4M55A

Crystal structure of human udp-xylose synthase r236h substitution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
312
structure length
263
Chain Sequence
b'RKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGKHVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucuronic acid decarboxylase 1
molecule tags Lyase
source organism Homo sapiens
publication title Man o' war mutation in UDP-alpha-D-xylose synthase favors the abortive catalytic cycle and uncovers a latent potential for hexamer formation.
pubmed doi rcsb
total genus 92
structure length 263
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.35: UDP-glucuronate decarboxylase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m55A00
4N18A 2NVUA 5EL0A 3R1IA 5CEFA 1NASA 4YACA 5AXAA 4CV0A 3EZYA 1A27A 3GVHA 1HT0A 4NPCA 3V5NA 3IUPA 1GPJA 2DQ4A 1Q7CA 3UVEA 1YWGO 3RAJA 1E1KA 3GZNA 5B37A 1DHTA 4ALKA 3GAFA 2GN9A 1Z7BA 4XZ3A 1YOVA 2Q1WA 3FPLA 4E5KA 1SB8A 3PVZA 1DC4A 4U8GA 4O1MA 1E1MA 1Y6JA 3FNEA 4CM5A 1VI2A 3KM0A 3L4BC 1HF3A 2WDZA 4NBWA 1ISFA 1SB9A 1UZLA 1WZIA 2R6JA 3I5MA 4PCVA 3KEOA 3NRCA 3I9JA 2NQ8A 4WGGA 4WLNA 3HFSA 4D45A 5KIAA 3OJ0A 2VQ3A 2HK8A 2HLPA 3ST7A 1ONOA 2BF7A 4N5MA 1PGPA 1J4AA 1E6UA 4YQYA 4R4JA 4LCEA 3H6KA 4CM8B 1MV8A 4PLHA 4AJIA 4E13A 4B8WA 1I5RA 4J9UE 3RUFA 3W8DA 3QQPA 1DAPA 4PRLA 1CRWG 4IIVA 5C7IO 1W4ZA 3C85A 3BTOA 1FMCA 3I1JA 3TSCA 1B2LA 2DPGA 3MJ4A 5TX7A 4B7UA 4W4TA 1R4MA 3WICA 3OSUA 3PWKA 4E32A 2Y1FA 4B4VA 4E12A 2A94A 4RCVA 4MVJH 2JHGA 4P22A 3GDOA 3CEAA 3I4FA 2QG4A 4D46A 4R16A 1N9GB 1PX0A 2HMWA 3KBOA 3QWBA 4XQCA 4KUEA 2GN6A 4MVJP 1ENZA 2Y05A 1JVBA 2X1HA 1GV1A 2O3JA 2ZIZA 4WCDA 4J4BA 4BNNA 1LI4A 2BELA 4BNVA 3ONDA 1EUZA 1JN0A 2P68A 5CEJA 1LDGA 4TKLA 2DPHA 4JBGA 1LDMA 3JQDA 3P2OA 3OIFA 5THKA 2NTNA 2EKQA 5HS6A 3GY0A 1ZW1A 2Q49A 3TL2A 1P45A 3WSWA 3OJFA 2BKAA 3ON5A 4ND5A 4A26A 4PLVA 4EJMA 2EKPA 3JQAD 2W2KB 3QWIA 5CDUA 1HEUA 1TA4A 4NJOA 4BO9A 2OHXA 3VH4A 4LMRA 4R5HA 1O95A 3GZ4A 3RJ5A 4JJIA 5JNLA 1DO8A 1SZJG 5IDYA 3WOHA 1M6WA 1XWFA 3HDHA 4JGBA 4AJ2A 2BGMA 2P4QA 2A92A 4CPDA 2WD7A 2GCGA 1KC3A 3F9IA 2HU2A 4QSMA 2ZATA 1DIHA 1R66A 1PTJA 3KB6A 1KVRA 4BNYA 2QYTA 3QIVA 4DWVA 3BA1A 1EVYA 3MOGA 3WYCA 3D4NA 3DZJA 2Z1NA 3GLQA 5L7YA 2VWPA 1L7DA 1LSOA 3L9WA 1B14A 1IYZA 4IDBA 4CMGA 5L7WA 3RASA 1J5PA 4MKXA 1SC6A 2NU8A 4R9SA 5AXDA 4BNTA 1YL5A 5ICMA 4NR0A 2GLXA 4J1NA 4PGFA 4NBUA 3GDFA 1FDUA 2CFCA 2C5EA 3Q6IA 4KQXA 1I24A 4BIIA 2OO5A 4ZRNA 2JCYA 3F47A 2HDHA 4AJKA 3ZHBA 4F6CA 1LSSA 2WEKA 2G82A 3KYDA 3ORFA 3WGQA 2RH4A 4CMCA 3C3XA 1I2BA 2EV9A 2QRJA 3K5PA 1QYWA 1EE9A 4ROSA 3INGA 4EBFA 1U3WA 1XQ1A 3RC1A 5G0SA 2PZLA 3QV1A 1QR6A 2YW9A 1X13A 1B8UA 4PRKA 3IMFA 1B7GO 4R69A 2JAHA 1GFSA 1H6DA 2VT3A 1T4DA 3GUYA 3JQAA 4LGVA 4J9VA 3UH1A 1U7HA 4ESOA 1EQ2A 3ZWWA 3MJSA 2C2XA 4RDIA 3ZWXA 4B3JA 4E5MA 3DOOA 3NT4A 1A9YA 4IMRA 1BVRA 4K1LA 1C0IA 4Z3KA 1YL6A 2HCTA 3D3WB 2HMUA 4XR4A 1ISHA 2DUUA 4IPTA 1QXSA 1DC3A 1C1XB 3GEGA 3H3FA 4ZQEA 2UV8A 1B15A 4R68A 1XEAA 4I1IA 1WLYA 4NBTA 5ENDA 2IYOA 1ISMA 1NP3A 3GFGA 2DBZA 2P5UA 3TOXA 3NUGA 1UXHA 1OC4A 1VJTA 2IZ0A 3RQSA 4CUKA 5IZCA 1DLJA 3HUDA 2DAPA 1NWHA 4AVYA 3B6ZA 4XGIA 3WTBA 5HM8A 2EW8A 4E31A 1SO8A 3NT2A 5U1PA 3LLVA 3H7AA 1O8CA 4HY3A 1BWSA 1V3VA 1Y5MA 3W8FA 2Q4EA 3ZW8A 4RPGA 4YAKA 4YJFA 3VPSA 1ZK0A 4HFRA 4DC0A 3WGIA 1RKXA 1H9AA 1YBVA 2QRKA 4YVFA 2WTBA 2QYSA 4EI2A 3GVPA 1NVMB 1GV0A 3RSHA 3AI1A 3WS7A 4XJTA 4HFMA 5TQVA 2IRWA 1LLUA 2PV7A 3GN1A 2X23A 3M6IA 4FQ8A 4CLEA 3PLRA 4P8RA 3AJRA 4LSWA 4PZDA 1RWBA 5F1PA 1GZ4A 3ETGA 5CPBA 1HE3A 5JBIA 1UAYA 5LDHA 4WUVA 4CLOA 1UZNA 1NYTA 3BMCB 3O03A 1R6DA 4DTIA 4L73A 5KCZA 4O5OA 1D7OA 1DRVA 1PR9A 3EY4A 4BO6A 4PN3A 4HV4A 5I7SA 2PKQO 4FFRA 2OGUA 1YDEA 4MVJI 1MLDA 3GMSA 2J3JA 1ZK4A 3LVFO 3PFWO 1J6UA 5A06A 1QG6A 4E0BA 3TL3A 1ADFA 1QP8A 2D4AA 5F1KA 5L45A 5FI3A 2C54A 2FHSA 3ICPA 4CUZA 4DLLA 2H1SA 1C1XA 3JV7A 3H9QA 5GZ6A 2X8LA 5A3JA 4YAEA 3F1LA 3GVIA 1YQDA 1P1IA 1EUCA 3HNPA 1Q7GA 1HXHA 2CD9A 4LK3A 5DBFA 3I6IA 3PHIA 3WFJA 4Y67A 1HTBA 4B7XA 5JAZA 8LDHA 2P9GA 3MJCA 4ND1A 2ZCUA 5L53A 5JO9A 3BMOB 3FN4A 5TS3A 2QW8A 5TNXA 4D0RA 2HUNA 3AUTA 3CZMA 4RZHA 1C0PA 1PGNA 1A4IA 3MWEB 1JWAB 4YWJA 1RYDA 4I08A 1KS9A 1YGYA 2B36A 3OJEA 3K30A 5COBA 1DSSG 3L4BA 1JU9A 1VE9A 1VL8A 3NDJA 4U5QA 3IP3A 4TQGA 4BMSA 1L7EA 1LRJA 4OHUA 4WJZA 5EQDA 1W8DA 4BQRA 1HWYA 2A9FA 1NWCA 4H15A 1U4SA 3ADOA 1U28A 4YDRA 4ALIA 4NFSA 3E6AA 4RVSA 2JFFA 3WLFA 1PZEA 5G0VA 1XU7A 5JS6A 1XIVA 1ZIDA 1DLIA 1KETA 1FDTA 3DHEA 4NZ9A 4WLFA 2AEFA 2ZCVA 2V7PA 3UCFA 4FBGA 5T8KC 2W2LD 1T2FA 4CJXA 2WSBA 4Y6RA 1HDRA 2CDBA 1XYGA 1K6XA 3GC6A 3KV3O 4WCFC 4CMKA 4CMIB 1Z7EA 2O3QA 4YCAA 3DO5A 3RJ9A 4LSMA 1M66A 1B26A 2X0JA 4IDCA 1UXIA 2E37A 5I9LA 2VHYA 5G0UA 1V3TA 2DU8A 3NT5A 3BTVA 4QUKA 4YYZA 2G1UA 3FF4A 1UDAA 2FY8A 3DAPA 3H2ZA 1XG5A 3T7CA 3GEDA 1V8BA 2IDZA 3OJLA 3KUXA 2PA3A 3HHPA 1N2SA 2VYVA 3GG2A 4QXMA 2Q2WA 2NADA 2PY6A 4O63O 1MXHA 1ADBA 1IL0A 4HX5A 3O26A 1KEWA 1PJSA 1PJ3A 5K9ZA 4E33A 1I33A 4CLHA 3TZKA 5DN9A 3R3SA 5HS4A 3JYLA 2CY0A 1MP0A 5F5NA 1TT5A 1YKFA 4DRYA 1NPYA 2GNAA 4GGOA 1Y8RB 4E3ZA 3EW7A 4IJWA 3U49A 4BO5A 4WLEA 