4M43H

Crystal structure of anti-rabies glycoprotein fab 523-11
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
EVQLQQFGAELVKPGASVKISCKASGYTFTDYNMDWVKQSHGKSLQWIGDISPYYGSTGYSQKFKGKATLTVDRSSSTAYMELRSLTSEDTAVYYCARRNYDGSWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of anti-rabies glycoprotein Fab 523-11
rcsb
molecule tags Immune system
molecule keywords Fragment antigen-binding 523-11 light chain
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43H02
4UQ2B 4C4KT 4J6RH 5JPMA 5IGXH 2GFBB 2HG5B 3D39A 4HIHB 4XCNA 4YK4B 2B39A 3T08A 4U1KA 2CK0H 2VLRD 3RDTC 3V0AC 4F15B 3PXHA 3MRJA 2JB5L 4CU6A 1VESA 4K8RC 2C1PB 2ZOLA 3ZDXF 2VAJA 1XCTA 2CDGB 4JN2A 2OZ4H 2MKWA 3G08A 4S1QH 4P59H 3K1DA 3RDTA 2Y36L 2NX5B 5F7YC 2VXUH 4XH2B 3FO0H 3V5DB 4OLVH 2VKXA 3WD5H 3NIDE 3VG9C 3VXUE 5CSZB 1I1AC 1R5VA 1V3MA 2F9BT 4MJ5B 4RBPK 1KCSH 2BNRE 4GUPB 1FIGH 3MACL 4ETYA 4G7YL 3TH4T 1MFDH 1WZMA 3BPCB 3UTSD 3LY6A 3ROLB 3C5ZA 3FT3B 1S9VB 1T2JA 3HCVB 3ARXA 4JFPB 4X7DC 3MRGB 3SY0B 1X4YA 5BJTA 4HJJL 1WBZA 2VDRH 4HIXH 3QXAA 4OF3A 3UYOD 3KPMA 3D39D 3DX8A 4UV7L 3HPLB 2BHUA 3QDME 3RNKB 2C4FT 3O2WL 3GZKA 3MUY1 4NKMB 5HI5D 3RKDD 1A1NA 3MV7D 3IB4A 4EUPA 3OKYA 4KKBD 3O3AA 4D0DA 3IJSA 1AKJB 1TNMA 2VUYA 3O3UN 5F88A 3WHXA 1FZOB 1S5HA 1I3GH 4BSWA 2OL3A 1H8SA 1OTSD 4Q9BA 3GSNH 3OXRA 2F19L 4I4WB 4JO4L 5FYKL 2CUIA 1JYVA 4OZIB 3TFKC 3RL1A 3BW9B 5CSGA 5CILL 4GBXC 5D6CB 2X41A 3H9HA 4GQPH 4JEGB 1QLEL 1RVFH 3QI9D 5D1ZD 1YEHL 1J8HA 1RK0A 4F7PB 1D6EA 4LVHB 1K5NB 1T20A 2QV2A 4HFWA 3BZ4B 5EU3B 3P4OB 3QIBA 4IOIA 3MUGA 3QH3A 2W9DL 4AG4H 4H88L 1OAXL 4EJ1C 1UKSA 4NO2A 1CDIA 4U3CA 1FNGA 1GSMA 1NGYA 3X13A 4K23L 2EYRA 4PJDB 1K8IA 3PQYA 3P2TA 1ACYL 3P9LA 3QIBC 1YEIH 4TVPD 4JHAL 4XPFL 2DLFL 3C6SA 4YHNB 4QLRA 2YUVA 5D7JC 3QG6A 5EIVA 1WJ3A 2Y7QB 2RFXB 3ARZA 4QXTB 1R3IH 3OGCB 1PX4A 5L88L 4OZIE 3CFDA 1T3FB 2XKUA 1QR1A 2VDOL 3HR6A 4U1GC 2FHBA 4IRSA 5JDJA 1OAKH 1VEOA 4JDTH 1AP2B 4YDKH 1SBSH 5DHVH 3G6JA 1FNHA 2R1YB 4E0RA 2F15A 1AFVH 3MJ8B 5C07A 5I74B 3C6SB 5ESAB 5CSZA 4LCYA 2DWEB 1FLTX 4C54A 2WINA 4IRSC 4JREC 1QFWI 3VXPB 2KZWA 3KPNA 3LHPH 3RVUC 3ZLQC 3PDGA 1EZVX 2FBOJ 5DSCA 4KTEH 4OCSH 4MCZA 4JDVB 1A8JH 5HGHB 3C6LD 4KKBC 1TJHH 2GY5A 3QAZC 3Q5TA 3DX6B 1T1XA 2ADFH 2Z35A 3Q0HA 1A6TA 4OF6A 4ZPVB 1INEL 3O2VL 2ARJQ 2CIIA 5I2IB 4MDIA 2BJMH 5JMRA 4O9HH 5C6TL 1Z0NA 2OJEA 5DZNA 4D2NA 2WBJB 5KSBB 4BFGA 3IXAB 1T66D 1AGEA 3OBAA 3DX9B 2PETA 5D7LE 2F58H 4QT5B 4XB8A 3K1KC 1OSPH 1LDPL 2HVJA 3HNSL 5TDNA 1QTYT 4GG6A 1AKJA 2IFFH 4H8WC 1DQQB 5C0NC 3H6JA 3MLTA 3THMH 5MEPA 3GSUA 2DLFH 2MHAB 3QWOB 5B8CA 4M7LT 5KSAD 3OXRB 3O6ML 1J18A 1LGVA 3NGBB 4Y19D 1CVSC 1TCRA 1E6OL 4PJ5D 4QTHB 1HN1A 4O2EB 4CVXA 4EEEA 4NO0D 5FUOL 1FZMB 2R1WA 5CJXC 2BXZA 5JTWA 2A2QT 2DQIH 3TVMB 2VDOH 3C6LA 3MFFA 3WKML 1FSKC 1G7JB 2EDTA 2VAAB 4KXZI 5DT1L 4MNQD 3JWDL 1MWAL 3WXWH 4PLKC 3FFDB 3WDHA 1U42A 3BQUC 5L9DL 2QSCL 2NX5D 3VFUA 2K7QA 1LO4H 1KG0B 4MHHI 5H94A 1A6AA 2XA3A 1V7NH 2AEPH 3JUZA 4QTIH 1PEZA 3BQUA 3NA4A 4QRQA 1HOCB 3QNYB 4UUJB 4KZDH 4YC2C 2PYFB 1A02N 2Z92B 3PDOA 3BESR 5FUZL 4Y8AA 5ID1A 1LO0H 4P5TA 4XGZB 5D1XD 2VLMD 4WW2C 1CDUA 2JIXD 4MAYD 4Y5XC 1Y18A 3V5HA 2H2SC 2J6EA 3RVTD 1JIBA 3NAAL 4JVPA 3AREB 3LKSB 4P5TC 4EKXA 1QR4A 5L2KB 4QRSB 1T1WA 4V1DA 4HPOH 1I3UA 1BZ9A 1MFCL 3JWNC 4P0DA 5GRUL 3UX9B 4HKXB 3GJFA 1BM3L 4NNYA 1UB6B 3FO2B 5DVNA 4C83B 43C9B 4ZS7H 2F19H 5CAYB 5JNYB 2BCKB 4ZUUB 1F4XL 3EGSB 3B2VL 1ZA6B 4QHMB 4HKJB 2YD3A 3O9WD 5F89B 5C0BE 3I6LD 2BC4B 4JPIB 1GYAA 4JR9H 5EOTB 5I1AA 5GIRA 5DRXA 3HG1D 4ZAKB 2OR9H 1JPTH 3RY5A 3DECA 1QBMH 5FCUH 3T4YB 2Q3ZA 1A9EA 3MJ9L 4IHOB 3HAEA 1ND0B 1PX3A 4E0RB 1PEWA 5FKAB 3QI9B 4MGXA 4CKVX 3SQOL 4JO2L 3GSVA 5TPWH 3VD5A 4KQ4H 4UT9L 1WC7B 1VFMA 3IAPA 2ATKB 3LZFH 3GSXB 4PJFB 1BIHA 1LE5A 2VLJA 3NCFB 1MLCA 2WP3T 4HF5H 3HRZA 4PB9H 5C0GB 3FN9A 3EDJA 4MWFA 2QQNL 3T2NH 4O2CA 3V4PH 2I9TB 3BUYA 4C58B 4ODWB 2OTUA 5DURD 1MRCH 2V2TB 1S7TB 3W5NA 5F3HB 3P73B 2VZOA 3UO1H 3I6KA 3LB6D 5D7LA 4YDVA 4EVNB 3L5XL 1RZ8A 3BPCA 5C9JB 1XCQB 2W65B 1GL4B 2Z91A 3S96A 3BZ4A 2YRLA 4HBCL 4XB7A 1XGTA 2FJGB 4XMKH 5HYJD 3B5TA 4MXWL 5EUOB 3CZFA 1BD2E 1NCDL 2AV1A 3MRNB 4LEXL 3KPLB 4Z7UF 1OQXA 5I8OL 3ETBF 3O45A 3A67H 2YD5A 1ORQA 4OZHE 1IZKA 2FECI 5BOZG 5IB4B 4S0TD 4OFYD 1N5YL 2V2TA 1IJ9A 4YEFA 3DOSA 3D18A 4KXZH 1XF5A 3ULUE 1F3RB 4Z78A 1W72H 2XTJC 3QDJA 4CMHB 4L3EE 4QY8B 4HEPG 1S7QB 2OP4H 5JUEL 1PYWA 5T1KB 4JFEE 2WUCL 1MAKA 4XVUC 2HAZA 1JE6A 5DI8A 5KN5A 2DWDA 1F2XK 4NYLA 5E2VL 3D69A 1J0KA 1TZIA 1WC7A 2YPLE 1XF3B 4N5ED 4QRUA 2WBJD 2OSLA 2C1OA 1W2KT 3G6JB 4YHKL 5DZOA 5SWSB 2VLJB 1OAQH 3TIDA 4AM0B 2YEZA 5ECJE 4OI9A 3OAYH 2EE6A 2J8HA 5I1KH 4EI5A 3EDEA 2YN5A 4NQCD 2M2DA 4K94L 5HYJA 4PJIE 7FABH 5TE6H 4YXKL 4MA1B 2A6DA 4E42A 2QADB 5D2NB 4FXGB 2JCCA 4K7FA 3F7VB 2FX8L 3NBNA 1IAOA 2FJHA 4NQEB 4NQDB 2IG2L 4J2XA 2AJZA 5CGYC 1X5YA 1WVZA 1A5FL 4OF8A 3RL2B 3BZEB 3WL9A 3U4BL 4PRPB 1ZLWH 4PGEA 1KC5L 2HRLA 3C9NA 5GSVB 5DD6A 4KZDL 1EXUB 3MV11 3RNQA 3W39B 1NBZA 3R0MA 4RGMB 4NCC1 5D70L 5MERB 3T09A 4AEHH 2V6HA 4LSRH 4DVBA 3SE4C 1MCOH 3C2SA 1DBKH 3CXHK 3EJZD 2IGFH 2X4OA 