4M55A

Crystal structure of human udp-xylose synthase r236h substitution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
312
structure length
263
Chain Sequence
RKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGKHVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucuronic acid decarboxylase 1
publication title Man o' war mutation in UDP-alpha-D-xylose synthase favors the abortive catalytic cycle and uncovers a latent potential for hexamer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 92
structure length 263
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.35: UDP-glucuronate decarboxylase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m55A00
1T2CA 2JCYA 1ZK1A 2XF8A 4XYLA 3X2EA 3LLVA 2VCYA 3JSAA 5T64A 5JFOA 4ZICA 1R12A 1N2SA 3ON5A 5COBA 4NR0A 5G0WA 2DTDA 2PNFA 1H9BA 2X7HA 1SCUA 4YJHA 4B8WA 1WPQA 3HJAA 3RCBA 3V5NA 3U62A 2QHXA 4MDHA 1MP0A 1PJ2A 1PR9A 1QRRA 1R4MB 2JAHA 4O6VA 2P9GA 1DFIA 2NQTA 2HLPA 4JP3A 1KS9A 1GTMA 2VT3A 1H6DA 1DDOA 1PQUA 3R1IA 3KYDB 3ROPA 3W6ZA 3DEYX 5IDQA 1MB4A 1I3NA 3IKVA 1EVYA 5JY6A 1GDHA 3NJ8A 4IMRA 1CIVA 1QLJA 2JFFA 1D1SA 5GY7A 3SJ7A 1DC5A 3PGJA 2XPCA 1PGPA 1PZHA 4L4RA 5ENDA 3Q9NA 1VJ0A 4NBRA 3K31A 1DIBA 1B14A 4J9VA 3QLJA 3ZU2A 3DR3A 4YT4A 3AM5A 4R9RA 1HE2A 4CM1A 4J1QA 5EL0A 3RFXA 4OAQA 1DAOA 4ALMA 4NU6A 3WGZA 5JXWA 4Q3BA 2EKQA 4YCAA 2FR0A 3FPLA 2NVUA 1S6YA 1ZIDA 3UW3A 4J0EA 3DTTA 1D8AA 4OJNA 4E2WA 2BELA 3F1KA 3HDJA 4E30A 3OJLA 4WCFC 3EZLA 4NPCA 3WBBA 1HXHA 1I32A 3I9NA 2ZYGA 3RQSA 4AJ4A 3PZBA 4JXKA 1VI2A 4GWKA 4HADA 4TKLA 3U4CA 1O0SA 1Q0HA 4NBWA 4CMCA 4CLRA 2W2KA 1DB3A 5JMPA 2R2GA 4KWIA 1LC0A 3V1TC 1WDKA 1P1JA 4R16A 4GX2A 4BNTA 2NU7A 2PGDA 4DREA 3CE6A 3Q2IA 1IPEA 5A06A 1I2BA 3RKRA 1RJWA 4K28A 4CV2A 2GCGA 1IL0A 1U5CA 2UUPA 3CZRA 3B20A 1LX6A 3GZNB 1KC3A 1YWGO 3VAZA 4YEDA 1G6KA 2C7GA 2WD8A 1P1FA 4B7XA 2VYND 4ND1A 3HE3A 1HZJA 4YQZA 3HDQA 3M2TA 1ORRA 1BVUA 1P1KA 5EIOA 3NAQA 4BNIA 3TZHA 4X54A 1Y6JA 2E49A 4DQVA 9LDTA 1XG5A 5A4DA 5ITVA 1BXGA 1HKUA 4GGPA 1F8GA 1GZ6A 4JJIA 1Q2XA 3KXDA 4PLZA 2OBYA 5GZ6A 1QYVA 3AY6A 1CQJA 2WD7B 3Q9UA 4Z0TA 4BO3A 1E5QA 2VUUA 5JY1A 4BO6A 3BMCB 3QWHA 3PYMA 4Y67A 4TZTA 4CV1A 3INGA 4GVLA 1R4NA 3FWZA 2QYSA 2PY6A 4NBTA 4XZ3A 1X13A 4ZQBA 2EJVA 2CNBA 3I6IA 1HE5A 1XU7A 4FCCA 1B2LA 2C29D 4PGFA 4BGUA 1CEQA 4HNHA 3LT0A 3E18A 5EINA 2FRDA 1UAYA 3D4OA 5BNFA 3ROMA 4BNJA 4P22A 1U4OA 4YYZA 4AJ1A 3F3SA 4LW8A 2JFHA 4BMNA 1QV7A 1U5AA 3X2FA 3WFIA 3HN2A 1H0KA 3GNTA 1SBYA 1GCUA 1OBFO 1SPXA 3I9OA 2VOJA 4CM4B 1ADGA 4E13A 4ND3A 5KVQA 1PJBA 3W8FA 3KVOA 3DBHB 3Q2KA 3H5RA 3IS3A 5DBFA 1EUZA 2XAAA 1Y8RB 1VL0A 3KZVA 2CVQA 4B79A 1A9YA 1MC4A 1RPNA 3M1LA 3MJTA 3OIGA 4R5HA 3GAFA 1KVTA 3ORFA 4IXWA 1HETA 4IUYA 2BGMA 1HE3A 2DUWA 3NGLA 3PXXA 5TNXA 1DIAA 1B3BA 4YJGB 2ZYAA 4E32A 3OA2A 4WUVA 2ZK7A 4CV0A 4DC0A 6ADHA 3ZNOA 3M6IA 1Q0QA 4D44A 4KOAA 3RIHA 1XR3A 1ONPA 1SNYA 2PD6A 2BD0A 1XKQA 4KP7A 2O50A 4OO3A 2VWGA 3PYLA 4YJDA 1RYDA 4JJGA 3GFGA 1ML3A 3AFNA 3PQFA 4NFHA 4OXNA 2X0IA 3VDQA 1K6IA 4FOSA 2CFCA 4PLGA 4A5OA 1TLTA 3I4FA 2ZTUA 5I9NA 3FRJA 3RUDA 3FF4A 3P5SA 5CDGA 3R0IA 4XQGA 2Q2WA 3EY4A 2V6MA 4WEOA 4K26A 4CQLB 1T2EA 4PRLA 2A94A 1EDZA 3DMYA 3IAHA 4H15A 3F5QA 3W6UA 4CUJA 5IXYA 4RCVA 1ONOA 2VHWA 1VKOA 3H5AA 3JYPA 1LU9A 5GZ1A 1HDYA 3GMDA 4XGKA 3WR5A 3U49A 1FMCA 1JVBA 1P33A 2PR2A 3GNSA 3ZNPA 3V1UA 4FGSA 4TZKA 4OM8A 4CR7A 3L6DA 1LDEA 1R16A 3LC7O 4CPDA 1ARZA 2ZB4A 3H2ZA 4CMKA 3MOGA 1A9ZA 4IDBA 4BO4A 5JDCA 3G1UA 1E7RA 4J91A 1PGNA 4J4HA 1I3MA 2P68A 4XDYA 4XRGA 4HFJA 1Z7BA 1N7HA 1DC3A 1HWYA 1LSUA 4PLFA 4U0JA 4WNCA 3PLNA 3GEDA 5DCUA 5IN4A 1YOVB 5KOIA 4MVJE 1KEWA 1IHYA 5JPIA 1X14A 1ZBQA 3WDSA 4DXHA 2Y1FA 2B37A 3K6JA 5TX7A 4EI2A 2HCTA 4RPJA 2UYYA 2C54A 2QX7A 4E31A 1SC6A 3GY0A 5EMHA 3KSZO 1ZFNA 1I33A 3V2UA 4Q3DA 2OFPA 2Q3EA 3FNFA 1X7DA 2BLLA 2EWMA 4GQAA 1E3SA 4IDGA 3RSHA 3LU1A 3ROKA 3SLGA 1PIWA 2TMDA 3A4VA 3PJFA 5LDHA 5KNLA 1PJCA 2R00A 4PCVA 1XQ1A 1FJHA 2A35A 3D5TA 2X5OA 2YY7A 4ZA2A 3JD3A 2OO5A 3WGGA 3WYEA 5J23A 1GUZA 5KVVA 4OL9A 4ROSA 1B15A 4P4LA 3D3WA 3ZNQA 1A27A 1JKIA 3D7LA 4IJKA 4QO8A 2VRBA 3WWYA 5JAMA 3GT0A 4F46A 3K73O 3UCFA 5F5LA 4D7AA 4LVUA 4KDFA 4L0QA 1ISMA 1U1IA 3WMWA 4BMVA 2ZB7A 2G0TA 5ILGA 1QYCA 2I76A 4I9NA 2A4KA 2OP1A 3LC1O 2XOXA 4NJMB 5LCXA 3NT2A 3TNLA 4B8ZA 3FPCA 2VWQA 5JCJA 4H16A 3IKTA 3Q6IA 4CMIA 2AQHA 2DAPA 3FNHA 1EBUA 3A9WA 4P38A 4IY1A 5JSFA 1ADCA 3EGOA 1YL7A 3ENNA 1X7HA 1U7HA 4E2ZA 4DLAA 3GPDG 2Y1OA 1GV1A 2OBNA 2JJYA 4OHUA 5AYVA 4IM7A 1N5DA 2BF7A 4ZU3A 4FOOA 4K6CA 2X0NA 3UXYA 1N1GA 1ZJYA 4AICA 5L95A 4PLWA 2W98A 2IXAA 1LBEA 2DTEA 2Q1UA 1PJLA 4E5PA 4XIJA 1U2GA 3WLEA 3ZU5A 1O5IA 2GSDA 3CMCO 2GNAA 1JKFA 3F46A 4Z3DA 4L8VA 2OXIA 1PL8A 3MJCA 3VTZA 3L6OO 2UAGA 2UUOA 5HS4A 4PG4A 3BHMA 1ENYA 4A10A 3PHIA 1T1SA 4NJOA 1MGOA 4YAEA 3UH1A 3WYCA 3DMTA 4J2HA 3IJPA 2QZZA 2AE1A 4BUCA 3I52A 4LISA 3ZGYA 2Z1MA 3VKUA 3MCVA 1WVGA 1GADO 5JC8A 4XX0A 2O7QA 2X9GA 4RGBA 4PLYA 4R51A 1E3LA 3GVCA 4CV3A 1P74A 2Q1WA 3VZRA 3LVFO 1UXKA 4E3ZA 1E6UA 1VL8A 2IEDA 3DQPA 4W7IA 4EDFA 1T26A 4FFRA 1CRWG 1M76A 3N58A 4KUHA 4C4OA 3ZV5A 5TS3A 3PJEA 4BNMA 1KEVA 