4M43H

Crystal structure of anti-rabies glycoprotein fab 523-11
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
EVQLQQFGAELVKPGASVKISCKASGYTFTDYNMDWVKQSHGKSLQWIGDISPYYGSTGYSQKFKGKATLTVDRSSSTAYMELRSLTSEDTAVYYCARRNYDGSWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragment antigen-binding 523-11 light chain
publication title Crystal structure of anti-rabies glycoprotein Fab 523-11
rcsb
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m43H02
4NC1E 3T77A 4NNYB 3LQZB 3ZDZE 2AXFA 1KLFA 2VE6B 1SYVA 4YXKH 4PS4L 4LU5L 2XWBA 5CKAA 2FBJH 5AAMA 5JW5B 1S78D 2EE6A 2FX8L 4MVBD 1KCLA 1RHHA 5DK0A 2AQ2A 1WF5A 3MC0A 1XF2A 4LKXA 1J88A 3RZCB 4GQ9L 4L1DA 3UAJD 2NR6C 4ERSH 4F9PC 2JJVA 1KC5L 4POYA 1AGFA 3FTGA 5DJXA 1E27B 4YWGH 4LBEB 1U8OA 2XT1B 3VA6A 4JY6A 1JYNA 2ITCA 3E3QC 4HPOH 2P42B 5EUKB 3WE6B 3LMJH 3CXDH 1OARL 1RULH 3MMEB 1HCVA 1MHHB 1ONQA 2DQCL 2B5IB 2YKLH 1EIBA 2HG5B 3ALWA 4Y5YC 3SKUD 1IGIH 2VL4A 2EC8A 2CKBH 4WW1A 3CSYB 3TIDA 3ARQA 1YEJL 3QJFA 4M5YH 2HT3D 4P4KD 1IVLA 2FATH 2V2WB 2Z92A 2ADFH 1QKZL 1JGLL 1UXWA 1X5HA 2ZJSH 4OLYL 4M5ZH 2ATPB 1FNLA 3BE1L 4MJ2A 2DICA 3MGOB 4ODVL 2FB4H 2XRAH 5IVXA 4KKAC 2B1HH 3BX7C 3D9AH 4ISVB 1DE4B 4EI6A 2B8OT 2J6EL 4MD4B 3BVNB 2H1PL 3KPPB 1UCBH 4I2XB 1JRHI 1I7RA 3SQBA 3QUKB 4OZHA 1IQDB 3IFNL 3PGFH 1JNNH 1S8DA 1U0QA 2F53D 4XHQA 1FO0H 5AUMA 5CIPB 3F7YB 3BRDA 5JZ7D 1MIML 5BZDB 3PWPB 2AEWA 2VLRE 4RNRB 3QI9A 2WIMA 2WBJA 4PV8B 3O3DB 2YPLB 4KHXH 3GUTA 5GGVY 3RKDD 4AENB 4DZBA 1OD9A 3BZEB 2DLEA 3RDTC 4PRDB 4HUNB 3DO7A 5F3HA 4GMTL 1VFAA 5TF1L 2FCBA 3P73A 4DN3L 3WO4C 3VXRB 4U1KB 1MQ8A 2A6JB 1M7DB 3U4BL 1D6EB 4PTUA 3VFVA 3CH8A 1AXTH 4R4NC 2JIXA 1G6RA 3VXOB 3VGAC 1NKRA 2W0KA 4PLKD 3KPNA 4M1CC 4UT6L 1IT9L 1Q0XL 2QADB 2DKSA 1FYHB 3SDAC 3DNKA 5EUOA 1MLCA 1MCSA 3G5ZB 4NN7C 2YD3A 3W11D 4X7EC 3BJ91 3H3PH 5FUZH 5E1HB 2YZ1A 4AY0A 5BO1H 5D1XC 4I0PC 1M7IB 4OGXH 4RDQG 4QXGH 3KPSA 1T04A 3HI1B 5DWUH 5F7KC 4Y5XB 5T3ZD 5FF6A 4K3JL 2GAZA 5BVJB 2DS4A 1JV5B 3BPCB 3H9SE 3O4OC 3S3PA 5DQ9A 1HHKA 2J8UA 3U6RA 1QBMH 3OR7A 3LEVL 4P0DA 4U1IA 1QP1A 5CS7A 4U1HA 3I84A 1P1ZA 1DQDH 4FQCL 2OSLA 1ZEAH 4I18A 2R69L 5C0JA 1U3ZA 5AYUL 2XWJA 4UDTB 3H42L 5C6WH 2BDNH 4UTBH 4JHBA 2CIIB 4JZJC 1B88A 2R0KH 4HGWB 3G6JB 3WJJC 4FMKA 5CEZL 3T3PF 7FABH 1FSKC 3QIUD 1DN0A 3JTTB 3QYCA 5TE6H 2CGRL 3O9WC 4KH2A 5DDHB 3STBA 4LLUA 5GPRA 3CPLA 3O3EA 5BV7H 4HV8B 4GKNA 1QZ1A 1MCWW 2J6EA 1AR2A 4G8FB 2NY3D 4J8RA 5DTFA 3ZTNH 1FG2B 1NFDE 4AEFA 3FQTA 5IB1B 3TJHC 2BXYA 1ZT4B 1DUYB 4NFDA 1RIHH 4PJDA 5SWSE 3BEWA 4UT9L 4GSDH 4KKLD 1CICD 3P77B 3R8QA 1T1YA 3CC5A 1FFRA 4HIEB 2DB8A 3F12A 1WT5C 3VFSA 3RNKB 1IGYA 1ZHLA 2Y5EA 3BKCL 4G9FE 1CE6A 4HBCL 2P7TB 5DZOA 4GG6A 5D1ZA 1C7SA 3KYOA 3QO0A 5IESL 1MRDL 2X4QA 1HQ4A 1FNSH 2NY0D 5IJVB 3K8LA 1R3IH 5IKCA 4HF5H 3C8DA 1R5IA 3TPKA 3UJJH 2VSCA 4POZC 3ULVL 4ONGL 5DUMH 4U6XA 4I0KA 3QQNA 4ODXA 1EJOH 4YHML 1IC5H 3PV6B 1JMZA 4GW1B 4BUHA 2CJUH 1KGCD 3MLTA 1I8LA 3MJ7B 3CX5K 5KSBB 4MD0B 3RWCB 4L3CB 1X5JA 1TCRA 3LEYL 3QPQC 2JB6A 3EJYD 5HY9B 5FYJU 1S5IL 3S98A 5GIRB 1FZOA 3RVUD 1IAOB 1KG0B 5FO9A 5KSAD 1CFSB 3QPXL 3NN8A 4PJFE 4MYWB 4KRPD 5L9DL 2VLLA 3GIVB 5GRZA 1KF9B 1GHFL 1TTFA 1AXSA 1JPSH 4OCYL 4NO3A 2A74A 1OCWL 1I9IL 5FIEA 5HD8D 4K3GA 1J11A 2D4DA 5IBTH 4X6FA 2C3WA 2Z4QA 4KY1L 2WQ8A 4TRPH 2VDPL 1FGNL 5T33L 5BW7A 3T8XA 4C55A 3SOBH 4R2GC 1AKJB 2VXSL 5IWLC 4MWFA 2ARWA 3KLAB 1I85A 5DD3H 1VENA 5IQ9B 2B0SH 4LVEA 4RFNC 4LAQL 4Q9QH 2YRLA 2XZCH 2EKSB 3HI6L 3G5VB 1NEUA 2Z35B 5ICYB 4FXGB 1NANI 2OTPA 1PGRB 3VG9B 3MOAH 3E6FA 1FPTH 1VSCA 4Z7UA 2BJML 1CGWA 1MJ8H 1YEEH 5HHME 4TUOB 1Q1JL 2EDXA 1WBYA 4OLWH 1INQA 4G6JL 2A73A 2XA8L 3GJEB 2EECA 3MRIB 4TSBL 4LCIL 1HHJB 5C0CE 4U6TA 3MFFA 3IJYB 4GFTB 1CG9B 1SEBA 4NHCL 2BFVL 1YN7A 4JLRB 2JCCB 4NPYA 2C4FU 1BOYA 2QR0A 2PN5A 4M7LL 4QHNB 2EO9A 2NY1D 2DLGA 5EU6D 4TOYH 5IG7B 3T2QA 4FFYL 4FQ2H 3D39D 3ZYZA 1MUJA 2YD9A 3L9RA 1F90L 1JK8A 3KR3L 2OTWA 3NCBB 1MRFH 4WIQA 3CDCA 1LDSA 5C0RH 2XN9E 2V7NA 1VADB 1E4XL 4HZLB 5C0NC 3LS4L 5SX4H 3KS0J 4P59H 3EYVB 4ONFH 1P5UA 4OM1H 5H2BA 3EOAB 2MJWA 2DQFA 2UYLA 4E41A 4CADB 3T0ED 2Z91A 4N0UE 3ZSSA 5BV7C 1TJIL 3P4OA 4ZAKD 4OCLC 2J7LA 5SWZE 5D7IA 5F6IC 3B2VL 3D25A 4JFED 3W9EB 3DMMB 4FOMA 3HE7C 5GRUH 1YEGL 6FABH 3JVGA 3CVIH 3C5ZA 3EJZC 1FE8L 4PRID 5HVHB 1JTPA 1MIEL 5ILTH 4BH8B 5E9DE 3MPCA 1E4WH 1EA9C 1ZT1A 3X11A 3S37H 4NZRH 4Z0XA 3JV4A 3WFCL 4ZPVB 1IQWH 5TE7H 4IHOA 1RK0B 2IPUK 2VNCA 4JFDB 4KHTH 3S36X 4NQCB 4PY8I 5IEKA 3RI5K 3JV0A 4YPGA 4S10A 1OGAB 4YNYB 4KI5D 5DJYB 3MOBL 2QSVA 2IAMB 4QLRA 1EHAA 3NACH 3QHFL 3HG1B 3DX7B 4K3EL 3FT2B 4FQPA 4LARH 4PPTA 4PJIB 1LEIB 2DQUL 4MHHG 4PJ7B 4RZCA 4EDXB 5F6HJ 3O6ML 5GZOC 4P2RE 1L7IH 4L9LB 2WWMD 4LKCB 5EPMB 3QCVL 4KXZI 2ATKA 4Y1AA 3TYFA 4JPIB 3NCCB 2C7UB 5F71A 4NUGH 1IBGH 4PJFF 1T1WB 1A2YA 3TT1H 3KPQB 4XVJH 1DSFH 4P5TD 4S1QH 3GMOA 5GGRB 3X3GL 4PJEF 3CXHJ 4PTTA 2P5ED 5FUOH 4FHBD 5E8EA 3OAUH 1OPGH 3OKDB 4RGMB 1Q9LB 1QLEL 2RHEA 4BQ8A 3QCUL 5CD5C 2XZQH 4IMKC 4NC1C 4W6YB 4UV7H 1R24B 2AABL 4Q6IC 4WUUA 4FZ8H 3OSKA 4Z7OF 4WI9A 5DQDH 3TNMA 3DGGB 4PG9B 3KPMA 1AC0A 3K4ZA 4KC3B 