4MIYA 3VH3A 5EQFA 3GNQA 3OHSX 3PP8A 3KYBA 1KC1A 1NBOA 4QFDA 4XIYA 1WMAA 4QO8A 1HDYA 2FSSA 1IPFA 3WBFA 4J1QA 2ZTLA 4RPKA 3ASUA 5JSFA 4FFOA 5AXCA 1T1RA 2X6TA 1FJHA 3QVXA 4IDFA 4AL4A 2FR8A 3WGOA 4BO3A 1FDVA 4WK6A 3JQCA 3ZCXA 1R4MB 3OMLA 3P2YA 4WECA 3D0OA 4CV3A 2O2YA 1U4OA 1Y81A 1LDBA 2O3RA 5JDCC 1HE5A 1B8VA 4DPKA 2B37A 2J5KA 4YTEA 5JC8A 4RLSA 1ZO8A 1E7RA 1GL3A 3AU9A 3KHUA 1DXYA 3SVTA 4OXYA 1X14A 4DPLA 4WLVA 3ZGYA 2QHXA 4CR6A 2Q50A 3NV9A 1YS4A 4Q3EA 3C1OA 4GQAA 4A7PA 4YJGB 5JW6A 1LDNA 1WNTA 3PJEA 4J0EA 3UCEA 1UP6A 4O59O 1MXFA 2EG9A 4E2YA 2ZB3A 3WQQA 4E4YA 1MB4A 3Q9UA 4R1NA 1EQUA 1P1KA 1D1SA 3RFTA 4CM9A 3LYLA 2HK7A 2O7SA 1AE1A 1QV7A 1XA0A 4J2HA 3WWZA 3LDHA 1K5HA 3I9MA 3U9LA 2EP5A 4AJPA 2DUWA 2B4QA 2JAPA 3HWRA 3KYCB 4DBZA 1NTOA 2J3KA 3A9WA 3IC5A 1I36A 4XDZA 5T6BA 1UP7A 1LLDA 1GQ2A 3EAGA 4HNGA 4MJLA 4TKMA 4ALLA 1I3MA 3GMDA 4M86A 4FJ1A 4HKTA 4Y6PA 4IUYA 5BQFA 3WDSA 2XOXA 4XJSA 3RC2A 4YPOA 4PG6A 4FJ0A 4KDEA 2DFVA 3U3XA 5ER6A 2ZKLA 1AXEA 2WMDA 3PRJA 1DB3A 4PG8A 5L4LA 2GZ1A 1H94A 1GUFA 3JD4A 5A9RA 3JQ8B 2VOJA 3ANNA 3BIOA 4KWHA 3F1KA 3OP4A 1U3VA 3WJAA 4XRRA 4XQGA 2W98A 4K26A 2EW2A 3D4PA 1LX6A 5AOVA 5C7LO 5C37A 1ID1A 3IS3A 3MOIA 3PI7A 1LTHR 1ZK3A 1P1FA 2V6GA 1MC4A 1WPQA 1PJBA 1E3WA 2W90A 2YHIA 3CPSA 2DM6A 5MDHA 2I5PO 4CLOB 2VWGA 3RUDA 1DFIA 2R00C 4IJUA 4TRMA 1XHLA 4JP2A 1QORA 2HJSA 4J3FA 4OSOA 4BKQA 4BO7A 4MDHA 3BTUA 1P9LA 1OMOA 3FRJA 5EPOA 3GHYA 1XQ6A 4AG3A 3B20A 5KOIA 5CG2A 1M67A 2X86A 3GH3A 3GGGA 4OXNA 1CQJA 2X5KO 3CTMA 3DOCA 4MVJM 2A35A 2Z5LA 1SOVA 1TB4A 2R2GA 3IOYA 2HSDA 4NU5A 4RZIA 3ZNOA 3JQGA 3NTRA 4UUOA 3NEPX 1P33A 3JYPA 1EUDA 3OBBA 3DZHA 1X7GA 4J7XA 4CQLB 2ZQZA 1YVEI 2NUAA 2J8ZA 1NR1A 4GGPA 3COSA 2NU7A 2PD3A 3JQ7A 4RVUA 1QYCA 2F1KA 4YJFB 3VDRA 3L0DA 1BSVA 1LQTA 2PD6A 3Q3CA 3TZQA 2CUKA 2P9EA 3EMKA 5THQA 4Y6SA 2EIHA 2VRCA 1NVGA 1A7AA 1B3RA 1BXZA 2D2IA 3FSRA 3I6QA 4LVUA 3RVDA 4BV8A 3M1LA 2EKLA 4BQPA 5IF3A 1RJWA 5ILGA 5DCYA 1W0CA 3D64A 4ALJA 3ZV3A 4RQTA 3ZV4A 3V1YA 1HE4A 1WDKA 4JBHA 1DBVO 2AW5A 2HRBA 2PZMA 3JYOA 3MTJA 4GBJA 4PZCA 4B4UA 1VL0A 1EDOA 5FI5A 1EDZA 1PQUA 1YB5A 2LDXA 3K92A 4TZKA 4BNLA 2X0NA 4E30A 2HMTA 2JL1A 3ROKA 3KETA 3JQFC 4GMFA 4XQEA 3GDGA 1YE3A 4KTVE 3QVWA 4BHTA 3DHYA 1ZH8A 3BHJA 3QVTA 4BGVA 2JFGA 2E4AA 2A4KA 4GX0A 1BMDA 2TMDA 4PLFA 3VZPA 5JMPA 1MX3A 3TZCA 1EFKA 2Z1MA 3PYMA 4N5NA 1XSEA 3H5RA 4TVOA 3ZWBA 5COAA 3V8BA 1SEPA 2Y66A 5JE8A 3SEFA 3OQ6A 5IZ4A 1YH3A 3E9MA 5ICSA 4JLWA 4DQVA 1NQ5A 3FWNA 5C5IA 4JXKA 3VH2A 2OZPA 1TXGA 4GLOA 3JYNA 1JAXA 4W99A 4I8XA 4DIFA 3I3OA 4G65A 3DDNA 3DTTA 2PH5A 1IUKA 4Z0HO 4PLCA 2CVZA 3KEQA 3AY7A 4XWYA 3LT2A 2OBYA 4W7IA 4XYMA 1IOLA 1J49A 2D8AA 1B16A 1DIGA 4BNIA 4L4RA 4M8SA 2H63A 3O4RA 4R1SA 4UVEA 5DP2A 3I9NA 2B83A 2RIRA 3ZNQA 1H9BA 4IZIA 4P4NA 4PLWA 3I52A 3LLSA 4JJGA 3ZWOA 2FN7A 7MDHA 4BNWA 4QO7A 4DVJA 1ENPA 1F0YA 1GYQA 3PZRA 4GX5A 4L75A 3QE3A 1HDXA 3CSDA 3QJ5A 4RVFA 5JPIA 4IIUA 1U5AA 3QVSA 3RBXA 1PL6A 3Q11A 1JQBA 2GERA 1OC2A 1T2AA 2UAGA 5EINA 2W2KA 3ZWCA 4E5PA 5I9NA 2BFMA 2J5RA 4IZHA 3SBOA 3N58A 1X15A 4TRJA 5IN5A 3VPGA 4Q3BA 3DEYX 4CMBA 4AJ1A 2J3IA 1UDBA 2WYUA 3AUAA 3A1NA 1F8FA 3JQ6A 6LDHA 5T64A 2DKNA 3ITDA 2J6IA 3VZQA 4AJHA 1Y8QB 2RCYA 4J16A 1PL8A 1R15A 4BNJA 2GDZA 5I8ZA 3Q2IA 3E18A 4IQ8A 1SCUA 1Y9AA 3E5MA 4NJMA 2RHCA 4JNKA 4W9NA 3ZDFA 3ZN2A 4CM4B 1XKQA 3A28A 1U3TA 3FBGA 2X58A 4UUNA 2C2YA 4M87A 4XDYA 5TLSA 3U09A 5JY1A 2ZJ0A 1C14A 3WQSB 3JD2A 3F4LA 4BUCA 4DQUA 5B12A 3L6OO 1N9GA 3S2EA 2HJRA 3ONEA 4CM1A 1DDOA 5ER9A 1VPDA 3T4XA 3NGLA 1B0AA 3O8QA 4J43A 4U6SA 1IZ9A 2AEJA 3PHGA 3NTOA 4DMLA 3ZZNA 4WNCA 1E0DA 5LC1A 3WQRA 1PGOA 2BI7A 1YJ8A 5B1YA 4D0SA 3W1VA 1GTMA 2Z95A 5L4NA 2C5AA 2QZ9A 3FCOA 4ZD6A 2G0TA 5DBIA 1UUFA 3KLMX 4HXYA 4Y98A 5DBGA 5JDIA 4BS9A 5BNFA 4HFNA 2CVQA 2V65A 2VUTA 4INAA 4A73A 4DIOA 3FR8A 4DL9A 2GD1O 2Y68A 5IFLA 3GQVA 4J6FA 3SLGA 2FPGA 1O6ZA 4Y9DA 4YAIA 3AM4A 1V35A 2C7VA 3AFNA 4D41A 3KYCA 2EP7A 3K96A 1TT7A 2CNBA 2GO1A 2I76A 4Z9YA 3UN1A 1P0CA 1A5ZA 2B5WA 3G1UA 5A05A 5TC4A 1ML3A 5F3RA 1NPDA 3AWDA 5TRTA 3AOGA 3ROQA 2P5YA 4FB5A 1T1SA 2Y1EA 4E6PA 3IQDB 5A9SA 1HKUA 2R00A 4RF3A 4IXWA 4NBVA 3PJFA 3VTZA 1EVJA 4RORA 3L77A 3BMCA 3JQBC 3UAGA 1XU9A 1VJ0A 1NQTA 3G3EA 3U62A 5DOVA 2X9VA 1G6KA 3Q1LA 3VVCA 1X0VA 3UGKA 4Z9XA 1IHYA 4P38A 2Y0EA 5F21A 5GY7A 5JY6A 2YV2A 1LRLA 3ZNPA 2I66A 4JROA 2BD0A 3I9LA 4QTZA 3H4VA 3WGHA 2IZ1A 3UXYA 4QX6A 3SX2A 4JQCA 4TRNA 2Q45A 1WXDA 3OQ1A 2WM3A 3TRIA 4BGEA 3S2GA 3M2PA 4YRBA 3QWFA 5MGBA 4XGKA 1MG5A 3A06A 1I8TA 1T25A 1T4BA 4CMEC 3PWSA 3E9NA 1O0SA 3FBTA 4NK4A 2D1YA 5HA5A 5ILOA 4IGFA 3PJGA 4OXKA 4TZTA 4LCJA 3GGOA 1Y8QA 3VAZA 3GHHA 1ZVMA 5JCJD 1EVIA 3ZU3A 4UEKA 3R0IA 2AEMA 3E1KA 4MKRA 1P77A 1TVEA 1G0OA 2PKQP 4XGNA 3UKOA 4II3A 1NVTA 4J0FA 3W4IA 1JLLA 4RJTA 3BHMA 3AFMA 4H3VA 4O6VA 5I7VA 3TJRA 1R16A 4OQYA 4Z0PA 1F06A 3UCXA 1A72A 1KYQA 1ZXBA 5KTKA 2E48A 2DBRA 5AQ1A 4CL3A 5AYVA 1I10A 3C8MA 4X54A 1HDGO 3DMTC 4XQ9A 3PDJA 4ZN6A 3TF5A 1R4NB 1ZMTA 1CYDA 2PR2A 3ZWMA 2Y1OA 3DL2A 4ZQGA 3QLJA 4I5FA 3CH6A 5H82A 5A04A 1U8XX 3MWDB 4BGIA 1K2WA 2DVMA 3GNTA 4IQGA 4XX0A 4ZRMA 4QECA 1V0JA 5G0TA 1H6BA 4M54A 3ADPA 5K6AC 