4M5HA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 45
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5hA00
4F7VA 1TMJA 3ILOA 5ETMA 1RU2A 2CG8A 1TMMA 3MCOA 5ETPA 3HCXA 4PZVA 5ETKA 3HSZA 3KUGA 1KBRA 4CWBA 1RB0A 1RAOA 3UDVA 3HSJA 3ILJA 3ILLA 5ETQA 3IP0A 4M5IA 1HQ2A 3KUHA 3MCMA 1Q0NA 4M5NA 4CYUA 4CYUB 4M5JA 5ETLA 2F65A 5ETOA 1G4CA 3HD2A 4M5LA 5ETSA 5ETRA 1F9HA 5ETNA 2F63A 3KUEA 5ETTA 1EQMA 4M5KA 4M5GA 4M5HA 4CRJA 1CBKA 3HSGA 3HSDA 1IM6A 1DY3A 1EX8A 2BMBA 4AD6A 3ILIA 1HKAA 1RTZA 3HD1A 3MCNA 3HT0A 4M5MA 3UDEA 3QBCA 5ETVA 1RU1A 3UD5A 2QX0A 1EQ0A
chains in the Genus database with same CATH superfamily
2FIUA 3WC0A 2LLZA 3DXBA 3R3TA 4JI7F 1FT8A 1GT8A 1YITS 1KLNA 1YLXA 3RG6A 1U4BA 3NGUA 4QPXA 4PWUA 3NGDA 1RHJB 4C2MA 2IRXA 3MDFA 2H65B 3ELHA 3JQKA 2BQRA 1EARA 5D4NA 4PG7A 4WFBQ 2BV3A 2XO6A 1Y5IB 4F0KA 2YKNA 5LT5A 3BGRB 4KHMA 4DFMA 4N7TA 2R8JA 3O3LA 4RNOA 2NS1B 1TKXB 5KG7A 3M9OB 2EG1A 4J9LA 5HK4A 4Q44A 4DV2F 5DDQC 3I82A 2RU9A 1RTJA 2FB0A 4WU3A 2GHWA 4LF7F 1PJ7A 3EZOA 2PA3A 2DD8S 2QG9B 3AA8A 4WFNQ 4X64J 1YTYA 1HBOB 4UT4A 3R5BA 2Y8YA 1CC7A 3E2EA 1QVFR 3RYLA 5FLXY 1TELA 5GAHI 2UUTA 2CJAA 3D68A 5B0EA 2R7WA 1RWMB 2G1HA 2LQJA 2YNFB 1YIJS 4WIIA 2CJXB 3BGLA 4WK1A 2MQNA 3ZNUA 1PO6A 1DTTB 1SC6A 2IA6A 1NJXA 4X4VA 2WBRA 2WB1D 2HQGA 4HHHA 1FD8A 5E3PA 4BWJA 2W7OA 1DQ9A 5F8IA 2HVDA 4KR0B 4D3HA 1EZZB 1O0PA 2GFFA 1CS4A 2IPOB 3G87A 4QIVA 2PMHA 3H59A 4F4KA 1JXVA 1WEXA 2WB4A 3LP2B 5CAAA 4R0EA 3R5JB 2QSWA 1TKDA 3BH7B 3W66A 4FXDA 4DL7A 4Z37A 3L7UA 1EX8A 1ICEB 4DQSA 5BXIA 3KLFA 1S7HA 5ITHA 3TNVA 1FFGB 2X1FA 3FCWA 3HKZD 4OYZA 2Z56B 5LSLA 2RMLA 5AE1A 3Q83A 2AGQA 2HHXA 1RISA 1QSSA 2M3DA 1FTCA 3OSNA 3BJYA 3EGNA 5HP1A 4OL8A 4OI0A 5K8PA 2E5LJ 2XMTA 3SCIE 2I6WA 4OYBA 5DQGA 2RS2A 1X4CA 4RR5A 4UY85 3PRBA 5CYQA 1MMDA 1RT6A 4KKOA 1RAEB 1F9EB 5KFDA 2EBEA 3D3CJ 3GIRA 2Q66A 2BRLA 1HR0J 2GV1A 2HNYB 2K2PA 2ZNYA 2PMZD 4JB8B 2IBOA 3KK3A 4FYWB 2VBWA 1TTHB 2E5JA 1Q4RA 1R8HA 3AD7C 5E2QA 1UCNA 5CYJA 1Q8BA 3HJVA 1A6LA 2KHDA 2RF2B 3QIPA 1EP4A 1HD0A 