5FM8A 5A16A 2YD1A 5DRWA 4NQXB 1RIVH 2R1YA 2H6PA 4EI5D 1DBML 3L3DB 3SJVD 4YDLB 3PGFH 1UXWB 4X99A 4APQB 2VISA 4Z5RA 3SE4A 3CZJA 5DQJB 1NC2B 3VDAA 1Q9LA 1DQDH 1ITBB 4HC1A 4M3JA 4PREB 1OT1A 4LSUL 5CMAA 4NNXB 1MRDH 4MJIB 4OF7A 4BELD 4FFWD 5DD6B 4HAFA 4OIIH 4P59L 2XRAL 2YEZB 1L9NA 3ARFD 1KG0A 5J3HD 3L6FA 4U1HB 4NUJA 3QIWD 1BF2A 3EBAA 3OJDA 4M6ML 4P9HL 2A73A 4OSUH 5FB8B 3F58L 5IJKC 3REVB 4G9FE 4AH2B 2BX5A 3MRQA 2G2RB 2G60L 4LPWA 5AD0B 7FABL 2YUZA 3V5KA 1IBGL 4XNYL 3ULSA 1KBGH 5IJKA 3MV9B 4JFHE 3B4NA 5J6HB 2PW1A 1UCBL 5E6YA 4JLRB 4LOUC 5CJOH 4MJ6A 5DRNB 2BNRA 5FKPB 4LPVA 4HUVB 5B4MD 3RA7H 2W0PA 4OLVL 1N4XH 5J56B 2UV3A 4NP4H 4GG6E 1DE4A 1TZGH 3QEQD 3IFNL 5I1LB 1LO3L 1MJJA 2NNAB 3QUYC 3RNQB 3WO3B 1LHZA 2BNQD 1FO0H 3L95B 2Z35B 3QULA 2CMRH 4LK4A 4M7KL 4FN0A 2NY7H 5J6HA 4K94C 3GB7B 3SE3C 4GW4B 1JHTB 5D5MF 2EIZB 1OW0A 4LKCB 3T8XB 3RDTD 5HYQB 5ADOH 4TQEH 3UBXB 4FS0A 3TWCL 4OAWA 4JY6B 5EA0L 4NQDA 1G7IA 4PGBA 5ESVA 2XA8L 3N1FC 2C3XA 3H9ZA 5B4MC 4R7NB 4LF3B 1A6VL 1RIHH 5DUMH 3A67L 4PJ9D 1QBLH 4YHZL 4XPBL 3RJDA 4FQCL 1A7NH 1J88A 4N1HB 1SYSB 4P57A 1CT8B 4KRPB 4MA3B 1A1OB 1A6ZB 5FYJH 2Z0BA 3MR9A 5ETUA 5CBEA 3REWB 1MI5B 3WHE0 5EZLA 4R9HA 4GKSA 2NY5H 2X4PB 1C8PA 2A6JB 1FC2D 1QP1A 3MODH 4J3XA 1A7RL 3F7QA 3QIWC 4MMXC 4P46D 1BZ7A 1C12A 3GMLB 2YUXA 3BKML 4ELMB 1NC4D 2KUTA 3CFJA 4J3TA 4ONFL 2B2XH 2ZUSA 4KGLA 4BZ2L 1RD6A 1QVOB 1MUJA 4OZGE 4I77L 1EAPA 2XZAH 3P9WB 4LOUD 5BXFA 1TZGL 3VA2C 4N0CC 4HAGA 3ARYA 5SWSD 1MLBB 4PP2B 1ORQB 4IDLA 1T1ZA 4C56A 3UXFA 1NMCB 5DA0B 1OTSC 4MB5A 3RVVC 5DD5L 4FOMA 3QI9A 4YHIB 1MH5B 1HHKA 4Z77A 3T3PF 2WWMC 1OLLA 3QUYD 1BREA 2XN9B 2IPTH 4B53A 4QYOB 4TRPH 1ACYH 4G6FB 1HI6A 2CLZB 4JM2A 5BRZD 5HGBA 3G6DL 1AE6H 5EDXA 3KPSE 2X4RB 2E7MA 2I60L 4LQ1A 2V2XA 5F21B 4P2OC 5FKPA 4LRNH 4PR5B 5DJ2A 1MAML 2E9WA 5GISL 4P4KC 4L4TB 2N56A 3F65A 1PKQA 2GTZA 1MHCA 4C56B 3H9SB 4HUMB 2EDRA 5TE6L 3HC4L 2HT4C 4WHYH 4PV8A 4JFDD 4P2OA 1VFBB 1BQUA 4JRYB 3OKDB 3FJTA 3VFPA 3QO1A 3GMOA 1EGJA 3PWVA 3NPSB 2VUOA 1OAYH 3LKQA 4ZFZB 5SWQA 2FYYB 2V17L 4KMTL 2DQDH 2C26A 3OKKA 4XBGB 4DOHB 2LU7A 1HYSC 4LCUA 4FQPA 3MLWH 1HSAA 1DLFH 4DN4L 1A1MA 1DQMH 1YUHA 3X11B 4OV6F 4OUUB 1UM4L 3S8WA 2AERT 1NPUA 4L29A 4E5XB 3WNOA 4R26H 4DN3H 2DB8A 1ZHBA 3BQUB 2HYMA 4PRHB 3TCLA 1P7KB 3PHSA 5C0DA 2PYFA 3BE1H 5JLZA 5FGBC 5EORH 1W0YT 4YHMH 3CFEA 4KDWA 5L9DH 4XBPA 4Y16C 4NJ9L 2FJFB 5D8JH 3S37L 4P57B 5ICXB 4Q97A 3SGKA 1NFDE 4G9DA 5I18L 5FGBA 1MH5A 1X5LA 2AEPL 2AEWA 3PQYE 3WS6A 5FGSA 4UILL 3WLBB 1XCTB 5KSUA 3QEGH 1UADC 3PP4H 5ESVB 1DN2A 1ZWIA 2VWEE 4YNYB 1SBBA 1YYMH 2LVCA 5DRZA 4WEBL 3WIIH 1M7DA 5SX4H 1JWSB 2IMNA 1AY1L 3IDMB 5GRWA 4HJGB 3J7HA 1AGDA 1JF6A 4LVNC 5IV2B 5EOCH 3T0BA 3TT3H 2LVEA 4M5YL 4U1MB 5CJ8A 2VDKH 4OLYL 1LO4L 2HRPL 4TOYL 3FB7B 1JGDB 2UUDH 4X6FB 3ALWA 3JTSA 2AP2A 4UIMA 1YJDC 3NTCH 1HQ4B 2IPKB 4NO0A 3SGEH 1YMME 2CJUL 1AP2A 1JGVH 4L4VD 4F8TA 2EIEA 2Q6WA 2LU4A 3ZDZF 1IAII 1GZPB 2PCPA 3I75B 5HHPB 2I25N 5GSRB 4YBQD 3H9SE 2R9HD 3MTRA 5BW7A 4XRCB 5DJYB 3TNNB 5IV2A 3RIFK 1I8MA 4EUPH 2IEPA 3OX8B 2DQEH 2FH6A 3B9AA 3FO9A 3KHOA 4P4KB 5HDLA 5GQBA 5JIHA 4Q0XL 4OV5A 2RIKA 4Y4FC 2JJWA 1NGZA 5GJSH 3PWPE 1C5CH 3L3IA 5L88H 5HHMB 1FLRH 4KK5C 5D72H 1Q72H 3CMOL 5TH2A 2NY2D 4LU5L 4LDOB 1IQWH 4QRTA 1IC5L 3LN5B 4Y4FA 4PGCB 5K59F 5D1XA 5JPNB 4I0KA 4Z7OF 4OGAC 2YPLA 5FM4A 3D18B 5C0JB 2BMKB 4XVUD 2PW2A 3M8OH 1MIEL 1KJ2L 2XN9A 3VH8A 1L6XA 3D2UA 4IHOA 1V7ML 1OTTD 2YUWA 4QRPE 3NCYS 4P2QD 4KTEL 1KUMA 4ONFH 4WUUB 3MRNA 3ARGA 1BJMA 2HTKD 4NZTH 4OZGB 1QHOA 4EIGB 2LAAA 2QQLL 3GHBH 4G6AC 1FYTA 4P2CG 2RCSL 2EE2A 3SKMA 1I8IA 1OAKL 3B6SA 3VXME 1CGYA 4MXWH 5I75B 1OAZL 3TBVA 2NY4C 2Y1VA 3CFKB 4MD0A 3RUGA 2OTUB 3U7YL 3P0YL 4Y5YC 1A6WH 2D4DA 1FN4B 1MFEH 4H1LA 4LLAA 3VXSA 1D7FA 1KN4L 2X2YA 1IC1A 4EIZC 5CWSB 1MEXH 3MRRB 3BIAX 4WGWB 3NZ8B 1K4CB 1HDMB 4PV9B 4AENB 3QQ3B 1UH4A 4RFNC 1OAUH 2EDQA 5BVPH 4NO5B 5F3BA 1I9RL 5A43C 3V79C 3DSNA 3SOBH 1HOCA 4UUJA 2GHWB 5EPMA 3MLTB 2QQNH 3MRKB 3T2NL 3W9EA 4QXTA 5ELIA 1JZ8A 1BVKA 3LD8C 3QQ4B 4HS8H 5E2UL 4G8EB 4YE4H 1EHNA 1NCWH 4OCYH 1EK3A 3DIFA 5CKAA 1LWRA 4E41B 1F4WH 3STZA 5TE7H 1IAIH 2VLJE 1KENL 2IAMD 5DR5L 1N26A 4JG1L 1WV7T 5AYUL 1ZMYA 2IADB 5K93A 3RWGB 3T0EA 1FH5L 4M00A 4MA8L 1DBAH 2VC2L 2Y5EA 4RAVB 4AY0A 5TQ2L 3UCRA 5JR1H 5KW9H 2APBA 5I1DA 4QHUA 2AXFB 2B4CH 3O6FC 3QEHA 4KVCH 5HY9B 5DD0L 3MLZH 1LO2L 1O7VA 1H15A 4N90D 3D69B 3T0EC 1NSNH 4FXKB 2XQYK 5GS1B 1N8ZB 4L3EB 4HCRH 3VMNA 2DS4A 3O6FA 4OCLC 4NZTL 1FNSL 4W70A 5C0DB 5I1LA 2R4SH 1I8IB 1BJ1J 3MO1A 3T3MF 3UTTB 1TQCB 3WV0A 2YZ1A 2KQMA 1NFKA 4L3AA 5ADPH 5ISZB 3OAUL 2A6JA 5CZXC 5A16B 3Q3GA 2VXVL 3X12B 3E6HB 3VCLB 2XZZA 3RBSA 5DEFA 5HSFA 5I74C 5DUBA 1G0YR 3VGFA 4X5WB 2E27H 1B2WL 3MCKA 1U8JB 4ONOA 4QRRE 4ZUSB 3VH8B 3DUUA 1JF5A 3ZKXB 3FHAA 1FL6B 4PJ9B 3VW3H 2O5ZL 1T7YA 1FGNH 5DJAB 3T0ED 1YQVL 1N0LA 4CN6A 5DFVC 5MENA 1KNOA 2EXWD 3BPLC 1C5BH 3VGGA 4YHPA 3BD4A 2LTQB 5JPMB 4U1HA 2YWYA 4FXLA 1KB5H 3OMZA 4DGIL 1A5FH 4XCNB 4HUWA 1FFNA 1VFUA 5F9AC 2NY3B 2Z31B 2R0LH 4X5XB 3MOAH 3D3VD 4NRYA 5GRUH 4IOFD 3QZWA 5CGTA 4NO0B 3DRQB 3G5YA 1MWAA 5LQBL 