1WWKA 1GU7A 1EK5A 4CMIA 3I9KA 1M2WA 3ENKA 5JAQA 3HDJA 1U8FO 2OMEA 3M1AA 4TROA 2W2LA 2WJPA 3U4IA 4R3NA 2ZYAA 4YQZA 4RQUA 4UEJA 4Z0TA 5BNIA 2GN8A 1PQWA 2O4CA 3F3SA 2Q2QA 1Q2XA 4XEHA 1UR5A 4K6CA 4GX1A 2FOIA 1DFGA 2V6MA 2ET6A 5FYDA 5CG1A 5KVCA 2ZTVA 2H5LA 2NLOA 2Q3EA 3H65A 9LDTA 3OETA 3H9GA 2ZK7A 3X2EA 1P1RA 2PZKA 3OQBA 3GAZA 4GKBA 3C7DB 4FC6A 4KMSA 4GWGA 1LA2A 1PIWA 4QT0A 4B79A 4MKZA 3HB5X 1NQOA 3GR6A 1E77A 5FFFA 4P4LA 3TPCA 1ONPA 1JAYA 1MUUA 4WEQA 5L51A 1FDSA 3P7MA 2Y1GA 2GN4A 2XF8A 5T5QA 2VRCD 4CR8A 3FNGA 4MVJF 3D3EA 2YV3A 3GF4A 3BMOA 1OOEA 3JQFA 1G0NA 4D44A 5BSGA 1H0KA 4GPD1 1GCUA 4EYEA 1QRRA 2J5QA 3GA0A 4RVGA 1GY8A 5JC1A 2VHZA 3KVOA 4RO0A 5FEUA 1KEUA 4AJOA 5HTOA 4LRTB 5FF9A 3SXPA 3FI9A 1DFHA 2JJYA 3ASVA 4M49A 5HBRA 5A5FA 3GPDG 3ZU5A 3DC2A 4D43A 1W6UA 4I9NA 4JCOA 3BTSA 2Y0DA 1DJNA 1ZK2A 3DAGA 3AUUA 1O89A 3OIGA 5KJ6A 1XLTA 2VTEA 4LISA 5U4QA 4TRRA 1BXKA 4S1VA 2Y1CA 3JQ7B 3ZWVA 3JQ9A 4UEOA 5A4DA 4DXHA 4BOYA 3N74A 2JKVA 3ZU4A 1ONNA 1N7GA 1EK6A 1MC5A 2CVOA 2PWZA 3LF2A 4YT2A 4XYLA 1VC2A 6ADHA 1Z73A 3OH8A 2NV6A 1UDCA 4W7HA 4C7KA 1KVQA 4PZEA 2BGLA 3S8MA 2D59A 3T7EA 3QWAA 4CM8A 4F45A 4BO8A 1LBEA 5GZ3A 4B4OA 2C20A 1ZNQO 1BRMA 2X9NA 4RF2A 3W4KA 4XCVA 1CDOA 3V2UA 2GASA 3X2FA 2QQ5A 4GSKA 2VYND 3NDIA 3RCBA 2FPPA 4BNXA 5A9SB 5CFZA 4G81A 4RPJA 1N1EA 4BO0A 1LSUA 5I9MA 3L6DA 4NI5A 5ITWA 5F5LA 3PLNA 1FXSA 2GUGA 1TEHA 4CQMB 1NHWA 3OIDA 3PYXA 2YJZA 4E5NA 1U2DA 4PG5A 1HSOA 3NJ4A 1E7QA 4ILKA 1ULSA 4CLRA 5IAAA 3F5QA 1U9JA 1EVZA 1K6JA 3K8ZA 4BMVA 3W6UA 2I99A 2PLAA 4OL9A 4OO3A 4AJEA 2DBQA 5H81A 1LJ8A 1ZKMA 4E2WA 1C0LA 3AM3A 4UAGA 3TZ6A 2O23A 4IS3A 1ZJZA 2AXQA 2VZ9A 4JK3A 1KY4A 1ULUA 1DRUA 3OEWA 3TFQA 2NVUB 2RBEA 3MJEA 2X22A 3JQAB 1VKNA 1MFZA 3EGOA 2JD0A 4RL6A 2X4GA 2BFPA 4FCCA 4J91A 3ZWYA 3UOGA 4U0JA 5B4TA 3ZNNA 3TOZA 1EE2A 3BZUA 1U7TA 2NACA 4WCFA 2AQHA 3DBVO 3F5SA 3A14A 3FWZA 3FPCA 3WIDA 1PJCA 3IIEA 3DZFA 2B0JA 3AU8A 4FOSA 1HDOA 1PGQA 2OORA 1WDMA 1ZSYA 1NAIA 2O50A 3HG7A 4AICA 1IHXA 1PL7A 4FFLA 2XPCA 4WKGA 4EGFA 1ZXLA 2IE0A 4YT8A 3AY3A 2GR9A 2H9IA 2Q4BA 2E82A 4YJGA 3WR5A 3DR3A 2ZB8A 4XYGA 4AJ4A 4H7PA 3JQ9C 5BR7A 3L07A 3QP9A 3U5TA 5T57A 5G4LA 3ZU2A 4YRDA 2CDCA 3H5NA 1OZAA 5B4UA 2VHXA 1LEHA 1LU9A 4JBIA 1GQYA 2GZ2A 2NWQA 3B1JA 4RPLA 4MP8A 4EUHA 4YXFA 5ES3A 3K9QO 4B4WA 3JD3A 4UVDA 3OM9A 1DAOA 3D5QA 4L9RA 4PLYA 5G2OA 7ADHA 2HO5A 3DXFA 3IJRA 1BW9B 3NGXA 4GLLA 2HQ1A 4BKOA 2VOEA 1LC3A 4NHEA 4CLDA 2VT2A 1E7MA 3H9EO 3SC4A 4ZICA 2CSUA 4ND2A 1HE2A 2V6BA 5JMWA 1RM3A 3KSZO 1A71A 4CM7A 1JWBB 3IKVA 1UAGA 3EZLA 4LN1A 3PTZA 3Q2KA 5BNTA 4J7UA 4XRGA 1LDEA 1F12A 1Y9EA 4MOWA 4EJ6A 5JAIA 4FFNA 3MEQA 4A27A 4K9DA 3DFUA 4YJHB 1X1EA 1ZSNA 4UUMA 4BNKA 4EEZA 1TT5B 1HYEA 1NXQA 4IINA 2YQ4A 2D5AA 1SOWA 3LQFA 4GVXA 4XD2A 1GYRA 3R3JA 3PQDA 3RKUA 3DAFA 4HP8A 1H93A 3VKVA 4UVIA 4OQZA 3VPFA 4B7CA 1S7CA 2C82A 1RM4A 4YT5A 3DZBA 1HL3A 4ZA2A 1GQQA 1YJQA 3HDYA 1NR7A 4BMNA 4I5DA 5TF4A 4KOAA 2Q46A 3PIIA 4R54A 1R0SA 1JKIA 1PJLA 5C3MA 3BMQB 3G49A 3L4SO 3NAQA 4BB6A 2G5CA 4DUPA 1ZBQA 3RWBA 3CIFA 2AHRA 4RGBA 4WLOA 2BLLA 2EHDA 2B4RO 1P74A 3AOEC 3GVXA 3LK7A 4ZQFA 4B8ZA 5I7EA 3UHAA 3WBBA 4DMMA 1T24A 1I01A 1QLHA 4D7AA 5HRUA 2YV1A 3DOJA 4JIGA 2OFPA 3PK0A 1AHHA 4GSLA 3JCZA 3OF2A 4TWRA 5I8WA 4EUFA 5EJ2A 4Z6KA 1N8KA 1GAEO 2AQ8A 3I9OA 4OH1A 3WNQA 4LMPA 4U6QA 3EHEA 4JX8A 4R51A 5EERA 3OJOA 1JTVA 2GZ3A 5DF1A 1MGOA 2DTXA 3H5AA 3TFOA 2AA3A 2AQIA 1X1TA 4J4TA 5TSDA 3MJTA 3IJPA 1ZFNA 2DLDA 3PFFA 4MIEA 2DBVO 1E1NA 3EVNA 3JSAA 1S6YA 2HK9A 3DZIA 3FHLA 3RUAA 2WD7B 4WEOA 1PZGA 3FNFA 1IZ0A 2X9GA 4RVDA 1OFGA 3PXXA 3VH1A 3UICA 3IKTA 1ISIA 5U9CA 1E6WA 2O3UA 1AHIA 4MINA 4FN4A 2I6TA 2FP4A 4CM3A 3GZNB 5TT0A 3TNLA 3VPHA 1T2DA 3WFIA 1R4NA 4HNHA 1RM0A 3E8XA 2UVDA 4OSPA 4YR9A 1ZCJA 2G76A 2DT5A 1CJCA 4IS2A 3CUKA 4L76A 4YAGA 3ULKA 3RROA 2POQX 1T26A 4FW8A 1PSDA 1GZ3A 2D0IA 1T2EA 1K6IA 1K0UA 2I9PA 5KVSA 5CP8A 3LC1O 4EZBA 4I9UA 4U7WA 1I3NA 3HFGA 1YO6A 4CQLA 3OFSA 1BDMA 5LCXA 5I7FA 1JVSA 4GVLA 1M75A 4IJKA 3NYWA 4EW6A 4CODB 1YB4A 3TZHA 4ZQHA 2PFGA 2AE1A 1E3JA 1HZZA 5TGDA 1EFLA 2PKRA 2CF6A 4M1QA 4WE3A 3QHAA 1NFFA 2B5VA 3ZV5A 2ZTMA 1Y7TA 5DZSA 3HQ4O 1F14A 1VM6A 3IAHA 5L95A 4NBRA 4YEDA 2BFAA 3QWHA 1M6HA 1LLQA 5KJCA 1JDJA 2OP1A 1Q0QA 2BH9A 4NIMA 2CF5A 3LT0A 2OOSA 3MTGA 5ITVA 1BVUA 1ADGA 3PDUA 3LT1A 5IXSA 4BGUA 3GRPA 1X0XA 1UJMA 3ZHXA 1DHRA 2PZJA 2UDPA 1QSGA 4OOFA 1NHGA 3DBLB 5JLAA 4YT4A 4AJNA 3LZ6A 2JCVA 1Z74A 1CETA 3SJ7A 2BHLA 4Q3DA 3WTCA 3WIEA 4NMHA 2D3TA 2GGSA 2HKIA 4BVAA 1PS0A 1Q0HA 3ZHYA 1SMKA 2FSVA 4NU6A 3BMNA 4A2CA 4DYDA 3RKRA 1I0ZA 4Q3NA 1YBMA 5HWSA 3RC7A 3UUWA 1HDCA 3I83A 1NAHA 3G79A 3GK3A 1LLCA 4DLBA 4A0SA 2VNSA 4B3IA 1TI7A 1WP4A 3C1AA 2VWHA 3HSKA 4NNJA 4FSHA 1KVSA 2FMUA 3VKUA 1Z6ZA 2FZEA 4DLAA 1FDWA 4FS3A 5BSEA 1R0KA 4PLZA 2EGGA 4LW8A 4D3SA 1GEEA 4FGSA 5IXYA 4EUEA 3WJ7A 3WXBA 4HFJA 2IEDA 3CMCO 3JD1A 1MFPA 4WLUA 1IY8A 1RPNA 3VDQA 2ZYDA 2XXJA 1N7HA 3D3WA 5ENVA 3IDSA 5A9TA 1HZJA 1BHSA 2IODA 4PLTA 1AGNA 3SJUA 3GVCA 1KBZA 2VNAA 4RF5A 2QX7A 5KJEA 1C0KA 4MVJE 1HYGA 3OECA 2NVWA 1B3BA 1DPGA 1VRWA 4L4XA 4UVHA 1P1JA 3U4CA 2I65A 1C3VA 3AW9A 4ND4A 1AXGA 3EC7A 3WGYA 