4M55A

Crystal structure of human udp-xylose synthase r236h substitution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
312
structure length
263
Chain Sequence
RKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGKHVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Man o' war mutation in UDP-alpha-D-xylose synthase favors the abortive catalytic cycle and uncovers a latent potential for hexamer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords UDP-glucuronic acid decarboxylase 1
total genus 92
structure length 263
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.35: UDP-glucuronate decarboxylase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m55A00
2O3TA 3VZRA 4AJIA 3L9XA 4BQRA 1IZ9A 1QSGA 4OKIA 3UN1A 3VZSA 1DFIA 1PL6A 2ZQYA 2B36A 4FC6A 1P45A 3DWFA 1W8DA 1XCBA 3WQSB 3K30A 3DC2A 1N9GA 2VTEA 3OA0A 2FRDA 1VL8A 3IUSA 1X0XA 1WWKA 4BQPA 1E3IA 1GUYA 3Q6IA 4O59O 1GV0A 1H0KA 4WECA 3WGQA 4C4OA 3GUCA 3DAFA 3H2SA 2ZTUA 1YRLA 3SVTA 3QQPA 5KIAA 5DOZA 4K28A 1V3TA 4M8SA 1LDNA 1NASA 1T24A 3DR3A 3GA0A 3ZWPA 2PR2A 5EJ2A 2C07A 2VHXA 4NK4A 4WLUA 2IYOA 4MVJP 3RBXA 4BMSA 4I08A 5ENDA 5F1OA 3MCVA 4EJMA 2PGLA 3JYNA 3ZDFA 2RIRA 3H5AA 3U4HA 3GPDG 3L9WA 2GASA 3L4SO 4HNGA 3DHNA 4ALIA 2IE0A 1P33A 1UXJA 4FBGA 1EQ2A 3ZNPA 1ZIDA 5L4NA 3JQ9A 4B8ZA 2Y0CA 2J5QA 1SO8A 5KVSA 4PG6A 1CQJA 2WMDA 4I5GA 4CM1A 1G6KA 4JK3A 5KWEA 3ZU4A 3INTA 3JV7A 5AXAA 1EBFA 3JYOA 4J49A 2UYYA 2D8AA 2QYTA 2DTXA 3GUYA 4IXTA 1Z7BA 1DRVA 4FJ0A 1EUCA 4D41A 1P77A 2VRBA 4M55A 4IGFA 4MJLA 5AOVA 5A3VA 2D1YA 2Y1GA 1D1TA 2VRCD 1H6AA 4IIUA 4PIVA 1GYPA 4WEOA 2PZJA 5DT9A 4L4SA 4BKQA 3PQFA 3HUDA 2VHYA 2JCVA 1A4IA 3MZ0A 3ASVA 2A94A 4PG8A 1Y8QB 4XJSA 3LYLA 5COQA 5JAZA 2VOJA 2HK9A 4HFRA 4NZ9A 4O63O 2NVWA 3ZV6A 4ALKA 4R1NA 3D3WB 3OJEA 4CMKA 2CNBA 2X9VA 4DYDA 5BSFA 1HSOA 2IZZA 1IUKA 4G5HA 4P8RA 5CEJA 2Q2QA 4FD3A 4WLVA 1N9GB 2ZYAA 4MVJE 1K6JA 1SAYA 2YV2A 3FNHA 3PWKA 1UAYA 3ONDA 5A9SB 3MJSA 1NXQA 1NHWA 4XR4A 2G17A 1O94A 3KYCA 4XB2A 4AJ4A 4CM4B 3F5QA 3T7CA 2DVMA 3DZHA 3JQEA 1I2BA 1U5CA 2NADA 4I8XA 3ROPA 4D42A 1Q7BA 2QIOA 4B8WA 3QIVA 4HNHA 4Z0TA 3IL2A 1EUDA 2O4CA 2PY6A 4A26A 1H2HA 1UZNA 4BKOA 3VH1A 1T2EA 2Y1OA 3PJEA 4AJHA 3QWHA 3SLGA 1KEVA 1LC3A 1CERA 3S2EA 1B16A 1E3LA 3M1LA 3V8BA 4IDDA 3GEDA 1XIVA 3PDUA 1TB4A 1E3WA 1QLHA 2DT5A 3L77A 2EXXA 4NG5A 4J1SA 3UICA 1V3VA 4FOOA 2X5OA 1DC4A 5CPFA 1LNQA 4F45A 3M1AA 3MEQA 3AUAA 2JD2A 3HSKA 2Y66A 4G2NA 4O6VA 1ZMOA 2FN7A 2HJRA 4J43A 4NI5A 5EL0A 4UULA 3KO8A 6ADHA 3GVIA 2EERA 1VJ1A 5DOVA 1XQ6A 3K2BA 2WWRA 4B7UA 2PKQP 4FDAA 3DOOA 2AE1A 4GMGA 2CVZA 3GHYA 2BFAA 3PFFA 1LSOA 3NT2A 2D4AA 2FY8A 2YQ4A 5I9MA 5L4LA 1R0LA 1F14A 3F1LA 2GN6A 4NPCA 4AL4A 1T2CA 4XR9A 3RUHA 1M6WA 3OH8A 4A27A 3AUTA 3UCFA 3WJ7A 5L7YA 1E1MA 5COBA 2UAGA 4QO8A 3M6IA 3ZN2A 1DO8A 2AMFA 3NGXA 3ABIA 1HDXA 1X13A 3QE3A 3V5NA 5CDYA 3PIDA 4ZRMA 3SC6A 2H6EA 2I9PA 2VWHA 3HHPA 3DZIA 3UF0A 2NTVA 1YL7A 2OO5A 5EQFA 3RUEA 3CKYA 4LN1A 4IY1A 3OQ1A 4OKNA 3AW9A 3PLNA 4J0EA 4OOEA 2JD0A 1B8UA 2BH9A 1U3TA 1M75A 1LA2A 1X15A 2F00A 5DF1A 1SC6A 4BIIA 4BV9A 1NAHA 1QP8A 5I7VA 4CLDA 3ADOA 4BNXA 1OI7A 2OZPA 4GBJA 5ICSA 1R0SA 5L45A 3ZWCA 3ONEA 4L76A 3CINA 4BNIA 4AJEA 2HU2A 1QYCA 1YBAA 1UP7A 1YL6A 4BNMA 4R54A 4URFA 4C7JA 1S7CA 4WASA 2OL4A 1XU7A 1BRMA 4AJOA 1Y8QA 3U3XA 1E7RA 1GV1A 3AM5A 2NM0A 5F1KA 3RFTA 2NUAA 3TZHA 4Z3KA 3FNEA 3KETA 4Y6SA 4NFYA 4YT4A 5IAAA 4CM7A 5FFFA 2BRUA 5F5NA 1HDCA 3KRTA 3C3XA 1PJ4A 5DBFA 1Z45A 2BKAA 1DIAA 1I24A 3D64A 2UV8A 1UXIA 1U2DA 3FR8A 2VWGA 3HDJA 2J6IA 5JW6A 3JQAD 4YAKA 1LI4A 4XQGA 5A3JA 2X6TA 3O26A 4E6PA 2GR9A 4XCVA 1NX6A 3GEMA 4P4GA 4BGIA 4IUYA 3H3FA 1UDCA 3WGGA 2ZCVA 1EFLA 3AOGA 4BNYA 3DONA 4J4HA 3JQFA 1H6DA 4NHEA 3ADPA 2NNLD 4GGPA 5AXDA 3RAJA 2C2YA 1Y8RB 3WMWA 1KC3A 3GDGA 3C7CB 3PJGA 3BYZA 2NU8A 2PD4A 4RVUA 4UUOA 4J4BA 2I3AA 3WX0A 2DAPA 1ADFA 1I8TA 1BW9B 1Z74A 5L95A 2PGDA 3PVZA 5L3ZA 5G0TA 3UW3A 4D46A 3PHJA 4N18A 4AJ2A 2HUNA 1GU7A 4IJVA 1WAMA 5JCJA 2C29D 4FFPA 4NBWA 3IMFA 3EVTA 4ALJA 2LDXA 4U6QA 3RUAA 3WBBA 3BMCB 1UXGA 4UVEA 3LT4A 1O8CA 5BSEA 5MGBA 2Q45A 2WEKA 2PZKA 1W4ZA 4YA6A 5I8ZA 3OMLA 1VI2A 1QXSA 2F1KA 5A02A 5JO9A 3UUWA 1LSUA 3BMOB 3HADA 1N7GA 1R4NA 1B8PA 4UREA 5ER6A 4HY3A 4AFNA 1WP4A 4BOYA 3OIFA 4ZICA 3A06A 4CJXA 3BMOA 4IDFA 4R9SA 1TXGA 3G3EA 1E5LA 1PU2A 1C0PA 4OSOA 2D5AA 3BXXA 5JDCA 4XYMA 4JX8A 4GWGA 1HSZA 1IHXA 4GH5A 4WJZA 4NMHA 4XDYA 2P9GA 3BHMA 4XRRA 4EUFA 3KEOA 3TF5A 3JQFC 1X1EA 3BA1A 3ST7A 1C0KA 3Q11A 3WSWA 3IKTA 3O8QA 2ZYGA 2ZB3A 4NJMA 3DDNA 4AVYA 4ITUA 4CODB 3UGKA 1DHTA 4ZA2A 2AEFA 2HKIA 4I5FA 1B3BA 1Q0QA 3KYDB 4MP3A 5A5FA 3ZU5A 2CMDA 5T67A 3WTBA 2YZ7A 1E77A 4IDEA 4UVHA 3RIHA 3DEYX 3W8DA 4CQMD 2X0IA 3DBHB 2NU9A 1ZJZA 4E31A 1A4UA 3UFXA 3BAZA 1HRDA 3HNPA 2JCXA 2W98A 3WSVA 5LDGA 2Z1MA 5TGDA 2X5KO 3RASA 5A05A 2GD1O 4CLRA 2O23A 3FNGA 2X7HA 5ADHA 1PJQA 1HYEA 2PH5A 1WDMA 3ANNA 4AJNA 1NVMB 3FBGA 3MWEB 2B83A 3AM4A 4G81A 3FPLA 4BUCA 3S2FA 3WXBA 2FR1A 3D5TA 3A4VA 4QTZA 1DLIA 1TI7A 2B4TO 4L9RA 3OM9A 4DBZA 4E13A 1PQUA 4D0SA 3H9JA 1I5RA 2G76A 3BTVA 3I9OA 4ESOA 5KJEA 3RKUA 4PZDA 2Q1TA 2C59A 3BMQB 3K8ZA 