4M4RB

Epha4 ectodomain complex with ephrin a5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
141
structure length
141
Chain Sequence
b'AAAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 141
sequence length 141
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4m4rB00
3UACA 5PCYA 3CG8A 1ZV2A 5D4HA 2OV0A 4WTQA 4E9XA 5I5JA 1IBZA 4BXVA 1W6LA 5AKRA 2IDQA 3QJUB 2VSMB 3X1BA 5IY5B 3NSCA 1XB6A 3N55A 1RZPA 3PAUA 2FT8A 1KV7A 5F7BA 1SDDB 1X9UA 1L9TA 2IWEA 3FT0A 4G71B 3NJNA 5ANHA 2BZCA 4YSTA 1GR7A 1AS7A 3OMIB 4KOCA 1BYOA 4AZUA 5I6OA 3GYRA 1ZDSA 1ADWA 2FNWA 1GY1A 1AIZA 1SNRA 2XV2A 2IDSA 2MTAA 2IDUA 3JT2A 2PP8A 4W9ZA 2H3XC 4JHVA 3QPKA 4GP8B 5I6KA 2AFNA 2CCWA 1AR1B 7PCYA 3H4HA 5B7MA 1PLCA 2PCFA 1KDIA 3TU6A 1HAWA 5D4JA 1JOIA 1E5YA 3UAAA 3FYIB 3CDZB 1RZQA 3OMNB 2CUAA 2BW5A 4HCGA 1PLAA 4G70B 4QLWA 1SFHA 1TEFA 1FA4A 2FQGA 4FA7B 3WNIA 4DP7X 3QQXA 1W8EA 2ZXWB 5B7EA 2JKWA 3FU9A 2HX7A 3FSAA 1N68A 2H5UA 3WNJA 2H47C 1SF3A 6PCYA 1GS7A 4HZ1A 2QDWA 5TK2A 3ABMB 2HZHA 1J9SA 3AG2B 2W8CA 2XUWA 3ASNB 3FYEB 4EF3A 1JZIA 3T6XA 1WS8A 1QLEB 1OE1A 3EF4A 3QJSB 4NB7A 1JZFA 3T6VA 2IH8A 1TEGA 2YARA 8PAZA 4YSUA 3NSYA 4AI7A 2AZAA 1AZNA 1VLXA 1AAJA 1EHKB 1NPNA 1IC0A 1N70A 3OMAB 5LDUA 1KBVA 2J57A 1ILUA 2XX1A 4TXVB 3IN0A 1NZRA 1OCOB 3NSDA 1ET8A 2IAAC 3AG1B 1NIBA 2QPDB 2YAEA 3FSZA 1AZUA 1AOZA 5EHFA 3FU7B 3NJFA 9PCYA 4AKPA 1GSKA 1NICA 1CUOA 3FPYA 1MG3C 1PY0A 2Q5BA 3T6WA 1SF5A 2ZONA 3NT0A 2AANA 4M4RB 1PNDA 2Y69B 3SBRA 1I53A 3PCYA 3ASOB 1ASOA 1R1CA 2XV3A 3G5WA 2UX7A 3QJRB 3WKQA 4A2FA 1F56A 4L0PB 4WKXA 1JERA 4AKQA 2DV6A 4E9WA 2VMJA 2YAFA 4A2DA 1OV8A 4N8UA 1A8ZA 2DYRB 4NERA 5I5MA 2J56A 5B7FA 4A2EA 1BXAA 2YQBA 1JZJA 2I85A 2I7SA 3AW5A 2IH9A 4UAHA 4E9YA 4F2EA 2IDTA 5A7EA 1NDTA 2PCYA 2XWZA 4G7QB 3ZBMA 1TKWA 3S3DB 3WKPA 1ASQA 2OJ1A 4HCIA 1AACA 5I26A 1IBYA 5B1AB 1CYWA 2FQFA 1E30A 2XV0A 1L9SA 3BVDB 3UGEA 3TA4D 4A2GA 4CSPA 1AANA 1JXFA 1URIA 3HEIB 2AVFA 1DYZA 3X2QB 4YSSA 1OCZB 2JXMA 2FQEA 1BQKA 5FC9A 3OD3A 4HALA 3ZX1A 1WAEA 4PAZA 2FT7A 1ET5A 3CVBA 2IWFA 2UXGA 4P5SA 2BWIA 4HAKA 2DY2A 4HCFA 2GB2A 3GDCA 3OM3B 4YVUA 1ZIAA 3TBCA 2YAOA 3ZIYA 4AKOA 1BEXA 1IKOP 4A67A 1SDDA 3DIVA 1AS6A 3T71A 2E86A 3FQYA 1SHWA 2BP0B 2HRHA 3ABKB 1HAUA 2HLEB 3AY2A 3X1EA 2R7EB 1JXGA 2TSAA 3ABLB 3EH4B 1QNIA 1WA1X 1M9WA 2UXVA 2WO3B 3UABA 4CSZA 1NPJA 2P80A 1NIAA 1OE3A 2QDVA 4YSQA 2EIKB 2QT6A 1A4AA 2BP8B 2PP7A 3ABGA 2EINB 4YSCA 3WI9A 1AZRA 3V9EA 2DYSB 3X1GA 3NJJA 2YAQA 4YSEA 3NJLA 2YXVA 5F7AA 1GW0A 4E9SA 1AZCA 1JVLA 3CDZA 2BWDA 1A65A 4M3HA 2PPAA 3UAEA 4KNSA 2VM3A 2I7OA 5B1BB 3C75A 3BQVA 1UATA 4NAJA 4X4KA 2XXFA 1DZ0A 3X1NA 3CVCA 4BK5C 3AG4B 1MZYA 1ZIBA 2EILB 1KCWA 1FWXA 1L9RA 2A3TA 2AZUA 4G72B 4N4YB 2X87A 5B3SB 1L9QA 3FSWA 2PP9A 3DKHA 3X1FA 1V55B 5TK4A 1E5ZA 3QJQB 1BYPA 1PZBA 2WO2B 1IUZA 3WIAA 1A4BA 1SFDA 3GXUB 4YSAA 4HHGA 1KCBA 2P80D 2FTAA 5I28A 4UF7C 4AX3A 1ILSA 3IEAA 4DP1X 2J5WA 2Q9OA 3SQRA 1XB8A 2OCCB 1M57B 2MRYA 3IN2A 1WA0X 1JZHA 2HRGA 2VW7A 1JVOA 4BWTA 1GS8A 3ZDWA 1L9PA 2YAHA 4G7SB 4BDVB 1NIFA 1KYAA 4DP6X 1PLBA 2IDFA 3QJTB 3ERXA 4KOBA 3H56A 2XXGA 3PLYA 3S8GB 2XYBA 3KW7A 4YSRA 4KNTA 1BAWA 1T5KA 3FU7A 2YXWA 1PAZA 2VM4A 1BQRA 1XB3A 2XVBA 4GY4A 1SHXA 2YAMA 5B1JC 3EH3B 2JFCA 1J5DA 3PXLA 1MG2C 2VW4A 2J55A 1PZCA 4GP5B 4A66A 1AZBA 4KO9A 2DWSA 1A3ZA 1OOWA 4W1TA 2TSBA 1SJMA 2LLNA 3QJVB 2PPDA 4DPBX 3PPSA 2BHFA 5B1KA 1MZZA 3V9CA 4ZK8A 1OE2A 2UXFA 4DP5X 1A4CA 5I6MA 2XX0A 3MX0B 1OF0A 1NWOA 1PF3A 2FT6A 2B08A 3TASA 4F2FA 4DP4X 3DTUB 3FS9A 1NWPA 2HX8A 3FU8A 2ZWNA 1B3IA 1AG6A 1WS7A 3T9WA 3WG7B 2CBPA 2XU9A 1NIEA 3D12B 4Q89A 1PMYA 4BXSV 4KO7A 1XMEB 1HFUA 3NJHA 4MFHA 1JZGA 4BWWA 3KW8A 2QPEB 3S3BB 2GHZA 4KO5A 4HIPA 1YLBB 2FWLB 4DPAX 4FAAB 2GC7C 2CJ3A 2PPCA 2FQDA 1BQ5A 3HB3B 3L45A 4UANA 4DPCX 4Q8BA 3CVDA 2N0MA 2WSDA 3NJMA 1CURA 1MDAA 2BW4A 5I6NA 2PLTA 4E9RA 1NINA 1TU2A 3OQRA 4YL4A 1J9QA 3TBBA 1V10A 6PAZA 5I6PA 3N2JA 3FQ2A 2BP0A 2RACA 3H4FA 2PPEA 4PCYA 2R7EA 2UX6A 5PAZA 1J5CA 4JHUA 5AZUA 4DP9X 5B1JA 1JZEA 1CC3A 4BWUA 4DP0X 4GYBA 4GXFA 3EHBB 1L9OA 1ETJA 3NJIA 2X88A 3NP4A 2W88A 1GYCA 1BXUA 1NIDA 1J9RA 4YSOA 5E9NA 2BP8A 1AS8A 2GSMB 1V54B 2B3IA 1KBWA 3S8FB 4A68A 3FQ1A 1W6WA 4GP4B 1ID2A 2EIJB 1M56B 3S3CB 4K9JA 4YSDA 7PAZA 2Y1AA 3PAZA 4DP2X 3NJGA 1E65A 1ET7A 2VN3A 3SBPA 4P5RA 1OCCB 2XLLA 3PAVA 1X9RA 2NRDA 3T6ZA 4E9QA 3RYMA 4E9TA 2BZ7A 1QHQA 4KNUA 5AFAA 3IBOA 1RCYA 1GY2A 2HXAA 2CALA 1RKRA 1FFTB 3MBWB 3AZUA 3EH5B 2VSKB 4KO6A 1BXVA 1WA2X 2ZOOA 1E67A 3SBQA 2GI0A 3NYKA 2GC4C 4QKTA 4F7KA 3IE9A 2UXTA 2GBAA 3U25A 3FSVA 4RH4A 4G7RB 3JTBA 3FPXA 1J9TA 3NSFA 1PCSA 2GIMA 5D4IA 2EIMB 3NJKA 1ASPA 2CAKA 2DWTA 1PZAA 2HX9A 4ENZA 2BO0A 1EZLA 1GS6X 1ZPUA 1ZDQA 1NTDA 1AQ8A 5I5IA 4JKNA 5I6LA 1OCRB 2FJSA 3AG3B 3CZUB 4BDVA 4E9VA 1KGYE 2PPFA 1CYXA 4A2HA 4DP8X 1JXDA 3NP3A 2VW6A 1KDJA 2IWKA 2YAPA 4HHWA 4YSPA 1AG0A 1PNCA 3UADA 4YVNA
chains in the Genus database with same CATH superfamily