2YFQA 4NQZA 1SEVA 4AJJA 3A4VA 1V3UA 2BGKA 2WE7A 4II2A 5DCWA 3NTQA 5ADHA 1RYEA 2PK3A 5JDCA 1NQAO 3KSDO 3KYDB 3O38A 3HADA 2QIOA 1QKIA 1O9BA 1EBFA 1XR3A 3E82A 2I3GA 2VCYA 3EUWA 1ZZEA 4OYRA 4CLXA 3U0BA 1E6EA 2BI8A 3OA2A 3TDKA 4LVCA 4XB2A 1E3LA 4F6LA 5KNLA 3B70A 1Y5RA 4WASA 4MVJD 3FTPA 3ZW9A 2PH3A 3OICA 4YJDA 3S55A 3T4EA 1HETA 2GYYA 4NFHA 4FPXA 2B69A 4OM8A 3PZBA 4UREA 1ENOA 1GZ6A 2VWQA 3RD5A 5H83A 3KO8A 4B3HA 4NJMB 4CLRB 4CM4A 3G0OA 4IDAA 4MP6A 2V6FA 1Y8RA 3ETEA 2WD8A 2C7GA 1YQGA 4CQMA 1HLDA 1ADCA 1J0XO 2NQTA 1Z82A 4J49A 3LT4A 4IDDA 3DHNA 2PGJA 4J2OA 3WB9A 4JN6B 2OP0A 4E2XA 1GDHA 4L8VA 5BSFA 1PJTA 2ZQYA 5KJFA 4PVDA 2VYVD 1DIAA 4FGWA 4FJ2A 2AG5A 4RF4A 1O94A 2DTEA 3E5RA 1LUAA 4BO1A 4PG7A 5DDIP 1ISGA 5CDTA 2Y1DA 2FR0A 3BMNB 1WW8A 3GN2A 1CF2O 5L4SA 1BTOA 1SNYA 2GSDA 4KWIA 2QZZA 2P91A 5JYEA 4OMUA 3PWZA 1QLJA 3WYBA 3AY6A 3GNSA 3H9JA 2YDXA 3TWOA 3FD8A 3DBRB 4QEDA 3Q9NA 4TVBA 1H2HA 1ENYA 4NK5A 5IDWA 3L6EA 4FIZA 3STHA 2O3TA 3CINA 5CDSA 4D3DA 5DP1A 4YRAA 3FTNA 2JD1A 4BO4A 2YHUA 4FC7A 3HN7A 1EEHA 1U5CA 3KSUA 1U2GA 4CM6A 3K2EA 4UUPA 3ANLA 5EESA 1M76A 1K3TA 3ZWNA 3WNVA 4PG4A 4BKPA 4G5HA 3D1LA 5A02A 2FR1A 1A4UA 2VHWA 3VHRA 2X5JO 2IEBA 2OBNA 4J4HA 4Q3AA 1T2CA 1X7DA 1H6CA 3RC9A 1WDLA 5DCUA 1EMDA 4CQMD 2PTGA 4Z3DA 1VKOA 5KVVA 1P31A 4ZHSA 1ORRA 5KKCA 2JFHA 4Q9NA 2C07A 2E6UX 3AK4A 3RU9A 4CL8A 1YQXA 4M55A 1ZMOA 2QRLA 1YB1A 2H6EA 4MIOA 2ZYGA 1BDBA 2JD2A 5C7OO 3K2BA 5JXWA 5DOZA 2EXXA 3AUSA 3KRTA 1E1LA 4URFA 5AXBA 4P4GA 2SCUA 2HRZA 4YA6A 1ZEMA 2Q2VA 4GMGA 4MVJG 1KY5A 1HSZA 1QV6A 3RBZA 1GUYA 1LRKA 4XIJA 4IQ0A 3VTFA 3KLPX 2EWMA 3FNHA 3K73O 4R1TA 3N7UA 5TIIA 1CEQA 2Q1UA 1YDWA 2AE2A 2I3AA 1D8AA 2VTDA 4CMJA 4EDFA 5TJ9A 2Q99A 3V2GA 1LDYA 2GF2A 4J1SA 3IP1A 3C1TA 1LNQA 1HYHA 1LQUA 2ZTUA 2B35A 1YOVB 1IB6A 1E7WA 1PJ2A 2AG8A 4ND3A 1EZ4A 1HLPA 1UH5A 1VL6A 1BXGA 2O3SA 3JD0A 4GX2A 4OIMA 3DQPA 3W6ZA 3EYWA 4HWKA 2IYPA 4RV9A 4A5OA 3ZI0A 4E5YA 3RUIA 3JTMA 3KTDA 2UYYA 3DONA 5BSHA 1ZSVA 1QYXA 4PLGA 3ZV6A 1Q7BA 5BT9A 3PJDA 1I32A 2BRUA 3QRWA 1ZUD1 2P9CA 3INRA 4EITA 2VRBA 1LC0A 2GPTA 2RH8A 1GEGA 3WGGA 3P19A 5A3VA 1KVTA 3DBRA 3E03A 3BAZA 3JQGB 5A03A 2WYVA 3HN2A 4F3YA 4TMFA 1KVUA 1O5IA 4JJFA 3SLKA 3LC7O 3KZVA 2Q1SA 3K31A 4Q3CA 3VPXA 3I4CA 5IZCC 3CE6A 5K0ZA 3I23A 4GL4A 2ZB7A 1NFQA 3HB4X 3MZ0A 3DFZA 4DPMA 1E5LA 1YRLA 3G1TA 5CEEA 2X0IA 4I9HA 3DMTA 4I5GA 4IDEA 1CERA 1G1AA 2VHVA 4L4SA 4HBGA 4DIBA 3O9ZA 4IJVA 2JCXA 4NDNE 1YBAA 4S3MA 2EJVA 2VZ8A 3HZZA 1JKFA 4DYVA 5CDYA 1UXGA 2WWRA 4ITUA 3JQ8A 1E3SA 1ISJA 4MP3A 4N5LA 4W9NC 1R37A 1W73A 1MG0A 4BNMA 3LC2O 2X0RA 4ZJUA 1H6AA 3QW2A 3EDMA 2IXAA 5DULA 3H3JA 3E48A 4W6ZA 4L0QA 4ONEA 5FWNA 4IMPA 1DEHA 3ETDA 3QVOA 4KTTE 5EN4A 3BXXA 5CAEA 1P1HA 2DFDA 3JYQA 3VOSA 1GD1O 1HDZA 2XAAA 2CMDA 4IBOA 2VUUA 1JKJA 2YUTA 4BNGA 4Q39A 4XYEA 1D4FA 1N1GA 1BW9A 4AFNA 3QA9A 5GMOA 4IY1A 4BNHA 3D5TA 3JQBA 1Q1NA 2XXBA 2X7HA 3PIDA 4O0LA 2LDBA 4YB8A 2Y99A 4I5EA 4GAEA 3C24A 3B1FA 4UVGA 1I30A 4ZGWA 3W8EA 4BNUA 3WWYA 2PD4A 1CWUA 1NX6A 2HAEA 1F8GA 3LU1A 4CR7A 3QY9A 1WAMA 1U1IA 4ID9A 3NJ8A 1PS8A 2NU6A 3WG9A 4BL5A 3H8VA 4BO2A 4Y8VA 3DWFA 2OXIA 1UZMA 4CMAA 1P3DA 1QYDA 4HUJA 4N54A 1NM5A 5L7TA 5JFOA 1VSUA 2O2SA 1H5QA 4OKIA 1SBYA 3H9UA 1CQIA 1DC6A 1E5QA 2CZCA 1PJ4A 3C7CB 3PHJA 5L40A 2YY7A 4WOKA 1WVGA 4U0KA 5LDGA 3RFXA 1UP4A 4J90A 1CIVA 3ZWPA 3ABIA 1KEVA 4NG5A 2YFHA 1Z75A 4WCFB 1GCOA 2NSDA 3KXDA 3VZSA 3GUCA 2ZJ1A 4GWKA 3S2FA 4RDHA 4YAJA 3PHLA 4BKRA 5G4KB 1PWXA 2D5CA 1VLLA 1A9ZA 5CPFA 4XA8A 3DMYA 1WMBA 3C7AA 4OOEA 2FWMX 3ICCA 4JP3A 4W82A 5JCXA 5CHEA 4GI2A 4XYBA 1QMGA 4R5MA 3WLEA 1DIRA 4PVCA 1C1DA 4F46A 2EF1A 4E21A 2BMAA 3PGXA 1R12A 4PIVA 2UUOA 3S2IA 2Y93A 4DGSA 3WMWA 4H16A 2AQKA 2O7QA 3UF0A 3AM5A 3ZWAA 3CMMA 5JO0A 2GRAA 4CMHA 3VC7A 1ZEJA 2IZZA 4HADA 2YQ5A 2TMGA 4CM9D 1JA9A 3DBLA 3O8QB 3RU7A 3RUCA 3E9QA 1E92A 1PS9A 1V9LA 1IE3A 4WPGA 3CKYA 4DA9A 3F46A 2B4TO 4RLHA 2WYWA 1VJ1A 5GZ1A 2NNLD 5IJZA 2PNFA 1BGVA 1E7SA 2NU9A 3F6YA 3M2TA 3ONFA 3RBVA 4A10A 1Z45A 5TT1A 1E3EA 4XB1A 3GEMA 2G17A 3VVBA 1DC5A 4K6FA 1RM5A 1PR3A 2FPIA 4QQRA 5G0WA 4C7JA 2CDAA 4GKVA 4KUHA 1BG6A 4RVHA 3KOUA 4IDGA 2X5OA 3L9XA 4FFPA 1GUZA 3AI2A 2BFOA 1E7YA 4OAQA 4D42A 4K28A 3G17A 9LDBA 4QFCA 1GR0A 4YBZA 3GT0A 3V1TC 3ROPA 1PGJA 3HE3A 4FD3A 4TSKA 2W8ZA 4ZU3A 1P0FA 3LF1A 4ALNA 4PLPA 3DZKA 1PZHA 4OGWA 1AN9A 2OUIA 2EEZA 5KJ1A 4IGEA 5A5EA 1KOLA 3QSGA 5L9AA 3ANMA 1SAYA 1IULA 4A03A 3RI3A 3GOHA 2IXBA 3V2HA 2RAFA 3GGPA 4CV2A 3RIHA 3F4BA 1I2ZA 3NX4A 2C59A 1XCBA 4FOOA 1I2CA 5T8KA 1BXGB 3RUHA 3SC6A 1KERA 4BKUA 4BV9A 3OEYA 4CMEA 1PJQA 4BNFA 4AJLA 4R1UA 3MCVA 3AI3A 3NKLA 3AOEA 4WNIA 3V1UA 3UFXA 1KEPA 3GRKA 4DC1A 5KWEA 1C1DB 1ZK1A 1NPTO 1DJQA 2F00A 3D7LA 1GPDG 5EMHA 5IDQA 2C29D 2HMVA 3RFVA 1NFRA 4OKNA 1XGKA 3TQHA 2VZ0A 4ALMA 3GG9A 5TJHA 1H2BA 4IM7A 2I67A 4R41A 3WMXA 4EEXA 1OI7A 2NTVA 5G4KA 5L3ZA 1KIFA 3VZRA 2EGHA 3GPIA 3U4DA 3B1KA 1UXKA 5T67A 4DREA 5CDGA 1K89A 2AMFA 4R01A 1U3UA 1XELA 1FF9A 4D3FA 4ZVVA 2O48X 3D4OA 4R3WA 2YDYA 3ITKA 4XR9A 1DOHA 5DT9A 1R0LA 2P4HX 2DTDA 3INTA 3RUEA 3BMQA 4DQXA 5JAMA 4MPDA 1YXMA 3IUSA 2NTJA 3CXRA 1I3KA 4EJ0A 3CZRA 4Z9FA 3ROMA 1YL7A 