4M4RB

Epha4 ectodomain complex with ephrin a5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
141
structure length
141
Chain Sequence
b'AAAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
molecule tags Transferase
source organism Homo sapiens
publication title Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
pubmed doi rcsb
total genus 29
structure length 141
sequence length 141
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4m4rB00
3NJGA 2BWDA 2E86A 3KW8A 3AG1B 3QQXA 3CVCA 3AY2A 5B1AB 3TASA 4YSCA 1BYOA 2CAKA 2XWZA 5D4JA 4KOBA 1ASQA 4KNUA 1AANA 1GS8A 5AFAA 3S8GB 5D4IA 2B08A 2GHZA 1L9RA 1ID2A 2P80D 2YQBA 2BP8B 2QT6A 1WS7A 4M3HA 4P5SA 2AVFA 3SBQA 2HZHA 3WKQA 2PPFA 4A2GA 1DYZA 2YXWA 1WA2X 4E9TA 2IH9A 4N4YB 3JTBA 2DV6A 3PLYA 5A7EA 4MFHA 1JXFA 3PCYA 3QJSB 4ZK8A 4BK5C 3L45A 3ABLB 1BXUA 3BVDB 4PCYA 4CSZA 4KNTA 1HFUA 1NDTA 4L0PB 2HX9A 4HCIA 4G70B 1IUZA 3DKHA 2PCYA 4WTQA 3OMIB 4HCGA 2Q9OA 3FYEB 2ZWNA 1L9PA 2W88A 4DPAX 1ILUA 2EIMB 4HHGA 3TA4D 1EHKB 1KBVA 1WAEA 3NJMA 3TU6A 3NP4A 5PAZA 3SQRA 2CBPA 2R7EA 3JT2A 1FWXA 4HIPA 1URIA 2FNWA 3SBRA 2GI0A 1GW0A 1OF0A 1V55B 4TXVB 1HAWA 1B3IA 3QJUB 1OOWA 3NJHA 2FJSA 2HX7A 3NJKA 2EIJB 3S3DB 3FSAA 3OD3A 4DP2X 2WSDA 3UAEA 4FAAB 4JHVA 2GB2A 2FT6A 3N55A 1J9SA 1ET8A 2J56A 2XVBA 1E65A 2AZAA 2VM4A 1OE3A 4F7KA 3S3BB 1FFTB 1NIBA 1AS7A 4QKTA 5I6NA 3T6WA 2A3TA 3FU8A 2XLLA 5B7EA 4DP1X 3X1BA 1ZDSA 3ABKB 3GYRA 5B3SB 2IDTA 1AS6A 1OCOB 4YSAA 5I6OA 2PPEA 2R7EB 2XU9A 4EF3A 4BWUA 2BW5A 5I6LA 3NP3A 2BP8A 2W8CA 2UXVA 3T6VA 1SHXA 3UGEA 4JHUA 4YVNA 4BWWA 1ZIAA 1A3ZA 1MG2C 2YAOA 4X4KA 4KO7A 1F56A 4YSTA 3T6XA 1BQKA 1JXDA 1PNCA 2AANA 2YAPA 4YVUA 1JZIA 2XV3A 3ASOB 4G7SB 1JZJA 2UX7A 2FTAA 3H4FA 3C75A 5B7MA 1RZPA 1SFDA 1AZNA 3BQVA 2IDFA 1PZBA 2IWFA 4PAZA 2DY2A 4KNSA 1NICA 6PAZA 1R1CA 2JKWA 3X1FA 1OCCB 1AQ8A 2J5WA 2I7SA 1M9WA 2JFCA 5AZUA 3ZX1A 1NPNA 1OE2A 1PLBA 2HX8A 1ASPA 1PY0A 1SDDA 3ZIYA 1DZ0A 1XB3A 2YAMA 3HEIB 3KW7A 1NIDA 1ADWA 4DP5X 4BDVB 1NPJA 1EZLA 2N0MA 5F7BA 5I28A 2BP0B 2PPCA 4E9QA 2XUWA 1KCBA 2EILB 1CURA 2J57A 1SJMA 2PP7A 2I85A 4NERA 3FSZA 1JZEA 4AX3A 3AG4B 1JVLA 3QPKA 1CYXA 5I6MA 2TSAA 2VN3A 3PAVA 5ANHA 4BXVA 2NRDA 3N2JA 2LLNA 2QDVA 3FS9A 3WNIA 1HAUA 1M56B 1E5YA 1AACA 2XV0A 1AS8A 2CCWA 2GBAA 4A68A 3FYIB 3S8FB 4P5RA 2H3XC 3HB3B 3CVDA 5I6KA 3NJNA 2ZOOA 3FU7B 1N68A 1PLCA 2HXAA 1NWOA 2YAFA 2J55A 4A66A 2BZCA 3QJQB 2JXMA 1AIZA 2VM3A 1AZRA 3AW5A 4K9JA 4G7RB 1AG6A 3FPXA 1BQ5A 3FQ1A 5PCYA 1ASOA 3UABA 2BHFA 1GY2A 4W9ZA 4YSDA 2FWLB 1GY1A 4KO5A 3FSWA 1NWPA 1AAJA 1TKWA 4DP8X 1NIFA 2OCCB 2BO0A 1NIAA 2Y1AA 4HALA 3UAAA 1X9RA 1E5ZA 1ZDQA 2I7OA 4E9SA 2MRYA 3CVBA 1KGYE 3V9EA 3NYKA 1GS7A 2QPEB 1OV8A 3DTUB 3X1GA 4AKOA 4YSEA 1ET5A 4KO6A 2IDUA 4WKXA 1QLEB 1T5KA 1ETJA 1IBYA 1J5CA 1WA1X 2CJ3A 4E9XA 2DWTA 1J9QA 3FQYA 3PAZA 2EIKB 1SF5A 1V10A 2VW7A 4BDVA 5IY5B 1AZCA 1W6LA 3QJTB 1WA0X 5B7FA 2CALA 4YSUA 2FT7A 5TK4A 2DYRB 5EHFA 6PCYA 3TBCA 3X1EA 1NINA 1GR7A 2YAQA 2YAHA 2VW6A 5LDUA 3CDZA 2UXTA 7PAZA 4GP5B 5I5MA 3CG8A 3CZUB 2BW4A 2IAAC 4E9YA 2XYBA 2IDSA 4KO9A 3NJLA 1ZPUA 1KBWA 2QDWA 3OMNB 4DP0X 2MTAA 2ZONA 4G7QB 4YSRA 1JZFA 1GYCA 1JZGA 1ZIBA 2WO3B 1XMEB 2UX6A 4KOCA 3RYMA 5I26A 3T9WA 3NJIA 1TEFA 2Y69B 1N70A 1AOZA 2BP0A 1PMYA 1L9OA 2XXGA 4A67A 4GYBA 1M57B 4YSSA 1AZBA 3AZUA 2GIMA 5I5IA 4E9RA 1PZAA 3U25A 3NSDA 1GS6X 1BYPA 3IN2A 4YSPA 2XV2A 3NJFA 4JKNA 4F2EA 1XB8A 3UACA 4GP8B 4AKPA 2P80A 2YARA 1J5DA 3CDZB 1RZQA 4GP4B 1TU2A 7PCYA 9PCYA 3QJRB 1JXGA 2IWEA 2UXFA 4A2DA 4DP7X 4E9WA 3ABMB 3IEAA 4YSQA 2BWIA 3S3CB 2VW4A 3ZBMA 1MDAA 1IKOP 1YLBB 1ZV2A 1UATA 3DIVA 3FU7A 2H5UA 1KDIA 2TSBA 4YSOA 1AR1B 4RH4A 1A4CA 3T6ZA 3WKPA 4ENZA 4UF7C 3EH3B 4CSPA 3T71A 1VLXA 2FQFA 3MX0B 5I5JA 2DYSB 1SF3A 4M4RB 1FA4A 2GC7C 3EF4A 1CC3A 1RCYA 3ERXA 1KCWA 1MG3C 4AI7A 4A2FA 1BXAA 3ABGA 1IBZA 3EHBB 1SHWA 5D4HA 4DPBX 3NT0A 3EH5B 2AFNA 1QHQA 2YAEA 1AG0A 2HRGA 4BWTA 3GDCA 4HZ1A 2PPDA 3FSVA 8PAZA 3WNJA 2OV0A 1NTDA 1V54B 1QNIA 5B1KA 4UAHA 2B3IA 3ZDWA 1BQRA 2RACA 2PLTA 4Q8BA 4F2FA 2VMJA 3H4HA 2XX0A 4E9VA 5TK2A 1NZRA 4YL4A 1E67A 2QPDB 2XXFA 4N8UA 3X1NA 2CUAA 2FQEA 4G72B 3NSFA 1PAZA 2FQGA 2VSMB 2UXGA 3EH4B 3FQ2A 4GXFA 3NJJA 3QJVB 1GSKA 1PNDA 2PP8A 3FPYA 4Q89A 4A2HA 1CUOA 3OQRA 3IE9A 4G71B 1OCRB 1E30A 5I6PA 1L9QA 3AG3B 3PPSA 3D12B 2AZUA 1OCZB 4BXSV 1KV7A 2FQDA 1X9UA 3OMAB 4HCFA 3TBBA 1J9TA 1A65A 4UANA 4DP6X 3V9CA 1KDJA 3PAUA 4AZUA 4QLWA 5B1JA 4NB7A 5AKRA 1PF3A 2YXVA 1JOIA 3H56A 1BEXA 2HLEB 2Q5BA 1SFHA 3FT0A 3ASNB 1RKRA 3IBOA 3IN0A 1JZHA 2X87A 4AKQA 1PZCA 2GSMB 1A4AA 1J9RA 2XX1A 4W1TA 3FU9A 1OE1A 4A2EA 1BAWA 1ILSA 1W6WA 5FC9A 2GC4C 2HRHA 2DWSA 5B1BB 3SBPA 1AZUA 1SNRA 4NAJA 3UADA 2OJ1A 1XB6A 4GY4A 5F7AA 1MZYA 4FA7B 1JERA 2IWKA 2BZ7A 3GXUB 3NSYA 1NIEA 2WO2B 2ZXWB 1L9SA 1BXVA 3X2QB 1W8EA 1PLAA 2IH8A 4HAKA 2PCFA 2PP9A 3OM3B 2PPAA 1IC0A 3G5WA 1L9TA 3MBWB 4DP9X 1A8ZA 3WG7B 4HHWA 2VSKB 2H47C 1ET7A 3AG2B 4DPCX 1JVOA 1CYWA 1MZZA 1PCSA 1SDDB 3PXLA 1I53A 5B1JC 2IDQA 1KYAA 3WIAA 4DP4X 5E9NA 1A4BA 1WS8A 2X88A 1TEGA 2EINB 3WI9A 2FT8A 3NSCA
chains in the Genus database with same CATH superfamily
