4GDIA 4K1HA 3H6JA 4XHBA 1W8NA 2VK6A 5F9TA 3NSSA 1E8VA 4FPEA 4WA3A 3T1EA 1W20A 4XMAA 2W20A 3TIAA 1L7GA 4GZOA 4XJAA 2C4AA 1SLLA 3TICA 3K37A 4MWLA 3GVJA 3JU4A 1W1XA 4SLIA 4UF7A 2VWDA 4CPMA 4XJZA 3NN9A 4MWUA 4X6KA 1EUTA 4MZAA 1S1DA 4X47A 4WEFA 4FPOB 2F29A 2H2NA 2YA5A 4HZXA 1E8TA 2VW1A 1F8DA 4FPGA 3OPZA 1NCBN 4KS2A 3H71A 1Z50A 6NN9A 2HU4A 1INGA 3K39A 3CL0A 1VCJA 4M4NA 4XHXA 3ALWA 4X49A 2QWIA 2QWBA 4JF7A 4QNPA 2VSMA 2QWAA 4FPCA 1NCDN 4XIKA 1N1SA 3TI3A 3SLIA 1N1VA 1DIMA 2F27A 1V3DA 1KITA 3INBA 4HIZA 1N1YA 1S18A 3A71A 4CPYA 3TI4A 7NN9A 2HT5A 2YDPA 1INYA 3K38A 1NNAA 2YA4A 1W21A 1MR5A 4FP3A 3K3AA 1IVEA 4FPKA 5B2CA 1B9VA 2XZKA 1XOGA 1NNBA 1Z4XA 4FOWA 2HTWA 2HTUA 3H72A 3PJQA 4XIOA 2VSKA 4NC5A 4HZVA 4MWXA 2JKBA 4J9TA 5HX0A 4FZHA 4GZQA 4HZYA 4WA4A 4XJ8A 2ZB5A 1N1TA 2ZB6A 5HUMA 4YW3A 2W38A 4I00A 4YW4A 4YZ3A 1NMAN 1L7FA 4MWVA 3SANA 5JYYA 2F25A 4MX0A 5HUNA 4NCSA 2YA7A 4CPNA 4GZTA 1NCAN 4CPOA 4K1JA 2F13A 2HTRA 1L7HA 4YW5A 1EURA 4FOQA 4GZWA 4KS5A 4WEGA 1IVBA 4MWQA 2F12A 1V3CA 4YZ1A 1F8CA 3O9KA 2BERA 1MWEA 1MZ6A 1VCUA 1SO7A 2QWCA 2QWEA 2HT7A 4KS1A 2CMLA 4FOVA 1MS1A 1V0FA 4FQ4A 4X4AA 2XCYA 1MS8A 4CPZA 1MS3A 5NN9A 1Z4ZA 4QN7A 4YZ2A 4XMIA 3GVLA 2AEQA 4D8SA 4HZWA 2HTQA 4XOGA 2AEPA 2YDTA 4XJ9A 4Q6KA 1MS5A 1F8BA 2QWKA 1V2IA 4YW2A 2BATA 4FPYA 1V3EA 4FPJA 4FP2A 4GZPA 1EUUA 3TI5A 4YZ5A 2SLIA 5B2DA 4XJRA 1B9TA 2QWJA 2HTYA 4B7JA 2XZJA 1BJIA 4GZSA 4FPLA 1INXA 1NCCN 1W0OA 1A4QA 1INHA 4GJTA 1W8OA 3B7EA 4MZEA 2BF6A 2F11A 2SIMA 4MC7A 4QN3A 4FPHA 4K3YA 4WA5A 2FHRA 4B7NA 2VK7A 4KS3A 3K36A 3TIBA 2W5OA 4H52A 1IVGA 1NNCA 1NSBA 1E8UA 1IVFA 1INWA 2F10A 1F8EA 1NSDA 1MS4A 4QN5A 4XE9A 1W0PA 1NMBN 1USRA 3W09A 1WCQA 1V0ZA 1SNTA 4B7MA 3GVKA 2HT8A 3TI6A 4MJUA 1B9SA 1IVDA 2VK5A 2F0ZA 4K1KA 3A72A 2HU0A 3ALXA 4B7RA 2H2UA 4FPFA 4KS4A 2BZDA 1Z4WA 3D11A 4MWWA 1MS0A 5HUGA 3B69A 4BBWA 4GZXA 3SALA 3BEQA 4FVKA 3CYEA 4YW1A 2X9MA 1USXA 4MWYA 4B7QA 4QN4A 1V0EA 3CKZA 2A75A 4FJ6A 4GB1A 4YZ4A 2HTVA 2F24A 4MWJA 4M4UA 4XILA 4M3MA 2SILA 4MWRA 1V3BA 4GEZA 2YA8A 2VVZA 1NN2A 1NSCA 2C4LA 1S0IA 2VW0A 5HUKA 1NMCA 2RKCA 2QWHA 1MZ5A 1INFA 1Z4YA 1EUSA 1S0JA 1SLIA 1A14N 2AH2A 3D12A 2VW2A 1IVCA 1DILA 2YA6A 1A4GA 