4M4RB

Epha4 ectodomain complex with ephrin a5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
141
structure length
141
Chain Sequence
AAAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 4
total genus 29
structure length 141
sequence length 141
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4m4rB00
4ZK8A 2GHZA 2PP9A 2PPEA 1ET8A 1OCCB 1XB8A 4L0PB 1L9RA 2BHFA 1BAWA 4YL4A 2ZXWB 4G7SB 4HIPA 1JZFA 3QJQB 3S3BB 1W6WA 2IAAC 2IDSA 1IBZA 2XLLA 1EHKB 4F2FA 3TBBA 4HAKA 1AAJA 4A2FA 3NJHA 3BQVA 1RZPA 2EINB 4AX3A 1PAZA 1PMYA 2YAEA 3T6ZA 2DV6A 1AZNA 1PLAA 1KGYE 1ASQA 1GR7A 1CUOA 2W8CA 2PPDA 3DKHA 1ET7A 1BEXA 2YAHA 4NERA 1PZCA 3T6WA 1GS7A 4HCFA 3IN0A 2AANA 3ABKB 3AG2B 1GSKA 3ASNB 4UAHA 3WKPA 3NT0A 1JZEA 5B1KA 2YXVA 4A2EA 2BP0B 4E9TA 4HZ1A 4PCYA 3N55A 4W1TA 1MZZA 3H4FA 2YAPA 3NP3A 4HCGA 1SFDA 4FAAB 2XV0A 3JTBA 1FA4A 2PP8A 3WNIA 3U25A 1AIZA 1PLCA 2NRDA 3OMIB 5D4JA 4M3HA 3X2QB 5ANHA 2BP8B 3HB3B 4YSOA 3NJJA 1ASPA 5B1JC 2VW6A 1AANA 3FQ2A 2FWLB 2IWKA 1NWPA 2PLTA 3PAZA 5I6NA 3TU6A 3NSYA 3C75A 2J55A 4KO6A 2UX7A 2I7OA 1WS7A 1V54B 3X1GA 7PCYA 1JXFA 2UXVA 1SHWA 4YSEA 1XB6A 4E9XA 3ZX1A 2TSBA 1OE3A 2N0MA 1JZHA 2DY2A 2FTAA 1JZGA 2DWTA 2BZ7A 2QDWA 2YQBA 4NAJA 4YSCA 1JXGA 1KV7A 2GSMB 2OJ1A 3OQRA 2GC7C 2FQFA 4WKXA 1ADWA 2BO0A 5IY5B 1I53A 4WTQA 4YVNA 4P5SA 2FQEA 2XX1A 3T9WA 5AZUA 2PPAA 4E9SA 1QNIA 1NZRA 1NICA 2PP7A 2EIMB 2H47C 2IDFA 2IH8A 4YSQA 4ENZA 1OCRB 5TK2A 4Q8BA 1GY2A 4YSUA 2IWEA 1BXUA 1BQRA 1SNRA 4KOBA 4YSRA 5B1AB 3NJLA 4W9ZA 4YSSA 4AKOA 3T6VA 2BP8A 2EIJB 1JZIA 2MTAA 4N8UA 1TU2A 4A2DA 3UGEA 1E65A 2EIKB 2GI0A 4BWWA 1PF3A 2VM3A 3NJFA 4YSTA 1E30A 4A67A 2YAQA 5B1BB 4KNTA 2EILB 2QDVA 3AY2A 4GP5B 3ABLB 1E5YA 4MFHA 3NSCA 4E9RA 1J5CA 5B7MA 3OMAB 3AG1B 4RH4A 2VMJA 2W88A 4DP1X 1BYOA 1SF3A 5AFAA 1CYXA 3PCYA 4YSPA 1E67A 2RACA 4QKTA 4E9WA 3X1BA 4TXVB 1R1CA 4KNUA 3WI9A 1BXVA 1GYCA 3DTUB 3PLYA 1CC3A 2HRHA 3NSFA 2JXMA 4A2HA 4UANA 3S8GB 2JKWA 3UADA 2UXFA 3QQXA 2ZWNA 2QPDB 3CVCA 2DYSB 2XYBA 1KYAA 1L9QA 2UXGA 1AG0A 1M9WA 4G71B 2CALA 3SBPA 3V9EA 2FT7A 2IWFA 2PPFA 4G7QB 2BW5A 3ERXA 2HXAA 4G72B 1BYPA 1L9PA 1XMEB 2IH9A 1NIFA 3IEAA 1ZPUA 2HX9A 2GB2A 4E9VA 3ZBMA 1W6LA 2BW4A 4BWUA 2GIMA 1NDTA 3FSVA 3QPKA 2E86A 4AZUA 4FA7B 3EH3B 4DPBX 2Q9OA 2VW7A 1OCZB 5B7EA 3OD3A 5LDUA 2H3XC 1ZIAA 2J57A 1AOZA 4N4YB 1PNCA 3EF4A 6PCYA 3FT0A 3RYMA 3SBQA 1NIBA 1PZBA 5I5MA 4BK5C 3ZIYA 1PCSA 9PCYA 3N2JA 3ABGA 3GDCA 1OOWA 2A3TA 1ILSA 1SF5A 2BZCA 3FQ1A 1NPJA 1M56B 1ZV2A 3QJSB 1DYZA 2CJ3A 4DP5X 1A65A 1ZIBA 1KCBA 3S3DB 3FU7B 1KDIA 3NP4A 4K9JA 2HLEB 5AKRA 1QHQA 1WA0X 1NIDA 1OE2A 3FSZA 4KO9A 2J5WA 3NJKA 7PAZA 3AW5A 4DP0X 3WIAA 2AFNA 1WA1X 2AZAA 8PAZA 2XUWA 3ZDWA 3CDZB 4CSZA 3S8FB 1AS7A 3EH5B 2X87A 2P80D 3DIVA 4HCIA 4DP8X 1BQKA 2HX7A 1PLBA 1W8EA 1AG6A 1FFTB 2IDTA 3H56A 3UAEA 5I28A 3H4HA 1ZDQA 1ASOA 2FJSA 1OV8A 2OV0A 5I26A 1B3IA 2YAOA 2FNWA 2JFCA 1OCOB 3KW8A 1KBWA 2CAKA 4CSPA 1NTDA 3L45A 3WKQA 3UAAA 2Y69B 3CVBA 1HAWA 1V10A 3NJIA 3TASA 1IUZA 1FWXA 5A7EA 2VM4A 4E9YA 1AS6A 2ZOOA 1JXDA 1J9TA 3JT2A 1KDJA 3NJMA 3IBOA 2BP0A 3PPSA 4PAZA 1SJMA 4GXFA 1BXAA 2TSAA 1J9RA 1ILUA 1SFHA 3OMNB 3FU8A 2BWIA 2LLNA 2P80A 1TEFA 5B1JA 4QLWA 4DP2X 1IC0A 1JOIA 4AI7A 3WG7B 3QJVB 5I6KA 1VLXA 1AZRA 1TKWA 1XB3A 3EH4B 2XV3A 2GC4C 1AZCA 2CUAA 4BWTA 1JVOA 3WNJA 1F56A 2HX8A 4JHUA 4X4KA 4F7KA 2J56A 1BQ5A 1GW0A 1IKOP 1OF0A 3FQYA 3FPXA 2FQDA 4M4RB 5PCYA 4DPAX 4YSDA 3G5WA 1PY0A 1OE1A 4Q89A 1M57B 2CBPA 3QJTB 2UX6A 3FU7A 1PZAA 2AVFA 1IBYA 2YARA 4KOCA 1MG3C 1AS8A 3D12B 3SBRA 2MRYA 3S3CB 5I6MA 2BWDA 2QPEB 2WO2B 2I85A 1A8ZA 3FU9A 2HZHA 1GS6X 4A66A 1A4CA 4GP8B 1HAUA 3FPYA 1L9TA 4DP7X 2YXWA 3HEIB 1J9QA 4DP4X 2XXFA 5I6PA 1MZYA 3EHBB 1SDDB 4KNSA 2PCYA 1TEGA 3AZUA 5F7BA 1AZBA 1N70A 4JKNA 3FSAA 1HFUA 1GY1A 3V9CA 4P5RA 5I6OA 3QJUB 3OM3B 3CDZA 4E9QA 1N68A 1A4AA 2OCCB 2PCFA 1KBVA 1NIAA 5E9NA 4A2GA 3IE9A 3X1FA 4HHGA 5F7AA 2WO3B 4G70B 4NB7A 3TA4D 1J9SA 2XX0A 3SQRA 2UXTA 2B3IA 1NWOA 2VN3A 2XU9A 2VW4A 3FYEB 5TK4A 3QJRB 2HRGA 2YAFA 1ZDSA 2DYRB 3UABA 4GYBA 4A68A 4AKPA 2R7EB 1CURA 3FSWA 4DP9X 1SHXA 1MG2C 2VSMB 1T5KA 3AG4B 1X9UA 2H5UA 4KO7A 1J5DA 2AZUA 3X1NA 3MBWB 3PXLA 2XXGA 4YVUA 2VSKB 4YSAA 4JHVA 3ASOB 4EF3A 3TBCA 1ET5A 1QLEB 4F2EA 3GYRA 1EZLA 4DP6X 1L9OA 2FQGA 3MX0B 2XWZA 3NJNA 5FC9A 3CG8A 5B7FA 3PAVA 2IDQA 2FT6A 4GY4A 1RZQA 1NPNA 1YLBB 4HALA 4KO5A 3GXUB 1WA2X 3NSDA 1NIEA 2Q5BA 3BVDB 1GS8A 4AKQA 2DWSA 5B3SB 2GBAA 2X88A 1RKRA 3NJGA 1AQ8A 1ID2A 1KCWA 1RCYA 1V55B 3IN2A 1WAEA 2B08A 1JZJA 3CVDA 1UATA 2I7SA 6PAZA 1WS8A 2WSDA 2Y1AA 1ETJA 5EHFA 5D4HA 2R7EA 4GP4B 1A3ZA 3ABMB 3T71A 1URIA 5D4IA 2XVBA 1AZUA 3T6XA 2QT6A 3FYIB 1X9RA 2ZONA 2XV2A 1NINA 3KW7A 4BDVA 1A4BA 4BXSV 2YAMA 5I5JA 1DZ0A 4DPCX 2IDUA 2FT8A 3CZUB 1JERA 1L9SA 5PAZA 5I6LA 1SDDA 4BXVA 1AR1B 2CCWA 4BDVB 1AACA 1CYWA 1PNDA 4HHWA 5I5IA 3FS9A 3AG3B 3NYKA 3UACA 1E5ZA 1JVLA 2PPCA 4UF7C 1MDAA 3X1EA 3PAUA 4G7RB
chains in the Genus database with same CATH superfamily