4HC1H 5JOPD 5EU6A 2NY5L 3GPEA 4WFHE 1XZWA 4XX1E 5CLYA 4CVXB 4N2KA 5J0BA 2H1PL 3DDGA 4K71C 3QJFA 3CFEB 1JGLL 4HC1L 1ZE3H 2A6KB 3NAAL 1CXLA 5FOJA 1LEKA 1RZFH 2GJ6B 2ZXQA 4NQEE 2MPAH 1RI8A 4LL1A 4DEUA 3B6SA 4GKZA 4TSCL 1AD9A 4MX7A 4UM8A 5C0RH 3RX7A 4X4ME 4Z3IA 4QXWA 4QDGA 4M5TA 4P23D 4S1SL 1TKWB 3TN0D 5EULV 2H0JA 2P80D 2VISB 1PJWA 2YQBA 3HNTL 3S5LA 4Y2DC 2EDKA 2CHNA 2FZ3A 3CE1A 3RUGA 5E2TL 3OTTA 4RMQA 3SDDC 1SHSA 2HZHA 4P4RB 4U4BA 1NUNB 3I75A 4WO4D 4XNXH 5ERWB 5E08H 2VC2L 5KJ4A 2EXWC 5TDPA 1AXTH 3RHWF 3IMTA 2DWEA 1ZCRA 4APQB 1F45A 2D31A 2TRHA 3DXAB 4LCYB 5FV2A 2H2PD 4K0OA 2AXHA 5D6CA 3RPBA 2ICCA 2XQYA 2PCYA 2R8SH 1MJJA 1X5MA 4YGAB 4WJG3 4PEEA 1HEZA 1RULL 3ARWA 2A6IA 4V1DE 5DMIL 4CSSA 4ZOEA 3DLQR 5H8DA 4G11A 3V6ZA 2P5EA 5IBTH 2KQNA 1HNFA 3A4EA 4EI6B 1QO3B 3TIEB 3I9AA 5IF0A 1S9YA 5EO0A 4GRWE 4GAGL 4DEPC 3QDJD 1U33A 5AVUB 3VAEA 3JQOB 4NQTA 5C97A 2CUHA 1DANT 1O0VA 1BX2B 1T7YA 1C16B 1HAWA 3CFKA 3C5ZC 4R84A 1WCQA 3DOSB 3BGMA 3WAJA 3NIGF 1PKQE 5FA3A 3ME0B 3BZEA 1R19A 5EZOH 4DKEL 2ZTBA 5DJ8B 2G60H 3ZKMD 4OZIA 2NQCA 1E65A 4FLHA 3MRKA 4NZTL 5HI4C 3C5ZA 1Q9OA 2LR4A 1QASA 5F3FA 5L2JA 4AJ0A 3HAEG 3V0JA 3L95B 3H2PA 1MFBL 4JBSA 2Z34A 1Q1JH 1EXHA 3IDGB 2FECI 4HWEL 4IKKA 3T6WA 1Y18B 3FUMA 3NH7L 3K5SA 2VDPH 5IOPB 1MSPA 1T1WA 3TJEL 5B3SB 1N4XH 4PWFA 1MHEB 2OYPA 1LWHA 4NRXA 5ICZB 1P7KA 2BW5A 2R0WL 5F6HI 1J8RA 5E1GA 1PD1A 4N26A 3QUZB 1P4BH 4FTVE 4HIJA 4EDWL 2IDCA 1IKNA 1HWHB 1A1MA 1NMCC 4BFNA 4DGIH 2Y6TE 2BFGA 4MMZA 1HHGB 2YAPA 2IADB 2XV3A 2H26B 5DRZA 2DBLH 2O5ZH 4MZRA 2UX7A 4XPFH 2AEIT 1FLRH 3VRLF 5GRUH 1RUKL 4KX7A 5E4AA 5D7LD 4X7DC 2DBJA 2I60H 1QFPA 1FVEB 1AQ8A 2H2PC 5E6IB 1A3LH 1KN4L 2LTQB 5C07A 3ATFA 3MREB 1M9WA 2NY5H 4N1HB 3T0ED 2AC0A 5F97E 1QI5A 2AXGA 1V7ML 2Z4QA 1RUML 4DN4L 4ZUTB 1OSZB 3LQZB 1NIDA 4Z18A 3AUWB 4LSVL 5I28A 4KQ3L 4PRPD 4JQIA 1Q9KB 5C7XH 1DUZA 1NBCA 2QR0A 2K6YA 1JGVH 4UI2A 2J5LB 3OKDB 3RKPA 3ULVH 4IGBA 3T0EC 2NT0A 3IVKB 1OAZL 4JZJA 4BUGA 3B8YA 3EFOA 4ONGH 1JVLA 4XXCC 2EDTA 2X3CA 1CK0L 1CYXA 2CHZA 3MBXH 4FKKA 3S9DB 3D39E 4K07A 4BXVA 4ETYA 1BFTA 3GNML 5K39B 4YDKL 2ZD0A 4JREB 3RE0A 5AW5B 1E5YA 3LXAA 4J4PC 5T3XE 1LILA 4KGJA 4Y4HB 4HG4J 4M7LT 3CBRA 3LVTA 4BELD 2AEWA 3D34A 2K78A 4WWKA 5L8JB 5CCKH 1KGUA 2PN5A 4N0UB 2BXZA 1JN6A 4X6EB 2KPNA 1J9CT 3UG3A 1CE1L 1E28B 1Q38A 1A14H 1H5BC 1GHFL 2G75B 4WU5B 1VAHA 5D1QB 4A6YH 2MJWA 3OHXA 4L9DA 3NOIA 4JE4B 1FG9C 5D2NC 5I8KH 2IOMA 2OK0L 1DDHA 1N0XH 2RALA 1YDPA 4X4YB 3ARGB 1EJFA 1BFOA 4FNLL 4ZS6D 3K6SB 4M5ZL 1NGYA 3HLAA 5IZ7A 3UBXB 1A6TA 1PPIA 2MKLC 3LKOA 2Q87A 3UXFA 2I7OA 5CXPA 1I9RL 2XQBL 1NGZA 1SLWA 3NFNA 4J27A 5DJ6B 4HQQH 1QW8A 4PJGE 1OP9A 1GGBL 3DX9B 3Q8FA 5TPWL 5I17B 1FAIL 4BIKA 3MCLL 2GSIB 5D7JD 3ZGIA 1FNAA 1VSCA 2IXQB 3EFOB 3NESA 1DQKA 1J5CA 3S3PA 3ULUC 2CJ3A 5AW4B 4LARL 1Z3RA 2PETA 4NYLA 3JBG7 1RZIB 3QIBB 4OU3A 1YEIH 2EIKB 2ZJSH 1V10A 1UWYA 4GMTH 4BCYA 4GI9A 2VW7A 3D4GA 3G5ZB 1NCBL 1AZCA 3KEHA 3H9SE 5B7FA 2A0LC 5EIVA 2ADIB 3U6RA 4N2IA 2YAQA 3PHSA 4KJWC 5LNEA 5F9JB 2GFBA 1JFHA 1U3JA 2O5YH 3N41B 4U33A 1EGJL 2VSDA 2X9XA 3SGKA 4GP5B 1J48A 4OD1H 4UIMB 4WO4C 1IGIH 3CZUB 3DMMC 2NYKA 2GJJA 4QLRA 1MFUA 1A1OB 4P2CG 3ZU8A 2P8MB 3NDYE 4NNYB 4B96A 4PREB 5GZNC 4WW2B 2C7UB 2WWMD 2JKIS 1JGVL 1Z9PA 1XMEB 1RJYB 3FU6A 1N70A 1MI5E 2BP0A 2R0LH 3GBEA 4RRPG 4WHDA 3TCLA 4J3SA 2XXGA 3AB0B 4XNUH 4UNUA 4ZD3H 2WC7A 2ZWKA 3MNWA 3U7WH 4YX2L 2R23A 4GB9A 2RB8A 3AZUA 4QRQB 5C09E 1BSIA 4OGYL 3WMQA 4HXBL 1CLVA 3QI9C 2WVUA 4EUPH 1CFMA 2VTFA 3KDPB 4Z7AA 1XB8A 5J12B 3S5LB 3T3MF 1NUFA 2OL3H 4U3HA 3PWPE 3MRQA 7PCYA 4ZX6A 1B4TA 5CHNB 5IP4A 2DMGA 2F15A 1HVXA 2CRIA 2WJ7A 2GTWA 4CVWA 3ZBMA 4BE6A 5ADOH 1YLBB 2XWEA 5HPOA 1FV1A 3HN5A 3PQYE 1P4BL 1WFOA 3QO0B 2DQUL 3UIZA 5D6CB 4EUPB 5IEKA 3SDCA 3EGXA 4NUMA 4HCRH 3ZDZF 4G8IB 2DYPD 4UV4L 5SWQA 3V5KB 2F54E 3DC0A 4Q9RL 3WE6B 5H37H 2FWUA 5J1SC 1PZSA 2A4CA 3TIEA 2XACC 4AZ8B 4G83A 1IEBB 3FCSB 4ICWA 1IC5L 2GJ6D 5DD6B 1G0DA 5HGGS 3G6AA 3ILQC 4QY8A 1X3DA 4NN6C 4ZW3A 5DO2D 3ULVE 1SDYA 3FO0H 1BBDL 3GMNB 3KWUA 4DJMA 5J9PA 2QSQA 3MPCA 5E8EB 2W92A 2NTFB 3DJZA 3FTXA 4FQCH 4XAWL 1JWSA 4YLQT 1D5BB 1NTDA 3EO9H 1C5CL 2KH2B 4KKPA 1YMMB 4NJ9H 4PJ7E 1Z9LA 4QHNB 3SPVB 1MFAL 3LS5H 2VMJA 1NUDA 4GQ9L 2IC2A 1D5IL 1SOQA 4Q7DA 1FN4B 3IDNA 3DNKA 1BLIA 1LP9F 2R56H 4X4XB 3HR6A 4QHPA 4YZFE 4LEOB 5C0CB 2WQ8A 3BKMH 4LCCB 2I9TA 1GTNA 4XVJL 1RZGB 3PGDA 3RY4A 3OJMB 1CFTB 4YHLH 1GJWA 5HI3D 4OZ4B 3LEYH 1J0YA 1NUGA 2BOBA 2D03H 1BREA 1T4KB 1X4ZA 3O2DA 4XP1L 4MMZB 5GJSH 5HHXL 3Q5TA 4KI1A 4W9JC 1SOXA 3C5ZD 4LLMB 5K9KB 2RBLA 4S1DC 1KELL 1AVAA 4E68A 4JQXC 3UBXI 1EWHA 2VDQH 3MLZH 2NQ3A 4RLDA 1MRFL 3CVIL 2E9IA 2ILLA 4FD0A 5E6IC 1OD9A 2BPBA 2F74A 2AJUH 2EJ1A 5SWQB 5LAXA 3CFKB 1WUZA 4L0ZA 2ZP9A 4LXFA 4AWJC 2JCCE 5GS0D 1FJ1B 1D6VL 1VFUA 5F7DA 3FQUB 1Z2KA 2NY7L 3QXVA 5ALCL 2YMTA 4R7XA 1LD9B 4AKQA 1OAJA 1FHGA 3EFFA 2ZNWA 4X7FC 1J9RA 4X7SH 3VFPB 2Q0ZX 1OT2A 3ARDB 3FNKA 1BAWA 4FXGB 4I48A 4NI3A 4E41A 2UY6A 2O6DA 3ZTNH 2VR8A 5DO8A 3IRCA 3KM1A 5JA9A 1J11A 5DZ9A 4BHUA 3B7SA 5CFHA 1HHJB 4D7PA 2DQEH 3ECBB 4IRJC 1KTLA 1N0LB 2R2CA 2BM3A 