4CPLA 3TI8A 2QWDA 2F28A 4XJQA 3O9JA 2QWGA 4GDJA 2B8HA 1WCSA 4XJWA 3SILA 4XYXA 4M4VA 4H53A 2QWFA 4NN9A 4FOYA 3CL2A 5M1ZA 2F26A 4DGRA 1MS9A 4K1IA 1Z4VA 2XZIA 2W5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGS A;  4QN6 A;  1INV A;  4MJV A;  3H73 A;  4XJU A;  1XOE A;  4HZZ A;  4GDI A;  4K1H A;  3H6J A;  4XHB A;  1W8N A;  2VK6 A;  5F9T A;  3NSS A;  1E8V A;  4FPE A;  4WA3 A;  3T1E A;  1W20 A;  4XMA A;  2W20 A;  3TIA A;  1L7G A;  4GZO A;  4XJA A;  2C4A A;  1SLL A;  3TIC A;  3K37 A;  4MWL A;  3GVJ A;  3JU4 A;  1W1X A;  4SLI A;  4UF7 A;  2VWD A;  4CPM A;  4XJZ A;  3NN9 A;  4MWU A;  4X6K A;  1EUT A;  4MZA A;  4X47 A;  4WEF A;  4FPO B;  2F29 A;  2YA5 A;  4HZX A;  1E8T A;  2VW1 A;  1F8D A;  4FPG A;  3OPZ A;  1NCB N;  4KS2 A;  3H71 A;  1Z50 A;  6NN9 A;  2HU4 A;  1ING A;  3K39 A;  3CL0 A;  1VCJ A;  4M4N A;  4XHX A;  3ALW A;  4X49 A;  2QWI A;  2QWB A;  4JF7 A;  4QNP A;  2VSM A;  2QWA A;  4FPC A;  1NCD N;  4XIK A;  1N1S A;  3TI3 A;  3SLI A;  1N1V A;  1DIM A;  2F27 A;  1V3D A;  1KIT A;  3INB A;  4HIZ A;  1N1Y A;  3A71 A;  4CPY A;  3TI4 A;  7NN9 A;  2HT5 A;  2YDP A;  1INY A;  3K38 A;  1NNA A;  2YA4 A;  1W21 A;  1MR5 A;  4FP3 A;  3K3A A;  1IVE A;  4FPK A;  5B2C A;  1B9V A;  2XZK A;  1XOG A;  1NNB A;  1Z4X A;  4FOW A;  2HTW A;  2HTU A;  3H72 A;  3PJQ A;  4XIO A;  2VSK A;  4NC5 A;  4HZV A;  4MWX A;  2JKB A;  4J9T A;  5HX0 A;  4FZH A;  4GZQ A;  4HZY A;  4WA4 A;  4XJ8 A;  2ZB5 A;  1N1T A;  2ZB6 A;  5HUM A;  4YW3 A;  2W38 A;  4I00 A;  4YW4 A;  4YZ3 A;  1NMA N;  1L7F A;  4MWV A;  3SAN A;  5JYY A;  2F25 A;  4MX0 A;  5HUN A;  4NCS A;  2YA7 A;  4CPN A;  4GZT A;  1NCA N;  4CPO A;  4K1J A;  2F13 A;  2HTR A;  1L7H A;  4YW5 A;  1EUR A;  4FOQ A;  4GZW A;  4KS5 A;  4WEG A;  1IVB A;  4MWQ A;  2F12 A;  1V3C A;  4YZ1 A;  1F8C A;  3O9K A;  2BER A;  1MWE A;  1MZ6 A;  1VCU A;  1SO7 A;  2QWC A;  2QWE A;  2HT7 A;  4KS1 A;  2CML A;  4FOV A;  1MS1 A;  1V0F A;  4FQ4 A;  4X4A A;  2XCY A;  1MS8 A;  4CPZ A;  1MS3 A;  5NN9 A;  1Z4Z A;  4QN7 A;  4YZ2 A;  4XMI A;  3GVL A;  2AEQ A;  4D8S A;  4HZW A;  2HTQ A;  4XOG A;  2AEP A;  2YDT A;  4XJ9 A;  4Q6K A;  1MS5 A;  1F8B A;  2QWK