3QWRA 2KYIA 2PPEA 3EFFA 3OB8A 1DSFH 4FQCL 4I18B 4QRPB 1UWYA 1NAMA 1PIFA 3VXRB 3HAEA 3FQXB 3EH2A 4FJ6A 4NO2B 3V0WH 1T20B 4AQAB 1MW2A 3I75A 1ORQA 1CE6B 1NCBH 1PD6A 5C2BH 3H6AA 3QXUA 3VXME 5K9QG 3PDGA 2XWEA 5BPPA 1GHFH 1CD1A 3D3VE 2I5YL 4PTTA 4HJSA 5F7MC 2X2JA 2Y36L 5FYJL 4JM4L 5IBTH 5F7HA 3SOBH 4JO3H 3NJHA 4JDTH 4DOHE 5KSAA 4I9WD 1GZHC 4LOVA 1TJIH 1X9LA 3GXMA 2CDFA 4M5SA 5TF1L 3A6BH 3MCYA 2AJSH 1T03L 4AYBA 4FQ1H 1E28B 2D8KA 4IRJC 3GSNL 4C56B 5I16A 2BMKB 1HDMA 3RAJL 3QEQE 1L3NA 2YAHA 4GRMB 5FYJE 1UYWL 4J3OC 2A4EA 4M5YL 3MLTB 1HHHA 2BHZA 1OAUH 4NFDA 4URKA 2B59B 4QRTA 1EEYB 4LVHC 3BP7A 3SSGA 1KGWA 4IU3B 4JPVH 3BH9B 2BP0B 4MRCA 1F4HA 4AL8C 1F3JA 3M17A 4U3HA 1X5FA 3IFPB 3OB0K 4LLQB 5DO2D 4PB9L 5I71B 2QADD 2JKLA 1PJ9A 2Y2WA 3JTBA 2QPFA 4OZIE 1PLCA 2K7QA 1RV6X 2V37A 4L5FL 4P3DB 4OLYL 2NSMA 2OS7A 5D4JA 1J1OH 3MX0A 3X2QB 3Q3GA 3VWJC 4JN1H 4WEBH 2BP8B 1I85C 4NQUA 1N7ML 3TN0C 5ICZA 2WBJD 1H19A 1MHEB 4NZRL 1UGNA 3FQ2A 3QEUB 1LP9A 3NSYA 1UWGL 4Y9GA 3KPQB 3L5HA 4A04A 1PBYA 4Y5YC 2C26A 3X1GA 4WI8A 2VRAA 1VFAB 4GSDH 3DSNA 4FCHA 4O02H 4XN7A 1XCXA 3PGCB 2BS8A 3IDNB 3OHMB 4CRPA 4YLCA 3K74B 5D7LB 1TZAA 1YN6B 4M43H 5IMOB 3BE1L 1OAZL 1OWWA 2IMMA 2AABH 2OJ1A 2A6JA 3CFJB 4P46D 4WKXA 3VQ2C 2X38A 4MLIA 1N5AA 2QHRH 3C60C 3QA3B 5CILL 4WTQA 5SWZE 1GZQB 3U1SH 4F80A 3LS4H 4XN8A 5JQIB 1EEUA 5MEOA 4KK8C 4MKMA 3MRJB 1KELH 4TNWK 3ZZQA 3WTUA 5KVDH 3UJIH 4PJCB 2BOCB 3T2LA 3GSWB 4PGZA 1Z5LA 4L29A 1A66A 5EWIH 1MXGA 2Q8AH 1FLRH 1UH3A 4AEFA 2DIAA 4AE0A 4GKSB 1LK2A 5B3JE 4UAOC 2VAAB 5JUEH 2TRYA 3GBNH 1JF1A 4X6EB 1WG3A 2GY7B 3CFKA 4NUMA 3SDYL 2XWXA 3BPNB 4FMFA 1XH1A 25C8L 4YXHH 1JV2A 4YHOH 5D93C 3AY2A 4GP5B 4I0PC 4XODA 1MAML 4K71B 3OF6D 2F54A 2BSDA 5DUBA 5ICXA 3OMAB 3TP4A 1AYRA 2R27A 4RZKA 4KXAA 1S9KC 4PEEA 5C9KA 3WTSA 4DP1X 3BIBX 5CD3A 3WY2A 5E6IC 4KI5C 5A2CA 3QEHA 1MIEL 5DO8A 4DH2A 4H8HA 3D85B 3FU5A 4ONGL 5LGHH 4NQCE 1DFXA 5I0VA 1T3FA 3RU8L 2MWCA 4AUYA 3WFEH 3QUKA 4ZSOB 3FJTA 5F89B 4AUJA 4FQXD 2HRHA 2W07B 3IB4A 4IGBA 2VDKB 2XSKA 1GMIA 4XAKE 1J1XL 4U05A 2EDFA 1AQDA 3STLB 3G5ZB 1MLCB 1MFAL 1XF4A 2VC2B 3ARTA 3LZLA 1PKQE 1V27A 2ZAHA 3B6SB 4HUXA 2QV2A 3OBAA 3FO2B 4G9FE 1EDHA 2CKBA 4BFOA 1OEZW 2PW2A 3TBTB 2IPUG 4Z0BH 2X6VA 1EJOL 2EIDA 1BYPA 3G6JA 4HXBL 5ADPH 3IEAA 1UVQA 5J5EA 4YHZH 1BX2B 3ZBMA 5KBMA 1A0QH 4YQXH 5I1DA 5KYWB 1EFQA 2RBLA 4YK4B 3QPQC 4G1MB 2FK9A 3IFLH 1OARL 5FWRA 3W39A 5T1KB 6PCYA 3H42L 3JZYA 1HESA 4XWGL 5AVWB 3SBQA 4DUVA 2VLME 2PCPB 4PJAA 2F7QA 5JHAA 1IE4A 1SGKA 4FTDA 1UWFA 3N9GL 3TM6A 1DYZA 2V8LA 1WUZA 4UOQA 4JFZH 3S3DB 1SDAB 2WNKA 1KDIA 4AG4L 5HYQB 4HT1H 1FAIH 1FO0A 1NIDA 1QHQA 3CLEH 2MPVA 5AD0A 3WLWD 1MCWM 2C9RA 2J5WA 2XZCL 3NJKA 3NIFB 4OF3A 2V7NA 1XIWA 5GGUB 2WUCL 4KKCD 2YQ3A 3BVUA 5IJKC 5CLWA 5JORA 3CVHH 4M7LT 1HZLA 4M8UA 1SVCP 3SO5A 3JTSB 4K5LA 2P80D 1KB5L 5D2LF 1YEGL 3S35H 2HYMA 1TQWA 1AG6A 3ARVA 5CSGA 3DO4A 3JV4A 4JPKH 2JI3A 4XE5B 2DEXX 2CZNA 4N6RA 3KL5A 5I26A 1B0GB 2NQ3A 3UBFA 1QZ1A 5I76A 4LCCB 4U6XA 4XC3H 2EE2A 2Q3XA 2PCPA 4RX4A 3BW9A 4ZO7A 4A7GF 2I07A 5FM5M 3X11B 1Q1JL 2FJGA 3FUEA 3QAZB 4DCQB 5F96L 5L9DH 3BWAA 3WXWH 5DQJB 3LKPB 4JJOA 2WQAA 1VB9A 2WLKA 3QDGD 3O6LL 5GGTH 3UGXA 4WI9A 5C0EA 2A77L 2EIZB 3L5WA 1A4KB 3LVEA 4LLMA 4PY7B 4GXFA 1MCSA 4NDMA 3WU1A 1J9RA 4UQ9A 3L16A 1MCJA 4MNGE 3DK2A 2A9NL 4DKFL 4ONHA 4ELKA 3T1WA 4JFWA 1N67A 4LCIH 2DM4A 4MNHA 3HPLA 1NGYB 2LLNA 5CP3H 3REVA 5TFSL 5HDBB 3MRHB 3WMQA 2Y7SA 3FOMB 3BIAX 1RVFH 5SWQA 5KYXA 5DD1L 4JO2L 4MXWL 1YMME 2YPVH 3H54A 1MFBL 1XB3A 3CX2A 5FYKD 1NUFA 1PZUB 3BUIA 1G5GA 2HX8A 4PP1D 4OJAA 3Q9QA 4YDIL 3FQYA 3BKML 4GSQA 1X7SA 3UTQB 2F1BA 5K1VA 5IOKA 2RFXB 4EDWL 2R2CA 4JKLA 1Y07A 5E8NB 2DKSA 5F3HB 2B1HH 3MCG1 5JZ7D 2VDPH 3ROOA 3U6XA 4WHCA 4XX5A 5I15H 1K8IB 4GAJL 1RZIA 3MO1B 4HIXH 3I74A 3LEVH 1P7QA 3B7UX 3GI8H 4FFVD 1MWAH 1UG9A 2KZBA 3MV8E 1FBIH 1I7UA 3I9AA 4XHQA 2YPKA 5JHDD 2RQEA 4M6ML 1CDHA 1GW6A 2GTWB 4LVNC 2E9IA 1G6VK 3VFVB 4GI9A 5EPMA 3QR1A 2DQ6A 3MLRL 4FC3E 5FV2A 4K73A 4LB8A 3CDZA 5G5DB 3QUXA 5IFJA 3SZKC 4NUGH 1I1AB 2NUTB 3BOVA 3IE9A 4FXTA 4N1CA 5DD6B 3CK0H 2A1WL 4Q6YA 1C08B 4FG4A 5EN2B 2GSIA 2X4NB 3K4AA 5FOBA 5L7XL 4IHOA 4WFFD 2KERA 4R3SB 4GG6B 1MW1A 3ESOA 3PL6C 3STLA 4IOIB 1HSBA 4OGQC 1IGYA 4XO5A 3SE6A 2Q2EB 1MCLA 5LXVA 1ZPLA 4M1DL 5IEHB 2Q3ZA 2G4EA 4HMDA 3HRZB 3H55A 3F3HA 2ADFH 5D5ME 1LO5B 3SPVB 2MNWA 1IARB 4KXBA 4PVBA 3MTRA 1NUGA 4DWHA 4HIEB 3GRWL 5DURB 3OJDA 1Q9OB 2O30A 4YSAA 4YS4A 3ASOB 4I4WA 2A38A 5FFGA 1KGUA 1E6OL 4DP6X 1DDHB 3KLKA 5ERWA 3O3AB 3DI3B 4OLYH 2HFGH 4QIRA 4WU7A 5GGQL 1F4XH 1KIUB 1UM5L 2AJYH 2ESVB 4G5ZH 4KPHL 4QRPE 4X0KA 3WJMA 1YEKL 3FCSB 1YLBB 2YBRB 4L4VE 1MFEH 3VD5A 1IZKA 1LK2B 6CGTA 2OL3L 4LLQA 3HKZA 4ONGH 3SJVD 1ZA6B 1FIGH 2I5YH 1MCKA 1XSJA 2WSPA 5IBTL 5D5MB 3BH9A 3NMEA 3SE9L 4JQIA 2VR9A 3NJGA 2RH0A 1FV1B 1EEYA 2BOCA 4U1MA 4Y9BA 4IS6B 1HHHB 4WGWB 4XMWA 5SWSD 4J3TA 2C4FT 1JZJA 4BEIA 2WZ0A 3MI6A 3GMMA 5F0JB 1UATA 4C56A 5I16B 3GSNH 1E28A 1H15A 2AAVA 5TH2A 4EI0A 1P69B 2J12B 1QVOA 3U9WA 5GS1C 4XPTL 2VQ1B 3M1OA 2B7DT 2XA3A 4ZJ9A 2VXQA 2BSTA 4QNPE 2P44B 3DHUA 3OX8B 4LHUB 1X9RA 3PGCA 3WGVB 4R7NB 4PI0A 4CJ1A 1U8LB 1L4IA 1N59B 2QVFB 3VDBA 4HSAC 2O6PA 2Q3AA 1LWRA 2YGPA 1A4BA 2NTFB 