3RY5A 2OJZH 2A77H 4X80L 2IALB 4JFFA 3TFKC 3PWNB 5DRWA 3GJFA 5FKPA 4OSUL 2X9YA 4UQ2A 2DDQL 3CH1B 3FHAA 4QRUB 1AC6A 5DD5L 4LAJH 3SO5A 3F65A 3LB6C 1EAJA 3BYTA 2DL9A 1HH6A 1MHPH 35C8L 4MAYA 4I77L 3S4SA 4CMMA 5HDOA 5D7LE 4WI5A 2BY3A 1RZ7L 3NABH 2F54A 4I4WB 3ZE0E 4TVPE 1JHKL 4HUKB 1KJ3H 4PJBA 3JV6B 4YUEL 4GUPB 3MXWH 5KBNC 1DQLL 3DVNA 3IDNB 1DEDA 2EE9A 2ARJQ 5LBSH 1AQKL 4HS3A 2ADJA 4ODHH 1Y18B 4P3CL 3TNNB 1IARB 1S5HA 2XXCB 5GGQH 2X89A 4PJCA 3UTTB 4WI3A 1MJUL 1IM3A 2QSCL 1OSZB 1OTSC 4NKMA 1P4IH 3RBSA 2J1KA 1F45A 4JHAL 1N6QH 2P5WA 5JUEH 4G8GA 5JHDD 1FAIH 2D7QA 3PGDA 4JFPB 1WWAX 4Z7WB 4XPFH 3OKEA 1U9KA 4HT1L 3O6FA 4WHDA 2HRLA 2YUWA 4YHIB 3QDMD 5E6IA 1DVFB 3RWDA 4MX7B 4WY7H 3SCMD 3ESVF 2GJ6B 5HGDB 4DW2H 3MLUL 4O02H 3IDGB 1FC2D 1U3HD 2X4RB 5EC2B 4P57A 1S9VA 4ZTPL 4I3SH 3MRFB 5FM8A 2X4TA 4FQJH 5HYSG 4I0CC 5F96H 4TULH 1FYTD 1KIRA 3ARFC 2IH3A 4TVSa 3MV9E 3D0VA 1JP5A 1PAMA 2FSEB 3EOBA 1CD8A 4CVWA 4NN6B 3QIWC 4N0YH 5I1EL 3BXNB 2PXYB 3BFOA 2IGFL 4XP5H 1BD2B 1JVKA 2A9NL 4G8EB 5IV2B 4UTAL 4HWZA 2VISB 2H45A 5FM5M 1BVKB 2X10A 3FO0H 5DRNA 3CFEB 5I1GL 3CDYA 5JOFA 2V9QA 2AJZA 1YPZA 1YY9D 5MERB 3OKKA 4DUWA 3CLFL 5ALBL 3GRWL 1PKQA 2HFGL 1KCVH 3VFWB 4U2YA 4QHLA 3HNTL 3QO1B 2JKXA 4PJ8C 4XNXL 4LSTL 4MZ2A 4OZGF 4AG4H 1LP9E 2Y4SA 3UYRL 4JO1L 4ZO6A 1BBJA 3OF6A 1UZ8A 4KJPD 1MFEH 3S5LB 5E8OA 2R1XB 3BUYA 1KUMA 2VDRH 2G2RA 3N0PB 5DMKB 4LP4A 4IRSD 2ITDA 3C9NB 2DI8A 1MCJA 1NAKL 3UCRA 1QLRB 2WIIA 5F44A 1IAIH 3WDIA 4KK8D 1MREL 4V2CB 2AJ3B 5IB5A 3VFNA 5H94B 2Q86A 2J88L 3ORJA 3GSQB 2NY2B 2ADGA 2YS4A 4G6KL 1VERA 4OCMC 3HZVB 4PRHE 4UUJA 4B53A 4CDHA 3KHQA 2G75A 3MV8A 5E8DL 4XCYA 4O2EB 5F7FA 3PHQA 1A1MB 1RD6A 2EDKA 3NA4A 4WTWA 2JJSC 4OAWA 1XGTA 5D5MF 1JTOA 32C2A 5AD0B 1WCQA 3KPTA 1KXTB 3JWDL 2RGSA 5DJAA 1RIVH 4OLUH 4BFGA 4WO4B 5EN2A 1QO3B 3RIAK 2PW1A 3S96B 3E2HC 1Y0LB 5I9QB 2BVQB 1AO7D 4K23L 1KIPA 3VXUB 1FNGB 4WTZA 2X09A 1TVBB 5FO8A 2AP2A 1UWXK 4HJ0C 4RFEB 5C09E 5H35A 4WU7A 2UWEF 1X6LA 2HFEB 3IKKA 4LF3A 4A6YL 1BLNB 5DVLA 3MRBB 3NA9H 4GRWE 1G9ML 1S7SB 3GHEH 3OHXA 4WNQA 4HBQA 4XNYL 2DM7A 3WBDA 4GS7B 2O5XL 3EYFB 3LDBC 4HWUA 2OX5A 4WI6A 3W0WA 4HKJB 4D94A 1EPFA 1R5WB 2FH6A 1K8DB 4P5MA 1WFTA 3BKJL 3P0YH 5IB2A 4UIMA 4JDTH 4XBEL 3GRWA 1DUZB 1KTDB 4APQD 4LPVA 3SDXA 1QACA 3LRGA 3A6BL 2FEDD 3ILQC 3TIEB 4J6RL 1NEZB 1SY6H 3GM8A 4YFLF 1ORQB 4R0LB 4CNIB 4ZPTB 4C57C 3IXTA 2WK2A 3MLYL 3G5YA 1G7LB 3GSRA 4X6DA 5B8CB 1BJMA 2AV1A 1DJSA 3BJLA 5KZCB 1CDHA 1K3ZA 3QH3A 3MBEC 5CD3A 5F7DB 4BK5A 4O00A 2RIKA 2GT9B 3BKMH 3QDJA 5HGGS 3TO4B 5CILL 4L3AA 2C4FT 3FQNB 1S7XA 5EOQH 1ZGLB 4MXVF 3VFGL 4OZIF 4Y89A 1DL7H 1G1YA 2ICWI 2GQHA 3CFJA 1RU9L 1CVSC 5IEHB 5M95B 5EO1B 2V7HB 1CLZH 1GC1H 2VDQH 1LHZA 1S9WB 1YMMA 5IBLC 4Z5RA 3MUJA 2R0LH 3QNZB 2ARJA 5C7XL 1NCCL 1L6ZA 1FL5A 4GRMA 1OHQA 2W92A 2CLVB 1YQVL 4L3EE 1NGXB 5MHSE 5HBBA 2IADA 2HLFD 1IAMA 1WIOA 2AJUL 1MEXH 1ZKAA 4TSCH 4R8WH 2AXGB 1WAAA 2KBGA 4ZXBD 1T4KA 5IVXE 1LP9F 3KLHC 3F7VB 3MRDB 3FQRB 1FVCA 4Z18A 4GJTB 3SDDD 2Y6SC 4ETQB 5CEXB 2QL1A 1MF2H 4MNGE 2IBZX 3QRGH 5EZJB 1T6VN 1C16A 1NGYB 1RSFA 1OSPH 1G9EA 3PGCA 3I6GB 4OUOA 2FWOA 2R29L 4PB9H 2OBGA 4EN3D 1KJMB 2ZUWA 4IS6B 4A6YA 1S7QB 1U42A 5D7LB 3FN9A 3HFML 3MREB 4L8SA 3D0LA 4M62L 3TPUA 1PLGL 1FVDA 1KPVB 3V4UL 5IGXH 3TCLB 5KS9F 5JOPD 2B4CH 1TZIA 3PL6B 4QTIH 4HC1H 1ZHBA 3BP7B 5FA4B 4Z77A 4G42B 4F9LA 1LMKA 4JZNA 4XI5C 4QRPE 5DHXB 4DN4L 3BAEH 1JHTA 4KRLB 4P2QB 1BZ9B 5GJTH 1TENA 5J6GB 3O4LA 4YHPA 5HI3D 1V05A 2NXZD 4WFGE 4AT6A 4TNVF 1JWMA 4X5XA 2BVOA 2IQAB 3RU8L 2P48B 1JF1A 4JG1L 5BJTA 3ZKSD 1TZGL 1I1YB 4OD3L 3M8OL 3TWCL 1S7VB 4L4JA 5C0EB 1CU4L 4UIKH 2XPGB 4P46C 3DRTB 5E94A 1T7VA 4OKVA 1S7UA 1QPXA 2F53A 3L95B 3M1BB 4JAMA 3IS1X 4PRPD 4R4FL 1LE5B 4LQFH 1X5XA 5B4MC 3ZYIA 4XB7A 3UP1A 5SX4I 1R3LA 1ZANH 1ZS8A 3ARBD 3TZVC 3QXDB 1QG3A 2GJJA 4JREB 2PR4H 2CK0H 3LOWA 3LH2H 3FT4B 3OR6B 4IMLB 4XCCH 1U8MB 3X12A 3FZUC 4OIIL 3ZDYE 2KL6A 3QBTB 1VEPA 2V9RA 5F70A 3TBSB 5I16B 1BX2A 1ZLVK 5E03A 4NZJA 3VGDA 3LAFA 1MFAL 3UJIH 3DX6A 3QA3B 1NJ9B 1J86A 2WM0A 3TYGL 1ITBB 2OR9L 4FQXC 4WFEE 3FRUB 2R0ZH 2DRUA 4FG6D 4H1LB 5SV4A 3GKWL 4JQXC 5GRYA 3C6LD 1X3DA 5I2IB 4LCWB 1BJ8A 1CD1A 3FT3B 4U6VH 3GMRB 4S1DC 2G5BB 4WW2B 5TJWK 3V4VL 5D2LE 4EUPA 2ICEA 3UTQB 5DMYA 3MLWH 4QHKI 3D69B 4MAUL 3VJ6A 3GHBH 5HGHA 2VZUA 4PJDE 4NHUA 3RZCD 4GBXC 2BNRE 1F13A 2EDRA 4NC2B 1O5DT 2XNAA 2FBOJ 5JA9A 2EEDA 4LHJB 5EFIA 2HN7B 3HPLA 2NX5A 2BY0A 3WSQL 4GG6E 5LWYH 4WEBH 4V2BA 1H3PL 3CVHH 5EOCH 4ZFFA 4Y4HD 3TEUA 5TH2B 1MY5A 3KJ6L 4JKKA 3QIUA 3O6KL 1I1AA 2EH7H 4FTVB 3IU3A 1SJEB 5FYJH 1N5AB 3DVGB 1MCPH 2E7LC 1QFPA 3S8WA 3LD8B 4NQTA 1PYWA 1UYWL 4HK0B 4EOWL 3QZWA 5LVEA 5K9OA 5IHUL 3MLPA 2BNQB 4LPCA 4L8CB 4D0BB 1XGRB 4ODTL 4Y16C 3MUY1 5DJ0A 3H9HB 5D2NC 3N1FC 2CUMA 1T1XA 4TPRL 5D7JB 4MJ5A 5L7XH 2XQBH 4JRYB 1B4RA 2E9IA 3UTPE 1PZUB 3OJ2C 1ND0A 2V5MA 4UINL 5CGYD 1X6NA 2WMPA 3O45A 4JVPA 5C2BL 4C83A 1F8TH 1TVHA 1JNLL 4GRWH 2E6PA 3HHRB 1XCTB 4OCWH 4EI5B 4L4TD 2PYEE 2B4CC 3IDJA 4S2SB 2NY5H 2VAAA 2P43B 2HFFB 4Y88A 2R0WL 3QUXD 2IG2L 1KPRA 4ZOCA 4BFIA 1X5KA 4NT6B 3DRQA 1OP9A 3GSNB 5T5FH 