1I3LA 1A7KA 5KKAA 4C4OA 2Y67A 2NM0A 1AUPA 3WYEA 3BYZA 2WE8A 3R6DA 3MJVA 5IG2A 4NFYA 1D3AA 2JHFA 3PHHA 4LRSB 1QYVA 1B8PA 2EJWA 5COQA 3PGJA 4OJNA 4N7RA 1VSVA 3PPIA 4E2ZA 1SPXA 2YZ7A 3PYLA 3NDRA 3LSYA 2ILTA 1LSJA 3K6JA 3PQEA 2Y0CA 4YJHA 3WX0A 3ENNA 1IPEA 4J1TA 4M89A 4L74A 1V6AA 3W4JA 3WSVA 3UW3A 1UXJA 4IXTA 4CV1A 4FR5A 1D1TA 3DBHB 2YYYA 3WGTA 5IDXA 3U4HA 1NNUA 5B4VA 2RHRA 4BB5A 1E3IA 3IL2A 4KQWA 3ZH2A 4RPHA 1DRWA 1GADO 3DBHA 1YONA 1L1FA 5DNAA 1PWZA 5AVOA 1OBFO 3FR7A 3JQEA 5IN4A 1TLTA 4D79A 4ZQBA 4FFMA 2VUSA 4MO2A 1MA0A 5F1OA 5K6AA 2NVBA 3HDQA 1OAAA 3PQFA 1ARZA 5JCJA 4GH5A 1N92A 4WOJA 1DIBA 1ZJYA 2E49A 2ZB4A 1PQPA 3ZHZA 1PU2A 5A1TA 1GYPA 2C0CA 2FZWA 4BNZA 1WZEA 3Q0EA 3BHIA 5KVQA 4MVJA 4PFJA 4KP7A 4KZPA 3H2SA 2HMSA 3HJAA 4UULA 2YHIB 1E3WB 2O4UX 2PGLA 2Q1TA 3EK2A 1LXCA 2VYNA 3WGZA 4DBVO 1X7HA 2OL4A 3DB2A 5EIOA 1N5DA 2EERA 4XKJA 1HRDA 1PEDA 2UUPA 1Q0LA 3OA0A 1JW9B 3EVTA 8ADHA 2DC1A 3DZGA 2VN8A 1PZFA 3DTYA 3S1LA 4KUGA 1F17A 4NH4A 4R9RA 4CUJA 1FK8A 5J23A 4FDAA 2FRDA 2PGDA 1EBUA 1XDWA 3PEFA 1P44A 2P2SA 2J3HA 1Y1PA 4G2NA 4J7CA 5JDIC 2W4QA 3TN7A 3GFBA 5JYDA 4KDFA 3P5SA
chains in the Genus database with same CATH superfamily
3GLIB 2NVUA 3DJYA 4BMCA 3BB4A 1ZPDA 4H4DA 1XLUA 1QDEA 4HWRA 4G8DA 5K03A 3R1IA 5I4CA 1RWKA 3UC5A 3HBNA 3KSAC 3SCZA 1A8QA 3CUUA 4MS1B 2OBBA 2IS1A 1BCRA 1QRAA 1A8UA 4NPCA 1MDFA 4XPZA 3V00A 1FSGA 5LP6B 3ZVNA 1IXSB 1ZQ1A 5EYPA 3WMFA 1E1KA 5B37A 3VISA 2QXYA 1SKYE 4LJLA 5JR3A 4KQ9A 2MTBA 4BYGA 5DNDA 1T8UA 2XE7A 4EMTA 3D6NB 3W9SA 5HKKA 1SB8A 1UOPA 2OHHA 2CL5A 1I9CA 2FJ0A 3PVZA 2QPTA 1DC4A 1I7NA 4TQAA 1FYFA 2V7VA 5JCOA 4CM5A 3SDZA 1VI2A 2GCIA 3EH2A 5K8VA 3HO8A 1IB0A 1EBBA 1ZOIA 3B36A 1UZLA 3UK2A 3W34A 3WK8A 1XAHA 3K32A 4D9EA 4EECA 5J1SB 1W4RA 3NRCA 4B5LA 1L7AA 3AWIA 2X4IA 4PNZA 2NQ8A 1IIRA 2NT3A 3FTQA 4IX9A 4XLLA 4F93B 4ZTUB 1XP5A 2ZJYA 2HLPA 5LXTA 3BCSA 3D9QX 3GGSA 4X3PA 2F2TA 1KFEB 1J4AA 1QTNA 2QTVB 4YQYA 2QLTA 2P1RA 3IT2A 2AI2A 2NZJA 1W88A 2RGEA 1UBRS 2XTNA 3RRYA 1LBHA 4PGAA 4Q9AA 4B8WA 3O3OB 1QKKA 2F48A 1I5RA 3CF4G 3HBLA 3QUAA 4DV6B 2GBPA 2TSYB 3NU1A 4RE6A 2MU1A 1CRWG 1OWMA 5J3JA 3C85A 2RD2A 5JAPA 1FMCA 2B1GA 3I1JA 3WYDA 4F3CA 3MJ4A 3EB9A 3QEAZ 2CZQA 1BIFA 3B6IA 3VDXA 4E32A 2FA9A 3NM4A 4MA0A 1JQEA 2W4IA 1B73A 4RCVA 3VNUA 4MVJH 2BBOA 3CSSA 5BSRA 1IMJA 2JHGA 2GPWA 3OLXA 4KQFA 5D85A 3BRCA 1MABB 3FVTA 3QK7A 3VHXB 2EDAA 1U1CA 3OQPA 1N9GB 4R16A 5FOQA 3HXPA 3KBOA 3UJ9A 2R4UA 2H8GA 5EEGA 4PO3X 4ZJYA 5B30A 1R5BA 2GN6A 3BGIA 1OH7A 3KAQA 3U4GA 4P4UA 2GKGA 4I14A 3TAHA 1N2IA 1QUEA 2QN1A 1UQUA 2FPRA 4BZQA 4ZTZB 2BELA 4HPXB 3BIFA 2QQEA 4NHOA 4XWTA 4Q01A 4YMUA 1N3IA 5LWQA 1AA6A 1W4BA 4M98A 5KTRA 2C7PA 2PXAA 5CEJA 4XI9A 4UTPA 2JEZA 3EC2A 2YS7A 3WL4A 1THGA 2O0KA 2XZDA 3BJMA 2A5FA 2IUTA 1D0SA 4TKLA 5AT1A 2R0QC 3ZGOA 2PUAA 4KR2A 1F9AA 3JQDA 3P2OA 2XOKA 5AH0A 5THKA 3VYRB 3GBVA 5HS6A 5AW8A 2JBAA 5AVKA 4Z9AA 3K1YA 3ND8A 4G86A 3TL2A 3C3PA 3JZDA 1P45A 4Y9RA 1ECGA 2C96A 4REOA 2C2BA 3MRSA 4TWZA 3ON5A 3FI0A 4MJXA 4EJMA 2ZBQA 2QJFA 2OCKA 3D6VA 4ML3A 2GJ9A 4JBNA 2CN1A 5CDUA 1IG0A 1TA4A 4HDRA 4UU1A 1RRMA 4D98A 1P2FA 2HIHA 1UEIA 4BO9A 1G5FA 3H8WA 2ZT5A 2AUNA 3N0VA 3UOAB 5EMKA 4LMRA 4R5HA 1A96A 3VH4A 4GIBA 1EAMA 2AI3A 3TIGA 1A4XA 3GZ4A 6GPBA 5AM4A 5EZ5A 4RGYA 4KCGA 2VP9A 4HNTA 1GPH1 3OZIA 2ZUBA 1LBIA 4PHGA 1AG9A 1QBGA 5FWDA 5IDYA 1ZMBA 2ZULA 3K0CA 3WOHA 2YIJA 1XWFA 2COUA 2H1VA 4L5CA 2CYCA 4LTNA 4KYUA 4ZCPA 5A5DA 4PX3A 1G4UR 5CW1A 2O6HA 3P32A 4WKPA 3LY7A 5FKJA 4CPDA 2P5TB 1WW3A 1FNCA 1KC3A 1F3OA 3FA2A 1VXRA 2CLFB 4QSMA 1QHIA 4TVKA 3S3TA 3WQBA 3I73A 3LECA 1KVRA 4BNYA 5CDFE 4DMUB 2PMBA 1ZOLA 2B0CA 2IEIA 3LXXA 3QIVA 4IJMA 4AROA 3MOGA 5EE1A 1A04A 4WMLA 3V7FA 1Y3BE 2VWPA 4HN9A 3BKXA 1LSOA 4EY4A 2ZSFA 3NYQA 4KXNA 5L7WA 4R9SA 1X74A 5ICMA 1YL5A 3KVYA 4O1HA 2ZM6B 1JXQA 4Y2HA 2VQFB 5TQ0B 2C3YA 1MAHA 4L4ZA 4NBUA 4ED9A 3WLTA 1WEHA 1CY2A 1GFWA 1W94A 1GL9B 4RY0A 5LLSA 2Z4TA 1V1RB 1I24A 1JKXA 2IPNA 2OO5A 2JASA 4DIUA 3F47A 2WYHA 3PGKA 2IZ5A 4MSUA 4HJXA 4ZRDA 5F12A 1PUXA 4WCVA 1IUPA 1SA0B 1P9RA 4S24A 3WGQA 2RH4A 4WN9B 4CU5A 1W36D 5HRCA 3C3XA 2QEQA 2IK8A 3K5PA 1JIKA 6AT1A 4LRQA 1MPTA 1U3WA 1QHGA 1XQ1A 4KODA 3KL4A 2C5GA 2E89A 1XPJA 1SVSA 2YVUA 3QV1A 4GEGA 2YW9A 3UFBA 2CLDX 1GO2A 1XQXA 2F1RA 3LE8A 2GK4A 2PIDA 5FCDA 4RENA 3LGXA 621PA 2DMRA 2VK4A 1MF7A 1T4DA 3GUYA 4ESOA 4J9VA 3LCMA 1U7HA 3A26A 4JAVC 4KQMA 1EQ2A 4EYSA 5JCZA 3U7IA 5E6RB 5J5CA 4YP5A 3MJSA 3UJ6A 1CUUA 2WKRA 3MD0A 4X60A 5DH9A 3JY6A 2CBZA 4N0PA 3VNSA 3ZWXA 4ERXA 5HUJA 3CH4B 2ZB2A 3LLCA 3FYUC 3IUYA 3AEUB 5A5VA 2JJMA 2Y77A 3TX6A 2UKDA 2HMUA 4HMQA 4G5SA 4JJ6A 1R0XA 3ENQA 5FBVB 1EYZA 3H3FA 4KBYA 4MGIR 4RTJA 4R68A 1CUZA 4NBTA 4RIFA 1KYIA 3LCVB 5KWIA 2OCGA 2C8LA 2NPOA 2VF8A 3GFGA 2DBZA 4U9HS 3ESQA 1FMJA 5BR8B 2AFVA 3EXHA 1OC4A 2XQJA 3RQSA 1DTEA 2BKVA 2P2YA 3IV9A 1ZC4A 3RT1A 3ANYB 2RDMA 4O4JA 1BXRA 2O2GA 1WMFA 4XGIA 3WTBA 1NMZA 5U1PA 1DKUA 2V7XA 1BDHA 3LLVA 3F71A 3H7AA 3DBOB 1O8CA 3R0QA 4IFEA 5G53C 1BWSA 1Y5MA 3W8FA 1L5GB 4YAKA 4N5DA 3OHPA 1E1CA 1QR2A 2DYKA 4HFRA 3WGIA 1U0GA 1AGRA 2QRKA 1L7VC 2WTBA 2QYSA 3L79A 4MCHA 1YDMA 4HMPA 3TIIA 5T4FA 1CZOA 