2ZJ1A 4MP3A 1K89A 4OKIA 2EGGA 4AJHA 4NQZA 4E5NA 1EBFA 1F14A 1D7OA 2GRAA 1M2WA 5B4VA 4J16A 2Z5LA 3DDNA 5TJHA 1SO8A 3WOHA 2O3JA 3OEYA 3PTZA 4HFRA 3G17A 3K30A 4XGNA 1V35A 4UVIA 5TIIA 2C5EA 1PL7A 3DAGA 4YRDA 1D3AA 1LDBA 4BNFA 1PU2A 1F12A 1H6CA 1LNQA 2PTGA 1TA4A 2GN4A 2QG4A 1IZ0A 4JIGA 2EG9A 3ZWWA 5KJEA 4RO0A 1RM0A 3ZV4A 1GL3A 5IXSA 3E6AA 4PZDA 2GYYA 4BVAA 2VOEA 3DHEA 1WZIA 1YB5A 1IUKA 1YB4A 4CLEA 1P45A 1YQXA 2O2SA 3VH3A 1SAYA 1VSVA 2POQX 5IZ4A 5EPOA 2JFGA 2EIHA 4BKUA 2NSDA 3LYLA 1E7WA 3JQ6A 3WTCA 1LRLA 3P2YA 4NFSA 2HK9A 3OH8A 4NMHA 1HF3A 5JDCC 3O8QB 3AWDA 4J1TA 3VH1A 3ST7A 4IGEA 3ZWAA 4CM8A 3IP3A 2Y99A 2X58A 2I6TA 5A5FA 3F5SA 4ITUA 3QE3A 4O1MA 1DIGA 4WCDA 4RVUA 3H6KA 2V6BA 1PS8A 2VWPA 2J5KA 5T57A 1E3EA 3E5MA 2YV2A 1NQ5A 2RAFA 2PV7A 2PGLA 3RVDA 4RL6A 2DPGA 4FGWA 3W1VA 3OJFA 1KVQA 3AI3A 3VHRA 4B7CA 4WLVA 4Y6PA 1NQTA 1HRDA 4J2OA 4G5HA 1Y8QA 1HZZA 4ZRNA 4IINA 2E82A 2IODA 1PX0A 3SX2A 1LA2A 4F6LA 3OIDA 3I4CA 1ADFA 2Q1TA 3JTMA 1KIFA 3OQ1A 3H9QA 3T4XA 2A92A 3UHAA 3R3JA 3ADOA 3RUFA 2R00C 3NKLA 1JVSA 2FWMX 1J4AA 4OKNA 4IIVA 3PI7A 3IJRA 2JCXA 3LLSA 3QVSA 3IDSA 1A7AA 3BMNB 4PIVA 3WLFA 3WIDA 1T2AA 1T25A 4R3NA 1N9GA 1XCBA 3CXRA 3C7DB 1NFQA 3TZKA 1R0SA 3TOXA 1MFPA 2BFMA 2B35A 2O3RA 2PZKA 4F3YA 2PA3A 1YB1A 3WB9A 4D3DA 3R6DA 1E6WA 1YXMA 3V8BA 4TQGA 3AY3A 3L6EA 2DTXA 2I5PO 3NDRA 3AW9A 5AXAA 1EVIA 1PEDA 4BO0A 4JK3A 4O5OA 1LSJA 4IDDA 1C0IA 1I0ZA 2EW8A 3H9UA 1KY5A 2HRBA 3BZUA 3H4VA 2VHVA 2Y68A 2ZQZA 1BDMA 3ZW8A 2A9FA 4BO5A 3KLPX 1NVTA 2CUKA 3VH4A 3NEPX 1ZSNA 3ZDFA 3AUUA 4K1LA 1YBMA 2DKNA 4K6FA 4UEKA 2WTBA 1O9BA 3VOSA 4D41A 1IULA 2FR8A 4DQXA 1QLHA 3ANNA 1LLDA 4GMGA 3WBFA 3GA0A 4KZPA 4LSMA 1GR0A 4R69A 1UDBA 4N54A 2NTVA 1B0AA 2YFQA 3H7AA 3ADPA 3ASVA 5JLAA 5L9AA 4C7JA 3GQVA 5B4UA 4U5QA 1N92A 3ICPA 3CUKA 3JQ7B 2X86A 3TZQA 1QMGA 1E3WA 2O48X 2YQ4A 1C0LA 1ID1A 1J6UA 1TT5B 2E48A 2F1KA 2RHCA 2PKQP 3B1KA 4Q3CA 3U4HA 3JYQA 1E7YA 1I10A 2BKAA 3KETA 3ZH2A 1UJMA 2QW8A 4YDRA 4NNJA 4ZQEA 1H6AA 3DMTC 1DOHA 5A04A 1ZK4A 2HUNA 4RVHA 4N5LA 2BFPA 2J5QA 1B7GO 2GERA 5A1TA 2JCVA 3AK4A 1FK8A 3KTDA 2VNAA 3CZMA 1VC2A 4AJNA 2GF2A 2EXXA 1HL3A 1A4UA 2ZTMA 4B7UA 1O8CA 4CLXA 1BMDA 3VZQA 1U9JA 1P3DA 3OHSX 1YQGA 3ANMA 3W4KA 2Y93A 3G49A 3JQ8B 5FFFA 2V7PA 4BV8A 3B1JA 1V6AA 3BMQB 4BGEA 2E6UX 4J0FA 2W8ZA 5BSFA 3DZHA 3CTMA 4M89A 3CEAA 4KUGA 2NU6A 4WASA 4ALLA 1EQUA 4FFPA 3ZV3A 1CETA 2RBEA 4BNGA 4RF5A 4E0BA 3EAGA 3IL2A 1E5LA 3I1JA 1ULUA 3SC4A 5DOZA 1ADBA 1YONA 4GKBA 5L40A 1C1XB 3Q3CA 2DBZA 3W4JA 4L74A 5G0VA 1K0UA 3RI3A 1I24A 4D42A 4R54A 3GGGA 2P2SA 3DZGA 5IFLA 8ADHA 4GLLA 3SEFA 3K2BA 5BNTA 1PS9A 5KWEA 1H6BA 3ZHXA 5L4LA 3KLMX 4HXYA 4CQMA 5KJ1A 4R1UA 1EE2A 4CM9A 3LDHA 3DBRA 3I9LA 4IMPA 3FBGA 4YAIA 3GK3A 4FPXA 2GGSA 2HSDA 5F5NA 4RQUA 5JAZA 2P5UA 2J3KA 1XELA 4YT5A 1ZNQO 1OOEA 1FF9A 3H3JA 5TGDA 4RQTA 2OOSA 4R1NA 1T1RA 1VJTA 2LDXA 2NACA 2EP5A 3U4IA 3RJ9A 1XWFA 1RKXA 1K2WA 4PLCA 1LJ8A 2X5KO 3WYBA 4AJJA 3V2HA 2P5YA 1YKFA 3BA1A 4L73A 5ICMA 4BNWA 1YBVA 4R1TA 1DBVO 3JQGA 3ZW9A 1DHRA 1CQIA 4XYMA 4NFYA 4GBJA 4DPMA 1QORA 1T4DA 7MDHA 4JJFA 4EUFA 3N7UA 1QXSA 4XEHA 1R66A 4G81A 1GUFA 5KKCA 1AHHA 2HJSA 2ZYDA 1K6JA 4MIEA 3IMFA 4Y8VA 1EFLA 2WEKA 1W0CA 3R3SA 4BQRA 4BS9A 3DOOA 3CMMA 1O6ZA 1WDLA 4Q39A 3D4PA 4P8RA 4DLLA 4FJ0A 1B3RA 1E1LA 1JWBB 4YVFA 2CZCA 2O3UA 3JCZA 1IPFA 4I9UA 5JYEA 3AUAA 4D46A 1KOLA 1GEGA 5I8WA 5EESA 1Y9AA 5FI3A 1TVEA 2V6FA 2VQ3A 3T4EA 3MWDB 2YDYA 4ID9A 3I9KA 1DHTA 3MTJA 4WGGA 3W4IA 3H8VA 1C0PA 2YHIA 1AE1A 1E77A 1F06A 3RUAA 3DONA 2B83A 2ZTLA 3LK7A 1YL5A 4KMSA 1NR1A 2Q46A 1B8VA 3L9WA 1BG6A 4EW6A 3VKVA 1WMBA 2PLAA 3FTPA 1ISFA 1NQOA 3GR6A 4RPHA 3DO5A 4AJLA 2UDPA 3TSCA 1KY4A 1EK6A 4FC7A 3OQ6A 5EJ2A 1UAGA 1LQUA 4RDHA 2DPHA 5JO9A 4H3VA 3T7EA 4FIZA 2VHZA 4CL3A 5B4TA 3M2PA 2D8AA 3O4RA 3GMSA 3SJUA 4E21A 2RH8A 4CM7A 2LDBA 1EK5A 4K9DA 4WNIA 4BKOA 1P1IA 1NAHA 4HY3A 3BAZA 4ZN6A 1ZO8A 4OIMA 1SOVA 2NU8A 3E9MA 3GG9A 1I8TA 3DZFA 2C0CA 3LT4A 3NT5A 1P0CA 3KRTA 5L7WA 4YJHB 1B8PA 5DCYA 1TXGA 1Y1PA 1JAXA 1E92A 5DULA 3EMKA 4PZCA 4CODB 4I9HA 1NVGA 2IZ1A 4W9NC 1HYEA 2YV1A 1E7SA 2EP7A 2ZCVA 1ZH8A 3EK2A 3S2FA 4M1QA 5G0SA 1WW8A 1DJNA 1PQWA 3VPSA 2AMFA 1U2DA 5F1OA 1YL6A 4YAJA 4ZRMA 3LF2A 1U7TA 4RF3A 4MO2A 4XYGA 4YR9A 2NV6A 3PQEA 4GMFA 1LEHA 1P9LA 2HMVA 2OZPA 3WX0A 4YAGA 2GPTA 3DBLA 1Z45A 1UXGA 3JQ9A 4XRRA 2HK7A 5DF1A 4NI5A 4HNGA 4UULA 3WFJA 4I8XA 4XQ9A 1XQ6A 3BTVA 4WLUA 3C1AA 4U6QA 4RVGA 3GF4A 1HDOA 4DIFA 3QIVA 2QRKA 1Y5MA 2B4QA 2NVUB 3WNQA 5JYDA 4BKQA 2J8ZA 1UDAA 4ZGWA 5JAQA 1D1TA 3O26A 4DIOA 1W6UA 5JCJD 1M75A 1E1MA 3ENKA 3RFTA 3WGOA 4XA8A 4TRMA 3F47A 4N5NA 1TB4A 2I66A 4QQRA 3VPGA 2IXBA 4ALJA 4YB8A 2ZCUA 5FWNA 4HFMA 4HX5A 1GCOA 1Y81A 4MOWA 3RKUA 1NNUA 2W2KB 2VZ8A 1Z74A 3M1AA 3NGXA 4FFNA 2EHDA 2B0JA 1Z75A 2YJZA 5I9MA 1IOLA 5DZSA 4IPTA 3RAJA 2WWRA 1DC6A 3E9NA 1LI4A 4CLDA 2G82A 1NPTO 1E3IA 1NQAO 3A28A 5U4QA 1DAPA 3L0DA 5AXCA 1E3JA 2Z1NA 1Y5RA 2Y67A 2GDZA 3AY7A 3BMOA 1HT0A 1IY8A 3D4NA 4MIOA 4NHEA 1DLJA 3S2EA 4Y6RA 1BXZA 4GWGA 4XCVA 1ZK0A 4MVJI 1Q7BA 3DZKA 1WWKA 2BI7A 1YQDA 1BXGB 2C07A 3KEQA 5IN5A 3G79A 3GRPA 4YRBA 3U0BA 3QSGA 3HDHA 2IRWA 4ZHSA 