A;  1V2I A;  4YW2 A;  2BAT A;  4FPY A;  1V3E A;  4FPJ A;  4FP2 A;  4GZP A;  1EUU A;  3TI5 A;  4YZ5 A;  2SLI A;  5B2D A;  4XJR A;  1B9T A;  2QWJ A;  2HTY A;  4B7J A;  2XZJ A;  1BJI A;  4GZS A;  4FPL A;  1INX A;  1NCC N;  1W0O A;  1A4Q A;  1INH A;  4GJT A;  1W8O A;  3B7E A;  4MZE A;  2BF6 A;  2F11 A;  2SIM A;  4MC7 A;  4QN3 A;  4FPH A;  4K3Y A;  4WA5 A;  2FHR A;  4B7N A;  2VK7 A;  4KS3 A;  3K36 A;  3TIB A;  2W5O A;  4H52 A;  1IVG A;  1NNC A;  1NSB A;  1E8U A;  1IVF A;  1INW A;  2F10 A;  1F8E A;  1NSD A;  1MS4 A;  4QN5 A;  4XE9 A;  1W0P A;  1NMB N;  1USR A;  3W09 A;  1WCQ A;  1V0Z A;  1SNT A;  4B7M A;  3GVK A;  2HT8 A;  3TI6 A;  4MJU A;  1B9S A;  1IVD A;  2VK5 A;  2F0Z A;  4K1K A;  3A72 A;  2HU0 A;  3ALX A;  4B7R A;  4FPF A;  4KS4 A;  2BZD A;  1Z4W A;  3D11 A;  4MWW A;  1MS0 A;  5HUG A;  3B69 A;  4BBW A;  4GZX A;  3SAL A;  3BEQ A;  4FVK A;  3CYE A;  4YW1 A;  2X9M A;  1USX A;  4MWY A;  4B7Q A;  4QN4 A;  1V0E A;  3CKZ A;  2A75 A;  4FJ6 A;  4GB1 A;  4YZ4 A;  2HTV A;  2F24 A;  4MWJ A;  4M4U A;  4XIL A;  4M3M A;  2SIL A;  4MWR A;  1V3B A;  4GEZ A;  2YA8 A;  2VVZ A;  1NN2 A;  1NSC A;  2C4L A;  1S0I A;  2VW0 A;  5HUK A;  1NMC A;  2RKC A;  2QWH A;  1MZ5 A;  1INF A;  1Z4Y A;  1EUS A;  1S0J A;  1SLI A;  1A14 N;  2AH2 A;  3D12 A;  2VW2 A;  1IVC A;  1DIL A;  2YA6 A;  1A4G A;  4CPL A;  3TI8 A;  2QWD A;  2F28 A;  4XJQ A;  3O9J A;  2QWG A;  4GDJ A;  2B8H A;  1WCS A;  4XJW A;  3SIL A;  4XYX A;  4M4V A;  4H53 A;  2QWF A;  4NN9 A;  4FOY A;  3CL2 A;  5M1Z A;  2F26 A;  4DGR A;  1MS9 A;  4K1I A;  1Z4V A;  2XZI A;  2W5N A; 
#chains in the Genus database with same CATH topology
 2AGS A;  4QN6 A;  1INV A;  4MJV A;  3H73 A;  4XJU A;  1XOE A;  4HZZ A;  4GDI A;  4K1H A;  3H6J A;  4XHB A;  1W8N A;  5FNS A;  2VK6 A;  4IFJ A;  5F9T A;  3NSS A;  1U6D X;  2GVW A;  5FNQ A;  2DG1 A;  1E8V A;  4FPE A;  4G3N A;  4WA3 A;  3T1E A;  1W20 A;  4XMA A;  2W20 A;  3TIA A;  1L7G A;  5D9D A;  1CQ1 A;  4GZO A;  5GX1 A;  4XJA A;  1X2J A;  2C4A A;  4AGI A;  1SLL A;  3TIC A;  3K37 A;  4IFL X;  4MWL A;  3GVJ A;  3JU4 A;  1ZI0 A;  1W1X A;  4SLI A;  4UF7 A;  2VWD A;  4CPM A;  4XJZ A;  