1MIML 2HH0L 3ARBD 3TO4D 4LMQI 1H3PL 4TNWF 3GSNB 3T65B 4GLRI 4F3FB 3HB3C 4XPTH 3C5JA 4L1HA 4TVPH 5DHVA 3CH8A 5C0AE 2HP4A 4PRPE 3GMPB 3WDIA 3QPQD 5ICZB 2FHCA 4YLQT 4YO0A 2ZZUT 1FQ9C 1IM3A 4GBXA 4Y1AD 4M4RA 4XX1G 4Q7DA 3UJJH 4G9FA 3HZKB 2W0KA 2AQ2A 1A14L 5DJDA 3QNZB 3GEWB 4GAFB 4WI4A 4LCWE 2Z8RA 1ZA6A 1NAMB 1AXIB 4GW4A 1KIRA 5TJWK 3RZCC 3TPUB 1QO3B 2CQVA 3BP5A 1AIFA 3AREA 2LQRA 2Z93B 1R5IB 2NY4B 5IW1B 1KIPB 3MBEC 4P99A 3V52H 4IRJB 4BQ8A 2DIJA 4Y5YB 5K9JH 1FDLL 1S7WA 2H32B 4HS6A 2RQ8A 3U1SL 5L2KE 3GGWA 3CXDL 5EFIA 3GMLA 3ILQD 3MBEA 5D7KE 3WS3A 5FYLE 3RWEA 1EO5A 1F6FB 1F5WA 2EDJA 4XBPB 4LLQB 4I4WA 2DQJL 2YK1H 4KWUA 4WVRA 3HPJA 2ZG1A 3MNVA 2ZUUA 4JO4H 2HFGL 2WIIA 1AHWB 2R1XA 2WQ8A 3K4DA 2EEBA 4YZFF 4JZOA 5HDBF 3BYYA 2QL1A 4TNWK 3ARSA 3QHZL 3ZZ1A 4D94A 2ZKHH 2HKHL 4GAYB 1FO0L 2CGRL 1F90L 2W38A 2L4OA 5I19H 3BRFA 2EYTB 2KPNA 4YWGL 3IVKA 2HT3C 3NPZB 3HZVB 4GXUN 3PHQB 3FL7A 4IOFC 4YDKL 2F54D 1X5HA 2H3NA 5H37G 1INDH 1EFXA 3U30C 1TIUA 1IKNC 4UQ2A 1LNUA 5FO9B 4FHBD 4KY1H 5GRVL 3HZKA 3ARPA 2CMRL 3O45B 2DIAA 1EZVY 1I3VA 4L4TA 2ZCLL 3WBDA 2Q3AA 4R8WH 2JB6A 2PYED 3AB0C 1IKNA 3UTOA 1IKFL 4O02H 4I5BB 4BZ2H 4R0LA 2Y07L 5D2NA 3H3PL 3MRHB 1S3KL 1IZJA 4DKDC 1QKZL 4QNPE 1NMCC 4QYOA 4ODVH 2ICES 3DVGB 5DD0H 1E6JL 5F1IB 2ZG3A 1T6WA 4RISL 3X3GH 1OB1A 5J1TC 2EDHA 1XMWA 3I02B 2VABB 3S35X 1BOYA 4HV8B 4IIQA 3RWFA 3RX7A 1FBIH 1XZ0A 1NCWL 3PNWB 4HX1B 3SPVA 1RZIA 3B9EA 5DQDH 3U0PB 2YS4A 3MLRL 3CMGA 1J11A 1T1XB 1KENH 2ATPA 3CVHB 1FFOB 4JFXB 2AKRA 3U79A 5KVEH 3OF6D 3FQNB 2M1KA 2YA2A 4PRIE 4G8EA 4Z7WE 2FATL 1OT2A 1NBYB 3L7FB 4BH7A 4OZFB 1R5WB 4D0BA 4OM1H 5D2LF 2NY6D 3JWOC 3RQ3A 1MAJA 3HKFA 2Q7YA 4PYGA 5T3ZH 1PZ5A 4YIQA 4XMLH 3DX7B 3V8OA 4XXCC 3KLAA 4JANB 2XTLA 5DVKA 5F1NA 3WS3B 5FYKD 1AE6L 4CVZB 1OP9A 4O2FB 4PGEB 1X7QB 1WK0A 3MV9E 3HTLX 4O9HL 4B5EA 4MAUL 5HHQA 3ULUL 3RDTB 2OTWB 3QO0A 2DD8L 5LWYL 4JRYA 5EZIH 4KKCD 2X9XA 2AK1H 1XIWD 4NO3A 3GSRA 1IGCH 4JKMA 3PV6A 1FVEB 1VPOH 2J5LC 3D3VB 1IC7H 3TJHC 1UB5B 5EULV 1FYHB 3VXRB 3B2UC 3OKMB 1LO3H 3WSQH 4IMKC 2FO4A 3DVNB 5D7JB 1A4KB 5FIEA 1KB5A 2X70B 2PUQT 2XWJB 4KK6D 1A0QH 5IEHA 4BJLA 3TO2A 2BNUB 5GGQL 1PQZB 4NQTA 3CX5K 4YPGA 4NUGL 2DQIL 2MQ0A 3E2HC 2GCYA 3MUHL 2EXYD 3T2QA 5IBLD 5E8EB 3VG0L 3U2SB 4ALAL 3NIFF 4WEUD 4TSCL 4F7TB 3VE0A 1D5BA 1FNEA 4RRPA 2HFTA 1DSFL 4ZUVB 1UWXH 1U8LB 5GGUB 4Y19A 4LSPH 3QFJA 3VXRA 3IVKB 4LQFL 1JYXA 3ZDYE 1RIHL 3SJVB 4JY6A 3K46A 3PWLA 4QRPD 3ZE1F 3ZKNC 1QNZL 4FMFA 5IT2H 3U4EA 3QCVH 4OUOA 1YN6A 4PUBL 4KC3B 3VE0B 3VWKD 1N6UA 5IGXL 1X4XA 5EC1A 2HFFB 2C3VA 4PD4J 2RGSA 1CVRA 3MV7B 4IOIB 4P9ML 4JKWA 4X98B 2HTLD 3MNZA 4GKSB 4H8WL 3FN0L 1YPZA 4PJIB 4M9OA 4FFZH 2JTDA 3SDAB 3I85A 1G7QA 1JGEB 1U91B 5C7XL 4TTGA 5FYJD 2BNRB 1CTNA 2HJLB 1G6RA 4NCDA 4HK3J 1UCTA 1ZE3C 2BVUA 1EJOL 4YAQA 1YECL 4M6NH 2FIRT 4U1NA 3KDMA 1ONQA 5IVXA 4NWUH 5DHYA 2Y25A 4FG6D 1A3LH 2OR9L 3NFPA 4X5LA 5GS0L 2ZOLB 1EVUA 3NA9H 1MQKL 2V2WA 3TN0A 1J0YA 1PZUB 4FQHB 4HG4K 2P47B 3QUML 1D5BB 1FNEB 1NL0H 1HHHA 1AJ7H 2CGRH 2ESVA 3QXDB 4U4BA 3BSZH 4CUCA 3QH3B 3DUSB 3OKNA 4FQLH 3LZFL 3O9WA 3B83A 2NXZB 4XCFH 3T0EB 2O5YH 3WN5B 1U8JA 1J87A 1MFAL 2H8PB 5T1LD 2OP4L 5HVGB 4X80H 1BQHG 2D7TH 4EN3C 4WU7B 4YBLC 2AS5M 5EBMA 5DYOA 2XZQL 1S5HB 1U8MA 4RWHA 2XFXB 5C0IA 2APFA 5C0EB 1T4KB 4L4JA 1KEGL 1U95A 4JQVA 4RRPG 4JVWA 4UBDD 3P0GB 1FCGA 1KFAH 3MZGB 4M8QA 3DUSA 3QO1B 4GAJL 3SKJH 3M8OL 2CDGA 3VWJC 3IJYB 3LN4A 4KRPC 3RWIA 3MRIB 4OLWL 5EU7E 3FFCB 4U05A 4XCYA 2AK4A 1JRHL 3CDGB 1CGVA 3FAXA 1G6RB 4R96B 3WL9B 2JK5B 1TTUA 1P53A 3H8NA 1PZ5B 5AZ2H 1A47A 3MMEB 4JM2B 1SVCP 5ID0B 2R0ZL 3HNVL 1H8NA 1YEEH 2GJ6E 1CU4H 1NFIA 5HHXH 3RVWC 3AGVA 2W59A 1RUML 4LCIL 4DUXA 1KT2A 2BXYA 1S9KC 4L9DA 3VRJB 4S10A 3QUXA 3X12A 4Z7VF 5E2VH 4Y8DC 4A6YL 3RTQC 1EMTH 1J5OL 4F33A 1YC7A 1YYML 4X98A 4I2XE 4PRID 3QUXC 3HFML 2C1OB 1PG7L 4JM2F 5T3ZL 1OGAA 4Q2ZB 4S2SB 5C86A 2ICEB 1QHPA 1RJYB 3DV4B 3GIZH 3TT3L 5SV3A 1ERNA 5DLMH 1J0HA 3KPNB 1QUNA 5F1KC 5JHDA 1B0GA 5E03A 1ED3A 1I3RA 5GGQH 2VTFA 5I1EH 2R2EA 4GAGH 2JCCB 3CPLA 1FZMA 4L3CA 1IGJB 4XNZC 4Z78B 3NIFE 4HUXB 1WCQA 1BD2A 4UIMB 4ZDHB 1K5NA 3MGAA 2J8UB 3EFDL 1C5BL 4UOW1 4X4MA 5DHXB 2EH8H 2GK0B 3S98A 4HG4J 2R69L 1KSRA 4LKXB 1FG2B 2G60H 4M43L 4WTZG 3KPPA 3O41A 3VMOA 1IQDA 2OXHA 3VWJB 3MLUL 1FPTH 1JPFA 2YC1A 4NHCL 3JTTB 3AM8A 3PGCB 5C9JA 2IAMC 5DMIH 1I1AA 1T7XA 4JGUA 2W9LA 1PGRB 3PWNA 1IQWL 1UZ6E 1EPFA 3L1OH 1ZS8B 1VFOA 2ORBL 2F54E 3IDMA 2P45B 1YZZA 1A7PH 1CXIA 4IRSD 1WZLA 2YHGA 5SX5H 3F12A 1RURH 2CLRB 4M6OH 5EBLB 5FYKE 5FA4B 2DQCH 1H8OA 4F7PA 1WZ1H 3AU1A 5ITBH 5C0RL 1J86A 2BP3A 4OZHF 1KTDA 1CCZA 2DWEA 3BEVB 3NCCB 3HCVA 3SDXB 4RGNC 2A0LD 4WUUA 1JI2A 4KHXL 4WWKC 1WSST 4ZO6A 1JFQL 3GKWL 4DEPB 2WANA 5I9QB 1JMXA 2B8OT 3TT1H 1BFOB 2QBWA 1A1OA 2W1NA 4GRMA 1ZEAL 3BKCL 5KSBE 3KLHD 4K3DH 4B41A 1GOFA 1JTPA 3S36H 3C6LB 3AU1B 4LARH 3RIFF 2DOCA 1YEFL 4K7PY 4MQSB 1C1EL 2Z93A 3EYQD 2DF3A 3WFEL 4K8RD 3BD5A 3KYOA 2IANE 2OMNA 3HLAA 2GSIA 1S9WB 4KKNA 3DVGA 2J6EL 2NTFB 1S9VA 4Y1AE 1RU9H 2H2PC 4F7CA 4PJ5A 1XR9B 5DDHB 5IW3A 4HUVA 1BQHB 5F6IC 2AXHA 4YBHA 5HXMA 1I1YA 4NZRH 4GBXD 