1I33A 1C0LA 5U1PA 5BNIA 5FWNA 4JBGA 3LDHA 1KERA 1UDBA 3WGIA 3AI3A 3VZPA 1NWHA 5FF9A 1AHHA 5JC8A 1PIWA 1YB1A 2J3HA 5A5EA 4TROA 5KJFA 1M6HA 1YGYA 2DTEA 1YDEA 3HG7A 3IUPA 2VTDA 1V6AA 1ZJYA 3CMMA 1M76A 2ZYDA 4PGFA 3JQ7A 4ROSA 2PD3A 5DCYA 1LSJA 3E6AA 1B26A 4G65A 3U4IA 1TLTA 1E7WA 3TWOA 4DMLA 1CDOA 2DKNA 4O5OA 3ROQA 5CDSA 3HN2A 4H15A 2C5AA 4AJ1A 3GAZA 2LDBA 4FFMA 3B6ZA 4R01A 2WE7A 3K9QO 3QHAA 2B37A 2TMGA 3RVDA 4Q3CA 4PVCA 3P5SA 3DBRA 3M2PA 3P2YA 3BMNB 4YR9A 1CWUA 1OC2A 2IZ1A 4RCVA 1NPTO 1GEGA 4YT8A 4ZQEA 4BNFA 3ROMA 2JJYA 3PI7A 3IKVA 5K6AA 1J49A 1E6WA 2HSDA 3BMCA 4YACA 1YBMA 5A04A 2UUOA 5L4SA 3ASUA 2Y0EA 3MJ4A 1H6BA 2DPHA 4D44A 4XDZA 3H6KA 3KM0A 3TQHA 2NU6A 3O4RA 4BGEA 3OEYA 3PYXA 2UDPA 4XRGA 1YJQA 4GX2A 2IEBA 3RJ9A 2AW5A 2B5VA 1BXKA 1CYDA 1NQAO 4U7WA 4RF4A 3DZBA 1I32A 3QVSA 3WLFA 4IBOA 1G1AA 1XGKA 1PWXA 3GHHA 3K5PA 4R41A 4GSKA 4CMEC 3EHEA 4LSMA 3I9KA 3VH4A 4R1TA 1W0CA 2JAHA 3HFGA 1PSDA 1BHSA 1PJ3A 5T57A 4XQCA 1VM6A 3TNLA 1X7HA 3IC5A 1YBVA 4HXYA 3QVWA 1HT0A 5TJHA 4RF2A 3DMTC 1DPGA 2VHWA 2W2LD 3S2GA 7ADHA 2BI7A 4PLTA 3SJUA 4CMJA 1WZEA 1HETA 3COSA 3KYDA 4E5YA 2V65A 2CFCA 3FN4A 2AQ8A 3GK3A 5B1YA 5C37A 3DHYA 2ET6A 3RFXA 4BO5A 4OXYA 1ZK4A 3PLRA 3EK2A 5F5LA 1HE3A 3I9MA 1A27A 2ZJ1A 1DLJA 1NVTA 1QORA 4B4VA 3SEFA 2EKLA 2AQKA 3ENKA 1GUZA 1M2WA 4YJDA 2WTBA 4DMMA 2PH3A 4KP7A 3GOHA 5U9CA 2WE8A 3JCZA 2CVQA 5JMPA 3T4XA 2I5PO 1ZNQO 3DHEA 3NRCA 3GZ4A 2RH4A 1Y9AA 1P1RA 2FR0A 3WFJA 4KQXA 1AUPA 1ZKMA 3VDRA 1ADBA 4RO0A 4W6ZA 3D3EA 2BHLA 4P22A 1EVJA 2DC1A 4PG7A 2VUUA 4R16A 1FK8A 5G0VA 1CRWG 3DZGA 5A9RA 2CY0A 4I5DA 1K89A 1U7TA 3IQDB 2YJZA 1ORRA 3CH6A 3PZRA 1LEHA 2CDCA 3KEQA 3WGTA 3V1TC 1UXKA 1H9AA 1VC2A 2EKQA 4D3SA 2DU8A 3JQ9C 1ULUA 1QYVA 2EV9A 4OXNA 3VVCA 1K0UA 4GGOA 4MINA 4YWJA 2DFVA 3ZHYA 4FJ2A 1VE9A 2BD0A 3NAQA 3ZI0A 3F4LA 5JSFA 4I1IA 3WNQA 2QW8A 4U0KA 1FJHA 1U4SA 3UAGA 2RH8A 3FCOA 1R12A 4EYEA 2AQIA 1LDYA 1Q1NA 5DP2A 1ID1A 1NFRA 5JAIA 4W7HA 2E6UX 3LT2A 5I8WA 4IJWA 2FSSA 3GVHA 5L53A 3GEGA 2OMEA 2VWQA 1KEPA 3QRWA 3R1IA 2ZATA 1HLDA 1Q2XA 2PGJA 2PK3A 1P44A 2XOXA 2WD7B 3GT0A 1PJSA 3JQ8B 4CM4A 5KTKA 1F0YA 1HWYA 1YH3A 1NP3A 3K92A 2RCYA 3W8EA 1LSSA 3ZW9A 4BNZA 4BO6A 2OBNA 2VZ9A 3OECA 1GUFA 2BELA 2P4QA 4BNJA 4BNHA 2IZ0A 4CMEA 3WGOA 1M67A 3BMNA 5G4LA 2JFGA 1HKUA 1PR3A 3GGOA 1P0CA 4A0SA 3FF4A 1ZEJA 3VPFA 2GN8A 4LGVA 2X58A 4IXWA 3S2IA 4RLHA 4A5OA 4DPLA 2Y1EA 1U3VA 1AXEA 1U4OA 4FSHA 3VC7A 3QWFA 4TMFA 5F3RA 3WS7A 2O7SA 4MVJD 2ZJ0A 4NFHA 3OEWA 5H81A 1U1IA 4J1TA 3F3SA 4DLBA 4XD2A 1EVZA 1A71A 4ALLA 2BFPA 2QX7A 2RHRA 3H9UA 3C1TA 1P74A 2CF5A 2Y99A 4ND1A 3RFVA 1U2GA 5G0UA 4BNLA 4EEZA 1DSSG 1UDAA 1GCOA 3KB6A 4HFJA 3VPXA 1YJ8A 3TFQA 4JBIA 3LSYA 2B4RO 3RROA 4RV9A 1N92A 4DTIA 1O6ZA 1H93A 1ZW1A 2O3QA 3I1JA 1I0ZA 3E5MA 2OXIA 4AJKA 1C1XB 1MFPA 1D3AA 4J6FA 3FSRA 4MPDA 4QECA 3MJVA 4PVDA 4WCFC 3W6ZA 4XYLA 1J4AA 4GAEA 5HM8A 4HV4A 5JNLA 1WW8A 4DQUA 3TOZA 1XYGA 4YYZA 1D8AA 3E9NA 1ZSYA 3GQVA 4RZIA 1EVYA 3AK4A 2WD7A 1BVUA 5TNXA 3WGYA 3NTQA 3OP4A 5ENVA 1J5PA 4MVJG 1VJ0A 1LUAA 3OETA 5I9LA 1PWZA 3RC7A 4L8VA 1O5IA 2ZQZA 3U5TA 4NJOA 3ZWYA 2YUTA 2POQX 5TT1A 2VZ0A 2EIHA 1AXGA 3PGXA 5EN4A 1O89A 5AYVA 4E30A 5CDTA 3VH3A 1WNTA 3ZGYA 3ZZNA 4D3FA 1UJMA 5G0SA 2GN9A 3GH3A 3RD5A 1ISMA 3BTOA 4FPXA 1PGNA 4LVUA 4BVAA 3MTGA 3B70A 3BTUA 5JY1A 3G79A 3JD0A 4E33A 4TZTA 2FOIA 3DB2A 5EERA 1JLLA 4GVXA 4YDRA 3U9LA 2ZB8A 4ZQGA 1XDWA 4JP2A 3DQPA 1W6UA 5B4VA 3A1NA 4YAGA 5HWSA 1DIBA 2DBRA 3OJOA 3TPCA 1BDMA 4ZQBA 3GG9A 2OGUA 4ZQHA 1LLUA 4DVJA 4CV3A 4NQZA 5JFOA 3I52A 3SX2A 5KJCA 4Z0PA 1BXGB 4E5KA 2SCUA 1ZXLA 3AY7A 4R9RA 5JDIC 2GLXA 2QZ9A 3WYBA 3KHUA 3L6EA 3D7LA 3U49A 4DIOA 5TT0A 1GQQA 1RM0A 5L40A 1FDTA 5AXBA 4BO4A 4BNKA 1I36A 3VTFA 3I9JA 4NBUA 1EDZA 1I10A 3NYWA 4D0RA 4LRTB 3E1KA 1IOLA 3LF2A 4XQEA 4E4YA 3OFSA 4TRJA 3OJLA 1SNYA 1QYXA 4E0BA 2NV6A 1GCUA 3WNVA 3C85A 3CMCO 1SPXA 1HXHA 2EWMA 3AU8A 4W82A 4W9NA 2C7GA 4MP8A 1MFZA 1QRRA 4DBVO 2Y1DA 3PWSA 1MXHA 4YJGB 1C3VA 2DBZA 2IODA 2JL1A 4CM3A 4CUJA 4GSLA 5HBRA 2PWZA 1LQTA 1NYTA 2EEZA 3EC7A 4ID9A 1P0FA 3WB9A 4CLEA 1BW9A 4FCCA 3TOXA 4E2ZA 1FDWA 4CL3A 3GGGA 4U5QA 3QVOA 4OH1A 4AJLA 4WCFB 3JSAA 2NSDA 3TL2A 4Z9FA 4IMRA 4RDIA 1VPDA 1IY8A 1HDOA 2UUPA 4MVJH 1R0KA 4R3NA 2P4HX 4JJIA 3E18A 1VSVA 2GZ3A 2OORA 4E2XA 1JAXA 1ISGA 3H7AA 3JQBA 1PS8A 1A9YA 3GVCA 2C2XA 1PTJA 4NK5A 3WOHA 2DBQA 2X9NA 2EP7A 5BSHA 5JYEA 1C14A 5IXSA 2P9EA 4IJKA 3VPHA 4EGFA 1JVBA 2WD8A 3FWNA 2VNSA 1OFGA 1RM5A 2X8LA 4D43A 3H4VA 4PLCA 4WLOA 1QG6A 4TVOA 3WLEA 4FFRA 2PZLA 5TIIA 4FN4A 4RZHA 2YY7A 3GF4A 1DRWA 3NT4A 3C7AA 3RWBA 1ML3A 4MIYA 4YVFA 2D2IA 5CHEA 3LU1A 2QQ5A 5TS3A 3ETGA 3QP9A 1W73A 3G49A 2DQ4A 2Y1CA 1E3WB 4LCJA 5TLSA 1E7SA 1HLPA 1XHLA 5KVQA 2C82A 2WYVA 3WG9A 3RBVA 2D0IA 4BGVA 3LT1A 4EDFA 2OBYA 3ZWAA 3JD1A 3F46A 2O7QA 3DMYA 4NJMB 4X54A 2CSUA 5H83A 3ZWBA 1WPQA 2IDZA 1ZK3A 1C0IA 3K31A 5CG2A 1FDSA 3KZVA 4TKLA 3ZW8A 4YJFA 5DZSA 2HAEA 5EPOA 4CMIB 3TZCA 3K2EA 1DHRA 4R5HA 2QRJA 1Z75A 2IXAA 1I2CA 3I5MA 4QQRA 1SCUA 3LLSA 4RPJA 2EGGA 3CSDA 4CR7A 4K6FA 2JAPA 3U4CA 1U8FO 5JO0A 4R4JA 4E5NA 4HFMA 3AUUA 1QYWA 1E5QA 4IDGA 3FD8A 5BNFA 5J23A 4IPTA 2BFOA 