5I7VA 4KQXA 2WE8A 3PLRA 3K96A 4XQCA 3HFGA 5JBIA 3SBOA 1JKJA 4JQCA 3DTYA 4M86A 3K92A 1H9AA 1V3UA 3GUYA 3MOIA 3EC7A 4RVSA 3AI1A 3VH2A 2Q50A 1R4NB 3UF0A 2X23A 1GQYA 1Z7EA 3TRIA 3GRKA 1I2CA 4XJTA 3QVXA 5BSEA 1C1DA 1GAEO 5C5IA 1JQBA 1DXYA 4CLHA 3CH6A 1EDOA 2EV9A 1XGKA 4PG6A 3OJ0A 4LMRA 4BL5A 4N7RA 1LSOA 3Q1LA 1FDTA 1MFZA 3TFOA 3ETDA 3AJRA 3JQAA 2VTEA 1O95A 1MUUA 1VLLA 2G76A 1B8UA 2AQKA 2Y66A 3EDMA 1DSSG 2DBQA 5G4KA 2B69A 2AG8A 3MEQA 3STHA 1ENZA 4QFCA 1LDMA 5AOVA 3WIEA 4RVDA 5G0TA 3LF1A 3PJDA 4XB2A 2NTNA 4L75A 5FYDA 4UREA 2IE0A 3VPFA 2O3TA 4GX1A 1SMKA 3JQEA 1NR7A 4J4BA 1B26A 2V65A 3HQ4O 3L07A 4JNKA 5L53A 2D0IA 5AVOA 5KTKA 1HDRA 2DC1A 3PDUA 1NP3A 1ISIA 5A9SA 3EZYA 4DTIA 3CINA 2Y1EA 5CG1A 3QWBA 3MZ0A 1MX3A 3KYCB 3I23A 3BHJA 4Y98A 4AJ2A 5IZCC 3E8XA 5JC1A 3JYOA 4L9RA 1NHWA 2Q1SA 5A5EA 2JKVA 1NBOA 4JROA 4YQYA 5F1KA 3RD5A 3PQDA 3LZ6A 4J1NA 3QWIA 4MIYA 5DBGA 4IDCA 1OI7A 4HBGA 3L9XA 4NDNE 4BNUA 3ZWYA 4BO7A 3JQFA 4FD3A 1Q1NA 3JD2A 5LDGA 4ZJUA 4S3MA 2RHRA 5DCWA 4FSHA 3TL3A 2J6IA 2Y05A 4I1IA 3JQ9C 4A0SA 1HLPA 2G17A 4FFOA 1U3UA 5IF3A 3DZBA 4FC6A 2HDHA 1K5HA 3ZHYA 2PFGA 4MKRA 3OBBA 4RVFA 1M6HA 2JHGA 2BGKA 2Q49A 4I5GA 4WPGA 4XR4A 4C7KA 1EEHA 2DBRA 4W99A 3AOEC 1DFHA 1E1KA 4MVJA 2NQ8A 4PLTA 5TSDA 1ZJZA 1GYPA 4OSOA 1UZMA 5DP1A 4KWHA 1T2DA 3D5QA 4BOYA 3QJ5A 5KIAA 5CAEA 3RC2A 4B4OA 5ILOA 5GMOA 2AEMA 4FJ1A 4RF4A 4RF2A 4BHTA 5HRUA 4MKZA 3MJEA 2AEJA 5ER6A 1DIHA 5JO0A 4UVGA 5JDIA 4WOKA 1EZ4A 1NM5A 1VJ1A 1Q7GA 2NU9A 5DNAA 4EJ0A 1SZJG 2FPGA 2W2LA 2NVWA 5FI5A 4AFNA 1YBAA 1U28A 4CMJA 2AEFA 1JLLA 5ICSA 1UUFA 2CVOA 3A14A 1ENPA 4J7XA 3ZWPA 1NAIA 3GC6A 3ITDA 5BR7A 4J49A 3V2GA 2E4AA 1C14A 4B3HA 2JD2A 3A1NA 3PFFA 4H7PA 2X9NA 1XDWA 5F1PA 4XKJA 2JAPA 3PWKA 3D3WB 3ICCA 3KO8A 1ZK2A 4Z9XA 2GZ1A 4HP8A 1I3KA 4D79A 4BO1A 3TF5A 1KVSA 3WGIA 4QXMA 1QV6A 2EF1A 1EMDA 4KTTE 1ZMOA 4UVEA 2O7SA 4MPDA 3PRJA 4TWRA 4R4JA 2P91A 1LDNA 4FBGA 1ZW1A 1VL6A 5L3ZA 5CPFA 5A3VA 5H81A 2Q45A 3OSUA 4CMIB 2GN8A 1H94A 2Q4EA 3DHYA 3FSRA 1NX6A 1NVMB 1SB9A 2EW2A 3FHLA 2WMDA 3HB4X 5C3MA 4KDEA 4B4VA 5ES3A 2AE2A 4UEOA 3NJ4A 3NYWA 3TL2A 3QVOA 3ZWVA 3KSUA 4BQPA 1A7KA 1JDJA 1H93A 1UR5A 3WXBA 4RZHA 2H6EA 3GEMA 1EE9A 4R41A 4PFJA 3SVTA 1XHLA 3CPSA 2FPPA 4UUPA 2PZMA 4JBGA 1EUCA 1VM6A 4TROA 5EN4A 4BNZA 1DEHA 3QY9A 4J6FA 5KKAA 3W8DA 3GGPA 5TT1A 3V1YA 2AA3A 1TT7A 1GYQA 4KUEA 1XEAA 4J7CA 5T67A 4E2YA 4IXTA 1RM3A 2PD3A 1BXKA 1EQ2A 3C1TA 4MVJF 2ZB3A 1F8FA 4CQMD 5I7SA 4IIUA 1CERA 4CM9D 3AM3A 1HDGO 1R0LA 1IHXA 4NZ9A 4CL8A 1EVZA 1LLUA 3HWRA 4E4YA 1GQQA 5BSHA 3GAZA 5BT9A 4RPGA 4N18A 3VTFA 2VRCA 5KVCA 1R6DA 3P7MA 3ZN2A 5CDTA 3OMLA 2P9CA 1J49A 5I9LA 1BHSA 2EGHA 1JN0A 2XXBA 1J0XO 3AU9A 1PL6A 3RUIA 4DGSA 2P9EA 1ISHA 4J3FA 4BKPA 1VKNA 1ENOA 5LC1A 2VHYA 3ULKA 1P1RA 3IP1A 5TLSA 3KOUA 1U3VA 3O9ZA 1FXSA 2OL4A 2X4GA 3NDIA 3D3EA 3PGXA 3RBZA 2D2IA 4QUKA 5I7EA 4GGOA 4OQZA 1PSDA 3TN7A 4CUKA 3KB6A 3I6QA 1G0NA 1FDVA 3O38A 4FFLA 2H1SA 1PJQA 1HLDA 5IG2A 4UUNA 2VZ9A 1V0JA 4ZQGA 3AFMA 3OA0A 1E7MA 1UP7A 5G0UA 1DFGA 2X0JA 4GSKA 4E5KA 4J43A 4O59O 5G2OA 1YH3A 3GDFA 4A03A 3BTSA 3H5NA 1E6EA 1DLIA 5CG2A 4WLEA 3ZWOA 2CMDA 3TFQA 3JQFC 3AU8A 4D43A 4IQ8A 3HADA 3K9QO 4JLWA 3U4DA 3GNQA 1A4IA 2VN8A 5F3RA 1UH5A 4P4NA 3TJRA 1P0FA 4MP6A 4O0LA 1R0KA 2X8LA 3GVHA 5ITWA 2BMAA 1VRWA 1BDBA 4CLOA 1VSUA 4DMLA 4UVDA 1U8FO 4LCEA 2GUGA 4QEDA 3ZI0A 1LDYA 1ZKMA 4BKRA 5HTOA 1BW9A 2G5CA 2WDZA 4TKMA 4LMPA 3E82A 3GH3A 4PLHA 4CM8B 1BSVA 3FCOA 4LRTB 3F9IA 3GVIA 2PGJA 2FMUA 4W9NA 4YJFA 2X0RA 3PK0A 3H9GA 2I3GA 1H2HA 1PZFA 1ULSA 2AW5A 3ZWXA 2UVDA 3KSDO 1ZXLA 2HRZA 2QQ5A 2D3TA 5CDSA 4M54A 2D5CA 1P77A 1BTOA 2VTDA 1NPYA 3F1LA 5JDIC 3MJSA 5KJ6A 1HYGA 4YPOA 4GKVA 1Y8QB 4NU5A 3AUTA 2HO5A 3KBOA 3QHAA 1YE3A 3GN2A 3OJEA 4N5MA 2X6TA 5DN9A 3WSWA 4GL4A 3DC2A 1SEPA 1PWXA 4WEQA 3GGOA 4B3JA 4XB1A 2QIOA 3ZCXA 3N74A 4OXYA 2NNLD 1T2FA 4WKGA 4PN3A 3HN7A 4RJTA 4IJWA 1R4MA 1LXCA 3KYBA 4AL4A 2ZTVA 1N9GB 3KYDA 2Y0EA 4Z0PA 4M8SA 3RFVA 3NTQA 4D0SA 5CFZA 5L4NA 3DFUA 1RWBA 4HFNA 6LDHA 3DB2A 4OH1A 4EZBA 4Q3AA 4Q3EA 3WGYA 3ZWMA 1C0KA 3ASUA 4XJSA 3S1LA 4E6PA 4WCFB 4B4WA 2DQ4A 1X15A 1B16A 4IZIA 3HZZA 2DM6A 4MINA 3G3EA 2I67A 3IQDB 1QG6A 4L4SA 3E9QA 1OAAA 3K8ZA 2O23A 2BFOA 3GZ4A 3UCEA 1S7CA 4G2NA 3RJ5A 3PFWO 1NPDA 4EYEA 3NTRA 2IZ0A 2NLOA 5HM8A 3PHGA 4E5YA 4GX0A 3E48A 5B37A 5CEFA 2HMSA 4YA6A 3VZSA 3KHUA 4Z6KA 3QWAA 1JAYA 4FB5A 3F4BA 1HEUA 1E0DA 1MA0A 1HDCA 3LC2O 3HSKA 1YDWA 3ANLA 3VPXA 3DZIA 1K3TA 1I36A 1LQTA 1BVRA 4OQYA 1E3WB 5A05A 4IQ0A 3VDRA 3FR7A 4PRKA 1G1AA 2GN6A 3GEGA 4HWKA 1QSGA 4OYRA 3AOGA 3HNPA 3WG9A 3H2SA 3OFSA 4LGVA 1Y9EA 3FI9A 1LDGA 3WGHA 2DU8A 2FOIA 2DVMA 4UAGA 1ZZEA 1U3TA 4ND5A 2P4QA 2VZ0A 2VNSA 3WQSB 4CM3A 2R6JA 3HFSA 3OJOA 4RPLA 4ALKA 3QQPA 3EW7A 5AXDA 3GZNA 4CMGA 3JD4A 5L7YA 3FBTA 1QP8A 5JW6A 4EITA 3VVCA 1MG5A 1AXEA 2WJPA 3NTOA 4IDFA 3S8MA 3MWEB 2O4UX 2CF6A 1PGOA 4DRYA 4DYDA 3CSDA 2CD9A 2PD4A 3DAPA 1V8BA 4PG8A 2GD1O 3D1LA 3ONDA 3JQBA 2Y0DA 1GZ3A 4FJ2A 1ZSYA 3PYXA 4EEXA 2ZB8A 3BTOA 4EGFA 2WD7A 1I30A 2ZJ0A 1MV8A 4ZQFA 2Q2QA 3RUCA 4CR8A 5JMWA 3BMCA 4MP8A 4CMAA 3ZU3A 1FDUA 3RC1A 1W73A 3S55A 2Y0CA 1LSSA 5HA5A 2D5AA 4E5MA 