4UDUA 1XIWB 25C8H 3QQ4A 4M5ZH 1AJ7L 1FRGH 4OZFG 2PYEE 2XTJE 4G9FD 3I50H 4HWEL 2BC4A 4JPIA 1NCCH 4HZAA 5FYLH 5GJTL 3UZVB 3GI9L 3EO0B 3KYOB 3V52L 1C5DA 1NANI 3K8MA 3V95A 1DDHA 4I3RH 3QHFH 4JLRA 1K3ZA 2BOBB 4KPHH 1X5FA 4JM2C 4NN6C 1SEQL 1RIUL 2FGZA 2OS7A 2AJUL 1HH9A 5I66B 3L3OA 1JVKA 3VXSB 5KG9A 3MQIA 4WO4D 4P2QB 4LMQE 3S3JA 5IM7B 4LPTA 1ED3B 3M17B 4KVNL 3LEVL 3ECBA 4FFVC 4HFUH 4G6ML 4PV8B 2FEDD 1YNTB 1GGTA 1RK1B 3FO1A 4HS3A 4HIIA 1NGWA 2X4PA 3L6FB 2PO6B 3X14A 1NBVL 4WV1A 3MLSL 3D5OF 5DK0A 4JPVL 2HN7A 5D1ZA 4QTHA 2BJML 5L6YL 3ZTNL 4MLIA 5B38A 2P7TB 5I1GH 4Z8FH 4U1GB 2YBRA 4WV1C 2JELH 3H7LA 4LFHD 1FGNL 2YMXH 4CADB 1BOGA 3MX0A 5DMJB 1T0MA 4PV9A 5KOMC 2BHYA 3T2PA 4GKNB 1CIUA 5L2KD 1QYGL 4OZHA 2ZUTA 5EZOL 4M03A 4OLXH 4U7MA 4LHUB 5CJ5A 4O58H 4QF1B 2F54A 4MDJB 3KYNB 3WNPA 4PP1C 2VLKA 2X7LA 4JHWH 4H0HB 5C09A 1I1CA 1YQ2A 3IDJA 1A7QH 3V4PL 1IGIL 4XNQA 3OKEB 2YD2A 3R06A 5F9JA 5HI3D 4LLYA 2OTPA 1EO8L 5I71C 4XVTH 3WS6C 4RGOH 3F7VA 1C7SA 3O2DA 1RK0B 3S4SB 1URLA 1MJ8H 4HPYH 1DEEA 4X6EB 5CJXA 5D96C 4Q6IB 4PTTB 1I9IL 4LCYB 3R0NA 1BLNB 1T80A 1WEJL 1G9NL 4KV5F 5HTSA 2MHAA 4YFEA 1WTLA 4U1SB 5C0EA 5J13B 2H9GB 3QQ3A 3R1GL 5C07E 3O4LE 4R2GD 2UZIH 4J8RB 1QLRA 2P1YA 1NUDA 2M26A 1AD9B 4PLJD 3D3VE 1D5ZB 4EI5B 2HWZH 2OMBA 1N2RA 2XIDA 3MRBB 1B0GB 5E6IB 3W9DA 1QFWM 1LMKA 2P5WD 2HTLC 4PB0H 5CGMA 4MB3A 4ZO8A 5D8JL 2VDLH 1P4LA 3GBLA 3F62A 4ELKB 3NAAH 3L5IA 3IYLW 5C09D 1I9JL 2XY1A 2DQUH 2F5AH 2CRZA 2G9HA 1NH6A 2R2HB 5T1DL 1XGYL 1YY9C 3G9AB 4YXHH 4I0CC 3BPNB 3FB8A 2W0FB 5BV7C 1MFCH 1J0ZA 2DMBA 4P9HC 4DEPC 5TPWL 3WXVH 1MRFL 4PY7A 3GMMA 3ZE2F 5AZEL 1RZFH 3DSFL 3H42H 4X4ZA 3PV7A 2GI7A 1EHXA 2XKNB 4NFBA 2PR4L 1F8TL 4G42B 5DD3L 5FF6B 5E24E 1YY8A 2F53D 2D7OA 4R4BA 4LSSL 2YD8A 4OLUH 1V3KA 4JY5H 2R8SH 3S88L 4OD3H 5IW6A 4MNGE 4G7YH 3QHZH 3T77B 3WFCL 1G7MB 3VXOB 1JPTL 3EO1B 1RHFA 1CI5A 5DGQA 1ZLUK 4MQ7A 5CLTA 1U2CA 5DK0B 1E4WL 4HS6B 5B38G 3VCLA 4P3CH 2CO7B 2EZ0C 3HC3L 1D5IL 1C08A 1J7VR 3QJHB 2RB8A 1B4JH 5DQ9B 1AH1A 4KHXH 3BT2L 1DL7L 4ZXBB 3DLQR 5FF6A 4KKCC 4GW5A 4EUPB 1V7MH 1G9ML 3VGAB 3IJSB 2Y6SC 3FN0H 4QOKB 3O4OB 3U4BH 4AT6A 4NQCA 1ZEAH 3BKCH 3VH8G 4LHUA 3WEXA 4YHPB 4CN1A 5EN2B 2FJFA 1HINH 3BEWA 4M7ZC 2WSKA 1MCDA 2ENSA 2N7BA 5FKAA 1I3GL 1HHIB 2Y36H 4Y89A 4K7PX 1RZGA 4FQXA 3MRLA 2FX9L 4CADA 1JNNL 3INUH 2JJUA 1IVLA 3UTQB 1KJ2H 1SEQH 2WLZA 3TJEL 3AY4C 5TE4H 1VADA 4GG6B 1OP5K 3MYJA 1OP5H 1UGNA 4JO3H 4GS7C 2H2SD 3QEUB 1MRCL 3TPKA 3RGHA 5I0ZA 2NY5C 2EDBA 2X1OA 5IVZB 1VHPA 2OYPA 4F58L 5BV7B 2GSIB 2Y6SD 2O61B 3AY4A 4I18A 4JPWH 3KYAA 4MSWA 5E2WH 5FGCE 9CGTA 2VDRL 2EDKA 1CD0A 2AVGA 5DGRA 2NTFA 4N68A 4HKJA 1HHIA 1KLFA 4GJTB 4YH6A 3RTQB 4UI2A 2GSGB 2WUBL 1IGML 4HWZB 4FFYL 4XP4H 3QXWA 3DMMB 5HYSA 5CUSH 1WTGT 4CMMA 3FOLB 1Y18B 2PO6D 3AS3A 3V5HB 5HGAA 5IP4A 3JUYA 1H3UA 1HILA 4LFHG 3ARGB 4U7SA 1BOGB 3RHWK 3H0TB 4ZXBA 5HHOA 3TESA 2XPGB 1FC1A 4WI6A 4WI3A 1UACL 5EZOH 1A6UL 4FQXD 4KK8D 3SKJL 1FVCB 1MJ7H 3DJ9A 5TDNB 3MJ8A 5C07B 1BFOA 1JNLH 4UV4L 1J1OH 3MRDA 2ED9A 1BIIB 5I1KL 1QG3A 5FV2A 3JSSA 4R4NC 2CKBA 3D85A 4D0BB 1RZIB 3EO9H 4M7KH 4EI5C 4NKIL 5EB9A 5J11B 2ESVD 5HVWA 4XMLL 4DUVA 4N0UA 4NKOA 1OGAE 4OTXH 3VD7A 1KCVL 5AUMB 4YDJA 1WEJH 1OB1B 2XACC 3G6AB 4AMKL 5TE4L 2VIRB 4JFDE 2PCPB 4JPKL 1KIQA 1WLHA 4N5EC 2D03H 5EOQH 1OWWA 4JFDB 5I16A 4RX4A 4N8VG 1IL1A 3PGCA 2ITCA 3FO9B 5DJCB 3HZMA 5SV4A 4ODBD 1JYNA 4M7ZB 1R3IL 4U1JA 5I8CB 1W72B 5HHOD 3S3PA 3L95A 4MQXC 3ULUC 4WUKL 3UYRH 1UWXK 2UWEE 4MQ7B 4G7VH 3OR7B 2BVOB 5D71L 3AC0A 1XGUA 1RIVL 1JZ3A 2VE6B 4XNYH 2KZ1B 2UUDK 4LEOB 1Q94B 1F3DH 4OZ4A 4HC1L 5C0JA 4HIJB 3MRMA 5JIPA 5JIIA 3O3EA 5CCKL 3CDFA 1DQDL 5KVGH 2A77L 3EYFA 3UMTA 1ZAGA 1BFVH 1QVOA 2Z8VC 3DYOA 5HVFB 5E70A 5SWSE 5I8EB 4QGTA 3ROOB 4BFBD 3H3KA 1JPSL 1P84J 4XP9L 3EDDA 4M1CC 4OLUL 3VXSE 5GXBB 1A6TB 5KANG 1X7QA 3BP6A 4RIRB 5TGBB 1KCKA 1QSFA 3ZKMD 5BQ7A 4M1GH 3O4OC 5E08H 3HA0A 3BDXA 3GIVB 5BV7L 4KROC 2V5SA 3MGTA 1QSVA 1I9JH 3HZYA 1WQVT 1MHPH 5KJRH 5IUSA 3AREC 4P5TB 5GGSY 4TVPE 1KTDB 1XGTB 1EJ6A 1QZ1A 3TV3H 1R5WA 4WW2F 3NMEA 2D7MA 2MPAL 3GSNL 4ORZC 5F1OB 2AJYL 1A3LL 3MCLL 1EEYB 2F8VA 4AMKH 3C2AH 3H0TA 2R69H 4U1IA 1JZ4A 35C8L 5LXGL 1FV1A 2DM4A 1CF8L 2XWJA 1Z6JT 2ENYA 3O6FB 4JZJA 2NLJA 1MQKH 3NA9L 4OIAA 4XI5C 1HSBA 5GS1C 3SO3B 2VXTL 2E9BA 4L4VB 4MNHB 5E4EB 3FMGH 3AROA 5I9QC 4KAQH 3DBXB 4U49A 2Y7QA 1JZ6A 1JCKA 4ZUWB 1AXTL 4R90L 3QNZA 3V0VA 1HZHL 3LKRB 2YKLL 1KCUL 3QUYA 2VOTA 4E41E 4BFIB 1TDQA 3JWDH 1QSFD 3STZB 4OZ4B 4XP5L 4JM2D 5BRZA 1NGYB 3X13B 4KMTH 2EO9A 5INDB 3ARBC 4FQ2H 3TO4C 5MHSE 4RAVA 1MJUL 1QBAA 3GRWA 1QBBA 1MCHA 3GRWH 2VZVA 3KPSD 4QOKE 5DFWH 2K1MA 3RX5A 4HJ0D 2NY2B 3FQXA 2P49B 3ARBA 4RQQB 3TO4A 4BSWB 2C7UB 4YDIL 5B8CB 1BWMA 2X70A 4FQCH 2D0GA 3QDMD 1UA6L 1YEKL 3GM0A 2VSDA 1L7TH 5JOPE 5ABDE 3F6IA 5D6CA 1KXVC 4M1GL 2PNDA 3GUTA 4LLWB 1NBZB 1IGMH 4R0LC 1GIGL 2XQBL 5KSVB 3T2OA 3WIFB 5DJ8B 4MNQB 2ITDB 5EBWA 1UENA 3X17A 2WWMD 3DRQA 4JFHD 3NZ8A 3LN4B 3JXAA 4MNGB 3B8YA 3NTCL 3KPMB 1OGAB 5GS3A 1L0XA 5IKCA 3BN3B 4V1DE 4NKMA 2E8ZA 5IM7A 1NCCL 4GW1A 3QISA 4LSTL 1T4KA 2BNRD 3WIIL 2I24N 1QSZA 5IHUH 4MJIA 