1HSBA 2CRYA 3HUJF 5CEZE 1F6LL 3SKNA 4YO0B 1UEYA 4QEGA 3V7AG 1L7TH 4ZNEE 2AJSH 3ZLQC 3BI9X 3GNML 1EFXB 2GSGA 3I6LE 3QPQD 3NMEA 2NW2B 4BSWB 5DRXB 4D9QD 2HKHH 1WCBA 3RHWK 1FFNB 5INCB 1ES0A 1LK2B 4Z7UE 1T03L 2R1WB 1N0LA 5C1MB 3T77B 3A6CH 2DJ4A 1IGCH 2HJKA 2AXFB 4MNQA 1SYVB 1LDPH 2XWBB 3QEQA 5GRJL 4LLDA 2FHBA 3T0XA 1T66C 3FQUA 5DUPL 2K7QA 3V9FA 1BWWA 1JIBA 4IDJH 1XF2B 2Y36L 4PJHA 2CXKA 3PUCA 3C08H 3ZDYF 4YBLB 1K8IA 3FTGB 4M6AA 3VMNA 5DJXB 4LSUL 2DQEH 1U8OB 5FKAA 3ULVE 4OGAC 5TGBA 2O5ZL 4JY6B 3QDGB 2ITCB 1LWRA 5BS0E 1OF2A 4GKSA 4LHUG 1KT2A 1ONQB 3SY0B 3MV7D 1EHLL 1FGVH 3I75B 3TA3A 4C56D 2FIRT 1IL1A 4WW1B 5CJBA 3GSVA 2C26A 5C6TH 3FO9A 3TIDB 4G6ML 1L9NA 3QJFB 4G8IA 5CBAA 1EDQA 5GRXG 4D0DA 2Z92B 2VQ1A 1CGSH 3QXVA 4ELME 2JB5H 5GGUA 1UXWB 5EOTA 5C0IA 3G6JF 2Y5TB 4WWKC 4YHOH 4PJAA 1U8JA 1ZK9A 2D2OA 3PP3K 1AIFA 2VDOH 3SGDH 4RMSA 43C9B 4NZUL 1MNUL 1I7RB 4OCXH 5CJOH 4JANA 5JO5A 4OZHB 1G0YR 4H0HB 5T5NF 2H3NA 4AK1A 1PJ9A 3PQYD 3HE6C 1S8DB 2X41A 3ALPA 1M71B 2GUOA 5BZWA 2X1OA 5AUMB 5CJXA 2FGZA 3SDCD 3BRFA 2AGJH 1HINH 3QI9B 3QSKB 5GGTA 1VKXA 3F7QA 2WBJB 2BHYA 4V1DB 2DQTL 5GS1C 3GUTB 2D3VA 4JFEA 4PLJD 1KC5H 1N3NA 4DVRL 4GRLD 2EIDA 3HMWL 4OGZA 5FHAH 5E6YA 3UTSE 3P73B 3ARSA 2WZPD 4PRIA 3ZDXE 4K8RL 5D7KD 3QJHA 3VFVB 2JIXB 1G6RB 1JRHL 1NCBL 2VDLH 3KPNB 3EFFA 4R6UA 4WFFE 2O5YL 25C8L 1W72L 2C3VA 1PX3A 4GAGH 5EUOB 1IAII 1UJ3C 3LKQA 1QSFB 4XWGH 5EWIL 3SGKC 5C9KA 1JHLL 3U7WH 5KSBF 5CBEA 1A1OA 2R23A 1A6TA 1NMBH 3KPSB 1LEGA 5I1AA 1T04B 1CLOL 5FF6B 2PNDA 3F58H 2HT2C 2GAZB 5IIEA 4DEPC 1HHKB 2J8UB 5FB8A 2XWTA 2Q87A 5IB3A 3NFPA 4U1IB 2RQ8A 2H6PB 2FHCA 4U1HB 5KSVA 3WUWA 3RX8A 2DQHL 3CZFB 4NKOA 2OSLB 2I9TA 1DBBH 3QUML 5GJSH 1I9RL 2XWJB 4GAYA 5A43C 1MCIA 2H1PH 1AKJD 4F57L 1D6VH 3LKSB 2OK0L 3QDHA 1HHIA 4FRWA 1A7OL 4ZUTA 3U2SA 5D7SL 5D93B 4ODSH 4ZTOL 4BZ2L 5D71H 1WFUA 1AGBB 1INDH 3CK0L 4YDKH 5I15H 5J12B 5IFJA 2XICA 2E7CA 3T2PA 1DN0B 3S34L 3UO1L 5CZXD 1A7PL 1ZVYA 4W68A 2J12B 1WZLA 5A2FA 3L5WB 3UBXI 1KJVA 4DGVH 3O3EB 3RY4A 4GKNB 1KLUA 1J18A 5I1LA 4J8RB 5DTFB 5E00A 4GMTH 2PYFB 5TF1H 4DN3H 1VDGA 3QFJA 3ARGA 2LU3A 1A7RL 1PD6A 1HCFX 1KB9K 2OLDA 3BEWB 5I30H 4UT6H 1IT9H 5F7MC 3CC5B 1NGWA 3F12B 2JCCF 4EXPX 3VFSB 1ZHLB 3SHSA 3O0RH 4G8GE 5DJ6A 1CE6B 3MJ8A 3QIBD 4IRJC 4J3XA 2B5IC 4LHUD 5JDSA 3U0TB 4YDLB 1UJTA 2E8YA 3QO0B 2W1NA 1FBIL 2BOBA 1HQ4B 2X4QB 5DFVC 5C8JA 3ARWA 4JB9H 3MCKA 4K3DL 4TUKL 2K3TA 5HDLA 1R5IB 2DI7A 5KVDL 3MLXH 4JJ5A 4XVSH 3SQOL 4X4ME 1RZKL 4ELMF 4U6XB 4ODXB 3B43A 3I2CH 4BZ1L 3UX9B 2YMXL 4NRZA 1W72A 1IFHH 1MFCL 2LABA 2YR3A 3MLTB 5GS2D 3H6JA 1AY1L 4M02A 4TUJA 1PDKA 4MJIA 1QRNA 2Z8VC 1OP5H 4C59B 2JB6B 1FZOB 1GZPA 4M03A 5FO9B 4LVOB 5EG6C 5CEZH 2VLLB 4D8PA 1A0QH 2XV6B 5I1KL 2HH0L 4JFDD 5JMOC 3GO1H 2A74B 2E27L 4NO3B 4YC2B 4NQCD 4YHKH 5GS3A 3QUMA 1VFUA 1Q9OA 2VLKA 3LQAL 3AMLA 2OXHA 5SX5H 4X6FB 1HXMA 3ZTJH 2Z4QB 1F6AB 4BYHA 3U36A 4FABH 3BT2L 3QDMA 1QA9A 3RIFF 3CFBA 4PG2C 3T8XB 3SKOA 3ZDXF 3SCMA 1RJCA 1D5XB 1XGYL 2VLRD 4RA3A 4JKLA 4Q9CA 4MA7H 1U3HA 4WGVB 5HYIA 4KAQL 4AIXA 3NVQA 2FJGA 3EUUA 5JIIA 1ZXQA 4XZUA 2DYPD 3H0TA 2QADC 4NWTL 4PJ7F 4OT1L 1GIGH 1F02I 1CF8L 3BP4A 5IESH 1MRDH 1I8KA 2GITA 4XVUC 1MCWM 2A73B 2ZCLH 4AM0A 1A7BA 1J05B 5J3HC 5C0BE 1TETH 3MFFB 1LO4L 3VXPA 3MACH 3V2AR 3B5TA 1YN7B 3G6DH 4NPYB 2A6IA 1GAFL 3VE0B 4JHWH 2FX9L 2B20A 5E6ZA 2CLZB 5DSCA 4ZSOB 1MUJB 3L9RB 5CHNA 4HW6A 1JK8B 2OTWB 1XR9A 2EYTB 4JRXE 3H9SD 3GZKA 1JGVH 3VGFA 4Y5VB 3PDDA 5H2BB 2XTJE 5LCVL 2K9UA 4HLZG 1BBDH 4PJ9B 4E41B 4U1NB 5B39A 1P84K 1K4DA 1ULVA 1KSRA 3C5SA 2Z91B 5JW3L 1OAYH 5ETUA 3P4OB 3WD5H 4ORGA 5CCKH 5D7IB 2VQUA 1JYVA 1TIUA 3SJVE 3D25B 4IRSA 3NTCH 1CFTA 5T33H 3ZE1E 3IYLW 2AW2A 4E5XA 5IF0A 3MJ9L 1K9TA 1SJHA 1UM6H 4P3DA 3C5ZB 3QQ9C 2Y7QA 2Z31A 2NY6B 3DETC 3VFPA 3EOTL 3P2TA 3DXAA 1ZT1B 1CD9B 5JXAL 3X11B 1YMHA 4OFIA 4Z0XB 3HI6H 4NQXA 4IHOB 2WP3T 4JKWA 4M7KH 1A4KA 3TO2A 4M3JA 1MFDH 2YRPA 1Q1JH 5IEKB 5A3ID 4YPGB 3WN5C 2LE9A 2VXTL 4LSSH 3V5DA 3IDMA 3MR9A 4NOFA 4WU5B 3WIHL 4G9FD 3QFDA 1PG7H 3WS3A 3SKMA 4X4XA 4RZCB 1F4HA 1ZLWH 3FFCE 1M6OA 4OGYL 2HRPH 3D85D 4R97B 4K7PL 4X6DE 1CDUA 4Z7WF 4HMCA 4Y1AB 1EEYA 3L3DA 2B1AH 4N5EC 2A0LD 4OB5L 4ZS7H 4QRTA 1A2YB 2PW2A 3QDJE 4BSJA 2HWZH 2BSSB 5JW4R 3GMOB 1SBBA 2QBWA 4PTTB 3VXSE 1NFKA 2YUXA 2D7TH 1JNHA 1KENH 5MEPA 1VGKA 5HHXL 5E8EB 5CUSL 3R8BB 2Q7NA 1Y6NR 3AM8C 2JF1A 3LHPH 3R1GH 2ZCKL 4G7VL 4KQ4L 1YMME 1P7QA 5E8NA 3NPSB 5B22A 4Y0GA 4YZFF 4NKQB 4WUUB 2F19L 1H8SA 1AD0A 3WHE1 1NGPH 4QRRE 1OAUL 3VW3L 4APQA 2PXYD 3BN9C 3KPMB 4R4BA 1L9MA 1MFBH 3MRLA 5I1DB 1YECL 4JFFB 1N2RB 2WLZA 5DRWB 3GJFB 5FKPB 4JM2D 2BC4B 3REVA 1SEQH 1RUML 3KVQA 4H25A 3RWIA 1CFBA 2IF7A 3VG9C 2VXUL 5GHWH 2MCPL 5KANI 5HYSA 1BP3B 1HH6B 2NYYC 4MAYB 1BAFL 4MXWH 4CMMB 4K3EH 4Y19A 3Q3GA 1AI1H 2F54B 3GBNH 2OMBA 2W65A 2DQUH 2FIKB 1F5WA 1MCFA 4PJBB 3K8MA 4UMGA 4L4VA 2AEQH 3HNVL 5HHMD 2NY7L 1MCBA 3DVNB 1RY7B 1TTUA 4J4PD 3V4PL 4KDTC 4HS3B 2ADJB 1NLBH 1E28A 4NQEE 5JMRA 1CFQA 4PJCB 1GGIL 3EYQD 3O4LE 1IM3B 3U7AA 1UACL 3VGEA 1CTNA 2FYYA 4NKMB 3MV01 3WIHA 3P0GB 4DQOH 5DD1H 5FK9A 1R6VA 4KKBD 2APFA 5E2VL 3WHE0 