1FS5A 1QYRA 2OZLA 3S28A 5BMOA 3ESAA 1NVMB 3PE4A 1J97A 3RSHA 4TUYB 4MCJA 5TQVA 1LLUA 3GN1A 1JKMA 1C7JA 2YWCA 4YAUA 3A31A 4FQ8A 4OQDA 4CLEA 2YIVX 3NPMA 5KQGA 4LSWA 3LRPA 1NIJA 5F1PA 3CF4A 4FT4A 3G1WA 2V54A 4I8IA 4V39A 1PEYA 5LZ8A 1EM8A 3ETGA 3T1TA 2XCTB 1VHWA 1HE3A 2H54A 2J07A 1VGQA 2IQ5A 1Z2OX 3UMSA 1UKBA 1R5OA 2GJ4A 1WVMA 3T1QA 3BMCB 4DRXB 4CLOA 1RP1A 3CZPA 1VB3A 4Q5IA 2EP8A 1R6DA 2YZMA 4D3ZA 4L73A 1UJNA 3DEFA 4O5OA 3C6KA 1OV4A 3EY4A 4IJ5A 1GCAA 2OXRA 1G7TA 2X40A 4DEXA 4PN3A 2PFSA 4PINA 2GVDC 4HL6A 2EAUA 2CUNA 3OZGA 3NIWA 3OPYA 4QPDA 2QVZX 4S35A 2ZYRA 3RT9A 3W8NA 5HKAA 1QG6A 2OKGA 1G3MA 1ADFA 2WQZA 5BORA 5TF0A 2WT4A 2C54A 1XFAA 3ICPA 5EPUA 4CUZA 3FOEC 3M34A 4O5AA 3VYVA 4CFZA 1ZI8A 3IO5A 2A9JA 2XNCA 4GOND 1RYMA 3BXEA 1QONA 2GM9A 1W46A 1E4EB 1I13A 3DDOA 1XDUA 3GVIA 3S44A 3HNPA 1Q7GA 1HXHA 2FPGB 2JI4A 5DMXA 4ZVNA 4YUZA 5C2JB 3PUZA 1XA3A 1ZGAA 3ZD7A 2Q5FA 1WU8A 4I6EA 3MAAC 1B8OA 1JG1A 2FE4A 2P9GA 2P1ZA 3AJ9A 3MJCA 4B83A 2Q5JA 4MYCA 4W5OA 2ZCUA 4DKJA 4NL4H 3BMOB 1LVGA 2VYCA 2ZDQA 4G4GA 3S70A 3KC2A 4Z86A 3AUTA 2PA0A 2E87A 2X9LA 2O06A 3O31A 3PDHA 1PGNA 1R9MA 1Y1TA 1KXJA 2O2JA 3M1IA 5J2UA 3BWXA 2GXSA 3NOQA 2P2LA 5H9WA 1B23P 2PPLA 1KJJA 1Z88A 2R4TA 5KYUB 3WRYC 4EHDA 1B4DA 3N5CA 3KZNA 4B3TB 3THOA 2XUFA 1W4AA 4GP9A 3GV0A 3TCNA 4RZ2A 1XWIA 1BMTA 2EWWA 2NO4A 1ZVQA 4TGLA 4BJ1A 2B25A 3ERCA 4J94A 4TQGA 5JXIA 4IOMA 5EE3A 1YK1A 1LRJA 1NVWQ 1GGMA 4M8KA 4GYKA 4OHUA 1HWYA 2JLUA 2SKDA 2A9FA 5IJ0A 3PC4A 1PK8A 1E3DA 1RAHA 4H15A 1GGEA 4YCMA 4AS3A 2HIAA 4RKRA 3V34A 1ISSA 2YMPA 1V9SA 2R79A 2J1LA 3E6AA 4IUDS 3A70A 2OZEA 4DR7B 1XU7A 1ODKA 1OLSA 3MW8A 4RX1A 1KETA 4NZ9A 5I7HA 4IV0A 1KE1A 1OIVA 1NVVR 3H75A 1FTWA 1ZUNA 5T8KC 2H7XA 4CI9A 1H9CA 8MHTA 3U56A 3V7NA 5D7NA 2DECA 3ZE0B 1WR8A 2FTKE 1XYGA 2HK6A 4WCFC 3SI7A 4CKCB 3TQQA 4CMIB 3QKRA 4EHLA 4F6RA 1Z08A 3KQHA 2C2WA 1KI1A 2XYRA 1BMQA 3DO5A 4BN0A 1B26A 1S96A 1NI4B 2FP3A 1KU6A 2X0JA 4KPGA 4LNUA 4XLZA 1CIPA 4DM4A 5I9LA 4UDNA 3W2FA 2O2IA 4DDHA 1NXTA 1U80A 1XKXA 2DHEA 2ZIXB 4Y6OA 3VR5H 3KBBA 3KQPA 3ZG6A 3BSWA 4YYZA 2D0PB 3KPJA 1RCFA 1OKKA 2JFBA 4GM0A 4TLBA 3NIFB 2R1UA 2AFHE 3GEDA 1ILWA 2QMZA 3I4LA 5DXFA 4DUGD 2IXTA 2C2HA 2NN3C 1C8LA 3KUXA 2QTNA 4QVGA 3RAEC 3UT5A 4DMRA 4X6UA 1TKRA 3QKIA 4ND6A 4HB4A 3IA7A 4MRSA 2NADA 2PY6A 4G24A 1CJMA 1C7RA 4GI7A 1CB7A 1ZN9A 2ERXA 3IQXA 4HGOA 3S1AB 3CNLA 3O26A 4Q34A 4EELA 4BMDA 1XTRA 3DE1X 4FKMA 2CMFA 4IX1A 2O14A 7REQA 2SKEA 2CY0A 1N2CE 5AI5A 5FWYB 4OJYA 2GNAA 4GGOA 1KL7A 3G85A 5BURA 3MWLA 5EZYB 4KMRA 4E3ZA 1QOPB 3P9IA 2QF7A 3GLUA 4OHVA 3MGGA 3PVSA 5FPKA 4IJWA 3U49A 3JPYA 1IQPA 1NURA 1E9BA 3IEVA 3EGDA 1C3XA 5C34B 3VH3A 3UAVA 3SK0A 3Q15C 1KC1A 1DXOA 1NBOA 4XIYA 1HDYA 4LE1A 5EJ5A 1BFUA 4LSGA 4RPKA 5KTYA 3ASUA 3P2MA 1CQPA 3X2SA 5DNVA 2H85A 4C22A 4NC9A 4G6ZA 5TQJA 2GARA 3UUGA 3M6LA 1FU7A 1T1RA 3B7PA 4UE6A 1N34B 2FR8A 3WGOA 3O8OA 3HBAA 3JQCA 2YBDA 2V0NA 5AW6A 3RAGA 1MIOB 2HREA 1R4MB 2VATA 3OMLA 1N36B 3V1LA 2F8LA 5CH8A 1T13A 1T0UA 2V55B 1QQBA 2CNNA 2OHOA 1L9KA 5JDCC 1NW7A 1NUSA 3N2YA 3A9RA 2WKWA 5FLEX 2AD5A 2J5KA 1K8ZB 3I32A 1N6HA 4N6OA 1WUYA 2WJYA 5IEBA 4AX4A 5K0FA 5JI2E 2HSGA 1FJXA 3SVTA 1AKMA 4DPLA 2ZRHA 4NBKA 3ZGYA 3L7NA 4JZKA 3NV9A 7MHTA 1TJ5A 1P6QA 4UMDA 3WK5A 5FLXA 4RK7A 3PG5A 4PSVA 4YJGB 4WFJA 4JX9A 1LDNA 4J0EA 2YJ4A 4CKEB 2EG9A 2ZB3A 1OA0A 3IPLA 5AI8A 4E4YA 5CA1A 3OZTA 1KGSA 4ZCTA 4G4IA 5JNTA 1D1SA 2J45A 1N6PA 3T0IA 4CM9A 1HKHA 1K5DA 1TF2A 2XQGA 4RQBA 3LDFA 5JPDA 2HK7A 2O7SA 1T2NA 4R0NA 4EY3A 1AE1A 1QV7A 3MAGA 4PX2A 5AUNB 1P5FA 1K5HA 1UBKS 1FEZA 2D7JA 2WKQA 2OD2A 3N2GB 3O8BA 4NPHA 5KAPA 4F91B 3U9LA 2EP5A 1HFKA 3W7BA 3WHPA 4RSRA 3T5CA 3LCJA 4OYHA 1TO2E 2JAPA 2ZVJA 2ZEJA 4D3XA 2ZIEA 1N2HA 1ECFA 3OZVA 1AKEA 2RGGA 4FYYA 1U9CA 2J3KA 3N9IA 3O7WA 2GHTA 2ZZKA 4P31A 5T6BA 5ITZB 2BFEA 3FGOA 3U4AA 1FXWF 2YYSA 2GLTA 2Q7XA 4YLGA 1K7CA 3ASZA 3E2PA 1I6MA 3GMDA 2XCSB 5BQFA 1O0CA 2FJPA 1FP1D 2P6NA 2HHCA 2GDJA 4P5PA 5I9IA 1IVSA 4JYPA 5C5CA 1L1RA 3WK7A 1E9DA 1KDTA 4Q03A 4B33A 5LNK6 1XNRB 3FSEA 1TEXA 2XOXA 1Y1LA 3N76A 4K0RA 4A3SA 1AUVA 1OYYA 1TTQB 1J90A 1N3BA 3IESA 5BSWA 3V8MA 3H1AA 2OILA 4HYYA 1PUIA 1P7PA 2FG7C 5ER6A 3U3XA 5K0LA 1KRHA 4IHJB 3DYIA 4X8OA 4M7WA 3QLUA 1GDDA 5A7HA 3RKSA 1UEXC 3L18A 5FHRA 3PC3A 3L92A 1T1JA 3VV3A 1Q95A 5A9RA 3C48A 2VOJA 5JSZA 3DPSA 2WNSA 4RADA 4XRRA 3DUWA 1WPRA 2W98A 3LIIA 1E9EA 1C0EA 2O7NA 3HLKA 4OBBA 3D4PA 2P6OA 2VP6A 4HH3C 2WF5A 3AERB 2C9OA 3OO0A 4HWPA 2MHCA 2OV6A 2V6GA 1ZM3A 3HKEA 1CT9A 1F6DA 2YHAA 4FI3C 1EIZA 4LHVA 2UXDB 1CZUA 2W90A 2YZNA 3T7AA 2DM6A 3VJRA 2KLBA 5BVGB 2OHGA 5AJZA 4WKBA 3RUDA 3JARB 3ZOKA 4RY2A 4JP2A 5DPMA 1TU0A 2HJSA 2MMCA 2V58A 4TXJA 4BKQA 1MJHA 4ZCQA 5LBIA 4UTNA 4PFSA 1P2SA 1P9LA 1WPXA 3F49S 3FRJA 3Q72A 5EPOA 5TR9A 3NAMA 2A1TS 5EJEA 4KWCA 1UK6A 2BY4A 1Y8AA 1CS4C 1JDNA 2X86A 3GGGA 4H7HA 4OXNA 4U2BA 1M1ZA 2X5KO 1B6TA 3C5HA 4L50A 4XGRA 1TB4A 4YV1A 1QVRA 4KXMA 3GLHE 1KJIA 2OZVA 3AB7A 3LZDA 3SYNA 2YJGA 3HFRA 3BK2A 3PFIA 1HQDA 1QHSA 2IY9A 3GGDA 3WKBA 1YVEI 4UDYX 2FMHA 4ENPA 3ZJVA 3ZHSA 3COSA 4O4JF 2PD3A 3JQ7A 4RVUA 1QZTA 1QYCA 3EZGA 3OZUA 5IUKC 1SVUA 4YJFB 3T1YB 3PDIB 4NZZA 