1L0QA 5PCYA 1QP1A 4YHYB 4V33A 4P2OD 4UB0L 4C83A 4QJ4B 3KPOB 2IXQA 2Y25A 7CGTA 5KS9B 5FO2A 2DL2A 1Y18B 4E9XA 1JN6A 1QPPA 4BXVA 3GMLB 1QW8A 2I69A 4LF3A 1DBKL 3VRLF 5L6YH 2O72A 4DK6A 2P5EA 3ARYA 3HAEA 4GW1B 1OK0A 1PLGL 1HHIB 1XGUA 4P8QA 4DQOL 4L3EA 3QCVH 3SPHA 1KBGH 1NMBH 2QLVB 3VH8A 2DWXA 2ZXAA 4CRPA 2IWEA 1XR8B 1HEJC 4FHBD 2R2HB 3VI4F 4XOCA 1LP9F 4ZX3A 43CAA 3SKMA 3BMVA 1KZYA 1JHTA 3HZKB 1F6LL 5CZXC 1XAUA 5AW7B 2K9FB 2J6EH 2E6PA 1P9MA 3NESA 5A1AA 2CHWA 2XG5B 1MXDA 1SBSL 1BREA 3TA3C 2Y7QB 3EXLA 5IW3A 3DRTB 1KYUA 4B9GA 2HJFA 1COBA 2C3WA 1G0DA 3FRPB 3QW9A 2WXNA 4J3OF 2PYEB 2A9BA 4D9LL 1UACL 1G9MC 5GS3A 2K0RA 1T3FB 3LS4H 3WO4B 1PLAA 2HB0A 1XBDA 3NSJA 3QEHB 1XGTA 4APQD 3FFOA 1U8IA 4X8XA 5T1LD 4IKJA 4Z77A 5EU7E 1F6FB 3L4YA 1YEDA 1QSFB 1HE8A 2A6DB 4N1CA 2DZEA 3OHMB 4M62H 4L1DA 2XA8L 1DFBL 3QR0A 2DDQH 3MV9E 2IADA 3RTQD 5EU7C 2XPGA 5DRNA 4LLYA 2KPWA 1C12A 3MGOA 5ESQA 4NENB 3W9DB 3X17A 3VUAA 3WGVB 2DQGH 3PWJB 3SGJA 3ASNB 4JPIB 4XT1C 1T22B 3P3YA 3KL3A 4MA7L 1BFVH 4FFZL 4NO0B 4RZCB 4NB7A 1NCJA 5KUKA 1OCWH 2ZWLT 1ND0B 4PY8I 4WW2A 1TEGA 3TT1L 1QASA 2R0WH 1RJCA 4PG9B 5TPWH 1N18A 1TTRA 4FG0A 3MJGX 4O51A 4QYAA 1VLXA 1EHKB 4AGLA 5LDUA 1NCDL 3DSFH 4MXWH 3VI3B 2V3DA 5FFOA 4JFFB 2Y72A 3OKKA 4LB8A 4XWGH 5KZCB 4UYQA 1L0YA 2VDPL 4WTZA 3TPUB 3O3UN 5GISH 2Z93A 4GRLB 3VYPA 1UKTA 2DQIH 3NA9L 3FU7B 1GCYA 1RZ7L 2D4DA 5TQ0H 2OMZA 1IRAY 4M93B 1CFQB 4KRPD 2KZKA 4X5LA 4AGOA 1MW1A 3UERA 3LSOA 1Q9LB 4I88A 4KK5C 4MCNA 4GAGH 4XAKE 3LEXB 5I6XB 5HYJB 4YLCA 1BXXA 4I2XB 2EDMA 4YXKL 3RL1A 1ASOA 3H55A 2R29A 4KUZL 5IWLC 4UT6H 3MBWA 1DVFA 1F3DJ 2PYEE 2LOEA 4E9WA 3QFDA 3I3EA 1OXYA 2NNFA 1QZ1A 4LGRB 4PJXF 4YHPB 2Q3AA 2UY6B 4L1BA 2OXHA 4MDRA 4NNYA 2GK2A 1OGTB 3L5WA 4GQ9H 3WO4C 1LDPH 2JB5H 2GSIA 3OX8B 4JM2A 2X1QA 4MJIB 4NJAL 5DI8B 2XQYK 5JPNB 4NIYE 4ZZFA 3KYAA 4UAHA 2P4AB 3UMNA 1CU4L 4UQCA 1GIGH 4WI7A 4LKCA 5BRPA 5C8JA 1J5OL 2I9TA 3SCMD 2UZIH 1TYEB 3VE0A 3LRLA 4HXAL 5FGBA 4QOKB 3E9TA 5J9PA 2A6JB 2OSWA 1NBVH 1H5BB 1I85A 4RDBA 2F7QA 1BSIA 5IMLB 3DO7B 3EGSA 4NFCA 4JN2A 1KJMA 4AJ0A 3GTTA 2X2YA 3OD3A 3WJJA 3MOBL 3AAZA 1ZLSH 1SEQL 4AH2A 4A7VA 2E6QA 4PAZA 5FM4A 2QV4A 3UAJD 5F0LB 2VL5A 4WI5A 3VI3E 1C5DA 3KLAB 1N67A 2DY2A 2H6UA 3MRDA 4JFFE 3WTSA 4Y4KD 3T4YA 3OKDB 6FABH 4LT7A 1TSHA 3AU1B 3MCLL 4GXUN 1JZ2A 3R0NA 2X89D 1IAKB 1L4IA 2Q10A 1T1WA 4OCXL 3NIDB 4R7VA 5CINL 3DIVA 3MV7A 4PHXA 1RFDH 2E86A 1NBZB 2BP0B 2CH8A 2AEQL 1WAAA 4GRLC 1VRSA 3AWGA 3ABLB 3OKNA 1X5XA 3PPEA 3MRGA 4YDVA 4XCNB 3NCJH 1FBIL 3LH2H 4G6JH 4YBQC 4HULB 4M93C 3HNTL 1H19A 5GSRB 1DJZA 4I2XE 1A14L 1P2CA 2XWEA 3QORD 3UTSB 1A7NH 4G11A 2MOQA 4H5SB 5I6XC 3HE7D 3VAEA 3N91A 4JUSA 1HSBB 1UWGL 2VLJE 1B2YA 3ARBB 4MDJB 4NO2B 5CN1A 5KSUA 4AK1A 2APVA 4YSEA 1B4LA 2DEXX 2TRYA 5CJQL 2BERA 2ERJB 2F53B 3BVVA 1CIDA 3PWPB 3QO0A 2DM7A 3N40P 3SE8L 2YO3A 2FGZA 3UAEA 4L8CA 1WFUA 2W0PA 4YXHH 3BQVA 1JWSA 3S36L 3WE6B 3IXTA 4BK5C 3QZPA 2E27L 2G4GA 4GW4A 1L9RA 2J8UA 5BUGA 5HI3C 1DEEB 3M45A 4M9OA 4QOKE 4GKSB 2DQCL 4U1IA 5FYLL 3X13A 2IPUG 3C6LC 1VFMA 2JSFA 1CDBA 3NK4A 4RISL 1OAXL 5AW5B 3RZCA 4OLZH 1H5BC 3L9BA 4N0CD 2JI1A 4XH2A 3A5VA 3LS5L 5KBMA 4HWUA 3KBFA 4PH8A 4HIQA 2VMFA 2WBWB 3ZW3A 1B3JA 4S1RL 1F90H 5FHBH 1UTDA 4F3FB 5LNEA 4NO5B 5GGTH 3LKNA 5HI5D 3GJFH 4OGAD 1J8HB 4PB0H 5E2VL 4OVVA 4ZMNA 4QIRA 3LJ3A 1YN6A 5DZNA 1KYAA 3ZO9A 2VKXA 4M6NL 1CGYA 4PVMA 5DJ0B 3KPSA 1FV1A 2VISB 3CSTA 3CHOA 1KEGH 4BZ1L 4HK0A 2HWZH 2PO6B 2ZXEB 2VDLB 1MRDH 3UPCA 1Z3GL 1XB3A 5KBKA 4D8PA 1Z5LB 3FRUA 3EH3B 3QO1A 2MPAH 2OK0H 4V1DD 2VLRB 5I1KH 1AGDA 4ORZC 1M71B 4H8WC 5FOBA 5GPRA 1D9KA 1ROWA 1NSNH 4HBQA 3V5DB 4R8WH 5IROA 4GP5B 4A66A 4PV9B 2VDOH 5IT2L 2YBRB 4WY7H 2Z92A 3HUJF 4JY6B 3BPCA 4LPVA 5SWZA 5CMAB 2F53E 4OF3A 3ARBC 3TT3L 3PV7A 1T89C 1E4KC 3UMTA 2YK1H 3F84A 2ERJC 1MHCB 5CD3B 5EIVA 3MBEA 2FO4B 2DQJH 3L4CA 1N6UA 3QUYD 1NGPL 3IDIA 3FTXA 1A4CA 3LZFH 5DVKA 3F00A 4EBQL 2HG5A 2JKLA 5T1LA 1KEMH 1GGCL 3WNLA 1FYTB 5C2BH 1DQMH 1EVTC 1UWEH 4PWGA 4KMQA 1TJXA 3UTQB 2XYCA 5T3ZH 3TIEB 4IMLB 1SPDA 3GT6A 2DWEB 1T80A 3RTQA 1HINL 3GBML 5IFAH 1LXMA 3MMEB 3O0LA 4XX1G 3BH8A 1E40A 4S0SD 3LRKA 4XPHL 3WFCH 3RWGA 1T2QH 3KW8A 5H37H 5L9DL 4KY1H 4YHIA 1U8LB 1TZGH 5TFSH 3KVQA 1YLBB 3L5IA 1BJMA 4XNZC 2NY6D 2AV7A 4P4KB 1J8HE 1R5VB 4TNFA 3BH9A 3SDDA 3OVUB 3IETB 1U6AL 1FC2D 1N19A 4HFUL 4GIPD 1Y1DA 2IH3A 5DJAB 4LZKA 3UJJL 3HZVB 4Q6IB 1IBFA 2JCCB 3C60B 3FBKA 2EC8A 4KUCD 1T0MA 4MNQB 4QPEA 3ZMNA 4OCMC 4OAWB 1TQUA 1ONQB 1PY9A 4RMVA 5GGVH 2YUVA 4R7DB 5I1AB 1KFAH 2N7BA 2WXIA 5GGRA 4G6KL 3D2UD 5D7LA 4KI5E 1XCTB 4XO4A 4MMYA 5J6GA 3RUGB 1YUHB 4LDEB 5SWQA 2YN5A 1ETJA 2B0SL 5I0WA 1O7SA 3JYBA 4KI5C 4NP4H 3WFDH 2X0WA 3ZT5A 5DZAA 5L8KB 1OGAE 1HXMB 2IFFL 2F54D 4UTBH 4Z7VA 2F1AA 2BNRB 4CVWA 2YUZA 1JF6A 3DYMA 4LOVA 3PWVB 4G9FE 4W9KC 3WLBB 5DQ9A 2F19L 1BLIA 4OLYL 3IGKA 1AR2A 1KXQA 2NOYA 1A1MA 1KCLA 1IT9L 3FONB 3RWDA 2VZOA 4FQLH 5F0PB 2HKFL 1WCBB 2Y36H 4ABVA 4K3EL 5JQ6L 5ANMA 3EG9A 1HQ4A 3D39B 4KNUA 3AXLB 3JWOL 1GY2A 3O6FB 3LPFA 3QJZA 3MBXH 1DQTA 3GSQA 2WQRA 1E9QA 3BOVA 2M83A 4KJQC 1A7PL 2VDNH 2OMYA 4WHDA 3SCMA 4DGIL 3QA3B 4BZ1A 1JHLH 2VWEE 1O6SA 1NM4A 1LJMA 5CR1A 1C7TA 1WZAA 2UXTA 2GYSA 3DTXB 3MRHB 5HDWA 2VRQA 2VWEC 1PCSA 4Z3TA 3FCGA 2CAKA 1CFTA 