4B53A 4O2CB 4LARH 4KHTH 3L7FA 3GB7A 4MNHB 3ULUE 1F1DA 1D5ZA 1YQVL 1A64A 3V6ZB 4IBLT 3I9GH 2ARJB 4HKJB 3RVUC 1TQSA 1A6AA 3RA7L 1SLVA 1OLLA 3KPSA 4WWPA 3RY6C 3L3KB 1E3FA 1T2QH 1ZTXE 2P4AB 3AG2B 3Q2NA 4Q14A 1LVEA 4XO4A 2HP4A 4JPIA 4AQ8C 4GLRH 5KW9L 4LPTA 4J2XA 4YFDB 4TQIA 4UOJA 2IDQA 2PCFB 5AEAA 4M7ZC 2PWFA 3QUYD 5HYQB 1XL6A 2K45A 1E6OH 1Q72L 1JF1A 1HHKB 3QCTH 2IFFL 3L3HB 3OHXB 4WSGA 5CINL 3TA3B 3TC9A 3MRHA 4S11A 1GIGL 2BINA 4Z7WF 4G1MB 1DDHB 5GS2D 1UKQA 4LKCB 2V2WB 3CVCA 2A7BA 5L2JB 4JFXA 1RU9L 1CZ8L 5JW4M 3NA4A 5BUAA 3EO0B 1KLFB 1KSRA 1BMGA 5FGRA 2PWEA 3U4BL 3BVVA 2BVOA 1D6EB 5F1NB 3CDFA 4TRPL 3IS1X 2VIRB 1JBJA 3QNXB 4LU5L 5CEYB 2WZPD 2Q76B 4ES8A 5AVWB 1KJ2B 4LAQL 3C6LC 1UH2A 3HZVA 2NXYD 4XZUB 3W5MA 2HT3D 4M7LL 1MI5B 2XWTA 4M3HA 2YEVB 1NKGA 2ZT9C 2AVFA 2VSCA 5IKCA 4HJGB 4G3YL 5E2JA 1H15A 5KVEL 1C5BH 1TPXC 3KXFE 2FEEI 4G80B 4XP9L 4JPWH 4DZ8A 5BMFH 5D1QD 5FB8B 1X5ZA 5DZAA 3ESPA 1RVFH 4LSTH 5IWLA 3CLEL 4NRZB 3EZJB 2EIBA 2L7QA 1LO4L 4AQ1A 4GRLD 4TVSa 1AHWA 5GRXG 1JHTB 1JS4A 1F00I 1KXHA 1OAYH 2W88A 3FB7B 4IMKA 3GUTB 1EHKB 1J1OL 1HU8A 2JJSA 4KBPA 4P2OC 3GK8H 4WFFD 4MRBA 2R0KL 4F24A 2YUVA 1COBA 4LCCA 1SYSB 2H32A 4WV1C 2OZ4H 1FL3A 4PJCB 5DC2A 3NJHA 3FHQA 3BQUB 4NKMA 3NAAH 4B9CA 4D0BA 1F3RB 4OCMC 1NANH 5AWNL 4IMLB 3ALPA 1DQDH 3DPBA 2WXJA 2NCMA 1ET8A 5F6HJ 2ZCZA 4L8DB 1FZMA 1OSPH 1DQVA 2JCCA 2VM4A 2WN2A 3S96B 5JOFA 3S34L 5CU5A 1MHPL 3O2VH 4ZQTA 3V2AR 2CSPA 1AS7A 4KPHH 4QKTA 4M1GH 3GHPA 4AYSA 4QNPE 3FU8A 1IEAA 2IGTA 3MNMA 2WAHA 5GGQH 5A6IA 3NIFE 1INEH 1G9NL 2X7LB 4U1JA 3S35H 1P4UA 4LSPH 5BRPA 2PTTB 2X4SB 2BVYA 3I2CL 3QIWC 3SE9H 4R96B 3UH8A 2UWEE 3MUZ1 5DD6A 2XNAB 1YPZE 4B60A 4JFFB 1GVIA 3UDWC 5GS0H 4BWUA 1QPPA 1XF2B 3TJHD 1SUHA 4ELMF 5LAPA 1ZIAA 3QFDB 5J5EA 1RUQL 5MHSE 2ZKXA 3K6IA 4KO7A 3I6KA 4XPHL 1UH4A 2JI3A 4BGDA 4KH2A 4TL4A 3UTOA 4PCKA 1IFRA 4JPVH 1HDMB 3LH9A 4NGHL 2HFEB 3LKPA 5IQ9A 4PJHA 1JZJA 4TVPL 5CGTA 3H4FA 1I1CA 4UTCA 1BPVA 4MAUL 2JTDA 2E9JA 4B95C 1QA9B 4JFOA 2CXKA 5IVZB 2E46A 1Y6MR 2CUMA 2XPZA 1M71A 2R9HD 2IAMB 2I7SA 2XWXA 1S6NA 1NBVL 3G04B 5C0EA 1T0NA 1BVOA 5D1XB 1PLBA 2EADA 3ELQA 3FUFA 4LAQH 2IAMD 2P48B 1JSYA 5E5LA 3R1GH 5SX4H 3S36X 4A7TA 4KMTH 3W3BA 3DX1A 5CKGA 4L1LA 3OB8A 4P2AA 3UIYA 2NNAB 2IQAB 4IBTA 1FE8H 3FUHA 1CLCA 2BIIA 3KLAA 3II2A 3PL6D 4GAFB 2P5PA 4XVSL 5EBGA 2UYLA 3OLGA 4XVTH 2A6IB 2BSTA 3O6ML 4WI2A 1A1MB 2E9BA 3MNWB 1CURA 2JJWA 5DJ0B 3MNDA 4QRRA 1QKZL 4HF5H 2ZX6A 3AG4B 5J6HA 3VUAA 4Z76A 3PFUA 2C9PA 3JWNG 1J5OH 3NCFB 1WBYA 4G7YL 1UJ3B 3U6XS 2IF7A 3G9VA 2VUOA 3US0A 1T89A 1AO7E 3WNIA 4RFEB 1J1OH 4TSAL 1ZHLB 3KS0H 3PHOB 4NZUH 4F33A 1SYVB 4QEGA 4U6XA 3VRJA 3IAPA 1JHKL 3F05A 2EUWA 1LO4H 3IJYB 2ENSA 3QT2A 2AJUL 2ZUUA 3Q2VA 4JFZH 2QVMA 4P5RA 5IREA 2K8QA 1EUUA 3V0DA 5EG6C 1AR2A 2WJ5A 1N64L 1T04A 4YK4C 3VWKC 2YQGA 4BHUI 2ROXA 4D8PB 1Q94B 3GTNA 2KKQA 2GKIA 2VQ4A 3QGVA 4LHUB 3RVTC 3SE8H 4EZKA 1CXHA 1NFDF 5JZ7C 4FQ1H 4LLYB 2CLRB 3WIHA 4ISVB 4LFHG 1QG3A 2OBGA 1AGFA 4Q97A 3Q13A 2BCKA 1KTJA 2B20A 2FVNA 3G6AB 5H2BB 3FN0L 5D71L 3OXRA 4YX2H 5T3ZH 3GZKA 3U1SL 32C2A 4TULL 3HR5B 4E9SA 4HWNA 5JDSB 5F7DB 5BS0D 1GRWA 3QARA 4IBVA 3D33A 2B1OA 3BT0A 4XCNB 5C08D 3HMXA 5EA0H 2YBGA 5I1AA 1U91B 3A6CL 4AIZA 1CQKA 3EJCA 1H3GA 4KXZH 1RUPH 3K80A 4UQEA 2NPLX 4K73A 2FWOA 1E5BA 1DFBH 4OQTA 2IDUA 5J13C 3QH3A 1YYMH 1IBYA 1FZKB 3RU8H 3LZRA 1TVDA 1LQBC 4FXKB 2HLAB 4PMEA 1IAKA 3H42L 4UOW0 2WKOF 1VCAA 3EJZD 4PQXA 3HG4A 4DUWA 3JWNH 3C2AH 4FMVA 5JLZB 3U36B 4Y8AA 4ZMVA 3HZKB 4FQLL 5BVPH 1H19A 3C60D 5E51A 1EMTL 4JFDB 1KGJA 4LASL 4N0YH 5F0PB 3FCSA 1UT1A 4YPJA 4S1QH 3HC4L 1E5AA 4NPYB 1CGWA 4GO9A 3EG9A 4P5KA 5HD8D 4XC1H 3IGFA 5FK9B 5KANI 5E70A 1C08A 2X9WA 4JQIL 3FCUB 3RL1B 4M00A 2FHCA 1GYCA 2WO3B 1BV8A 4P3DA 3T9WA 1UA7A 4EO5A 4M62L 2Q86B 4YDVA 1IAIH 1HN1A 2WXPA 3H9SD 4UQ2B 3PYCA 1M57B 5GGTA 1I3GL 3WFBL 1AZBA 4RGNE 5KSUB 3HIZA 4AC4A 4D2NA 4B0MM 2Y36L 1QR4A 3U25A 4GW5A 2JJTA 5GGSB 2F8XC 5FUOH 3UACA 3AWFA 3VXSD 1ZTXL 3NDZE 3FT4B 3WY4A 1NFDA 4OSUH 2HLFD 2Q76A 5LCVL 1ECZA 3WJJA 4JGNA 4GG8A 1AIFA 3ZE0E 3VE0A 4OLEA 3CHPA 4DSYA 4FTVB 3RRQA 3QJXA 1LYQA 2GI7A 2NY4D 1J12A 2YD1A 4DUVA 1G1YA 5IHUH 3UGUA 1MWAB 4K9EL 4OFYD 3MJ6A 5FUZH 4KUCF 4ZW6A 3ZTJH 1D5MA 2Y3AA 1HL8A 5E2VH 3D2UD 4O2FA 5MEOA 4RH4A 12E8L 1DSYA 2OCFD 3RFZB 4GT0A 3UFIA 4M93C 3NFNB 5KYUA 1IZJA 2ROYA 3IJHA 5EZPA 3BAKA 4K7PL 3HZYA 3IB4A 5F71A 3QQNA 3O3DB 2ADYA 3BSGA 1RZ8B 3MKGA 3ZYJA 4KNQA 1EAPA 1XZ0A 4KRPD 3ILEA 3LS5L 4QHMA 2N7BA 1YEHL 3FRPB 3FQXB 3EYVA 5ICYB 1I8KB 4PFEA 4JDTH 3U9PH 4XAWH 5EPMA 3BJLA 1J8HD 3TVMB 3F5WA 4U1IB 3JUZA 1CG9B 4P5MA 4AEEA 1P7HL 3ZVVA 1MRCH 2EDJA 4KRLB 4L18A 1EK3A 2E7BA 1UM6H 3F6JA 4AEHL 4AL8C 1JGUH 4FZ8H 2VAJA 2NZ1A 3S96A 5JOFB 4XCEA 3C5ZB 2NUTA 1I8MB 4MXWL 1R9FA 3HZ3A 2NX5D 3TYFB 3GM0A 3ZUCA 4WU7B 3H4HA 3AY4A 4YDNA 2CGZA 3RILA 1U95B 1VZGA 2R4SL 3QQ3B 3RI5F 4XN9A 1XAKA 2Q10A 2IOOA 2RQEA 2VC2B 4NFDA 4RGOH 4WY7H 3X1NA 2J8UF 5C0CD 4PGJA 5IQMA 4C47A 2Q2EB 5F7KC 5DD3H 2E7HA 1PAZA 3DX9A 4GXFA 2HPTA 1QLRB 2LVCA 3MFGB 4PJ9B 4H4NA 2C4FU 5BVJB 1HQ4B 4LEEA 1CE6A 3O4LB 1XCTA 2QGDA 3FMGL 4BEIA 