4I5EA 3RROA 1OC4A 3AI2A 1NXQA 1WMAA 4MVJP 4TRJA 4PG5A 4E2XA 4CQMB 3KV3O 3BIOA 5K9ZA 3PDJA 5I7FA 3DBRB 1CF2O 4GSLA 2OHXA 3GDGA 1TEHA 2QYTA 3WJAA 4DWVA 2PH5A 4TRRA 5CPBA 1AN9A 2HAEA 4YACA 4UUMA 4BNVA 1MC5A 4OXKA 2P4HX 5A3JA 3JQAD 2C82A 2EERA 4AJEA 4CM4A 3KUXA 3IIEA 4YAKA 1CYDA 3RBXA 1AHIA 2FZEA 3DBHA 4Q9NA 1DRWA 1Y8RA 4LN1A 4NIMA 3C3XA 4ONEA 4PG7A 3TDKA 2X22A 3QW2A 2PK3A 4YXFA 4PLVA 3JQGB 3JQDA 3QV1A 5IZCA 3C85A 4JCOA 2Q4BA 4BV9A 1UXIA 3GVXA 3ZWBA 4DQUA 1H5QA 4YJGA 4EJMA 3C1OA 3HDYA 5BSGA 3OECA 4A27A 1WDMA 3OP4A 1JU9A 3O03A 4CM5A 4YRAA 5ADHA 5L4SA 2EKPA 4BNHA 4UVHA 1I5RA 3I9MA 4BO2A 4CMHA 4EUEA 4TRNA 5JAIA 4HV4A 5FF9A 4IDAA 2O3SA 3PWZA 1RM5A 4WOJA 2J5RA 4IZHA 5T5QA 2WE7A 4M87A 4R1SA 3RBVA 2Y1CA 5F21A 1GZ4A 4DA9A 5DDIP 1MXHA 3NDJA 2VUTA 2Q2VA 3PHLA 3MJVA 2VYVA 3AOEA 4IS2A 2YHIB 1I2ZA 5HS6A 4CQLA 4DPKA 3IUSA 4ND2A 4NG5A 3ITKA 5T8KA 3NT4A 4BGIA 3CIFA 1ISJA 3NRCA 1OC2A 3COSA 2BH9A 4U8GA 3TZCA 4YBZA 2HJRA 1K6XA 1RM4A 4B3IA 3GDOA 2B36A 3L4BA 4FDAA 4PVDA 4E12A 2GLXA 3U09A 2CDAA 4BNKA 1T24A 3WTBA 1ZEJA 2PKQO 3UOGA 4CLRB 2WYWA 1NYTA 3IC5A 2C59A 3BXXA 3KEOA 4JP2A 3RC9A 2C7VA 4JBHA 4Z3KA 1M67A 2HMUA 2CY0A 1JWAB 3ETGA 4MVJD 3BYZA 5CP8A 1P44A 2YUTA 1YOVA 1ZUD1 2ILTA 4XD2A 4J7UA 5ENVA 3E5RA 3GN1A 2CF5A 5L45A 5CHEA 4XYBA 4RLSA 3WS7A 4EBFA 4INAA 5L7TA 2F00A 5CDYA 5L51A 1EUDA 1KC1A 1OFGA 2FY8A 1A71A 3PVZA 2W2LD 2GASA 4BB5A 5C7IO 1KERA 1HDZA 2B5WA 4MJLA 3Q0EA 1PJ3A 1L7DA 3OETA 1Z82A 1LLCA 5EERA 4ILKA 1KYQA 1GEEA 5THKA 3W8EA 4MVJH 5A9TA 4Y6SA 1KVRA 2FSSA 3PHHA 4IS3A 1ZMTA 2YQ5A 4OMUA 2J3JA 3TZ6A 4QSMA 3DBLB 1CJCA 2O3QA 4XGIA 4FW8A 1YO6A 4Z9FA 3KYCA 4QT0A 2NVBA 1GY8A 4DC1A 1GFSA 3A06A 4RDIA 4HUJA 3SXPA 1E7QA 1N1EA 2W90A 3QVWA 1RYEA 1PGQA 4NJMA 3JQBC 2OMEA 2PZJA 1LRJA 3BHIA 3QWFA 3PEFA 2G1UA 3RU7A 4E33A 2ZKLA 2FZWA 1WLYA 2WYVA 5DOVA 4BNYA 5H83A 4MVJG 1KEUA 2CSUA 3QP9A 3L77A 1PS0A 2SCUA 3PPIA 4EJ6A 4CM6A 3Q11A 4DYVA 1EFKA 5DBIA 4J4TA 2H63A 4W4TA 2W4QA 4AJOA 3D0OA 3JYLA 3OQBA 2IYOA 1XSEA 2VWHA 2ZATA 3I83A 4B4UA 4ND4A 3WMXA 4WK6A 1QYWA 4BNLA 1E1NA 2VT2A 3ZWNA 2GO1A 3GVPA 5IAAA 3ZWCA 1X7GA 2PWZA 2D59A 4L4XA 5A02A 5A03A 3TQHA 1HE4A 3INTA 2AHRA 1WNTA 4Q3NA 3JV7A 1LC3A 4XIYA 1YRLA 4XDZA 3FNEA 3RASA 2X1HA 3P19A 3NV9A 5C7OO 2QRJA 3HG7A 3ETEA 2FHSA 1W4ZA 1GV0A 2HK8A 2ZQYA 4U0KA 1ZCJA 4BO8A 2VYNA 4PLPA 2J3IA 4BMSA 3OEWA 4ALIA 2HKIA 4GAEA 1KBZA 3BMOB 4IQGA 4BB6A 2FN7A 1L7EA 1SOWA 1SEVA 2C20A 2YYYA 4U7WA 5C7LO 2VRCD 3U9LA 1YJ8A 4TVBA 2E37A 4PVCA 1UZLA 3PWSA 4YTEA 2XXJA 5MGBA 1J5PA 1UP4A 3DBVO 2PKRA 4A73A 3PIIA 1NFFA 4II3A 2NWQA 5HWSA 4LVCA 3UUWA 2B5VA 4D0RA 4UEJA 1IE3A 4YWJA 4DPLA 1UP6A 1KEPA 3C8MA 3G1TA 5T6BA 1DIRA 3ZHZA 3IOYA 4DBZA 1LLQA 1PWZA 4I5DA 5DT9A 3DL2A 2IYPA 5FEUA 3G0OA 4JBIA 3GFBA 2C5AA 3JD1A 1NHGA 4QECA 1C1DB 2AG5A 2HMWA 4DL9A 4Z0HO 3U3XA 4DLBA 4LK3A 3I3OA 1H2BA 1I3LA 2CDBA 1GQ2A 1Z73A 3T7CA 3C7CB 1L1FA 3LQFA 3JQAB 4OGWA 4IBOA 2IZZA 1XA0A 2HMTA 1WP4A 4PZEA 3OF2A 5T8KC 2V6GA 1BWSA 2VUSA 5G4KB 3L4SO 4R9SA 4L76A 1YDEA 1PJSA 1W8DA 4AJKA 2FR1A 5BNIA 5KVSA 1QR6A 2AXQA 4W82A 4CUZA 2Q99A 3L4BC 4D3FA 1UXHA 3KM0A 3WGTA 5CDUA 2YZ7A 1G0OA 1HSOA 1IYZA 3WICA 2YW9A 1PR3A 2RCYA 4RORA 5AXBA 3O8QA 1Q0LA 2ET6A 4F45A 1OMOA 5MDHA 1YGYA 1MXFA 1PZEA 2NTJA 3D64A 3H9EO 3QA9A 4WECA 1NFRA 2D1YA 2FPIA 3K2EA 2CDCA 1FDWA 4AJIA 5A9SB 1VE9A 4DIBA 3UFXA 1M6WA 3PHJA 3UN1A 1GPJA 3EHEA 1XU9A 1R15A 3QVTA 4U6SA 3PP8A 4NH4A 4Z9YA 3GOHA 1CDOA 4GI2A 3VVBA 2HU2A 3BTUA 2YHUA 5IDYA 1N7GA 2GR9A 4W7HA 1LRKA 2JL1A 4FFMA 1X1EA 2I3AA 3WQQA 1MLDA 2YFHA 1DO8A 3K5PA 1F0YA 2H5LA 1V9LA 3DOCA 2WSBA 3H3FA 2UV8A 4GVXA 2AQIA 1NTOA 4CJXA 5BQFA 5K0ZA 1UZNA 2DUUA 4OOFA 5TQVA 1VPDA 2GN9A 2I99A 4R68A 5TJ9A 2PH3A 3WWZA 3BMNA 3NX4A 3GUCA 1OZAA 4WJZA 3FTNA 5HBRA 3UGKA 4CMEA 3CKYA 1ISGA 4TSKA 9LDBA 2YV3A 1PJ4A 1QYXA 4FR5A 3UAGA 2ZIZA 3S2GA 7ADHA 3JQCA 1WAMA 4AVYA 1P1HA 2GZ2A 4CR6A 4QFDA 4GLOA 1DJQA 2JD1A 5JE8A 3B1FA 4DVJA 4DMMA 3MJ4A 2NUAA 3GHYA 4BGVA 1FDSA 4EUHA 4JN6B 3GG2A 1PJTA 2NADA 3GLQA 1LUAA 2BGLA 3WJ7A 4DUPA 5JCXA 4A26A 5CEEA 1DPGA 4QX6A 5IDXA 4J90A 2I9PA 4BNNA 3HHPA 4WE3A 1UXJA 4RPKA 3GPIA 5B12A 2DFDA 3DXFA 4KQWA 4MVJM 1O94A 4M55A 1NWCA 2BFAA 4XQEA 4LRSB 4QO7A 5ER9A 3C7AA 5K6AA 2EJWA 1BGVA 3FN4A 2O4CA 2DFVA 1GPDG 5KCZA 4IJVA 2BI8A 2NM0A 4BIIA 1GU7A 3EUWA 1HDXA 4URFA 3UVEA 4TMFA 3JQ7A 1SB8A 4I08A 4R01A 5IJZA 5JS6A 2Z95A 1X1TA 5KJFA 5GZ3A 1TT5A 4II2A 4TVOA 2CVZA 4I5FA 3I9JA 3LT2A 3WQRA 5TC4A 1I01A 2Y1DA 3GHHA 1JTVA 1XYGA 1A5ZA 2B4TO 3AUSA 3TWOA 1X0VA 3WGQA 3DZJA 3WNVA 1QYDA 1YVEI 1X0XA 1GYRA 1U3WA 3SLKA 3ABIA 5IDWA 5I8ZA 3VPHA 3DHNA 3DFZA 4S1VA 5C37A 3ZHBA 4F6CA 3NUGA 1HYHA 1BRMA 3MTGA 1EVJA 2WM3A 4O63O 2YDXA 4D45A 5U9CA 1PTJA 5COAA 3JQ8A 1WZEA 3F6YA 4W6ZA 4MKXA 2X5JO 1Z6ZA 4UUOA 4ZVVA 3BMQA 3PIDA 3S2IA 3JYNA 3DWFA 2OP0A 1N8KA 3ROQA 3B70A 2D4AA 4IJUA 5B1YA 2OORA 3DOJA 5COQA 5KJCA 2IEBA 3OM9A 3H65A 2FP4A 2J3HA 3RUHA 4WCFA 1C1XA 2X9VA 4P4GA 3FNGA 1YJQA 1ZEMA 3PZRA 4ZQHA 2JD0A 5H82A 4XYEA 3HUDA 1R37A 1F17A 3E1KA 3WSVA 4OOEA 2B4RO 2GZ3A 4GH5A 1IZ9A 2VHXA 2PZLA 2C2XA 1PQPA 2DT5A 4OSPA 5EQDA 3F4LA 3FWNA 4GPD1 5EQFA 2AQ8A 2FSVA 