4P4KC 4ENZA 2B15A 4X7SH 5DHEA 1TKWB 3ZKND 5H37G 4BUHA 3N1PC 4PS4L 5EFIB 1LEKB 4Y4KA 4ODXA 1B4RA 4DCQB 2ZWKA 5T1MB 2BIPA 2XZCL 4Q6IC 2X4OB 3IE4A 2GY7B 4KC3B 1CYXA 2X89A 3C60C 3LHPL 4U1HB 5C0FB 4XNQB 5K59F 5MEQA 2J44A 2YAPA 2P52A 3RUGE 2BSRA 4IHBA 2AJUH 1P7BA 2ZKYA 4ZMZA 4EUPB 4K8RD 4L23A 3SZ6A 3E7JA 2UZYA 4PW4A 3QCTH 2D0HA 4IW4C 2BNRE 3CIAA 2A2QT 3QJUB 4F8LA 1UWFA 1P4IL 3QUZB 1XB6A 1RP8A 2BH0A 2YC1B 4N2OA 4JO8A 3LZLA 2OPCA 2EUXA 2YLHA 3WLWC 5CFAA 1CZ8L 3MR9B 1C5BL 3DIFA 5C09B 3IKCB 2GITB 5GS1A 3RILA 2X44D 1BJ1H 1EHAA 1E6OH 5J6SA 5I6OA 2BVPA 2WLHA 2VO8A 1EJ8A 4HEME 2MNWA 1X5IA 1NGZB 5CBEB 4QRTB 4ZD3L 2F61A 1YEFH 5I1IH 4WJG3 4ISVA 3OJMB 1LQBC 3O6FC 4I3SH 1A6UL 2Z8SA 3QJFA 1NJ9B 1VERA 1A02N 4C4UA 4J27A 2PTTA 2ZF9A 3H42H 1KCUL 2F8XC 4EOWL 4WUUB 4HK3J 4AK2A 5CWSB 1TLKA 4ELMA 3HOGA 1FIGH 3OMNB 3C12A 4YGVA 1V3MA 1OW0C 2HKHH 3VD5A 1RUPH 2DH2A 4K3GA 3NDYE 3VMNA 2YMTA 3MXWL 2PUQT 2NYYD 3OAWA 3CNKA 4DP7X 2ZXWB 1FL5A 2ADFL 3BE1H 5EG6C 4WO0A 4YO0A 4IBWA 5C0NC 4N68A 5EEVA 1B4JL 5C0CB 5C0JB 1E5UI 1M2VA 5IHZB 3WFZA 1O75A 2FO1A 1X4XA 4M1GL 1M7XA 1U3YA 4P5KB 3QYMA 3W9EA 3EDEA 1NM9A 3FYEB 2OYLA 4NIKB 1S7VA 4HJJL 4KH9A 1AJ7H 1SEBA 3S6CA 4CGTA 3SDYL 3ZDYB 3EO1A 1WC7B 4Y4FB 4NQEB 4WFFE 1G7JB 1XO8A 4XZ4A 3MCG1 3W37A 5EC2A 4F7MB 2GJRA 4ZQKA 2XKSA 3LB6C 4X6DA 2NY3D 4JFQA 3QUXD 3M8OL 1HI6B 4HETA 2CNYA 5BXFA 3DUUB 5I19H 3QUZC 5ECJE 1T83A 4L0YA 3PWUA 4XMXA 5C09E 3U9UA 3ZZQA 1A8JH 3NFNA 4WI0B 4NRYB 5D1XD 3L9YA 3NCYP 3HPJA 5IHUL 4MX7A 2E4FA 3VXSB 4A39A 3Q8EA 3OGCA 4QCIA 3MYJA 1RZGA 4N0FB 1SVZA 2W0LA 3QUYA 2HVJA 3AMKA 3TYFA 3ARPA 3VFOA 1M6OA 5IGXH 3H6AA 4Y4HB 1CLYL 2NNCA 2K45A 1ZA6A 4FLHA 4D9QE 4AJWA 3WIIH 2F5AL 4WUUE 4I0CC 1PX3A 4TTDD 4HMEA 5DJXA 2VMJA 4B27A 4ZDHB 4U3SA 2D3JA 2V37A 2V3EA 2B3RA 5EZOL 1D6VL 2Z8RA 2ZCKL 5DJYA 4PLJC 1AY1H 3KVDD 3Q2CA 3DX6A 4HIJA 3ESOA 4AQ1B 2VXSL 3TVMB 3QIWA 1ORQB 2YQBA 3BQUD 1QRNB 1RZ8B 2G5BB 4E41A 5JHAA 2APWA 5D70H 1E7VA 4FQIL 3O2WL 3WD5H 4HCIA 3OR6B 4FQHB 3O3AA 1HDMB 1GZHC 1KIRB 1RURL 5GRYA 1ITCA 3VGBA 3TA4D 1X6NA 1AANA 2MOGA 5GGSA 3GSNH 4R4BA 2W60B 4NAQA 3EJYC 3ZDYE 3GIZH 3G04A 2R0KL 3HFMH 3REVB 4NQEE 3ROLB 2ZE0A 3ARUA 3MTXA 3D87B 4KX9A 1F11B 4HUXB 3D2UA 3P2BA 1VDGA 4JKPH 4V2CB 3TONA 4Y4FC 2WJ5A 3TCLA 4QRPA 4XNUL 2D3LA 5DTFB 1NGQL 4POZC 1I4FA 2AXFA 1S7UA 5IB2B 3KBHE 2IIJA 4WSKA 1JYNA 2NY0B 2X4TB 4JM0A 5JW4R 3DOSB 3TEXA 1YEKH 2WSKA 4B9JA 4W6YB 4EO5A 3VXSE 4AQEB 5F88B 3NABH 1FN4A 4LCWB 1INEL 4GMSH 4MCZB 1N6QH 4DZBA 2H26A 2MTPA 5HPMA 3TBYB 2AK1H 3MOAL 1V3KA 2V2XB 3GINA 3GMQB 4Z7NF 5I17B 2JIXA 4UQIM 3N85H 4HS8L 4ZS6D 3V0JA 5E9DD 4JPSA 5CP3H 2EVHA 2ZTBA 2V17H 1S9WA 4HWBL 3ZE1B 3FQXB 3T0VA 4LHUD 3TURA 4Y4HC 4WW2F 2PF6A 3F7PC 4Z7WE 5D1QE 4ZX4A 2YAQA 1QQDA 4P48A 5JLZA 4N87A 4PJBB 3RZCB 3SYCA 4F57L 3C6SA 4ODTL 3ML8A 3AU0A 1EEZB 4NQCB 4G3YL 5D1QC 5D5MB 3BCFA 3HZMB 3OSKA 1ZOXA 3IJHA 2OZNA 5AB9A 4LCCA 1QRNE 1UUSA 5CD5C 2HLFD 5B22A 1DJHA 1PQZB 3TVMC 2ED6A 4PJ7F 4WDIB 4UQ3A 4BKTC 3GO1L 3U1SL 1LO2L 1YNLH 1DZ0A 2J2ZB 3EAKA 4P2OB 3KYKL 3D4CA 1RMFL 3QH3B 1OSZB 5LKNA 3LN4B 2AK4B 3GI9H 4QWWD 3EYUL 4JHBA 1MCLA 3OAYH 2NXYD 3B9EA 1V3JA 2IC2A 3LKOB 3QJQB 5DD0H 4DK5A 4FA6A 1D7CA 1GAFH 1HX0A 4R4ND 5BVJB 3POHA 5CZRA 1G1KA 2TAAA 4ZS7L 4S1QL 3QAZB 5J6HB 3L3KA 2AAAA 1TDQA 3VXOB 3IN2A 1E2WA 5DWUL 1MIMH 4X6BB 4ANUA 3CPLA 3F2LA 4HHAA 5CJOH 5C0BD 2J72A 4AJVA 1BD2D 4BSVB 5L2KD 4YPGB 5D2LA 4BA8A 4CMMB 1U4FA 3FT2A 4BDVB 5IUCA 1RULL 2IDFA 4LCWE 1F45A 2NY0C 3BGMB 5KYUA 2ZXBA 4KQ4H 3MNWB 3T0BA 3PDOA 4OZHF 2X6AA 2JKSA 2P48B 2XTJD 3LIZH 2Q0ZX 3A67H 3QC6X 4OIAA 3F58H 5KYXB 4XBGA 4XE5B 5B1JC 25C8H 1QA9B 4F2ME 4APQB 1UENA 1G7PA 1TQTA 3EXJA 4QJ3B 4K3DL 4PPTA 5D7JD 4FHKA 2X6VA 3D09A 5IVNA 2AERT 1Y07A 3OAUH 1XGYH 2FNBA 4NQCE 2DI8A 3GF8A 5JIMA 5CZVL 1GGUA 2CD0A 2Y24A 1QZNA 3ARFD 3BSZH 3MV9A 3RIAK 1NDGA 4X4YA 5HGBB 1LILA 4JN1H 1RPQA 2WANA 4XCFH 3MLTA 2G0KA 1EA9C 2LAGB 3JV6B 3Q6FA 1QW9A 2AK4E 2WYZA 4G8IA 1WAAF 1GVIA 4S1SH 4XOEA 4X9IA 3TC9A 2IQAB 4LSUL 5F7FA 5C0DB 4JE4B 3M07A 2AS5M 2CZNA 5D9SA 5J1SC 1H15B 3HG4A 4PHZA 1BVKA 3QJOA 4P04A 3QAQA 4R26H 5EO9A 4UOZA 3VWKD 4DESA 5J0BA 3PP3K 4ALAH 3Q13A 1P1VA 3CFKA 3LKSA 3U6XS 4U6VH 1TTGA 4AM0Q 3ECVA 4Z7QB 5TH2A 2WWOA 2YS4A 4HIPA 5FYJH 5TDOA 4PM1A 5LBSL 3SO3B 3QIBA 5D6DC 4DPAX 4HWBA 1ZLUH 1JWUA 3OJDB 1E3ZA 3SKJH 1LMIA 4GSXA 4JO3H 2Z7UA 4N20A 4M7KH 5DZJA 3CFMA 3KWUA 4M8UA 4F9LC 1PBYA 3QUXA 4FKEA 4HUWB 1UVQB 1B9KA 1ZHBA 2YRPA 3DO3A 2BW4A 3HHSB 4OCRL 1MFCL 2XFXA 2NLJA 2J8UF 5C08A 1C1EL 4AWJC 2X7LB 1EVUA 1HT6A 5D1XA 1KLGB 4WEMB 3FUKA 3G5XB 2YQ3A 3QDGB 2B4CH 2ODHA 1N8ZB 1S46A 1JZEA 3ZQ9A 3FFCB 3NP4A 3NJIA 2G30A 4EI0A 3WUWG 5DD5H 5HYIA 1PZ3A 3MVSA 1SJVA 1NANH 4APQC 1KWGA 3AREA 4U1KB 3PNWA 4I4WB 5EU5B 2JI3A 2O61A 1CVSC 1D7BA 1JI1A 4PS3A 4GP4B 1XDTT 1D6EA 4UT9A 1QFUL 5KW9H 4I48A 1A7QH 1A5FH 4GAYB 4RBPH 1FNAA 2Y7NA 3NFPB 3TYGL 3O45A 1R3LB 2XLLA 1ZK9A 1RJZA 2X4PA 2IH1B 3CFEA 3BQUA 3T2OA 5IP4A 5KVFH 4E9TA 3MODL 3NDZE 4R4FH 3TBVB 3M6DA 4J6RH 3EOAB 1WWAX 1OO2A 2OYMA 4PWKA 2N56A 1OT4A 4HKBB 3AZUA 3CBJB 1WQVT 4JGJA 