2P5WB 4OZ4A 3OJDA 4G8GB 4LCCC 3PE9A 3PGDB 3GI9H 2BRRH 1P84J 3IJSA 4IOFC 4QRQA 1IKNC 4HUWA 3O6FB 3BPNB 2R56H 4LSRL 5E6IB 2M26A 1OAKH 3DMMC 3RWDB 4LOUC 4AL8L 5KW9H 1RV6X 1LK3L 4HQQH 3ZE2E 5B38A 3Q6GH 4KJQC 5SWZD 3H3KA 3U4AA 5DMGD 5DK3A 2NXYB 1J7VR 1S9VB 3GDBA 3MLVL 4KZEH 1I4FA 2X4TB 3WHXA 3TESA 2N4IA 1KIRB 3U1SH 2IH3B 1B90A 3D0VB 4LK4A 1JN6A 2VN4A 5DHYA 4R26H 1NGQH 1G7IA 5T1DH 4ERSL 2IAMC 4WDIA 1WTLA 1YYLH 1Z6JT 1KJ2B 3FQXB 2NTFB 3OB0K 5DEFA 3ZHDA 4G43A 4YWGL 5GRWA 1KN2H 4HWZB 3OKOA 2DMCA 3K4AA 4HPOL 5DZNA 4L9LC 3T2OA 3SGDI 1QNZL 4PRPA 5DRNB 1WFOA 2PO6D 1RULL 3GFUA 2R4SH 5JOFB 3LKRB 2AJZB 1YPZB 4ZUWA 2APBA 2VR5A 2YKLL 3OKKB 3ARBA 3BGFB 3FOLA 1NC4A 3BESR 3OB8A 1CXLA 1PKQB 1IGIL 3HZMA 2CKBL 4QHLB 4P2RD 5BCAA 4U31A 4M5YL 2YEZA 3QCTH 2FATL 1BBJB 4GG8A 5KZCD 2ADFL 1UZ8B 5FGBA 4RGMC 4X99A 5E8OB 3PF2A 2ZJSL 4M5ZL 1EUUA 1RAMA 3MXVH 2G2RB 4D9RD 1MVFA 1ETZA 1ERNA 2ITDB 1CWVA 2XRAL 2G9HA 1U8HA 2B1HL 3D9AL 1OLLA 1U58A 2J8OA 2WIIB 2M8XA 4GXVH 3K8KA 5DRZA 2C5DC 1UCBL 4M48H 3M07A 3MLUH 4BKLA 5IB5B 4I5BA 3VFNB 2CRMA 2Q86B 2MHAB 3S37X 1EZVX 4L8BA 1FO0L 1VPOH 2ADGB 4UUJB 2G75B 4GBXD 3CUPA 3MV8B 5DLMH 4XCYB 4JRWA 3PHQB 4Q0XH 4KHXL 4X83A 4OAWB 1XGTB 32C2B 4JZJA 3AMKA 3DX8A 43CAA 5DJAB 3OXSB 1WEJH 3T0DA 2YHGA 4Y4HA 1B9ZA 5EN2B 2PW1B 2FJHA 1AXTL 4JDZA 3WJJA 1YY8B 4H5SA 4LLVA 4LLQA 1AE6H 1KIPB 5D7LD 3O9WA 4X6CA 3V52H 5FO8B 1Z9OA 5H35B 4TVPD 4WU7B 1BZQK 5I8CB 3H3PL 4QXUL 3QUYB 5FUZL 3W81A 1CQKA 5BO1L 4EDWH 3OHXB 3F7PC 4WNQB 5FOJA 3UPRB 2HTLC 3HN3A 4JO1H 5DWUL 4QTHA 3I50H 3P40A 3D3VA 4P2QD 2PUQT 4OV6F 3TT3H 4UZGA 4J2XA 3W0WB 3T3MF 4N1HB 3CMGA 1QBML 4MNQE 5INDA 2X7LA 4PFEA 1DQDL 1RZ8A 5ACMA 4UIMB 5KANG 5J11B 1NAKH 3FRPG 4QOKE 4JN2A 1TPXB 5DI8B 1DVFC 4UDUA 5EH1A 5GSVA 3SDXB 1OLZA 2BDNL 2CKBA 3LY6A 4N8VG 4PJHE 4UTBL 1PQZA 3ZE2F 3P4NA 3VXNA 2E6QA 1H3VA 2R0KL 3BIKA 3D2UA 3QUXA 4FS0A 2J88H 1QR1A 1WIPA 1EGJA 5HYFA 7FABL 1LEKA 3SKJH 3IXTB 5TE6L 1REIA 3G5YB 3GSRB 3T2NH 2D03H 4NRYA 3BWUC 3QH3B 5T1KD 5CD3B 5BV7L 2XI9A 1J1OH 4XH2A 2EH8L 2HP4A 1J12A 1PSKL 4NN6C 4HJJL 1OQXA 3ZTNL 1S7XB 1QVOA 3OTTA 5EO9A 1O7VA 4OQTA 3TN0D 3CFJB 3BISA 1NL0H 4XAWH 1FO0A 3MV9D 5HGBA 1RIHL 1I7ZA 3H3BC 3VWKD 4GSDL 4PBVC 4Z5RB 4PRNA 3BKYH 4AZ8A 2ARJB 1FL5B 4GRMB 1U8KA 2YK1H 4G80A 1SVCP 4Y4FD 5AG8A 2IADB 4NO0D 3SO3B 4DTGH 4EBQL 4F7PA 1KCKA 1FNSL 2Q76A 1R3IL 1T4KB 1FVCB 1T2QH 3ELAT 5D1QD 3UJJL 3FHQA 5DUML 1RIUH 5EZIL 1EJOL 4HKXA 1C16B 1IC5L 4XBPB 1OW0C 2CJUL 3NCJH 2FWOB 3RI5F 5FYKE 4A6YB 4PJ5E 4X98A 5SWQA 4L8SB 3CX2A 3D0LB 4HAFA 3TPUB 1FVDB 3VH8B 3MV7A 4MDJA 1RUQH 3NFNA 2R2HA 3VCLB 4C56A 1QSEA 1TZIB 1CI5A 1ZHBB 4FQIH 4Z77B 1IKFH 4KMQA 4JZNB 3HC3L 2YOCA 4P4KB 1JPSL 5TDNA 2NY2C 4MQTB 4WUKH 2O26U 3O4LB 1QUNA 1YN6A 4YHPB 1ZHNA 4LPUA 1MCRA 1ZA6A 5IBTL 1JWMB 4GT7A 4X5XB 4HDIA 5E4EB 4F3FA 2BVOB 2VZOA 4E42A 4KK9C 1HEZA 1JF1B 4FQQA 5BJTB 1HDMA 4XHJC 3BD3A 3BP6A 1BREA 1PW3A 3SOBL 2CD0A 4PRHD 5CJQL 5DD3L 3W39A 2B0SL 4WO4C 2Z9TA 4X0KA 4XP4H 5K9QI 4OKVB 1S7UB 5BXFA 1X5AA 2F53B 4JAMB 5EBMA 4Q9QL 1A64A 2XZCL 5ESVA 2HFTA 2OZ4A 1YQVH 3SGEH 3AS3A 3MOAL 1R3LB 1FPTL 1ZS8B 2AJUH 1MJ8L 1YEEL 5L2KE 4GRLA 3VXQA 1A02N 3T65A 3FAWA 3HE7A 4WFHE 5K9KA 1BFSA 1NC2A 2EXYD 2OCFD 4GS7C 2DBJA 2YXFA 5C09D 5I73C 3B8YA 1BX2B 2YBRA 3DX6B 3SE4A 2HTKD 4TOYL 1EFXD 1F42A 3IXAB 3OKMA 4FQ2L 1F11A 1OOAA 4MA8H 2EDYA 1MRFL 1NDMA 1F2QA 4YBHA 2QSQA 5AWNH 5C0RL 4XXCA 1A3RH 2FR4B 1KELH 1KCUH 1EVUA 4WI4A 4H1LH 2ZUTA 1QFHA 3MRKB 4P59L 4OF3A 4ONFL 1CD1B 4DN4H 3BZFA 2ICWA 4PRBA 4EUPB 1RZFH 2ICEB 5CSZA 2VUYA 3QFJE 4R0LC 3QQ3A 1IGFL 5FYLL 4IIQC 3VJ6B 5HGHB 3AXLA 1IEAA 4NHUB 2I25N 5CKGA 1RHFA 2KKQA 2XNAB 3H7BB 3TO4C 5EFIB 1KTKE 3HPLB 2NX5B 3MRHB 3U9PH 6FABL 3CVIL 1CU4H 4QNPF 1MQKH 4ZFFB 4NO2A 5ILTL 1CK0H 5MENA 1E4WL 4HAGA 3FOMA 3VFUA 5BRZE 3QIUB 4PJXE 1IQWL 3IU3B 1OTUD 3VA2C 4KRMB 4G7YL 1P69B 3G5XA 4KHTL 4KKCC 4IMKA 5FOBA 1BQSA 5K9OB 2NY3B 3MNWA 1QRNE 2IANA 3NACL 2QQKH 5DJ0B 1FRGH 4LARL 1T1XB 4MJ5B 1JZ6A 1AGEA 3RY6C 2VSDA 1DQMH 1MFAH 4L3ED 3S7GA 5MHSD 1ND0B 1JI1A 1CICB 3HKFA 3O45B 4C83B 1TVHB 1IJ9A 3FKUS 3LQMA 4JG0L 4WJ5A 3GKWH 3QIBA 4HS6A 1C12A 4LHUA 3IDJB 5DFVD 2VAAB 4NUGL 4ZS6D 2NY0B 3TT1L 3OGCA 4XVJL 4O2FA 1DSFL 1KPRB 5H37G 3TF7C 3PL6C 5DK2A 5JNYA 4PD4K 1KCSH 4L9DA 5TFSH 3DRQB 2R4RH 3DUSA 1HSBB 5FUOL 4X5WB 3M45A 3SKNB 3QI9D 1I3GH 1OPGL 3RQ3A 1A9BA 3U4EA 1HKLH 5TPWL 2XZQL 1B4JH 4UV7L 2GSGB 4NN5B 4ZUSA 2MNUA 4FZ8L 5JLZA 1WWBX 1ZAGA 4PV9A 1JJUA 2F9BT 1WCBB 5DQDL 4YDVA 4HEPG 4CN6A 4QYOA 1ES0B 1ACYH 4PJGE 1HNGA 1S9XB 1EVTC 4OM0H 5FV2A 2JIXD 2A77L 4WFGD 5JPMA 2HJKB 4KRPB 3RJQB 3QEQB 2WANA 4JFHE 4JQVC 5F9DC 4LLDB 3ZTJG 4CGTA 1U41A 1U8NA 1UYWH 5EU4A 5C0AE 4PJHB 4DCQA 3KNBA 1MI5A 4JREC 1CIUA 1XMWA 1MHPL 4ODTH 3HAEH 3W9DA 2W60A 3J8F7 5C0DA 1K8IB 1VESA 3RGVD 4UNUA 2VLRA 4LGRB 1KJ3L 5TGBB 5C92A 4P23C 4B5EA 4X7FC 2H2PD 3MRCA 5LBSL 2J8UF 2DYPA 4ODHL 1OF2B 2L4OA 1ZA3B 1KT2B 5GGQL 4TNVK 4HX1A 4W70A 3O3BA 3BIAX 2BK8A 3L3KA 3TA3B 3UXFA 1IL1B 2PCPA 4KU1A 4PLOB 5AZ2H 1P4IL 3FO9B 3RIAF 5DYOA 3RVVD 2LTQC 2EICA 3RTQD 1B6DA 1UM5H 2XQYG 4WW2C 5CBAB 4WFED 4M1DH 