3MLWH 3LMJL 3BLKA 1CE6A 2YXMA 2QVMA 1K4CB 4JPSA 4DPCX 4YHYC 3RKDC 1N6VA 2FIRT 2E6PA 2OSWA 2JK5A 4NN6B 1ES0A 4YHZL 1N4XL 3B9KD 2ARJA 1V7NL 4OSUH 3UTTD 1WZAA 4BXVA 3RUGF 2F58L 1NQBA 1CGWA 3V8OA 2ZWKA 1H8NA 2R1YB 3IS1X 3O4OC 5I5IA 4N8CH 3GBLA 2ZNXA 4HKZA 4KZCA 3D51A 1M7IB 1PU0A 3CFUA 1AY1H 4Y2NA 3LKQA 5DEFB 4QAWA 3RI5K 3GMRB 4ZK8A 3LPGA 5E6YA 3C09C 5ANME 5EU7C 4BYHA 2AK4B 3CAFA 4HA1A 4IDJH 3R0MA 4L0PB 1PG7L 2ODHA 3NSXA 1BAWA 1UENA 3HN3A 4U0RB 1DUYA 4U1SA 3QQNA 4BZ2L 3WJLC 4OCSL 1FZKB 2OYMA 1WEJH 3E1ZA 4PRDA 1QUNA 3QORD 3CN2A 3BZFB 5IJDC 3CUPA 3L6FA 3BFQG 4QTFA 1VFBA 1EBPA 1FI8C 3IXTB 3E9UA 4LIQE 5DFWH 4F2FA 5I23A 3PJSA 4HAKA 4YXKL 3GB7B 1Q1JH 1U21A 5JOPE 3MNWA 5E24E 4ADIA 3VGGA 3MODH 2CDFB 3T8MA 1MCQA 2GQHA 5FKAB 4WI7A 4QT5A 3JQOB 3ZE0E 3LVTA 5EEWA 5DMKB 1S46A 2IFGA 1IGFH 1X5MA 2CJUL 4KK6D 4R96B 2X6UA 3SKJH 1GR7A 4G9DB 1QSEE 5BS0A 1LP9F 1BEXA 3GXDA 4P23C 4KTYA 5IB5B 2Y22A 5GGRA 1AFVL 4HCFA 4GI6A 1C8QA 2JVUA 4NQDB 4QHKI 4P48A 4AQAA 5FM5O 3N40P 4ETQA 4XX1G 4PRIA 5D7IA 4UAHA 1VRSA 1NAMB 4GBXD 2WIIB 4O2CB 4Q97A 3MREB 3O2WH 1KB9K 4G80A 4H1LB 4HIIB 2WANA 4EN3A 1HHJA 3VI4E 2A74A 3VG0H 5L2KA 5KSVB 4LP4A 4L5FE 4XNUH 2WB1A 2Z31B 1OAKH 4H40A 4JZNA 2OMVA 2E7DA 4XBPA 1BMGA 4AM0A 2R8SL 3P3YA 3A4FA 4RDBA 4G5ZL 2XKSA 3OKEB 4F1SA 4Y9EA 3KPRB 4ALAC 4RGMB 3Q01A 5FUZH 1XL4A 4NC2B 4NO3A 4LPVA 4MJIB 4PJEF 2FWLB 2IWKA 4HLZH 4Z3HA 4NOFA 5AYUL 1V05A 5CCHE 3TC9A 1EDYA 3EJQA 5EBWA 4YN3A 1VEMA 2ZAIA 3HNSH 2PN5A 3I9GL 3K8MA 4L3EB 4NQEA 3UZEC 4TRPL 1IGML 2OCJA 5KZCB 1BCIA 2X3AA 3D25A 4KJWC 2ZSWA 4LLVA 5HY9A 4AVHA 4MAYB 4X2UA 3ZX1A 5IOPA 4U7SA 4DK3A 1T6WA 3PWNA 3WD5L 3NRFA 1F45A 3QZBA 5AQ0A 2ZKXA 2BNRA 2DIBA 5F7WC 4AQOA 4QTIH 2H1XA 2RQ8A 2ZCLL 1CXLA 4HH9A 3NCFB 3D07A 3OQRA 3U82B 4X9GA 4KTGA 5CMAB 4NP4L 3DX7A 1NGZB 3Q0HA 4WGVB 4XN2A 2P5WB 4DERA 1G6RL 5BOJA 4A6YA 5LVEA 1IM3D 2PP7A 2CUMA 1B2WH 3N41B 5DWUL 4OFPA 5DD3H 4K8RH 4ZS6D 3W81A 5LGHL 2VDQB 3L3HA 3PDOA 5ABDE 5E8OA 4F33A 3LRSB 2JLLA 3RZWA 2XIDA 2W0FB 2QZ5A 4QHLB 4YXLH 5AOJA 4KI5E 1KB5B 4C56E 5CJ5A 3HZMA 1S7QB 2WVVB 1LQSR 3WIHL 3BZEA 1N18A 4CDGC 4DFIA 2H0EA 3I6KB 3WAJA 3K8LA 1BQHG 1AXSB 2YRLA 5DHVH 1BQHA 2RACA 1QABA 4FYQA 3GGWA 4AC2A 4E9WA 4H25A 3L4YA 1B6UA 1FYTB 3U0TB 3QEGH 4GMTL 3UEZA 1CFVH 5T33L 2Y5TA 1BXVA 3MLXL 1MRDH 2CGZA 3MLZL 3RQ3A 4A2HA 3FQ4A 3GMQA 2JKWA 3ZHLA 1WTLA 3I6KA 3B34A 1AD0A 1DVYA 1NMAH 4X7TA 1ZKAA 4DN4L 4LHJB 2YD5A 3SBPA 4JG1L 3SQBB 3QQ9C 6TAAA 1GTFA 2XWDA 1U58A 3I3BA 3UJTH 3ERXA 1DQJA 4QHUA 1ZD6A 5IVXF 4DK6A 1C12B 3GHBH 4G2AA 2IXQB 2GIYA 1L9PA 3LPFA 5EORH 4G7YL 4D9LH 4OTXL 3QFDA 2BW4A 1KB9J 3QG7L 4OAWA 2JB5L 4OCXH 3WDJA 2C3VA 1CDUA 5BS0E 2CM5A 1LEKA 1RULH 2QPUA 1TEYA 3LQMA 1P4BH 1RI8A 5HJDA 1PY9A 4M7JL 1ECYA 2DLFL 4AIXA 1U8CA 4GXUM 3GDCA 1IKFH 1F90L 1SUJA 4TV3A 1P7HL 4IBYA 1SF5A 1YAIA 1LD9B 3TGXA 2IQ9H 2CJ3A 1E4WL 2X4OA 3MUUA 4A7GA 4W4OA 4WNSA 4UNVA 4YDJA 3OLEA 5FDYA 1J5OL 5IOPB 4KO9A 2HCZX 5HDBF 2IWGA 3DX2A 4FKKA 1TTFA 3TF7C 2YJQA 1XF1A 3BMWA 2GAZA 3FRUB 1JGVL 1A6TA 3F04A 2CRMA 4S0SD 4GW5A 1U8NA 3PV6B 3EH5B 4D0BA 4HMCA 4NO3B 1YYMH 32C2A 5DT1H 1L9MA 3SE4C 3DPBA 4KQ4H 3VM5A 3HE6D 5E6UB 5D4QA 4Y9FA 3VGAB 5TFSH 4YXKH 3KW8A 3PL6D 4XB7A 3IGKA 1CGXA 1NTDA 3TEWA 2Y69B 1UCBL 1FYTE 3SKOB 1CMOA 2EXWC 4RBPK 3IJYB 4MD0B 4JPIA 1EXUA 2IAMB 2X7LB 1P0SE 2XPGB 4QRRD 1N2RA 5D7IB 5F9OL 1P5UC 2BINA 2BOBA 4RMWA 2D9QB 3AWGA 4L8SA 3VAEA 4YDIH 1RP8A 5F1NA 5ITBH 4H2AA 2VRKA 1J0JA 2FBOJ 1U30A 5IW6B 1EFXD 3KXFB 1KFAL 3MDJA 4JG5A 4OIFA 1E6JH 1KTDB 5IKCB 4YBQC 2JE8A 3U46A 2Y7LA 1GZPB 1IC0A 1PDKB 5ICUA 4QLWA 3QQ9D 1HHKB 1AO7D 2PW1A 1DE4B 3P0VH 1O9WA 4N0FA 2A9DA 3QJVB 5GZOC 4UZGA 4L2LA 3H7LA 4OD2A 2J5LB 3ZMRA 2Q0ZX 3EH4B 3ZDXE 2DQDH 4S1RL 5IR1A 1MFAH 2BH0A 1JVOA 2DM7A 4EDXA 4GW4B 1NEPA 4BH8B 3CUPB 5PCYA 2IALA 4AUUA 3S8WA 3ZDYB 2D0GA 4YSDA 1LGVA 3CDFA 3WKYA 4Q89A 4OZFG 2D3VA 3BCFA 4H8VA 2VAJA 4WQOA 4K7FA 1DVFB 3MRLA 2CMRH 3QNXB 2IGFH 5HYJB 1NBYB 5I6MA 3QNZB 4TUOA 4KROC 3VGHA 2QFPA 5FPIA 1GYVA 4LK4A 4TNEA 3ZGIA 2OK0H 2E7HA 4HKZB 2Y9RT 3SPJA 2WXJA 4JB9H 1NDMB 3K3QA 3SDXB 1JGUH 5M7QA 3I9PA 2AQPA 2P46B 4PJBF 4DP4X 5FB8B 1I3UA 1MZYA 2MNJB 4KNSA 2WZPD 3PUUA 3QYMA 2VDLH 1KGCE 1G9HA 2XQYG 4LF3B 1ANUA 5I18H 5F7DA 1ES0B 3VD0A 1Z5HA 2GW5A 1HHGA 2DIEA 1X3DA 3PF2A 4OFQA 4K94H 3OLDA 4L1SA 2V9RA 1RLWA 1UC6A 1FAIL 3CLEL 4M00A 3SQOL 3FB8A 1CO1A 1V3MA 3UC0L 5DHXB 5KOVC 1UWEH 3WY4A 4CMMA 4AWJC 4IGBD 3DO7A 2VQ1A 1D5MA 4HWBA 4XO3A 1RJCA 3SQRA 3IDJB 4R4NC 1GGYA 4ZS7H 3TIDA 1NWOA 2XU9A 3FYEB 4K3EH 2WN3A 1H15B 4LFHG 3U4KA 3BXNA 3RZCA 2K6YA 4J4PC 1MEXH 1IQDA 1KPRB 3CMOL 5F70A 3WTXA 1C5BH 3BSZH 2VSMB 1QSFD 3OKLA 4W6YB 4JAMA 4I9XA 5KVGE 1ZHKA 5I1KH 2YOCA 2H6UA 4HUWA 2N01B 4RWYH 4PJIA 2YD0A 5BQ7A 5CZRA 2FGZA 4BFEA 5JOEA 3HE6B 3FT3B 4TVUA 1J05A 4BZ2A 1UJ3A 4K3JH 1EBAA 1QLEB 1I7TA 5J1AA 1CE1H 2Y1VA 4PJ7A 5T5FL 4Q9QL 2B4CC 1YNKH 3R06A 5FDWA 1SM3L 3N3EA 4XN4A 1HEZA 4X0KB 1GZPA 4JR9L 4CU8A 3FBKA 3MBEA 1ZTMA 5E8EB 1UASA 3FDWA 2MQ0A 3SPGA 1DBBL 1M1XB 1DDHA 3AGWA 1IBHA 1U3JA 4LLWA 1BJ1H 4PJIE 3R7QA 3WY1A 4DN4H 1KZQA 4O4YL 4AYDC 