3ARTA 3LYRA 3K91A 1J0KA 3V8CA 3RWEB 4HJ0D 1F18A 1K2DB 3QEQB 5ISZA 1JGEB 1F6AA 4HS8L 5IB3A 1KDJA 4K7PH 5AG8A 2Z91A 3SPHA 3SQOH 4XMUA 1T5WB 1TFHA 5KS9E 4PY7A 3QR1A 1PF3A 2YRBA 2PO6A 4NHCH 4N3UA 4HG4K 2YXVA 1RQ5A 1X5HA 1ZD6A 2Q2LA 3ARFB 1NC2B 3EJYC 3MRLB 5HYSA 1X5IA 3QFJD 4OF6A 2Y24A 1G7MA 4OJFL 1XBRA 1IGIL 1FDLL 2Q6WB 1RJZA 5L8KB 5IJKA 4PW4A 1P7QA 2OJEA 2CR0A 2KZWA 2DMHA 3UADA 3VI3F 2EDNA 2W0PA 2W5PA 3RGBA 1YO4A 2J8UB 1PTZA 4AJVA 1YVLA 1D2PA 1UD2A 2D3VA 2VDRH 1BD2D 4DW2L 2VDLH 3F01A 3LKNB 4KVPA 5ICZA 4AGLA 1G4RA 2IH8A 1QEWB 4JFEB 2EUVA 2IH3B 3BC9A 3KYNA 1RPUA 4QR7A 1T80A 3QO1A 4IRSB 4H40A 3F65A 4KUCD 3VB8A 1LK3H 4W9DC 1AE6L 3LN4A 4TUUA 1ZS8B 4GRWF 2ITFA 5CM1A 1ORQB 1BM3L 4MQ7B 4RMUA 5CP3H 4OCWL 2DJ4A 2R15A 1SQ2N 3K8MA 1EPFA 1MCJA 5D7SL 2C9RA 3LCYA 4I87A 4UILH 1MQKL 5D1ZB 4QJ4B 4K3EH 4GRMB 1J18A 4YR6B 2OMUA 3KW8A 1ZTXH 2HKHH 3GSWB 3L4WA 1N18A 1E9PA 1A7PH 4OFKA 2PTVA 5IUSA 3MJ8B 4YE4L 3BESR 4V1DD 5ID0A 4WAFA 4NXKA 5D72L 2BY0A 2QJDA 4JPKH 3IXAB 5E6ZA 3IKKA 4MAYA 5BCAA 4A6YL 5HVHB 1N4XL 3VDBA 5IROC 3UC0H 5HD8C 5K9QG 2APSA 3PL6C 4MJID 3IMSA 3D5OF 3UPCA 2ZPKL 2P49B 4OCXH 4N4YB 2HH0L 3VVWA 1XGTB 3T4YA 3C60C 2PXYC 2RFXB 1K3ZA 4P5TA 1E42A 4UQ2A 5ITFB 2LQRA 3O9WA 4IOSA 4PTTB 2HX9A 3C8HA 2FD6H 3UO1H 2J5LC 3DDFA 2HJLB 3K0WA 1L9PA 2YPKB 3HPLB 4LSSH 4BKSC 3TA4D 1RUAL 4LLQB 1I7UA 1KBVA 2F7IA 2FLRT 4QO1A 1IT9L 4HJEA 4LEOA 1KIPB 2DQDH 4AEFA 2OMXB 3ALXA 5BZWA 4LGRB 1CFTA 1HCZA 1ZY9A 1LGVA 3OWEA 3OF6A 4LL9A 1K8IA 4K94L 4PWEA 1KT2B 5GGRA 4ZFFA 1KPUA 1TJGL 4YPGA 2HX7A 4MAZA 4YDJB 2FO4B 2HFTA 4ZUVA 5EBMB 3VCLA 4H5SA 2B14A 4O58L 4JG0H 3M17B 4KRPC 3Q0HA 3SE4C 5MEOB 3ZQXA 4ONFL 1BP3B 1N6UA 1UB5A 3VSVA 3EIFA 3QIBA 1MXDA 5J11C 1EANA 3MRNA 3P3UA 4GAYA 3S3BB 2WLYA 3CQFA 1VERA 2NX5B 4YNYA 1K8DB 4Z6AT 1NIBA 3CFBB 5T3ZD 1EAOA 5E00A 4Z7NB 3LKSA 1XD0A 3A3YB 2XLLA 3G6JF 1MCSA 3P9MA 2QQNL 3EYOB 5EO9A 4N9GB 4U1LA 4ELKA 3ABKB 1H8NA 1NGWB 2IGFH 4MNQA 3TLRA 3KAAA 4PY7B 1XCXA 1KEML 4KRMB 4PB0H 4Z8FL 4JFDD 5B39A 4DZBA 3B3IB 2VWEE 3WLWD 1SY6H 2B59B 3Q1SH 3BDBA 1S9XA 2G2RB 5E8OA 5I0YA 2B1AH 2WNKA 1MFCH 1JHKH 3MA7A 4UT7L 1NC4A 3RGVD 4X4KA 4CBPA 4RRPA 3BQUD 3LHAA 4TQ8A 1A22B 1BCIA 2GUOB 1VFAB 1M7XA 4ZXBB 4CU6A 5D2LE 4IEFA 1I7ZA 1AC0A 2HG5B 4JANB 5FWRA 3MN8A 1RZPA 3LQAC 4UYQA 4EZLA 1GXEA 3L2LA 4N8CL 3MLTA 5IVXB 3WSQH 1N8ZB 5A40E 2DY2A 4HF5L 3RQ3A 3LRHA 4R4BB 4E42B 1U8NA 3NZUA 3FQTB 1DVFC 4NWUH 2CMRL 3S7GA 3STZB 1PZ3A 5AZUA 4QUOA 1A3RH 4XVSH 5KUMA 1IBDA 5AOZA 2BVQB 5BOPA 4BFFA 2DL9A 3PWNA 4K5NA 1WISA 2FSEB 1AY1L 2X4PB 3NEXA 4MDIB 1Q9LB 3FRPG 5BQ7A 3C5JA 1CB4A 1A0QL 2FEDC 2BP0B 2IPUK 4OCRL 3ZL2A 2D4DA 2ZCHL 1CTNA 1URZA 4DOHB 4MNQE 2IG2H 3PNRB 1AYOA 1HL4A 4P46B 4GRWB 2A77L 5L2KE 5DJYA 1DUYA 3PREA 5I6MA 3NCMA 5E1AB 4WK0B 3NTCL 3FCBA 2AQ2A 1SJHB 3ES6B 1JNLH 5JHDA 3F8UB 2TRYA 1QFUH 5IJVA 2IG2L 1IC7H 1UD8A 2RCSH 2YGNA 1ZS2A 1KIQA 3MRFB 3HHSB 3WJLA 2O61B 3ARDA 1UWFA 2QADC 4XZUA 1MAMH 2WXKA 5LO7A 3NFSL 2Z1PA 4MHHI 4NZFA 3SCMA 1Q90A 5B38G 4M6NH 2W9EL 2RGSA 5SV4A 3FU7B 1N68A 4JFSA 2PYEA 4NS0A 3NCEB 4Y19D 2YBRA 3UMTA 2NNXA 2NLJB 5IHHA 5GXBB 4GRWH 3QJQB 5ILTH 4OW6A 4P57A 4XH2B 4EKJA 4NENB 3MLSL 3VDCA 2JK5A 1V5JA 3LIZA 5D6DA 1BQ5A 4GOSA 4YH6A 4C54A 3LRSA 4N2LA 1HQRA 2ICWJ 1TJHL 2CDFA 2DQFA 3HI6H 3UZEA 4D9QD 4NCC1 5AD0A 4KZDH 3RTQC 4MMXA 3NACH 4NAQA 2Z7ZA 3GI8H 1XCQA 4XBEH 4HT1L 2C9UA 5HHQB 3MOBH 3QPXH 4PS4L 1SXAA 4XNYL 4AMKL 2FJGA 3TNNB 43C9A 5L7XH 2IALB 2YPVL 5AKVA 3CSFA 4P2QA 1OALA 5T1JA 4NI6A 1KYFA 2OAAA 1OV8A 4HXAH 1RU9H 4F2MA 3W56A 1N6QH 4Z8FH 1J1PH 2GT9B 3BGAA 4FXKA 2H1LM 3C09B 3WY3A 4GUPB 2PABA 3GGWB 3C12A 4G7VH 3MROA 1GKOA 1HHJA 2DWTA 3OAUL 3UYPB 5M95B 4IOFD 5J6GB 4R4ND 5C0FB 1T03H 2F7PA 1CS6A 4QI3A 2HJFB 3F58H 4XHJC 4K5OA 1CD1B 3GSXA 5BRQA 5KUKA 1RZJH 1DHKA 2ATPB 5JUEH 4X8JB 3Q2WA 3TN0B 4EN3D 2VW6A 2B1HL 3UTSE 5FR3A 3KL5A 2NTSP 4FLSA 3LRKA 4K3DL 3UEZA 1SMAA 1LK2A 3CZLA 5F21B 2D73A 1VA9A 4RISL 1OKEA 3N1QC 1C12A 2R1XB 3I6GB 5K5YA 2WZ0A 5IMOB 3QXUA 1CLYH 3IGAB 3RWDA 1ZLWK 4LU5H 1ZWIB 3IDMA 4I0CC 5MEPA 1AHWB 2A9DA 1JZGA 3U30B 3B9KA 3GMRB 4K9EC 3ZHNA 3QHTC 4H1LG 3RYMA 4WEBL 4PJBB 3I50L 1P2CA 3DV4A 2DF3A 4LMQE 4F9LC 3QG6A 3RWIA 4D9QE 3VI4F 2BSEA 4AYID 5HGDA 2LAAA 3LN5B 4X99B 1CLOH 1ACYL 3DBXB 3ZZSA 1O5PA 2Z92B 4PGEA 4HJTA 2FJHB 3QCTL 5CINH 1DN2A 5C6TL 3ARBC 2DQJH 5CAYB 3FTYA 1HINL 2GTWB 3VI4A 3CXHK 3GSQB 2ZPKH 4DN3L 1TJMA 5KW9H 1E2ZA 1KJMB 2QSTA 4NSKB 4AQ8A 5HYEA 3AROA 2N1KA 4YEEA 1BVLA 1R5VB 1ZVHA 3CX5K 5D1QC 5EFIA 1VCBC 4BZ2L 9PCYA 3MHZA 1WH0A 2X1WL 4LHUA 1U6AL 2XA8H 2JH2A 3HZMA 4GKOA 3S3CB 2AJXH 3PAYA 4LSUL 4YSOA 5AVYB 3VMNA 1G9MC 1AKJA 1P1VA 1QSFD 1L3NA 4HFUL 4I5BB 4ZUWA 3QDJE 2AITA 3OXSA 3VFWB 1BQHA 3WKPA 5CLWA 3W0WB 5J1AB 1AGCB 1ZHLA 3K2UL 1U3HB 4LRNH 2BOLA 4FQXD 5GSRA 4WJ5B 4O02B 5EZLA 1MDTA 2X5PA 3ERXA 1KELH 4NKDB 2QL1A 1I1AB 3QWRA 2R56L 5F70A 5GRVK 2QQNH 5E9DE 5GZOA 1WFNA 1KGCD 3F12B 1UD3A 3C09C 3ZL4H 3O2WL 1TETH 1MJUL 4OLUH 1L0XA 2XTJC 3DX2A 3SDXB 5BV7H 3GMQB 1VGKA 2M1KA 2GY7B 4F27A 3V6OC 1Q9WB 3CN0A 3EOBA 4X7SL 4HZ1A 3JWDL 2CDEA 3OWRA 1CO1A 3VGFA 2X44D 3RWIB 3CZFB 