4NCC2 1N6QL 1QEWA 4IOIA 4D0DB 5FYKH 5K9QG 2VQ1B 4YHLH 1FAIL 3QAZC 4XC3H 5GGUB 3A67H 4F33A 4XPFL 3DXAE 5L6YL 1EAPA 4P2YA 5EU6B 5IVZA 3D39B 4PJAB 1EO7A 1HHGB 1U8JB 4JO3H 5I1CH 2JE8A 5DO2D 5FDYA 3BQUD 3D5OF 4N1EA 4UB0H 2RR3A 3H9SA 4JJHA 3FCTA 3B9KD 1KBGH 4XGZA 4WY7L 4HG4K 1DBMH 2C3XA 5L0QC 5JA8B 4DW2L 5D6CA 5JO5B 2EDNA 2BNRD 4O02L 4UNTA 4MB4A 2H3NB 3L6FB 5F9JB 1DDHB 2XZAH 2EXWD 3OJMB 2EDTA 3DX9A 2CH8A 5BZWB 5HDQH 3T0EB 4I3SL 3PNWB 3V0WH 1PY4A 4RGNE 4M6MH 4LL9A 4ZAKB 4FQJL 5D1ZD 3UPAA 5F96L 4TULL 1VKXB 1OT2A 1ORSB 3BEVA 1XT5A 4XPBH 1PFCA 4JFEB 4N68A 1VEOA 3TP4A 3JXAA 4GMSH 1I9EA 4N0YL 1OY3B 2I5YH 5D7JC 4PRIB 2F8OA 3MGTA 3VFMA 1MSPA 1N8ZA 2EDWA 3LN5B 5EZLA 5ACZA 4NCC1 3EFFB 4XWOC 1FH5H 3FO0L 5CGTA 4XPGH 3ZKMC 2HVKB 2C3VB 3SE3C 1IZKA 4YX2H 3RAJH 1DQQA 1NFDA 4CBPA 4EI5C 2WBKA 3LKQB 4OLZH 3GSUA 4RIRA 3UTPD 1J8HE 5ANMA 1NLDH 2ENSA 3NIGE 5CBEB 5LXGH 1A1OB 4S1RH 1KCVL 5SWSA 2DN7A 2R23B 3HPJA 3LKNA 1A6TB 1U95A 2JJSA 3MZGB 1LEGB 3ZT7A 5I1AB 4AG4L 2R9HC 5IIEB 2AEPH 4CKVX 2V5SA 4G9FA 5FB8B 2XWTB 4P9MH 4MZ3A 1SYSA 1MFEL 3NFPB 2J4WL 5KSVB 1VGEH 3WUWB 4NKOB 2IC2A 2I9TB 3ULUF 4XMPL 4GAYB 4RX4D 4N8PA 3RPIB 2V2TA 4PJGF 4NSKA 1FQ9C 4EKXA 1HHIB 4ZUTB 3U2SB 3EJJX 5CEZD 4MS8D 5IR1A 1IAIL 3U0WH 2ESVE 3L3HB 1B0GA 5IFJB 2YD7A 2UZXB 4M7LT 3I6LD 1JPFA 4PLNC 1UWXH 1U3JA 2VWEC 4UBDC 4L4VE 1KJVB 3S4SG 2DQTH 1IE5A 1RZGA 4PJFA 2R15A 3B5GA 5CP3H 5I1LB 5E00B 1ZSDB 3KLDA 4M93B 4PJEA 3OKYA 2C1PA 4YBLC 5LKNA 3ARGB 3LS5H 1YDPA 1RIVL 4OLUL 1HILB 2APXA 5DZLA 4BFBD 3WIFA 4GAJH 1NGWB 1UKTA 4JM2A 3X14A 5ADPH 3KXFE 1X4XA 2AJYH 5DJ6B 1U8QB 1FFPA 3MJ8B 2KQMA 3IFLH 1XFPA 1JHLH 3MBEA 3E3QE 4M43H 3O8XD 5JDSB 1ZT7B 3ULVD 4AMKH 2BOBB 5C8JB 4OI9A 4CU6A 4PREB 2CDFA 5CMAA 1CLOH 5E7FA 3MCKB 4N90E 3GHEL 5FO7A 4E41D 3IRPX 2WAHA 4JJ5B 5BS0D 1OT1A 1AGDA 3U79A 4NIKB 3B6SA 5H8DA 5KSUA 1W72B 5D9SA 1IZJA 5F6HI 3CSGA 3DROA 5C0CA 4HFWB 3PXHA 3P0YL 4MJIB 3AROA 4JDTL 4MMZC 1H8NA 4AIZA 2X4UB 5D7IF 2NY6D 1GZPB 2W91A 3V0VA 4OQ1A 2DKMA 4KUCF 2FH8A 3FN0L 4Q58C 4D8PB 3ARDC 1SY6L 3BSZH 1NUNB 3KPRE 4ZNCD 1I9JH 4EZMA 1GPOH 4GH7B 3RFZC 2XN9A 5JHDB 1R3KA 4LRIC 1U8PA 3QUMB 2WBJC 4WWID 1Q9OB 2VLKB 3ULUH 4FFWC 1HXMB 3BKML 1U92A 3U36B 1UEMA 3QDMB 1QA9B 5IM7A 3CFBB 5EOQL 1DL7L 1QSZA 1X5IA 4XX1E 4N0UA 1HH9B 4LFHG 3SCMB 1T1ZA 4POUB 3CSPA 1CLZL 1A3QA 2VDQL 3PHOA 1U3HB 4U1GB 2PF6A 3CFCH 4ZFOL 2FJGB 2M1KA 3DIFA 3C2SA 2R0LL 4XZUB 2OMNA 2EDJA 3DPBA 1CT8A 1DTUA 3H0TB 3WO3B 3UTSD 1N5YH 4H8WH 4FQLH 3MQIA 2DTMH 1I8KB 1TTGA 2GITB 2A83A 2P8MA 5E9DA 1VA9A 1H3TA 4K3DH 1MEXL 4WV1C 4TSCL 4R8WL 5CAYB 4HWBH 3SQOH 3VXPB 1RZKH 2NMSA 1PEZA 3C8HA 1CL7H 1DZBA 3D1MC 4BQ9A 3AB0B 1MF2L 2A6IB 1UH2A 1T7YA 3QRGL 1MFCH 1ZWIA 1UC6A 5GXBB 1F6FB 2YUZA 2O61A 1AY1H 1EBAA 4WUUD 5DSCB 4OFVA 5CHNB 4PB9L 1XR9B 2PO6A 3KYAA 3MRPA 4MA3A 3UBXA 4Z7QE 5HDBE 4ZFZA 3TZVA 4HSQA 1U91A 5IGXL 1EO5A 2NY4D 5D93C 5GS0H 2B4CL 4KK6C 4P2RA 3WFBH 3AS2A 4HC1L 1SMOA 5J12C 1QD0A 3AY4A 1EXUA 5B39B 4M61A 1K4DB 4PGBA 3VWJD 1NQBA 3BAEL 3C5SB 15C8H 4ESKA 5ETUB 1AP2A 5GJTL 5F1KC 1MPAH 3NZHH 4ORGB 3P30H 3EO9L 4MAYD 5DR5H 1T83A 4YK4B 4YPJA 4IRSB 4U1JB 5IK3B 4X6CE 4E5XB 2F54D 3HLAA 5IF0B 4F15B 3UMTA 1SJHB 1EJ6A 4P3DB 2LU7A 1ZLVH 4JQXA 5DJ2A 1SY6A 4X9BA 4IOSD 1X5LA 3DXAB 3L3GA 1S7WB 1YMHB 5D96B 4NWTH 4NQXB 3D3VE 4OT1H 3TM6A 4WI8A 4LQFL 2X89D 3BW9A 5KG9A 1A4KB 3TO2B 4H20H 4GBXA 3RHWF 1C1EL 4YDLC 2PR4L 5E56A 3I9GH 3V5DB 2CK0L 3LH2L 2VZSA 4JM4H 3IDMB 2B2XH 4LLMA 4XCCL 3MR9B 4PJCF 1Q9KA 2E7MA 4K7FA 2APWA 2P5WD 4G8GD 3QFDB 4Z78A 4ZFOA 3KPLA 4KDWA 4NO5A 3SKMB 3VU2A 4X4XB 3WS3B 1MCQA 3KDMA 2ZCHH 4HHAA 4LLWA 3VI4E 3UJIL 1IILE 1M6OB 2MOVA 4XPAH 2NNAA 5I6XB 3AU1A 4XMLL 4JN1H 5HYJE 3OL2A 2Q3ZA 2E7LA 3IFOB 3ARED 3WEXA 2MMXA 2R0ZL 1EEYB 4KJWD 1QFWH 4QRTB 5I71B 2AQ3A 2PW2B 4K94H 5LCVH 1UZ6E 3DBXA 1XGUA 5HHOE 5ID0A 1L0XA 4CW1A 1J0ZA 3VD4A 5D2NA 4U6VL 3AC0A 2H32B 2EIZA 1JNHB 5MEPB 1EEQA 3MLWL 1VGKB 3MROA 3WJLA 3VFOA 3ULUC 1F4WH 2ZUVA 1FLRH 3GHBL 4YC2C 2V17H 5EC1A 1UT9A 4XCNB 5E8NB 3PABA 3O6LH 2HT4D 4KK5D 3WV0A 2VDNH 3MJ9H 1FZMA 1NAML 5BW7C 4APQB 2DLTA 2DWEB 3VD9A 3T0BA 1CXIA 4JFOB 1OAZH 4WEBL 4R4BB 4M6OH 3D18A 3CVHL 5EOCL 1O7SA 3MRLB 1RPQA 4M6NH 4LFHD 1RMFH 3E1F1 5F1IA 2P8LA 5DJ8A 3N06B 2GK0A 1TQBB 1PY9A 3REVB 2EH7L 4H25B 4H8WC 3WFDL 2X44D 1NCWH 4X7DC 3RWIB 2XTLA 5FYJL 1MCPL 4OCSH 5FM4A 3D87B 5HYSB 4NGHH 1IC1A 4Y19B 1WWWX 3Q3GB 1YPZF 4M00A 1KV3A 1Z3GH 4EEEA 5MI0B 3TN0A 1E4KC 1FP5A 2BVPA 2W65B 5L7XL 2XQBL 1QSEE 3AFLA 5FM5O 4K7PH 2BHZA 5C0BD 4D0CA 5JXEC 1F8TL 5KVGH 2DI9A 2R2EA 4Z7QF 1E28B 1UG9A 1CFQB 4OCWL 5DHVH 3RVXC 4Y4FA 5ACLA 5GS0C 1F00I 4NO0A 1MVUA 2NY5L 4QY8A 4Y5VC 1LO3H 2FYYB 2NZ9C 4KROD 3GMQA 1XIWD 5EBGA 4ZXBB 5HVFB 2VIRA 5FK9B 4PJ9C 3B8SA 5CZKA 4MXQC 4ZOBA 3SDDB 4OZ4B 2RAMA 3OJDB 5T5FL 4M7JH 4JRXD 2OTUA 3HS0A 1L7TL 3IJSB 2AI0H 2AJSL 4J3UA 4QRQB 4HUWB 4JVWA 2XTJD 5HI4C 4EN3B 4P2OD 2G60H 1LP9A 1YJDH 2MCG1 2HKHL 1RK1A 3JVGC 1GGCH 3C5ZC 3QULA 3NIDE 3ARUA 4N0FA 3BIBX 1DFBH 3A6CL 1IGCL 2ED8A 3SJVD 1EMTH 1G9NC 1LDPL 3IF1A 5AAWA 3GK8H 1NCNA 1I4FB 2C3GA 4OF0A 4LPYA 3ZKND 4OF8A 3WHXB 2Q3AA 4WWKA 