5F8RC 1NOAA 3NZHL 5AG8A 3AU1A 4L8SB 4WFGD 5B3SB 3Q2LA 2NW3B 1RKRA 4HF5L 1E5AA 3IJYA 3MRDA 1CFQA 1BOGB 1YEWA 1VGKA 4XC1H 4H8UA 1KB3A 4YWGH 1WAEA 1XGPA 3LB6D 2EUVA 1WUNT 3HS0C 4GAGH 5I17B 4LVOB 1SYSA 2AGJL 4RMBA 4Z7QB 4R90H 2WSKA 1MEXL 2AJXH 4EQ3A 3IXAB 5GHWL 3WLBA 4HIJB 1JD9A 1QFWM 3L3DB 4LFHD 4PJ8D 1HCZA 1QBBA 3N1PC 4S11A 3EOBB 3VM7A 1ZT1B 1RH8A 3T08A 1RIVH 4KH9A 5JYLA 4D0BB 1CFBA 5E4AA 4LSRH 1HJBC 5LNGA 3QUXB 5GGTL 3D39E 5I8KH 3KWWA 5EPMB 3B37A 5FEBA 1U9KA 3MLWL 1QBLL 4WWKD 1JPFB 3FH8A 4A2LA 1T1XB 1MFDH 3EYSL 4AMXA 1D9KB 1R3IH 4WEBL 1T1WA 1LD9A 5D71H 2CIIB 4DNLA 4ZFGL 4ZMLA 1H5BC 1ZS2A 1CLOL 3S5LG 1ZA3A 3QEQA 5CJBA 3TFKC 4R4FH 3ZTEA 4FLOA 1XHHA 5TQ0L 2WZAA 1A3RH 1AIFA 1JVLA 1FCGA 4FADA 3DMMB 1LE9A 2XJLA 4V1DD 4YIQA 2GHZA 1EAQA 1V5JA 2R69L 1I9IL 1KUMA 1QLFB 2CIKA 2BHFA 3QQDB 3BH8A 1FH5L 5F93C 3P9WB 1C7SA 4LEEA 3QEQD 3O8XB 2GABA 2XWCA 3DOSB 2ZT9C 3IETA 4XCNB 1HXMA 3BP4B 1DANU 4FFYA 5DA4A 3WFHA 4OUUA 4QXVA 5IHZA 4M4RA 4MA8L 3LH9A 3MUJA 4LKXB 2D7TL 5JQ6L 1EHKB 4FFZH 1OPGL 1TQCC 3B8SA 3FKUS 1QW9A 2DJUA 1GVIA 3GBML 3NAAL 1HL8A 3NFNB 5IW1B 1R5IB 1XH3A 3HTLX 3H2QA 4M8QB 2EINB 1SXCA 3E8UH 6FABH 1ETZA 4YFLF 4G6JH 2VMFA 4R6UA 4KXZI 3IE4A 1TOXA 4DZBB 2DV6A 1HH9B 1B4TA 1XSIA 4WLCA 4I77H 2VH5H 1E6OH 1EGJL 5KYYA 2DN7A 2KL6A 1HWHB 1T5XB 2CLRA 3AT0A 2WAQA 2ATAA 3F2LA 2FECI 4Z3EA 3G08A 1PZCA 4G7VL 1GS7A 4E41D 4KMTH 1FYTA 3U0TA 4KKPA 2EZ0C 3KLHD 3WS3A 5DJ8B 3FQUB 5IIEA 1AXSA 2HKHH 4NUGL 5CKAA 1X5IA 3BPOB 4PCYA 1NCGA 3FN0L 5AB9A 4HGWA 4Y8DC 3MBWA 1KY6A 1S7QA 4M29A 1KGXA 2FJHA 2M1KA 4QTHA 4MAYD 3MRQB 2OX5A 4BUQA 5DEJA 3RG1C 3KL0A 5ETUA 5G4NA 3VFNB 3JWNG 1QO3B 5D2LE 5FS5A 1KFAH 4Y4HA 2DKMA 1OM3L 2V5TA 1THAA 4Y5XA 3VJ6A 1OARH 3HB3B 3I3DA 2HMIC 4CSSA 1EO8H 2WLZA 2PCXA 5MP6H 2Y3AA 1ERNA 5T1LD 4KO6A 1PX4A 3DV4A 2ZOLB 3W5MA 3FT4A 4GXVL 3PQYE 2R4SL 4KTDL 4MNQA 2UX7A 2DW5A 3VGEA 1KYUA 5GGUA 1JXFA 3BVNA 3QUZB 3WFCL 3L5IA 2JCCF 2BNQA 4D7BA 2ADGB 4GAFB 4Q6IC 5D1QD 5FHBL 3TL5A 1E5UI 1E9PB 4NFBA 2CXGA 2CO1A 3D69B 2L7QA 4XCYA 4KVCL 4S1SH 4KZEH 1ZJAA 2P43B 5DJCB 5JMOC 1DEEB 2EP6A 3FHQA 4R0LB 5JXEA 4NN5B 4EKJA 1T04A 1D6VL 1XQ4A 4HKXB 4ZOAA 2RD0A 3POHA 3PWNB 3VXNA 5JO5A 4W70A 1LO3H 2ZXQA 5EBMA 3NBNA 2H32A 4QR7A 4GJTB 5C08D 1WDAA 4IRSA 3RVXC 2JIXB 1WFIA 2OYPA 3QZMA 5EDXA 4HQQH 3P73B 2N4IA 5DUPH 4I8DA 5JR1L 4GSDL 4M61B 5B1AB 1YRKA 1UTDA 2K4WA 4NN5C 4YSRA 1HOCB 4MJ4A 1VFUA 5I24A 5I1DB 5HPMB 2VDRL 1WWWX 2V2XB 3EGXB 2MTAA 3LN9A 2C3GA 2BCKA 3SGEI 4LMQE 4AM0B 4RVBA 4RETB 4MYWB 4MCZA 2V2TA 1AHWC 1JWSB 2XZCH 2P8PB 5KYUB 3QORB 3W1ZA 2YAQA 2YS4A 2UUDK 1THCA 3IMVA 2YA1A 2ADYA 5F97E 1CXEA 1J5CA 4LEBA 4Z18A 3MV8B 1U8QB 3ARBD 4X9HA 4Y7MA 2E4FA 4JM0A 3IF1B 5DI8B 2G9HB 4ZSOA 1A2YB 1QX1A 2EDKA 3U4BH 3BUPA 1ESOA 2EDQA 4OCYH 1CDGA 3I2CL 5I8CB 3AITA 1QATA 4XNXH 3DTUB 3PLYA 3CFMA 2JXMA 3CMOH 2O5YH 4MX7B 5KOMC 4WO4A 3ULSB 2A6DB 2DYSB 1IEBA 3WCYA 4P23D 4GKZB 3B9KB 1WHOA 4QT5B 1UWXH 4NO0A 4AQ1A 3BFOA 1O7VA 1JV2B 5KN5A 3T3PB 3U0WL 2PYED 5EB9A 1X5AA 2HXAA 4FHJA 4K5OA 1MI5E 4NEHB 1FFNA 4YPJA 1HSAA 3HMXA 1LO2H 2ZXDA 3SJVA 4PWKA 1B6DA 2GB2A 4RGMC 4GSUA 4HU8A 2SEBB 1HI6A 2D7NA 3FSVA 2EKJA 2NY0D 1BDYA 5JPNC 2Q10A 1DUYB 2IH1A 1R3KB 2WPGA 5B7EA 3OD3A 1AGDA 4G6AC 3T4YB 4BZYA 2XCMC 1E3ZA 2YD2A 2WXQA 1RUMH 2B4CL 3VFWB 4BK5C 2ISDA 1U8IB 1ZJBA 5I8KL 2PUQT 1NCWH 5IK3A 2FYYB 1DSFL 3UTZA 4WWPA 4LSSH 3KS0H 2BY3A 2BIPA 4ZUVA 5TE4H 3MJ8A 4HXBH 1ZWIB 2N7SA 2P5WE 3TJEL 1IT9H 3EDJA 3OG4B 4DFHA 5JMRA 3HAEG 1N3NA 2G60L 5D7LA 4HUKB 3LSOA 3UAJC 2EADA 5DJ6B 5HVFB 1UXMA 3IDNA 4ZTPL 1OE2A 3FSZA 2JK5B 4U6YB 3SO3C 3T04D 5C0JB 3FTYA 4JM4H 3C5ZC 4Y4KD 1A1MB 4AZ8B 1HILA 2AEWA 1R75A 5HJGA 5GS0C 1UD4A 1FFOA 3X17A 3VQ1C 2FE0A 4A7TA 1MW0A 2X0WA 4HV8A 4J3BA 3U4EB 5BCAA 1OCWL 2X87A 3DIVA 3QQ4B 4JQVA 4CL7A 3V0AC 3ARBB 4W81A 1GPOL 5E03A 1YNTA 5DHVB 3ESUF 3Q3GB 1LO2L 4U4IA 2A9CA 4KVNH 4AT6B 4P5KB 4TMPA 4NO5B 1TMQA 4Z7QF 1UEMA 3FZUD 5FHAL 3B3IB 1JUFA 1AQMA 4UQ2A 3NZUA 2FNWA 4ZQKB 1BF8A 4I0CC 2QV4A 1KBWA 3JTTA 1CN4A 5IMKB 1CLYH 3UAAA 1RIUL 5IB2A 4Z7AA 2B1AL 1U8IA 4K7PX 5ISZE 3L7FA 2VM4A 3QUYD 4YE4L 1QBMH 1XEDA 2HVJB 3ARFC 4IU3A 4XC1L 1JF5A 5D5MA 4X98B 1V7MH 4PJ8A 3PWUA 3DRQB 3GIZH 3L7FB 4F8PA 5FGSA 4EUPB 1NFDF 4TF4A 2J3SA 5LJYH 1AE6H 3RWJA 1UACH 2OTWA 3FCTB 4M1DH 5BZWB 2I27N 3AY4A 2E74C 2LW3A 1HDMB 3OR6B 1M05B 4N90D 3CE1A 5A2BA 1ZVNA 2ESVA 3DYOA 4PV9A 5E6ZA 3VWKD 1VKXA 1NMCB 4HWEL 4DIXA 4JO2H 3QUZC 4KDVA 3LOWA 3CFIC 2J8HA 2A6IA 3SDYH 4AGQA 2W80C 4WWKA 2J8UE 3MYZA 3QQ4A 2LHAA 5C9JB 5KSAC 4E9LA 3L2NA 4UBDD 4X42A 1ZLSH 2X9WA 5T3ZE 2I9TB 4EJ1C 4TSCH 1F56A 4WW2B 1Z9NA 4P46A 1OF0A 1OK0A 3OGCB 3LS5H 4IQHA 9CGTA 1ZEAH 3O6FB 2OAAA 1U3HD 1KTRL 3ULUF 2CBPA 3EO9H 2UX6A 4D9LL 3ATBA 4U1IB 1XD1A 4HHAB 4IMKC 2Y23A 4CUCA 3MV8A 3O2DL 1LDPL 3UTOA 5EEUA 3D12B 3S35X 3SBRA 5D1ZB 1KBBA 3ATFA 1TQBC 4GIPD 4GG6A 1SQMA 2VCOA 3EYOA 3P11L 2P8PA 4JPWH 5KVGL 1DLFL 4MCZB 4JDEB 3HW7A 4MZ3A 4JFVA 1TQTA 2VJ0A 4JM2F 5CZVH 2WLJA 1QSFA 1JHKH 3BHBA 4IYKA 4L3EE 2BCKB 5JXAH 3K71A 2LFEA 3A0OA 3BPCA 4ZW6A 2DQHL 1TEGA 2JCCA 1FAKT 1WISA 2AS5M 5GGVL 