1BEYH 5L8JB 2I07B 3ULVC 5JO5B 1KEMH 1AHWA 2R1XB 4LP4A 3SKMB 1N64H 4W6XB 4XXDA 1IILE 4JFZL 1BIIA 3GBNH 1MI5A 3CVHL 3WIFA 1CXKA 1H3GA 4OLWH 3LQAH 1SY6A 3MRBA 1GGCH 1R3JA 3DVIA 5TDPB 2X4OB 1C16B 2BNQA 3IDXL 4CMHC 3OG4B 1JRHH 3H3BC 5BVJA 2DLGA 3MRFB 1P1ZB 2WIIB 3ZTJH 4ZUTA 4Q6IC 1CDYA 3HZYB 5DS8B 3P30L 4HLZG 1PLGH 3HNVH 3E6FB 4KJQC 5HYSB 3NFSL 1FZKA 2QEJA 3FFCA 4KY1L 1J1PH 4Q6IA 5TFSL 1RU9L 3SKNB 4HF5L 1HK6A 1UXSB 4XWOD 2ZUWA 1ONQB 4HV8A 4IIQB 1UWEL 1YYLH 5LKNA 1OWRM 3BE1L 5HGHA 2DMCA 3I50L 5B3NA 2PTVA 1ZK9A 1Q9OA 4QGYA 2MTPA 3VD4A 1MCIA 3RWCA 5KSVA 4ODVL 4H0IA 5HD8C 3S37H 3PWPA 3MLRH 2BNQE 4PRBB 4JJ5B 4K2UL 1M1SA 4IRJC 2DQHL 1X5AA 3GJEA 1FHGA 1HNFA 4NGHL 4R0LB 4RMUA 3ARWA 4R4FH 2PYEA 4KJQD 3KYKH 4NM8L 5CEXB 4PD4K 4LCWD 4ZO7A 1P69B 4HKBB 4NFDA 1KN4H 5EUKA 2DI9A 2HVJB 4KI5F 4Y2DB 5DMGD 3PHOA 4G8FA 2FX8H 4G80B 1ETZA 3PABA 2YPVL 1WUNT 4NPYB 4QHNA 4TUJB 2GQHA 3WFDH 2CPCA 3QUZB 3SOBL 1DVFA 3CSBA 4K3EL 4Z7VA 1S7QA 1CE1H 2YPLD 3BN9C 5A1AA 1L9MA 2IJ0C 2H45A 4QXWA 4JFED 4OKVA 1M7IA 3TA3B 4APQC 2FEDC 2OQJA 2R4RH 4PBWD 4X8XA 2OZ4A 4FQQA 3SGKC 5BS0A 1MCLA 3HI1B 4Y4KC 3FT3A 3SCMC 1JHLH 3PWNB 3EKCA 1IM3B 4GBXB 4LSPL 4APQA 3LMJH 4H25B 2NY3D 2Z31D 4JKLA 3HRPA 4RZCA 2BVQA 3VFVA 1UT9A 3DXAD 3CFCH 3VD9A 4FZ8L 2HFFA 3OGCA 2DM3A 4NSKA 4XP1L 5GIRB 5DUPH 2Z92A 5E1HB 3RWCB 1ACZA 1TENA 2BVEA 4HZLA 4OGAD 4ZDHA 3QJFA 1U58B 3BN9D 5DD1L 4NM4H 1U36A 1L7IH 1VGKA 1N59B 3VG0H 2IBZX 5DJ6A 5K59E 3PXJA 4B50A 4RMTA 3MACH 1FIGL 1AO7A 1F6AA 2IG2H 3FCTA 4DAGH 5C92A 5T3XH 3L3GA 1EX0A 4XBGA 4JRYE 2JIXB 2X9WA 4MAYB 4QHLB 3HE6B 3WIHA 2I5YL 5TF1H 1B0WA 1IM9A 1RMFH 4L3EA 2LAGB 5HYIA 5HD8D 5H35A 4LEXH 2HTKC 3ABZA 2DQEL 3SDYH 5I8OH 4XC3L 4JFEA 5JDSA 4S1SL 2AEQL 3BHBB 4NBXB 4WW1A 4X6CE 1O7SA 1T22B 1N5YH 5BW7C 5D4QA 3KPSB 2JJSC 1L7TL 4XNZB 3G5XB 2EDNA 3UO1L 2NY4D 1U8LA 5GGUA 1M6OB 4Z95L 3WFEH 3QAZB 4NQED 3DIFB 3MRPB 4DK6A 4LSSH 1DBBH 3CLFH 2VISB 4Z5RB 3O9WB 2NPLX 1MJUH 2EEAA 4LAQH 1D5MA 1VADB 3DUHA 1HQRB 4PFEA 4Y4HC 3RVWD 4Y7MA 3QWRD 4XCCH 4XHJD 3VI3F 5BMFL 5IHBA 4JGJA 4GRWB 4F7CB 4H26A 1KIQB 1LD9A 1A4KA 3HC3H 1F4HA 5DF0A 4MXQC 5ALCH 1MUJB 2A73B 5GSVA 4TVPL 1SEBA 1VENA 1SJHA 4K71C 3CH1A 1HH6B 2VDNL 4N1EA 4L3ED 4MZ3A 1FP5A 3GSOB 4G6KL 4PJGB 4KHTH 2QHRH 3DX6A 3LV3B 1AD0B 3LRSB 4JANA 5F1NB 4ZTOL 5IB2A 2IMMA 5E8PA 3QJFB 2V7HB 1JV5A 2H1PL 4KKLD 5I1JH 1NGQL 4DZ8A 3DO7A 1U91A 2AJSH 2KH2B 5DUBB 2DYPB 3MZTA 1BAFL 1ZANL 2C5DC 3MRMB 3VFSA 4YAQB 3MNZB 5LQBH 4OUUA 3FZUC 5I30H 1OF2A 4EI6A 5HYJE 3S96B 1I7ZB 1FVCA 2WUBH 1IGFL 1FFPB 5ID0A 1OAZH 3VXMD 2OM5A 1JNNH 5E8NA 4I0PB 3BH9A 5EFIB 1ITCA 3UROR 3O0RL 4XNUH 1ZHLA 2Q8AL 1NMAH 1UM6L 3RY4A 4QHKJ 3DYMA 3JVGA 1QSED 5J9PA 2VDQL 2XNAB 3C9NB 4YUEH 3EYVA 4JFFB 4BSVA 5IEKA 4XXDB 2BY1A 3IT8D 2J8UE 2XYCA 3CK0L 2MCPL 1FN4A 3EOTL 3RTQA 1CXHA 1RUKH 4PTUA 5D1QA 4DUWA 2FZ3B 4ZFZA 5BS0E 1RJCA 4OLXL 3KWWB 2X5PA 5KW9L 2NR6D 1I7TB 4L8BB 4U6XB 2F53B 3MBXL 2IANA 2RAMA 4NO2B 4OFPA 1V05A 1W0VA 5IMMB 2LTQC 2DLIA 1A7QL 4LLQA 5IIEB 4Z7QE 5CD5D 5HHNB 3EFFB 4JCLA 1QLFB 4WFED 5F9OL 3FB7A 4MS8D 4MXVE 5KANI 4PB0L 1FG9C 5AAMA 3KHQA 5A2FA 4GRLC 4PJ8C 1T7VA 3TBTA 1M7XA 4HUXA 3PWJB 3HG1E 5A2IH 4K2UH 3HE7C 3V6ZB 2FIKB 3N50A 3A6CH 1MQ8A 4TPRH 1ND0A 3TZVD 3GIVA 4PRIB 3MV7A 4U3XA 2ZCLH 3NN8A 5C8JB 3ZE1E 5ERWA 1NGQH 4GRLA 3QQ9D 3QZWG 4PPTA 3H42L 3ARVA 2FO4B 3DVNA 4LLMB 1YMMD 1CXFA 2NMSA 2NZIA 4L8DB 3G6JF 1AXSA 4G43A 4UTAH 1U8KA 1EFXB 5EC2A 5CEYA 1N0XL 3QA3B 4XP6L 4PYHA 2I60H 3ALPA 1J1OL 4EDXB 3F7PC 4QF1A 3BI9X 1KN2L 3VRIB 2VZ3A 2ZCHL 3WDJA 3CC5A 4Z76A 3IFLL 3K2UH 1SM3H 1KPRB 1J8HD 3MROB 1QACA 3PE9A 2EDFA 2VLME 3B9DA 4DJMA 1LE9A 1XF1A 3L5JA 1G7MA 5SWZE 4KGJA 1AD9A 5ACZB 3MCKB 5KS9F 1T89C 5LG1A 1MWAH 3WXWL 4D8PB 3MGOB 4CU7A 2GAZB 1KCVH 3KG5A 3RWJB 3BRGC 3PQYD 2MCG1 1CFQA 1KTRL 2FATH 1K6QL 3U7WH 4J3OC 1WIOA 4DZBB 4MB4A 4HMCA 1T89A 1KIPA 1G7HB 1NMBL 4ODHL 4YFDB 3UBXA 3WNMA 4PJCE 1G7PB 1MVUB 1QRNB 1S7UA 3WFCH 1FFNB 5FEBA 2ICEA 1A7NL 2NR6C 4PJGA 4P2OB 3LH2H 4KTYA 1MIMH 2HH0H 5IR1A 5JORA 4MWFB 43C9A 5IK3B 2AABL 2YD4A 3S35H 2DLHA 2DLEA 5E8DH 2IH1A 2XNAA 3MV8E 4M62H 4Z7OE 1JGUL 3CLFL 4LKCA 1J8KA 4O4YH 5MEQA 4OCXH 4JRWA 3WIHL 4M1DH 3MREB 2HVKB 5IB3B 3O3BB 1A2YA 4LLDB 3EOBA 4MQXD 4PJ8D 1VGKB 3ROLA 1FDLH 1FZJA 4YQXH 5IROA 2BOCB 3VI3E 3L3DA 2Y23A 4HEME 4X7CC 3NOIA 1VACB 2E6JA 4J12A 5E2TL 2E8YA 3TV3L 5A2LH 4ZFGL 2QKIA 2FEEL 4UNUA 5HPMB 3WUZA 1N7MH 4M5YH 3SE8L 2QHLA 1ES0B 2FX9H 5E00B 3MRCB 3GSOA 2Q8BH 4LNRB 5CJBA 3Q1SL 1MHPL 2HKFH 2A6KB 4NRYB 2HVKA 4DWHA 3CFKA 4BFEA 2CJUH 4M1CD 4DGVL 1SMOA 4FQIL 1KF9B 3LKNB 3IDNB 2IPTL 1SVZA 1YEFH 1BF8A 5FFLA 3U9UB 2NY1C 4ZD3H 4TSBL 5C0IB 2IH3B 4UNVA 4KK9D 5IG7B 1OGTA 4EN3B 5GISH 3JV4A 4KI5D 2W9EH 5C0AB 5HHVH 3X3FH 3O8XB 4PGJA 3PABB 3HC4H 2AV1B 1ZT1B 1FL3B 4F7TA 1R3JB 3MJ9H 1A9BB 2F74A 2A83A 5DJ0B 5DVLA 2MCPH 3CK0H 4JO2H 3MXWH 4LSTH 3VXQA 1OQOA 4Z77B 2PXYB 1KLUA 2V17H 2C1PA 3FB5A 4ZNCD 5EBLA 4ZO9A 3TBWA 4WCYL 1JGLH 1MJ7L 4QRUB 1ZA3B 4KKAC 4K7PH 4OCXL 1HXYA 2Q76B 5FM5O 3MMEA 4QHUB 1XEDA 1UB5A 5D2LE 2EIZA 2P43B 2FB4H 1HILB 1NBQA 2VLKE 3RGVA 3MUZ1 3L3OB 4HUKB 