4Y88A 5FO9B 4L2LA 3GMRB 1TQBB 4P06A 4X5XA 5L4FA 2ZSVA 2FECL 3MACL 2IQ9L 4Z7QE 5EIIA 4JB9L 2GJ6D 4R2GD 1KIQA 2JB6B 3MA9H 1ZWIA 2O5XL 4LNRA 4ATWA 1S9YA 4XBEL 3B83A 1KGIA 2Z64C 4NZJA 2GK0A 4LRNL 3TO4D 3G6JA 4BUGA 1FDLL 1MRCL 1MCEA 3O0RH 1PG7H 3N3EA 5K5YA 1JV2A 3P3RA 5D72L 4DUWA 3QORB 1S3RA 1NAML 2WSPA 2WWMD 4K3DH 2VDQH 3KLLA 3HE7B 5LG1A 4JKLA 1DQQB 3J7HA 5JO5A 2A74B 1J10A 4GEJA 1PZUB 1H9DA 3UDWA 3U0WH 1IIKA 5E5MB 3G6AA 3QDGE 4JO2H 1HE7A 2YWZA 1UM4L 2VLJA 3KPRE 5D7HA 2YEQA 3GSVB 3FFCE 3OG4B 2NW2A 4LBEB 2CJTA 1FNFA 4CGUB 5I8OH 1BMZA 3IMSA 5AW0B 5GGRY 3KPLB 4LSSL 3OKLA 4MA8H 5EZJA 1ZHKB 4JGNA 3KVPA 4IS6A 1WHPA 4HLJA 2X4NA 3Q8BA 3FO9B 1IBZA 3QEGH 5I5JA 3VXTB 5E9DA 3C8KA 3LZNA 4NM8H 1WBYB 3BLPX 1E50A 4UI2A 3X1BA 2LQRA 2AV1B 5FECB 4MLSA 2D03H 2BSED 3ZZSA 2EZ0C 2FT8A 3C6LA 1X9QA 5IQOA 3R06B 4AL8H 3FN9A 4OZFH 1QFWH 3BN3B 4ZUWA 4HOZA 1LE5A 4AEHH 4Z7OB 2YMXL 5LBSA 3TZVD 1T7YA 1A64A 1T21B 3VW3H 5EN2A 3IDXH 3SKNA 1GY1A 4TVPD 3PGCA 2XTSA 3KR3L 1BGXL 5F7MC 1FL5B 1U91B 3EFFA 5L7XH 5H35A 2BCKA 3UAJC 3IXAA 2WXMA 2PP8A 3D8MA 3GSXA 1ZVNA 1INQB 1OM9A 4H8QA 1W8OA 2DLGA 2CCWA 1ADQL 3S2AA 3U2SB 5DFTA 1QEWA 1PLCA 4BBWA 2AJXL 1TQBC 4HISA 4P2QE 4YC2B 2BW5A 3ILEA 4NUPA 3SHSA 3EYFA 3FTYA 1GJWA 5CHNA 1J88A 1X4ZA 5I1DB 2BMKA 4JANA 2CDEB 1NGWA 1Q9KB 3TH3T 4APXA 4V1DB 3I02A 4LOUC 1I9EA 2A73B 2XBDA 3JTSB 2H47C 2QVTA 3KLSA 4FQ1L 5EC1A 2QGEA 1BD2A 4PJEA 4QF1B 2PW1A 1AGEA 1L0XA 3JWNE 4PUBH 4AW7A 1GS7A 4L5FH 1LVEA 3VMOA 4XXWC 1JCKA 1P6FA 2B59B 3HE7C 1E4KA 5B8CA 1XGPA 3E0GA 4HT1H 4M61A 2PCXA 3RFZA 4HUVB 1HXKA 5IEHA 1JWMB 1WS8A 4L37B 3VNZA 2CRZA 2HFGH 2OP4L 3ALXA 3FH8A 3ZR6A 5IB3A 3NSYA 2K3TA 1M4KA 3NCXA 5C6WH 3K3QA 4OSUL 4JY4B 1I9IH 4PJ9A 4QGTA 1UC6A 3BKML 3NSDA 3KEHA 4ZFZA 1TQVA 5I74B 1HIMH 3AG1B 1C16B 1SYSB 3OLEA 5ID1A 4GT0A 1MI5A 4X5PA 1WO2A 2RCSH 3ARFA 3DA0A 2E75C 5JXED 2OXGA 5HVGB 3IPBA 3WJLC 5HY9B 3NZ8B 1VB9A 4OZ4B 4NPYA 2Q5BA 3WIFB 4DGVL 1TJGL 5LJYH 2X3BA 3C08L 1K6QH 1QLEL 4OZFG 4ZO8A 3ZHLA 3U0PA 4F15B 2MMXA 2NUPA 4YS4A 4M4RB 3HLAB 2NY6B 1F6AB 2WINA 3QUKB 1NAMA 2WXLA 4N0UB 3F6LA 2OZ4A 4QR7A 5DZLA 4PJCA 1H0DA 4KVNL 4OJFL 1CCZA 2IPKB 5HI5C 4KXDA 4DTGH 4OGAC 5GRJH 3A4FA 5L88L 4AKQA 1M7IB 1OAQL 3BFOA 2EIZA 4LPTA 4NXSA 3B6SB 4RNRA 4N8UA 5CEZD 4MXQD 1E3XA 4HGWB 4NWUL 3UROR 2CA3A 4H8PA 2J56A 5B7FA 2QTVA 3CCHB 3CXDL 4LQFL 4OJCA 1BZ8A 2VR9A 3PWNA 3U7YH 4HYTB 5EU4A 1ZLWK 5IB4B 1LEGA 4F2EA 2FSDA 1NKOA 5IMOA 3GXIA 2A9ML 1U3ZA 4QXGL 3OHXB 2J1ZA 3ZBMA 1JGLH 1NC4D 1PD1A 3S3SA 3WENA 4WZ9A 5I26A 1IBYA 4PCSA 4HJGB 4X4ZA 2OTWB 3U46A 2F54B 2R56L 2VLME 2DBJA 3SBWA 1Q0EA 2DWYA 1CDGA 4H25A 5F7KC 1URIA 1OGAA 3HEIB 4JCLA 1ODUA 1OZUA 3CVHA 1JAEA 5D7KD 5A6LA 3V79C 4G9FA 4Q7DA 1CLOL 4LLAA 1NEZB 3R8QA 1WE5A 2C1PB 1TYRA 2E4TA 4KV5E 1ET5A 1S5IH 3Q2VA 1VPOL 1XXFC 4N2HA 1VESA 1M42A 1P1ZA 3B8YA 4XPGL 1BYNA 3PS6A 1IJ9A 3T8XA 3GDCA 1ADQA 4AMKH 1CFVH 3JVGC 3ZIYA 3FB6B 4MQXD 3LN9A 3FF7A 3EJQA 4HF5H 2Y7LA 3I6LE 4H8UA 4TUKL 2WZPA 1EFQA 2FECI 1G0XA 2H2PC 3NQKA 3GBDA 3TTYA 2EE3A 5FKAA 5I74C 3L81A 5LQBL 1WYJA 3SE9H 3RX7A 1IZJA 5IVXE 1XBRA 3SE3C 1MJUL 2CLZA 1Q94A 2JKTM 2QQLH 1YEGH 3VB9A 1OAZH 3DSNB 1WHOA 4N0UE 4PJ5B 1MWAL 2EIKB 4NQUA 4K94H 3U9PL 3O2DL 5AENA 4HQQL 3QHFH 4F15C 4HOWA 4J3OH 2L8AA 3IDGA 2NY6C 2R0ZH 1BX2A 4FZ8H 5I1JL 3GZKA 3GC3A 3MUUA 2ATKB 4FTDA 3V2AR 1A0QL 3P40A 1QLFB 4HKXA 1L6XA 4ZODA 5GIRB 4BH8A 5A2CA 1HJCA 2Y22A 1H8LA 4KQ3L 2W91A 3CDZA 1KGXA 3N1QC 1MOEA 4BQBA 5CO1A 3NPSB 1TNMA 3F7QA 3VFMA 2V2WA 1HYSD 5C0EA 5C0RL 4QHLA 4UOW1 1IAIM 1U8PB 2XKUA 1KCWA 5ABZA 1NCCH 3MPCA 4RCAA 3OHXC 3KXFD 3RWJA 2A9NL 2CIKB 5BQDA 4HJUA 1KLFB 1NDMA 1V55B 3MLXH 1DE4B 3B3IA 3D30A 2P43B 4LARH 4HFWA 4BFIA 4OGXH 1A47A 5CCKH 5GGSY 2GJZA 5GQBA 1SFDA 2JKRM 5KVGH 3ULAB 4NWTH 1YG9A 5TQ2H 3V5KB 5A3ID 5D93B 5ERWB 3NEEA 1QACA 3HZYB 3RVXD 3T65B 4KTEH 4X99A 1LO0L 1IFRA 1I3GL 1WA0X 2OBGA 3BWZA 2DKMA 3ZRFC 2VW7A 3VG0L 4HXBH 1A6AB 3MNDA 4LKXB 4BWTA 3NBNA 2D31A 3OWEA 1Z3RA 4M5YH 3FTVA 4HEMA 4JL2A 1Q1PA 2J43A 4OKVA 2HAZA 3OJVC 4PSRA 1BMGA 2BSEA 2BY1A 2DQUL 3RB7A 2WB1A 2UVFA 2WVSA 4LP8A 2VLKA 2VT0A 1F3JB 1MCPH 4BHUA 5J56B 2VXVL 5JOFB 4IRSD 1I1YB 4PJ5E 4MJ6A 4YIQA 2XVBA 1U8HB 1I8KB 1JGIA 1MCIA 5JZ7D 1CD1B 5KYYB 4GKLA 1MFAH 4JM4L 1JFQH 5HGHB 2R59A 5D1ZC 2CKNA 5DHVH 2XWJA 3QE5A 4X98B 1ZGLB 1E8WA 3ESVF 4ADGA 5HHMB 1IFHH 1WK0A 3FT1A 5C0GA 1E8ZA 2Z3FA 2NNRA 4ACTA 3K0YA 3W2DH 4J3OG 5ICYB 1M1XB 3EYQD 1CL7L 3K1DA 1GMEA 4NLAA 1OTTC 1GC1H 2FJHA 2XX0A 2H9GA 3TASA 3NPSC 4K8RC 5F6IB 2UUDK 4EDXA 1OB0A 3GHPA 1S7XB 2OM5A 3ZOAA 1A6PA 2K6WA 2YXFA 3V0DA 1XF4A 2D0GA 1S7RB 1JPTH 1NIEA 2NY3B 4AM0B 5ITBL 5IKCB 1R0AL 3O3BA 4N90D 4ZPVA 4JZJB 1J8SA 4KO7A 3D3VA 1KTJA 4JZNB 4LIQL 3N42F 3NJHA 4M8QA 1OM3H 1F4YH 1EFXD 5HGAA 4EE2A 4PGCA 1YCSA 2XBTA 4TVUA 3S35X 5J1AB 4N0RA 4WFHD 1N0XH 4IBVA 1MWAA 4PRAB 4YNYB 5D93C 4OM0H 5IFHL 2EH7L 2QSCH 2C1OB 1W72B 2WW8A 3BKYH 2LABA 1TCRB 3L3DB 4PJDB 1A7RH 1AHKA 5LGHL 4K55A 3VFSA 2X38A 3F7KA 1WLHA 1KOAA 4HPYH 1TEYA 3CVDA 1FH5L 5FUCE 4GG8B 1DN2A 4OT1H 4AENA 1CURA 5I6NA 2GPZA 4IIQB 2WLMA 3NIFF 4JQXC 1KELL 