5GX3 A;  3NN9 A;  4MWU A;  4X6K A;  3V65 B;  1EUT A;  4MZA A;  1S1D A;  3SRG A;  3G4H A;  4X47 A;  2HQS A;  4WEF A;  2W8B B;  3ZGC A;  5FNR A;  4FPO B;  2F29 A;  2H2N A;  2IAR A;  2YA5 A;  2IAT A;  4HZX A;  1E8T A;  2VW1 A;  1F8D A;  4FPG A;  1C9U A;  3OPZ A;  4XMB A;  1NCB N;  4KS2 A;  2POO A;  3H71 A;  1Z50 A;  6NN9 A;  2P4O A;  2HU4 A;  1ING A;  3K39 A;  3CL0 A;  2VAQ A;  2FP9 A;  1VCJ A;  5FNU A;  3WN7 A;  4CH9 A;  4ZLR A;  2Z32 A;  4M4N A;  4XHX A;  3ALW A;  4X49 A;  2QWI A;  2QWB A;  4JF7 A;  4QNP A;  2VSM A;  2QWA A;  4D52 A;  2FLU X;  4FPC A;  1NCD N;  4XIK A;  2ZWA A;  1N1S A;  3TI3 A;  4AHA A;  3SLI A;  1N1V A;  1DIM A;  2F27 A;  4HHO A;  1V3D A;  1KIT A;  2IAP A;  4C1Y B;  3INB A;  4HIZ A;  3V1S A;  1N1Y A;  3Q6P A;  4GNA A;  4ASC A;  3I1C A;  3II7 A;  1S18 A;  3A71 A;  4CPY A;  3TI4 A;  7NN9 A;  2HT5 A;  1IUB A;  2YDP A;  1INY A;  5CGJ A;  3K38 A;  1NNA A;  1K32 A;  4CHB A;  5F72 C;  2YA4 A;  3WWA A;  1W21 A;  1MR5 A;  4FP3 A;  3K3A A;  1IVE A;  2FPC A;  5D9C A;  4O5T A;  4FPK A;  4ZGC A;  5B2C A;  1B9V A;  3IAX A;  2DYH A;  2XZK A;  1XOG A;  1WP5 A;  1NNB A;  1Z4X A;  4FOW A;  1IUC A;  2HTW A;  4L7D A;  2HTU A;  3H72 A;  1SUU A;  3PJQ A;  4XIO A;  2VSK A;  4NC5 A;  2IAO A;  4ZY3 A;  4HZV A;  4MWX A;  1H6L A;  2JKB A;  4J9T A;  5HX0 A;  4FZH A;  1Q7F A;  4GZQ A;  4HZY A;  3ADE A;  2ISM A;  4WA4 A;  4XJ8 A;  2ZB5 A;  1N1T A;  5FZJ A;  2ZB6 A;  5HUM A;  4YW3 A;  2W38 A;  3TC9 A;  5FZN A;  4I00 A;  5GTQ A;  3V64 C;  4YW4 A;  4GNC A;  4YZ3 A;  3KGG A;  1NMA N;  3UC1 A;  2IAS A;  3S94 A;  1L7F A;  4GN9 A;  4MWV A;  3SAN A;  5JYY A;  2F25 A;  4C1Y A;  4MX0 A;  5HUN A;  3LI4 A;  3A9G A;  4NCS A;  1N6F A;  2YA7 A;  2OJH A;  4CPN A;  4GZT A;  5EO7 A;  1NCA N;  4CPO A;  4K1J A;  4D52 C;  2F13 A;  2HTR A;  2GVU A;  1L7H A;  4YW5 A;  1EUR A;  4FOQ A;  4GZW A;  4KS5 A;  3AMR A;  4WEG A;  3LI5 A;  1IVB A;  4MWQ A;  2F12 A;  1V3C A;  4YZ1 A;  2DG0 A;  1F8C A;  4PWZ A;  3O9K A;  2BER A;  1MWE A;  1MZ6 A;  1VCU A;  1SO7 A;  2WOZ A;  2QWC A;  3FVZ A;  2QWE A;  1IJQ A;  2HT7 A;  4KS1 A;  2CML A;  5GX5 A;  4FOV A;  1MS1 A;  1V0F A;  4FQ4 A;  