25C8L 1PKQB 3G04A 1QOKA 3MOBL 2GY7B 3PL6D 3MBED 4P5TD 1CGUA 1WISA 1QYGH 5ICZA 5D7JD 1ES0A 3T3ME 4FXGA 3CU1A 3NIDF 2IBBA 3NFSH 3LEVH 2ZSWB 4FNLL 1ZS8A 3G5ZA 3W9EB 1BEYL 2JCCF 4X9IA 1ZLUH 2EC8A 3D2UB 3QDGD 5F7UA 1JRHI 4EBQH 3DARA 1P7QD 5EOQL 3FOMA 4MCYA 1BQSA 2APXA 2VZ1A 4FQIH 1BLNA 5IMLB 5T1KD 4PJAB 1VSCA 1HHGB 4V2BA 1IL1B 4YR6B 5E5RB 1S78C 1HKFA 5DJXA 5HHMD 4WO4C 5IVNA 5DK3A 3GHBL 1VB9A 3G6AA 1B0RB 4HLJA 4Z7UA 3QG6B 1H3WM 3CVHH 4X4XB 2FCBA 3L3IB 1EFXD 1NLBH 2P5EB 4JFXA 3LAFA 3V0VB 2YR3A 3ZTNH 1MHEA 1QSFB 3D39E 1U3ZA 1XF4B 4MCZB 3D0VA 4WO4A 4I9WE 3RGVD 1CK0H 5FHAL 3TPUA 4L4TD 4XXCA 2G2RA 4OQTH 4ALAH 5KZCD 5KSUB 3KPRE 2QADD 2CDEA 2NY1B 2ZUXA 1CLYL 5IBTH 3FO0L 3OAZK 1INEH 4O58L 1F6AB 5F1IA 3FONA 1MFAH 3ZDYF 5JIKA 3WSQL 5DHVB 1T5WB 5CMAB 1A0QL 3KJ4C 1IGIH 3FMGL 1CLZH 5KVDL 2DDQH 3TCLB 2V9TA 1IGCL 2VSCA 2VL5A 4IMKA 2R0ZH 1JHLL 2MQ3A 3LQAC 1WWAX 4NZDA 5E8DL 3KLSA 1QFHA 3L5WB 3RVXC 1CU4L 3BP6B 4RIRA 5TGBA 1X44A 5IB5B 3MRIA 5EC1B 1MFDL 2NX5A 3ZYOA 4W81A 5GZND 3NCBB 1M05A 5IKCB 1PBYA 5LXGH 2P48B 4R96A 3GSQB 3WLBA 2E27L 3U0TA 3QP3A 5J1AB 3ILPA 4PRAA 3VXMB 4XHJC 3Q6FA 2ATKA 4Q0XH 2VQ1A 1IARB 3WJJA 1JZ7A 4PJDF 4P4RA 4WFHD 2VWEC 3B5GA 3HRZB 4ESKA 3FRPA 3MYZA 5E1AA 5C2BL 3I6GB 4OFYA 3RIAK 4CJ0A 4OSUL 3ULUF 4WUUE 6FABH 1LP9A 4PLOB 3DURB 5JXEA 5EU6E 1KJ3L 2FEEI 4HKZA 4QRQB 4HWBL 4JY5L 3QIWB 3RZCB 2VN4A 3MRHA 3BZFA 4L3CB 3RVXD 1CICB 3BIKB 2ADGA 3P4MA 4Q6YA 3K74B 3MV9A 2E6PA 2V5YA 12E8H 3JZ7A 1CR9L 1U8HB 1FVEA 5I2IA 1QFWL 4XH2A 4JVUA 2O26U 4XNMB 1CWVA 1I7TA 4OGYL 3BMVA 4UTBL 3LOWA 4JG0L 5CILH 3LMJL 1Q9KA 4P9MH 3INUL 1N8ZA 3MPCA 2FSEB 2ZJSH 3HI6H 1GZQB 1IT9H 4FQ1H 4JHAH 4XPFH 32C2B 3VFGL 4DGIH 2IPUG 3SY0A 4NT6B 3VFWA 3B2UD 1G9NC 1CGSH 1AI1L 1VDGA 1P4BL 1TLKA 3NABL 5GS2H 4NWUL 4U2ZA 1Y6MR 1T0NB 4JZOB 1QPXA 3FT2A 5JXED 2EO1A 1KIUA 1PSKL 3JWOL 3U46A 2CK2A 2XPGA 1NSNL 4ZXBC 5A40E 4PJEE 1KTKE 1D9KB 4NN6B 3ULUD 3SDDC 5F3BB 1A7RH 4R7NA 3QFJE 3BEVA 3VRLE 4LAQL 1WWBX 2AJSL 3IRZA 2DQFA 2MMXA 3GSWB 1HCVA 5CIPA 1EFQA 1C7TA 1UH2A 1CE6A 1UACH 3NCJH 4U1KB 1P6AB 4EN3A 5FV1L 3U9PL 4JPWL 1BD2D 3PIQB 4PJBE 5CBAB 1JNLL 1U93A 3VWKA 3ZKND 2MJWA 4WDIB 1PLGL 2FR4A 1T04B 3SKOB 4NQEA 1RUPL 4ZNEA 2XV6B 4JRXE 4NKOB 1U8HA 5FXCH 3MLYH 5HYEA 3RWJA 3OG6B 3V6OC 5BMFH 2FLRT 1WZKA 3DV6B 1QRND 2XXCB 3RPIB 3UEZA 1P7QB 2GJ6A 3GSXA 1QD0A 2EH7L 3SDDD 5ALCL 4PRHE 1RULH 3AS0A 2F5BL 3LSOA 3CUPB 1ORSB 3EYSL 1GC1C 4M93B 3V6OA 3BPOB 8CGTA 1W72A 5ENWB 1XGPA 1KTLB 5E1AB 2B5IC 1JUFB 2OI9B 4ZPVA 1DUZB 1LP9F 1J8HE 1I7RA 4RGND 2DWDB 4NYLB 2WBJA 2V7NB 3ZDXE 1IAIM 4FG6C 5CFHA 3EFDH 4X5XA 1NCAL 1YEEL 3HFMH 4R7DB 5GGSB 2W60B 2ZSVA 1WWWX 4H20L 4J7RA 3V6FB 4U6YB 3KLHC 3QJHA 3DTXA 3U6RA 3VFOA 3I6LE 4KRLB 4D3CL 1KTLA 1DVFB 4UU9A 5AWNL 4EQ3A 4YIQB 1FBIL 2Z8WC 4LDEB 5DEGA 4WFGD 3DHMA 1TJIH 2P42B 3OPZL 1CXEA 3RKPA 2PW2B 1HQ4A 2IPKA 4W68A 4ZODA 1H0DB 4MLSA 3CVIH 2GAZA 1A64A 4P5MA 5GPRA 1XGRA 4WFEE 3MRFA 2H2PD 3FFDA 3B3IB 4UBDC 2XKSA 3QEQB 1AO7E 1YUHB 1BGXH 1AGDB 2A0LC 2YA0A 3QHFL 1DN0B 2IC2A 1ZGLA 5F96H 3JBG7 3O8XD 3P77B 3QEGL 1GHFL 3BKJL 1OGTB 5I17B 4UMGA 3DROA 4JZJC 5DJAA 4LCWB 2FHFA 5DRZB 4YHNA 3L9RB 5GS1A 2FD6H 4MD4A 6FABL 1J1XL 4PRHD 1BJ8A 5C09B 4MAUH 3GK8L 3WMSA 2QKIB 1I1FA 1WBYB 3GB7A 3L3GB 3I3EA 5KSBF 1RZJC 1RUAH 1UXWA 1T03L 1JZ5A 1NC2A 1CFSA 4F9LA 4C59B 3QG7L 3LEYL 2D4FA 3CXDH 4GRLD 4JFYA 2VDMH 4LSRL 2DJUA 5DRWB 1DLHB 3T0XA 1JGVL 4AIOA 4F9PC 4XP6H 4QRRA 4PTTA 5EORL 1Q9WB 5EPMB 3CFBB 4HJGA 1P2CB 3H7BB 4POZC 4RMQA 4LGPB 4JR9L 4PBXA 4JFFD 3HLAB 2HFGH 4ZUUA 3QUZC 5EN2A 1DUYA 2CXGA 3TT1L 1EXUA 3W81A 4AH2A 3QRGH 3SEPA 3W5MA 5JDSB 3HI5L 5J3HC 3R06B 4WWKA 3UTSA 2JB5H 4H1LG 2ZKHL 2WV3A 3GBML 4OQTA 2IADA 3EHBC 2D0FA 2IFGA 1JWMA 1BVLA 1CR9H 5D6DC 4HUWB 2OCFD 3CIQA 3T0AA 2BVYA 4XVTL 3VFMB 3CVIL 4JB9H 4PUBH 7CGTA 4ZAKC 5HI5C 2IQAB 3BIKA 1YNLH 4OZGA 5DJYA 5EZJB 5D6DA 4K3JH 4JN1L 5KVFL 2BVPA 1I9IH 1DUYB 4TULH 1QA9A 1NAML 2OR7A 4M1DL 2X42A 1E4XI 4GRMB 4TYUA 3UTTA 1I1AD 1E27A 1ZHLB 4FP8H 5ITFB 1P6FA 4N0RA 4XI5D 4NOBA 2VR5A 4N0FB 1ZTXL 5FUCC 5I1CL 4YX2L 5LAXA 5LGHH 3DETD 4RGNE 2X4SB 3BDYH 5CINH 3IS0X 1JGUH 1YMMB 3DXAB 4HIIB 4ZPTA 3O11A 1LK2B 3QI9C 4EXKA 1DEDA 3GSQA 1E6JH 3MFFB 4QCIB 2EYRB 2CIIB 4JN2B 1S9WA 3BKYH 1ODAA 4XNUL 4Y2OA 2EDOA 3L3HA 1Q1JH 1UKTA 1PG7X 3CDGA 4NN5B 3VFOB 2VDML 4OB5H 5GGVH 3EYUL 1R5IA 3MXWL 1CQKA 3IF1A 2Y06L 2ADJB 5D72L 1UCBH 4L8CA 2IWGA 4WUUD 1SJEB 4P4KA 2JJTA 4P3DA 1NCBL 4K8RH 5L2JA 5IB4A 4PJHF 3ROOA 5CP7A 1HSBB 1QFOA 1DQQA 4KROB 3T77A 1DP0A 2WUCH 1XH3B 1NBVH 1TITA 1A6VH 5DUML 4X4ME 3DETC 2HMID 1A9EB 2BY2A 2B1AH 2KL6A 5CP3H 3BDBA 4U33A 5FYKU 3MLYL 4KZEL 2E3VA 2R2BB 5ESQB 1HHJA 1P84K 4F37F 1BX2B 5J6GA 5EG6C 4H88H 2AXGA 4U6HB 3X11A 5MP6L 4ZSOE 2BVPB 1RULL 3BOVA 3EFFA 4X9GA 4NKDA 4ONHB 5SWSA 1OTUD 4NWTL 1TETL 1UB6A 5D93C 2MOVA 3DRTB 1KNOB 1SM3L 5JORB 3ULUH 1RY7B 1N6VA 3IAQA 4NUGH 5BZWA 3AAZA 4DOHE 3LKOB 2WP3O 4Y16A 4ODTL 3W0WD 3HPLA 2P8MB 1LK2A 2PTTA 3G9VA 3TNMA 4GXVL 1FL5B 4FTVB 2DQTL 5D2NE 3DO3A 1RJZB 1A7OL 4TTDC 5C3TA 5B22A 3UTPE 4KTDH 1Q9WA 4KUCF 4PJAA 4HCRL 5EO9A 5E0QA 2GITA 1CGTA 3MJ9A 