5AM1A 3VDRA 2WTUA 1ZCZA 5DNYB 3Q3HA 5AI6A 4AI6A 1T36B 4X62B 4DR4B 1XTPA 2RIPA 4RKWA 4M8IA 2AF4C 1AO0A 5I01A 1FSPA 2IHZA 5FWXA 2IVZA 3RVDA 1BXZA 2D2IA 4LVUA 2DB3A 4TXNA 4BV8A 2OLKA 2B30A 3I1FA 1QTRA 1NC1A 2E85A 1G2OA 3PD1A 2HFJA 1RJWA 2BIFA 1U8TA 5ITSA 3DW3X 2JH3A 5DCYA 3D64A 1O0BA 3CG4A 1E2UA 1YRWA 1C50A 3V1YA 4TTVA 3A25A 4TV8A 2ZS7A 4QREA 4Y9UA 5K4GA 2N42A 1DBVO 3CTPA 4DIMA 4RZQA 2NUBA 2HJGA 2FN3A 5FI5A 4Q4JA 1GUBA 2LDXA 2R65A 3PX2A 4K88A 4LHYA 1ULAA 4IO1A 4RY9A 4ZARA 5T4HA 5LL6P 2NSHA 2HMTA 2B4KA 3OCJA 4PPQA 4MWOA 4X00A 4XQEA 3P0IA 4TPKA 4XM1A 2J3MA 1XF9A 2XY4A 3BHJA 5FNVB 4BGVA 1REQA 3TK1A 4P3NA 3OX2A 2AS0A 3TZCA 4HTFB 1KP2A 1UKVY 2DQSA 2G4CA 2V8OA 1I3OA 1ECPA 4P7GA 4I1UA 4YP1A 2N75A 1L7OA 4CZ2A 2Y66A 1JG4A 4AIIA 5LN1A 4JZYA 4OATA 4EGQA 3BD9A 2HEIA 2HADA 3R2JA 3E9MA 4FFSA 4RIIA 1NQ5A 3OE4A 4JBWA 5CX4A 2VTBA 1TXGA 3ZVRA 1P4GA 1YKGA 4K05A 2HTEA 3FMIA 1CUDA 1X7ZB 3GJ7A 3I3OA 1N8TA 3VKGA 4URHA 4CEJA 1E79D 3FVVA 3WLPA 2IUUA 4HVLA 3BL6A 3QXXA 3MQ4A 2RGDA 4PS0A 4HTFA 1PVOA 4XWYA 2ZDHA 2ZAMA 4DM3A 1K08A 2DSTA 1AHNA 1HT1E 1NKSA 3C1UA 3NI2A 4RD1A 4UD6A 2R84A 3I6BA 3K6SB 1XMOB 4AS1A 2Z83A 5SZHB 2O5EA 4IWNA 3K7EA 4IDHA 1BYUA 2H63A 3AEQB 1F2TB 3CISA 3O4RA 3UJCA 2V3WA 1P9NA 5DASA 5DP2A 1XRQA 4Z0NA 1O94C 2FRXA 4W5NA 2ZBRA 4WZAE 4AT1A 2NPIA 2B21A 3TTVA 4ASUA 4ATNA 1KFCB 1VMAA 3ZS8A 1A5SB 1BKSB 1OZGA 4TV8B 5BUQA 3I52A 1BJRE 3K0AB 3LLSA 4X65B 4JJGA 5HOEA 4FM9A 2FN7A 3B9BA 1CF9A 2HQBA 4QGGA 2PCJA 2V45A 1O5OA 1F0YA 1FE8A 1FFBA 1M3SA 3KFVA 3PZRA 1ZOSA 4H17A 4EPYA 1CTQA 3PQ3A 3F90A 3QE3A 4B3XA 5KWJA 4RVFA 2NMVA 1U5AA 3QVSA 1RRGA 1AQLA 1PL6A 1YDGA 2P1DA 3NEAA 5KYVA 3WOVA 2UAGA 1ABFA 2VXOA 2QZJA 2XJ4A 3ZWCA 4EHAA 2J5RA 2QAGB 3NTVA 4TRJA 4NYMR 3ZCVA 4MKHA 3HB9A 3PDIA 4CMBA 1V1MA 4PC3A 1RRPA 2OQVA 3WMRA 3ZVLA 2YNMA 3TNJA 5JD4A 1KJWA 2J3IA 1UDBA 1NP7A 4YJ2B 1H8EA 4NE9A 2J46A 1F8FA 3A1NA 2YWGA 3LPMA 1HG1A 2AOWA 2DKNA 3B5EA 1NONA 2ZJBA 4B3DA 3MHTA 1AK1A 2A14A 4RJKA 4W5JA 5EMJA 2PRYA 4AJHA 2RCYA 1R7RA 3OLVA 1PL8A 4J16A 3IQIX 4XCXA 1P4AA 1R15A 1ZRSA 2H7CA 2VA8A 3KZXA 1SUWA 1X80A 2CLIB 3CLSD 3MMPA 4D2IA 4Y9SA 1OA1A 1MW8X 3E18A 1SCUA 5DHFA 1CHNA 3QYFA 5A0FA 1PT7A 3IAS6 1LX7A 4AYXA 2W6MA 2ZU6A 4QOJA 5TLSA 3EE6A 2H92A 4KHPB 3JARA 3VQTA 2HRDA 3WQSB 4G8JA 5B12A 3KJHA 1XEFA 4J6EA 3NOXA 1V6SA 1XL1A 3ONEA 1QHHA 2CXXA 1DDOA 1LW7A 4YCNA 1VPDA 4W5HA 2WZCA 3R7WA 3OESA 3NGLA 4CXMA 1VCHA 2C4NA 2EYQA 3HEMA 3DVLA 1IQRA 4J43A 1IZ9A 3ZWQA 4ENVA 2QSYA 2K7FA 3ZZNA 2ZOSA 1I6WA 3EZNA 1BEUB 3GLFA 4E1VA 3TLJA 1YJ8A 3FZNA 4O2BF 4OIFA 5FJJA 4MDFA 2QD2A 1KJQA 5L4NA 3P9YA 1GL6A 5K3CA 2C5AA 2QZ9A 1L5WA 2WG2A 3FCOA 4XWAA 2Q9BA 1AQNA 5ALGA 2G0TA 5REQA 4EG7A 4QASA 3BMXA 4Y98A 2P9JA 1I4WA 1M72A 4AM8A 4WBNA 1Y1QA 2SICE 1NVVQ 4BTVA 5KKNB 3W6OA 2P6MA 2CVQA 2JVJA 5LIPA 4N40A 2V65A 4HMOA 3A4MA 2JFPA 2VUTA 4UM5A 4KK3A 1I2DA 1S2IA 3TLZA 3W6PA 1ZONA 4ZCLA 4DIOA 1P4HA 3FR8A 3ONVA 5B36A 5M7EA 1BH2A 3EGEA 3J7AC 2ERCA 1Y0BA 4AIRA 2JI7A 2WIFA 1CDZA 1VG8A 1TJ4A 4BXOB 3USZA 4YRFA 1O6ZA 4K81B 2E18A 5HKKD 1NVAA 1V35A 3AFNA 4MHTA 4B34A 3K96A 1X1SA 3W5HA 4JVMA 3UN1A 4G23A 1P0CA 1KRXA 4ZYUA 2IDJA 2VA9A 1GNVA 4G0YA 3G1UA 3H4MA 3NVKI 3X1KA 2CLLB 5KS2A 3PFNA 5F7ZA 1DEOA 2FK8A 2W2QA 1NPDA 3AWDA 5TRTA 2VZEA 1ZIOA 2F1OA 3SSNA 3VI3B 4K86A 2P5YA 4M9ZA 4FB5A 4MWBA 3KJNA 1JEDA 1NJ6A 3IQDB 4E6PA 1EDEA 4RUKA 2IHNA 5TEVA 1AC5A 2R00A 3DAOA 4TYQA 1P73A 1BE0A 2GH1A 2PRZA 3NB0A 2QENA 4BFLA 3IPYA 2N1BA 4ZIRA 2BZ1A 3BVPA 1EWKA 1D03A 3GRVA 3L77A 4QYXA 4RORA 3JZMA 3KXLA 1SXJD 3KB8A 4DRZA 5IJWA 4Q18A 2QGZA 5KYKA 2QU8A 3HXTA 4NABA 4JUCA 1DC8A 2VKTA 4RH1A 5IAGA 2X9VA 2X19A 1AQJA 1S3IA 1VHTA 1QIMA 2OT3B 1YQQA 1G5RA 1VBFA 3Q1LA 3WRXC 4QQFA 3VVCA 3W05A 3O94A 4EA9A 1YE5A 4P38A 2I29A 5HQ3A 4RZSA 3KELA 3T41A 2Y0EA 3RHZA 5GY7A 2BBSA 3ZY6A 2DETA 1V7ZA 3STTA 3ZNPA 4O3FA 9ABPA 5IYZA 4H6PA 3DKKA 2E4WA 4K03A 4BCBA 3EISA 3I9LA 4JP1A 1MTOA 2C2OA 2I6SA 4HDAA 3CRQA 2CMKA 3UXYA 5T3UA 4HGPA 4AO6A 1GAJA 3FCYA 4JQCA 2BM8A 5C1PA 4TTAA 3KHTA 1ODCA 2I1VB 2WM3A 3WKAA 1E3QA 3TTYA 1J22A 2A0KA 2AIRA 2ZXFA 5GJVC 2RGAA 2YY5A 1ZRMA 3C97A 4BZWA 4YRBA 3U4QA 4Q4DA 5TV2A 5LQCA 4DNQA 1R3UA 2DERA 3K09C 1XTVA 5CU7A 5G3YA 4M9QA 1B93A 3EODA 3K0FB 1XROA 2D7DA 1N5RA 3OJCA 1O0SA 1IIBA 4DLUA 3K53A 1ES9A 4OJQA 4IGFA 4OXKA 5HA5A 4ARBA 2EQBA 2YWHA 2AXNA 3PTLA 4LCJA 4LGMA 4X66B 2ZM5A 1G5PA 1S01A 3VAZA 1RZRD 2CCKA 3ZU3A 7REQB 2WF8A 4GYYA 2F43A 1TVEA 1G0OA 2RHWA 3H0CA 3FB4A 3NHBA 1DMRA 1RZRA 3BFKA 4E11A 4KRGA 4UPVA 4RJTA 1R27A 2HU5A 2YWJA 3BHMA 2FLVA 4IJ6A 4DIEA 4H3VA 3D4IA 4RS3A 4MWEA 3GRRA 4JI7B 1A2KC 4OQYA 3RSGA 1IVYA 1IEWA 1DEAA 1SXJC 3LJKA 1LB1B 5FXMA 4Z7JA 5KDOA 1KYQA 1GNRA 1OT5A 1ZXBA 2E48A 5LQRA 3TM5A 4QUGA 5AQ1A 4KRYA 4CL3A 3DT6A 5AYVA 4GPIB 5UKDA 1XF1A 3C8DA 5B55A 1Q14A 1W44A 3B7GA 1EFRA 1HDGO 4X54A 3LQYA 4XQ9A 4V0ME 2OGZA 2ZAYA 3A6JA 2DCMA 2VDRB 3D6UA 4JP5A 4DGQA 5BN3B 4LPSA 3ZWMA 1NUPA 4RNCA 4ZQGA 4M0KA 2FP4B 2VP3A 4I5FA 1F38A 5H82A 4F7DA 1ANKA 4CW7A 2FWRA 4XX0A 4AZTA 2A1UA 2B98A 1PYOA 4KMOA 5LR6A 1DOAA 3EWNA 1TU4A 1NI4A 2AJCA 3K4PA 4I6JA 4LJ6A 1TVKA 4R2LA 5FUBA 1M34B 3ADPA 2H1CA 1NYQA 3J7TA 