1FG2A 1MWAH 1OK0A 2DM2A 4K5MA 5DT1H 1D5MB 2EZ0D 3VQ2C 5B4MC 5LGHL 4HOXA 4J6RH 4OIFA 1F8TL 1KB5H 3HC3H 2FBRA 3B9EA 4UINL 3ATDA 4NGHH 5D7KE 4G8AC 4AEIH 3Q44A 2JKNA 1NZRA 4HGWB 2QPDB 1B0WA 1OSYA 2WGNB 1TQUA 2WLNA 2QELA 5BW7A 4U6VL 1YNLH 4DZBB 4P2RA 3VFUA 1LLAA 4HS8H 1G9EA 2D3NA 5FYJH 2DLEA 1G9HA 5HHOB 2DJSA 3BH9B 1CFQB 2H3NB 3V95A 3GMOB 3KPRD 3D2UB 3RURA 2NXYC 3GBDA 4YXLL 2CO1A 2HJKB 5I6PA 3APMA 1YSOA 4ZAKB 3P02A 4GQQA 4TNVK 2QADB 1MCHA 1YDPB 2OJZL 3TBBA 2QKIC 4UM9A 1CFNB 2DLFH 1EGJA 3OJVC 4FCAA 3S3SA 4CC4C 2HVBA 3L2NA 2L7JA 5CMAB 2XPYA 4K3JL 1F90H 5MEQA 4AGOA 2H32H 4NB7A 2WP3O 4FERA 2YWYA 3I6LD 1BIIA 3SDYH 3TF7C 2DQHH 1ZHKA 2J4WL 5KJRH 2AJSL 4N0CD 2WVVA 1BBDH 1DEEA 1LXMA 3ZIMA 1VADA 2OULB 3MJGX 4PGZA 4L4VB 3CFJB 3ZK0A 2DKMA 3TF4A 1B0GB 2AGJL 3ZKXB 5KJRL 3QDAA 4MQSB 5CSZA 1JPGA 2HG0A 3MUHL 4NQXB 4RZKA 4YN3A 1FZOA 5C0GB 4ZQKA 4PWIA 2IAMC 2NY1D 1JF6A 2V2XA 4XWOD 4NHUB 2ITDA 1FNHA 2A6DB 4UINH 4PCSA 4MA3A 1K2DA 5ISZB 5CD5C 1XGYH 2V3DA 3FFCD 4QT5B 2EDDA 4ELDA 2L7UA 3T4AB 4PLJC 3HCVA 4KI5F 1AMXA 1ESOA 2ZUYA 4ZD3L 4WDIB 1C8QA 4OGAC 4JY4A 1NEZB 5FYKD 1G1CA 2VN4A 3GIVA 4JM2D 3T3MB 4MHHG 4ZX3A 3EJJX 1Q0XL 1C5DA 3HHSA 3K3QA 3V0WH 5JORA 3N44B 3T2NH 4XBGB 3Q8CA 4JY6B 2J12B 5E6YA 3SBWC 3CN2A 2WUBH 1MJUH 4OLUL 2CM5A 5B1JC 5D2NE 1KLFA 2X4TB 2YEZA 2IV8A 3QQ4A 2CXGA 4RWYH 1J88A 1NAMA 1T7XA 2ZSWA 4M3JA 1QBML 3P54A 4OVVA 3RZCA 2BWDA 4KK5C 1GZPB 3WXVH 2W9DL 2CLRA 1SM3H 3FUNA 3UBXG 4ODSH 2WTRB 4ODVH 2YD9A 4XHQA 5JHDD 2CAKA 1XX9C 2IOIA 4G6MH 5DMGD 4BA8A 3MR9A 2Y4SA 4NFCA 3ZDZB 3APNA 4P3CL 3SJVB 2CGRL 2VZTA 2COVD 2DQGH 4U6XB 1BZOA 2WINB 2V33A 3BPOC 3P0YH 4XNUL 4FMFA 4ODUB 4J39A 1HEJC 1XF1A 1YEJH 4JM2F 3BP4B 1JGDA 4Z0BH 5I71C 5AW7B 1S9VA 1ADQA 2BSSB 4LZKA 3N43F 3FH8A 2WLJA 2ERJB 2QMKA 1ODUA 1KFGA 4R97C 3K5RA 1V7NH 2WLMA 4UMSA 1UURA 3O9WB 4PTTA 2VLKD 2MWCA 1NAKH 5DWPA 3MFFB 1JHTA 2MSPA 3JTBA 2DV6A 3PLYA 3QP3A 5IR1A 3D51A 4GAAA 4JKMA 3ULUF 3HC4H 3D07A 4X99A 5C09B 1CT8B 3HBZA 1P6AB 4KHTL 3TV3H 3VDAA 1NDTA 2FLMA 4OB5H 4Y9FA 2HTLD 3UAFA 2AQRA 3C5XA 4LLUA 5I1DB 1W0VB 3S37X 2V17H 1W72A 4QRPD 4HKXB 5EOTA 4Y7OC 4AYEC 1NCAL 2X9ZA 5E6ID 1WAEA 2EVFA 4QRUB 1U8LB 4QTFA 4YIQB 2F5BL 4KMQA 1LQSR 2E6JA 3E6FB 4DO6A 4N8VB 3J2PA 2P44B 1YJDH 5D7JC 3TBSB 1NJ9B 3GHBH 4U7MA 5I66B 3HE7D 4BQ8A 2JK5B 1A6UL 4KY1L 5G4MA 2EIJB 2HVKA 1JD7A 2X1PA 3ARSA 4BD4A 1L4IA 2AQSA 4FFZA 4JRYB 1F58H 2XCMC 4JQVC 4EN2A 2NY6C 1B90A 1CTMA 3K0YA 2XVBA 3RWEA 2AZAA 3HFMH 3LXCA 5C7XL 2DQJL 1WGVA 5BO0D 3SGJC 3AAZB 3B2MA 1ITBB 2AV1B 1T7WA 4M61A 4AYGA 2E59A 4JRLA 4EN3A 1XF2A 3IXTB 3X1BA 4ANVA 1S7QA 3VD2A 3HUJA 3MV9A 1AS6A 3KPPA 4HUUB 1S7VB 2IWGA 3HB3C 3KR3H 3FO9A 4GS7C 1CGVA 1OT1A 1ORQA 2P47B 3I75B 5ERWA 1S4IA 3ZSTA 3OX8A 4LRIA 2OJZH 5GRJH 3SQBB 2MMXA 3KNBA 4HGKC 5GISH 2BP8A 2UXVA 3PWVB 4FFYA 5DCCA 1V3KA 4N1EA 4XB8A 1TMQA 3VG9C 1W15A 4YLBA 4AENB 1VENA 2OR8A 2X4UB 3HI5L 5E6UB 2YAOA 1FLRL 1ZXKA 4EOWH 3A4DA 3DMMA 4Y0GA 5EH1A 1QPKA 3L48A 3OKOA 3SY0A 4ECNA 1ZANL 4YDVB 3UZVB 4HOWA 3BUPA 2Y6SC 3BZ4A 1SXNA 2VR5A 4HMDA 4YUEH 3T1FA 4KZEL 3A47A 5GGUB 2WQWA 1W91A 1A3LL 1KN4H 3OKKB 4QOKB 1SFDA 4M48H 1Q4NX 3QUKB 2VN7A 4LAJH 3BPLC 3UMNA 2IDFA 2BHYA 5BS0A 4PAZA 4XN4A 2ZYIA 2EIDA 1R1CA 1OCCB 1WWCA 1T5XB 1ZLSL 1KLGA 1FCCA 1ADQH 5A2FA 1JN6B 1F8TH 1XZ0B 4N5EC 1FFNB 1NSNH 5DK0B 3DIFB 5D1ZI 5ESQB 2EVJA 4X80H 1DZ0A 3TVMD 1BWMA 4DP5X 1XGYL 4HWEH 2ALAA 4AW7A 2ZNXA 3P30L 4QNPF 3NIFF 1JRHH 4NZTH 2J8HA 4MXWH 3MRJA 3V55A 2H9GA 5D7IB 3I84A 3W5NA 4LFHD 1IC7L 2DI8A 1YPZF 5B3JF 2ICWA 1CVRA 5FO7A 5HI5D 4Y16D 2AQTA 2MTPA 3CC5B 1L7IH 1T6VN 2OSYA 2QDVA 1EQWA 2OL3A 3I02B 2V6HA 1M56B 2D7QA 2GIXA 4NQSA 3CQPA 1XH1A 4HIIB 4D8PA 4H2AA 2CCWA 2GBAA 3V10A 4HGWA 1YMHB 1XF5A 3KWWA 4XNZC 1LK2B 5LBSL 3BZFA 5I6KA 3VXNA 4JREC 5DUPH 3M6DA 4X7EC 1XGUB 2R23B 3T77A 1DVSA 1VGEL 1FIGL 4KK8D 4A66A 1TLKA 5B8CC 2V2XB 3B8SA 4RMWA 2EP6A 3PP3K 1THCA 3ETBJ 4NZ8A 3TBYA 2P42B 2WQRA 4P06A 2CA3A 3BH8A 3VXMB 3CDYA 5J89A 2GK0B 4OGXL 1GY2A 4ZS6C 4IJ3C 3R0NA 1MVUA 2F5AH 4OIAA 4YHIB 4YSDA 4QHMB 1TQBB 2F1AA 5TH2A 1NC4B 4NQDD 3MCKB 1A2YA 5T1MA 3QCVL 3VM7A 4XN7A 1D5XB 3QZWB 3KYOB 4LIQH 4FZEH 5HPMB 5T1KA 3Q7JA 2W80C 4XPGH 3OGCB 5CCJA 4HV8B 3ILQD 3RJQB 3ARXA 3QQDB 1ET5A 5FGSA 4WUKH 3DX7B 3VGBA 3X14B 4S0HA 4PS3A 1W0WA 4MCZB 1ETJA 4D9RE 1JZ3A 4A2LA 3NCWA 2B77A 4W4OC 1CGXA 4KXCA 4DGUA 1B4JL 5IOKA 5TDOB 3BLPX 2ICES 5SWSB 2XN9A 3GIZL 1JXKA 3QJTB 5AB0A 2EYSB 4GFTB 4AM0B 2JLPA 2NNRA 2PW2B 1NH6A 5I1JL 1UXWB 1WG3A 5KVMC 5LNGA 1J8HA 3DOSA 3REWB 1ETA1 4GS7B 5E9DB 4A38A 2F0CA 2XWJB 3KLSA 3K2UH 4PG2C 1YAZA 5KG9A 5F7EL 3SKNA 2WXOA 5AAMA 4PRPE 5JQIB 5D70H 1G6VK 4K2UH 1CFSA 2HFGL 3PP3H 1ZJBA 2B1AL 4JGMA 3ZL1A 4DTGH 5IJKC 4HLEA 3EOAA 4IBQA 4JDZA 3HE6B 5AW6B 2WLZA 4N0CC 4Z7OB 4KVCL 1JNNH 3MXVL 3ARPA 1FG2B 1RZKC 1AGBA 3DRQB 1Q1PA 1PFCA 1U8OA 3POHA 1A4JA 5EBWB 1U6AH 3PP4H 1FPTH 2OR7A 4HEPA 1S7UA 5JIPA 3RAJH 1DLFL 5I8OL 2JQZA 2PWGA 4FQHB 4TRPH 4YDIL 3VYPA 3IFPB 4EZMA 3A21A 3HRZA 4RGMB 5JYMA 5E8DL 2P8MA 2VZVA 1BQSA 1QFWI 3WHXA 5D7LA 3MXWH 4KUZH 4JPWL 2DAVA 3PWNB 2XG5A 2BSSA 4GP8B 4HWUA 5JXAH 3HUJE 3MV9E 