5DJZB 1RZFL 5GS0C 1HYRC 5E2UH 3K80A 4RSVA 2YA1A 2BERA 5EBGA 4DCQA 3U6RB 3E8UH 1RK1A 1NGPH 3IGAB 4YGAB 4PP1D 5JNYA 5HHME 3BUYB 1H5BC 2J4WL 1YY8B 1VFAB 3CLEH 1RUMH 1JHKH 4UDTB 3S88H 1HWHB 1CICC 3S5LG 5IOPA 1KYOJ 5EU6D 2GTWB 4G8GE 4EBQL 5ISZD 1CDHA 3U0PA 2ICWJ 3KYKL 1A3RL 4NM8H 4FFVD 5D1QB 3QCUL 2EIBA 4N9GB 2DBLL 4KUZL 3RFZC 4LVNB 4GMTL 4Q9RL 5DT1H 2X4UA 4HHAA 5CJOL 1V5JA 4ZYKB 4ONHA 4Y2DC 3GDBA 1FG2A 5T3ZD 1MCOL 4OJFH 4PR5A 4TUJA 2VLRE 3NIGE 5IVZA 3QWOA 1D5ZA 2EC9T 3IU4H 4RZCB 5E56A 2YN3A 4HWBA 4XT1C 2P8PA 5HHNA 3B8SA 2FH8A 4OLZL 4Y2DA 5C1MB 5HPOA 2A6DB 2VLKD 3ARDB 2Z8SA 1S7RA 4GKOA 3WNNA 5D1XC 4HS3B 5LGJA 2P8MA 3UZEA 4KRMB 3MV01 3JTSB 4PP2A 1CLZL 4QEGA 4DVBB 4ORGB 4GMSH 3TN0B 5C2BH 1BVLB 3SKOA 1ZWIB 4DW2L 4YDJB 4TN9A 4EXPX 4MHHG 4HUNB 3F12B 5C0CD 1T21A 5CD3A 1FPTL 1N7ML 3A0OA 2BCKA 5MI0C 4KJPC 2NW2B 2VQ1B 4NQSA 1GZQA 5J4MA 3QYCA 4D0CB 5KVDH 1MREH 4HMDA 4PJGF 5GGTL 2FX7H 4PJFE 3K4ZA 4G6FD 3S36X 3BISA 3EAKA 1MELA 4DGVH 3KYNA 1CZ8L 5EOCJ 2DL9A 5DWUL 5JW5B 1CL7H 3CCHA 4I9WD 4M9PA 1T0NA 3NCYP 1IT9L 4M43H 4JJ5A 3HE6C 5INDA 4XC3H 1T6VN 4JQIH 1ZLSL 1LO5B 2ZCKL 1GJIA 4ZOAA 2JF1A 1OSZB 2R23B 4ZYKA 2ZUQB 1JP5A 2AK4B 2G5BB 3SGDH 5CZXD 12E8L 5MHSD 2VQTA 3HHRB 3UZQA 1ROWA 4PJHA 4UINL 3FN3A 2FSEA 5LJYH 3W82A 3JVGC 1VERA 3LN5A 4O2EA 5GRVK 2ED7A 3RI5K 3MRQB 4KK5D 3MODL 5DVOA 3QPXH 1YMHA 1CFTB 2VDNH 2PXYC 3NGBC 3TVMA 4I18C 3QULB 4PS4L 5D1QC 5GJSL 5LAXB 2ZUYA 1H0DA 1B3JA 3MLXH 2AJVL 5GGTA 1A21A 3PWUA 5T5FH 4MNGA 2EXWC 2DI7A 3B9KA 4Y4KB 2B4CC 1KXQE 4MCYB 4LKXA 3BXNA 3SDXA 2XN9E 3FRUB 3WD5L 1FRGL 5HGDA 4U6HA 3TBYB 1I9EA 4HQQL 4Y4HD 1S5IL 1EA9C 3B9KC 2UWEA 2LE9A 2J6EH 3JV4B 4WY7H 3KNBA 3BW9A 3TIEA 5CUSL 35C8H 3UPCA 5KTEL 5L7XL 2LV4A 3TLRA 5JHDB 1UM6H 4NZRL 4U1MA 4NZJA 1U8QB 3IDIB 1BQLL 3P0VH 2EH7H 4N0UE 1OP3H 1Q72L 1AXTH 2DKUA 2X10A 1QKZH 3OHXA 3V5KB 1Q8MA 4PTUB 1T1WB 4V1DB 3QRFM 4OT1H 1ZSDA 4GQ9H 4LIQL 5IF0A 2AK4E 3JWOH 2L7JA 1TVHA 3PV6B 1PY4A 4R97B 1SYVB 3WUWG 3CNKA 4KV5E 4F7MB 1EIBA 2ZCKH 1WAAF 3P0YH 1NCTA 4DTGH 1WIPA 4ELMA 4GOSA 4G8GB 4LPUA 3B9KD 3V4UL 3EDFA 4P23D 3RZCD 1T5WA 5F7EH 2WWKO 3KXFB 4OQTL 2WZPD 1NGPL 4E42B 3CX2A 1VGEL 3ZDZE 4KUCD 4HGKC 4EN3D 3T0WA 3MRKA 5JA8B 5FYLL 5GJTH 3FQNA 1RJLA 2BHZA 5F8QC 2DQCL 4EDWH 1HE7A 2R0WL 5EO1B 2C4FU 4URTB 2LABA 1HSAB 5IMMA 4HCRA 4GMTH 4Q9RH 3OPZH 2KDGA 2PXYD 5F7WC 3HC0A 3ZE2E 2Z9TA 5DR5H 5AYUH 5D1QD 3C8DA 2M8XA 1QRNA 1S7UB 2X44D 4NDMB 4D9LL 4G7VL 3QUZD 1U8PB 1OSZA 1DFBL 2AW2A 1GRWA 2XT1B 3MRGA 3QDMA 3HR5B 4NPYA 2ESVE 2GFBA 2HG5A 1OAUL 4XCEB 4F57H 5L8KB 3KS0J 1FYTB 1RUQH 4CGTA 4I0PC 5ICXA 4YHLH 3RL1B 2APWA 2H6PB 3KYMB 4YPGB 3RZCA 4YXKH 15C8H 5ITBL 2JLLA 3IDXH 4LVEA 2VLRB 3D85D 4U6VL 2AXJA 2AI0H 1NEZA 1BP3B 5HGBB 3ZHDA 4HXAL 2OK0H 4M62L 4BQCA 3V6BR 3GK8H 3C08L 1IEHA 2V5MA 3OJVC 2YZ8A 1NANH 3VFSB 1XF3A 4L8CB 4JRXB 5EZJA 1K4CA 4LSUH 1J1PL 3W2DH 5C0CB 4YQXL 5I76A 3HZMB 1F58L 2CKBL 3GJFB 4QO1A 4MA7H 2UZIL 3N85L 2XI9A 1TJIL 3U4EB 4TSCH 4O51B 1Z9SA 5F71A 1X6NA 3FKUS 1CD8A 2GJZA 2IH1B 1DQJB 5J1SC 4BKLB 1JTOA 3GO1H 3L3JA 4XVSH 3OZ9L 4RAUB 4MJIE 4AEEA 4PJ8B 3QFJB 3QIUC 3MXVH 1Y6KR 4G5ZL 4XVJL 3VJ6B 2ITDA 1LD9B 4IRSB 4JREB 5EIQA 5C9KA 2AEIT 2F58L 2NLJB 1NCDH 4R90H 4FZEL 4OD1L 1U3HA 4NQVB 4WFGE 3O8XA 1CFQB 4RWYL 1VACA 2HJKB 2QQKH 2IFFL 1LQSR 3N06B 3CGTA 4FQHA 1YQVH 3DURA 4LRIA 1IEAB 4NP4L 4WFFD 3CFDB 2H26A 2A9NH 2LFGA 1N5AB 1W72L 4AYFA 3E0GA 3SE8H 4D9RE 1CDGA 5HYFA 1NAMH 1U92B 4PS4H 3VWKB 3VXNB 3CSYB 3SE9L 3M07A 4POUB 4NZUH 5T3XE 1DQTA 2VZUA 1E4WH 4OF5A 5DJ6B 3P4OA 3QIBB 3ZKMC 1KJMB 1HEZA 3BP7A 1UA6H 1YEKH 4U6YA 4GSDL 2HJLA 4JZNB 1GZPA 3RGVC 2AXGB 2GT9B 3TNNA 2WNGA 1RZ7H 2CLZA 4IIQC 4OM0H 2I5YH 2X1WL 2I27N 3BUTA 2IQ9H 3HI5H 3U36B 3TFKD 1N64L 3SDYL 3DWTA 4RA0C 2FB4L 5E94B 3IFNH 1E4XH 4GT7A 1D5XA 1MPAL 3ZO0A 3GBMH 3V9FA 2XFXA 1JUFA 1U3HD 4LCCC 4Y5VB 5DZLA 3NVQA 2A83B 1XGUB 4FTVE 1KEGH 3MRPA 4NN5C 1M7IB 4JG1H 4FQJH 3WN5A 4UB0H 5GRJH 2X4NB 4IMLB 4U1LB 3VFNB 1KGCE 2B4CL 4JFQB 4KVCL 4Q2ZA 4S2SA 4OI8A 1WAAE 1G9MH 1M7DB 3BO8B 5GS0D 1EHLL 1B0RA 2WK2A 4U3HA 4DGYH 1UJ3A 4YGVB 5C09E 4ZSOB 1F4WL 1RZKL 5ACLA 2YPVH 4X4YB 1T66C 1FH5H 1YEJL 2Q87A 2QSQA 3N1QC 4N0CD 5FGCB 4GRLB 5EZLB 2ZP0T 1NCUA 1HKLH 1LO2H 4UV4H 1NCNA 1NFDF 1QBML 3BKYL 5DD5H 1CLCA 4D3CH 3ZL4H 1HHJB 2CUHA 1AGCA 3GMNB 5KSAC 2BSTB 5IBUG 2BSRA 2GJ6B 1FGVH 3I9GH 4IRJA 3CC5B 3UC0H 1OF2B 4D9LH 5IIEA 4R3SA 1WFTA 1G6RH 2WMPA 5I30L 3WUWB 3CPLB 3V6FA 4HKXA 4DKFH 5JXAL 5F6HI 2BDNL 2HWZL 5DEZA 3OF6A 5FO9A 4QHKI 4F15C 4P4KD 4G42A 3WFDL 5JR1L 4WHTB 4RMWA 3D25A 2V7HA 3RWFB 1KLGB 1ZKAA 5I73C 2P5EE 4K9EC 3QUYB 4CVXB 2FWOB 3WHE1 1T2QL 5CBAA 1I8KB 5J8OA 2L7UA 5ERWB 4JQXC 5DC9B 4OCRH 1RPQA 1PG7H 3CSYA 1AKJD 3BKJH 3C09C 1LK3H 4OCMC 4Y0GA 2ICWA 2Q76A 3DUUB 1S7VA 2CUMA 5C08D 2R0KL 3GIZL 4LSVL 5KVMC 4WGVB 3WJJC 3RRQA 5BCAA 3SDCB 2I9LA 3FONB 1FVDA 3V2AR 3BZDA 5DQJA 1FORL 2D03L 1S78D 2FGWH 1P7QA 2JE8A 4QTIL 3PF2A 4LRNL 4JRYD 3ULVL 4QHMA 1SY6L 4MA3A 3HMXA 4HH9B 2I07A 1GGIH 2WWKT 2AJXL 3OQ3B 4HKZB 1HINL 4WW1B 3FB6A 4OZIF 3BPLB 2B1HH 1MNUL 4Y16D 1T1YB 1F02I 5I71B 4NRZB 5ICYB 4P2YA 2BY3A 1BWWA 