1PEDA 3Q9NA 1OC4A 3GN2A 3OICA 4L4RA 4DXHA 3DBLB 1PZHA 1IL0A 2B4QA 4JJFA 4W9NC 2HRBA 1YWGO 2E82A 4WKGA 1U8XX 3FR7A 4D79A 3T7EA 3GNTA 3V1UA 1Y1PA 2JCYA 1MG5A 2IXBA 4IS2A 4J9UE 1PJLA 1UXHA 3PPIA 1ARZA 5U4QA 4E2YA 1NAIA 2C54A 3FWZA 2O3SA 2W2KB 4RDHA 3PQDA 2FZEA 3I6QA 2R00A 3LQFA 3LF1A 4IDBA 3ZCXA 2ZIZA 3DOJA 4CQMA 3G1UA 4XEHA 5B37A 1NQOA 3I4FA 1R6DA 4DLLA 5JXWA 4B7XA 1Q0LA 3H8VA 1EBUA 1P9LA 4OJNA 2TMDA 3O8QB 3WQQA 4B3IA 1DIHA 9LDTA 1O9BA 2Y1FA 5DCUA 3E82A 4RPKA 3ICCA 4B4WA 1X14A 4GKBA 2BMAA 1NM5A 1JWBB 1TT5B 5DULA 1EDOA 2Y68A 4FS3A 3PFWO 3U0BA 3JYPA 1DB3A 1QLJA 3TZ6A 5CPBA 3S55A 4ZHSA 4UVGA 3Q2IA 3A9WA 3KLMX 5IZ4A 3PYMA 4KUEA 5T8KC 1JDJA 2AQHA 3DBHA 3H65A 2EP5A 1U9JA 3OA2A 3I3OA 5C5IA 2FMUA 1F17A 2D59A 1GD1O 5BNTA 5I9NA 3I6IA 5G2OA 3TFOA 3NJ8A 4Q3DA 3AFMA 4J1NA 4Y98A 3WFIA 4NNJA 2DM6A 2YV1A 1H5QA 3GNQA 1T25A 1A9ZA 3KUXA 1GY8A 4PLHA 3PEFA 2Q3EA 4MOWA 3ZH2A 4E5MA 4I9HA 3BZUA 2I3GA 3RUIA 4Q3NA 2GZ2A 3IAHA 1GZ6A 4BB6A 3HWRA 3GN1A 4DQXA 5CAEA 4RLSA 1DIGA 2NVUA 5F1PA 1TEHA 5IDXA 1FMCA 1PGQA 4IZHA 4E21A 3PZBA 4KQWA 3OF2A 1LLCA 2ZTMA 2Q4BA 2AEJA 4U0JA 1JKFA 1R4MA 2FR8A 2IYPA 4YJHA 3QSGA 3O9ZA 1HTBA 1HYHA 5B4UA 3ZWOA 1E7YA 1VL0A 3KV3O 4F6LA 4IDCA 2NQTA 3PHGA 3W1VA 4D3DA 2OHXA 1AN9A 4P4LA 2Q99A 3NX4A 4BO0A 4QO7A 3QWBA 3JQGA 4YQZA 2GUGA 1ONOA 3GZNA 3HB4X 3INRA 1GAEO 3B1JA 3QJ5A 2C0CA 3CIFA 2I6TA 2WM3A 2CDBA 4F46A 4PLFA 3B1KA 1K3TA 3B1FA 3V2UA 4E2WA 2GO1A 1NVGA 2Y0DA 1BGVA 2HJSA 1PJ2A 4JLWA 1GYQA 4RF3A 3CEAA 1MC5A 3WJAA 4K6CA 2HLPA 4JP3A 4KMSA 5JPIA 5BSGA 4CMGA 2X0NA 4P38A 4NFSA 3VVBA 3RKRA 2PD6A 4A03A 1OOEA 3EZLA 4KOAA 5I7SA 1G0NA 1YVEI 1DFGA 4BGUA 4FC7A 3I4CA 4IM7A 2H63A 4JQCA 3O03A 4YEDA 4Z9YA 4IQ8A 1EMDA 4UUMA 1HDGO 4PFJA 4RVFA 1Z73A 1HDRA 1BXGA 1J0XO 1X7GA 4PG4A 3H9EO 3VPSA 3WWZA 4CQLA 4LMRA 1XR3A 2JHFA 2OP0A 1C1DB 3OQBA 1E3EA 1D7OA 3RSHA 1JAYA 2AE2A 3Q9UA 5IXYA 2QHXA 4K9DA 2IEDA 1ZZEA 1DFHA 1XELA 4EZBA 3K96A 3ZU3A 3E48A 1IB6A 1HZZA 3E8XA 1KBZA 2G0TA 1OZAA 3RC9A 4M87A 2GGSA 3RUDA 1K6IA 3GMSA 3LT0A 1DIRA 4YBZA 3TJRA 1Y8RA 2HQ1A 2NTJA 1PJCA 1BXZA 4OM8A 4XIYA 5EQDA 4XGKA 4BO8A 3K73O 3C7DB 3GDFA 1WZIA 1X1TA 1HE4A 2OFPA 3DZJA 2DTDA 3FTNA 4CM5A 1KS9A 4TSKA 4B4UA 3G17A 4H16A 2HO5A 2DUWA 3H2ZA 4F6CA 1YDWA 1IPEA 3RU7A 1FF9A 4IDAA 4EUEA 4WLNA 1B7GO 1SB9A 3JQGB 5CDGA 3JQAB 1YQXA 4JCOA 1PZGA 4OOFA 3C24A 4FGWA 1IE3A 1TT5A 4I9UA 1K6XA 3NTRA 2BGLA 3D4PA 2ZTVA 2XXJA 3WWYA 5L7WA 4XJTA 3DTTA 4WNIA 1ZVMA 4IINA 4Q3EA 3HFSA 1E92A 2VRCA 4OQZA 2VOEA 3CE6A 5GZ6A 4DIFA 1DBVO 1Y5RA 5I7EA 1PQWA 3DAPA 2VWPA 4H7PA 3BTSA 4B3JA 4UUNA 5IDQA 1JKIA 4CV0A 4J2HA 5DBIA 4YJFB 1VLLA 2ZCUA 1R4NB 3HB5X 2EG9A 5TF4A 5JAMA 2CD9A 1S6YA 1EE9A 4CMCA 3PIIA 1DEHA 4EJ0A 1WMAA 5B12A 2AG8A 2D3TA 1IYZA 4B4OA 1N8KA 2WYUA 5IFLA 4UAGA 3AWDA 4NDNE 4YB8A 1MC4A 1LDGA 1DC3A 3VKUA 4L4XA 4RL6A 3U09A 1U7HA 5HS4A 5EESA 1NPDA 5HTOA 1MUUA 1ADGA 1E3JA 2W8ZA 2Q2WA 3NKLA 3R3JA 5JDIA 1IULA 2AXQA 2P2SA 1QR6A 4R3WA 1RM4A 2HMUA 4WOJA 1UUFA 1Z6ZA 5DBGA 4Y6PA 1UH5A 2P5UA 3BMQA 1L1FA 2O3JA 3F1KA 4FFLA 3OIDA 4XGNA 1LBEA 4CUZA 1VL6A 3D3WA 8ADHA 2YW9A 3FNFA 2E37A 3LC7O 3I9NA 3NDJA 2ZB7A 1A5ZA 4ZQFA 3O38A 1YO6A 2YHIA 4BNWA 1H94A 2V6BA 2RAFA 1YE3A 1DXYA 3NJ4A 5KKAA 1YQGA 2Q1SA 2X0JA 1ZFNA 3GDOA 1DDOA 1LRLA 4Y6RA 3U4DA 5IG2A 2NQ8A 5KKCA 3RQSA 3QV1A 1FDVA 4LMPA 5JE8A 4BV8A 2WSBA 4RORA 3VPGA 4MVJI 3UKOA 4II2A 3PRJA 4ND5A 4XB1A 4WOKA 4MKRA 4WGGA 1UAGA 3ZWWA 3IIEA 5A06A 2OOSA 5T5QA 4FR5A 3RI3A 3ETDA 1NR7A 1KOLA 2XF8A 1P1IA 3JQAA 1OAAA 4JBHA 5MDHA 3DZKA 3TN7A 4MVJM 1UP4A 4LCEA 4Q39A 3HDHA 4ALMA 3EGOA 4FIZA 4GMFA 1A7KA 3RCBA 4XX0A 1B2LA 1LRKA 3ZU2A 2ZKLA 3GG2A 3QW2A 4LK3A 1ZSVA 2FPPA 4OO3A 5AQ1A 3GAFA 4EJ6A 4ZJUA 4YRDA 1N7HA 1RYEA 4U6SA 4WE3A 1EEHA 4C7KA 3N74A 2G1UA 4DPMA 2PLAA 4TKMA 1MXFA 3DFZA 2PNFA 3PTZA 2H9IA 5KJ1A 1E1NA 1I3MA 3RUFA 1SEVA 3KSUA 4GPD1 3WICA 1WXDA 3ENNA 4CLOA 4R51A 3OIGA 4CM6A 4S3MA 4M1QA 4TWRA 4DPKA 4J9VA 1VJTA 2PKRA 5EMHA 4YT2A 1VKOA 2YHUA 5JCJD 1MGOA 3CZRA 4YAJA 1C1DA 1F06A 5C7LO 1KYQA 1NR1A 1GFSA 1Z7EA 4XYEA 1EK5A 5IN4A 3AOEC 1ZXBA 2PV7A 1CEQA 1BVRA 7MDHA 4YCAA 2B5WA 4MVJA 2I67A 4K1LA 4NBTA 3MTJA 5JY6A 5BQFA 4W7IA 2V6MA 4B7CA 4XGIA 5H82A 3SLKA 1ISHA 3MJTA 3DXFA 1EUZA 3KSZO 1H2BA 1JW9B 2NVUB 1E6EA 4QFDA 4CMBA 1Z82A 5CEFA 1EZ4A 2GERA 2OP1A 5A1TA 3OBBA 5G4KA 3E9MA 3HDYA 1P3DA 2Y67A 4F3YA 2YFHA 1KVRA 1KC1A 3ZWMA 4LVCA 5ITWA 4R1SA 3LC1O 3WQRA 4RJTA 5JDCC 5FEUA 1A7AA 5AVOA 4PRLA 3KYCB 1YXMA 3E9QA 4J2OA 3VZQA 2W2KA 5KVCA 1PGOA 5KNLA 3CZMA 1XG5A 5BR7A 5B4TA 3GMDA 4JN6B 3WYCA 4R1UA 3RJ5A 4E12A 4J16A 4J7CA 3VTZA 1HE5A 4CQMB 5JLAA 3GVXA 1PJBA 4WUVA 1YB5A 2YHIB 2E48A 3DBRB 1BDBA 1GZ4A 1ZSNA 5CFZA 1EK6A 5KCZA 2P68A 3OJ0A 2B0JA 3AY6A 3AI1A 3D5QA 1TVEA 2A9FA 3BHJA 4L74A 3AUSA 3PWZA 4ZU3A 4Q3AA 5THKA 2VZ8A 1PGJA 4DL9A 3CUKA 5C7OO 3H3JA 4CM8B 3ZV5A 1V9LA 1QYDA 2G5CA 2NLOA 2O48X 5DNAA 2FZWA 3ZNQA 4WCDA 4JNKA 8LDHA 5IF3A 4WLFA 3MJCA 1PZEA 2G82A 5JAQA 3ANMA 1XU9A 3TZKA 1B3RA 3IP3A 1KY4A 1MP0A 3KTDA 4J90A 1ZCJA 3ZV4A 4PZCA 1LLDA 2PA3A 3X2EA 2BFMA 2BLLA 4TRMA 2CUKA 3HE3A 1LDEA 4CLOB 3QY9A 1GTMA 1LDBA 4QFCA 2FPIA 3IS3A 4XYBA 4HBGA 4LISA 