5E24E 5KS9A 4U3XA 2D9QB 1JN6B 2BRQA 5DHYB 1LO0H 1X5ZA 1G7IB 3CVHA 3BPLC 4WDIB 2D9CA 5DEFB 3V6ZA 5KJRH 4G43B 4PRHA 2VLJA 1KJ2H 4HIJA 2DQEL 5B3JE 4PY7A 3NOIA 5J13B 1B0RA 4LNRA 3PIQA 3HE6A 4RAUA 1T0MA 4LHQB 5HPMA 2YXMA 4OCNC 4NJAH 3DWTA 3PP3H 4PRPB 5A16A 3CAFA 3ABZA 5LJYH 5IW1B 4K94C 4ZUWB 5IUSA 1UACH 3ARBB 3FOLB 4G6AD 5GS1A 1FGVL 1UZ6F 3FFCD 1OTTC 3GBML 1AQDA 1KPUA 4S1SH 3HZMB 4JFZH 5C6TL 2OR8A 5ADOH 1CXKA 2BSTA 4MQXD 5JR1H 3SDXF 5HHQA 3DURA 4W81A 2A2QT 3K3QA 5C09A 1F3JA 4GG8B 5F7YC 1DQJA 2JB5L 3V8OA 4X99B 5MENE 3VXME 3QDJD 2EDOA 3GMNA 4YHOL 1ETZB 5IFAH 3NPSC 5J1TC 5DURD 1H15A 2G9HB 1U8HB 5E2WL 5FHBH 2VDOL 3UPCA 3BGMA 1WJ3A 3FRPA 3SGKA 5DRZB 2IPUG 3L3OB 4PP1D 3OAYK 3C2AH 4N8VA 4BKLB 1A6ZA 3C6LB 3GMMA 4OCXL 4WENB 5CJOL 3EHBD 1YMMD 4NNXA 1GVIA 1NFIA 1AGCA 3MLVH 2KDGA 2IANE 5DJDB 4L8BB 3T3PE 4QRRD 3O4OB 3QZWG 3PWUA 2AGJL 4MD5A 3S3JA 1HINL 3CUPB 2Z0BA 3QEHA 2FLBT 2OM5A 2WLYA 2VDKH 2C9AA 2X4PA 3H7LA 5FHAL 1HYSD 5EIIB 5DVOA 2HYMA 2I9LB 5C07A 43CAB 3R0NA 2CPCA 3N50A 4Y4HB 4DK6A 1WAAF 3PP4H 2FJHB 3F6LA 3JUZA 1YEDA 4ONOA 1A7NH 4JFQA 2GTZA 2VDLL 2DBLH 1QNZH 4H5SB 4LLVB 4LLQB 3UTOA 1V3KA 4QRSA 5BQ7B 3O9WB 5JW5A 3NIFE 5IHZA 3LKOA 2VERN 4GAGL 5C3LD 5D70H 1G7PB 4XWGL 3NCYS 1ZTXH 4U6HA 2X70A 3U7WL 3HNSH 3JWOH 4JGMA 4Q2ZA 1NMBL 4UOJA 1P53A 3BWAA 5JIPA 1D9KD 4M4RA 3UEZA 4AIOA 3F58L 3LPGA 4QTHB 4AQ1B 4M8QA 4NQED 5KOMC 3CJJA 3O4LD 4L3EA 1CGTA 1GH7A 1YNKL 3ARYA 5INDB 5FYLE 1C5BH 3NGBB 3U46B 1FL6B 1BGXH 3MLZL 1RZ8B 1YJDC 1YEHH 3O6FC 3BPNC 1VFBA 5FV1L 4JN2B 4U3HA 1DBBL 5GJSL 4YFDB 2A6KA 5E6IC 4IRJA 4UDUB 5GSVB 3RRQA 3RVTC 3L3IA 4MNGA 4L4TB 1D6VL 1PQZB 3NIDF 1I1RA 3EDFA 3MRQA 1MI5E 3P4NB 3VXNB 3L7EA 3LIZH 3TBYA 3BIKB 4ODSL 3QUXB 4Y2DC 4KZDH 5D71L 4M3KB 1INDL 5I15L 4YDKL 2NXYC 1A7QH 1GOGA 2FZ3A 5LAXA 4YR6B 1EERB 3IDYB 4Y8AA 3B9VA 1M4KA 4DGVL 2VKWA 1WK0A 4XH2B 1F3RB 1P4LA 1AR1C 3H8NA 1QVOB 3K2UH 4QRPA 3ZT5A 1WV7T 5EO9B 3MLRH 3KGRA 5B3JF 4FFVC 1H3XA 1KOAA 3HUJA 5FGCE 3V5KB 5HGBB 4KV5F 3B5HA 1IQDA 1I7ZB 2NCMA 1WFNA 5I30L 4PRNB 5ERWA 4RMWA 4L8DB 3HAEG 3PWPA 3O0RL 1BFTA 1U8KB 4QXUH 4PV8A 3O3DA 4TQEH 2VAJA 4ZQKA 5GZNC 3BGFC 2D0GA 2L7JA 4F7PB 2Q76B 5IBUB 4JB9L 1G7MA 5J89A 1FZKA 1EUTA 1GOHA 4ACPA 3EYUH 2QQLH 2ZKHH 3MLXL 4XVSL 3RGVA 4U1KA 4I3GA 3E8UH 1TCMA 2EDFA 4HKXB 3I2CL 5IMMA 5DMIH 2UVFA 1IFHL 3H9ZA 1W8OA 4W6XB 4K71C 1L0QA 3UJTL 2VB5A 4X98B 2VKXA 5SWQB 2NX5D 3HB3D 3S36H 1JMXA 4MJ4A 3MV7B 4MDJB 3NFNB 3V6OC 5K9JH 3GSWB 2R2HB 4C56B 1LGVA 2Q6WA 1M7IA 2GIYA 2DLFH 1NBVH 1I3RA 3HI1A 1T21A 3RTQA 1I1AD 1S7RA 1A0QL 5TDNB 2KZWA 4K9EH 1FN4B 3OV6A 3GO1L 4FN0A 1YN6B 2FL5A 4YHKL 2EH8H 1JPGA 1ZA6B 2I24N 1PSKH 3C60D 1MFNA 4HDIB 4F3FB 4HJJH 4E42B 3G9VA 1HEZB 4TTDD 4FQQB 1JFQH 4FABL 5F88B 5D2LA 1HDMB 3U0PA 3RVWC 1V7ML 3BQUA 2CDEA 4A2MA 2DIAA 3B9KA 5ANME 1EFQA 3W39B 2VLMD 3BD5A 4U1SA 1IM9D 3OJVC 2BNRA 4X0KB 4MA7L 3QT2A 3PQYB 1LD9B 4XTRC 3BO8B 5BXFB 3NIFF 1LO5A 5EBMB 3RNQA 3TV3H 4WRLA 5ESVB 4RAVB 3EYSH 4N0CC 3SDCB 1A6UH 5JORA 1NPUA 1GIGL 5GSRA 2VN7A 4C58B 5EBLA 2FHFA 4EBQH 3PXJA 3JWOC 1SM3H 4GOSA 3QUYC 2ZCLL 3O41A 4GRLB 1JE6A 2MQ0A 3VXQB 3T65B 3HE7B 1TETL 1FG2A 2E6JA 5K9KB 1NC2B 4U0RC 2BVTA 5EZIH 3MACL 3O2DH 1ZHKA 3G6DL 3L7FB 2IPKA 3WUWG 2YBRB 2R8SL 4JHWL 5JQ6H 3P77A 1R0AH 1F11B 3ZKMD 4HIEA 3I6KA 1D5IH 5J11C 2BP3A 4DOHB 1NDMB 1TPXC 1ZE3C 3WN5A 1JGVL 4YAQA 4MNQD 1TVDA 2GJZA 3HC3H 1HK6A 4N0RA 3BZFB 1BBDL 2ICWB 2OP4H 3QEQD 4PRBB 1FNEB 4PJEE 5CSZB 4QOKD 4XAKD 1BZ7B 3QQ3B 5I18H 1VHPA 1UXSA 2AV7A 1OAYL 3ARXA 5T3ZH 2CIKA 2PYEA 3LPFA 3AXLB 3WD5L 5CCKL 5KSBA 5ID1A 3NTCL 2P5EE 2EZ0C 2IQ9H 4RX4A 3M17A 4N9GA 4Z7OE 5EU3B 1UM6L 3DI2B 5CJQH 5JW4Q 4NO2B 4X9FA 1CFSA 3PWLA 4ZNEA 2PTTB 5MENB 5CLTA 3FOMB 3VFUB 5I66B 1S78C 3AM8A 4MVBC 3G5XB 5DMJB 4LGSB 4M7KL 4RISH 3AGVA 5FOBB 1MFDL 2L7UA 3TA3D 5GRVK 3ZYOA 1I7TA 3SO3C 3U82B 4LSSL 1BFVH 1ZMYA 3MNWB 3UAJC 4F7MA 4ZFGH 2EDEA 4ZOEA 4NWUL 1AGEB 2ZSVA 3KLAA 1J1PH 1PG7L 2AKRB 3MRMA 2IH1A 4XPTH 5C9JA 4RDQF 2GI7A 3MRNA 2HRPL 4XPHL 5DC4B 2ZWLT 2EKSA 4D2NA 2BCKB 4FXGA 1T5WA 4WJ5B 4L8SC 3QIBB 2AK4E 4HS6B 4M1GH 1C12B 1G9MC 1R3HB 2B1AL 3BDXA 4LHUB 3O8XA 5LGJA 4ZS7L 4Q7DA 4O2FB 1N4XL 2HWZL 4DKFH 5DK2B 4K9EC 5JNYB 3MSPA 3OAZK 5BS0A 4PJ5D 3DVIA 1IGFH 2D7TL 2HT3C 3DUSB 5FYLH 4P4KC 1KENL 4C4KO 2JCCA 1FC1A 2YD4A 3ALXA 2F15A 4PUBH 3QISA 4FP8L 1A9BB 3LHPL 3R1GL 3U4EB 5IG7A 3LSOA 4ZUSB 5HTSA 1GOFA 3EDKA 1I7UA 5JLZB 5IT2H 1NGPL 4JFYB 4OJFH 3FONA 1QBLH 4YDVB 4QYOB 4ELMA 1MFBL 1YEKH 2D0FA 3EYVA 5JPMB 3K1DA 2FD6H 4UOW1 1MHCA 1R5VA 2ID5A 1SEQL 4G7YH 4LCCA 4LVNB 5TDPA 5JZ7C 5JQHC 4ZO8A 3IETA 1U8NB 4Q9RH 5EU4B 3CCHA 4DCQB 3FB8A 5GHWL 2BVUA 4KWUA 1TJHH 3JV5A 4MXWL 3W9DB 5FXCH 5C2UB 3RKDC 2W60B 4Z76B 1AI1L 5C0DB 3GBNL 4UT7H 1FYTE 2NW3B 3TBTA 2VLRB 4Y4KD 4KI5F 1EEZA 4QXTB 2AEQL 1J1XH 5HYQB 4PLKC 5L2KD 3MRCB 4WFHD 4OBRA 4JG0H 1OVZA 2DYPB 1NLBL 3UTSA 1ADQH 3CX5J 4I48A 5L8KB 3L5JA 3TVMD 3W11C 3O3BB 4RRPG 3L3KB 4XRCA 3B9AA 4NQDE 5B39G 4YNYA 5DJYA 4H0GA 5DYOB 5J1SC 2XXMB 4DQOL 3WXVH 5DD1L 4OZGE 4WGWB 4CVZA 4WHYH 4HIHA 5IJKC 4HUMB 1V5JA 4PJ7A 4LMQE 4LCUA 4KGLA 3GI9L 5TPWH 3CZJA 