3WCYA 2ISDA 2EC9T 3DV4A 3W0WB 2BVOB 2V2TA 3ARTA 5B39B 5ILTH 4JO4L 2AEIT 4JRXE 3CE1A 3B1TA 3HLKA 3JYCA 4DP9X 2P7TB 3C8DA 1LO4L 1JCVA 1QLRB 3K6FA 3L9RB 4GYBA 1IAMA 1XIWD 4PP1D 1WFTA 5KBDA 2FZ3B 3O6MH 4L29A 4ZRGA 3IKKA 2L3BA 5HHME 4FQCL 2IBZX 2NYYC 2X4UA 3OG6B 3B9KD 4H1LB 1A6WL 4NO3B 5HHVL 3THML 1DLFL 2NQDA 3VTTA 3QUMH 2NDFA 4PRPD 1GZHA 1Z9NA 1DSFH 5HDQL 1E28B 3AABA 1QUPA 3QFGA 1J0JA 2HT3D 3TBWB 4UTCA 2VERN 3SJVD 2C9PA 1GZQB 3ZL2A 2DJUA 5CEYA 5FKPA 3VVVA 4G6FB 4I9XA 3FF8A 4DP2X 3VFGH 3TF7C 1ET7A 5IM7B 4IU2A 4QJ5B 1E27A 1QKZL 4NZ8A 5K1VA 4TNWK 4MYPA 3PHQA 1AI1H 2BZ7A 5F6IC 2F0CA 4W9CC 4I3RH 1MHEA 4NM4L 2ZXDA 4X6EB 5AWNH 1NC4A 2H1XA 2Q8AL 1Q9OA 3VB8A 5AG8A 2NY3C 4JJOA 1BFOA 1RV6X 1YEEH 3GMPB 4HMDA 3MUZ1 1QVOB 2CO7A 5J11C 4LASH 4U6XA 2AI0L 4PJDE 3LN5A 1NCBH 2F6AA 3K7UA 2A4ZA 1AKJD 1I7UA 4HLZG 3VFWA 1NBYB 2VGLM 3E6HB 4UAOB 1ASPA 2HVBA 1RH8A 3UTZB 3W39B 1NOLA 1G7LA 4XRCA 4DKEL 2W0FA 4K7FA 1DUZB 1IQWL 5FYKD 4WGKA 5C0AE 2DKSA 3UZEC 4LHUB 1MDTA 5LGJB 3W0WE 4JFYB 5CFHA 2JXMB 4CC0A 4YFLI 4W70A 4Z7WA 4TTDC 4M6OH 2ZNWA 4H88L 4XPFL 1JUFA 5D1QA 3D08A 3PQYB 5IVOA 5FF6B 1SN2A 1JF1A 2R0LH 4Q9CA 1JYWA 3VXMB 4ZNEA 1ZV2A 1ETZB 3FKUS 1ZA3A 1GYWA 4NGHL 1IAOB 2FWUA 4M1DH 1RHHB 3D18B 2AJZB 2JQZA 2XQYG 1XQ4A 3QDJB 4FXKB 5AZ2L 1F8TL 4OZGB 5KYWB 2XWBA 4GS7B 3HG0A 4LHJB 5GGUA 1BVNP 3S96B 2PW2A 1AQDA 3QPQC 3WS6C 5ESAB 1RZIB 3WXWH 4JKKA 2VE6A 4GBXC 1AO7B 1ZE3H 4OLVL 2DTSA 3ETBF 1Z5HA 5AOMA 3V0AC 2NXYB 2R69H 3FH7A 1MJJB 2ZUQB 4OQTL 1U58A 5D55A 3ZUNC 2PR4H 1FO0A 1GPOL 4YSTA 4KOCA 1AD0A 3NN8A 2DQHL 3V0HA 1ADWA 3O11A 4RVBA 2BMKB 4U6YA 4P9HH 4FLRA 5BOJA 3DBXB 4G8FA 5E8DH 5ICXB 3TEYA 3ZTCC 4HD5A 4WKZB 2KLTA 2IDUA 1NBQA 4M03A 5MP6L 3MJ8A 4IBYA 1IQDB 2KDGA 4OI7A 5C0BB 1RPUA 2WN3A 5L2KB 5MEND 4Y19E 1U42A 2NW3B 4Y89A 2VITA 4TQEL 3P9MB 5IVZA 1I3RA 1HL4A 2YIHA 3FFDB 5DVNA 4M29A 3MV8E 4PY8J 4U1MA 4D0CB 4G80B 2XTJB 2FIRT 5JORB 1UB5A 1QUNA 4TULL 4U0RC 4IK6A 2ZX5A 4Z5RA 5IB3B 4HUUA 2XZQH 3C5ZA 1HHJA 4AC4A 4UAOC 4XI5D 4CU6A 4UINH 2VXQL 4LHQB 4WU7B 3RA7L 3WNJA 3K71A 1JRHH 1UZ8A 4F2MA 5D7JB 1H3TA 1KYOK 3GHBL 4HJ0D 1CGVA 5TK2A 5BUPA 3PQYE 1EIBA 4N2AA 1CL7I 3ETTA 2AEPH 4IKLA 3VXME 1OPGH 4OI9A 3GD1C 1QPKA 3VI3F 4ZYKA 1HWGB 3HG5A 1IC7H 4IRSA 3T4AB 5FLVA 1IZKA 4WW1A 4NQXB 1YEJH 3QDJE 4YQXH 5IQMA 4OZGE 5KSAA 3DGGA 4BKSC 2HLFC 2BLFA 1DHKA 1KB5B 1FFOB 3IMRA 4FMVA 1Z1WA 1AAJA 1IBGH 4ICWA 4IKIA 5LLIC 1XF2A 1NEUA 5LBGA 1AO7E 3BIKB 4FXKC 1F0LA 4GS7C 3G3LA 2O6DA 5IR1A 2VMDA 3QDMD 2UY7A 1G7IB 3DYOA 3L8QA 4JFHD 2IAAC 1PY4A 1MNUL 3QZNA 4ZUUB 1KLUA 2QPDB 4OFYA 1AZUA 2NXYC 3VWKB 4XVJH 4BQ8A 2QKIA 1WF5A 3LNIA 3ZY7A 2ZUQC 1PYWA 1AIFA 1ZMYA 3WN6A 1F58H 1IEAB 4U7SA 3V4VB 2EDHA 1XV8A 3NSXA 1ZSDA 3T0ED 5AG9A 4U1SB 1LK2A 4Q2ZA 4DZ8A 2Y69B 2ZOUA 5CIPH 1OAYH 5C0BE 4UMGA 2P49B 4W9GC 1J5HA 3A23A 1XHHA 1BQSA 1A9EB 2ZKHH 2ZSWA 2ZUYA 3HS0A 4JREB 5LCVL 4AIEA 3FQRB 1VFAA 3L6FA 1BIHA 2NY4D 2EVJA 3RWCB 2G9HB 3L3IB 2DV6A 3D0LB 4GW5A 3CSFA 1JGVL 2XTJE 4A2DA 5E1AB 5IOKA 1DJYA 3L1OH 2EIDA 3M1BB 1HS6A 2BNUA 3L17A 3ULUE 2V9QA 4ODUB 5HDBB 1EFXA 5BZDA 3O2VH 4YDKL 3US0A 1XWVA 3OR7A 3KZ8A 1BQHA 3NZSA 1TVHB 2XTJC 3K8LA 3BUDA 3OPZL 5KG9A 4X9HA 2B77A 5DZOA 1D5MA 1GGTA 2MOVA 1TO5A 3CLEH 1BP3B 2XQBH 3RWFA 5IB5B 4JR9L 4YZFE 3HC3L 4PTUB 4RGMC 3ESNA 3ZE0B 1SN0A 3TEWA 2X4QA 2XJKA 4OQTA 5D7JC 4XXCC 1NFIA 3QSKB 4MYWB 5EOCJ 1XCXA 3ALPA 2OL3H 3KMDA 4KBPA 3ZX1A 2WCSA 2AABL 2WVVB 1OHZA 1CBVL 3CFJA 4IBLT 3TNMB 4OBRA 5E6ID 4PRHD 3T4AC 5H94B 2UXGA 2FEDD 5C86A 4FMKA 1BZOA 4RMBA 5IBUG 2I60L 3EIFA 4QHMB 3BO8B 3DJ9A 3HI5L 1EXGA 1ZGLP 1JTPA 1ZVHA 1EGJH 3FN0H 3LXBA 4ELDA 4LQ1A 3BGFB 4U1LB 3B9KA 5EORH 1IGCH 1IL1B 3E6FB 3EO0B 5IB1A 5TDNB 2CKBB 2GKIA 2JTDA 2XCMC 2YN3A 3CK0L 3IF1A 4PRPA 4UQEA 4XP5H 2HRHA 3AY2A 1HAUA 2NZ9D 4XMWA 2XRAL 3NJXA 4TN9A 5AKSA 2HFFA 3X1EA 2J1WA 3MLWH 3VWKC 5A7BA 43C9A 2GJ6B 3LQAH 4R2GB 1PIFA 5DEFA 5F1IA 5I18H 4K7PL 5EPMA 1E9PB 4IQHA 1IGYA 4P05A 1MF2L 4YK4B 3WO3B 2VSCA 2WWKT 5JOEA 2VXQA 2WN2A 1IKFH 2BRRL 4PS8A 1A4AA 5ELIA 3TO4B 2Q7YA 2Q76B 2EINB 5CZKA 3I85A 4AXWA 2FJGA 2DYSB 4AYEC 4JREC 1JPST 2APTA 2WQAA 2M2DA 3ZJAA 8FABB 1GW0A 4H4NA 1YC8A 4FP8H 4CADB 1C7SA 2B16A 4Q4IA 1N3NA 2KZ1B 3AS0A 3VG9B 3MC0A 5G55A 5B1BB 3IVKB 1UATA 2FHBA 3KPRA 2XXFA 5F8RC 1UOKA 4HV8B 4OU3A 1AKJA 2EILB 2VMEA 2A3TA 1AGFB 1XF1A 3KDMA 4LGPB 3ZE0E 3KE0A 4PGDA 4N85A 3FSWA 2CGRL 5DS8B 5F7WC 1PD0A 2IO5A 3DKHA 4J3SA 4JNXA 1AXTH 4N2IA 3Q43A 4OM1H 2GUOA 1MCRA 1YMMD 4D9RE 1X4YA 4MNGB 3V8CA 3FC8A 3EOBA 5CU5A 3TZVB 3EYVB 4ESKA 2XVGA 4M5ZL 3JUZA 2OA9A 4B9FA 1L7TL 3ULVE 4EDWH 1ZCRA 1AE6L 4PRNB 3L13A 4ZOAA 3HB3D 1T1XA 5FUOH 3IFLH 4FFWD 5DHXB 5LCVA 3UC2A 5F7DB 3LPPA 3WS3B 3ULVC 1T03L 2KLSA 1ES0B 1L9PA 1OEZW 4JK0D 1LEIA 4I18A 4IYKA 4OCWL 3BGFC 1QABA 3PY9A 2AHIA 4KVCL 4KI5F 3B43A 3BHBA 4M9PA 2JJVA 1BBJA 2XYBA 3UBXG 1X5ZA 4YSRA 4OD1L 1PKOA 3CVIH 1A9BA 4JRYE 4WNJA 1JXKA 2AJ3B 1YQ2A 4R2GC 3U36B 1M3IA 5K9KA 4YK4C 4P2QA 4N2FA 3U1PA 2WLJA 1JGEB 5K1JA 2CA4A 4RFOL 2WWKO 4G8EA 5DSCA 3TO4C 4PJAB 4PJGE 3O9WD 2HLAA 3HAEH 3ZVVA 2QADB 4Z76A 1KNOB 4UDUA 5AZEL 