3CD0A 1XTZA 3HVTB 4Y0FA 5F9LA 1YRTA 3K5LA 4NZ7A 4ED5A 1BC6A 3V6KA 2RDJA 1MMNA 1Q1KA 4CM2A 1S97A 3E8OA 4IOBA 1TFWA 3IWNC 2R3VA 1W7WA 2IM2A 3JS9A 5SUHA 4DPOA 1GXUA 1YJTA 1MW7A 1QE1A 1S4FA 2DNNA 2VG5A 4IG0B 5FIIA 1SBRA 4Z2XA 1YWXA 2NXCA 2BE7D 4DF4A 5LL6d 4DCJB 2OPRB 2CQCA 2ADCA 4ICLA 3I5CA 4AYBD 2VODA 1FWKA 1VR6A 2QZ8A 2XMJA 3CJ8A 5JVGQ 4UQTA 3EUNA 3TVZA 1B3TA 5HJYA 1JB0C 2WONA 1U2RA 2JHEA 1N5TA 3HVWA 4DJBA 1T03B 2BA9A 2HBRB 3K17A 3KDOA 4EFAC 5KAKA 1S1TA 3S8SA 2IMWP 2UVRA 1G1XA 2YWWA 1RT5A 1ZPVA 1HBMA 1HPZA 1LXJA 1S79A 2GAHC 4DSKA 4ECXA 4YY3F 3A4TA 1U8SA 1VDHA 4YUDA 1FRIA 4ZJQA 2AYEA 3BPDA 3B4DA 1EKSA 1MROA 3MPYA 4LF1A 3IWXA 2E1PA 1OWXA 2JLGA 3KLIA 4LF2A 2ZHBA 3TEHB 1ZYQA 2B4OA 3DGVA 3QFWA 4K5SA 4P2XA 5K8OA 4U95A 3T5KA 4DSIA 3BSAA 1MWZA 4RX6A 3KMQA 1NZAA 1T11A 3BSOA 1D8YA 1HBNA 4A8XA 1LWCA 3ENQA 4O3QA 4OYPA 3NAHA 3LWMA 1HNIA 3KOAA 3IAM9 4QIGA 1IWGA 3OFGA 4XPEA 2QLFB 1LWFA 1Q81T 2UVVA 3FBBA 4Y2MA 3G6YA 2NCKL 1UWBA 5DGAA 1X9SA 1XNQF 2I5JB 1K0TA 2B9YA 2F8HA 2GCFA 3AOBA 4CLPA 4NYPA 3C6TA 2VD3A 3CT9A 1JIHA 3BGFA 5G0RB 2V0NA 4DV6F 2UXDF 1K0VA 3KG0A 1WTBA 2R7SA 3DLGA 1ZOTA 4ZCLA 2HHPA 1CJKA 2EFNA 4DV2J 1BHNA 2DNHA 1URNA 3DMJB 1WUUA 3M8QA 4PXBA 3BBCA 3E01A 2E7WA 2CQ3A 3QO9B 2DEIA 1M1KT 1WC0A 4URQU 1NHUA 3DM2A 4DN0A 3UPFA 3MUTP 4B08A 1FRKA 4LBHA 3DRPA 3TJAA 3GSDA 2DNPA 3TZYA 2VKZG 2OEKA 5E5NA 1C1CA 1F1BB 4QWBA 5RUBA 1U1PA 4CP5A 2FHJA 2H3EB 2IFXA 4ZP6A 2C3YA 2I9SA 5KT5A 2DR8A 4LF5F 2N7CA 2Y0SD 4K0KJ 1MN9A 1G4CA 4OI6A 2LECA 3LP1B 1FJGF 2XB2D 2BQ3A 2R8HA 1N32J 2J0XA 4LSNA 2CPZA 1SV5A 4OHXA 3TRGA 3CJ4A 4ZVHA 1VQLS 5D4LA 3G6VA 2JLFA 2B6AA 1NRKA 2OD6A 3AT1B 3D4JA 1WKLA 3AY0A 1VRTA 3LPEA 4ZJLA 3TA0A 3BV8A 3GV7B 3T5HA 4ZVUB 2ZOGA 1U1QA 2M4MA 3CDUA 2FJDB 3M05A 4KYZA 5E3QA 4A48A 5HROB 1YK9A 3BREA 1TKTB 1OO0B 2R2RA 1U1KA 2UUBJ 4X4SA 2XEXA 4DV3F 1PILA 1F5AA 3MCOA 1FKPB 2D41A 3MFIA 2Z2YB 1SCJB 2EFQA 3OT9A 1KS2A 3UDVA 4ENOA 5J2NB 1YQHA 5IWAF 2C22A 4EUVA 4LSZB 2DH8A 2HPUA 4CLKA 3QRPA 2NPFA 2XMUA 2YX7A 2JSXA 1QAXA 3I4HX 4F25A 3N28A 