4KKZA 2XOTA 3D85A 2JCCF 2VITA 1FORL 1AJ7L 1WQVT 2DQTH 5FLVA 3UERA 3KR3L 3II3A 1UWGL 1JTTA 3ABMB 1F11B 2K4AA 4I5BA 5AB1A 1MDAA 1TJIL 3GD1C 1DN0B 4OUUB 2BJML 4QHNA 3TTYA 1IAKB 2OPCA 4ESKA 2K1MA 5IROD 4FQJH 1H8OA 3SDAA 2BNUA 3VWJC 4HSCX 5E95B 1B2WL 1A4CA 1HI6A 3BP6B 4J6IA 3ARDC 1HSAB 2CKBA 4MD4B 3MV01 4OLYL 1WBXA 2F68X 1YQVH 4N90E 3ZKQD 1OSZA 4QAWA 5ENWB 1NFKA 4M4RB 4F8QA 3X13A 3O3BA 1KCWA 5ESAA 3IETA 3HC0B 4K2UL 3TPUB 2A9CA 3ABGA 2AXFA 3F6LA 4NZUL 5J13B 3KPMA 5EMYA 3QC5X 5I1KH 4ISVA 1YMMD 4G8IA 4JHWL 3WU1A 1T03L 3ULVF 5DQ9B 5TD4A 1QTSA 3SDCB 1ZPLA 3NCYP 3KLHC 1LE5B 3WMSA 3G6JB 4QGTA 3WNJA 2D0FA 3RWGA 4HLJA 4DGYH 1SPDA 5FW8A 3BH8B 3GEWB 3O45A 1N19A 4XMZA 5LG1A 4B9ZA 2DQEL 3P3YA 3QUZA 5ABAA 4R0LB 3V5DA 1KJ3L 1FGNL 3AACA 3S2AA 4YGVA 5BZWB 1HHKA 2CGYA 4X8XA 3CU7A 3QAZC 2CUAA 1F4YL 3ARYA 3EOTL 3NSFA 2YRLA 3DECA 5E94B 1FH5H 4OZGA 3KPNB 3W9EA 4XCFL 3PABB 3QDJB 4P46A 3GEFA 4GG6B 3D30A 4OCWH 4CRPA 4V2BA 3RHWK 3W39A 4KKQA 5T5FL 2UWEB 4O2FB 1MCQA 1SZNA 1OCZB 1B2YA 3WNOA 5K9OA 2EEFA 2BSBA 3VRIB 2R9HC 3JV6A 2CO7B 2QMJA 4QF1B 2KDGA 3CX5J 2HUEA 3O6FA 2BNRA 4XCCH 2NZIA 5D2NA 2L7EA 3CHSA 3MRBB 4FP8H 3WXVL 4APQD 1F6FB 4BK4A 3S98A 5EEXA 1ANUA 1KJMA 4F7CA 3FT0A 1QBAA 1UXWA 1U8PA 2NMSA 2PYEB 4KMTL 1RKRA 5CO1A 1E4HA 2OP4H 1PG7H 2N4IA 3JWOH 1FFNA 5AOIA 4F20A 3Q9QA 2CA4A 3QZNA 5FA4A 3L9RB 4P23B 1R3HA 5E8PA 3T1WA 3ORJA 3N3EA 1W6WA 1ILSA 3P9WB 2ITDB 3BJ91 5IK3B 5ACZA 1GC1L 3DV4B 1XD1A 5C09A 2IPTH 1DVFB 4NRYB 5AW8B 1I3VA 2FECL 4NAJA 2A74B 4PCTA 3N1MC 4EQ2A 2K70A 2Y25A 3KG5A 4FXGC 1A6PA 2AJVH 2EQDA 1KXVC 4JEGB 4JZOB 5CZVH 4I48B 3WFEL 4GRLB 5IB4A 1HOEA 1URLA 4NLAA 4P9HL 3WIIH 3HG1D 1T2QL 7TAAA 3ASWA 4V1DA 1YC8A 4LSSL 5AW2B 2PP9A 2YLKA 4AENA 5L8LB 1J0IA 1IC0A 3CZKA 5JW5A 1JPTL 2ZUWA 5C7ZA 3V4VA 5E7FA 1WDAA 4JRFA 5INCB 1IKFH 3WG7B 5KBDA 1NDGA 2DS4A 1ET7A 3QW9A 1KCUL 1PCSA 3DURA 5IROA 2MKWA 3BPNB 4G9FB 3MRGB 1CN4A 2NDGA 3FN9A 5ECGA 3KWTA 4G6AC 5JXEC 4KKCC 1EEYB 4MYPA 1ODAA 4B97A 1U3NA 4ZNEE 4PRHD 2E7LC 5IVXA 2DDQL 5JIKA 3AG1B 1VPOH 4PV1C 4UAOB 5FGCB 2OTUB 1AXSB 2OW6A 3GJFH 1MFDH 1ZHNB 1OSPL 4UT7H 3N9GL 2JLLA 2KZKA 4Z7UB 4ONHB 4GNKB 1QSEB 1JMXA 3BH9A 2AMUA 4H13C 5C0ND 5I1GH 2NY7H 1DLFH 5I8OH 2VDKB 3R18A 3QA3B 3PP4L 2WGXA 1WIOA 5JIMA 4LGPB 2VZSA 4APXB 3QISA 2O30A 2EIEA 4PJGA 3TPUA 5KYNA 4WHTB 3MUUA 3QEUA 4GKNB 3GKWH 3ZO0A 3AU1A 1OAUH 1P4IH 4M6OH 1OP5H 4WSJA 2CK2A 1VACA 3KPSD 3DRQA 3MQIA 1JWMB 1UT2A 1TMCB 3DYPA 3NIFB 2YEZB 5AW3B 3ZT5A 2AW2A 2QLVB 2HTKD 3ABLB 3BD3A 3GJFA 1OPOA 1PEWA 4G6ML 5EF1A 5C1MB 4KNTA 5GS1B 4Z7IA 5F7MC 4MVBD 3OKNA 4ENEC 4OI8A 3DHPA 3LEYL 1FL5A 2WAQA 5JPMA 5KYYA 5FGBC 2VM9A 3T2QA 4S1RH 2J2ZA 4DPAX 6FABL 4ZAKD 1DEEB 4HHGA 4NN7C 4LIQE 3MYJB 4ANXA 2RCSL 1IEBA 3RDTD 3VU1A 5G4OA 5HGHA 2F8VA 4L1TA 3LPGA 1ETZA 3JT2A 4LCWE 3TA3C 4H0LC 2JJUA 3P69A 1PLGL 5ESQA 1OF0A 1WRFA 2EDQA 2N7SA 2VLJE 1LO0L 5FYJD 4Q4EA 4E0RB 5CR1A 3NJKA 3UROR 4HUNB 4UB0H 1FFQA 2ICEC 5AALA 5LWYH 1IIKA 1UGNA 1R5WB 1FFPA 1XXFC 2J1WA 4RSVA 3NIGB 5GHWH 1MEXL 3SDAB 4ZSOE 4LLDB 5DURB 1KJVA 3OZ9H 1CZ8H 3HPJA 5IHWA 1BZ7A 2Q7AA 3EGSA 2Y36H 5IUCA 2VOTA 2J25A 2VDOH 1ZKAA 4WTWA 3GO1L 3SGDI 5DEZA 2QQQA 1VEMA 1DSFH 2A73A 3O8XB 4U6YB 3SQOL 2XG5B 3O11A 4WW2F 1DFBL 3ZMNA 4JM4L 5CIPH 1HE8A 1YEWA 5D7LB 4PP1D 2FL5B 1CXIA 1ZA3B 2VXSL 3EJUA 1MIMH 3FFCE 3IDGA 4J3OG 3T6VA 3VXSB 4YOKA 5BOJA 4UTBA 4BWWA 2BOCA 3I9GL 5HYJE 1A3ZA 4A7SA 4IIQC 3EDJA 1E3XA 3DSNA 2WV3A 4YSTA 4FQXB 5JTWA 4D0DA 1TTUA 4OR1A 3LDBB 4E36A 4G7SB 2Z31B 5D2LF 2A74A 2K4WA 1BEYH 3HI1A 5FFLA 5I76A 3GFUA 2JWYA 3QFGA 4UIKL 2FATL 5E1QA 2VR9A 4ZFZA 1IJNA 1LD9A 4XXWA 1HX0A 1C9SA 1TXKA 2R29L 1NGPL 2YQ3A 4WFEE 3GNMH 4IHBA 4XVUD 4GG8B 4R90H 4ZO8A 1CD0A 3EBIA 3ZMEA 5I8CA 4M4RA 2WKOA 2QHLA 3KW7A 1L0PA 3KYOA 1G5GA 5ALCH 1ZV9A 1RK7A 2B9BA 5DJYB 4UNVA 2C3WA 4BDVB 4Z9KB 1EZLA 1BGXH 4I7ZC 3VRIA 4TTGA 2BRRH 3ETTA 3G6JE 1W0VA 5K93A 5I1HH 3MRNB 1NCIA 3GRWH 3EDDA 3O6FB 5E2WL 1H0DB 3DA0A 2MNWA 1KMGA 1UXSB 3RIKA 1CICD 3TFBA 2H8PA 2I9LA 4LVOC 3HA0A 3MBED 5HTSA 4P2QE 4OJDH 1A5FH 4HH8A 5EZLB 4YHYB 5FK9A 2HB0A 5DGQA 4HUWB 4W6XB 4F1ZA 3B1TA 2CBTA 4LP5A 5GZOC 5A3ID 3QZWG 4KQ3H 4XN5A 4LMQI 1REIA 4MB1A 2KS0A 4X2UA 4L29B 3QWQB 3CVDA 2PO6C 1OW0A 2ZQKA 3NJNA 2W38A 2WZPA 3GMLB 4MNQD 4P2OB 1M4KA 4PJCF 4A1RA 3DARA 3EH1A 1X6NA 1YCSA 1N6VA 4XCEB 2W0FA 4NO0D 5FCUL 5JIHA 2HXAA 1I9IL 3WD5H 4MJ5A 2OXHB 4KFZC 2A6JB 1I7TB 3N1GC 1YN6B 3FT2A 3PDGA 1F42A 1UXLA 3BWUF 4NWTL 2PXYA 3EBHA 3GJFB 3SO3B 1F5WA 3F7YA 3H9YA 2H32B 2G9KA 1FAIH 4UIKH 2RD0A 3UABA 3AFLA 2VMFA 2EEAA 3C6SB 3FTGA 3NCJH 4YZWA 3MLSH 5JORB 1VZIA 3QG7H 1TPXB 1UA3A 4AYBA 2WYHA 3RG1C 4PMFA 1NWPA 3LH2L 1EHXA 1E5CA 1I3GH 4U4IA 3VMOA 4U1NA 2ZUQB 1MJ7H 3WJLC 4F7CB 1UJ3C 3AGVA 4CC1A 4PBXA 3V0VA 4KK9C 3RFZA 4U1SA 5I1IL 2F53B 1OXYA 1ACCA 2N01B 3II1A 2CK0H 1I82A 4OTXH 1JV5A 1AGFB 2R1YB 3CFDB 3EYOA 3TT1H 2ISDA 3V7AE 3WXWH 5LWYL 5L2KA 4GG6E 3EYUH 4WKXA 1JPGB 4NEHB 2JXMB 1GZQA 1J1XL 1BQLH 1RZKL 2ZAIA 2WIIB 3TBWA 3TEZA 2J6EL 3B9KC 1TQWA 3EDFA 1XGRB 1ED3B 4QHKI 1ZSHA 3KWXA 4WGVB 3UTPD 5JHLL 1MHPH 2Q20A 3O2VL 3TH3T 5KZCD 4LE8A 4MMYA 