1LE9B 2HTLD 4JE0A 2EDEA 3TJHD 2WWMC 2FHFA 1KPVB 2X42A 4ZXBD 4LVNB 2MPVA 2HSIA 2ZPKH 5F1KC 3VQ2C 4LLDA 5LBVA 3EFOB 4HS3A 5LO7A 4JFTA 3VG9C 4R5TA 1S4IA 2X3CA 4QLRA 5FGRA 5HYSG 4XMKH 3N9GL 4K5OA 2VO5A 2HUHA 3NZHH 1J48A 4UM8B 2XWDA 2O5YL 1U2YA 3CN2A 4X7TA 2XWCA 4DO6A 5EA0L 3DX7A 3BZFB 1EEQA 4MA3A 1OLLA 2CHDA 2ICCA 4J3BA 5FV1L 5JXAH 2ODIA 1XSKA 4M6ML 2FVNA 3B7TA 1PX4A 4HS6B 4IHOB 2X4RA 3GZOA 4HDIA 3QIUD 2EEBA 3BD4A 1ICTA 2VH5H 3TZVC 1FP5A 1PZ5B 2OQJA 2BSBA 3FCTB 5DQJB 6TAAA 3TJEH 2YD4A 1PD6A 4ZUSB 2NUTA 2GC7C 4HIEA 4FOMA 3U30B 4TPRL 1DBJH 2YRZA 1B6DA 2VQ1B 1UWXK 2XN9D 3DI3B 2FATL 3N6YA 2J12B 1OTSD 3HW7A 1HCYA 1HHKB 1Z9PA 2ZUUA 3RUGF 4E9RA 3EGXA 1EZVY 5IJVA 3QDMA 1FHGA 1VFUA 3AM8C 1SHSA 2X6MA 4R6UA 4Y2OA 3I3BA 5I15H 3FHEA 4MD5A 5F0JB 2LW3A 2EYSA 3X14B 4C56E 4JG1L 1ZTXE 2W80C 4JHUA 2IV9A 4OW6A 3QRGL 1B0GA 3K91A 3S3PA 2WTOA 1DQLH 2BOBB 1K2DB 1K8IB 5DRZA 3RWIB 2FJFB 5ITFB 3PYCA 1K5NA 4R96A 4XTRD 3BAKA 5ISZD 2APFA 2QADC 3HG1D 12E8L 1UKQA 4OB5H 5F9WB 2C5DC 2CK2A 4ZT1A 3IAQA 1FPTH 3FU3A 5EOCH 4FA8A 4M7JH 3QI9B 1OZTG 32C2A 3HAEG 4K5NA 3UYRL 4X8JB 3NJGA 5IESL 4LVNC 5DHDA 3VD3A 3K5SA 1RU9H 5ADOL 1N5AB 4HJEA 4HZLB 2C26A 4N9GA 2ITEA 3M17A 3L3OA 3VFNB 4F7EB 1MFEL 3CN1A 5DR5L 1SOQA 5IW1B 3U83A 2Y06L 4IEFB 4FERA 2KL6A 3BISA 3FHQA 2R29H 2FDBP 2Z4QA 4HP5A 3LOWA 4N0YH 4A7GA 1KIPA 4JDVB 5E4OA 3TO2B 4NRXB 4PYHA 4ODTH 1VFBB 1WZ1L 3LQZB 4MXVE 4POYA 2CO6A 4NQDA 3K8MA 1FVEA 4FQQA 3OXRA 3VXQA 5CP7A 3LEYL 3L1GA 4K9EC 1G0YR 1J9TA 2E8YA 3BVUA 5JXEC 1DBKH 5IVXA 1KF9B 5E6IA 4PRHA 3HCVB 3Q3GA 1PLGH 4GAAA 2EABA 3E8VA 1DJGA 3U30C 4DIXA 4DQOH 3K6SA 1EAPA 3AG3B 4E68A 1F4WH 1XR9A 2GIYA 4I1NB 2PPFA 3BEWA 4J23A 4YDIL 3WSQL 1RZFL 2JKXA 1YZZA 5F7YC 4L4VD 5I76B 1AYOA 2X0VA 4FTVE 2EDKA 5KJ7E 1NGYB 2F1EA 4MXQC 4GUCA 3LVEA 4OLWL 4Z0XB 2ZOKA 5IG7B 3FB5B 1SBSH 4G1EA 1N4XH 4Z6AT 2IDQA 3D0VB 4KVPA 4BM7A 3LNGA 2WOBA 3WNMA 5GRVL 2MCAA 3VGFA 5EOTB 2Z8VC 3P4MA 2VDKL 5LN8A 5F7BA 3KXFB 1JK9A 1HKLH 1IB5A 3K6DA 4D9LH 1X5JA 1UACH 3FT0A 5F9WC 5JW3H 3IYLW 5B4MC 5AVYB 2H45A 2WBJD 1XZ0B 2UWEB 2IWGA 4UM9D 3RU8H 3QI9C 2BWQA 3CMOL 3G5ZB 5JIKA 4YZWA 4XNBA 4YFLF 5FCUH 4WTZG 3F7VB 5DRXA 1DFBH 3TBTA 3HN5A 2MTAA 4KWUA 2Q3ZA 2ZQKA 4AV4A 2KPNA 2DICA 3S5LA 5GZOA 2YLKA 3QG7H 3O8XD 1IEBA 2W94A 3Q1SL 1D5IL 4MQXC 3IJYB 3MNVA 4ZFFB 4MA7H 3UCQA 1HAWA 1E9OB 1TVBB 5BQ7A 2AJYL 5E51A 3P3UA 5JYLA 4AVKA 2NCMA 1PDKA 4HCGA 2XG4B 5FIEA 2JLLA 5BV7C 5DRWA 4EKJA 4X9BA 5ACZA 3MCYA 3T5WA 3U2IA 3N41B 2IBGA 5E8EB 3ILPA 3RP1A 3LZOA 3RVTC 5GS0L 2QHRL 1FG2B 1M05B 5T1KD 3TN0D 4RLDA 1U8JB 5D1ZA 4U4BA 1W72L 3ARGA 3UPAA 2VDPH 3GEWB 1UCBL 3ZDYF 5JHLL 4MAUL 2HZHA 4FCHA 1IGML 1J9SA 1MHHA 3NA9H 5A43C 4TUJB 1JZIA 2JKNA 1FFNA 2F7OA 3UTTB 2CHXA 1LDSA 2W9EL 4PJ8C 2IH8A 5DJZA 1XEUA 2YARA 3CZSA 5SV4A 3WBDA 3OKOA 5SWSE 3LH9A 2APXA 4IKNA 2YR3A 2HRPL 4TNVK 4UQAA 5ICZA 1N70A 4KUZH 1KBVA 1HYSC 3PP3H 2EVFA 4WUKL 1U4EA 1TJIH 3O9WA 3V0VA 2VABA 4UBDC 3TNNB 2VN5A 1NIBA 1BFTA 1U8KB 2Y6SC 1SJEA 5FYJD 1JPFB 3WKMH 2WUBL 3ATFA 5DMGC 1GMIA 2HTKD 2AITA 5EOQL 1ZD6A 2DOCA 2X3AA 2L7UA 4JQVC 4NJAH 3MRCB 3SDXB 1NFDB 1PY0A 4L8SA 1CU4H 2C4FT 1SF5A 3HBZA 5A3IC 2VDRL 2X5PA 3U0TA 3LXUX 5AD0B 1J5OH 3BP5A 3FUIA 2OMUB 4BD4A 4JPVL 1ZANH 2ICEA 3ASOB 4FNUA 2VAJA 4ABWA 4HKJA 3AS3A 3MJ9A 1CFSB 4QRUA 4G43A 2EVGA 4B7IA 1RUAL 4F58L 2QBWA 4XNDA 1JV5A 1CF1A 1ZT7A 2PWDA 3MOBH 1PX8A 1SEQH 1S8DA 1JD9A 1AQKL 1XF3B 5IJKC 1T6WA 3D4ZA 4GAJL 3SIKA 3VD1A 3T77A 5DU7A 2IH9A 4E9YA 4JRXA 4XGZB 5DYOA 1XIWB 2PTUA 5T3XE 3HNSH 5FO7A 3DVGB 5FB8B 5JZ7C 2XWZA 3MCLH 3OKMB 4TNVF 5HVWA 3MLVL 2MHAA 1CYWA 5D1ZI 4MAYD 4BINA 3RKPA 2DQFB 1WT5A 2CM6A 3I50L 3HG3A 1E4XL 3KYOA 4PJFE 4PREB 2ICWA 2IMMA 1U3HD 1U33A 2AEQH 3UTTE 1QEXA 1LM8V 4HH8A 1AZZC 3NCBB 2CBMA 1GKOA 1L0PA 3R4DA 1FBIH 1CGXA 4NRZB 3SJVB 2LTQC 1MJ7L 3DHUA 5IOPB 3KCPB 3HZ3A 1I8MB 2VSDA 3V4UL 3VRJB 3HNTH 3LRSA 4YHNA 3CDGB 4EZJA 3IDMB 3MRFB 4JPKL 1JP5A 1A14H 3L3HB 3NCMA 2GW5A 4MDIA 4EN3D 5I0XA 4QRQB 2ZCLH 3CUPA 3R7QA 3P4OB 4HAKA 5K9OA 5LDSA 4U6HB 4IRZL 4NZDA 1UWGH 5G4NA 1WWBX 3GB7B 1P4BL 3PL6A 4R83A 5AW6B 4HX1B 5CJQH 1U8CA 3FQNA 4DOHB 1KMGA 4TNEA 1JE6A 1HSAB 4D94A 5F9OL 3LMJL 3HG1A 3T71A 5C9JB 2I07A 3CX5K 5M94B 1VACB 4YLBA 2HLEB 3IPEA 1AGCB 1NFDE 1WGOA 1Q0YL 2ZWYA 3SDXE 3ZE1F 3ZE2B 4E42B 2WCGA 2X10A 2I24N 1RPKA 3S36H 4HIHA 2BSTA 4XNMA 3BXNB 3CHRA 2E27H 4YSQA 4GJTB 4KROB 4WHTB 3FO2A 4IBQA 5ISZB 1MJ8H 1T1YA 2F58L 2QT6A 4JAMB 2NXZB 4BRJA 5EU6A 1NLBH 2DQCH 4PWFA 5FYLH 2R2BB 3IDUA 1OGSA 1WBXA 1OAXH 2PKDA 1K4CB 1I1CA 1AFVL 4LESA 4DEUA 3T1FA 1K5WA 3E80A 3FJTA 5C0AA 4EIBA 2YD0A 3NMEA 3EYSH 4KK6D 4OZIE 3P73B 1X5AA 3LS5H 1KTLB 3GGWA 3QARA 4MVBD 4IOIA 4ZAKD 4S1RH 1KTCA 2C9QA 3CD4A 2HMIC 5FFLA 3MV01 4FNLH 5LXGL 1GOGA 3ULUL 3ARZA 3L5XL 1FWXA 5ENWB 3BDYH 3RY5A 1XIWC 3V95A 1W16A 3CSYA 1G7QB 1TXKA 4M6NH 4NKIL 2A6IB 1HOCB 4FNRA 2PP9A 4GBXA 4LEOA 2A6KB 3CFBB 4F5CE 3SJVE 2KQNA 4BZ1H 1YNTB 2ICWI 4JQIL 4N2DA 1NMCB 3MLRL 2JKJA 4J8RA 3JQOB 1G7HA 1Z3GH 2HT3C 4WGVB 2R1WA 2Z8WC 3PUUA 4UUJB 3QGVA 1OVZA 1E4JA 4KTDL 2VJXA 1FFPA 3GJFB 3HR6A 4WV1B 