1T3OA 4OX7A 2CPIA 1WACA 1X5TA 2VDIA 3MTJA 2WSFC 3MM8A 2XHCA 4DR2F 1UKUA 2I0XA 4QZVB 1NBEB 3OTDA 4OYAA 4C0BA 4I6WA 1A0OB 2B8QA 3SFUA 3R2DJ 2XSJB 4NX9A 1I1GA 3VGTA 4RU9A 4DQQA 2HGLA 2J8AA 5KOXA 4NA2A 4EYHB 4C48A 2HRUA 4GVBA 3RW7A 3CDBA 4F2SA 2ZUAA 2IYGA 4HH0A 2ZJQQ 4RUHA 2YKPA 4I6AA 1S9EA 3FBEA 3SEOA 3HFZB 3NG8A 3OHBA 2E7VA 2JC1A 1IR0A 2UUWA 3CCWA 3T1YF 1FKAF 4NLSA 4WWSA 3OTOF 4L72B 4ZVPB 2O67A 2CJQA 2QMWA 3NWGA 5I42B 3OSPA 2I2YA 2LCWA 2AEJA 4PPDA 3P3DA 3JQMA 1SH0A 1XNRJ 2C28A 4LR7A 5C25B 2DNRA 7AT1B 3JYTB 4IFYA 1B0VA 1JLQA 1VJWA 4USHA 5CABA 1TVRB 4DUYJ 2H4WB 1CBKA 3VQSA 2J76E 1H6KX 1TP7A 4NZ0A 1X0PA 3ENVA 3OJSA 3DC2A 1S1UA 4LF6J 2VG7A 4UUXA 4HKQA 4JOUA 5BYQA 4IR1A 1N34F 5DLGA 1SI9A 1IN0A 4J9QA 4ZK7M 2VBZA 4KSEB 2QLXA 1H73A 1NMEB 1BLUA 1SJ1A 1TL7A 1XR5A 3IWLA 4OYMA 4QWCA 3I32A 4QYZJ 3WQPA 2G2YA 5J1EA 4DEZA 1U0HB 1HNIB 4Y34A 2HNDA 2ZEJA 3UI3A 2CJ9A 4MKYA 3SIPB 4YDXA 4CO3A 1X9WA 4Q7AA 3Q8SB 3OLAA 2V2VA 2LQBA 2P9CA 3H40A 1NK5A 4RBUA 1IJFB 1FDNA 2B9EA 3TQ1A 4CTAA 4EBCA 2Z58B 3U1NA 4DU8A 4PWDB 2DHAA 3CPWR 2CVEA 4W98A 4J9SA 1SJ3P 1CEZA 4HI2A 1IKYA 3S6EA 3DLLQ 1BY9A 1RE1B 3C6TB 4EK2A 5IT0A 1TK0A 1M5SA 3HHEA 4K59A 5L46A 5GADU 2NZ4A 3NNHA 1M5VC 1OYDA 5HMWA 1AFIA 4OI1A 3CIMA 2J6UA 2AJ4A 2AMCB 1Y9OA 1NPPA 4P71A 3CCVS 1CVJA 1Q7YT 3BF4A 1SJRA 3FVYA 4WE1B 3DMJA 2C2NA 4RW7A 3HX9A 3ONQA 4I67A 2VA3A 3F0NA 2DO4A 3MM5A 2QMUB 4QJVA 5T41A 3UVJA 5J2MA 2MJUA 5HMZA 2HNZB 4NLUA 2QEXS 3C16B 3PXGa 3TR5A 1WHXA 3NEKA 4ID5B 2J8SA 3GR0A 5AXKA 2DK2A 2LA4A 3DRPB 2OJ3A 1SKUB 3H2VE 1GFWB 4ZHRA 2BQUA 1REVA 1NJZA 1KLMA 3PACA 4HDGA 3DU5A 3PV8A 3X3UA 4AL5A 4M5DB 2GGPA 2DGOA 2R7XA 2DXEA 4WFAQ 4IH5A 1HW8A 1SIWB 3V4IB 4WP9A 4YR0A 4FDFA 1SQGA 5HVGA 1AUDA 3AAWB 3TJ9A 1JJHA 3BR9A 2VICA 4IH6A 1U26A 1I6JA 4FBTA 2BRKA 3A3PB 3ADAC 4BLGA 4C11B 1TU0B 2G0CA 3JSMA 1PG5B 4AXJA 1U24A 2JX2A 1KTQA 4TQSA 3KLEA 4XPCA 4J9UE 4P9SA 3CJRA 4Y2KA 1HI1A 2OELA 4U7CA 1Y5LB 3OTOJ 4B3RF 1TUVA 3HJFA 2C42A 3TUPA 2OKQA 3BO2A 2UUAF 2NXUA 1U09A 4DV0F 2GZOA 1LKZA 3WDOA 1VLOA 1K1QA 