4X4A A;  2XCY A;  4AGT A;  4IFN X;  2ZW9 A;  1MS8 A;  4CPZ A;  1MS3 A;  5NN9 A;  1PJX A;  1Z4Z A;  4QN7 A;  4CSD A;  4YZ2 A;  4XMI A;  3S2K A;  1CRZ A;  3O4P A;  3GVL A;  2AEQ A;  4D8S A;  2GVX A;  3A9H A;  2FP8 A;  2XN4 A;  1N6E A;  4HZW A;  2HTQ A;  4XOG A;  2AEP A;  2YDT A;  4XJ9 A;  4Q6K A;  1MS5 A;  3S8Z A;  1F8B A;  3WW9 A;  2QWK A;  5GX2 A;  1V2I A;  4YW2 A;  5EO8 A;  4A0P A;  2BAT A;  4FPY A;  5D9B A;  3P5B L;  1V3E A;  4FPJ A;  2IVZ A;  4HHQ A;  1N7D A;  3HLI A;  4FP2 A;  4JML A;  4GZP A;  1EUU A;  3TI5 A;  4YZ5 A;  2SLI A;  5B2D A;  4XJR A;  3Q6K A;  3HRP A;  1B9T A;  2QWJ A;  2HTY A;  3KYA A;  4B7J A;  2XZJ A;  1BJI A;  3DAS A;  2IAX A;  4GZS A;  2W8B A;  2FPB A;  4FPL A;  1INX A;  1NCC N;  1W0O A;  4HW6 A;  1A4Q A;  1INH A;  4GJT A;  1W8O A;  3B7E A;  4MZE A;  5FWW A;  2BF6 A;  2F11 A;  2SIM A;  1X2R A;  4MC7 A;  2IAU A;  4QN3 A;  4L7C A;  4FPH A;  2ZZK A;  4K3Y A;  4WA5 A;  2FHR A;  4B7N A;  2VK7 A;  4KS3 A;  3K36 A;  3TIB A;  2W5O A;  4H52 A;  1IVG A;  4GN7 A;  3FW0 A;  1NNC A;  1NSB A;  2QE8 A;  1QLG A;  1E8U A;  1RWL A;  1IVF A;  4IYG A;  5FNT A;  1INW A;  2F10 A;  1F8E A;  3Q6T A;  1NSD A;  1MS4 A;  4QN5 A;  4XE9 A;  1W0P A;  4D52 B;  3E5Z A;  4Q1U A;  1NMB N;  4GNB A;  1USR A;  3W09 A;  1WCQ A;  1V0Z A;  1SNT A;  3NO0 A;  4B7M A;  3GVK A;  2HT8 A;  3TI6 A;  4L7B A;  4MJU A;  1B9S A;  1IVD A;  2VK5 A;  2F0Z A;  3BYC A;  4K1K A;  3A72 A;  2HU0 A;  3ALX A;  4B7R A;  3WDZ A;  2H2U A;  1V04 A;  4FPF A;  4KS4 A;  3VNH A;  2BZD A;  1Z4W A;  3ZGD A;  3D11 A;  4MWW A;  1POO A;  1MS0 A;  5HUG A;  3B69 A;  4BBW A;  4GZX A;  3SAL A;  3BEQ A;  3HLH A;  1QBI A;  1ZGK A;  4FVK A;  3CYE A;  4IQK A;  1E1A A;  4YY8 A;  2G8S A;  4YW1 A;  2X9M A;  1USX A;  4MWY A;  4B7Q A;  4QN4 A;  3S8V A;  1RWI A;  1V0E A;  3LI3 A;  3CKZ A;  4GN8 A;  2A75 A;  4FJ6 A;  4GB1 A;  4YZ4 A;  2HTV A;  2F24 A;  4MWJ A;  4D4U A;  4M4U A;  2DSO A;  4XIL A;  3SOB B;  3SOV A;  4M3M A;  2SIL A;  4MWR A;  1V3B A;  4GEZ A;  2YA8 A;  2VVZ A;  1NN2 A;  1NSC A;  2C4L A;  1S0I A;  2VW0 A;  2IAQ A;  5HUK A;  1NMC A;  2RKC A;  2QWH A;  1MZ5 A;  1INF A;  2GHS A;  4N1B A;  