4FOMA 4K4KA 2C3VB 4JB9H 1NINA 1IU1A 3LKQB 1MEXH 1OK8A 4TVPH 1BAFH 1FYHB 3ZE2E 1KT2A 1AP2A 3IRZA 5D9SA 4AVIA 3IAQA 3DWTA 3F83A 3UJJH 2BW4A 2OSWA 4OQ1A 5FDWB 4FJZA 4ZZKA 2DM7A 1EEYA 2J8UA 2Z92A 2XETA 4I1NB 4BFBD 1QMUA 5LBSA 1JFQH 5KYUB 3TO4D 4HZAA 3EG9B 3VVVA 2KYIA 1CU4H 2VDKL 3BO8A 5IQNA 1LMKA 1XGPB 1QSFA 5KSBF 4JMXA 1QUNA 2UYLB 3IGUA 1MH5A 1RVFL 3VX0A 2R69A 4HQQL 3B3IA 4UWQB 5L7XL 2H0PA 1KLUA 2AK4A 2ATKA 2I26N 2I60L 1TZ8A 2BRQA 2P80A 2V7NA 2VRAA 2Y5TB 2X4NB 5E5RB 5AENA 1GOHA 4XNMB 1RHFA 4NRYA 3CNKA 3FUDA 3N06B 1JXGA 2GJ6E 4A2DA 4DP7X 3AAZA 4PRHA 4M62H 4ZMNA 2Y5QA 3T65B 4NCC2 5GS1C 2LFEA 1NCWH 2V9UA 4HIXL 1YEIL 1GGTA 5ICUA 3L3JA 3CFCL 1NOFA 3EFFB 2C3GA 8FABB 4PH8A 3T09A 2QKIB 2QVKA 2R4RL 3WUWB 4R26L 5DVKA 3FH5A 4IM8A 3DVGB 3ZKXC 5IMLA 2OMVB 4N6RB 4UF7C 2EVIA 5HJGA 1TZIB 1K6QL 4CSPA 4YHYC 2VXUL 4KRNA 3DX3A 3KGTA 4OF7A 3SKMB 4BFEA 4DEPB 3VD0A 1LEGA 3BSZL 1SF3A 2HCZX 4N6QA 1CC3A 3BFQG 1TJGH 5C0JA 4P5TC 1ZXQA 4A2FA 5DC4B 2PUQT 1SHWA 4Q2ZA 2NY3D 3V4PA 4Q9QH 5D2LA 3D0LB 4M7JL 35C8H 2ARJA 4HKJA 1HSBA 3PL6A 3VFSB 3RA7H 2EE3A 4ODTH 3MV8A 4YMPA 4WTZG 2CLVA 1FFPB 1FBIH 3GSNH 1G87A 2DOCA 1ZA6B 2BC4A 4UOQA 2Y06H 4MZ2A 5TJWK 5DRWA 4IU3B 2B3IA 3MNVA 3FHEA 4JM2A 4N3TA 1FVCA 4H25A 3QUXA 3QJHB 4AGMA 3OJ2C 4E5XB 5A2BA 4XCYA 2I32A 1E4XH 3BVXA 1TOXA 1P6WA 1UWGH 1NC2A 2ED8A 3ATBA 4PV9B 4YL4A 2QVIA 3AC0A 1XO8A 5FYKU 1ROWA 4RDQF 1DP0A 4XCCL 1BOGB 4H8PA 2FQEA 1G7IA 3KWVA 3Q43A 2FB4H 4WI5A 12E8H 4HGMA 5F88A 3W2DH 3AMKA 5IVXE 3UDWA 4FFWC 4JJ5A 2WN3A 2FLBT 5IHUL 1XR9A 2ZXCA 2F74B 4G1EB 4WI4A 2ITEA 3X17A 1A25A 1AXTL 4PJ8B 3S5LG 4I3SL 3VH8A 5CU9A 4WHYG 3MO1A 2MCG1 1KPVB 4ODXA 2OQJB 3CFTA 4FI8A 4I88A 5BO1L 2VUYA 5IIEA 3BGMB 3V0AC 1P0SE 1HIML 2NXZB 2VITB 3BISA 2FR4A 1NSNL 3RPKA 4Y5XA 5BVJA 3LXBA 1NJ9A 4WK2B 4X6BA 1SVBA 1Z0NA 3H56A 3K6NA 3BPOB 3RWJA 1H5BB 3OJDB 4MYWB 5IESH 1RZFL 3GQFA 1CGYA 4R7NB 5EC2A 4AY0A 4KXBA 4EVNB 3IDXH 1PZCA 2F1EA 4NNPH 2O5XL 4XP1H 5HHXH 1F1GA 1ND0A 3FK3A 1CXEA 2B7DT 1ECYA 2FX8L 5KSUA 3U7YH 2Z65C 2NUTB 1I8MA 2DQIL 2V5YA 1AI1H 4EXKA 3T1FB 4NNPL 1G43A 1OP5K 4PPTA 2BY1A 3VMPA 5C0FA 5MP6L 4OGAD 1KCSL 2OZ4L 3D39B 1B0RA 1RPQA 2QV2A 4DERA 2ZXGA 2Y2TA 4P4KB 3N91A 3V79C 3CVHL 3A5VA 5INCA 4HMEA 1FC2D 4RDQG 3S3JA 3WFCL 3R4DA 4MD5A 4OLVH 1FI8C 3ESNA 2HYMA 3GMOA 2CDGB 3P4OB 3NFPA 3THMH 2VSKB 4WO4B 5EU6D 3Q8BA 7CGTA 3UO8B 3LIZL 4HKZB 1TLMA 2C4FT 4ZUWB 3CFEA 3DYOA 3F64A 3G5ZA 1CXFA 4H20H 4U1LB 1F6AB 4WTZA 3SPIA 3VQLA 5C0DA 5IB3B 4GBXD 3FAWA 4PLKD 1SN2A 1YEDA 4TUJA 5IK3A 4WNQB 5ACZB 3UPRA 1CIDA 4PGBB 2NY0C 5CEXA 1HL9A 1D2OA 2JKSA 15C8H 1HC1A 3D69A 2D8KA 4L8SC 2G5RA 1FFOA 2ZX7A 5F9WC 1CDJA 3AUVA 2VN5A 5E1IA 4X0KB 3WENA 4HJ0C 4EPSA 5AQ0A 1P4LB 3DETD 1KN2H 3WY1A 1NCWL 3S8GB 3GSUA 1NCAH 3ATEA 1MCWW 3VXPB 1PZ2A 5DR5L 4DESA 4FRWA 1G7LB 3IKCB 3HBQA 1UC6A 3VXSA 4NDMA 4GQRA 3V52H 4KPHL 4PJ5D 4I0PD 3OHXC 3VNZA 3PE9A 3ARFD 2P5EB 3H6AA 5GS1A 1F41A 1UKSA 4I9XA 5C8JB 1W72B 3NZHH 3LZLA 1UYWH 2WBJC 4U1GC 2DWXA 4AGQA 3BVDB 1MCEA 3BO8B 3QPXL 4PS4H 2K6WA 4LO9A 4HXBH 4L0PB 2P9RA 2B9AA 4R5TA 3MGAA 4IHOA 3SOBL 3D6GA 2YSSB 1RL1A 3BGFB 4PJHE 4OBRA 4MD5B 1DANU 3FDWA 4B5ZA 2B3RA 3BW9A 3GMLA 3FRPA 1MRCL 2Z9TA 3QK0A 2C9XA 4DKTA 4PJ5E 5C0AE 1WZLA 4QTIL 2WUCL 2C3VA 2A6KA 4G7VL 3SBRA 4X5PA 3WN5A 1E4JA 4CA4A 1W72H 1B3IA 5C2BH 2HFFB 2YXFA 3OZ9L 3H53A 3Q6GH 4DQOL 4Y5YA 5CMAA 4FFWD 1GZPA 3J07A 5FX3A 4CMMA 1VKXB 4WJKB 3MJ7A 4W68A 2OR9L 1WVZA 4WLCA 4V11A 1JPSH 3V4PL 1G7MB 4X50A 4Y4KC 1NCBH 2GJRA 4U1HB 1A7OH 2WNGA 1LO3H 2X4OA 2VYRE 4IKJA 5FUZL 3HC0A 3NTCH 4N1CA 4OZIF 3TS8A 2ADGB 1A9VA 1M7IA 2MCPH 2ZP0T 4L3EB 4ZDHB 3TZVD 3HJEA 4YSAA 4Z3GA 1BFVL 4MAUH 1PIFA 2OS7A 4QYAA 5DJDA 3BUDA 3P9MB 5I6LA 2N3JA 3WFDL 1F86A 3VD3A 4FZEL 1SHXA 1HQRB 5E6SB 2UY7B 5TE6L 5JHLA 3H2WA 4YNYB 4YWGL 2BIQA 2YC1B 3KYNB 3QUKA 4MMZC 4RGNB 1XTLA 3P11H 3CHXA 3QNZA 4JMNA 3RVXD 3TJHC 1PNCA 4MB3A 1UZ6F 2AANA 4MJ5B 1YECL 1CBJA 4PP1C 4QJ5B 3IT8D 3CQQA 4JRXD 4JKLA 3SD5A 3QDGD 4GIPD 2Q1EA 3ALWA 2FTAA 4NP9A 2AXGB 1MNNA 5CJOL 1AZNA 4TTDD 2G75A 1CBVL 3SJVD 3G7TA 4WHTA 1E6JH 2E7DA 2NUPA 4YPGB 4PJAE 4NN5C 4X5QA 4ZNEA 2E7LA 2J6EH 4UZSA 3GSVB 4PJ8C 4KX8A 5FHBH 1E9OA 2BK8A 4K3JH 5HSFA 3AMLA 3VXUB 2YPLD 2X7LA 4U1JB 1U92A 3TCXA 2R4SH 3BUQA 2YPLE 1IGMH 1CD1A 4IJ3B 3EO1A 3ZRSA 4FQLH 5BVPL 2W0LA 5EV7A 3VD7A 1BMZA 2Y0SA 1CDIA 4BQ6A 5DXWA 2HSIA 3ZSSA 1MCDA 1S7UB 1SJMA 3KVDD 4HIJB 2MCAA 3AQXA 4P04A 5F7YC 4Z0XA 3UBFA 4WI0B 2C9SA 5I6XC 5IB1A 4R83A 1FQ9C 3KS0J 5LUMA 4FNUA 1H8LA 5F9DC 1XGZA 4KITB 4GUCA 1OCWH 1VFMA 5HYIA 3LZFH 5J11B 2AEPH 3ENEA 4Z7VF 3N50A 4X9YA 3P3TA 4BFRA 5T5FA 3FQNA 1AS8A 1RP9A 1P4LA 1UOVA 3BEVB 4I9WD 5DHYB 3D18B 4ZZFA 2Z93A 3WIFB 4H8UA 1GGCL 4KK6C 5ANME 1ZANH 3KPSE 3K8LA 4Q4IA 3EKCA 1UUSA 3GRWL 4KKAD 2DLFL 1EO7A 3E2HC 4XE5B 5T3ZL 3RWGB 3FF8A 1J05B 5A2JH 4OZFH 2NR6D 5E2UH 3E7JA 2EH7H 2F58L 2GJZB 3G08B 5F1KC 2IPUG 1AQKH 3K6FA 4MJIB 3EUUA 4NKOA 4PR5A 2E4FA 1T04B 2AABH 1PJ9A 3QZWA 5DJ6A 4Z78B 3W9DB 3UO1L 1DVXA 1AO7D 1OD7A 1OEZW 3FSWA 3CFQA 3RZWA 3BP4A 5E2WH 5EF3A 3CWGA 3B7RL 4U6HB 1MJ8H 3FOLA 3MLYH 4URKA 2CO3A 2X2UA 3UTZB 