1EAPB 2BRRL 4RQQA 4NJ9H 4PIRF 1YEFH 4JR9H 1B0WA 2BSRB 4UOW0 3IDXH 3ARRA 1QLFA 2R56L 3KHOA 1YC8A 1Z9MA 1OAKL 3OB0H 3QFJD 3H9SB 1IC7H 1NCDH 3ARGD 2GW5A 3FCTB 2ILLA 2C7UA 5ITFA 5KW9L 4HQQL 3TCXA 1T1WA 3WLWC 1A6VH 5D6CB 2EE3A 3BN3B 3SDYH 3Q6GL 1J8KA 3EO0A 1G7JB 4NQSB 4BQ6A 3MNVA 3VWJA 4YJZL 1TQCB 3K81A 3QIUC 4KZEL 1MAKA 1MLBA 4XXDB 3QXAA 4ZO7A 2F8VA 4ZD3H 3U1SL 1CE1H 3BEVB 2X1PA 2WUBH 5GGTH 2NY3C 4YHZL 5F7NC 4K8RD 4R26L 1NGQL 5T1DL 3QWRD 1MOEA 1YYLL 5IQ7H 3DGGA 4BFEA 5D5ME 3GMLA 5GQBA 4JPVL 2VZ3A 1M05A 1F4YL 3MGTB 4CMHC 4HEME 3VFMB 1KN2L 1N8ZB 5EZLB 3FB6B 5ACZB 5IW6A 4KKLC 1CICC 4OTXH 5D2NE 5DUBA 2VITA 4MJID 1QRND 4P4RA 2IPTH 4QHMA 4W4OA 1N0XH 5I0ZA 4RMTA 2FEEL 1DQQB 1NFDB 2R4SL 2X4NA 3GSUB 4QWWD 4RIRB 4DJMA 1FIGH 2UWEE 3QG7H 3FN3A 5ANMB 1AO7E 2YC1A 5SWSB 5I8KH 2NY0C 2VDMH 3WIIH 1U95B 2R1YA 4X9HA 4YFEA 4NFCA 3QCTL 4G9FB 1G6VK 3RWHA 1MRCH 5L6YH 3K0WA 4RSVA 2VLKD 4YBQD 4OI8A 3MXVL 3QEGH 3D85B 4Z7NF 4WVRA 4EJ1C 4NN5C 1A4JA 3BHBA 3AREA 1NMAL 1Z5LA 2V2TB 4X4MA 3EJYC 4X8XA 5CWSB 4NSKB 1TLKA 3KYNA 2L0DA 4GXVL 3WXWH 2EDDA 3RVUC 4M48L 3L5IA 3QUZD 3EOYG 5KSAC 4LSQH 5CP7A 3Q2CA 4KRPC 1J9CT 2DJSA 3NFSH 2FNBA 5T1MB 2RCSH 4M7ZB 1JPFB 2ICCA 3T08A 1VPOL 4YQXH 3WNNA 4I13B 4P5KA 4NNPH 4XP9H 5HD8C 5DLML 4PJFB 3RUGE 4Q0XL 1FORH 2P49B 2YA1A 3TBWA 4LSPH 4JFHD 4MXVE 4OZIE 2C1PB 1RURH 5MP6H 4MX7A 2WP3O 3WL9A 2GJ6A 4G9DA 1WEJL 4UV4H 5C0AD 5IOPA 2X1QA 4QKXB 2XG4A 3WIFB 5EIVA 2IFFH 4DZ8A 4JM2B 1AE6L 3X14B 3V52L 2Z8SA 2ZUQB 1FFPB 2DQJH 3MBEB 3DECA 2Q8BH 2W9LA 2CDFB 5CMAB 2X1XR 4EDWL 3VFTA 2HVJB 1BIIA 1SVZA 3JBG7 3HMXH 3I50L 4LEOB 1KXQE 1AGDB 4OI7A 3B6SB 1B2WH 3TT3L 2NLJA 5KSUB 2J4WH 5D9SB 1EHNA 1SBSH 3KYMA 5HHMB 3OPZL 2NY1C 2AAVA 5KAQF 4H26A 5C0BA 1JF6A 4XMPH 5C0CB 3C8KA 3CFEA 4DFHA 2A6DA 4AIZB 4GKZA 5B38G 3CFDB 2Z31D 1NBYA 2X5PA 3DHMA 3V0VB 5KS9E 2NPLX 3IKCA 3DXAD 1XIWA 1URLA 3VDAA 4JCMA 4AH2A 5CJXC 3SKJL 3T0EC 4F7CA 4PGCB 2XN9B 5I1JH 4JRXA 5L2JA 2VLJE 1R3KB 3T2NL 2D03L 4ZAKC 3WDHA 2OR7A 1OW0A 5JOPE 1U8PB 4GXUN 1HZHH 4NRXA 5FYJE 1F4XH 1J1OL 1TDQA 1U8LA 4OZFH 1OM3H 1MHEA 1XEDA 1U92B 4P2OA 4GLRH 4G5ZL 3HCVA 5IM7B 1AHWA 1XCQA 3DTXA 4N0UB 4RGND 5HI5D 1T1ZB 1NL0L 5HYEA 1RQ5A 5J7CC 4XAWL 5SWZB 3PHOB 3SJVA 1A9EA 3U30B 3UYOD 3DIFB 2N7AA 3GSQA 3BKYL 4LLAA 1BECA 4XX1G 1G7QA 1CT8B 3L1OL 3KPOA 3DSFH 2YK1L 2X4OA 4D9LH 1T6WA 4O2EA 2A83B 5C3TA 2P8MB 5E9DB 4DTGL 4L29A 4Z7VE 4KI5C 4BQCA 3O2VH 4PBXA 1T2QL 1ZLUK 5ISZE 1BPVA 7CGTA 4OLXH 3BMVA 1RIUL 5FECA 2P1YA 8FABA 4LRNH 1ZWIB 1J8HD 1P7QD 2O61B 2Z8RA 5IMLA 3MNZA 5E2JA 2HMID 3NCJL 2CKNA 5HHNA 1RJZA 3I02A 2WWMC 1FNGA 1E6OL 2PO6B 1HIML 3UBXB 2KPNA 1K4CA 4ZFZB 5JHLH 3GEWB 1ZLSH 1U91B 1RUQL 3FN0H 3FFCA 2GSIA 1I1FA 4LIQE 3P4MA 2GY5A 5DQJA 4P5TC 4P2RB 4FQIL 1EXUB 1IKFL 4M61B 1G1CA 5C07E 5E7BA 1WITA 1K3IA 1CN4A 3C87A 1AP2B 4HKJA 4WUKL 2P24A 1HE7A 1B3JA 3SBWA 2W0FA 3RUGF 2ESVD 4Y19D 3VXSA 5EULV 2ED7A 3HLAB 2F5BH 4MA1B 3IT8D 5DJ2B 1N64L 3EFDH 1WICA 4L4VD 1EHXA 4JY4A 4D3CH 4TNWK 3L3GB 4HKZA 4XP4L 1CR9H 4OD1H 1ORQA 2RFXB 4R0LA 4QRRA 3KLSA 5LG1A 4J23A 4IIQA 1ROWA 3BW9B 5KG9B 3VRIA 2CO7B 4GBXB 2GT9A 2NR6D 5ELIA 4HWEH 2ZG2A 4YXHH 2WINA 4LLMB 1ZGLA 1Q9KB 3O11B 3MRGA 4K7FB 3KXFD 3FJTA 2FX7H 3EIFA 4EIGB 4ZFOB 4DUVA 4NM4H 3C6SA 4NO5B 4MB3A 3KDMB 4HHAB 4LLWB 1CLYH 4OLVH 1VEMA 2NNAB 4FQ1H 5IROC 3AU1B 2M2DA 5T3XE 1E0OB 4N90D 1U3YA 3FB7B 4MA8L 3B2UC 4HXAH 3WEXB 1IAKA 2CLVA 5AWNL 4JY5H 5ENWB 1NGXA 1IC4H 3SE8L 5ALCL 1MAMH 1A3RL 4KMLB 1KELL 1KCUL 3K2MC 3DBXB 3TH4T 1XGUB 5ID0B 1KB5B 5ITBH 1AJ7H 3Q6FA 1D9KA 1RZFL 3E6HA 1MWAH 3SPVA 3RY6A 2OL3H 3MROB 4I2XE 4IJ3B 5HHVL 4NQEA 4NQVA 3HUJE 3VFOB 2H32H 1HYRC 2VL5A 1GGBH 5F1SA 5EBWB 1LO2L 3EO9H 5IB4A 4JPWH 3RA7H 5EC1B 3I6GA 4KKAD 5E99H 3T1WA 2UZIL 4IS6A 1MJJA 1FZMB 3PWPE 2MTPA 3U9PL 4DWHA 2N56A 2CRZA 3VD3A 1J0JA 5L88H 2VXVH 2YPLE 1MQKL 3D18B 3SCMC 1CK0L 5F1IB 2P8LB 5DJ8B 2GK0B 4G42A 3OMZA 5KVFH 4D9QE 4CJ1A 2X4SA 2VO5A 3MYZA 5TF0A 3VXRE 1CBVH 3FFDA 1BZ9A 2GCYA 3JWNC 1C1EH 1NC4D 1UQSB 5IBUG 5T1KB 1PKOA 2XQYK 4Z7VF 3RDTD 4Z0BH 1QPPA 2QQKL 1FRGL 4RWHA 4EIZC 3EW3B 3TN0B 2BVPB 5F3BA 1T0NA 1D5ZA 2LU4A 3AB0C 1E6JH 4R4ND 1DQML 4Z95H 5DJZB 1WTGT 3MV9B 4M1CD 4NYLA 3VWKB 4XMLH 1JBJA 3SDAD 4D0CB 4Z6AT 2R2EB 1MCOH 5FCUH 4YEEA 4W6WB 3G6AA 2HKFL 1HOCA 1T3FA 4PGDA 1YY9C 4Y4FB 2WWKT 1FNAA 4NO0B 5D1XD 4XT1C 4I0PD 1MVUB 1P7KA 4QY8B 4HPYH 2JK5B 2DLIA 1Y6KR 4U1MB 4JDVA 4IMLA 2VR9A 1CGYA 4F37K 5I17B 1KCSL 5D1QB 3X3FH 4TN9A 5TFSL 2XKNA 1UB6A 2R4RL 2Z93A 1MCKA 4FFZH 1LNUA 3KAAA 1K5NA 4P23A 1XH3A 1I3GL 1OGTA 4KJPC 1N59A 2OTUB 3HS0B 5D8JL 4KQ3H 1HKLL 3G6JE 1B4JL 5EZOH 3PJSB 3ZHKA 4YK4C 4IRSC 1NAMH 3Q48A 4LVHC 3SGJC 1LP9B 3N1PC 1KCRH 3MODH 1HQRA 3EO1B 2V9TA 4H1LA 1N7ML 1NMCB 5J56B 1BM3L 1WZ1L 3RWGA 3QULB 1ACYL 4KK8C 5GISH 3WKMH 4OM0L 4N0FB 1C5CH 4RWYH 1GZQA 4H88L 3DYOA 3FT3A 2A38A 3GMRA 4N9OB 3IF1B 3O9WD 3WFDH 4JEGB 1KN4H 3RL1B 4LEXL 4HS8H 5C08A 3IAQA 3QNXB 3UDWA 1X7QA 3C60A 3TBVA 5E5RB 4FNLH 2F5AH 4ZUVA 2VABA 3D3VD 2IFGA 3TJHD 1UA6H 4KXZH 1JZ7A 4PRHB 2VLJB 1B0RB 1IM9A 4LNRB 3MJ6A 3PIQB 4RAUB 5HPMB 2B7DT 5I6XC 4R90H 1PG7W 3QWOA 