1Z4Y A;  1EUS A;  1S0J A;  1SLI A;  1A14 N;  4IN4 A;  2AH2 A;  3D12 A;  2VW2 A;  1IVC A;  1DIL A;  1OFZ A;  2YA6 A;  1NPE A;  2GVV A;  1A4G A;  4CPL A;  3TI8 A;  3U0S A;  2QWD A;  2F28 A;  4IMB A;  2IAV A;  4XJQ A;  3VNG A;  2V91 A;  3O9J A;  3L6V A;  2QWG A;  4DG6 A;  5GX4 A;  4GDJ A;  2B8H A;  3SOQ A;  3G4E A;  2IAW A;  1WCS A;  4XJW A;  5H47 A;  3SIL A;  4XYX A;  4UOU A;  4M4V A;  4O5S A;  4H53 A;  2QWF A;  4NN9 A;  4FOY A;  3SRE A;  3CL2 A;  4R40 A;  5M1Z A;  3DR2 A;  2F26 A;  4DGR A;  1CRU A;  1MS9 A;  1N6D A;  1C5K A;  3AMS A;  4AH4 A;  4K1I A;  1Z4V A;  1CVM A;  5EX7 A;  2XZI A;  2VPJ A;  2W5N A; 
#chains in the Genus database with same CATH homology
 2AGS A;  4QN6 A;  1INV A;  4MJV A;  3H73 A;  4XJU A;  1XOE A;  4HZZ A;  4GDI A;  4K1H A;  3H6J A;  4XHB A;  1W8N A;  2VK6 A;  5F9T A;  3NSS A;  1E8V A;  4FPE A;  4WA3 A;  3T1E A;  1W20 A;  4XMA A;  2W20 A;  3TIA A;  1L7G A;  4GZO A;  4XJA A;  2C4A A;  1SLL A;  3TIC A;  3K37 A;  4MWL A;  3GVJ A;  3JU4 A;  1W1X A;  4SLI A;  4UF7 A;  2VWD A;  4CPM A;  4XJZ A;  3NN9 A;  4MWU A;  4X6K A;  1EUT A;  4MZA A;  1S1D A;  4X47 A;  4WEF A;  4FPO B;  2F29 A;  2H2N A;  2YA5 A;  4HZX A;  1E8T A;  2VW1 A;  1F8D A;  4FPG A;  3OPZ A;  1NCB N;  4KS2 A;  3H71 A;  1Z50 A;  6NN9 A;  2HU4 A;  1ING A;  3K39 A;  3CL0 A;  1VCJ A;  4M4N A;  4XHX A;  3ALW A;  4X49 A;  2QWI A;  2QWB A;  4JF7 A;  4QNP A;  2VSM A;  2QWA A;  4FPC A;  1NCD N;  4XIK A;  1N1S A;  3TI3 A;  3SLI A;  1N1V A;  1DIM A;  2F27 A;  1V3D A;  1KIT A;  3INB A;  4HIZ A;  1N1Y A;  1S18 A;  3A71 A;  4CPY A;  3TI4 A;  7NN9 A;  2HT5 A;  2YDP A;  1INY A;  3K38 A;  1NNA A;  2YA4 A;  1W21 A;  1MR5 A;  4FP3 A;  3K3A A;  1IVE A;  4FPK A;  5B2C A;  1B9V A;  2XZK A;  1XOG A;  1NNB A;  1Z4X A;  4FOW A;  2HTW A;  2HTU A;  3H72 A;  3PJQ A;  4XIO A;  2VSK A;  4NC5 A;  4HZV A;  4MWX A;  2JKB A;  4J9T A;  5HX0 A;  4FZH A;  4GZQ A;  4HZY A;  4WA4 A;  4XJ8 A;  2ZB5 A;  1N1T A;  2ZB6 A;  5HUM A;  4YW3 A;  2W38 A;  4I00 A;  4YW4 A;  4YZ3 A;  1NMA N;  1L7F A;  4MWV A;  3SAN A;  5JYY A;  2F25 A;  4MX0 A;  5HUN A;  4NCS A;  2YA7 A;  4CPN A;  4GZT A;  1NCA N;  4CPO