2GTWA 1UACL 1XGUB 4UCFA 3FSAA 3ML8A 4HW6A 3TBSB 1MCBA 2FZ3A 2OJZL 2YEVB 4G59C 4MAZA 4E9QA 2OQJA 3UOAB 4UT6A 4Y8AA 1KXQA 1MFNA 1CXKA 5CINH 4EE2A 3X1FA 4D8OA 1I9JH 4N8VB 4AQEA 4HJEA 4O51A 3PWVA 5CUSH 3TA4D 5KN5B 2X6BA 1Z9SA 4EUPH 5DJCA 2Q20A 1FRGL 4MXQC 4PJGA 1FYHB 5GSVB 2N1KA 4WO4B 1KEMH 2WIMA 4MX7A 4HC1H 3JSSA 1SHXA 3VXUE 4XNYH 2WP3O 5DGQA 1A21A 1E4KA 4ZPTB 1E2WA 3S37H 1NCDL 3TZVD 4FQIL 2G9HA 2VZUA 2ZOLA 4HG4K 3MV7E 1U3NA 4UQAA 2MCG1 2HT2D 2XQBH 5AOKA 1II4E 3MLVH 4Y5XB 1CG9A 4KAQH 4AEIL 3B9AA 4OCRH 3T77B 2XWZA 3QORA 2F5BL 4DETA 1VCAA 3CC1A 4HJTA 4EXKA 5FW6A 4H44C 4PYGA 3KPMA 4UZSA 4ZMYA 3ZK0A 2OI9C 3F00A 4IM8A 3UBHA 2MPAL 2R29L 2WZ5A 4WJKB 4X99A 1YEDB 1KMGA 2HA1A 4ZFOB 3LNGA 5BUAA 1XGRA 1DQVA 1N12A 2EYRB 5TDOA 3QFJB 4M61A 1OPGH 3Q06A 1UD6A 4PGBA 5D1XA 1KJ3H 2V5MA 2X88A 3LKPA 5CZXD 2WYTA 4PV1C 2QVIA 5DJ8A 2CKNA 2ERJB 3WS3B 5IJCC 4J3XA 5I1AA 2LE9A 5IQMA 1B9KA 4LEOB 4NJAL 4IRSB 5C0RH 4PJ9D 2XYCA 4EVNB 1DBKL 1T66C 4P2OD 1AI1H 2WXHA 4RGNB 4CA4A 2CLRB 2ALWA 2ITCB 3GTTA 4ZW7A 4U6XB 4PGDA 4Q4EA 4PW9A 1O7DC 3ML9A 4LBEB 5C0CD 2WKOF 5D4HA 5GZNC 4UT9A 3JWOC 1KTKE 5AAPA 3HC0B 2SODB 4DGVH 4CC4C 2O5XL 4N85A 4M8QA 3H3PL 5J56B 1UGKA 4KHXL 5EOCH 4MCMA 3FYIB 2BNQB 2R56L 1T4KB 3IYLW 3RP1A 2VE6A 4NUJA 2AQ2A 1IM9B 5JA9A 1NBVH 3BGMB 4DZ8A 2VR6A 3FT4B 4AEHH 5TJWK 5DMIL 2R9HC 1IL1A 3MRGB 3DPDA 2DQUH 2OR8A 5C3TA 3ROLB 5GS0D 5L6YL 3B2DC 3S9DB 1P6WA 2BSEA 4M3KB 4APXB 3EFOA 3WTWA 1E4XH 5HYQA 2AC0A 1QLFA 4KXZH 4OT1L 4S2SA 4TL5A 1SBSH 1IL1B 2XI9A 3MRGA 3KZ8A 1LILA 1LDSA 4GG6F 5ITFB 4CVZB 1AACA 3QFGA 2EO9A 3C2AL 4Q9BA 1ZCRA 1JE6A 2Q87A 1QUPA 1CPUA 3ULUC 3D85D 3WFDH 2F53B 3BIKA 5AOIA 4HIXL 3KWVA 3RIKA 4CMHB 2OFQA 4Y5YA 1EK3A 5ILTL 1JV5B 1OCCB 5DMJB 2RJMA 4UTBL 2AQ3A 3RWHA 3L4XA 3OKDA 1AHKA 4PS4H 2Y1ZA 2YFOA 1ADQH 1C7TA 4O5LL 5I5RA 3MFFB 1IBZA 4XPFL 2G3XA 4GKLA 3UMNA 1L0PA 1T5XA 3OL2A 4XBEL 1U4EA 5CO1A 3ZKNC 2XWBA 4YE4H 4WJ5A 4GEIA 4A2FA 3K6SA 4OGAD 4FRWA 4NN7C 3Q5OA 1PQZA 3BRDA 2BFGA 3PWPD 1DCEA 5TQ2H 4F3FA 5AW4B 1SN2A 1I1YA 5C0ND 1J10A 1XF4B 5CS7A 2FGWH 5CCGE 1WICA 3L08A 1AQDB 1DQKA 4FI7A 3MBXL 3CD4A 3MMEB 4IGBB 4G6FD 2CHZA 2E27H 2Z8RA 1YNKL 2PPDA 4C47A 1RIHL 4XVTH 1IRAY 4G8IB 2B1HL 4DKFH 4NNPH 3HUJB 5HVWA 1ZHBB 1R5VB 1RK1B 3DOSA 3ILEA 3P0YL 2X44D 3VXUB 2Z8VC 2QQLH 3CQQA 2UWEE 4FNPA 4TUJB 3O41B 2BSRA 3WKPA 3K0WA 3NT0A 3U48A 4XN1A 2WP3T 3D18A 4JRXB 1MHHA 2HKHL 2JJVA 4YIQB 5EDSA 2KQNA 1BA9A 4JHBA 5SWZA 5EIVA 4FAAB 4NQXA 3NEOA 5CJXA 1A1OB 2IJ0C 2CK0H 5C0AD 1G9ML 1OP3H 1BQLH 5HGAA 3ILPB 1J1PL 2GHWB 4H1LH 4PJGB 3GJFA 4JG0H 1UXSA 4Z9KB 5IV2B 2FX8L 1YPZF 2Y0SA 2GJ6D 5HYJD 1DVFD 1KENH 2WO4A 3BO8A 3HRZC 1JPFA 3X14A 2JSFA 5GRJH 1J05B 3EFDL 4F92B 1DQDH 3CDYA 4WSGA 3HMXL 3T0DA 3GSWA 2K8MA 5TDPA 3EJPA 1UQSB 5HDRA 3MOQA 5A2KH 3LX9A 1GRWA 3MRBB 3GMPA 3QIBD 1NLBL 4O2EA 2TSBA 1ZTXE 1BJ8A 3C5SB 3QJFA 2LV4A 1ZT1A 4NI3A 3RB5A 3SKNB 1XGUA 2YK1L 2WLHA 4I1RA 4L3CB 4J8RB 4HG4J 5F7UA 1OKEA 3TIDB 3C6SB 1SN0A 1JWUA 5IY5B 3IMUA 3DO7B 4NC0B 4NQVA 4P5SA 3M1BB 4FL4B 1HHIA 4NQCB 2MMXA 1CFQB 4NM4L 1KIPB 1TZOA 3II1A 2E9GA 3L5XL 3HE7A 3LNHA 4ENZA 1GA2A 1PZ5A 1RUPH 2X6MA 5F9WB 2NXZB 4L0ZA 2JQAA 1GY2A 1HHGB 4TRPH 3T1FA 4CU7A 3TYFB 2OZNA 2Y24A 4PRPE 4G3YL 4ABWA 1I9IH 3T8XB 4FXGA 4HWBL 4B7IA 2BP8A 1T89C 3WNLA 4K23H 4NWUH 5JTWA 1VGEH 3WEOA 4OI7A 5DJDA 2MTPA 3OGCA 3QWNA 1D7DA 2CGRL 2FJFB 3BRGC 3L3KA 4WW2A 5LBVA 1HEZB 4XAKD 1RIVL 1Z3GL 2MIZA 4KC3B 4XWGH 4TL4A 1G43A 1NAMH 2E46A 4X9FA 4QRUA 5J3HD 5LBSH 1MI5B 2HFFB 3CX5K 3QUYA 3QIUA 2YD8A 4L1DA 2XG4B 4E68A 1CF1A 4XP9H 4HX1B 4OBRA 1S8DA 3CWGA 2KQMA 2ZX9A 4K8RC 4LBAA 4OZ4B 1OW0C 1MCOL 4BH8A 3QCTH 4JO1L 4UV4L 2QQLL 1DO5A 3VH8G 4XNYL 2IEPA 5J6GA 2A99A 5TQ0H 2GTZB 4KUZH 3V9EA 4OLVH 4KY1L 5CHNB 1HHKA 5K9JL 3HI6H 3V6ZA 5CNHA 4HOMA 1W0YT 2EE3A 1J5HA 4K9EH 1ZPUA 1TCRB 1D5BB 1TU2B 2HX9A 3WEAA 4JDVB 3DIDA 4WI0A 4QHMB 3RVUC 4P5KA 1QEXA 4K94C 2IO5A 5JXEC 1A6UL 1QNZL 2OJZH 5KAQG 5JIKA 3W9DA 2GCYA 1T20A 1UXLA 3JV0A 4FA7B 2BOBB 1MFMA 1CJYA 1IC4L 4ZTOH 2H3XC 3FTSA 2X9XA 4XPAH 3EF4A 4ZO9A 5A1AA 4JPIB 3FN3A 2D7QA 2WINB 1PZBA 4QXGH 3L2LA 3IJ8A 3QDGE 5HHOA 4CW1B 1U8MA 5T8IA 4F24A 3G6AB 3MA9L 4KTDH 3VFTA 1FRGH 3TVMB 3CSPA 3EBHA 4U6YA 5G4MA 1E4WH 3PWLB 3ZMNA 1ILSA 1YN7A 2C9XA 3HS8A 4BH7B 2Z3FA 1PAMA 4PRAB 4AYEC 5GGTA 3C6EA 3CFCL 1H8OA 4IRZH 4NRYB 2FHBA 4D0DB 3GMOA 3SDXF 3ZT7A 3BSGA 1LP9E 3PV6A 2FIKB 5AW6B 3CZKA 5EU7E 3RY6C 4EI5A 3PHQB 4Q6KA 3ECBB 1MUJA 1J11A 3ZW3A 3V52L 5BV7C 1CTNA 3SYOA 4NQSB 4FYRA 1TPXB 3QDME 4DP8X 3SE3A 2ILLA 2XN2A 4YDJB 2NY6B 1NAKH 4J2XA 4Y4FD 2SEBA 2ICWI 2PW1B 3IPEA 4LESA 1JGLL 1UURA 2JB6A 1GC1C 1EQWA 1PDKA 2OMTA 3WENA 4EI5D 2OV0A 4TKWA 3KPSA 1D5ZA 5BOZG 3QDJE 4FDWA 5BS0D 4J4PD 3HFFA 3S5YA 1DJWA 1AO7E 4U3XA 3T6QC 1C16A 4HLEA 4XGZA 1AS6A 1RERA 2ZF9A 2ZOOA 1KCKA 2YO3A 4FTVB 3K72B 1GAFL 3ISWA 4PR5A 3BMVA 2JKTM 3PNWA 1I8MA 3GIVA 4TULH 1BXAA 3V8CA 3MYJA 2Y72A 3P2BA 3QG7H 3QFDB 4KY2A 3RGVD 3KWXA 3VFGH 1WAAF 5I8CA 1P5VB 3EYVB 3FCGA 3QXVA 3E2HB 4P99A 3TN0A 3O9WA 2W5PA 3LJ3A 5GS2H 4L4VD 4XWOC 3HG3A 3LD8C 3SQBA 3VXMA 3GMNB 2BIIA 1OP3K 4XHJC 