5A16B 2MQ3A 2YD5A 2LQRA 3GJFK 3D2UD 1ODAA 4YH6A 5GS1B 5I71C 5KSBE 1AQDB 1KPUB 2BNQA 3FL7A 5AZ2L 2QEJA 4POZD 4KVCH 2BSTB 4QXWA 5HHQB 3DURB 1UM5L 1WVZA 1RUAL 4M1DL 3RWJA 2EC9U 1Q72H 5C09B 1F3JB 1UH3A 5FYKL 1DQJB 1QSVA 5T1LA 4YHLL 4XC3L 3A67L 3RJDA 5F1NA 3EYOA 1GXEA 4GRWB 3GMNB 5HHOD 2J5LB 3IVKA 4JO3L 3SE3A 1H15B 2GYSA 1JWSA 3OG6B 5I1CL 1G0DA 1XCTA 4LIQH 3TJEH 4APQC 1HHHA 4UB0L 1CYGA 4HUVA 2CRIA 1KBGL 4N8VB 1DBML 1NH6A 2E7BA 3GMPA 3GMMB 4MCYA 1GRWA 3HR6A 5HPOA 2FEDC 3X17A 4NNXB 1NFIB 1AGCB 3BD4A 2XZAL 1TQBC 4QOKA 4DEPB 5HDQL 4IRZH 3V0WL 1RHHB 5DK0B 4CU7A 1DP0A 4DAGH 4M6ML 3PWUB 4LKXB 4MD5B 2VTFA 4B7LA 3D6GA 3QEHB 1J0YA 4XPBL 2DD8H 1IGMH 1DBKH 4R2GD 1VFOA 1AGFB 4GMSL 1TMCB 3P4LA 5MI0C 5C07B 2I5YL 3NAAH 4OFKA 3B4NA 3QG6A 3IAPA 4HH9A 1JPST 1YEDB 1Y6MR 1WQVT 1Q9WA 4JFQB 2GTZB 3DVFA 4U05A 1X5YA 1FH5L 1A5FL 4QRSB 1JUFA 2E9BA 4XPGL 5IHZB 1G6RL 3LKOB 3IU4H 2JCCE 3EZ8A 4YX2L 3RAJL 3HAEA 4OLZL 1ZOXA 2YD8A 3GBMH 4U6HB 2HLFC 2X70B 1NLDL 3NZ8A 1QSED 3LV3A 5LXGL 2ZUYA 4S1RL 3PG2A 4Q2ZB 4EVNA 4ZXBC 3BWAB 1A6WL 3CD4A 3SDDC 6CGTA 4M8QB 2AEPL 3ETBF 2J8HA 5T3XH 1OB1A 2OI9B 4HWNA 4L3EB 3MUZ1 3I85A 4P9ML 3QDGA 3CDGA 1KIQA 5F7WC 1VGEL 2W9DH 3C09B 4NM8H 4AYFA 4MCZA 5IVXB 2XZZA 4F80A 3R0MA 1VFBB 3HC4H 2KZ1B 5E2WH 4EI6B 4EN3C 4L5FH 2A6KB 4XNZB 3OKNA 4IRJB 5C0ND 3LZFH 3L3IB 3SY0A 4OUUA 4MNGB 2X9WA 2NQCA 3MRQB 3I75A 3BDBA 3L7EB 5MEQA 1CQYA 4I9WD 3TBYB 3U0WL 2OQJA 3BUTA 2FO1A 5A2KH 4PGJA 3HI5H 2FZ3B 4PJ5A 5LAXB 2Y25A 1EGJH 1BOGA 4LDOB 5CIPH 3GSOA 4F58L 1BEYH 2YSSA 1CZ8H 1FFOA 2Y5TA 5HI3C 1MELA 2NXZC 1H5BA 2D7OA 2GKIA 4DZBB 5B21A 3HE7D 1P4LB 1IEHA 4KUZL 1NC2D 3DO7B 4QRPB 5F3HB 4JFDE 1VFAB 2CDGA 3EJZD 4P3WA 1P5VA 1TNMA 4NQCE 43C9A 3LS5L 4PTUB 3HUJB 4OQTH 1OGAE 2JLLA 2A1WL 4X8JA 5J13C 3ARDA 4HIXH 3HG1E 4U33A 1TNNA 4K7PX 1M71A 4GAJL 3KG5A 5ERWB 5J0BA 4FQHA 4PJIE 5ADPL 3VMOA 1MLCB 2AJYL 2EDQA 4PJ7E 5ESQA 4LRIA 5ECJE 1TJGH 3IFLL 4U7MA 4V1DA 1N6UA 4ZQKB 4M43L 3ARBC 4AMKL 2GHWB 1L6XA 1AFVH 4F8QA 1G7MB 1FZKB 4GAFB 1HSAA 5DQ9B 3RGVB 3U6RB 2XG5A 1C08A 3OR7B 1YNKH 5IMMB 4Y4KA 2ZNWA 5FGBC 5GZOD 5KN5A 1P1ZB 1A3LH 4J1UA 3T1FA 3UTZA 3MLZH 4GLRI 5HJ3A 4I18B 5L2KA 3DUHA 5DVNA 5C0JB 4C4KT 1S9KC 1QSFA 1CTOA 4FG6C 1XF4A 3TVMA 2XKUA 4WHYG 1GGTA 4PYHA 4WV1A 3C6LC 2Q6WB 3VXMD 5MEND 4DVBA 1I3RB 3VRJA 1T21B 3RTQB 1S7RB 3BSZL 3WFEH 1I9JL 3MYJA 1GPOL 4NKDA 4LLUB 5CD5D 3L5XH 3CPLB 2FL5B 5C86A 3STZA 2H6PA 5D6DC 2QHRH 1JPGB 4I3RH 3RZCC 3ULUL 3CZFA 3DGCR 2EKJA 2IAND 4CVUA 5D2LB 3U0PB 1BIHA 4UQ3A 3BQUB 2CDEB 3LKSA 3FQTB 3B9KB 3ZDZF 3WLWD 2F58H 4Y4HC 1V7NH 2C4XA 4PJDB 4U1SB 3TFKD 4FMFA 2BNRB 1AGBA 1T1YB 3CFCL 4MHHI 1LO5B 3RNQB 2F74A 1IGYB 2APVA 4MJ6A 3U7YH 2H2SC 4GG6B 5JORB 3L5WA 3KYOB 3LB6D 5D1ZB 5GSRB 3ZSTA 1N5YL 1Q8MA 5CP3A 5EBLB 4H8WL 4FQLL 4XCFH 2DTML 2OZ4H 5IKCB 4LMQI 2ADIA 3O41B 4JCLA 5BRZA 2PYFA 3QWRA 4HWBL 4PJXA 5LGHL 5EU5A 4YDIH 3UTTE 3T04D 4HMEA 1CL7L 1ZHKB 4YXLH 2IPKB 4ZOAA 2MKWA 5CGYC 4BUGA 2FLRT 3NGBC 3UJTH 1TCRB 1W0VA 2IBBA 1U6AH 3I6KB 3N9GL 1JNJA 4JKPL 4WEMB 1JGUH 2YD6A 4Z7WE 2NTSP 4AEEA 3WN5B 3U0TA 1OTSD 4YAQB 1P4BH 4KTDL 4ODUA 3NN8B 5FYLD 3QUXC 4FXLA 5GS0L 3EDEA 4I8DA 2GJZB 4UI2A 3CMOH 3WFBL 1JZ8A 4LPWA 1LQSR 1AXSB 2HA1A 1UXSB 15C8L 2AV7B 2GJ6E 4CRPA 5BMFH 3EDDA 3IDYC 4X4YA 2CIKB 2PYEB 1XGQA 1MI5D 2VQTA 1MPAL 4AJ0A 3NZHL 1A6PA 4RFOL 3P30L 5DR5L 5J1AA 5ID1B 3CGTA 4YZFE 5DD0H 1D5MA 4MNHA 1V7MH 3M17B 4N9GB 4NCDA 2X42A 4MWFB 3CXHK 1V3JA 3QUZA 1L4IA 3PWLB 1OWRM 2YPVH 4HUXA 2VUOA 4PBWD 1BVLA 2PTVA 4PJIF 4JFXA 1IAIM 1L0YA 2WNGA 4XP6H 1G9NL 1BD2E 3ARFD 3E6FB 4XC1L 1BHGA 4Z7UB 1T20A 4FXKA 4PJGA 4H20L 3W2DL 1WBYB 1INQB 4CN1A 1I7TB 5EA0H 4YE4H 3WFZA 1F6AA 3QIWD 1WZKA 3I9GL 2YZ8A 4JM4L 2B2XL 4F7MB 3Q1SH 4Y5XC 1SEBB 3KYKH 4O4YH 4OFDA 5E2UL 2JJWA 2ZSVB 1D5XA 2QR0B 4UILH 2R8SH 5C0AA 2V2XA 5JW4N 5EU7C 2IWGA 3MRMB 2IH1B 2ZCHL 2FO4A 4LP5A 5C9JB 3V95A 4S0TD 4XPAL 3MRNB 4J3TA 4QT5A 3AAZA 4JN1L 4OCRH 1P9MC 4LQ1A 1T5WB 5KTEH 2V7NB 4ALAH 4YFLI 2EEAA 3O8XB 5EO0A 1QFWL 3GSXA 5LGJB 4HWBA 4MDIA 4PJ8D 1CIDA 4K94L 1J05A 2DQFB 5IFHH 4RRPA 3KWWA 1V3LA 1A1NA 2UYLB 1E4KA 5BS0B 3OGOE 3QR2A 4U1LA 3BDYL 1A14H 3TGXA 1KLGA 4IM8A 3VE0A 1RZJH 1A21A 1F4WL 1FLRL 3PWJA 5E08H 2V17L 2LVCA 4OF7A 2CLZA 4ZSOA 3LSOB 3O6LL 5JXEA 1D7FA 1I7UB 2EYTA 3IS0X 2VDNL 1T7WA 2HJFA 5GS2H 3E0GA 3FONB 5IMKA 5HGAA 5CEYA 3MBXH 1OAZL 1HI6A 4ELMB 4M6OL 3ZL4H 4Y5VA 3MX0A 4M6NL 3F7RA 1RMFL 1H3UA 5J06A 4PJ9A 3JV4B 3IDUA 4QHUA 4U1NA 1T5XA 5I1IL 2YPKA 1MHCB 3BH9A 3ES6A 4OZFG 1R5VB 5TDPB 4LCCB 1KB9J 2WV3A 4BA8A 1NCWL 3JUYA 3IETB 3SDCC 4OCSL 3RL2A 3CCHB 3FB8B 4DKEH 5SWSD 3G08A 4NGHL 2EC9T 1Q0YL 1EK3A 2C1OA 2LAGB 3VXUE 4PLJC 2CMRH 2QKIA 1NCAH 4GRLC 5FCSH 1NFDF 5DA4A 2EDBA 4WTXA 4NWUH 1Z3GL 4KI1A 3TBTB 5F1OB 1EEZB 2YWYA 4AEHH 4XPHH 3SE4C 1KULA 3UBXG 1K6QH 1YEIH 4HJ0D 5KVGL 2ATKB 2JELH 3TYFB 1OP3K 3UTSB 1HXYA 4I48B 2PTUA 4XXCC 2I07A 4NKIH 3WMSA 4XRCB 1N4XH 1KEGH 1LO3L 2QQQA 1T89C 3FMGL 5I74B 3DYPA 4CVZB 4WU5A 4CN4A 4HIHB 5F89A 4M7JL 1OAQH 4FP8H 4LCUB 1X4ZA 1J8HA 5F7EH 4ODBD 4RQQB 5K93A 2AI0L 4HLJA 3V5HA 4YDJA 3WUZA 1QLFB 2G60L 3TNMB 2BXZA 1WBZA