2PFGA 3LZ6A 1RJWA 3OQ6A 4GQAA 3ON5A 1DAOA 3OHSX 3L6OO 4BS9A 3GNSA 3WTCA 1P1FA 4BO9A 3W4KA 1XA0A 4IIVA 2WJPA 4QEDA 2QG4A 1JU9A 3NTOA 2A35A 4J4TA 4DC1A 2FHSA 4YTEA 4IQ0A 3UXYA 4YQYA 4OL9A 1HL3A 2BF7A 2UVDA 1KVQA 3WGHA 2H1SA 2JD1A 4MIOA 5CG1A 5ER9A 5JC1A 3LK7A 5T6BA 2VUTA 2HMWA 3KVOA 4KTVE 1LTHR 2Z95A 5AXCA 4FB5A 4YJGA 5JBIA 3C1AA 3P19A 3I23A 3GRPA 4DLAA 1Y5MA 1D1SA 1E7QA 3ZWVA 3G0OA 4M49A 2CDAA 3ULKA 3GC6A 2FP4A 1N1EA 1MA0A 3N58A 3UOGA 2XXBA 1LJ8A 2HDHA 4IJUA 2VT3A 2YDYA 2GNAA 2ILTA 4QXMA 3E5RA 4BNUA 5TJ9A 2BGMA 3JYLA 1T4BA 1R15A 3PJFA 3L4BC 1NHGA 4OSPA 4N5LA 4ND2A 1I01A 4EI2A 1HDYA 1YKFA 2FWMX 1A72A 3DMTA 4BNGA 3JD3A 5COAA 1WMBA 3ORFA 3Q1LA 3EYWA 4AJPA 5TX7A 3A14A 3WYEA 3WIDA 1NFFA 3MWDB 4XQ9A 1DOHA 3KYBA 1ENZA 3PP8A 5IDYA 4Z3DA 1YOVA 4CV2A 3WMXA 3FHLA 2H5LA 1ADCA 2Q46A 4M54A 2E49A 1DJNA 3EZYA 1ENYA 1JA9A 3HQ4O 1UR5A 4EEXA 1PL7A 2FSVA 3QWIA 4FQ8A 1CJCA 3G1TA 2HMTA 2X86A 1P1KA 3EVNA 1PJTA 3R0IA 4BNTA 5JS6A 5GZ3A 4PLVA 1ZK1A 2CF6A 4KWHA 5DN9A 1ENOA 1H6CA 2QZZA 4YRAA 4MIEA 3SJ7A 2NU7A 3ZWNA 5GMOA 1E1LA 6LDHA 1PL8A 1BWSA 4LSWA 3DFUA 5HA5A 1WVGA 4BO2A 2Q1WA 2EF1A 4BKRA 1U3WA 4J3FA 4N5NA 1N1GA 4CLRB 4PLYA 1NQTA 1R16A 1T4DA 4OIMA 1G0OA 4R68A 3TRIA 3UCXA 4KWIA 3W6UA 3GFGA 1BG6A 4XA8A 5IZCC 3EDMA 4JXKA 1XWFA 4CR8A 4H3VA 1QKIA 3ANLA 3PK0A 1XLTA 3LLVA 1L7DA 2GRAA 2JFHA 3AM3A 2NWQA 3PJDA 4L73A 4Y8VA 1EFKA 1IHYA 2O2YA 4CLHA 5DCWA 4S1VA 4DA9A 3BHIA 3PDJA 2B35A 4R5MA 1IZ0A 1LRJA 2X22A 2YQ5A 5C3MA 1R4MB 5GZ1A 4HFNA 1FXSA 1MB4A 1N5DA 1ONPA 1V8BA 2VYVD 2P91A 4DQVA 1LDMA 2R2GA 4L0QA 3F4BA 3STHA 4OXKA 3ONFA 3TSCA 5CDUA 2YDXA 1YL5A 3PHHA 1SOWA 2VHVA 4BHTA 3QA9A 3KLPX 3GZNB 1GPJA 3DL2A 3EAGA 4RVSA 4GX5A 3ZNNA 1UP6A 1TA4A 1ZEMA 4II3A 1DRUA 4E32A 1I3NA 4RVDA 2C5EA 1B15A 4IGEA 4I9NA 3HZZA 4GLOA 4RVGA 2Q49A 4FOSA 5DP1A 3GY0A 3AY3A 4UEJA 3VH2A 4UVDA 2J8ZA 2WDZA 5JYDA 3V2HA 3RBZA 1IPFA 3E03A 3DTYA 3F47A 5IJZA 1ISFA 3SBOA 2J3JA 1HYGA 4CV1A 2RBEA 3R6DA 4BNVA 2X9GA 2X5JO 1VSUA 3ZNOA 1DC6A 5A03A 5CEEA 4MP6A 4BO3A 4IS3A 2C7VA 1EQUA 1GZ3A 1PS0A 2V6GA 3KXDA 4MKZA 1CQIA 2GDZA 5K9ZA 1GL3A 3EMKA 5BT9A 4MVJF 4WEQA 3QLJA 2DBVO 3RC2A 3RUCA 2YYYA 4PCVA 4ONEA 4N5MA 3SXPA 4Y9DA 3WBFA 1KVSA 4XKJA 1LC0A 1NWCA 4N54A 4D7AA 4BO1A 2VYVA 4MO2A 3N7UA 1MV8A 4RPHA 1VKNA 4AJJA 4YJHB 1WDLA 4PZEA 4Z6KA 3WIEA 2IRWA 5K6AC 3H9QA 4RF5A 5L9AA 3MJEA 2HRZA 1I3LA 1JKJA 5DDIP 4JGBA 5EIOA 3W4IA 3NDIA 4E3ZA 4YT5A 5TSDA 4ND3A 4HWKA 4IZIA 5KJ6A 2W4QA 3DBVO 1E3SA 2I65A 2ZTLA 2BGKA 2P5YA 1HEUA 5L51A 3JQ7B 4NBVA 1SB8A 1RM3A 1XKQA 1YQDA 4QSMA 4GKVA 3SC4A 4BNNA 1T2FA 3JD2A 5G4KB 1UZMA 1P31A 2GYYA 1C1XA 1Y9EA 4ZGWA 4FFNA 3ZV3A 1KY5A 1ZBQA 1U28A 4CM9A 3D0OA 1RPNA 2JFFA 4KUHA 2VUSA 3W8FA 1SZJG 3JQ8A 2JHGA 2R00C 2EW8A 2QRLA 4YPOA 5LDHA 4J7XA 5K0ZA 4AG3A 1ISJA 3FI9A 4NIMA 2HMSA 5IDWA 1QV7A 5LCXA 2Q2VA 3C1OA 5GY7A 2YV3A 3DOCA 3FBTA 4NH4A 2DPGA 3I9LA 4WK6A 2NVBA 4DC0A 2I76A 1SMKA 4W99A 4BL5A 3X2FA 2J5KA 4OGWA 1AHIA 1LU9A 4Z9XA 3TDKA 1Y81A 1KEUA 3EY4A 2Q50A 4KUGA 2GN4A 4Z0HO 1NNUA 2AA3A 4HP8A 2O2SA 1KVTA 4CR6A 4LW8A 3FRJA 4GI2A 2GZ1A 3ICPA 2O3RA 2O4UX 1DAPA 3OJFA 3UH1A 1XEAA 2EHDA 1LXCA 3UVEA 4BO7A 1RWBA 2XPCA 3KSDO 1N2SA 2GCGA 4TRRA 2D5CA 4RGBA 1UZLA 5ITVA 3K6JA 3AI2A 2X4GA 1JN0A 1M66A 1V0JA 3ITDA 1E7MA 4OHUA 1F12A 2P9CA 3VHRA 3WGZA 4CPDA 4N7RA 2QRKA 4GVLA 3D4NA 4CUKA 2OUIA 1ZH8A 5TC4A 2PKQO 5FI5A 3IJPA 4BKUA 1QMGA 2VYNA 2AG5A 4RPGA 1V35A 1ZUD1 4XYGA 5ILOA 4GL4A 4PLWA 1QV6A 1VRWA 1JVSA 2Z5LA 1L7EA 3M2TA 1BTOA 4XZ3A 5A9SA 1AE1A 2Y93A 2BI8A 1BMDA 1JTVA 1ZK0A 1GQ2A 2VCYA 4IMPA 4RQTA 4INAA 4CMIA 2HMVA 2WYWA 2A4KA 3ETEA 4WNCA 3NEPX 4TVBA 4EUHA 2EJVA 2PZMA 1T1RA 1K2WA 2DLDA 4FGSA 1GEEA 4PRKA 4DGSA 2HK8A 2I99A 5TQVA 3LC2O 1SBYA 2EW2A 4YRBA 4ALNA 3ROKA 2X0RA 2J5RA 4DYVA 3F5SA 3DO5A 1ZK2A 1F8FA 4TRNA 3I83A 5THQA 4A10A 3H5NA 1LX6A 4JIGA 3VKVA 1NFQA 3H5RA 4RPLA 4FFOA 3GR6A 3MOGA 3D4OA 3PQEA 4OAQA 1EE2A 2DFDA 4Q9NA 2NACA 3F9IA 4M89A 3CTMA 1CETA 3ZWXA 1NTOA 1SEPA 2CZCA 4UEKA 3NV9A 3BIOA 4WLEA 1FDUA 4XIJA 1KEWA 4WPGA 2YFQA 4CQLB 4ZN6A 4CMHA 1Q7GA 4GX0A 4DIBA 2EJWA 3JTMA 4CM9D 1LLQA 3AOEA 2X1HA 2GPTA 5T64A 4DUPA 2VHZA 3HJAA 3Q3CA 1NQ5A 3AFNA 4GX1A 4DWVA 3IOYA 1PGPA 2R6JA 3L0DA 4L75A 2X23A 3ZHZA 2EKPA 1GADO 1T26A 1EVIA 4RVHA 1B14A 5TRTA 3GRKA 3KBOA 4FJ1A 4NBRA 1YB4A 5JMWA 1Y6JA 1DJQA 4A7PA 1T2AA 3HDQA 3MOIA 4J91A 3V1YA 4HUJA 4HKTA 4GWKA 4NU6A 4O1MA 2JKVA 1CF2O 3S1LA 3GGPA 3KOUA 4A2CA 1PZFA 1K5HA 4R69A 4BKPA 4MDHA 4YAIA 1GYRA 3JD4A 1B0AA 1E1KA 1ZMTA 1AGNA 2AEMA 1JWAB 1ENPA 2J3KA 3QWAA 2Y05A 4CLXA 1NPYA 3CPSA 1I30A 1X7DA 5C7IO 2DUUA 3PYLA 4HX5A 1PQPA 2ZK7A 3OSUA 3ZHBA 5ES3A 2NTNA 3R3SA 4KDFA 1XSEA 1OMOA 3JQ6A 4WCFA 1OBFO 4J7UA 2V6FA 2AHRA 1TT7A 2GF2A 4EBFA 1XQ1A 1HZJA 1X0VA 3P7MA 2GSDA 1U5AA 3IDSA 4ZD6A 5JCXA 2EGHA 3V2GA 2VNAA 3INGA 1HF3A 3PHIA 2V7PA 1WDKA 1J6UA 4NU5A 4A73A 1R37A 1PS9A 5ICMA 1MG0A 1Q0HA 1YS4A 4EW6A 2Q4EA 4CM8A 1WLYA 3A28A 3LVFO 1T2DA 4Y67A 4NR0A 4PLZA 3Q0EA 5HRUA 3DAGA 1O0SA 4PG5A 5KOIA 3IP1A 1KIFA 2E4AA 2VT2A 4CMAA 4OYRA 3TZQA 3W4JA 2XAAA 4RQUA 3F6YA 1YOVB 3H9GA 3JQCA 5IZCA 4I5EA 1B8VA 4EITA 1BSVA 3WR5A 3GVPA 2ZB4A 3PGJA 4YAEA 