1AZRA 2KZWA 3ZRFC 5E6IB 3EJYD 5L7XH 5D96B 2F8OA 1LE5A 3K4DA 4ZSOE 1BIIB 3KR3L 3SPHA 1HKLL 3C2SA 1A6TB 3MCLL 3CSFA 4HLJA 4NGHL 4FXKC 1QASA 4MD5A 3BVVA 3OSVA 1DJIA 4P5TA 3IDIA 1A9BB 4JRYD 3TBYB 3CIQA 1BQHB 1HOCA 3FU7A 5F6HI 3OQ3B 3VTTA 2AVFA 2NW2A 4MJID 3POCA 1OTUD 3GXNA 4QUOA 5FGRA 3BZEB 5TPWH 2BWDA 4XOEA 4UM9A 2WO2B 2V7HA 2OK0L 2I85A 3P0VL 3UTSA 1MNUH 3QI9C 1IJNA 5F9DC 5AVQB 2B8OT 4A66A 4QJ5B 1JPSH 2XVLA 3OAZH 4P9HL 4XX1E 3MZGB 1LEKB 4HJ0D 1ZK9A 3HB3C 1NCOA 4K3GA 3HN5A 4EBQH 4WTZA 4YC2B 2J2ZA 2OI9B 4JKNA 4J23A 4NT6B 5IESL 2F5AH 2W9EH 2VXUH 2HN7A 4JFHD 3QIBC 3EJUA 3DDFA 2PR9A 4LPUA 4ZTPH 1Y18A 1WJ3A 3FFCE 1RJLB 4RZCB 4UT9L 3NCJH 2IANE 4FLHA 2BIQA 4QWWD 1CLZL 1UB6B 4NPKA 3QIWB 1FL5A 1KCSH 3LAFA 3HPJB 1I8IB 1DQTA 2R83A 2HRGA 3FW6A 3SPCA 2UVEA 1L6XA 1C9SA 1BVKB 1HH6A 2KS0A 4F2ME 5FYLL 3VI3F 2WGNB 3CVIL 1MELA 1T5KA 4S1DD 3GUTA 3S88H 4KO7A 4DVBA 5B39B 3X1NA 4Y2LA 3PXLA 4X4YA 4LCYB 3KWUA 3KPLA 4K3JL 4JHVA 4TTDC 3RWFA 3ZO0A 1V3LA 2VXTL 3TBCA 1MRFH 1XGYH 4OIIH 4OZGB 4L1HA 2ADJB 3FFDA 4BE5A 4H0HB 1YEIH 4UTAL 4JREC 2EDLA 1H0DB 3FB6B 4Z78A 4UTBH 4FZ8L 2Z31A 3VD7A 4JM2C 4KJQC 2XTJD 3CXHK 4HS3B 3DBXB 3EJSA 4HUMB 3LRSA 4F9PC 2VNCA 2VDQH 4H1LG 3ZHKA 2NY3D 4WFED 4UT6L 4JY4A 5K39A 5KUMA 1JHTA 1EHLL 4Y5VC 1P4BL 2GBAA 3F8UB 1YEEL 3K72A 3I84A 2R0LH 2D3JA 4O58H 1RCYA 5DHYA 3WTVA 4AEHL 5A3ID 3UO1L 5GS0L 4I88A 4WV1A 1HZKA 2VWEC 5IB5A 3J07A 5I18L 4ZXBC 1PG7H 1YNLH 3UZQB 2P24A 3H8NA 4BFKA 3KPSB 1QTYT 3HG1D 3CSYB 4KBPA 1WHPA 3KDMA 4G7YH 4G8EB 4KFMA 5CJOH 2WW8A 3V4UL 2E7LA 1B0RA 2KZ1B 4PJAF 2YR3A 4CC0A 4DESA 4PJ6A 5J12C 3TV3L 5E5LA 3SD2A 5D2NA 2NCMA 2DBLH 5BO1H 2VXTH 2CIIA 4LE8A 4FABH 2HKAA 1G7IA 5EBWB 4Z95L 2YMTA 2CO7A 3RL2B 3U30B 2R0KL 3ELQA 2ZOWA 1QRNE 1VEPA 3BPNC 5L2KE 2UZXB 5PAZA 2XWTB 5KYNA 4B7LA 4G42A 3BRFA 5LWYH 5GRXG 1Y6NR 5T1DL 3D2UB 3UTTE 4DEUA 3UACA 1CLZH 4HPYL 1QSEB 3X12A 3WIIL 1M3JA 5FW8A 1I3VA 5HHOB 1MDAA 3T8VA 3E0GA 3EOBA 2XG5B 1KYDA 3MRPB 5DVOA 5GS2D 1PCXA 2BLFA 4OJYA 1ET8A 4S10A 2MCMA 1LMIA 3L3DA 4XB3A 5MEQB 5E0QA 4X8JA 2CO4A 4N24A 4WI4A 2K6WA 3TJHD 3C60B 4HIPA 4WIQA 5DURD 3MR9B 5KJRH 4IIZA 3V4VB 5LLIC 5HXMA 2IDSA 4W4OC 3RVVC 2CO2A 4G6KH 3LKRB 3TO4D 3TX4A 2Q7YA 3MKKA 4Y16D 1UCTA 4ZFZB 3RB7A 4N2CA 4HH8A 5CGYC 2YGNA 4JFEB 5CHNA 5DMKA 4WDIB 4GQ9L 4OZFA 3LYRA 3VACA 5LGKA 3DV6B 2GTZA 4Z0BL 4F37K 4PWIA 2FB4H 4XCEB 4D0CB 5I30H 3HC4L 4P2RB 4YO0A 1BZ8A 1X5XA 2CK0L 1KLGA 2LR4A 3SDDD 1T7ZA 3SO3B 4YK4C 2CA3A 3OHXC 3QIUD 2MOQA 4G6MH 4I2XE 4NERA 1T89A 5IJVA 3IN0A 4G11A 3GTVA 3TTYA 1FZKA 4AIOA 2IOMA 3ES6B 2V33A 2XG4A 3ASNB 1JWMA 4A2EA 2CRYA 2YXVA 3HE6A 3EG9A 4YHNA 5G4OA 3FTGA 3THMH 3RX7A 1HKLH 2A7BA 2QQKL 5HHVL 1LNUA 4B0MB 3ARFA 1M71A 4U7KA 2A9MH 1MQKH 3DA0A 1U8OB 5IJVB 1BFOB 1IAIM 1FA4A 4WY7L 3WNIA 4KX9A 3WJJA 1HE8A 3OMIB 2FAUA 2HLAB 4V2BA 3ZT5A 1M4KA 4JQIH 3VQLA 1FGVH 1MAJA 3DV6A 3M7FB 4MQ7B 1ZS8A 5E9DE 3RFZB 4LP5A 2J55A 5HDBE 5EO1A 3ZUCA 3QR0A 3HE7B 4WWKC 3HMXH 1YEEH 4R8WH 5GRZA 3K2UH 2WXGA 3AUVA 3B9KC 3DRTA 4QGYA 1HHIB 2KPNA 4P2AA 4WFGE 5EO1B 2BSTB 1KPVB 1D6EA 4YGAB 4PCTA 1WZMA 3V5HA 2DWTA 5EF2A 2P42B 4X7SH 4RGNC 1KV7A 2D0HA 5B21A 5CEZH 4LAQH 2BO0A 5GHWH 2AABL 1AGEA 4L4JA 2GSIB 2X2YA 2X4NA 1OF2A 2DQIL 2XX1A 1Y0LB 5BRQA 2MJWA 4O2EB 3ZL2A 4YFLI 3QZLA 2FBJL 1O75A 4CILA 2EIMB 1I1RA 2DIJA 2IDFA 2BNUB 2IH8A 2X4UB 2E47A 1GGCL 2W65B 5TK2A 3ARGC 1UA3A 1KIRA 4UU9A 2IC2A 2CO6A 4GI8A 2I26N 1AKJD 1SOXA 4YHKH 1BXUA 1SMDA 1G4RA 1DUZB 1WZLA 3Q2CA 4DAGL 1FQ9C 2ZUVA 1WAAE 2K3TA 4AYID 1JZ5A 1YDPA 4C55A 5IV2A 1H9VA 2CO7B 4N8UA 3ZRCC 3ZTJH 5HGAB 5IESH 2NX5D 1WVZA 2EXSA 4U49A 4D9QE 1FG2A 2MSPA 3TYGH 1K8DA 3LXBA 5HGHB 3GXIA 4KHXH 1IQWL 5EOCL 1MWOA 4WTXA 1DTUA 1TSHA 2X1PA 3GLDA 4KI1A 4AJYV 3INUH 2QDVA 1NBCA 1N6QH 2FB4L 5TE7L 4XO8A 5B7MA 2OSLB 2WCGA 1H9DA 4K3HA 4PRHE 4YFDB 2ZUSA 5C6PB 1I31A 1KOAA 5AFAA 5IFHH 1KEGL 3CSYA 1RUKH 3VXUA 2RFXA 3HLAA 4TLUA 5LXGL 3H3KA 3NCXA 2L0DA 3LKRA 1D5XA 3LXCA 3L95A 1LO5A 4TXVB 4X5QA 4YHLH 4KNUA 3UTQA 4B50A 1OO2A 1L0YA 1YMHB 5CSBA 5ACZB 4X8GA 4Z3TA 3HRZA 1CC3A 3IDGA 4ODXB 1DBBH 3QQXA 5DD0H 2XPGA 2QGCA 2VJXA 2X7LA 5D2NC 3WHE0 1BVNT 4JY4B 5EC1B 4IHOB 3NVQA 1MF2L 2WC7A 5DD6A 1OTSC 1FVCB 2X4TB 5AB2A 4HS3A 3FFOA 3L3OB 1B2YA 1G7LA 2HFGL 5DVPA 3MXWH 1XBRA 2YIHA 1ZMYA 4NPYB 4NDMB 4LOUC 1S5IH 1TTGA 5CN1A 5GRWA 5LDUA 2O5YL 5AOMA 1N10A 4G9FA 3CH1B 1EEZB 1I7UB 1IGMH 2AMGA 4FABL 2VDRB 3U4AA 4DVBB 5B39A 5FGBC 4ZDHB 4MAUL 4MD4A 1MW3A 2HG5A 2R69H 2DDQH 2OCFD 1B0GA 1RZIB 3QCUH 1W91A 3LRMA 1TETH 3R8BB 4R5VA 3UG3A 3ZSSA 4FQQA 3HZ3A 2H6PB 4OD1H 2DMBA 2Z7ZA 3SDXE 4OQTL 4WGKA 4Z7NE 4J12A 4ZBJA 3HPJA 4MMZB 1WA0X 5C6TH 2YSSB 1R3IL 2P24B 4X7CC 1QEWA 5JORB 5GS1A 1G7PA 1JK8B 2AZAA 1NSNL 1T0MB 4TQIA 3KCWA 2XFXB 5I1HH 4QRRE 5IQ7L 2EDTA 3GO1H 4TPRL 4I9WE 3UEQA 3KLQA 1EHAA 2DMGA 5E8PB 4RIRB 4TNVF 2WXRA 4RAVB 1CBVH 3HHRB 5EU6D 3T65B 2AJYL 4KPHH 1SN5A 1DQLH 3MRHA 1I8UA 3H56A 4UQ3A 3B9VA 3RY4A 2XN9D 3KDPB 4X5WA 4JFTA 2E6QA 5GZOD 3GDBA 5A2FA 2DQCL 1A6WL 4ONHB 2XQ0A 1TQVA 4PJAB 3WKQA 4ELKB 1GOHA 4L0YA 1ZGLP 1LO4L 5CBEA 2MNUA 1F1GA 2Y07H 3APCA 3WSQL 