5IT2H 2C9SA 3UO1L 3W3BA 3ES6B 4M1CC 4DOHE 4LSVL 1R5WB 3IGFA 4P3WA 1N5YL 3TT3H 2NX5B 1YA5A 4ATTA 1Q90A 5DURD 4CJ1A 1FJ1A 1WG3A 3F7RA 2XXGA 4J28A 4IRJB 5MENB 4HEPA 5I30L 4LSPL 3C6EA 4Y19A 4OLXL 1NGPH 2OSLA 1BQRA 3MUGA 3VO0A 4JFZH 1CE6A 5IFJB 1MUJA 3J27A 4I5BA 1OF2B 4EBQH 2H8PB 5AAWA 4HK3N 3MV8A 1GGCH 2CUMA 3VTAA 2VTFA 5DK0A 3WY4A 4KROC 1SYVA 4AT6A 4CL7A 5DDHB 5L2JB 3H9SE 2VDOB 2NXZC 1I8AA 2BNQD 5JPMA 2DWSA 1YYCA 3F6IA 3GBMH 4JMNA 3TWCL 3CLFL 1KCVL 3C8HA 3F7LA 1USQA 3CSBA 3P77A 4NN7B 3CQQA 4IOSA 2FAUA 1JTTA 3EYOB 5L9DH 3GS4A 2LGNA 4WK0B 4DPBX 1RUKL 3INOA 3UH8A 1W8NA 5B3NA 2GSGB 4BE6A 5KJ4A 1YEIH 4RFEB 4WU5A 1KIUB 1NGXB 1YPZB 5F9JB 3QXAB 4IRZA 1V27A 4UYPA 4NHCL 1OF0A 1U6AH 1KGCD 2MQCA 2WOYA 3CFTA 3GS7A 2YEVB 4P5TA 5BMFL 3PABA 1FAKT 3MJ7A 3QUHA 3BKJL 3L3GB 4Z7QF 1MAML 3MNZA 3OQ3B 3EOYG 4H20L 4FADA 4FNTA 2XJLA 1N0LB 4BZ2L 2FWOA 1MLBA 2QVIA 4FLQA 3T09A 4G6KH 3VXPA 3OB0K 4JDEB 3QULB 1NMCC 1I1FA 3LD8B 3LHAA 2E47A 2EYSB 4NC1E 3ZR5A 2YSSB 4HPOL 5I73B 4EI6A 4Y8DC 2LE9A 3D50A 3TEZA 5KSBB 1X5GA 2O6FA 1RK0A 4XB7A 2L7JA 3I84A 2C9XA 4NC1C 1XH3A 4A55A 2IFFH 4ZPTB 2NZ1A 3A4DA 2NX5E 3T0EB 4OTXH 1CICB 3IRCA 5ACMA 4WV1C 5ABDE 1GGYA 2V5YA 3DMMD 4FYRA 3ULVL 4GRMA 2G2RB 5MENE 1SJXA 2Z31C 3P9LB 3P3SA 2WGXA 1JPSL 4OLYH 4CVXB 1LO5B 4RQQA 1BM7A 2NY4B 5TJWK 1IT9H 3C2SA 3EBHA 3GHEH 4IRJC 3GKZA 2HKFH 1RK1B 1ZLWH 4B97A 4Z3IA 3PV6B 5JQ6H 2ADJA 1CC3A 2XZZA 1I8IA 4GUQA 5HJ3A 1A1OB 2W88A 3ZK0A 1J9RA 4FDWA 4FMFA 1VEMA 4YLQT 4TYUA 4XI5C 2R23A 3QNZA 1E4XI 2OX5B 4X9YA 4DGIH 1JK8A 3AACA 5FDWA 4O2EB 4WK2B 2GABA 4JHWL 1B90A 1H3UA 4NN7C 4QDGA 5DJ6B 4NNXA 2WZ5A 2VUKA 3DUSA 5I66B 2N7AA 4PJHB 3AGWA 1QNZH 3RWHB 4R90H 5JW5A 5KN5A 5MHSD 3ETBJ 2CLVB 1X9RA 3EZJB 4O58L 5T3ZE 1JDDA 1T5XB 1NUGA 3FOLA 4PS4H 4LCYA 5CS7A 4YAQA 3QG6B 2ESVE 4CN4A 1RKRA 1DLHB 1HQRB 1QWNA 2XZCH 3KWWA 3BAEH 3VX0A 2NTFB 2VDNB 4JFHE 5TE4L 5MEPA 5E24E 3P4NA 1EJOH 3LHPH 4DGYL 2D7NA 3X12A 5EWIL 4IU3A 4B53A 3U9WA 1G6RL 3SBQA 2O26U 1U3HA 4KJWD 5JA9A 1K72A 4YE4L 3MROB 1YJDL 3LD8C 3Q7JA 5FOJA 5CLXA 1I8LC 2P5WA 1IARB 3HJEA 4ODSL 4J3OD 3T0EE 4P57B 3FO1A 2ENQA 4UV7H 3V7AG 4EN3A 2WY3B 1P4IH 3T0EC 1OL0A 1IILE 1CICC 3ME0A 3M1OA 2AQPA 1BHGA 2AXGA 3K2UL 5I1LA 2F5BL 5CGTA 1CZ8H 1FNEB 1C5BH 3DIDA 4WWKA 1U2HA 1ZEAL 2F9BT 2P24A 3BWSA 1JGDB 4YDZA 2VW6A 4B0MB 5LAXA 2NY4C 3KGUA 3L1FA 1PNCA 4NZTL 3S4SG 5JUEH 3UACA 4R9HA 3A47A 1FCGA 2ENPA 3KHOA 1A3LL 1DL7H 2H32A 2R1XA 3VXUA 2Q20A 4PJIB 4X42A 4ZD3H 3APFA 2W5PA 2ROXA 3TBTB 1AD9A 3V4PA 2VSMB 2NY5L 1A6UH 1XGRB 5IY5B 1ZTXL 2H1PH 3BDBA 3VCLB 4UNVA 3Q44A 4BZ2A 1KCUH 3IDJA 4GINA 2DJSA 2OMWA 3MRPA 4OQ1A 1HCZA 1T1ZA 4PJHE 3VNYA 3B4NA 2BDNL 3LXCA 1QATA 1MFNA 1YY8A 4KDVA 4MBOA 3ZZ1A 4FJYA 5I8CB 3GXFA 2PWEA 3BZEA 5IEKB 1YMMB 3MXWH 3FU6A 3AY4C 3VFRB 1JJUA 2PCPA 3U7WL 1GKEA 5E2WL 1U8QB 1B4JH 1DQJA 4XMLL 1GOFA 4XP6L 5KEZA 5E6SB 4M1GH 2UZPA 1IKNC 2FEDC 2ZOTA 3TFBA 4DUXA 3D69B 1G7MB 4L8DB 4LDLB 1U41A 5H2BA 2N59A 7PCYA 1IE5A 5F3BA 1XGZA 3UX9B 5B7MA 4HJJH 3TU6A 5E6RB 3STZB 3WHXB 1U9KA 1QWUA 5TF0A 3SDYH 4Z7UE 3GI8L 4FULA 4DO5A 1O5DT 2F8VA 2MKLC 4V11A 4G8GA 3WAJA 1KJ3L 3HHRB 2LFGA 1SXBA 3R1GL 2HFTA 5JDSB 2NT0A 1A7OL 2BY2A 4HIXL 1W8EA 2AF2A 2A38A 4U1JA 1KYOJ 4P3DB 5IV2B 5J8OA 3IFOB 4JRYA 3M8OH 1J1XL 3EGDA 2I5YL 3FSAA 1I7TA 5TGBA 1AHWA 3CBRA 3N44F 3CWGA 1SZNA 1T0PB 1JVKA 2FHCA 4PJGA 3RPKA 5IHUH 4YDMA 4K3JL 3MHZA 2G4EA 4KV5F 2Z91B 3GNML 4FQXA 5HHNB 3VQ1C 1OB1A 2UUDH 4PJIE 4ZXBB 2R9HD 4YSUA 5DMKB 4Q56A 1AZNA 1CLYH 3GKWL 3SKUD 3TBSB 1NPNA 2QTEA 4D0BA 1WBZB 2Y7MA 4XBPA 2XX1A 4P59L 4LAQL 1G6RA 1Z9MA 3KYMB 3IFPA 1D6VH 4Y5XA 3T0XA 3F12A 2MCPH 3LNDA 5JHDE 2VXSH 1XSOA 5GZNC 1D3CA 1QSZA 3WFEL 3J07A 1N64H 9PCYA 2P8PA 3QIUB 5GHWL 3UZQA 3QQDB 1OAKL 1B0WA 4QXTB 3RPBA 5T5FL 1C5CL 3WFBL 5DK2A 1VGEH 2ARWA 4KKQA 3O2WH 4G8AC 3O3DB 2ITCB 4I77L 4CSTA 1BM3L 1RURH 1JNHA 2XN9B 3F7YB 2BOCA 1M9SA 4FFWC 3UP6A 5A16A 2A4EA 2O93L 4WKXA 4MD0B 4FLOA 4L8BA 3NZUA 3US1A 2R0KH 3MRLB 1KBBA 2NR6D 3B9DA 4L05A 2BHUA 1JNNL 1MQKH 5AL0A 4P46B 1V8HA 5BV7L 1NGQH 4C56A 1S9KC 4ETYA 4HKZA 4YWGL 2ATPA 3F5WA 4O5LH 4FZEL 1O7DE 4KXZI 2Y3AA 3GSNB 4AYID 3X3FL 3LV3A 3FQNB 1JG9A 2ADIB 1MCCA 1Y0LA 1JMXA 1O7DC 1INEH 1I31A 1UYWL 2IAND 1MCSA 3D33A 1I3VA 3IDNB 3L95A 3SYAA 4J3TA 1FAIL 1SXSA 4B9CA 4F1SA 3RRQA 4DN3H 3SPVA 4WHYH 3PHOB 1KTRL 1O7VA 5I9QB 2GBUA 2BIIA 1FGVL 1J12A 1QSEE 4HUKB 4QAWA 4ZXBC 5IJBC 3MA7B 4FYQA 5DO2C 3DRQA 4HWBH 4HAFA 3RPIA 4ONHA 4P5MA 4ELKA 2QKSA 4WO4B 4TSAL 5HTSA 4PBVC 2KI6A 4W9LC 4JFOB 3QQ9D 2DQEL 2ZUVA 5KANI 3RB5A 4F57H 2N3JA 1FNSL 3Q48A 3KH3A 1UOLA 4G3YH 3RIFF 1JHKH 3A6CH 3D7PA 3K6IA 2R7EB 5CN3A 4Q14A 1ORSB 4V2BA 5KSVB 4NFDA 5HHQB 4DVBB 2V4LA 3GO1H 5LWYL 1W0WB 3KYKH 3QIUC 1RMFH 4GSDL 4WI6A 3IM1A 1G9NL 3NUKA 3MRJA 4AZ8B 5E8NB 4N8PA 2XN9E 1BMWA 3EYUH 3S37X 3VI4A 1LP9A 4QRSB 2WLKA 5GRVK 2FR4B 3WTYA 3NJLA 2VC2H 4FCAA 2YXVA 2WQVA 2CBOA 4UTAL 1MY5A 8CGTA 5F7NC 3MO1B 2VIRA 5FA3B 1MLCB 3PIQB 1OPOA 4ZS7H 1FNGA 4S1QH 5EZPA 1DBML 3Q2LA 4L4VB 2VM3A 4KJPD 4L9DA 3SY0B 3GSWA 4MQ7A 1U8NB 1D2PA 3LS4L 4X4KA 1JZ5A 4FTVA 4HWZB 2CK0L 