5ILGA 3GPIA 3L07A 2J3IA 4OMUA 9LDBA 4K26A 1GDHA 1ULSA 3C8MA 3IJRA 4PLPA 4B3HA 4QT0A 1GPDG 4MKXA 3RU9A 3VAZA 3UCEA 4B79A 2HCTA 3U62A 3P2OA 3NDRA 2B69A 1E0DA 5CP8A 4BMVA 4ZVVA 4ILKA 1NBOA 1HDZA 4U8GA 4FW8A 1U3UA 1I3KA 1V3UA 4TQGA 3B20A 4W4TA 1JQBA 1SOVA 2FPGA 5HS6A 3WDSA 4XWYA 4GLLA 1PX0A 2I66A 4QUKA 4AICA 1MX3A 4UVIA 2VYND 4DRYA 5L7TA 3JYQA 1F8GA 4J1QA 3UHAA 5I7FA 1Q7CA 5FYDA 1O95A 1T1SA 2A92A 3CXRA 1ZO8A 1P1HA 3FPCA 1GQYA 4KTTE 3S8MA 5KVVA 2O3UA 3JQBC 3L4BA 4E5PA 3AJRA 2Q1UA 3EUWA 4TZKA 3Q2KA 2PTGA 4JJGA 4PLGA 4DREA 1KETA 1HE2A 3T4EA 5IN5A 2CVOA 4CL8A 3DBLA 2O50A 3FTPA 1Y7TA 4PN3A 4KDEA 3QVXA 1YONA 3JQDA 3DZFA 4ZRNA 3PXXA 1I2ZA 2VN8A 3VOSA 3RC1A 4YXFA 3GFBA 1D4FA 4JROA 4OQYA 2Z1NA 2HK7A 3D1LA 4LRSB 1P1JA 2QYSA 4UEOA 4KZPA 4IQGA 3PHLA 5A9TA 3ITKA 1LQUA 3L6DA 3AU9A 4UUPA 4O0LA 5FI3A 1RYDA 3VDQA 4ND4A 1PR9A 1RKXA 4P4NA 1MLDA 5F21A 4BB5A 1ISIA 1H9BA 3ZHXA 1GR0A 4QX6A 1ONNA 3QVTA 5T8KA 5G0WA 3NGLA 4D45A 5A4DA 4J0FA 1CIVA 1DC5A 4HADA 2C20A 2W90A 1R66A 4M86A 4BMNA 5LC1A 1E6UA 3NT5A 3GLQA 3EW7A 2RHCA 1KVUA 3HN7A 4Q3BA 3TL3A 3NUGA 2VQ3A 5EINA 2W2LA
chains in the Genus database with same CATH superfamily
1FRQA 2WV7A 3RREA 4MWSA 1IXRC 5F7OA 3UN1A 1FP4B 1P4JA 4FT4A 3VBEA 4B3RB 3BXGA 3B13B 1CS0B 3TJMA 2QGZA 2YWBA 3KAJA 3KQQA 3ETCA 3K30A 1XJ5A 2E7ZA 3WQSB 1N9GA 1ZZGA 4ZDWA 3OA0A 3CUSA 4TKUA 5BO5A 3UJ3X 4FYJA 4OD0A 1N77A 1LCIA 1Z4MA 3IUSA 2OHFA 1WWKA 3O0DA 4G41A 5M3BA 3Q6IA 4O59O 1U63A 1KOJA 4PO3X 4Z53A 1D09A 5FV7A 2I2FA 4ZVPA 1R10A 3GUCA 2CLSA 1MX1A 3AL2A 2ORED 1Z37A 1AKNA 3T7DA 3K71B 1QS0A 1U31A 1LDNA 3FYDA 3DR3A 4FX5A 3PEYA 3ZWPA 1JKMA 4GWLA 1HO3A 4WLUA 3OOJA 3CG0A 5K4HA 2ATEA 3LIIA 1K7FB 1P4RA 4F5EA 1CY0A 5L8VA 1N0WA 4BXOA 4XFDA 3H5AA 1Y5LA 3U4HA 5YASA 2B3DA 1RBMA 3FE2A 3AR5A 5KC8A 1F2DA 3K1ZA 4GQIA 4MW2A 1KF0A 2WUWE 2LRHA 4WFQA 1N34B 4UE2A 4WZAB 1P33A 1PNVA 1Q21A 1S2OA 1UXJA 3Q9LA 3PT9A 4K81B 1EQ2A 3RADC 2Q4DA 3IAXA 5JRJA 2D0OB 2GEUA 2F9LA 1WD5A 4X1OA 3FTCA 1STOA 4Y2RA 2J5QA 1EWTA 4EB0A 7MHTA 1J97A 8ABPA 2Y4NA 1DAFA 2HGZA 5E9JA 1KI1A 1IVNA 2GN1A 3X1DA 4DCUA 1QHHB 3M1IA 1VJGA 4DF3A 2V1UA 2JF0A 2PQ6A 3LCVB 4ARAA 4O4JB 4MV6A 4RMJA 2N47A 5EZYF 3JV7A 3JYOA 3PPWA 1LPSA 4HWSA 2QYTA 5AJXA 2DTXA 3D4BA 2HPZA 2OHIA 2NO7A 2LXNA 3O8DA 5BN5B 2PGIA 3ZHQA 2FMIA 2YWFA 1DRVA 4FTWA 4NEHB 3OU2A 4AMGA 4B48A 4S1WA 4OX9Y 4FJ0A 4ZAGA 2Z4TA 4KL8S 3O7MA 1FFCA 4AIRA 4MI6A 3VSBA 4IGFA 4MJLA 3WHKA 1JX6A 4BLRA 1WHTB 4GZMA 2QTVB 4KIUA 4BFLA 3LBFA 4I1YA 1T2UA 4E1BA 4JA2A 3TVYA 5DT9A 2VDOB 3G0DA 2H92A 2PJDA 3G9UA 1DU4A 5DHQA 2IIPA 1MF7A 5JU6A 2OLEA 1AKRA 5LBIA 3OE5A 2B1RA 1J2TA 1YASA 3ZTYA 4JDPA 8ATCA 1VFNA 5JAZA 3OBIA 1ONBA 2WDPA 2X5NA 3AINA 3AP1A 4NZ9A 1T5BA 2NVWA 4O63O 4TLAA 4UOQA 5DTMA 3ZV6A 2NAPA 3EIWA 1ADYA 3AYZB 4ZAYA 4ALKA 5AW4A 5INTA 3QG1A 5KS2A 2QUJA 1CP2A 2YZKA 1ABEA 5KNCA 4H3HB 1IUKA 2PS1A 3NAGA 4QICA 1G2QA 3AVTA 2XYPA 4MICA 2OGWA 1GRVA 1LI7A 2BM8A 2UYGA 4MVJE 2ZYAA 1M6YA 1K6JA 2XDQA 3CVVA 3K4QA 1UAYA 2WKRA 3BD6A 1AZSC 5CW1A 4JBXA 3VR0A 2G17A 2EATA 1X1QA 3LUFA 2PMCA 1A4XA 1L8OA 1SUEA 2GPWA 4RD3A 4XB2A 2VH2A 4MPTA 3BHNA 1DQSA 3DCJA 2DVMA 3DZHA 3H11A 1JG7A 4GI5A 3JQEA 2G63A 3DDWA 1I2BA 1A76A 4DV0B 1U5CA 5F9HA 2ZUUA 4KH1A 1FTYA 3ROPA 2DR0A 4IHKA 1OILA 1XZLA 2HLDD 2RK6A 3FPGA 4PCAA 3ZXIA 3IL2A 3AVVA 3TG2A 5HF6A 1YVRA 2PY6A 3GEEA 4QYWA 2Y1OA 5B36A 2ZR8A 5CCXA 1RE0A 5CM2Z 5CX4A 1IDOA 4AJHA 3N9IA 3QWHA 3SLGA 3UBMA 1LC3A 4L28A 4UCXA 3S2EA 5E6RA 4ZCRA 3H1FA 5FFMA 3PUIA 2BCEA 3ZK9A 3OU7A 2V7UA 4LHEA 1QLHA 2R87A 3L77A 5J1TB 3OTOB 3PA8A 3UWPA 3GJ4A 4J1SA 3SQWA 1UM8A 3KP1A 4RTLA 4JI4B 1PK9A 2BMDA 2XGJA 3ZD6A 3WRYA 2BEVB 2X5OA 1A77A 1V9SA 2XNSA 3QLUA 2NTYC 4Y9SA 3AUAA 4ESEA 1U7DA 3N76A 4G2NA 4ZWNA 2RKBA 4QDZA 2Q6IA 3NXSA 2HJRA 4UHKA 3CTPA 4J43A 4JQOA 4NI5A 4QATA 1FYEA 4UULA 3GVIA 1EHYA 4NOKA 5EL0A 5HIIA 5F7JA 4DRXB 2CL0X 4Z3OA 4DDTA 4B3CA 5DOVA 3NYRA 4EIWA 1L7NA 5KYUA 3UPTA 4Q21A 1H1TA 5KSZA 2C9MA 1YQEA 2CYBA 2PKQP 1CDDA 3PNBA 1E58A 2AE1A 1DXQA 4MJXA 3RSGA 1ORIA 1ABBA 3KR9A 2X1MA 3HDTA 1M6NA 3QJGA 5LYJF 4DABA 1F14A 3MAAC 3T34A 5BMVA 3OX2A 4NPCA 1YQ9A 3OIWA 4I2VA 3RO7A 4K86A 1T2NA 4XR9A 1W34A 2F6RA 2PYDA 2WR8A 2BUBA 3FLMA 3HMKA 3HJUA 3PXBA 4UHFA 1Z39A 4F5YA 1TLLA 1PE0A 3RTCA 1QOQB 3UCFA 3UJHA 3U7GA 4HDQB 3B6KA 3L8ZA 4NV1A 5AJZA 5L7YA 3ZH9B 2UAGA 4QO8A 2G3YA 3M6IA 3PXCX 3T1OA 3ZN2A 1CX9B 1Y37A 3IIMA 4ENSA 3KX2A 4X8OA 4IH4A 3QU7A 1XAGA 4BB9A 3S1SA 3NGXA 2YNMD 1FXUA 3QE3A 5CDYA 2B6HA 5FEMA 2BKLA 1OHHA 4PQEA 4M8LA 2H6EA 3RVLA 1T8WA 1HURA 2AOUA 5FUBA 5JIBA 2ZBVA 1T8YA 3HHPA 2VPQA 2WJVA 1RC8A 1VE6A 3AKYA 2GHRA 2RHWA 1H5UA 3OQ1A 3QBDA 3PLNA 2PAAA 4MYTA 4OOEA 2LIVA 1GSHA 2ZRJA 4IVQA 2II6A 2ID9A 2MYNA 3AXSA 3CNHA 1AG9A 4I4TF 1E62A 1TU0A 1CKEA 5K0BA 4RZXA 1LS1A 3V8NA 4WV3A 1HYQA 2A9VA 1NAHA 5FDFA 4DDHA 2ONCA 1PWHA 4EVIA 3IV6A 5ALUA 5EKUA 1KOFA 2BGUA 2VDKB 1T8UA 3ADOA 2VTVA 1BMTA 4INOA 3DVAB 5JSZB 3ZEIA 1VLQA 3T35A 5KB3A 5BSTA 1WU7A 4KXUA 3NJRA 1H8ED 1NUUA 2FW6A 3AIIA 3LY5A 3O47A 4M7PA 4MUFA 4NECA 5IBCA 4LBZA 1IAVA 1NXXA 4L76A 3RS0A 3GLIA 3R7LA 3CINA 4PM4A 1NN1A 4BTLA 1WCYA 1WZ2A 1VA5A 5CYOA 5JBNA 