3FFDB 4EO5A 5C0EB 1OB1B 3F6LA 1SOSA 1TTBA 3GQFA 2MCPL 5DRWA 5GS0H 4LSVH 3ZL4H 3RWFB 4PGBB 1SLVA 3QFJA 4FNQA 3EYUH 5CJXC 5J9PA 1NC2D 2I07B 3KGRA 2HT4C 3QXTA 3RTQD 4V11A 1BEYH 4P5TB 2EUXA 4XVUC 4PYHA 4WHYH 3ARBC 2CDGB 4HD9A 5FFOA 3V10A 4ZFGH 4KDWA 2C9SA 3WG7B 1INDH 5HHPA 1CLYL 5CLZA 5I6KA 5L4FA 5F0PB 5IUSA 4YZWA 5HHQA 4BK4A 3ZTNL 3VXMB 3MV01 1TKWA 2Y7QA 3HG1B 3OPZH 4JFPA 3BGFB 4R4BA 3N41F 5HPOA 5F89A 5AVTB 4JLRB 3DNKA 1ITCA 1FLRL 1N4XH 4DPAX 1KF9B 3KEDA 5E8OB 1HEHC 1X9QA 5LXGH 2JTDA 5AD0B 5KVFH 1Q94B 2PTTA 3GI9L 1PZAA 4LVOC 5F6HJ 4E5XB 4MSWA 2CU9A 3C5ZA 4X7DC 4DGUA 5L4IA 5I1KL 4PGEB 1MCIA 3VXTA 1LO3L 4QRQB 4FYTA 2P5PA 2QPEB 1MJUL 4XGZB 5KVGH 4YFEA 1Y6KR 1RQ5A 2X1QA 1KGIA 3FPYA 3NIGF 2VL5A 3IMWA 3ULAB 1N8ZB 2H1PL 2OQJB 1BBJB 4MYPA 2V7HB 2YC1A 4Q6IA 4NJ9H 1EVTC 5AVYB 2FZ3B 4P2QB 2LT9A 1AZBA 3BQUA 3H2PA 4Q56A 3G6JF 3MOAH 4UT7H 3RY5A 5C3IA 1N8OE 5I6XC 1IGJB 5DFAA 4IRJB 4HDIA 1Z7JA 1FFQA 4NQSA 12E8L 2KT6A 5DUML 3QJUB 4QCIB 1F4WH 1UVQB 4TLKA 1QI4A 2AXWA 2FBJH 4Y1SA 3M07A 2C4XA 1FGVL 4Q52A 5CSZB 2D4DA 3UBXI 2FRGP 4UYPA 3U2JA 1ZVSB 5HVHB 2TAAA 5E6IA 1CL7H 3AACA 3CJJA 4PJHA 5FA4A 2UXTA 3CFJA 5GIRA 3CZFB 4FA8A 3B2XA 3N85L 1YEKH 1G1KA 3ARSA 3LY6A 1U92B 2F54E 2JKRM 5DEGA 1OD7A 2HVKB 4OCLC 2ENQA 1X9UA 5FO7A 1HHJB 1GKOA 2GITA 3KPQA 4RAUA 5D7JB 2Z1PA 3LHPH 1JZ4A 5CBAB 3JVFC 2GPZA 4NZUH 1UWGH 1F42A 2BS9A 1DVZA 1LP9B 2FX7H 4PWFA 4M93C 2VSKB 4TLSA 35C8L 3D48R 1XH0A 1FN4A 3HG2A 1OTTC 2Z93B 3APMA 1U8PB 1JGUL 1QAWA 2IBZY 4TSAH 5D1ZC 2EVHA 1T7WA 1IAOA 3W9DB 4GS7B 1E5BA 5IB3A 3MX0B 3K6OA 4WKZA 3WBDA 5B7FA 3L1GA 3CQPA 1UB5A 2FCBA 2C34A 2YD3A 5FECB 5C09D 4JO4H 3QDMB 4H0GA 1ONQA 4R4ND 5B4MD 5SWSA 3OR6A 2A6KA 4FZEH 5T3ZL 4DKDC 2BSSB 1GC1H 2B14A 4YJZL 4BHUA 5I74B 1NCAL 5FKAA 3LH8A 4BFIB 4JGMA 1UOWA 5KS9E 3GRBA 4LU5H 4XB8A 3S36H 2NXYB 3ME0A 1UZGA 3CH8A 5ALBL 3VXOA 4DUXA 4BUGA 3KLLA 4Z8FL 1C5CH 1IT9L 3WEXB 1WS8A 2WSDA 5JOPD 4OIAA 4HX1A 1QA9A 3OKKB 3O6KL 5EHFA 4FNLH 4CJ0A 1BJ1J 1J8HB 1QLRA 3EJJX 4NN6C 3P2TA 3RIFF 3ULUD 4F93B 3DURB 3UJJH 1SDYA 3TLRA 5DEFA 2HFTA 5DD0L 5B4MC 2WWOA 2XZQL 1MIML 1BSIA 5DZJA 4IJ3C 3RDJA 1M3IA 4HV8B 3U4EA 1RUML 2YWZA 4ENED 1E90A 4FMVA 1H3UA 1O6SA 4YDKL 4HOWA 2F9BT 4B9KC 4Y9CA 1YUHB 5I5JA 1MQ8A 3I75B 1WBZA 1QHOA 5DJ6A 43C9B 1H5BB 1TZ8A 5ICZB 2YPLE 4FTVD 1IBBA 1AR1B 4OGYH 3L3GA 5DSCB 3DTDA 1JF6A 2VZ3A 4OFVA 3R4DA 1KELL 1N59A 4WWID 5DD1H 3EW3B 4A37A 5TE7H 1RVFL 4OCMC 1P5UB 1HZHH 1UT1A 3ARGB 4LHUA 3VCLB 1TJGL 2FLRT 4BSWA 1E8WA 1QFPA 3M17B 4XAWL 2PP9A 4YBQD 2R0ZL 4M62H 2Y06L 1Z0NA 4MLSA 3QDJA 1Q8MA 1QLRB 3NCBB 3OKKA 4MMZC 4GT7A 1QFUH 1KIQB 3PFQA 4N20A 4O5LH 3DX4A 4EDWH 5C86A 2WXNA 3DUUB 2R2EB 4OT1H 3ARGD 3K6NA 5J7CC 3UAJA 4ZS6C 3P30H 5EBGA 2BNRD 1VESA 4AH2B 2APVA 1TPXC 2BVOB 4F9LA 3DJRA 1WF5A 4EIGB 3NPZB 4JY6A 2MQ3A 4M1CD 1IEBB 3GJFB 3H85A 5AYTA 2P8LB 3U9PL 4G5AA 4QOKB 1YEIL 3L3KB 3P4OA 2NQCA 5FKPA 4K4KA 1UB5B 1XMWA 3RWGB 1SJEB 2W9DL 1UFUA 1G7QA 1BAGA 4HOXA 3OJ2C 3VYNA 1NGWB 2WWMD 3HBPA 3L4UA 4WUUE 1NA8A 2WUCH 2X1WL 1U8QA 4I18A 4QRPA 3KMDA 4KKZA 4UNUA 4PJCF 3GRGA 5AUMB 1I1AC 1O0VA 5F71A 5GZND 3G9VA 5LBSL 3JWNC 2HVKA 1JPTL 4PRIE 4G8IA 4FFYH 3U25A 4PJFA 5GGSY 1INQB 1SXBA 2EYTB 4PJ5B 4IBVA 5DYFA 3HA0A 1CS6A 4YC2C 4IOIA 1ACXA 1HINH 3CZSA 4U1HB 3HC3L 4MMXB 3AXLA 2ZCKH 4N3UA 5K33A 1PQZB 3GO1L 4ELMA 4JFHE 2KC0A 3GMPB 2NY1D 5E9DD 1WS7A 4U3CA 3KLHC 2UXVA 3UL4A 3L9BA 5DUJA 1R24A 5EBMB 4BD4A 4XP5H 4ZX6A 1I3RA 3TCLB 1T04B 3D0LB 2EXYC 1ZSHA 3X14B 3RWHB 1AR2A 1VFMA 1RK0A 4P5TC 3CZLA 3EDKA 4E5XG 1CFSA 3TH4T 4HEPG 3KHOA 3D69A 2O6FA 1WBXB 2ZCZA 1NPUA 5D7JD 5EF0A 3O8XC 4LNRB 1TYEB 2NMSA 3ARRA 5I1GH 2H7WA 1XCTA 1Z0MA 2EDJA 2H47C 2KH2B 1DQQB 1UM4L 3EXJA 1I8LA 4UQEA 3MLVL 5CINL 2QSTA 4PRHB 1MHHB 4JRXA 2LQRA 4PRNA 3CZNA 3RKPA 4E5XA 2EECA 4HUNB 3O45A 4PHXA 1OAXL 1F58H 2O61A 5H4YA 2HRPL 1MVUA 1WTGT 3L7EA 2XWJA 4UT7L 1KEML 4JZJC 1E65A 4Y4HB 3OLGA 1IVTA 4XBMA 3IGFA 3QUGA 4WU5B 4AV5A 5FA3A 4QGTA 2A0LC 2BSED 3JWOH 3TV3H 4UOZA 1TZIB 5HHQB 2V17H 3B1UA 2HRLA 3NSCA 4E9RA 3RX9A 2WAHA 3HC0A 3INUL 3WYRA 2VXQH 1I3GH 2DQFA 4JHAL 1UJTA 1E67A 3OHXB 1QFWH 4MA7H 2WBWB 4AVJA 5CZXC 1NEZB 1AXTH 1TDQA 1TNNA 2X9ZA 3MFFA 4X6DF 8FABB 1TR7A 1CIDA 1S3RA 1NCAH 3HZKB 4PY7A 5EO0B 4DPRA 1MFVA 4UANA 5F9AC 2HT4D 2UXFA 4ES8A 3HI5H 2EE6A 4O00A 1BZEA 4LT7A 1L9QA 1OB1A 1JV5A 2HT3C 2EYRA 3CDGB 5TDOB 4BBWA 3QT2A 4YXHL 1ZLWH 2WXPA 4X99B 1WT5A 3H9YA 3TEYA 5IW1A 3VDAA 2Q8BL 1IKFL 5CD5C 3DIFA 1TTRA 3WV0A 4QRFA 4TSAL 4M43L 2UY6A 2NNXA 5SV3A 1S2EA 3RGHA 4AIZB 4CVZA 1J5IA 1ID5I 2VXVH 1QRND 2H41A 2MKWA 4OUUB 4HUVA 4PB0L 5B8CC 2VDRH 3T77A 1SBSL 4IOSD 1MVUB 3MGOA 4AZUA 1U8JB 4ZO6A 3SQOH 4GKOA 5E8PA 2EDOA 1J0ZA 2NLJB 3SCMB 3JTSA 4LDLB 3IBEA 4Z7VA 1BD2A 1A7RH 1DP0A 3F58H 4ZD3L 4Z7WA 4X5XA 3T4AC 1ZLUH 3U83A 5IZ7A 5ILTH 3MV9B 5MI0C 2MOGA 5AYQA 3SY0A 1YVLA 5BVJA 3U9UB 4JHAH 2BZCA 3DHMA 2J4WH 5E99H 5BZXA 4ANVA 2E7MA 3QJSB 2XT1B 3V4VH 4OFDA 3SY6A 2Q7NA 4GAGL 3ZVVA 3FQNA 1UH2A 3NP4A 1NUNB 5HD8C 3O4LA 2X0VA 3HUJE 1QSVA 4O51B 1FC2D 1FNFA 3PJNA 4IK7A 3NCWA 2NR6D 1I9RL 3QPXL 4LLYA 1NMAL 1NCUA 