4P46C 3BEVB 1SXCA 1VZGA 5ADPH 5FO8A 4PLKD 4B5EA 1IM3A 1RULH 2WGNB 4O2FA 4AE1A 2Y2YA 1L9QA 4GQZA 3X1FA 4WFGD 4XCCL 2WO2B 5T3XL 5DFVD 1A4BA 3CH1A 3P02A 3L4XA 2IBBA 5BZWA 1EBAA 4KKLC 4QRRD 4FXLA 3WTTA 4UF7C 3EJPA 1HHGA 5T5FA 1NCGA 1HILA 5HJBA 2JH2A 4DP1X 2WBJB 3BJLA 5ID0A 1BFVL 4JFXB 4UM9B 1SOSA 4PVNA 5I9QC 2ZG2A 4XNYL 1ZY9A 3OF6A 4NKDA 2DD8L 5D6CB 5ETUA 5FWQA 1JVOA 4WHYG 3L2LA 3L3JA 4WO4C 4TLTA 2CIIA 3U4EB 4XPAL 1D2OA 2V33A 3GMNA 3DSFL 2DBLH 5CZVH 2JJUA 1MSPA 1MCOL 4KJYB 4KOBA 2GFBA 3WUWB 5EEWA 2DWDA 3RKDC 4Y5YB 3O8XB 2C7UA 4XXDB 5DUBB 2WLLA 4HIIB 4RDQG 1HEZB 1Z9SB 2BFVH 1NPUA 2ARJQ 3RWEA 2DQIL 4GY4A 4WLCA 1CQYA 3WE1A 3FOMB 1MFDL 2KZWA 3BKCH 3T2QA 4ONFL 5G4OA 5HSFA 3DX0A 3GMOB 3MRKA 4LSUH 5C07B 3AS1A 1ZHLB 4N6RA 3KLDA 2VW4A 1A6VL 3OC5A 4GAGL 4BFRA 5T1KB 3TN0B 4ABQA 1UQSB 3ULSA 1MAKA 1BV8A 2WTPA 4YBLB 2VZSA 2F8IA 1P5VB 4LK4A 3V6FA 2FIKB 1SJMA 4P2RE 4UQ2B 3VWJD 3J8F7 3MGTB 1EX0A 4LDOB 4BCYA 2CO3A 3QJVB 3K6NA 4G42B 1CXFA 4JG9A 5LBSH 1B0RA 4PR5A 4YDJA 1L9MA 4PJ8A 4A6YL 5I24A 4IGBD 4JFWA 2JJTA 4IMKC 1JF5A 2GTWB 4RAVA 1MVUB 2JB5L 3CHQA 3CFDB 3SOTA 2EYTB 2H3NB 4P0DA 2HX8A 4K07A 1F4XL 2ZWNA 5EUOB 1AG6A 4OCRH 1DJSA 2EDRA 3BP7A 3NPZB 5SWSA 1GIGL 5MEOA 1XCQB 1TTAA 2NNAB 4Q89A 5G5DA 4CBPA 1C1EH 2PCFB 2UZIL 1T7VA 3ZTEA 4MFHA 3NRQA 4PJDF 5JIPA 5IIEA 3ZZLA 3RNQA 1VENA 2ZYRA 3E1ZA 2O1AA 1K85A 3D4YA 3B2VL 5AKTA 4PRIB 2WBJC 4NOFA 4D3CL 3DROB 3KS0J 4Z95L 4FAAB 2IOOA 2IAMB 4TOYH 3QWOA 5EIIG 3LKQA 4LLMB 1CFNB 2PPCA 4QTIL 2F7RA 2J3SA 3UPRB 2PYFB 3SDCD 3IBEA 4Z78B 2BPBA 1C8QA 2D73A 3NFSL 4JJ5A 4UTAA 4CMHC 1QFUH 4U1GC 3OQRA 5D7SL 6PAZA 3NACL 4BH7B 2CG9X 1CF8H 2ZYIA 3DVNB 5AW1B 5I6PA 1P7HL 4Y5YC 1RSYA 3O8XC 5JOPD 4MWFB 1GJIA 4Y0GA 3FU0A 2ALAA 1L5GB 5C07E 4KZDL 4DP0X 3AUVA 3VFUB 3MODH 4LLQA 3NCJL 2XWTB 3LH2L 1U93A 4G6JL 4LL4A 5EBWA 2EXTA 1BZ7B 4PQXA 2XHNA 5E03A 3WEXB 1U95A 2EYRB 2BP8A 1LYQA 4GKNB 1P5UA 2YGPA 3WDHA 2MEJB 4XVOA 1KJVB 3OB8A 5IW6A 1A7NL 4FXGA 3TN0C 3V52L 1ZJAA 4CC4C 3MRMA 4NKOA 3MACH 2IQ9H 2YXMA 4JB9H 2FL5B 1F41A 2G2PA 4MAYB 2IDCA 4YBLC 3SB3A 4AEIH 1HXYA 1GA2A 5TE6L 2LV4A 2N01B 5ESVA 2WJ7A 4PJFA 4JO1L 1I9JL 2O5XH 4OV5B 4XBEH 2CJUH 3QEUA 2VN3A 4HJSA 1RUQH 2BSSB 2G60L 1FDLH 3CZFB 4LRNH 5FHAL 3WFHA 1T04A 1AZVA 2EKSB 1MRCH 1T7ZA 2E46A 2XQ0A 2ED8A 4TUOB 5EUOE 4QHUA 3RVVC 5HDOA 3CAFA 4PV8B 2QHLA 3ARDD 1KPRA 1U92B 4M7LT 1NAMH 2HXAA 3N1GC 2CALA 3QWRD 2OZ4H 1WTLA 1WFNA 4GSQA 3MXVL 4RGND 2H6PA 1UXWA 1KBPA 2W65A 3ZMRA 2VSKB 2WUCL 4JJHA 2L4OA 4Q9RH 1FZKA 1UM4H 4FKHA 2J20A 4ALAC 2IANA 3IE9A 1M7DA 3MRIA 4PRIE 3X11A 5F9DC 1BECA 4LSSH 1ZVSA 5EU3A 4OY9A 3KPMB 4RAUB 3VSTA 5FK9A 2E56A 4EI5B 4BKLB 4ONOA 3O6LL 4AEFA 2D2OA 3BN9C 2WIIB 2IAMC 5E5LA 5T33L 4K71B 1R34A 1ZDQA 5FHBL 1P4LB 1WPCA 2IGFL 3G5YB 2GIXA 5GGTL 2VDQB 3DNKA 3F05A 3FQTA 5F7UA 4B9YA 2FJSA 4IJTA 1IM9A 4E5XA 1DVQA 2ROYA 3OKEA 1WRFA 3IMWA 2YMXH 3BPOB 2PWGA 3CVHH 4QYOA 4OZGF 2V7HA 4A6YA 5M95B 1ZT1B 3WGUB 1KEGL 4NS0A 2HWZL 3KR3H 4LU5H 3ARWA 5D4HA 4ZAKB 4L3CA 3KYNB 4OZIA 2WP3O 2MPAL 4BGLA 2OK0L 2F74A 2Z4TA 2DMKA 2GJPA 1ADQH 4KX8A 3HNVL 1NSNL 4L4JA 3VU1A 2JE8A 5EZLB 4KZEL 4QO1B 2AJXH 3Q6GH 4OZFB 3GLAA 1PKQA 4MAYC 1QR4A 1IVTA 4JRFA 4MHHG 2WQUA 3WU1A 4LCIL 2X9XA 1BYOA 2YK1L 3HUJA 4GUOA 2HN7B 1UD5A 5F1NA 3JV4B 4LPYA 1U36A 3LYRA 1YHPA 3MX0A 4LL9A 2HVKB 5DJ2B 4PGJA 3KDPB 4NBZB 4FQ1H 3JT2A 1FZMB 4ETQA 1BOGB 2WBXA 4GP8B 2AXJA 2DJ4A 4PCKA 4LLUA 2J8OA 1UWEL 5F70A 3UIZA 3G08B 4FEIA 2XWXA 4NUMA 3LKRB 5DURB 5HHOE 1E5YA 4KKBD 4Y16A 5A6MA 4X4XA 1RJYB 1FA4A 4FA7B 4ZUVA 4G9DB 4OUUA 2P5ED 1YY9D 4YZFF 5B7EA 4EI5C 4OSUH 3V5HA 3FT3A 4X4MA 3NJVA 2BC4B 4K71C 2VQ4A 3HMWL 3K0WA 1DCLA 2BNQB 3AQDA 3H9SA 4OCNC 5DHYA 3SZKC 5CF3A 2R2EB 5I16B 5B38A 3REWA 4EF3A 3MRQB 2AQ3A 3CC5B 3BPOC 3LH8A 1ZS8A 4DGVH 1TJGH 3C08H 1QLEH 1VCAA 3PFUA 1EK3A 4KKCC 1TLMA 5J12B 4MVBC 4ZAKC 3H3BC 3CC1A 1QYGL 4IBTA 4OJFH 3ZKMD 4NP4L 1ILUA 3BVNB 1IJNA 2EH8L 4D0DB 1BVLA 1UCTA 2Z34A 4JPWL 1OAQH 5EBLA 3K46A 4P23C 1V7ML 3B5GA 3V7MA 5DA4A 2ZT9C 4Y2NA 4NWUH 4G5ZH 3TFKD 4LQFH 3CXDH 1A3QA 1N12A 3GZQA 1UWXH 1YNKL 1EH9A 3E38A 3WIHL 5KVMC 4F37F 4QXGH 4U7KA 4NLHA 2JK5A 3VD9A 4P07A 4TVPH 5HGDB 1CI5A 2R56H 4LPWA 2DI9A 4R0LA 4XC3L 4KDTC 3WKQA 2Z31A 1HTYA 1F56A 4MMZC 4IBUA 3DMMB 3MBXL 5D2NA 4GG6B 1N59A 4G1MA 4OIIL 4WFED 2FCBA 3TEUA 1CLOH 2Y4SA 4AIZA 2Q2LA 1FFQA 4J1UB 3KPPB 2P46B 4CW1A 3AWEA 5CLZA 4XPGH 1G9EA 3ESMA 3ZE0F 3AW5A 4CVZB 1FF5A 5IK3B 3TIDB 4WI9A 4GQPH 3K72A 5DJDB 4TRPL 1Q9WA 2BNQE 4TNGA 4H0HB 4TUKH 2ITDA 3ATEA 1RY7B 3SDCA 5LQBH 2AQTA 3GUTB 1HL8A 5IMKB 5E8PA 3BWAB 4AYFB 2SEBB 2X70A 3ULVF 1I1AA 1JPGB 2OMVA 4L4TE 4C4KO 1IGTA 4CAGA 1I7ZB 1MJUH 3VU2A 3O3EA 3GMMA 4ODVH 5E00B 1MWAH 1P7KB 2P47B 1UXSB 3IJEB 4HQQH 1CR9L 3D5OF 4IIZA 3FQWB 5ALBH 5J12C 1S7QB 2V7NB 4ENED 1YC7A 4LCUB 1ED3B 1QBAA 2PN5A 4YVUA 3MREB 2YAOA 2WQSA 5CSZA 2Q86A 3IGAA 4AYMC 5GJSL 1A22B 1A0QH 1UZ6E 5CGYD 1TU2B 2ESVA 3T1WA 1S7WA 3A6BL 4KQ3H 1S3KL 1X5FA 3MCKA 1F02I 4QHPA 2EO1A 3T3PE 5JQHC 1EJ6A 4JM2D 1BPVA 1WA1X 2UXVA 2VZUA 4H26B 2CXGA 1KPUB 1T6BX 3V55A 5ACLA 2P80A 5C0RH 4I0PC 2B1A