2ICWB 1WAAA 1P4LB 4CU8A 2CIKA 2JJVA 4H1LB 4XPAH 5DQ9A 5D2LB 4OFVA 3BQUD 3OB0K 3S9DB 3BZEA 5TF1L 1U8NA 1DN0A 4PRAB 3VXMA 4ZUSA 5F6IB 3I3BA 4QOKA 1LO5A 1HI6B 4IDJL 3MOAL 3OKOB 2NTSP 2RJMA 1AY1H 2AV7B 5CEZD 3C60C 4U1SA 3ZYIA 3I2CH 5IMOB 2WLYA 3TN0C 3O4LB 1DE4B 4V1DD 1U3JA 1N3NA 3LIZH 1DVFD 1H9VA 3H9HB 5CBEB 1AR2A 2JJSA 1PJ9A 3C60A 4NZUL 3MLUH 4NHCH 2FX7L 3IKCB 4XAWL 2E6QA 3TJEH 4XC1H 5CD5C 2ADIB 5CCKH 4NC0B 4MS8C 3A6OA 3N1MC 3B9KB 2A1WL 5F88B 4I2XA 5C0AA 4KAQL 3NABH 4BK4A 1T7WA 4FABL 3LRGA 1EGJH 5GHWL 3RL2A 2VH5H 1TZIB 3KS0H 3SN6N 4XP9H 3KJ6L 1S7SB 4AEIL 3TF7C 1A3QA 4FRWA 1TCRB 4RDQF 3GMMB 3OAYK 3LEXA 5I1IL 1U6AH 3REVA 4R3SB 4XP5H 3DXAA 1ZHKB 1KN2H 3SCMD 3FB5B 1I75A 1KLUB 4RMSA 2HRPH 4TOYH 4PJ7A 4QOKD 3QNXB 4ZOBA 5E8EA 3P4MB 4UIKH 3CMOH 3E3QC 2FIKA 2DAVA 1DDHB 1CT8A 1YPZE 2YD7A 3JV6B 4UINH 4XNXL 2J8UF 5EWIL 2IGFL 3GSNA 4IOSD 1CZ8H 4KJYA 3GMNA 3IXAA 5DURB 3CJJA 4HWEH 5J6GB 5B39B 3P3YA 3GKWH 4HBCH 5GGRB 3FQUB 4LSQH 2QR0A 3UAJD 3C2AL 5E9DE 4BK5A 4HD9A 3IJHB 4RISH 2VJXA 1M71A 3O3DB 3VFRB 3TBSA 4KPHL 4PJ5B 4K3DL 2RR3A 1XH3A 3NH7L 1QFPA 4G8GA 3VXRE 4P2QA 1RI8A 3TBVB 4JO1H 3MA7A 1S3KH 1T83A 4K23H 5L2JB 1KULA 3MC0A 1P9MC 3QQNA 2HLAA 1WIUA 4WY7L 4LNRA 1IGFH 4Z0XA 2WBJC 2GSGA 2K7PA 4FQJL 4L9LA 5E6IC 5DTFA 1J8HB 1KOAA 1ZVSA 2E7LC 1EEUA 4X6DA 1T83C 1TETH 3FQUA 1R0AH 4UZGA 4NC2B 2AJZB 3IKKA 3GBNL 1RZKC 5ANMA 5HI4C 3BH9B 4YUEL 4DGYL 3PL6B 3DPBA 3FZUD 4X99B 3ARBB 4RQQA 4R26L 3O3EB 3TO4B 4DN3L 2VERN 4F8QA 2HA1A 1FV1B 1BVKB 1YA5A 2J4WH 3VXSD 5I73B 3OL2A 1CDBA 1OARL 2BRRH 4HT1H 1IGTB 2LU3A 5BVPL 3EYOA 3P30H 4JAMB 4PJXF 3K81A 5I8KH 4X0KB 3CVHA 2YRZA 5F7MC 4Y1AB 3TEUA 3S6CA 1JWUB 1KPUA 4X6EA 1B88A 2HKFL 2NXYB 5DK2B 4X6BA 5JOPD 4G6AD 4OCSL 3U7YH 3B43A 4OF0A 4PJ8A 1GGBH 4U31A 1MFEL 4X7TA 4MA8H 1OY3B 3DNKA 5ADOL 1CG9B 2IAMA 2WAHA 5IHUL 1YJDH 5DFTA 5TFSH 5HHOE 3EHBD 1NMBH 2AGJL 3GSUB 2XA8H 4JAMA 1KC5H 1R3LA 3UBXG 1KT2B 1QSFE 3VGAC 1GGIL 4E41D 5I75C 5KZCB 2D31A 2Q86A 4AJ0A 5AWNH 1RFDH 5E00A 2NYYC 4PRIA 4S1QL 3LHPL 3WFHA 1L4IA 5FK9A 4X7FC 2RHEA 3HN3A 5E95B 4ZS6C 5JLZB 3C60B 3GUTB 2ARWA 3W11D 2KQNA 2D0HA 3PDOB 4LDLB 3EO1A 1OGAD 1R3KA 3C5SB 1BHGA 4W4OC 2VXQH 1DEEB 2R0KH 4U7KA 1CBVH 2O5XH 5I6XB 1A4JB 3GRWL 1K6QH 2EYSA 4F9PA 4HIHA 4W4OA 2CK0L 1UJTA 4GG8A 4CN4A 2J8OA 5BS0B 2Z4QB 3F7RA 2DL2A 5DFVD 4PY7B 1DZBA 4P23A 5D7IA 1TJHL 2VIRA 3WFBH 1NGZB 4HXAH 5T1LB 2F54B 1HZHH 4MDJA 2OK0L 1XF5B 1X5GA 4O2CB 1TFHA 2ADGB 2P5EA 3OJDB 3U7WL 3EDKA 1KB5L 2DQGH 2MWCA 1O5DT 3KR3L 3V6ZA 4ODUA 5MEND 3EJZC 4ZOEA 4P23C 3MRCA 1GAFH 5GGRY 2R0LL 1P1ZA 4QWWD 4I3SH 1AGCB 3CFCL 4LLWA 1KBGL 1AC0A 4Y88A 3QSKB 3VXOA 4WI8A 6CGTA 1AGBA 3U48A 4L8SC 1LDPH 3RAJL 4P5MB 4ETQA 1BPVA 4P4RB 3TZVC 1LEIA 3MRDB 3KPRB 2O5ZH 5DWUH 4P2RA 5JZ7D 2W0LA 4G6JH 2OJZH 1H5BB 1FCCA 4RMVA 4JM4H 1KLGA 5CEZL 1KV3A 4EUPG 1YEHH 4ZFFA 4HX1A 4LCCB 4Y5VC 3SPVB 4V2CB 2Q8BL 3B6SB 3O6LL 4LGSB 3UPAA 5DUPL 1X9QA 15C8L 1DQLL 5IB2B 1LEGB 3LPGA 4P3CL 4IBLT 4MJ4A 2EDYA 4CW1A 1CFVH 5BQ7B 3LKRA 1REIA 1TVHB 5A2JH 2VXSL 4Z7NF 1U8IA 5M94B 3ARUA 1DANT 5T1MA 1JK8B 4FQLL 4Q58C 5L2KA 3QEQA 5FYKH 3IDGA 1HHGA 4TUOB 5GRYA 2ICWI 5IFJA 2BRQA 4PGDA 1I7ZA 5FYJE 5IFHH 4OZIA 4M4PA 3E6FA 4G5ZH 1I1AB 4XVJH 4JFYB 5I6XC 1WZ1L 1RVFL 4TNVF 3AFLA 1B6UA 4OFKA 2WIMA 3PL6C 4AL8L 4HPOL 3HMXH 5E94A 4X9BA 3HAEH 5JOEA 5ITFA 3EZ8A 1YN6B 3VFWB 4UT9H 1OM3L 1A14H 1I1FB 3FOLA 3QDHA 2UVFA 4P2RD 5KS9B 5D1ZC 1P4IH 4N1CA 4NQDD 4PGZA 5F7DB 5FA4A 5HHVL 4WRLA 4X7TB 4NGHH 4K7PL 1MY7A 2IH3A 2PKDA 1QEWB 4FMKA 4Z7WF 4FQQB 2CO6B 3O3AB 4NHUA 5B21A 4D0DB 3FFCE 4M6OL 4BQBA 3RAJH 4LBEB 5DI8B 5KN5B 2DICA 2Y9RT 3A6BH 4J1UB 2P44B 3ZKXC 1J05B 3C5ZC 2P24A 1QSEE 1MHCB 2ADFL 2YRPA 4PJXA 2X4SA 1OCWL 1ZANH 1A6UH 1M71B 1H3VA 2P5WA 4ZFOB 3ZSTA 3ULVE 4LIQH 4G6KH 4XAKE 4KJWD 4P46A 4PJCB 4PJ7F 4DKEL 2PF6A 4HWBH 4MX7B 1NC4A 1JGEA 5JW4Q 4OB5L 4R4FL 5AZ2L 4LCUB 4P46C 2EECA 4GFTB 1E28A 1WITA 1ZVSB 3GSRB 5IW1A 3Q6FB 2VL4A 4I48A 2EIDA 1UWGL 4LLDA 5IFJB 1A6AB 2HT4D 1P7HL 3T1FA 3RVUD 3D9AH 1I7UB 3PNWA 1ZHKA 5JUEH 1TJGL 1I85C 4LASL 3UJTL 4P49A 5KG9B 3QFDB 5C07D 4A6YH 1FAIH 1H5BA 2GTZB 1Q38A 3FQRB 1G1CA 3QBTB 1UZ6F 1R3HB 1UZ8A 1V3LA 2YXFA 5DD1H 5MEOA 2B20A 3K2MC 3EJYD 3MV9D 2R1WB 5IMKB 5KS9E 1OAQL 4M8QB 4S11A 1F3JB 1JYWA 1B90A 1YPZB 4PJIA 1P5VA 4GXVH 4C4KO 4YHYC 1DFBH 5GRXG 3BAEH 5IQ9B 2SEBA 5D1ZB 4NN7C 4XPTL 3LPWA 1LEIB 2ZWLT 1HHKB 4BA8A 3BXNB 5DRNA 2BFVH 1UFUA 5L6YH 1U8MB 3VFUB 3EOYG 1QRKA 2BK8A 3VA6A 5DMKA 2ITCB 4XBEL 3B5HA 5FUOH 3KXFA 4KKAD 3UTZA 1I4FA 5K33A 2V9QA 4P23B 5D7IB 5IBTL 4ZFOA 2R29L 3VI4F 2F5BH 4OKDA 4KVNH 3F5WA 3U9PH 4UT6H 5I18H 1J0JA 2VYRE 1X6LA 4GKZB 3STBA 1RSFA 1Z3GH 1BBJB 2CIKB 4XPHL 3QEHB 1HWGB 3OKEA 3QDJE 2F53E 3EO0A 3TYGL 3CFBA 4FZEH 4OM1L 3JWDC 2XZCH 1F00I 4RNRA 5DMKB 2B1HL 2OZ4L 5LBSH 3C5ZB 3N85H 4XNMA 1P5UA 3KAAA 1FFPA 1IGTA 1PQZA 1A4JA 2UY7A 4XPGH 2F8XC 3L3KA 5E08L 2V5RA 3N0PB 4OI7A 3UJIL 4BZYA 3MUJA 1DBJH 4PLJC 1IFHH 1MF2L 4UNTA 4OIBA 4PGCA 5D93B 5FCUL 1EO7A 3LQZB 2OX5A 4Y5XB 4HS8L 1RZGB 3KXFD 4NT6A 2VRAA 2CLRA 3JV0A 1CGSL 4FQXC 4P46B 4CW1B 4BQ6A 2W0FA 2AJXH 4LPCA 2GTWA 1KIR