4IRXA 3UANA 5C8DA 5KYWA 1EK5A 1LBQA 1OYWA 4CMIA 4F6RB 2PX8A 1M2WA 3T3OA 3CIOA 3QEMA 2PKWA 4DLSA 3EFOA 2RHDA 4YP0A 4GC9A 3AG6A 2NT4A 3CCFA 3P27A 5DSZA 2BKXA 2QT9A 1ZUNB 3U4IA 3WY9A 3BFJA 3QEJA 3C6QA 4RQUA 3S2SA 3OX3A 2O4CA 3K8YA 3OMWA 3WZLA 1ZGCA 1N2BA 1W0JD 1WTCA 3EGXB 3I04A 3LRTA 2ZUEA 3GJXC 2WAAA 3JAKB 4XEHA 1OXUA 3MGAA 1E62A 4Y18A 4CQLB 1RC0A 5I4IA 1X8LA 2QLBA 4RLFA 4WXMA 5FYDA 1CVRA 1AO3A 1UKYA 1D09A 1JEQA 3G02A 3URKA 1Z7WA 5CG1A 4F2DA 3H16A 1NI5A 3LA6A 5EHNA 1CR6A 4ON9A 2ZK7A 3CUSA 2IITA 3KFLA 3Q8XB 2PZKA 3OQBA 3GAZA 4NCIA 4CE6A 2J9FB 1KZ4A 4GKBA 1F4PA 4KMSA 1DQNA 3E81A 1M8FA 2Q0QA 1PIWA 1RACA 1E9RA 4LOAA 4C7MA 5JJ5A 4B79A 3EXIB 4C05A 4RD2A 1GNQA 2OQRA 1E77A 1GWNA 2XUOA 4NS1A 5J2UB 2HYDA 5L51A 2QMOA 4IMIB 4LBVA 4Q4LA 2Y1GA 2JFOA 2XF8A 4TL9A 1J21A 3EPRA 4WBXC 3TOVA 3D3EA 4I4IA 4IH9A 1FUEA 2YV3A 3BRWA 3BMOA 3JQFA 3ANTA 5AHKA 4QXQA 3VKFA 5AM3A 1A8SA 4DYHA 5FR2A 4BLPA 4CKBB 3REFA 3QU5A 3PEEA 2IV7A 3HGQA 2EHJA 3K16A 2X2PA 4CL2A 4RHXA 4RVGA 4I4LA 3MMZA 3FCXA 1HNNA 3D6FA 3KVOA 3W6NA 3VNVA 4HXEB 4AJOA 4MYRA 4LRTB 4PPNA 5K0GA 4W7SA 5SV2A 1KH1A 2Q6TA 1ZD2P 1Z0AA 3GQBA 1GCIA 2ZP1A 1DFHA 3M70A 3VR2A 1XNJA 1V4BA 3EEYA 5DHRA 1FP4B 4GD3Q 2HOQA 4MW2A 3CWQA 3GPDG 2VH5R 3ZYCA 5DSTA 3IJ5A 3WGJA 4JI0B 4JYZA 1MZPA 4YRQA 1GPWB 4RQAA 1M2JA 4QBHA 3WE7A 2HWKA 1I1OA 3AUUA 5AOAA 1O89A 1RYYA 2WJ4A 3E58A 5ALHA 1E2PA 1EG2A 2VTEA 5JROA 4JI8B 4U9UA 1BXKA 4IIYA 4L3VA 4B6SA 1TJPB 1PHRA 1EGMB 2QG6A 4HWGA 3ZWVA 3PLAE 3KJFA 4BOYA 1JLSA 5J2TF 1N7GA 1KZ1A 1MC5A 2PSDA 4DV7B 1FXUA 2PBLA 3C39A 2ZIGA 4C5CA 4CCYA 5JFTA 4XYLA 2PWYA 5EE5B 6ADHA 2J48A 4BQEA 1P2VA 5LPNA 4W7HA 4C7KA 2QAIA 2E4YA 3F6PA 2NXNA 1JPUA 3T7EA 3QWAA 4ZI7B 1KORA 1FQJA 4UHHA 4BO8A 5DT2A 3OWOA 4LOLA 4RF2A 3WDMA 4E5SA 2AOXA 4Y0AA 3K6RA 4KX5A 3W4KA 1J5XA 4C6HA 1J9EA 2QD5A 1NE2A 2AI1A 4O4HB 4IQFA 4YDSA 3WGLA 4EYOA 4YCLA 2XUQA 3SOPA 4GUDA 3T7SA 2QQ5A 2VRNA 4QTYA 1UZAA 3IHWA 1ZRHA 4ZC8A 4ZYVA 5BVHA 5ADUS 2R87A 4G81A 4RPJA 3OJXA 5I9MA 4YMLA 3TTTA 2FZLA 1U31A 5EWJA 4D4IA 5ITWA 3O8CA 1A9TA 1I2MA 5C4MA 3IAEA 3T0GA 3OTHA 1FXSA 4O25A 4M1MA 4AX8A 4CQMB 2JCBA 3BXOA 3CEMA 3PYXA 3PEWA 3DLBA 4TYPA 1XRNA 1KZYC 3EUFA 3LX5A 1NG1A 1T1GA 3N2ZB 3HU2A 3QLUC 4TN1A 5FB3A 4HB2A 1ZIXA 1E7QA 4RESA 2I80A 3F5QA 1U9JA 3AUFA 2XTAA 2B2CA 2OCPA 3NC4A 3W6UA 2V7UA 5F2EA 5JH7B 1YA6A 2ZDGA 5H4HA 5EWMA 1VKJA 1OH6A 1LJ8A 5I5GA 3M4YA 1C0LA 4R40A 5GTDA 4G97A 5KINB 1ULUA 1DRUA 3TFQA 2WDPA 3RTAA 2DFTA 4AP5A 1XCMA 2FSPA 3CBGA 3FIJA 1C3OA 2JD0A 2VYFA 3RANA 4KC0A 4PHHA 1IN7A 3ICOA 2DHQA 5SY4A 4BFUA 4Q6BA 4QUAA 2EYUA 2BDTA 4WBNB 4J2TA 3HC7A 4QQNA 2NACA 4XAQA 3MJFA 2Y1LA 5HQTA 2N9UA 2JI6A 4BWVA 3FPCA 1AKQA 4PTZA 4WN9A 3CVWA 3GP5A 4NJEB 4FVTA 5DYGA 5EXSA 2YJ3A 3K1AA 4KB5A 2CLEB 3B12A 5B7NA 3OZCA 1ZNWA 4P4TA 3NMUF 1RVV1 1SIUA 1OGYA 1JTFA 3QUSA 4L28A 3T52A 2JHPA 3SQWA 4AICA 5EQTA 3C45A 1PI3A 3ZYZA 4EF4A 1J23A 3GEPA 4YR7A 1TQ2A 1ZL2A 1H23A 1FOEB 2IE0A 4OVKA 3TCKA 4OUDA 3RFFA 4EENA 3W3AD 1VMEA 5K2OA 1MO2A 1QX3A 2PCLA 3RT7A 3DR3A 2NU6B 4NULA 1Q57A 2ZWIA 4XYGA 2C7OA 3IOEA 1R9GA 3CC8A 3JQ9C 4GI3A 1OSNA 4LJKA 4LI0A 5G4LA 5MF6A 1JPJA 3FMGA 3KT6A 4YRDA 2CDCA 5B4UA 4RHFA 1GQYA 5HF9A 2NWQA 3B1JA 4KV7A 4MP8A 4TLDA 5DVZA 1X80B 4EUHA 4FYKA 2QE6A 4FKBA 3ADKA 3PD7A 3FNIA 3K9QO 5ES3A 4B4WA 5HDQA 2Z6UA 3NEJA 2FW7A 2P41A 5I3CA 2O8BA 4PLYA 5G2OA 4KFUA 2JJ8A 2IX3A 1E2DA 5I8PA 5EXXA 3GJ0A 1A1SA 2PVPA 4GLLA 2D5LA 1NNSA 1SQ0A 2I4LA 1DQPA 5BW6B 1MX5A 4X1OA 3S2YA 3M6VA 1VIYA 3H19A 5HZKA 2I62A 1VCMA 3RYCB 2VT2A 4EFNA 1O97D 3OFJA 1USIA 3C3DA 3A4TA 1CZRA 4V0QA 1MVNA 3KDSE 2W4MA 3BFPA 1FZQA 1BE6A 3DOEA 3HA7A 4GZ6A 4CM7A 2H4HA 5A4IS 1QGAA 4AKSA 2G5GX 2KBFA 3ESXA 5BNTA 3F8TA 4QGAA 5FA8A 1LDEA 4B48A 5JAIA 1H4SA 1EFCA 3THYB 4KRFA 2ZBDA 2LW7A 5CGZA 4FFNA 4GGMX 5HK9A 4A27A 3WL5A 1FP7A 3AI7A 2JW5A 3EIHA 4YJHB 2QN9A 4UUMA 2BN4A 2JBAB 1TT5B 3K0AA 3GRFA 1HYEA 2JLCA 4E4TA 2QTMA 1NXQA 3QY0A 5BY2A 1P2TA 4Y2UA 1JLHA 5CT8A 4EKIA 3MA0A 3EXHC 4MK4A 1VKZA 3WK6A 2CXRA 2YQ4A 2D5AA 1SOWA 2H07A 3F6CA 3L0BA 3HLYA 3LUFA 4K9MA 4NEHB 1CW2B 1V8OA 5E9JA 1TD9A 2HLDD 4KPFC 3ZDBA 1T6ZA 2PKCA 2Q0HA 2C97A 3D8UA 3OPXA 3RKUA 2XWBF 3NANA 1BQ4A 1NVBA 1P2GA 5TGZA 3HBJA 4PC7A 1FTYA 4OQZA 4RFSB 1T8RA 3PUYA 1S7CA 2C82A 4E2FA 1RM4A 4Q00A 3DZBA 1CVLA 1HL3A 4ZA2A 4ZZ2A 3EARA 2JLXA 5TF4A 1EK1A 2Q46A 4KIJA 4R54A 1VL2A 1R0SA 4LUCA 3W06A 1JKIA 1DKQA 3T7JA 1WXQA 3G49A 1QZUA 2RHMA 4YHHB 3P9XA 2G5CA 2OSVA 3I05A 4M1OA 3NCHA 1ZBQA 1JLMA 4PC1A 3RWBA 4N12A 1BE1A 1SD5A 1IBCA 2L2QA 3CIFA 4Q9DA 4RGBA 4HDNA 1ZYUA 3FUUA 4JC4A 1OAKA 1OXVA 4BX2A 1NA5A 2VTBB 4NXNB 1B0UA 1NBAA 1J1ZA 2C0PA 4DS3A 5I7EA 1GRNA 1XRSB 1C8KA 1WUHS 5HJ2A 4IRUB 3ZY5A 4EFMA 1QLHA 1KR2A 2PSFA 4WXHA 2YV1A 4JIGA 1E2LA 1WBBA 2J7PA 2PLFA 3DOIA 1E98A 3NTUA 1JJ7A 4Z6KA 2QTVA 3UAWA 1KP3A 3WNQA 2NZ8A 3S7ZA 1P7YA 3SP1A 5EERA 3PSHA 1JTVA 5HMMA 5KTMA 1MGOA 1I9GA 2ID4A 2QDKA 4FMPA 5JWOA 3TFOA 1P4SA 2AQIA 1BS9A 2GT1A 2QN8A 1ZISA 4J4TA 1F0KA 1HL7A 5TSDA 1ZFNA 4CF3A 2RE8A 3W3AH 2AF3C 4U39A 2HK9A 3DZIA 3CW2A 4EUKA 4C88A 2WD7B 3S8YA 3PL1A 4XARA 1IZ0A 3MWFA 2CGEA 2IU6A 3D02A 4NVRA 1OFGA 3PXXA 3BICA 4RVDA