1HFKA 3EDYA 2VNJA 4URFA 4KQHA 2QBYA 3U0VA 1D6JA 2FPSA 4XVQA 3DUFB 3BB1A 4E08A 3BBLA 4NNOA 4F1KA 4Q1VA 3QF7A 4Z1OA 1Y8QA 1BGWA 4RZ2A 1KRXA 3VAYA 1FFYA 3KETA 3TZHA 1L5WA 1U0HC 2V8OA 4RZQA 4A8JC 4HAYA 5IAAA 4AG5A 4GZ5A 3HKBB 4ARVA 3T94A 4G9GA 2OTCA 4J29A 4H17A 1HDCA 3RU2A 3AR4A 4FHDA 3TW0A 2RGGA 1KO7A 4FI3F 1Z45A 1JE1A 1AQIA 1U1FA 1U2TA 1I24A 2UV8A 1LVUA 4Q3OA 3QBTA 4EG7A 3WJ2A 3Q8XB 3FR8A 4MGKR 1PKXA 1HDIA 2J6IA 4KYUA 3JQAD 4QODA 5AJYA 3HNOA 1T8TA 3CH4B 5FQNA 3RYTC 4EJ2A 4B76A 1GPUA 3BS4A 2XWBF 3FFXA 5E6UA 3VVLA 3K6SA 1NYQA 1QTQA 1FP6A 1UINA 5D00A 4RIHA 1KOGA 3BERA 3JQFA 4NHEA 2G72A 3ADPA 2NNLD 3RAJA 3MUEA 3L6UA 4UAJA 1Y4AE 5AXDA 2A7QA 4R81A 4ZP1A 5HRAA 5KOHA 2W6MA 1U8EA 1O2DA 3PJGA 2NU8A 1AS0A 3WFZA 1C80A 3FSEA 2FFJA 2KE5A 1X1SA 2B8EA 1PJAA 1P7YA 2CYAA 3FWPA 4YONB 3WX0A 5I01A 2GOYA 3H42B 4KHZA 3G5TA 1G7TA 1Z74A 3M5WA 4QPNA 2G1KA 4OF4A 4XTRA 3UW3A 4D46A 4BY9E 2GCIA 3PUVA 4CQJA 1Y80A 5BVHB 4DIUA 1GU7A 3CSUA 2D2XA 3FCEA 4IJVA 4A6EA 3C87A 4C3OB 4UD2A 4NBWA 5HK8A 4QUBA 1P4SA 3OF5A 4WT7A 5DNUA 4KRGA 4IYJA 1GIAA 1JPVA 2GEJA 2PVCA 3I12A 5LZ5A 3RUAA 1H69A 4FSDA 1DJOA 1CNFA 1TAHA 2Q45A 3A7EA 4K9MA 4MS4A 4OA8A 2M6KA 4D9NA 2RHGB 3G6KA 4DA0A 3QMVA 1QXSA 1ESMA 1ZJJA 5JO9A 1YRHA 2HQBA 3MSCA 4FDUA 1DX6A 4AO8A 4B3BA 1KK2A 5HCNA 4ECEA 1N7GA 1NATA 1PFWA 3IMCA 3P0JA 5FTJA 1B8PA 4H60A 4HY3A 1DEAA 2QRPA 4TTJA 2PKCA 2R8XA 3FYHA 2EIXA 1FMFA 2GZSA 4TXNA 4O8CA 2DUMA 5KCMA 3G3EA 2APJA 3DM5A 3P32A 1PU2A 2A0KA 1PWYE 5FUQA 2PL3A 4OSOA 3BXXA 4JX9A 5AW6A 4AS3A 3PDIB 2XUOA 1P2TA 3OLYA 5K8LA 3IQIX 3ESCA 4WJZA 4NMHA 3N0TA 3HKCA 2P9GA 3L0SA 2YZNA 4EUFA 2O8NA 3I53A 1FUYB 3NOXA 1LVHA 3A10A 2IPMA 3ST7A 3DLPX 4BVHA 3H5IA 2UZ3A 5AW8A 1QP4A 4IOKA 2A1TS 2GX6A 3OJWA 3UAWA 1Z7GA 4BYGA 2VTBB 4D26A 4RJIA 1VYVA 3ORSA 4S1OA 4C0WA 4Z2YA 3UGKA 1DHTA 4ZA2A 4F3CA 4RAOA 2E0IA 1E5DA 2AEFA 2PRIA 2XLBA 2Y1XA 1B3BA 2YWGA 3A0UA 3AEXA 5AW7A 4FNOA 1MA3A 1C7JA 1R50A 5T67A 2JAWA 2G9VA 1QPBA 2I6UA 2ZM6B 4UVHA 1ZOOA 1GHTA 4RSGA 4XLZA 3U40A 2CFTA 2X0IA 1BC5A 1O95D 4IIHA 1E66A 2ID8A 2ODPA 3BAZA 1HRDA 3QX8A 4M1SA 2JCXA 2Z04A 1Y6GA 1I7NA 2E1PA 1E89A 1QGED 5TGDA 3FVVA 4MUGA 3RASA 1DARA 2AVDA 1QTIA 3D8NA 2O5EA 1Z07A 3W5VA 1PJQA 4PYNA 1YR6A 5LQJA 3B2NA 1RKUA 2AR9A 3ANNA 5HEKA 4QNMA 4W5TA 2Q5FA 1JQKA 3OLXA 5D01A 3W7VA 2I6FA 2N9UA 3DMNA 3E81A 4BUCA 2VQDA 3SSOA 4DG8A 2ENWA 1XD2A 1J21A 1CY7A 4W8HA 5TVKA 3X1YA 1RAFA 1PTJC 3KU1A 1VB3A 3VR2A 1TZKA 1VCNA 1LNZA 3I9OA 3SBEA 3PGKA 3D2CA 1SR8A 5K3AA 1NW7A 4JP1A 4C4PA 3ICQB 4ML3A 2V4ZA 3AM1A 4PZDA 2XYRA 4P54A 3QNWA 3RGWS 1B4DA 1TQ2A 1RCFA 1TAGA 3K70B 3W77A 2FZVA 2RGYA 3MMNA 1ECPA 3HU1A 5ISMA 4YWHA 1P5ZB 1K97A 1QGDA 1SCQA 5E95A 5U1PA 5FWNA 4JBGA 3EULA 3JAKB 2TMYA 1HLFA 2CB9A 3ZEAA 1EGMB 1UDBA 2VP2A 3DVAA 2C00A 3EFEA 3RSQA 1TCCA 3SD7A 4A1FA 1UPUA 4WW0A 2NXNA 4TROA 4ZT4A 3WYNA 2C5FA 4DEXA 2CFOA 5KJFA 3RODA 1AKQA 1FZQA 1WX1A 1YDEA 1YGYA 3IUPA 2VTDA 5EP1A 4EHIA 2Z5VA 3QTBA 1PYGA 1FZTA 4NYMQ 2QM8A 2G5GX 1UK6A 2I7TA 1M76A 1CR2A 2O0HA 1NMXA 3JQ7A 4G5XA 1P9OA 2IA5A 4ZO7A 1TM7E 5CBPA 3BE4A 3E6AA 4QPPA 2V98A 3BRWD 2JA2A 2BZ0A 3TTSA 1XZAA 5LLSA 4ARZA 2P75A 1ZDMA 3N2NA 2W37A 3HGMA 3KQTA 5FJIA 2LDBA 4BP8A 1EX9A 1R0ZA 4HPWA 4FDVA 2VS1A 3K9QO 2QT9A 3GDHA 5JUWA 4OVKA 3CBGA 3KJXA 1ZCAA 3U56A 4PVCA 5EPEA 6Q21A 4BP1A 4I1SA 1OUMA 5BV8A 3IPXA 3R2JA 1LKZA 4ESHA 2C2MA 5DNCA 1A8QA 4E1AA 4YR9A 1E18A 4IH1A 4RJJA 2VF4X 4RVNA 1AF7A 3UKJA 4V0LA 1M2JA 3GFQA 4F56A 4ZQEA 2WTMA 2IUYA 2GEDA 3OLZA 1J49A 1OX4B 3TW8B 2HSDA 4B84A 3U4GA 4YACA 2OXCA 5A04A 2UUOA 4PGHA 4MGYR 4OQ4A 3W79A 3L4JA 3VX4A 5L4SA 1F2TB 4FWIB 1M1YB 2XLCA 4XDZA 2PTHA 4JUDX 4N7JA 4RULA 4PIMA 2YXDA 1PL0A 1KZ6A 3H6KA 3FMIA 3HM2A 3L01A 3D0RA 1J2EA 3RYFA 1U02A 2G71A 1Q3KA 1X7XA 4B85A 5FNVB 3VR5H 4L0DA 4BGEA 3PYXA 4QHYA 4Z8YA 1YJQA 3EZXA 4HWTA 2IEBA 3AVQA 4JYBA 5DGHA 4KR2A 3OO0A 1UFQA 3CKLA 1GZ5A 3CJQA 4N8DA 2R1UA 3I01M 4JBWA 5A71A 1XL1A 3WLFA 3GFFA 3UAYA 3GHHA 1N0HA 1SD2A 4QBHA 5K0GA 5J1SB 1FTNA 4G0ZA 4K6OA 1DG9A 4JYMA 4OYYA 1V8DA 3EHEA 4LSMA 4CMEC 2IYXA 1KYWA 4RKYA 4CFSA 3WLLA 1YZNA 1DDIA 3AETB 3L06A 5F52A 3HBAA 1EWKA 3WK5A 2ZPTX 4Z9AA 4XQCA 1LQ2A 1XVUA 3PUWA 4X90A 1X7HA 1Y4DE 3FROA 4QXRA 1YBVA 3UTDA 1B93A 1II8A 2ZRIA 3QJYA 3QVWA 4QREA 1Z3IX 3HEAA 4E4TA 3OOEA 3DMTC 1SGWA 2HOQA 2R5FA 2ZB2A 1D0IA 1J2JA 2BI7A 1R5JA 2GYWA 2NT4A 3LPNA 2HA3A 4DN6A 2G67A 1EB9A 2Q28A 3DYBA 3T5PA 2FKAA 1RWXA 3SF0A 4UPDA 4RJ2A 4BVEA 1F4LA 3GK3A 5BWCA 6NULA 4C22A 5C37A 3RFXA 3OZXA 1QANA 3OURA 4BO5A 4OXYA 3RRBA 3SIXA 1GPYA 1S2MA 3PLRA 5F5LA 3TBHA 4ZYUA 3ABZA 3ITEA 3I9MA 5CHYA 4YR7A 3GLGB 3DEHA 4JKYA 3BB4A 2JI6A 2OENG 2PKEA 4UU0A 2QUBA 2R1VA 4YJKA 4JI8B 4O3FA 1XZNA 3CO5A 2K7ZA 5CJ2A 2GYVA 2VP6A 2R1ZA 3CR3C 3BE6A 2AQKA 1GUZA 4YJDA 2BFCA 1Q1GA 1J8FA 1QFJA 3RYCB 2IP2A 3HEBA 4HB3A 4X84A 1OTXA 3A27A 5U9CA 1KR2A 2ZT6A 3H1BA 2V58A 5JMPA 1NBAA 3ED5A 4W1SA 5G02A 3HJRA 3R44A 4WDRA 4BFZA 2A14A 3GDWA 2C4MA 3P0HA 1ODCA 4GHWA 3SYNA 4LQCA 5JALA 1MAVA 1Y9AA 3EQZA 1E9DA 3WFJA 4RMNA 3VDRA 3GJ7A 1KKLA 2G7ZA 4W6ZA 4AP6A 4LHXA 4UNRA 3TXAA 4D92A 3Q12A 1AQ6A 1ODFA 4PTYA 3RTDA 4US1R 2AN5A 3T7RA 2BDTA 1TAUA 