1U3ZA 1QZNA 4MS6A 5K1JA 2JQZA 3HVNA 1AGBA 2C7UB 4JJHA 1AS7A 3S34H 3TT3H 1QR1A 1OAXH 1PEZA 2D2OA 2K8QA 4ODHH 2LVEA 1IILE 4MMXA 3OLIA 2IMNA 3CZJA 1AKPA 1YEDA 3BPCB 1BLNA 3L3OA 5IVOA 3C8HA 2R2HB 2VR8A 3V0FA 1IU1A 1YG9A 1YA5A 4CSPA 4ZT1A 2E6JA 4J3WA 2PW2B 4FE9A 1NDGB 1QFOA 3F7PC 2CM6A 5D6CA 4ERSH 3OGOE 1E8XA 1J88A 1PLGL 2G0LA 2AP2A 1CK0L 2KI6A 4R2GD 3ZYOA 3PPSA 3RBSA 4Z7QE 5EC2A 1YZZA 3QUKB 5ITBL 4Y16A 4TTDD 3GNML 4HGMA 1M1XA 1CICC 2JKSA 1IM9D 4KRLB 1G7QB 1K9TA 4X6DE 2OW7A 2UWEB 4I5BA 4FFWD 3WTYA 2XJKA 2W9LA 5J13C 5KAQF 1QTPA 2P8LA 2WNXA 4NFCA 1EZVX 3ULUH 2V0AA 1P84J 3L5JA 1YEHL 1CLVA 2WXOA 2IGTA 4PJFF 5DUBB 3RIFK 3VUAA 5AW2B 1J8RA 5C0CB 4ADJA 1BF2A 2N7BA 3RWCB 4N8VG 2J5LC 4A6YH 4LRNL 4HPHA 4K8RL 3N42F 3O6LH 4GQRA 4KWUA 1JF1B 1CU4H 4X6EA 3ENEA 3KS0J 5LN4A 3BDXA 4G6AD 4L37B 5T1JA 2R2EA 4EUPA 4X4XA 2XACC 3NA9H 3FB5A 3B2MA 1E0OB 5BZZA 1KIQA 1KC5H 1EJFA 2IG2L 4OCNC 3PP4L 2ESVE 2W65A 3APNA 2X4UA 5EIQA 3BHBB 3C8KB 1ZTXL 4NQDE 3V5DA 4MB5A 3VCLA 3DSFH 5MEOB 3ARGA 3W37A 3JTTB 4Y5VB 5D7JC 2AF2A 2J4WL 5E99L 1A4JA 1J9QA 4HJGB 1JGLH 2L7JA 3CFTA 3PGDB 1LHZA 2V3FA 1YNLL 3D3VD 3L3GB 3ZE2E 3CXDH 1X4XA 3PXJA 1OAYH 5DHVA 2OR7A 3GBNL 4BFJA 2YZ8A 2DB8A 1WZ1H 4LF3A 5E5RB 3O6FA 4Z7VE 3FBQA 3RZCD 4JFFD 3OM3B 1G87A 4KJYA 5E9NA 1W0WB 4L1LA 2Y7MA 2P28B 1YEHH 2V5SA 4DVRH 4KGJA 4FNUA 5C0JA 3P9MB 1KYOK 3VYPA 5DMYA 2R23A 3FZUC 4BFFA 1CVSC 1S7UA 3ECWA 1ODAA 3LQAH 1AKJB 4PRID 1OSPL 3C87A 3MRLB 5BRPA 4X80H 5DZLA 1U8KA 1U93A 4GYBA 5J6HB 1BIHA 4PUBL 4O02B 4NIKB 3I85A 2VERA 3MJ9L 5D9SA 3W0WD 4WCYL 3JBG7 4TUKH 5AAMC 4HGKC 1KTBA 1KTCA 3GJEA 2F74B 4OGZA 3MLRH 1C1EL 2VZVA 5A3IC 1GYWA 1NL0H 1NMCC 1JWMB 2X1XR 1KN2H 2ORBL 3F7LA 3IKCB 3VU2A 1EZLA 3VRLF 2FO8A 1I1FA 4IKNA 1HI6B 1F11B 3BWSA 3QRLA 4GXUN 4OFKA 3DOHA 3TWYA 2WQWA 3NRPA 4GRMA 2BSSA 1JN6A 5IMKA 2NUPA 3SGDI 2A6KB 5DYOB 2FT6A 3FT9A 2X89A 3BEVB 2H26A 2AJVL 3L81A 3QQ3B 5EUKA 3S3JA 1EAJA 3HG1E 4QAMB 5IW6A 3UX9B 1F41A 3SDDC 5ACLA 5I15L 3O3BB 1YEJH 5D1ZD 3BDYL 1PFOA 4AQ1B 1MCHA 1U8PA 4WDIA 1ID2A 3KHQA 1A9VA 5IBUB 4OFYA 4MA1B 4KTEL 1B3JA 5CBAA 1CD1B 1FFOB 4HC1A 1RFDL 2LLGA 4ZPVB 4CSTA 2OXGB 4ODVL 5DWUH 3CFCH 3WDHA 1OT4A 5DEGB 2F5AL 4NO2A 7FABH 5D1QA 3F7YA 1CF8H 4GUPB 4Y2DC 5AVUB 3FO0L 1J0KA 5H2BA 4MAYC 1PSKH 5FCUH 4I2XA 3RY6A 5D4IA 2NTSP 2ED6A 1MFEL 2QT6A 2VLKB 1FHGA 4MXVE 4F2MA 4JKWA 5EOTA 4U2ZA 5TE6L 5IK3B 1JWSA 4JQVC 1MJJB 3SE3C 4FERA 4LL4A 2GAZB 3FRUA 2ZXCA 5LUMA 4B97A 4H5SA 4P2RD 2VLRE 4CADB 5BV7H 2JMRA 4J4PA 2VIRA 2IH1B 4NGHH 2VXVL 2D31B 3GKWH 4XVJL 4QXUL 4D9RE 5I6LA 1SDDA 1NCTA 4GH7B 4P2QA 3ZR5A 2AXJA 4Y4FA 3BP5B 2DLEA 2R29A 4HT1L 1HINL 4FS0A 3L1FA 5IROA 4C4KT 4DVRL 1J8SA 4FKHA 2I32A 3GSQA 3RGVA 2WLIA 5CWSA 5FWQA 3SHSA 4FYSA 1XD0A 4WW2F 1MDTA 3BUYB 3T4AA 2NT1A 5BUGA 4NO0B 3HLKA 2EE9A 4LNVA 4XP1L 5IG7A 4W9HC 1ECZA 4Y16C 5CEXB 3ARZA 5SWSE 3WD5H 3MBEC 4N2BA 3S96A 5HHXH 1IAKA 5B38A 2VJ8A 1KLUA 2CDEB 3W57A 2YA0A 4KMTL 4I3SH 3ZTJG 3S7GA 3BVNB 3QUZA 3ZZLA 2EYSB 3WEMA 1A7BA 4JLRA 5EU6A 2CBOA 1M2VA 3HC4H 5IMLA 3DX6A 3NABH 1N0LA 3S2CA 3N9GH 4L8CA 2FEJA 2ICEB 2VN5A 3DBXA 3JWDC 1BBDH 4UILL 3SDCB 4XNAA 1MFDL 5DZNA 1F58L 3VFNA 3KVDD 5LNEA 3AMLA 1CFTB 5INDB 12E8H 2Y6SC 5DUMH 2WXIA 5C6TL 1PJWA 1JNLH 4E41E 1OGTB 4ZFFA 3I6GA 2DZEA 5D8JH 5KANI 4KTEH 5IIEB 3H4FA 5EZIL 2C9QA 3TA3B 2HLFC 4ZI8A 1VERA 2XV0A 3DDGA 4Y2DD 3GUTB 3OC8A 5I30L 4UAOB 2H32B 3G08B 4UTCA 4BRVA 5E4EC 1QHPA 2OTUB 2ZCLH 5JO5B 3VXNB 1SXSA 4C57C 1AGFA 1OPOA 2IBGA 3GNMH 4KHTL 1G5AA 4NC1C 4OM1H 5DVNA 2B9BA 4P23B 3WFBL 5DJZA 5IVZB 1M2VB 4ZXBD 3VI3E 1F6LL 2KZKA 2VC2H 3BPLC 1XH3B 1I9EA 1SJHB 2XTJB 5IWLC 1RJLA 4RZCA 2WCSA 1SHWA 1T0MA 1XB6A 1JK8A 4YDNA 2HN7B 1MCRA 3O3DA 2Z92B 1HXMB 4BZ2H 1MIEH 5L0QC 1IAKB 4LCWD 5B38B 2V5YA 3CFDA 4HSCX 3NIDB 3MV8D 3W9EB 5BRZD 1RIHH 5CEXA 3LZQA 1DR9A 3D4CA 4RDQF 2QFRA 1LE9B 1QO3A 1WFOA 3T9WA 1TQSA 1XH2A 1NICA 1RJYB 2NR6A 3T3MB 2FJHB 4QTHB 4YSQA 4BK5A 3N04A 1EEZA 2ICES 4P8QA 1D9KA 4DAGH 2WQXA 3BKMH 3GJFH 3VI3A 1RZ8A 4JVUA 2X70A 4MJ6B 4U1GC 4YSSA 5IM7B 3KCPB 2EIJB 1CFTA 1INEH 3EXLA 3IJEA 5EUOF 1R17A 5C08B 4JZNB 4BCZA 2ZTBA 2WTRB 4PJXB 2OL3H 4JFEE 1FF5A 5KYYB 1ZRUA 3G9AB 5JOFA 5H37H 3UJTL 1N0LB 1VIWA 5IJKA 3HOGA 1K6QH 5TF0A 2C8NA 2C9PA 4RH4A 4XNMB 3EO0A 4FL4C 4XBGA 4FCAA 4FOMA 5H2BB 1OGPA 4XMTA 1FL3A 5D1QB 4QKTA 5F3FA 5D6DC 4RRPM 3P4NB 4NQDA 4YNYA 4L9DA 4AITA 4LKXA 5GRVL 5IHZB 4KVPA 1DSWA 2OMBA 4ZPVA 3HI1A 1D5XB 4XCFL 3EOTH 2BXYA 3ARYA 3E2HC 3LKSB 2DYPA 2KKQA 1LO0L 1PYWB 4AVIA 3FUHA 2DI8A 4ZUSB 1XR9B 5ID1B 3NH7H 4PLJC 4OR1A 2YGOA 4JJ5B 1HZHL 2IBZX 2UXGA 5IVNA 2AK4E 2HTLC 4LEXH 3VU1A 1F18A 3DMMA 4MVBC 4OLWL 3PDDA 4JZOB 2NQDA 3A6BL 5FM4A 5JZ7C 5EUKB 3ARDD 3WELA 1NEUA 2DEWX 4RQQB 3D08A 3L6FB 3UPRB 1OTTD 1F86A 3BZFA 3A22A 2VDML 3CHQA 1NC4A 3EHBC 3IDMA 3T0VA 2PYEA 1Z9OA 1I1FB 2CMRL 3E9TA 3FQRB 8CGTA 1JVKA 3MLXH 1KJ2A 2CH8A 3F64A 5I75B 3S88L 3VFOA 5KS9A 3SDDA 2CO6B 3BH4A 4M02A 4CKQA 4XT1C 2QLYA 3RYMA 4PJIB 5I5MA 3KWWB 1I8LC 3ZIYA 2WBJC 5JDJA 4OW6A 1MCCA 2AQ1A 2APTA 3EDFA 3TEXA 5E2TH 1B88A 2QVKA 1RPKA 1AC0A 4UYQA 5HP5A 3F62A 3RHWF 1ZIBA