4RZIA 4YT2A 1HSZA 3EVNA 1GUYA 3FD8A 4XWYA 1T4BA 4G65A 3ONFA 4WLOA 4J1SA 1ZVMA 1Y7TA 3RC7A 3JD0A 1D4FA 2EEZA 1P31A 3HB5X 1PZGA 1M66A 2HQ1A 4RLHA 5U1PA 1O89A 4XR9A 4FQ8A 2H9IA 2DLDA 4WLFA 5G4LA 5TF4A 2BHLA 3OICA 2QZ9A 3TOZA 4FN4A 1HTBA 3RWBA 1QKIA 4BO9A 1JA9A 1Q7CA 8LDHA 2Y1GA 4HKTA 4ALNA 5JNLA 2OUIA 3LSYA 1YS4A 3EVTA 2OGUA 3ONEA 4IDEA 4AJPA 1LTHR 4LCJA 1XIVA 5AQ1A 1U8XX 4R3WA 4A2CA 3VZPA 1MG0A 4FS3A 2QRLA 3INRA 4NBUA 1KVUA 2RH4A 3VC7A 3UKOA 2TMGA 3IUPA 3OIFA 4IGFA 4RV9A 4YT8A 3H9JA 4NK5A 1IB6A 4ESOA 3TPCA 2JHFA 3E03A 4NK4A 4A7PA 2DBVO 3LT1A 1DC4A 4ZD6A 3ZNNA 3B6ZA 4DBVO 1A72A 2RIRA 3RU9A 5CEJA 5TT0A 1V3VA 4AG3A 4D3SA 3ZZNA 4CMBA 4CMEC 1GD1O 1ZK3A 1NWHA 1WXDA 1NASA 1KETA 4M49A 1DRUA 4J9UE 1V3TA 1CWUA 1UDCA 3UCXA 3ZU4A 4CLOB 2VYVD 3C24A 3EYWA 4QTZA 3UICA 3P2OA 1JW9B 2WYUA 4JGBA 4GX5A 4R5MA 4WLNA 1DRVA 1U4SA 5DP2A 1C3VA 5TRTA 1BW9B 1AXGA 4LSWA 3DAFA 3RUEA 4KTVE 4JX8A 2I65A 3ZV6A 3PJGA 3QRWA 5A9RA 1ZSVA 1AUPA 4NBVA 2EKLA 2BRUA 4Y9DA 4YJFB 2IDZA 3FR8A 1ZXBA 5THQA 3U5TA 3I5MA 4BNXA 2C2YA 3SC6A 2O2YA 1TI7A 1AGNA 1PGJA 1XLTA 3AM4A 5K6AC 1ONNA 4EEZA
chains in the Genus database with same CATH superfamily
1NR5A 1CDZA 2J7PD 3TK1A 4CCYB 1YFZA 3D59A 3OUUA 4UBIA 3CUTA 3RF6A 5D6NA 4XYLA 5DNUA 1O6BA 3CCCA 3QEMB 5T64A 3VR4D 4GM0A 1L8AA 2LUOA 1MAAA 2BR3A 2GJAA 2PNFA 2ZP1A 3QPDA 1H9BA 2Q28A 2DQKA 3LE8A 2X7HA 1SCUA 2JA1A 1T6NA 2ATCA 1NRIA 1YCGA 2R6AA 2P90A 3OVMA 4O4JF 5H7XA 2DKOA 1WPQA 4B47A 1WABA 2BSAA 3G2MA 4PXSA 3RCBA 3V5NA 4C0JA 1EVKA 2AN1A 1MP0A 1PJ2A 1QGYA 1R4MB 3FTDA 4HEA1 4MQ5A 5J2TF 3TXXA 4RTPA 2UXDB 4M0FA 3C70A 4JP3A 1Q16A 3ELBA 5I9BA 4A23A 1GTMA 5JS2A 2VT3A 1UC4B 1DDOA 4RY8A 3ROPA 1CLEA 1Y63A 2OCYC 1T9GS 2B8NA 3W6ZA 3DEYX 3ZDZB 1P8AA 3IKVA 3PB3A 1JIVA 3F8TA 4GMHA 3A9VA 4FT4A 4TMWA 1G20E 3IKJA 5K2MA 1Q1ZA 5GY7A 1HDIA 2VVTA 3SJ7A 5IMSA 3PGJA 5IYZB 3U16A 3CVYA 4EVRA 4B7ZA 1I0LA 2VDOB 1VQ1A 2YXLA 4FNOA 2CNNA 3KKPA 4QUHA 3HYLA 4MHSA 3COJA 2EZ4A 3KE8A 2JI9A 3K31A 1B14A 1BWRA 3LPNA 3QLJA 1VCHA 3ZU2A 4YT4A 3ONWA 1N4DA 2PSSA 1EWYA 1XL0A 3H3XA 9ABPA 2VNKA 2ZTSA 4CM1A 3AP1A 2ZRFA 5EL0A 1EKXA 4TL7A 3R7SA 4DSZA 1UWLA 1S89A 3E58A 4NU6A 2RC5A 2EKQA 4Q3BA 2GVZC 2XMGA 4HT3B 1NUQA 5LYJA 5J4YA 3ZVNA 2DUJA 2P7IA 4C2UA 1Z26A 1ZIDA 2Y1XA 2N1BA 1M73E 3D3QA 3UW3A 1U7ZA 4N0MA 4DLVA 3RT9A 3ZZTA 5HP4A 5JSYA 1IOZA 2KQUA 3GP5A 1USUA 3OJLA 5AD1A 3EZLA 2BKEA 4JZKA 1CIJA 2RKOA 5ELMA 4Y2RA 4LS3A 2HRQA 3I9NA 2ZYGA 2I2XB 3UYLA 4DUGA 3LW8A 4CFZA 4L28A 2JLUA 1EEXB 2PX5A 4HADA 4LXUA 1O08A 3F3KA 1YA8A 2GESA 5D5QA 5TQJA 2PZBA 4CMCA 5THXA 2XLBA 1TF7A 2GBCA 1M6YA 1N5IA 2R2GA 3IUYA 2QTZA 4KWIA 3DNMA 5HKKD 1I1HA 2YWFA 5JVDA 4KREA 4Y1RA 3HCBA 4GX2A 1QWSA 4BNTA 1T6XA 1JG7A 4JLOA 4L8LA 4DREA 4D1YA 4I55F 5TR9A 5KTRA 1MMFB 1THGA 4K28A 1EGVB 4RACA 1JT2A 4Q9AA 3WB0A 4C43A 5IX8A 3PKJA 3CZRA 4NXNB 3R5HA 5BMOA 1JXAA 2O6LA 2I33A 3SYLA 2WD8A 4JNCA 4C4TA 2H4HA 2WWVD 1D0IA 2I8CA 1GQOA 4RK6A 2VYND 5HIAA 1ODFA 3BWEA 4WMLA 2XRFA 3CW9A 5IVDA 1ORRA 1C8KA 2J9ZB 5EZ5A 4BNIA 3NAQA 2LIVA 4CL0A 2CLIB 1Y82A 4QWWA 4MYSA 4RGVA 2PMEA 1A9OA 2Z98A 9LDTA 5A4DA 2IYSA 2VH2A 4PW0A 5ITVA 5IVPA 1BXGA 2QE7A 4GGPA 1F8GA 2PFKA 3FROA 1PYDA 5GAJA 1GKKA 3VJLA 1IUPA 1CHDA 3N5KA 3HY6A 1MH9A 2PFSA 1XTSA 4G4GA 4V39A 1WUJS 5LWQA 1CQJA 4Z0TA 5I7WA 4L15A 2LRHA 3TZBA 4TXHA 2O1WA 2VAWA 3WKAA 1KHTA 3HA2A 2OM2A 5EUCA 2H1FA 4CV1A 1S2IA 5HQ3B 4L4UA 3WAKA 4W5HA 3FWZA 2BTQA 2PY6A 1Y3AA 4BJ6A 2EJVA 1HM5A 3I6IA 5E6UA 5JCZA 2UZ0A 1U9IA 3QMWA 4QOGA 4R8MA 2ALJA 2A4MA 2OB1A 2X8JA 3VR3D 4HNHA 5JHGB 2R79A 1A2QA 2FRDA 2WT9A 721PA 1WMEA 2VPQA 3C6XA 9GPBA 2FQXA 4P22A 4AJ1A 1HL7A 3IUJA 3G59A 4RZ3A 1KGDA 3TEMA 1QGED 3LJKA 1QV7A 1R00A 2FP3A 3HN2A 4FHEA 3X2FA 2PGOA 3GNTA 1SBYA 2WNIA 2RI0A 3LUJA 4LNAA 4XARA 5DGXA 3L04A 5AOBA 4OXIA 2VOJA 2EFEB 4OP3A 5KSZA 4B7AA 2PUBA 1ADGA 3RTGA 2IA5A 2EHJA 2NZ8A 4I2VA 1ZI6A 5KVQA 3RWOA 1RWPA 3OKFA 1TEZA 3OX4A 4EF5A 5H1YA 1NP7A 3WLPA 3H5RA 2J9XB 3RREA 3KXPA 3PC3A 1QZ3A 1OU4A 4K46A 5DBFA 3PT5A 1Y8RB 5KYUB 2D0PB 1WCIB 5DGDA 4RK1A 2C4KA 1JQDA 1RJGA 3G0GA 5A0FA 3ORFA 3H87A 2ZLBA 2BRUC 4IUYA 1E2UA 4OL0A 4CNQA 3U4MA 1P5HA 1SKBA 2E4YA 3ECCA 5EY5B 1U8AA 4JI3B 2V74B 5J58A 3OA2A 4CV0A 1AURA 2B4KA 2PX0A 1Z8NA 1OWLA 1U7WA 1Z4JA 4I4TB 2H1IA 4RD1A 1P9WA 4XCQA 1TEVA 5AI6A 4FW9A 3WGUA 4E2FA 4X92A 2G4LA 2ZFUA 3OZIA 1WY5A 3SEAA 5EXSA 5JVDF 5K8CA 4B09A 1KAOA 2DWPA 1UC5B 1BMTA 2BD0A 5E0KB 1DQPA 3NDPA 5HKBA 5FBQB 1OXBB 2H2IA 2O50A 3TO5A 3T7RA 3GJ0A 4G37A 2XT6A 1C9JA 1P0IA 3EA4A 4JJGA 1GTG1 2CBZA 2G4CA 2KB0A 5EKTA 4GR9A 2F67A 3PQFA 2OGWA 3N8KA 4NFHA 4JEMA 1D2MA 1O9GA 2IKQA 4M9CA 3S70A 3THWA 1PSZA 3GJQA 3FB4A 5AM0A 1LVHA 2ZRJA 1YCDA 3CO0S 2FPSA 3LZCA 2H2AA 1R27A 1PVDA 4N1AA 3V4VB 1X1DA 4XQGA 3HM9A 2WJJA 5DLYA 2Q2WA 2NGRA 3EY4A 4LBVA 1ZN8A 4TMKA 3H99A 5CU7A 3W79A 4WEOA 1SRQA 3AL2A 4GBMA 5IXYA 1CNMA 2NZWA 3PIRA 3W6UA 4PXAA 4RCVA 1ONOA 2PSFA 2VHWA 4DKJA 1LU9A 3Q85A 4OSEA 1FX0A 3GMDA 4XGKA 3I92A 5D3QA 4AT1A 5ERGB 2WFLA 3U49A 4LBZA 2C1EA 1O58A 1K5GA 4G8CA 4CIYA 4UBMA 1G5TA 1NJ5A 2H3EA 2QX9A 3IEIA 3ZQJA 4FE7A 3HNRA 1WW2A 5LQNA 1E4VA 3I8SA 4C87A 3HA3A 4FTWA 1JDNA 