1JYNA 4IBWA 1OL0A 4P46C 3ZTJG 4QTHB 5LGKA 4X7TB 4YBHA 3OF6D 5LGHH 2JELH 1QWUA 3I3EA 4AKOA 4KI5D 1CLZL 3IU3A 1ED3A 1KJVB 4PGCB 2J44A 1SLXA 5IB1B 3TO2B 1BBJB 3CN4A 5DHDA 2BIPA 3V4VL 3VD1A 1RHHA 3TBTB 2RJMA 1OGTA 3FQYA 3SE3C 3WS6C 3L5XH 1YY9C 5DD0H 3HMXH 3U4EB 3VFGH 1W6LA 1WA0X 4P2QB 1CGUA 5TK4A 1YMHA 1E27B 1RURL 1QI3A 3TBCA 1A7PL 2YN5A 3Q8AA 4DNLA 3DUUA 4PRBA 3QDME 3WTXA 4NO0B 3WEXA 4GMTL 2F9BT 5I1LA 5GIRB 4QRFA 3M8OH 5CZRA 1RJCA 3TCLB 1DL7H 3TEWA 1EJOH 5KSAC 3U6XA 4PN6A 3TGXA 4POYA 3VWJA 1E9QA 3Q3GB 2HKFL 4ZJ9A 5CSBA 3ZTCC 5KTEL 4MJ6B 2Y9RT 4TLSA 3IYLW 3MV8D 2DEYX 3U1QA 2C8NA 2EXYD 4PVLA 1CTOA 3I9IA 3QIWA 4PU2A 2XICA 4GYBA 3UOAB 5F3BA 1C12B 2R1XA 2Y23A 4IIQA 1JXJA 3AQZA 1U0QA 3KGRA 3HNSH 2GIMA 4XOBA 3ULUL 5DHVH 3KZ8A 3BPNC 1Q1JL 2VERA 3GRBA 4MJ2A 5CGMA 3T6QC 1S9XB 2G2RA 3NSDA 4IMKC 1XT5A 2OYLA 1IGYA 1YPZA 4JKNA 1ZVNA 1VDGA 3DGCR 5FV1L 2OXGA 3EADA 1W0YT 4NNXB 2YARA 4ODSL 3ARZA 2ZCKL 4W4NA 4GP4B 4KKNA 5DVPA 4NFBA 1HOCB 1KGIA 2KT6A 1I7TA 5HYJB 2VN6A 1CE1H 1Y07A 2VWEC 4FGMA 5TE6H 2O4EA 3P0YL 5GJSL 1USZA 4AQOA 1H0DA 4WTXA 1HH9B 1UATA 2J73A 1FORH 2H5UA 3MCYA 3OKKA 5EUOA 4JX0A 2XVGA 4GSUA 1ZHBB 2WVSA 4FLQA 4IRJA 1SXCA 5D4QA 2OMYA 2YKLL 2A1WL 5C0JB 2FQFA 4MSWA 3TVMA 5AAMC 2ZOKA 5F9OL 2VAAB 3IMRA 3MC0A 5BV7L 4FHJA 4JO5A 2J6EA 5TGBA 3ZZQA 1G9ML 2NW2A 2XDHA 1CFSB 4UCFA 1MG3C 2WPGA 2E8YA 1EO8H 1QTPA 4KVCH 1QA9A 3BMWA 1YYLH 3GSRB 3O3DA 3WLBB 1N5YL 4YK4B 1YMME 3LN5A 1G9NC 4MZ3A 2N56A 3AT8A 4LSVH 4LLDA 5C0AB 1LP9A 2VDOB 4XBPA 5B1KA 1KFAH 2GJZA 2QGEA 1SJEA 1G0YR 1H8SA 1C1EH 2PLTA 5CCGE 1RMFH 2HT2D 2JSFA 1WCBA 2CNYA 1I3RA 5TK2A 5I74B 2H7WA 3Q8EA 3IMWA 4W4OA 5C0BB 3TT3H 1VPOL 4J3UA 4QGYA 4WI6A 3P9LB 4X6CA 3D8MA 1B4JH 5G55A 3CDGB 1FZJB 4L3EA 2AJVL 4H8WL 1QZ1A 2LU7A 3L3DB 4PB9H 1DE4A 5H35B 1HYSD 1PNDA 1MJ8L 2PP8A 1U3HC 4U1MA 3M45A 5F44A 4HIHA 3MO1B 4QRSA 1UT9A 5ADOL 4Z77A 2MNJB 1L9QA 2BNUB 3MLRH 2HAZA 4I4WA 2HA1A 4U7KA 4XOCA 2H0FA 2NYYC 4F58H 4KJWD 1IGFL 4ZRGA 5EF2A 4LBEA 1TTRA 2P5WE 4FNRA 3ZKSD 1WD8A 4WY7L 1QLRA 4RFOL 4ZYKB 1M1XA 3T8XA 4G8GD 4NKDA 3QYNA 3QS3A 2V37A 2WZ6A 3P73A 4XRCB 4YFEA 5CBEA 5BOZG 5C9JA 2DLTA 5I1CH 2A73B 3O8XA 1N3NA 2EH7L 2F58H 1OSEA 4IBUA 2XKNB 2AJYH 3WNLA 3PHQA 3AQYA 3FN3A 1SFHA 3TH4T 5E6IA 1N12A 2OMTB 4JHZA 1FN4A 1KGWA 4FP8L 1LEKB 5T5FH 4WGKA 5EORL 1UASA 5LN4A 2YGQA 4QCIA 2GITB 1E90A 2W60B 3CXDH 3ARBB 3VI3A 5LB1A 2BIOA 5JQ6L 2X6UA 1CK0H 3MBXL 5GGUA 2FBJH 5FKPA 3VTMA 3NGBB 2C5DC 3D09A 1PG7L 5TF0A 1CIUA 2HRHA 2HT3C 1RPKA 2F6AA 4PJ8D 4BK8A 4LKXA 3RJOA 1KJ3H 3DJSA 2Q3AA 4FQIL 4WW2A 2WWNA 3CDCA 5AOJA 3L4UA 2BZ7A 3P1VA 1O7VA 1E8XA 1RY7B 1F4HA 2V3FA 2XZCH 4KAQH 1V7MH 3O6FC 1R5IB 1SEBA 1B3JA 5KG9B 1RULH 5JW4Q 1GTFA 3NPSC 3QUYB 3OJDA 2ZJSL 4Y4HA 4QHUA 3KDMA 1FJ1A 2NNCA 4Z7WA 5JPNC 1JVOA 1TETL 2BNQA 5AUMA 5K1JA 5DJ2B 2VXTL 1BM7A 1HK6A 2YD0A 2PR4H 1OAYL 3AXHA 4FYTA 1WS8A 3MREA 1HEHC 2BP5M 1JZ8A 4LOUC 2A6JA 4PV9A 5KSVB 4ZMOA 5FECB 5I1EH 3VQ1C 2EO1A 1INQB 3IDXL 3IJSB 5CS7A 3F7YB 2CU9A 2XWTB 3QQXA 5B1AB 4Y9BA 4RAUB 1I9RH 3NZHL 1Z9OA 1Z7JA 4HFUH 1ASQA 4PRBB 5ALBH 1Y7VA 3KGSA 1X9LA 1JRHI 1OB1B 2R29A 3DMMB 1VADB 3SY0B 1FSKC 1FVDB 1UD4A 2LGNA 3A4FA 5F96L 5I75B 2GITA 3EYQD 4HUMB 5T1DL 5IG7A 3WTWA 4I3RH 1A6TB 3O6KH 1QFHA 2IGFL 5J6GA 4ZXBD 1MLBB 4LCWD 3HHRB 3MJ9H 3F7LA 4NRXB 1P84J 3S88H 1FRGL 4X9IA 1AGEB 5C07E 5KBKA 3T0DA 4LHUD 5I8EB 4PJ6A 4YBLC 3VXRA 1EHAA 1CVSC 5D1QE 3FRUA 3BAXA 1X5YA 4KQ0A 4CSZA 2FDBP 5HJ3B 2APWA 2W65B 1IUZA 4PJ9C 4DO4A 4XT1C 1MY5A 4NZRL 4K23H 3N6YA 4PRID 3VFPA 5A16A 5JW5B 4J3TA 3I50H 2OR9H 5E8NB 2X6AA 3UTSB 3K71B 2VR6A 4Z7QF 5PAZA 5I15H 3SDAC 3CVHA 4JZNB 4PI2A 1F4WL 4XP6L 3PJNA 1UB6B 4HDIB 4AT6B 3ECBA 3VXPA 1BF5A 3G9AB 4YE4H 1OOWA 4R7LA 2EXSA 2IAMA 2FJSA 3QFJA 1WV7T 3S3DB 3EXLA 3AABA 3GUFA 3LKSB 4JR9H 1ZOXA 2WSDA 3QBTB 2ARWA 4PS8A 3ZE1B 4Z95H 1IBGH 3E6HB 4IBYA 4R5VA 4E5XG 4JUSA 3V6OE 1OE3A 1CD9B 2QR0B 3QYMA 3SOTA 4M6MH 4M9OA 3FCTA 1YN7B 1G1OA 2V9RA 5I6NA 2A9NH 5H4ZA 4X6BB 4G9DA 2NW2B 4N8PA 3SY6A 3AXLB 3DX8A 3GMPB 4R26H 4JFYA 4M8QB 1QNZL 5TQ0L 1CQYA 2ENPA 3MRIB 4PLNC 3VB9A 3H54A 1OAXL 5D5MF 1KBKA 2GTZA 1FNEA 3WGVB 4XN1A 4BKLA 1EEQA 4GW5B 5D1ZC 4F57H 4Y9EA 5GRWA 1DCLA 1I7UB 3UGEA 4HJ1A 2BSDA 1BZ8A 3QEQE 5HDWA 4YVNA 3ISWA 3VXOA 2DBLL 2O5ZL 4PBWD 2EDLA 4J12A 5KZCB 3RWHA 2XY1A 2V2TB 2P5ED 3MNVB 2GSGA 1TYEB 4HT1H 5FHAH 4POUB 1JXDA 1HH9A 4QYOA 3T6XA 2NSQA 5JLZA 1E6OL 3VXSE 5DYOB 2I5YL 3O4LE 3O0LA 1EJ6A 5ES4B 4J4PD 5CN2A 5IVNA 5TE7H 2W07A 4M5YH 4PV8A 4X98A 3MBEC 1BOGA 4XXCA 1HXMA 4CSTA 2PW1A 3DRTB 2CGRH 3MODH 2VLRD 5D9SB 2J5WA 3JV0A 2DKSA 2DLHA 3HAEH 3WDHA 2HX8A 4XI5C 3V5KA 1IC1A 3MRDA 1BJ8A 3ZIYA 1G6RH 2R2EB 3E8UH 4HJJL 2CKBH 4JFPA 4WWKD 4FFZL 3NFSH 4LQ1A 1KPVA 5AVTB 2X41A 1IX2A 3GSNB 2XQYK 1KB5A 3VA6A 4LIQL 4JFHE 3MKKA 5JXEA 1IIIA 4UUJB 5FM4A 5DJCB 1D7BA 5KVFH 3T3PE 4HKBA 3CZNA 2JF1A 4LCWB 4F8LA 4LB8A 2FBJL 2VN3A 3FUEA 2DIAA 4JO2H 1QRNE 3DROA 2CMRH 1EZVY 1DUZB 1KY7A 4PLOB 2ZWLT 1Z9SB 3VG9B 3GZOA 5IBTL 4XBGA 4MJ4A 5K69A 3DUUB 5DD0L 1IC5H 1IFGA 3MBWA 1H3PH 1JTPA 1BYNA 1P53A 3Q2CA 4QWWD 5HYJD 4YC2C 1JDDA 2P5EE 4PJEF 3WNPA 1OWR