2ZAMA 3RIYA 4MVYA 5G0VA 3PGA1 3DZGA 3RSCA 1RLIA 3Q8MA 5I4IA 2QTWB 4GOKA 4IUCS 2WFLB 1G8SA 2Z8YM 3T3MB 2XUFA 4ZEVA 1ECLA 1JI3A 3PZRA 3V42A 3ABSB 3U80A 2CDCA 4G63A 5DASA 3WGTA 3V1TC 4D80A 1UWCA 1KEEB 4REQA 3CB4A 1FLDA 5AHOA 3RS7A 1PD0A 1WS6A 5FXMA 3QUSA 4DR2B 2GM4A 621PA 2ZT8A 4MWOA 1RHMA 3H11B 1WPRA 1VPVA 3HP7A 2FPUA 4H4EA 5MN4A 3OTWA 5C7YA 3ZHYA 1UDWA 2OE2A 1XXLA 4AD8A 5ADWA 3WNQA 5HJ2A 2QW8A 2E55A 1CU1A 4MTCA 1QO9A 1V39A 1JDTA 2P0YA 1A7JA 1TYAE 1R12A 3DZ8A 3FCOA 4B6SA 2I8AA 2UXDB 1LDYA 1NZJA 2Q6VA 1KFBB 5DM4A 2QQFA 1DRKA 5B3JA 5JMOA 2I7CA 5IAEA 5JAIA 2DLNA 1N25A 1FS4A 1SN7A 1UJNA 1UMKA 4W7HA 5H3CA 2PL9A 4DRZA 2WQ7A 3TI9A 4RUKA 5I8WA 2F64A 3IEVA 2QAGC 5FBKA 3CLUD 2GBIA 2H1CA 3GVHA 4TV9B 2HF2A 2IHNA 4TL9A 2VWQA 3DTVD 4RD0A 4ZZ3A 3H2JA 4R9VA 1SBNE 2PGJA 2PK3A 2WD7B 4JLVA 4WMLA 5KTKA 1PJSA 1SVIA 1WOMA 1EVKA 4AKIA 1HT2E 1ODIA 1LX7A 2B2XA 1DIOB 3NEYA 4QFMA 5IK2A 4DHWA 4Z9BA 3M5DA 2JJ1D 1LK7A 3ZW9A 1WSDA 5ALNA 1JAIA 1FYXA 1I2AA 3AERA 4H0CA 1VYUA 1U8AA 1BD4A 2GSWA 2P4QA 2PQ2A 3QW4B 5CIWA 3G6WA 2C58A 4RH3A 4BNJA 5F2NA 3BMNA 4NOLA 4B8YA 2F8SA 3K1TA 4R8MA 1PR3A 4HDMA 3GGOA 1P0CA 3HUUA 3IFSA 4IMJB 5ULLA 5ALLA 1ZEJA 3ENQA 5ANRB 4BU1A 4CIXA 2AL7A 2DGDA 4I4CA 4C78A 3CT4A 2A5YB 4IXWA 4DKXA 3WKEA 3S2IA 5DK6A 2LGJA 4A5OA 4EELA 1L9XA 2X5XA 3O0TA 2PGOA 1FCJA 4ZO8A 4ZDIA 1XZQA 3QWFA 4TMFA 4I14A 3A58B 5F3RA 1U1EA 1N5OX 4EA6A 1EESA 1FSPA 2GMWA 2WFMA 2WAAA 4KLRA 4RTNA 3ZS9A 5AK5A 5H81A 2GM9A 3ACCA 3AVOA 4A0FA 4EY8A 2CBZA 2OESA 3NO4A 3P9YA 1E64A 2C88A 2NO6A 2ORYA 3K4HA 3P2EA 4NE9A 4X97A 3VR3A 1HX7A 1A71A 1XP5A 4ALLA 3PICA 5EJMA 1EXNA 1P60A 5SYMA 3VNAA 3FZGA 2P8JA 1P74A 3C1TA 4LEIA 4ND1A 4AW9A 5B1DA 3RFVA 3SZGA 1IBKB 4BNLA 4Y1RB 1GZHB 1UDAA 4IV0A 3A2KA 4HFJA 1JILA 4MYUA 1OXVA 1JB9A 5KNCD 3MGAA 2DHQA 3LZDA 1XJ0A 4UTOA 2QORA 2OFOA 4P1ZA 3ECSA 3PI6A 1DQZA 1L4YA 1N92A 4H4CA 3E4DA 4DTIA 3Q5EA 4HLUC 2OV2A 5D51S 2OXIA 4AJKA 1W1WA 4G4SO 4J6FA 3FSRA 1R5BA 3GUZA 3KHKA 4O2RA 1JKXA 1XD8A 1XRQA 4QECA 4PAOA 1RMTA 1LPOA 3W6ZA 4XFKA 2BSQA 3N07A 3OLCX 3LIPA 5E3IA 2BGTA 3PXUA 1WW8A 4YYZA 1ZL2A 2P7IA 3TR6A 3FGNA 1OSNA 3E9NA 2Q7XA 1BNCA 4Q1BA 4HVTA 4F21A 3GQVA 4RZIA 4A91A 1KTIA 1EVYA 1YKSA 1CIJA 3PTAA 1KI9A 1NN0A 1BVUA 2WD7A 5FI1B 2QTNA 3NMUF 2YOGA 1X8KA 2ZSEA 1G7SA 4LE2A 2GVZC 1Z8FA 1J33A 1PZXA 4O5AA 3HV0A 4DAEA 1HQYE 1L0BA 1ZIOA 3PC4A 1F2UB 3ZCUA 4FGJA 2B4AA 2O05A 3RC7A 5K3DA 3SHWA 1E2FA 4ZU1X 1JIXA 4MS1A 1VSQA 1W2GA 3WP1B 1V8FA 1YR9A 3RHFA 3MELA 5KYNA 3W9YA 5CDTA 5AYVA 1L6IA 3CNQS 5K3BA 3ZGYA 4CETA 2HJGA 3M8KA 1V1RA 3OEED 4D3FA 1UJMA 3OUZA 4JYAB 2XZLA 2OG1A 1HYBA 4Q4LA 5EZYB 3GH3A 1TF2A 3LDFA 2QUAA 3RD5A 1AT1A 4TS3A 1N78A 1P2BA 4LXHA 4FPXA 1XCPA 1PGNA 4R2LA 4YH1A 1J06A 2L0XA 3C8UA 4BVAA 1IUPA 2WUGA 3BTUA 2R9VA 3OQIB 4D4IA 4ZCIA 1NOIA 3AR7A 1P5JA 3HA5A 1KPGA 3COZA 3JD0A 4KH0A 1B74A 4J1TC 3DB2A 4BEJA 4R8VA 3NHPA 1N6PA 1ZGCA 2OO3A 2VSQA 2ZB8A 3QKTA 4J0QA 4RZUA 2XCOA 2VIIA 4I5IA 2IUUA 3I61A 3KEMA 3DQPA 5HVNA 4IZ6A 4PIPA 4DCJA 5B4VA 2JANA 3A1NA 1QX3A 4Z7OB 1BQ4A 3TPCA 2HLNA 1MMFB 4ZQBA 5JCOA 4V0QA 4ZQHA 4DVJA 1XQYA 2RHDA 2RHTA 4CV3A 3IE2A 2VK8A 2H2IA 4Z0PA 1BXGB 3RQIA 4X93A 1JHYA 1T4CB 1BCSA 3WWPA 2PRSA 5JDIC 2GLXA 2QZ9A 3RTAA 3CR8A 3D7LA 1ZH2A 3OE7A 4J07A 4TYQA 2JGJA 5TMBA 5TT0A 2QP4A 4YCMA 1W36C 4BO4A 2JGKA 1F60A 3K1AA 1Y1TA 4PHHA 4NBUA 1M8PA 5E7IA 2GCNA 2Y9MB 3FGOA 1PDOA 1KJYA 1QG0A 1W8IA 1I10A 3D4IA 4JMLA 5GONA 4D42A 4RFSA 3G2QA 2OY0A 3CUEF 3E1KA 1IOLA 3LF2A 1I13A 1NVAA 2H7XA 1Y7PA 4OGKA 2VATA 4UNSA 2DPLA 3IQWA 5J2UB 2NV6A 3NW9A 4RL4A 3AYXB 3VGPA 1G7RA 1HXHA 5GM1A 1DX9A 1JHPA 3AU8A 1RHRA 4W82A 1WKBA 5I9IA 3SNHA 2C7GA 5GQSA 1CUGA 1QRRA 1EI9A 1DJPA 3IELA 4EENA 3DAYA 4F4IA 4PCUA 3HJHA 1KYTA 3ID6C 1ZC4A 4FYXA 2SECE 3FAKA 5LD2C 4YJGB 1Q83A 1SA0A 3HRIA 1AD2A 2IODA 4N47A 3DE4X 3U6KA 3FUUA 5B2FA 2GBCA 1NP7A 3IAM1 5HBRA 3O4VA 1LQTA 1T9HA 5T3YA 4Z51A 3EC7A 2IH5A 4CLEA 2C84A 3UK0A 4J0KA 3O2NA 2IHYA 3PEVA 3WXMA 4FCCA 4E2ZA 4KXNA 3DO8A 3VR3D 4Y6GB 2RE8A 2FDXA 4U5QA 4WCFB 3DP9A 3LMKA 4KBFA 2Y1KA 1LFDB 3GUHA 1SKQA 1JR4A 1XVLA 3KZNA 8AT1A 2FP4B 2LP4Y 4AF8A 2OGZA 4Y6LA 3ZHCA 1BO6A 3QOYA 3QTTA 1RXIA 2P4HX 4UXIA 3S2UA 3HO6A 3QVMA 3SC2B 2OORA 1KI7A 1T1GA 1JAXA 1ISGA 1CUFA 2FQYA 4K9RA 4ARBA 1I5EA 2XUHA 1A9YA 2DKFA 2CE2X 2C2XA 1REQA 4DCPA 3LAWA 5IJWA 2FFAA 3RS9A 2CXPA 5BSHA 3TRKA 1U8YA 4JENA 3WMRA 2CL5A 2Z9DA 5I5GA 4IJKA 4N39A 1JVBA 1TQDA 2WD8A 3FWNA 1ZA1A 2VNSA 2X8LA 1RM5A 3D6AA 3O8OB 3H4VA 4KPYA 1M83A 2W5UA 3CF4A 2Q5CA 4KQJA 2WTXA 3TQRA 3RS5A 4YUZA 5I5EA 3U1VA 3UJ8A 5BR1A 3EVBA 4FFRA 2PZLA 1P39A 4BNDA 5EGSA 4X3CA 4EO9A 4FN4A 4RZHA 1YUMA 2ES4A 4R2IA 1TCAA 1TEVA 2ATCA 1M8JA 3ILSA 1UQTA 2TS1A 3N7TA 3NT4A 4CKYA 4UMEA 4EX7A 5BRAA 4O2BA 4V0RA 5CHEA 1RWWA 3NTVA 3KR2A 3QUCA 5HQTA 1L1EA 2PT9A 3EEIA 3G49A 4EA9A 1KMHA 4YCNA 5T41A 1NJ2A 4LCJA 4OM7A 4DJFC 1QC5A 1YIAA 1C8KA 1XHLA 4OK3A 2C82A 2WYVA 1NXVA 3U4MA 2CXXA 5LKAA 5HKKD 5IJ0B 1SUAA 2F90A 3ME5A 2OBYA 4H7FA 3ZWAA 2B61A 3I4LA 4MGIR 2H9AA 4UE3S 1SUSA 4NJMB 4MGHA 3VNQA 4DMHA 5H83A 4UEWA 5JCOC 3VJRA 1RJGA 4HWPA 2FTKE 2QVZX 2YS7A 4YJFA 4QXPA 2XMBA 3TPFA 3GJSA 4M46A 