1ULZA 2HA3A 5IJ0B 2A86A 3EDRA 1CRLA 2BUBA 4BO4A 5DLEA 3T3EA 2CSXA 2MOKA 1E7RA 1UM9B 4OV6B 4ZTZB 1PGNA 5GJBA 3PPXA 1XTQA 2C03A 3RVBA 1M0WA 5BV2P 1QQAA 1MT0A 5JZMA 5KU1A 4M3NA 2GKSA 1YQEA 3RODA 4PLFA 3G8DA 5K5EA 3A3YA 5IN4A 2YC4C 5KOIA 2DCMA 4MW6A 3IAM6 3ND8A 1V16B 1ZBQA 2XDQB 1FBTA 1G7CA 1IFXA 3WDSA 1TYCA 1U80A 2CUZA 3O90A 3BGOS 4IV5A 2FK8A 5TY0A 4RVNA 3GY0A 4L3VA 4ARSA 1IOWA 4EVIA 2PPLA 2H17A 5CA0B 2JI8A 1L4HA 1J22A 3UV6A 4OI2A 2OFPA 5JSZB 2P2ZA 4PHFA 3DT9A 4GQAA 1E3SA 1JHOA 1P0MA 2HUPA 3ROKA 1P4SA 4P82A 4KVAA 3A4VA 3MTDA 5LDHA 1UBJS 5KNLA 3DP9A 3VAYA 4MGKR 2OHFA 3K05A 4XTCS 1XQ1A 2QY6A 2WA2A 1VB5A 2H0QA 4KNYA 4KN9S 3JRXA 1C7IA 4XFJA 3E9EA 1NQWA 1IBRA 2OO5A 3F7TA 1CUBA 3LUPA 3EEFA 4U2KA 3L49A 2Z57A 4OL9A 4AN4A 1B15A 3KT8A 1TJPB 3ABRB 4MMZB 5K8TA 2AYYA 3COYA 3VU1A 1RJ9B 3NNSA 4IDOA 1A27A 1JKIA 1V6CA 2NZYA 3WWYA 4C20A 1ZGCA 5JNTA 4MPTA 5AKXA 3AG6A 4ILEA 4RNCA 2FDXA 3GXOA 3UWMA 4KDFA 3ESYA 5ESRA 4L0QA 1ZD2P 5CJJA 3R8XA 1U1IA 4CKYA 2VSOA 3RIXA 2G0TA 2I22A 1YIOA 4ACAA 1L7BA 1QYCA 3H1GA 4BJ1A 1QIGA 4TQUS 4B8ZA 1ODIA 2AYXA 1EXMA 5KU7A 5BSTA 4HG2A 5HCIA 2FN4A 1NNEA 2KPOA 5JRJA 4FYVA 3HBNA 3R74A 5KYGA 1W46A 2FFQA 4B35A 1OZFA 3OX2A 2EFCB 4A8PA 2SCUB 3EQ2A 3UHPA 4HNTA 4EJ2A 5D87A 4IY1A 5EUBA 1ADCA 3JSXA 1FMJA 3P9KA 4Q21A 2D1FA 3ZY2A 5JSFA 1ETHA 1X7HA 5BN5B 3EQ8A 4E2ZA 1YZQA 2C0QA 3UBMA 3EEIA 4R2KA 3Q98A 5ALGA 3D2BA 1YUMA 4F4UA 3ZOZA 5CDHA 2WWGA 5CVEA 1SXIA 2VYFA 4IM7A 2BF7A 4QRHA 5I9TA 2WT4A 4B83A 5IS2A 2WVAA 3EDQA 1R10A 1N1GA 1ZJYA 4AICA 4O8CA 2W71A 1UBUS 4XGQA 2OHJA 4X6YA 5IM4A 2IXAA 1LBEA 3L8DA 3JVUA 4LXHA 1KH1A 3I42A 2O20A 4HLDA 2WHXA 4JU8A 1NU8A 2GNAA 4ZXFA 1JEAA 1RKBA 4R83A 4QVIA 4Z3DA 4PPGA 1X7ZA 1PL8A 2IELA 4X1IA 3MJCA 3V46A 1GARA 3L6OO 1DX6A 5JH7B 1T3ZA 2ADOA 1KI4A 2QYHA 3AEKA 2YYSA 3Q12A 4EB8A 3KHKA 3PHIA 1T1SA 1NVAA 1MGOA 4RTRA 5JJKA 3M4XA 3DMTA 3G68A 2PJUA 1VYUA 1XC7A 3IJPA 2AE1A 2WSLA 4NBNA 4BUJA 3ONNA 1P6XA 3I52A 4LISA 2Z1MA 5JANA 1SZDA 1OXSC 1R6XA 4D5EA 1GADO 1DT3A 3L8EA 3N3BC 5AHKA 2JH9A 5HYVA 3SBDA 2O7QA 1NVEA 2XUPA 4QULA 5DIZA 5TPWA 5EKSA 2HCRA 1R5BA 3UJ8A 1CV2A 3ONVA 4R51A 2QAGA 3GVCA 4IOKA 2Q1WA 1VSTA 1SXHA 4E3ZA 5AM3A 1PW7A 3LC0A 4OLFA 4W7IA 1XNRB 1JSLA 1E58A 3FWKA 1WG8A 4MW2A 1M8GA 3PRKE 4KUHA 3TD2A 2FLWA 1E9FA 1G21B 3I5UA 1CLUA 1K89A 4OKIA 3FI0A 1J2JA 4URYR 2JLRA 2OBLA 3FPGA 1F14A 3CLKA 3W7VA 3KV1A 1M2WA 4J16A 2Z5LA 2ZSFA 1GRQA 1MQ8B 3DDNA 4WZBB 5AKEA 5TMEA 2OYRA 4YAFA 4EG3A 5KX5B 4NEGA 1GOTA 4MAMA 3BH6A 4F5YA 5BV7A 1T13A 1ULHA 4YP0A 5EWLA 1FNSA 2JAXA 2ORYA 5E7MA 1OH8A 1ZWLA 2AVDA 2P1ZA 1NLZA 3DAGA 1LDBA 2P3SA 1ZBDA 2D54A 1H6CA 1QHIA 1Y6FA 1LNQA 4KIUA 4S12A 1DKOA 4KFSA 1V8PA 5KJEA 4GE0A 3K0KA 4WNYA 2HYDA 3ZV4A 1GL3A 1ZCFA 4G4SO 4G85A 2Y9PB 3BSWA 1OIXA 3N6RA 3DYBA 3NU1A 1IUKA 1FFXA 1TQDA 4F04A 5KYKA 1F4VA 4LKOA 4UDXX 2R66A 3U61B 1E9CA 1XP8A 3KJGA 5HOQA 4G41A 5EPOA 1RWWA 3CLUC 4ENUA 4GOOD 5A5DA 1LK0A 3OIWA 2FEKA 3DB1A 4N5IX 4DR3B 5LB4A 1C9NA 1E7WA 1V11A 1ZUNA 3WTCA 4BGDA 2X2OA 3OQNA 4MX8A 5TQ2A 5SY9A 4IGIA 4NFSA 2HK9A 3OH8A 3KT6A 3X1DA 1C8LA 3GQBA 1B4DA 1ZI9A 2NO7A 1DAFA 1K3FA 1X70A 3AWDA 3D8SA 2NTEA 3E9CA 1QHXA 2GA9A 3LPLA 4IGEA 1HI9A 5HCNA 4CM8A 3ZE1B 2YNMD 1F4PA 1JGTA 4IEEA 4C9BA 1EXDA 2VSFA 5EJ8A 3F5SA 4Z8YA 3OPVA 3KQSA 1Q14A 3QE3A 2YW2A 2V6BA 4QJ5A 3TNYA 4J0CA 3JRWA 1NBMD 3U7IA 2O7NA 1WDWB 3ZX4A 3GJ5A 1NQ5A 2JI7A 3RT7A 4DLSA 4Q6BA 4HVLA 2DPGA 3EC1A 4HDSA 4CQMA 3ZIDA 1USWA 5FV4A 3HS3A 3AI3A 2PS1A 4B7CA 4Y6PA 4J2OA 2ID8A 5D2CA 1V71A 2XW6A 4IINA 4ZRNA 1M2OB 5C9ZA 3D6FA 5KNCD 4GKAA 5LXTA 4L9WA 4K6KA 4F6LA 1Q3TA 2D2XA 3I4CA 1ADFA 3O73A 3QFCA 3OQ1A 2ONKA 1R6TA 4ZHQF 1EINA 5TEVA 1UWCA 3RYFB 1ESCA 1BX0A 3UHAA 4CF5A 1E63A 3AYZB 3DMHA 3NKLA 3OC0A 3L0SA 1JVSA 4KMMA 3L0IB 4FOLA 5BVHA 4GPIB 2P6RA 4BY9E 4GKKB 1OT3A 2IUFA 3IJRA 3LUAA 3A6PC 4RQAA 3BMNB 1QUEA 1W19A 4M99A 1FFBA 3T5CA 3CIOA 1ZISA 2R84A 3TMKA 3BCRA 2ZITA 1H4VB 3LKZA 3CYFA 2PZKA 3NANA 4H6XA 1GGNA 4LRYA 2PA3A 4UHBA 4D3DA 2LPMA 4XEUA 1TADA 4EFNA 5FOSA 1TJ4A 3K6SA 1DGQA 3CGGA 1P4HA 2QL7A 4TQGA 3CNOA 1V41E 1QH0A 3L6EA 3NDRA 3NGMA 4UZSA 4R3UC 1FU8A 2QG9A 3PE3A 4FILA 2ZYHA 4WK0B 4BO0A 3FY4A 4RU1A 1TMOA 1CRZA 1C0IA 1QGUA 3K5HA 1VBKA 3AF5A 4JL5A 3TTVA 3BZUA 4NL4H 2DLCX 3G9XA 4W5WA 2F8MA 1ORIA 3R76A 2VHVA 4RMJA 4AS2A 4MHOA 4ZANA 4BRWA 2A9FA 2R8XA 3W9YA 3NEPX 1T34A 2YN0A 2P6PA 4Q1VA 1DC8A 2DKNA 1T8TA 3WBJA 4K6FA 4UEKA 2LBPA 4D41A 4HDNA 4XIFA 3ANNA 5F23A 1OKKD 1RBMA 1SCNE 2IGBA 2R1TB 4GMGA 3K0EA 3TW8A 3V55A 4D8WA 4EPVA 3BOSA 1OR8A 2HGSA 2Q07A 4CMGA 5C7YA 4C7JA 3SS9X 5LP1A 3GQVA 3L1HA 2A59A 5DM0A 4ZYWA 2RGDA 3PUYA 4CIVA 3B1WA 3ICPA 4AMUA 4CDGA 4Q37A 4H08A 3JWJA 1OLOA 1XQXA 4K6MA 1ZGHA 4ZKEA 5KUTA 2CFSA 3QLEA 3NIBA 4MQUA 1QG2A 1J6UA 5J4LA 3G7NA 4HLUC 3VC3A 4DCGA 2UZ4A 2PS0A 1YIDA 2F1KA 2QB5A 4X91A 3FPSA 4AECA 4FEYA 4XSVA 3B1KA 4Q3CA 4RSGA 3JYQA 3NBZC 2E5WA 4RIGA 2FFJA 3WYFA 4YMGA 3KETA 2HLNA 2PUTA 3ZDAA 4EY7A 1DWPA 1NN3A 3QJGA 3UUEA 3F6SA 1H6AA 5J2UB 1DOHA 2ZB2A 3AF4A 4KPFC 1SELA 4PCLA 1DCMA 2J5QA 3RW9A 1B7GO 1YDHA 2GERA 2GUWA 1KZ6A 1FK8A 1C5KA 3AK4A 4IFIA 1VC2A 1X7XB 2B30A 2GF2A 4EB6B 1HL3A 1A4UA 