A;  4K1J A;  2F13 A;  2HTR A;  1L7H A;  4YW5 A;  1EUR A;  4FOQ A;  4GZW A;  4KS5 A;  4WEG A;  1IVB A;  4MWQ A;  2F12 A;  1V3C A;  4YZ1 A;  1F8C A;  3O9K A;  2BER A;  1MWE A;  1MZ6 A;  1VCU A;  1SO7 A;  2QWC A;  2QWE A;  2HT7 A;  4KS1 A;  2CML A;  4FOV A;  1MS1 A;  1V0F A;  4FQ4 A;  4X4A A;  2XCY A;  1MS8 A;  4CPZ A;  1MS3 A;  5NN9 A;  1Z4Z A;  4QN7 A;  4YZ2 A;  4XMI A;  3GVL A;  2AEQ A;  4D8S A;  4HZW A;  2HTQ A;  4XOG A;  2AEP A;  2YDT A;  4XJ9 A;  4Q6K A;  1MS5 A;  1F8B A;  2QWK A;  1V2I A;  4YW2 A;  2BAT A;  4FPY A;  1V3E A;  4FPJ A;  4FP2 A;  4GZP A;  1EUU A;  3TI5 A;  4YZ5 A;  2SLI A;  5B2D A;  4XJR A;  1B9T A;  2QWJ A;  2HTY A;  4B7J A;  2XZJ A;  1BJI A;  4GZS A;  4FPL A;  1INX A;  1NCC N;  1W0O A;  1A4Q A;  1INH A;  4GJT A;  1W8O A;  3B7E A;  4MZE A;  2BF6 A;  2F11 A;  2SIM A;  4MC7 A;  4QN3 A;  4FPH A;  4K3Y A;  4WA5 A;  2FHR A;  4B7N A;  2VK7 A;  4KS3 A;  3K36 A;  3TIB A;  2W5O A;  4H52 A;  1IVG A;  1NNC A;  1NSB A;  1E8U A;  1IVF A;  1INW A;  2F10 A;  1F8E A;  1NSD A;  1MS4 A;  4QN5 A;  4XE9 A;  1W0P A;  1NMB N;  1USR A;  3W09 A;  1WCQ A;  1V0Z A;  1SNT A;  4B7M A;  3GVK A;  2HT8 A;  3TI6 A;  4MJU A;  1B9S A;  1IVD A;  2VK5 A;  2F0Z A;  4K1K A;  3A72 A;  2HU0 A;  3ALX A;  4B7R A;  2H2U A;  4FPF A;  4KS4 A;  2BZD A;  1Z4W A;  3D11 A;  4MWW A;  1MS0 A;  5HUG A;  3B69 A;  4BBW A;  4GZX A;  3SAL A;  3BEQ A;  4FVK A;  3CYE A;  4YW1 A;  2X9M A;  1USX A;  4MWY A;  4B7Q A;  4QN4 A;  1V0E A;  3CKZ A;  2A75 A;  4FJ6 A;  4GB1 A;  4YZ4 A;  2HTV A;  2F24 A;  4MWJ A;  4M4U A;  4XIL A;  4M3M A;  2SIL A;  4MWR A;  1V3B A;  4GEZ A;  2YA8 A;  2VVZ A;  1NN2 A;  1NSC A;  2C4L A;  1S0I A;  2VW0 A;  5HUK A;  1NMC A;  2RKC A;  2QWH A;  1MZ5 A;  1INF A;  1Z4Y A;  1EUS A;  1S0J A;  1SLI A;  1A14 N;  2AH2 A;  3D12 A;  2VW2 A;  1IVC A;  1DIL A;  2YA6 A;  1A4G A;  4CPL A;  3TI8 A;  2QWD A;  2F28 A;  4XJQ A;  3O9J A;  2QWG A;  4GDJ A;  2B8H A;  1WCS A;  4XJW A;  3SIL A;  4XYX A;  4M4V A;  4H53 A;  2QWF A;  4NN9 A;  4FOY A;  3CL2 A;  5M1Z A;  2F26 A;  4DGR A;  1MS9 A;  4K1I A;  1Z4V A;  2XZI A;  2W5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...