5EPOA 1HUQA 1MRNA 5GIOE 3E9ZA 3K8YA 1DBSA 3EE6A 3F5FA 5CK5A 4DV7B 4FNAA 4CR7A 3RDPA 2VYCA 2JAPA 3L8YA 3P9CA 4IKPA 4IZOA 1U8FO 4GP6A 4R4JA 4HFMA 3ISTA 3PWTA 3PRHA 3S7ZA 4IDGA 3FD8A 5J23A 1RZRD 3NBZC 1BN7A 1U6IA 1GOTA 1A69A 1P7VA 1RP1A 4G1CA 1ZD2P 4Q34A 5CK4A 2JLXA 2CBXA 1M2NA 1UANA 3DJFA 4GU5A 5KINB 1IL0A 1JVNA 2H11A 1QCCA 2C2KA 3WGKA 2L2QA 4WKGA 3I09A 2VP9A 1ZD5A 2BFNA 5CD9A 1QRTA 1NNI1 3FR7A 3T7EA 4F4CA 3GNTA 4A8JB 1Y1PA 2JCYA 4A2QA 2GBPA 2WPDA 3PFNA 4IS2A 4EY7A 4J9UE 1JR3D 1PJLA 1UXHA 5DX1A 1ARZA 4E2YA 1S3GA 2FWPA 1NAIA 3SXUB 2IXTA 2EFJA 3FWZA 5L6MB 4YMSA 4RDHA 2LKDA 2C5SA 2VDWB 2FZEA 4RD4A 2IUFA 3I6QA 3SSAA 3WAKA 2JAXA 5CBPB 2QRHA 4TMXA 4AQDA 3ZCXA 1A95A 1NUPA 4QAQA 5J3JA 2IBMA 1KSGA 3G1UA 5B37A 4YC7A 1CTQA 1QVWA 1B42A 4IHJB 4XLLA 3IBGA 2XT6A 3ZVMA 2YVKA 3FZQA 1JEQB 3CN9A 3NNDA 1W36B 2XGGA 3V6LA 3ZLTA 1DIHA 1JAHA 3DKRA 1PR6A 5F4ZA 4KU4A 2VDUE 4MITA 3T41A 3K0KA 1GNSA 1ZOPA 3BULA 2XA1A 3G23A 4IF4A 4RVOA 5HF5A 1ZMRA 4B4WA 3NAZA 1X14A 1ILEA 2BMAA 1MNQA 2WAOA 5E9QA 1TT5B 2C9BA 3CCCA 4N49A 1PR4A 3NEJA 4OATA 3UW1A 2Y68A 1V96A 1XTTA 2CXSA 3LWZA 4FS3A 4HNSA 1DB3A 2FDRA 2HJWA 2Z09A 5CPBA 3SJBA 1EIZA 4GPAA 3DVLA 1FSFA 4UVGA 2G09A 2JI4A 3IP6A 3Q2IA 3IOBA 1J20A 3EPPA 3A9WA 3FPBA 3UOWA 4DJDC 2F55A 3REGA 3VR1A 4TPKA 1FLNA 2GJAA 1Q84A 1F9AA 2IUTA 2IPNA 5CA0F 1KSFX 2PDAA 3NC4A 5B6PA 4KIJA 2B1IA 2FZKA 3SJZA 2D59A 4OHCA 2X77A 3BEOA 4S1PA 1C7EA 1YA8A 1URPA 1KMNA 2RJOA 1YI1A 2RAPA 3SHQA 1YA6A 3QKRB 1Z8DA 1H2YA 2GJSA 4Q3DA 4DUZB 2PO5A 4QNRA 4Y98A 2VHJA 3WQHA 2KLBA 3EAQA 1CUBA 1NOJA 1I4DD 1JLMA 4KQGA 3HR4A 4FFWA 1TKRA 3D7MA 1X3LA 3C5EA 2IYQA 3ZH2A 2JGIA 1DAIA 1Z25A 5KQMA 2O0LA 2R7AA 3OCYA 1GZ6A 3ND6A 4HZUA 2OGSA 2F3PA 4Q7KA 3GN1A 3QPDA 3AHHA 4KX3A 4EY6A 3H2GA 1YS7A 4NZZA 1NVXQ 1ZN8A 4OU4A 4QC2A 4PYRA 3MVEA 4KQWA 4U02A 1C5KA 1LLCA 1V6CA 4U0JA 3PNSA 1JKFA 3RPEA 2IYPA 1TM4E 2ASEA 2KMLA 1FSZA 3WDLA 2MYTA 3MT7A 2GEVA 3DOEA 3IB6A 4GM0A 1XHFA 4HMPA 4F4FA 4C6SA 3THWA 4TKVA 1AKWA 2AN4A 4REQB 3TLAA 4EGQA 4QO7A 1I4TD 1UJBA 2IKSA 2YN4A 3NB0A 1ONOA 2FQWA 4KQCA 4MKFA 1F3LA 1GAEO 1TK9A 3QJ5A 4XM0A 5J58A 2I6TA 1U94A 2C1ZA 3WV5A 2O54A 4PLFA 3B1KA 4UHEA 2IHTA 3E84A 1OREA 4TUYA 1IONA 1JBEA 3B1FA 2XWJI 2GO1A 4ZEOA 4GEGA 3V2UA 3VO1A 3PD0A 5FJJA 2VQSA 2ZJ2A 1KU0A 8MHTA 1UJ2A 4XWAA 3IMKA 2QV0A 4S1NA 3UWKA 4F1WA 4C43A 4INPA 1XNGA 5ALEA 3HCOA 4JP3A 1NJFA 3D6JA 4D8XA 1ODJA 2XE4A 1IK4A 4OHKA 2ODQA 3PQ7A 5K0LA 4NFSA 1AF4A 4A03A 1OOEA 2CWDA 3HCPA 4KOAA 3DEZA 5EAIA 5I7SA 4S2UA 1Y5NA 5CYFA 3T5TA 1SVSA 2EG5A 3EVEA 3NHUA 4RU1A 4YYEA 4DAOA 1QK3A 4HAOA 4EGAA 4JUAA 2DG2A 2ZIXB 5LOVF 3BT7A 2NAFA 1V95A 5HFNA 1MT0A 4O4IF 4M9XA 2ZPUA 4IQ8A 5HK9A 4Y7DA 1ULAA 4UUMA 1HDGO 4L07A 2VPYA 1HDRA 1BXGA 1CUHA 1EFTA 3JALA 4PG4A 3VPSA 3J7TA 4NKRA 2Z2IA 5DJ5A 4AWXA 4LMRA 3LLCA 3AXTA 3L4KA 1XR3A 5U4XA 3W2GA 2BGJA 2FZGA 1D7OA 3CU5A 1YOBA 2F67A 2A9OA 2A57A 2C31A 2AE2A 1WLSA 2HHLA 2Z3VA 3GMIA 4GPZA 3LLMA 4IQ4A 1AGPA 4EUHA 4EZBA 3GJYA 5KYYA 3KVRA 5CR9A 1HZZA 2XVMA 5F12A 1KBZA 5JFGA 3RC9A 4M87A 4ZVRA 3EDCA 1AURA 3RUDA 1LI5A 1JA1A 1MOSA 3BF7A 4KJZA 2A9JA 3LT0A 5AKGA 4M9UA 4EHKA 1I3CA 9ABPA 3GYGA 5MGNA 1Y8RA 1A3CA 1H65A 2HQ1A 4IEFB 5FBHA 1NKTA 3TLJA 1BXZA 2ZDHA 1ZCBA 4ISCA 2XD4A 2JBWA 1TYCA 2IDKA 3WZLA 2OFPA 2BMJA 3FDIA 1F8UA 4HHEA 2DE0X 4AY5A 4U7GA 4BWFB 1DG1G 4WWHA 3WY9A 2PL1A 1NVKA 4D74A 4AKGA 2QBYB 4F6CA 3MFYA 3M89A 3FX2A 4I1UA 5CFRA 1IPEA 2L19A 4JD5A 4CEHA 1B7GO 1QHFA 2IHVA 3KKPA 4V38A 2JFZA 3JQAB 1XNJA 1LWNA 3LCCA 3HVHA 3BICA 3SZLA 3GRZA 1VPWA 3HUTA 2XYQA 1EWYA 2FUKA 1O03A 1V71A 3QTLA 3NTRA 2X8BA 3RVQA 5B3KA 4P0QB 3D4PA 4L1KA 4FZJA 4FFBA 1G3MA 5HILA 4CKWB 1FNNA 3W6NA 2A78A 1ZVMA 2F3RA 2VDWA 4IINA 5LB2A 5CMLA 4OJKA 1VPTA 4OQZA 1WSBA 5EJ7A 5GZ6A 3AKZA 4H1UA 1DBVO 5BSVA 3RAEC 3U81A 2VWPA 4FKZA 3DGFC 3VU9B 5AVSA 1C3OB 1FW8A 3EBPA 1XEXB 3N86A 3V3TA 5IDQA 2R6DA 3ZBPA 2JLAA 4N0EA 4YMVA 3A6EA 5FV4A 2YBEA 3Q5GA 3PG5A 1OXBB 4MR9A 1R4NB 2P3QA 2G25A 4Q9IA 4H08A 2AI3A 4EHLA 1DBQA 1DX4A 4NDAA 5DW0A 5JAMA 4K8OA 4ZVTA 2CD9A 2P35A 4CMCA 5JLJA 3N2KA 1Q7RA 2IIQA 5JS1A 4GI7A 5JNSA 1DEHA 4MQEA 2FMFA 3STUA 2GLUA 1QF9A 3THYA 2BT4A 4G56A 1UBHS 3R9XB 1RQXA 1Z6YA 1TTPB 3K9BA 2I29A 5JMTA 5C8DA 1FUEA 2FFQA 2NU7B 2XJ9A 2JLBA 4Y2VA 5BP7A 1G2PA 1TIKA 1N5MA 1JHXA 4NBKA 3VKUA 3B5JA 3SE7A 2QL6A 4RL6A 1O6GA 3C8ZA 3CPHA 5GV8A 2N1MA 2W70A 3L46A 3U09A 1NPDA 2FEMA 4NHOA 3SF8A 3L43A 1MUUA 1ADGA 1E3JA 1E8NA 2W8ZA 3CS3A 3R3JA 2QXTA 4HRAA 4QD3A 1IULA 4YAWA 4XPIB 1WEKA 2BEKA 4O2BF 3VR5A 3ZVKA 1XDZA 2ZSKA 4JQZA 3IXQA 3KZKA 4Q9JA 4DTCA 7AT1A 5IUNC 4O29A 2BFEA 4TTVA 4WOJA 4BQOA 2C78A 2ZTHA 2FFRA 3AT1A 4Y6PA 3KDAA 4G97A 3R3YA 1BKDR 5DNVA 3FMVA 1P5RA 2O3JA 1WPGA 4JXJA 4FFLA 4PZ0A 3IBFA 5HW0A 2DXIA 2QI9F 4Q3KA 4XGNA 1JTFA 1VL6A 2A86A 2C83A 3G2JA 3D3WA 4DE5A 2AZ4A 4LY9A 1KBQA 3LC7O 2H48A 3EXG1 2ZB7A 3NDJA 1A5ZA 4PQFA 1YR1A 3CEPB 2DT8A 1H94A 1BDJA 2V6BA 4ZEXA 2G6TA 3KZ1E 4PNZA 3T7IA 2H2AA 4UEOA 2IW3A 1VG9B 3THSA 2R2AA 3X2SA 1QGOA 2JKYA 1RXWA 3RVOA 1X9HA 2X0JA 3GDOA 5AVKA 4Y6RA 3U4DA 2H2WA 5ALVA 5BVGB 1RLJA 3BXZA 3O3NB 4C9BA 2JH9A 1P2UA 4MVJI 2D2VA 1MDBA 1X6VA 4EATA 3X0DA