4B7UA 4YV1A 1SU6A 1CVLA 1A76A 3GGDA 4ZI7B 1L0BA 1U9JA 1CJUC 3TX6A 3VH1A 4IFEA 4EW3A 3COWA 2R96A 4LQDA 3TCXB 3ZK7A 7MHTA 4PICA 5BPFA 3B1JA 2HF2A 3URMA 4BGEA 5AW2A 1JJ7A 2W8ZA 4JUCA 1KI6B 4CLOA 5M5BA 1DCKA 4WZAA 5BSFA 4M89A 4GHWA 4KO1S 4R40A 1KQNA 3SZGA 4V03A 2WPNA 1NF8A 3OTWA 2HJ9A 2FLVA 1EQUA 3ZV3A 3B60A 1T6ZA 1E2PA 2Z30A 2WWWA 3EAGA 1E5LA 4KFRA 1RZ3A 4QG3A 3IL2A 4KFCA 4HVCA 4IUDS 1GPNA 2GD2A 3U6BA 1C1XB 3Q3CA 2HDOA 3W4JA 4L74A 3Q4GA 3NWOA 2XMBA 2Y6UA 4NCHA 2ZBUA 5FPKA 1LY1A 5KNDH 1XZPA 3WKEA 5DXAA 2B8WA 8ADHA 3GJXC 1KJYA 4GLLA 4Z4IA 1XXHB 4ZQFA 5KWEA 1PS9A 1SIWA 3WO0A 2DETA 4RIFA 1F3LA 2XD4A 3H5IA 3ZHXA 1Z18A 4UNRA 2BN4A 5L4LA 2AB0A 4G1FA 2Q6IA 4R1UA 1EE2A 1I9CA 1NV8A 1UC8A 5E8JA 1XMJA 1TTQB 1U65A 1W25A 3DBRA 4P3PA 4YGXB 3SHFA 4B76A 2HADA 1E9DA 3GK3A 1PF7E 1YDFA 1SC4A 2ROQA 3LBNA 1SCQA 2GHQA 1ULTA 4XUEA 4F9GA 4RTNA 2I7TA 1M34B 2Q5LA 2R1UA 3IX7A 4QE3A 1SPBS 4Q4AB 1QF6A 4LE1A 1ST2A 1D2NA 3V9PA 4YBRA 1MBZA 2AZTA 4G5SA 3HRKA 4RQTA 3RLIA 5JAUA 4R1NA 2GK7A 5KBYA 1T1RA 2LDXA 1LTKA 3K0HA 3SZUA 5A2GA 1C7ZA 1X7YA 2Z43A 4ITVA 5J2TB 1AKMA 1NXVA 1XRPA 4YXWA 5TVKA 3WYBA 2BONA 2Y1WA 5LZ8A 4AJJA 1YKFA 5ICMA 1WSBA 4R1TA 2XUGA 4L5AA 4DJ5X 1ZLXA 3JQGA 4X94A 1KFBB 2B5OA 4O4LF 4EHAA 1QHEA 2LNDA 1TU3A 1E79A 2DY1A 3N7UA 2VP3A 4A1FA 1EE1A 1Q6YA 3LUBA 4DARA 2H92A 2NSJA 5KKCA 1L7RA 2Q5OA 1B1AA 3PUWA 1K8RA 3IMFA 1HZZC 5MN6A 4BS9A 3TRDA 1ZC4A 3CMMA 3P2JA 2WSSA 3D4PA 3ILVA 1XZGA 5T6MA 3D02A 3OMXA 1UDWA 1FLAA 3AFHA 5TQ0B 1QBKC 2CZCA 1ZH6A 1KR2A 4D46A 1I51A 3E3AA 4N3BA 5EE3A 4YHBA 5EESA 2LR0A 4L08A 5DMHA 5FI3A 1TVEA 1WL8A 3HXMA 2VQ3A 3BE6A 2M6SA 1BGWA 3OQIA 2CXSA 3T4EA 3VBEA 3VHXB 5LQJA 1DHTA 4MV7A 1T35A 3MTJA 4JI0B 3V9AA 1H3NA 1II8A 2AOXA 1GL9B 4YHHB 3GLFA 1UBGA 3R6LA 2ZTLA 3OMWA 3KZKA 2ZSHA 4RAOA 3IHWA 1QFSA 1VE5A 1KPHA 4EB3A 4P34A 4QU9A 3L9WA 2BVNA 2XGJA 1XMOB 3AZPA 1UEXC 2WAYA 3DO5A 4Q3KA 4AJLA 4X44A 4FC7A 1EK6A 3H16A 3OQ6A 3HKDA 4KQ1A 3SYMA 2WV7A 4D6YA 5KREA 5FYQA 5E2BA 1UBCA 1E4EB 2DPHA 1XPJA 2IHZA 4BAUA 4H3VA 1PLLA 5IUJC 3GMSA 4E21A 2XNDD 4EBBA 4A0RA 4I55B 1HFEL 1OU0A 4CM7A 2W2XA 1EK5A 4D8UA 1IG3A 3K9LA 4WNIA 1GXSA 3QEBZ 1GGVA 4E46A 1P1IA 4Z4FA 3V7FA 4EFKA 1NAHA 4HY3A 1R4ZA 1VLZA 1WP9A 1LKZA 1UQRA 1YS1X 1SU7A 2ZROA 2A5DA 3BAZA 3KJQA 4H59A 2NU8A 2KWIA 4ZOEA 3DZFA 4BZXA 1TCAA 1SCUB 1Y1PA 2X4DA 5BV0A 4ZAYA 1R8YA 3PFCA 3VU0A 1C1HA 3RIMA 3CUWA 5C35A 3WRYA 4AMZA 1UT6A 1FUIA 4I9HA 4J3NA 3QLTA 4ZOQI 5JFTA 3HDVA 4W9NC 2YV1A 2IOHA 5K0JA 3H86A 1E7SA 2EP7A 4V0RA 1KYWA 1BQ4A 1XJ0A 3WWDA 4FNAA 1G20A 3TW6A 3TL6A 5G0SA 2H11A 4XD7D 3CX3A 1XZDA 4DJEC 4S0XA 2QVYX 1Q1GA 1CDDA 3ODGA 4YAJA 4ZRMA 5F1OA 3USES 3I61A 3FHOA 4ZMBA 1Z16A 5FLEX 2NV6A 1P9LA 4LSGA 3T52A 1IWPB 4UFPA 3QU4A 1YE5A 1KZ1A 5AR1A 3WX0A 1MV5A 3EZXA 2VHCA 2R7LA 5DXJA 5FO1A 4YAGA 5F4ZA 4BLRA 4FM9A 4QTXA 4AX4A 5BMVA 4YRIA 4DR2B 4GU5A 1OVGA 4XRRA 5KCMA 4BQNA 4HNGA 1QIJA 4RJ2A 3WFJA 3X1WA 2J5BA 4TV9A 4OHXA 2ZXUA 2F55A 2P8SA 3BTVA 1L1QA 2XZPA 1Z39A 2BHNA 5C4IA 1RQPA 3AV3A 1JXOA 3C1AA 4JVNA 4UQOA 1SCDA 4UBJA 4WRRA 3IIIA 5CW2A 2O8VA 3TZEA 8AT1A 4ZOLA 1VE6A 1R8JA 2CYBA 4KACA 5LYJB 3K70C 3QIVA 4TL9A 5ALYA 3ZS8A 4BX0A 4BKQA 4IMIB 4QYMA 1DUIA 5JAQA 3QXJA 3W5IA 1J99A 5IVIA 3WGVA 3PQ4A 3FYHA 5JCJD 3RFTA 3SNKA 3WGOA 3LOUA 4TRMA 5TB5A 4M0KA 5ENZA 4ZJZA 10MHA 4TTRA 4JR2A 1H22A 4DCOA 3MQ4A 3DG9A 3R0XA 1UBRS 1GVNB 5HIIA 3TLAA 3SYTA 1R8SA 1XZMA 2IXBA 4DZTA 1UANA 1E6MA 4B43A 3ZHSA 2V7UA 4PZZA 3H1TA 1FSSA 4Y9UA 4G2TA 5B53A 2BJWA 1GCOA 4MOWA 3W2IA 3B5IA 1I1QB 3KPYA 4MRAA 2DFLA 2P9FA 3HN6A 3GUUA 1U04A 3M5PA 1E0KA 1Z74A 4JOSA 3ZY5A 4EA7A 3SX4A 1NURA 1YZLA 2VNJA 1ECJA 4BQQA 5JVDB 2EHDA 1P4GA 4Y1RB 2LD4A 2Q3FA 4G0NA 3PQ8A 2X8WA 1TX4B 1QQTA 1E9RA 4OBEA 4CF6A 3E9NA 2IZ5A 5TS2A 3IA7A 2C98A 2G82A 1P2GA 2YMQA 3OZFA 3VX3A 1VI6A 3L7OA 3MPOA 4KO4S 2EWWA 2W83A 1YTLA 4PO8A 4HLNA 5AXCA 3CRW1 1BHQ1 2IS6A 4AKGA 2FN9A 1HT0A 5E3JA 2LZ0A 2V5UA 1RKUA 1DLJA 3AVXA 1B0ZA 4Y6RA 3A8TA 4XCVA 5DM60 4K7JA 1YA6A 4ID3A 1JHZA 3DW1X 2EG5A 3E7DA 4AI6A 1BXGB 5LQCA 1OXXK 3G79A 1S9HA 1PJRA 3HMQA 2Y92A 4EGSA 3QSGA 3HDHA 1VL5A 3MPUA 4LC9A 3RRBA 1ZM3A 4FN5A 1PN3A 1ZW6A 3D8RA 1C9MA 3K96A 1V26A 3H5VA 5JBIA 1MIOA 3C3CA 1CQJB 3RK4A 3DTYA 3ANYB 4NZZA 3K92A 2IXTA 4C3OB 3PDIA 3Q5EA 1R6AA 1V3UA 4KQIA 3ZH9B 3E9ZA 3UKJA 3MOIA 3EC7A 3QG5A 4MPRA 4RVSA 3AI1A 2CLKB 3HXPA 2FWPA 2JIBA 5AW9A 2BTQB 3KUKA 3SJCA 3UF0A 5AM2A 1TFRA 2J6HA 4MWOA 1JEJA 4BAZA 3HU3A 3O91A 3PHCA 5E6UB 2BBWA 1DNPA 3GRKA 3U4QA 5JAPA 5E2AA 4EG0A 1GAEO 1AG9A 1K88A 2J4CA 3KTOA 3BK1A 5BMVF 1EDOA 2X8JB 3CLTD 4F8EA 4NDZA 3OJ0A 2XMSA 3UUGA 2IYAA 2EJTA 5LU9A 3S5UA 2OECA 2OV2A 3TJMA 5JZBA 3LA6A 5B5SA 1LI5A 1XAIA 3LYAA 1FFEA 3O8BA 4Y0NA 4F4DA 1XN4A 5C80A 2JIQA 1P3Y1 2REOA 2WPDD 4L8FA 3TTTA 1LPBB 2BTOA 1ABFA 5B1DA 1IBSA 4FOPA 4BZZA 1B8UA 2AQKA 2Y66A 4U63A 3ML1A 2AHOA 1BRTA 1EJ6A 2IHYA 1DSSG 1FBNA 2DBQA 4L8YA 4BLUA 5J4HA 3F67A 4PO9A 1N3LA 2GZMA 3GX1A 2B69A 4CU2A 2AG8A 1KTIA 2KLBA 1LNSA 1EZZA 2FAXA 4P36A 2AGVA 2C78A 3OCVA 3O6VA 3LS2A 4I1OA 4KKXB 1IM2A 1JS1X 4N9WA 2R1ZA 4WKOA 2VPZA 4LDNA 5G1PA 3VYTB 1PR1A 2Z2ZA 4RVDA 2ZXEA 3VYSB 4U2EA 1N33B 2NTNA 1T8WA 3ESDA 1X9GA 4WN9A 3D7MA 3BFPA 3JATA 3T1NA 1NR7A 1T6BY 5FLXA 3II6X 4WDRA 3KDSE 4N49A 3IUBA 3N5CA 4JNKA 5DWQA 5CBPA 3STWA 1KO1A 1JJFA 1YOBA 1L4BA 2Z09A 3THYB 5AVOA 1H23A 1KJWA 4HGRA 1IQRA 5H68A 1DBPA 1ISIA 1EJBA 2EQ5A 2CW5A 2ZYTX 3EZYA 2VL7A 4IJ5A 4M0PA 4UNSA 4DTIA 1ITZA 3CINA 4ZVSA 5JMTA 5CYFA 1K06A 2BIFA 5CG1A 2FDRA 4Q47A 3T34A 1T43A 2QLMA 1DDGA 3S29A 4KBGA 1G8AA 1MPXA 1IVYA 5SYAA 2HTFA 1OHHD 1BMFD 1JV2B 1RQ2A 3BHJA 3E8XA 4MYRA 5DTEA 4ZAZA 3THWB 1G64A 2DQSA 3W9UA 2J09A 1GNSA 5A5EA 5EPUA 2XT0A 3LPMA 1W93A 3X1MA 2R2AA 4YQYA 5F1KA 3PQDA 3SMVA 4BMXA 2ZUCA 3DCNA 2NT3A 2Q3MA 3QNUA 1M2EA 2FX3A 3IXLA 4HBGA 2MMCA 2CJYA 1QQ6A 4X95A 3VYRB 5F73A 3JQFA 4I8DA 5FUXA 2H4ZA 2ZIXA 4XFDA 1II9A 3BAFA 1KYYA 4QRDA 2FK7A 4MEAA 1ZVKA 4W5QA 2XNHA 3TQOA 1FX0B 3TL3A 1RI1A 4KR6A 2WFLB 1T9HA 2BKXA 2J6IA 2UVQA 4TTJA 2QYOA 4H3HB 2VDLB 5B1SA 1N6RA 1DWUA 3DWEX 4A0SA 4POAA 2D7DA 2WRZA 1IB0A 4FFOA 1KH2A 3RWMB 1Z6YA 1MRSA 4JODA 4LYGA 1K5HA 3DEHA 3ETNA 3RVQA 5C8YA 4DG8A 4F9EA 3P52A 4MKRA 3OBBA 5UKDA 2W00A 2JHGA 1EWQA 4AY2A 4XR4A 4HEJA 4AN1A 3PA8A 5BN4A 4DV4B 3U60B 3DFIA 2DBRA 3DLAA 3K9WA 4Q3OA 2VPWA 1KF0A 2V7WA 1E1KA 2GEBA 3D9QX 4M1MA 3K2QA 2IIVA 2NV2B 2VJMA 3WK7A 2PUHA 1SN7A 1FNCA 2O9JA 3CUYA 4YH1A 1XFAA 2QTLA 4V0NA 4D56A 4UOZA 5GMOA 3B82A 4G5XA 4LF8B 3TVDA 2W6ZA 1B6SA 1YULA 2IV7A 1VXOA 3CEPB 4PV7A 1PEYA 4UVGA 4CZ2A 1EZ4A 4IIJA 4JSTA 1OW3B 1GILA 1Q7GA 4Q4JA 3RYCA 3GEHA 2JGAA 3QLVC 5ALRA 5F35A 3S2SA 2FN8A 2QW1A 1OYVA 1XQ9A 2FPGA 2W2LA 4RHUA 4HZIA 3KUDA 3VR5A 2YWHA 3GAAA 2QV0A 2GDJA 3H4TA 4LSZA 5DWVA 4Y2HA 5DEIA 2PQ0A 3FG9A 2RGXA 3W04A 2DQYA 5ICSA 1UUFA 3KR9A 5BWNA 2FUKA 3LVRE 2BEWA 5K0SA 3ABOB 5I7OA 3LXMA 1P2BA 2JD2A 3LQKA 3DEJA 4MRNA 3IEXA 4TV8F 3FGNA 5F1PA 4TTVA 2JAPA 1XRMA 2IOQA 1AS2A 4U2FA 4UM5A 4W1PA 2BFNA 2HPVA 5CB4A 3N2LA 4D79A 4U2CA 2JATA 5BRJA 3WGIA 4DDTA 2P0EA 3RVPA 1OWOA 3R9KA 1JFSA 1SQFA 2ETXA 3FGZA 3GV0A 1LTQA 4LYDA 1ZMOA 1JBEA 1W0JA 3BE5A 1XTVA 4KYTA 3RS7A 5BW8A 1XTPA 3QHPA 2HPHA 3KQQA 4JYMA 4TWRA 3CURA 2O0HA 1PYGA 2F8LA 4PGGA 2X2FA 1XJQA 2ZVDA 4UHKA 2G88A 2A1TR 2J9RA 2JHCA 3H6HA 4HNRA 4LKRA 4ZO8A 5L6LB 3EBPA 3I0ZA 1HQCA 4FFWA 1XZHA 2CV0A 1RHJA 2WILA 3OSUA 3SC2A 2C5LA 3MBKA 1NVMB 2H1RA 2EW2A 1UOPA 4RSMA 5EJ6A 4G56A 3UH0A 4B4VA 3CLRD 3NJ4A 3TL2A 2D06A 1EJ2A 1IG0A 2REQA 2DE0X 5J59A 3UA3A 2QM7A 1EK1A 3KSUA 4BQPA 4ZCTA 2XADA 4DT1A 1BDIA 3UB2A 1KXJA 2ZQ5A 1PR0A 4PE5B 3BERA 3PITA 5BSUA 5EJ7A 1EE9A 5FH9A 5I4CA 4FKZA 2JPDA 4NBLA 1M0SA 2GEKA 3NVMB 2AWOA 1C81A 3R9WA 2I62A 2IH5A 3IHLA 2WQ7A 1EUCA 1TO6A 4NTZA 4YQEA 3FLAA 2I0FA 4BNZA 5C8YF 2HMYB 5KKAA 4REOA 5CVTA 1O95C 3A37A 1W76A 5C81A 5AK4A 1VL1A 3BKXA 5ECGC 3WO1A 2VQ6A 1WJGA 1TT7A 4WA8A 3TUJC 5LP6F 1GYQA 4KUEA 4KPEC 1XEAA 1T0IA 2QU7A 4J7CA 1G5IA 1RMYA 4M21A 4E2YA 1X7ZB 4OLAA 4X1IB 2ZB3A 5JTTA 4LNUA 1H66A 4CM9D 3AEKB 3AM3A 1YD7A 4INJA 1EGQA 4CL8A 4K5QA 1SCAA 3HWRA 5BSHA 3AVPA 1QWOA 1YUNA 4WXMA 3CN9A 1N0WA 3A1EA 6REQA 1CUJA 4RPGA 2G1PA 1CUCA 3VTFA 2Q6OA 3RRYA 4HGQA 3PUVA 3R5FA 3B6MA 5K09A 1WCXA 5KQRA 3QXGA 1U2SA 4QDXA 4IIJF 2H1HA 3F73A 3ZN2A 2JFQA 1G5RA 1PL0A 3ISTA 3IT3A 4WKPA 2OT3B 3OMLA 5DNWA 5TPWB 1I4WA 5K99A 2QAGB 2XXBA 1J0XO 1M1ZA 2PUVA 2WU1A 2RG1A 1MX5A 4B73A 4XWKA 1D4ZA 4QXQA 1ISHA 4TXNA 2BWJA 3JZDA 1MO5A 2EFHB 3HYSA 3MAGA 4BKPA 2BMWA 2VHYA 4OXRA 2Q0HA 4L07A 4X41A 2O8BA 1ZN2A 2B1GA 1K98A 2B0CA 2O54A 3ZJ5A 2G77B 4H7DA 2WC1A 1S9DA 3GLIE 4OXXA 1VGRA 3GT3A 4RA6A 3PGXA 3RBZA 3OOWA 3C5EA 2D2IA 4ZARA 1E4YA 1TRKA 4L2IA 4G6ZA 3OSZA 3I6QA 5EYPA 1G0NA 1OROA 2HI0A 3WFZA 1E69A 1FDVA 2DWCA 4FFLA 5CB4F 1AQYA 2UZIR 2JEYA 1JF8A 5EWLB 4DMFA 3CVWA 1FE8A 3GBPA 4YUWA 1V0JA 4ZQGA 3AFMA 3S1SA 2A84A 4QTTB 1N5LA 5K2OA 3S68A 4BVEA 1DFGA 1E9EA 1PNOA 3DOEA 1X8XA 4HGOA 1NTRA 2PMDA 3GDFA 3UM9A 3OD1A 4MA4A 1O2DA 5IC5A 3ZV7A 3TFQA 4IQ8A 4JLWA 4PCAA 5EUQB 4F11A 3QUCA 3DHWC 2VN8A 3MB8A 4MV0A 5FBWB 1UJCA 1FFXB 3TJRA 4MGEA 3ZXIA 3BWDD 1J5XA 5CXUA 2X8LA 1M54A 1R9NA 2FE1A 2JK1A 5A7FA 3HL4A 2QD3A 1VRWA 3PPYA 4DUZB 4RXUA 1WUKS 1XMIA 1VSUA 2C5FA 5B58T 1V11B 1ZUNB 2HNBA 1IN6A 1ODJA 1U8FO 1D2AA 2MR5A 2GUGA 4BZWA 3W7BA 3P9SA 5LUAA 1QHHA 1AHNA 5TQ2B 3U1VA 3ZI0A 1ZKMA 2DULA 1YDGA 2J85A 1L4YA 3GQBB 2ZT8A 2QMQA 2QR2A 4RETA 3G82C 3MUNA 1A5BB 2FXVA 2QMEA 4LUCA 4CM8B 4PTYA 3RG8A 2G80A 1DAMA 4F4IA 3G8BA 5DBHX 4Z7QB 2PGJA 2P4UA 2FYTA 2V7QA 3IMKA 3CO5A 1A2BA 4YCLA 2A1UA 4EUKA 2BCEA 1CY8A 2ZU6A 1ZXLA 3DLIA 4K9LA 1SM4A 1LX7A 1YR8A 3FMOB 2VTDA 3IOBA 4HDSB 3QKIA 5F9FA 2FRXA 5JDIC 2B1JA 5KJ6A 4XIIA 4EO7A 2WTUA 1UZAA 2A0KA 4KK4A 4DW8A 3A05A 2OHHA 2HO5A 5LXTB 3OTHA 1GCIA 1GQRA 4N5MA 4JFRA 2EX4A 3RRNA 3WSWA 3DC2A 1PWXA 3OM0A 4B3JA 1HO3A 4GF5A 1D2GA 4NOLA 4N5HX 2R0QC 3N74A 1PLJA 2NNLD 4HXEB 3LTEA 5LQDA 5BVHB 1D6JA 1T2FA 2YVLA 1BQEA 1DAKA 3DJFA 1ZL2A 4AP9A 3DM9B 2DFKB 3PNSA 3TGWA 2QL6A 4RYDA 3ZDCA 2O2IA 3HJCA 3SKVA 1VIMA 4O2AF 4Q01A 1MNQA 4M0CA 4RS4A 3W3AD 3AKDA 3EUFA 4FDUA 4C6RA 5PGMA 2QENA 3HMKA 2CXXA 3OKCA 4WOCA 4RJKA 1XCMA 3K6SB 2VDNB 4HFNA 4GI7A 3PEVA 2P3QA 1NBEA 2BHRA 1GUDA 3WGYA 1O87A 5LBIA 3ZWMA 4CKCA 1QS0A 4Z51A 1IXRC 4NOKA 4IEFB 5DYGA 3AP3A 4U2BA 4PX9A 5IBCA 4PWYA