2CQHA 3NMAA 2NXJA 3K5OA 1WEYA 2B7BB 3IR7B 4ZCKA 5MAOA 2YKQA 3CJTA 3T5LA 1Y3JA 4P73A 2VH7A 3UN5A 3PW2A 5A0YA 1FDBA 2BBEA 2ZITA 4DR3F 3MMJA 4ELTA 4ZP9A 3MR5A 1XWLA 2HS4A 2CWKA 3SQOP 3DOMA 5HANA 2PIIA 5I3UB 4CNZA 2EW9A 3D1OA 5KG2A 1VQ8S 2M70A 4LJMA 5AXMA 4HYKA 3OR1A 2XY7A 5JUMA 3TI0A 4L3NA 3I87A 5HSPA 2DRAA 2WK4A 5ETLA 4KO0B 4O3NA 4F3OA 2G13A 1QAJA 1F2GA 1UA1A 1B7FA 2H5IB 1IBMF 1KHWA 2BVZA 1UW4A 3CW2C 4YQWA 4R0JA 3CB4A 5K5MA 1REGX 1RADB 2BABA 3M8RA 4X62J 1RTDA 3D28A 1S0VA 3RZAA 3HF5A 3IGNA 1KVJA 5F8GA 2X3GA 4R25A 4G1IA 4RKUC 4OLOA 5L9XA 1NO8A 3CJ3A 4I68A 2VV5A 4KGMA 4W4MA 2KYXA 3IC1A 1IWAA 1RT1B 5C25A 2OAUA 1H2VZ 1T05A 3EZUA 2HZVA 4TU9A 1RK8A 4D3GA 1RB0A 3DOKA 2BEFA 1WORA 2V94A 3MMCA 1ZM4A 1T95A 2Z4PA 2D1CA 4C6AA 5KT6A 1UJ5A 3QSYB 3BKUA 4WIQA 1RAHB 1R43A 2O5DA 4ECQA 3KLGB 1UTAA 4ZVRB 2XS5A 2ACYA 2EI5A 2HW3A 2DISA 3I96A 3N4WA 3MWBA 3ZTPA 1N5YB 3NL0A 2F9JA 3V2UC 5B0DA 3Q8VA 2BKOA 1WF0A 4PWWA 1N8RT 1CQMA 1KD1T 4WP3A 2Y9HA 2V8VA 1VRUB 1J5OA 3ULHA 4C9DA 5FJ4A 1QE1B 3JTOA 3M32B 2CPXA 2V4JB 1CULB 1O5JA 4LIRA 2ADBA 4ECSA 2OP5A 2CPHA 2OPRA 1YI2S 3VAJA 2B56A 4L73A 1PJ6A 4CT8A 2FJVA 1FWLA 5L1KA 1VK8A 2XYPB 3K5PA 1KBRA 3EGVA 3P4UB 3EX7B 3GB0A 4CH0S 2J0QD 5IOLA 4AQYF 2HMIA 2HQFA 1DLOA 4DS4A 1OIAA 5DM6Q 1IKYB 3PW5A 2GQQA 4WFZA 3RU0A 3QLHA 5EDWA 3H2UB 1IR2A 2K1RA 1N6QB 3T41A 3GFXA 2OIHA 2Z2MA 2DHGA 5ETTA 3T1HF 2UP1A 3H2LA 4DPTA 3C3LA 3HDSA 1VGYA 4RW4B 2N3OA 1FD2A 2WZ1A 1MU2B 2YX4A 3NRBA 3IBWA 1X0FA 2KZMA 3KG1A 3DU6A 2BJ7A 3PTWA 3MM6A 2MGZA 2J7WA 1FVSA 1PYOB 2BZ2A 2U2FA 3CJ2A 4I6YA 4ZVQB 1X4GA 2DVIA 1J27A 3CCTA 3MMAA 5DJBA 3W64A 5F8HA 2F4VF 4FNIA 2I38A 2KT2A 4GRSA 4K4YA 1GH8A 2APOA 1VQ7S 2VB6A 4QYZK 4TU7A 4KRWA 4LRAA 2OPQB 4OI3A 3UCGA 4QPTA 2V4QA 1M5PC 2VJVA 4AL7A 2WVCA 2ZKUA 5KG5A 2R2TA 2L9DA 1UW9A 4CYUB 4EO6A 2YNHA 1RZMA 1DURA 1FKOA 1FRLA 3DOLA 3ZXWA 1GMWA 4IFVA 5K14A 1TL4A 2FQQB 1PSDA 2HK2A 3CJQA 5CQGA 4ED0A 2PI5A 5H9FK 3SMZA 4B3TF 4YHHJ 4OV6A 2OO4A 2ZC3A 1FCAA 1XR6A 1RHRB 4YFUA 2RQCA 5J2QA 4NCGA 4LIWA 3DLKA 1RTZA 1TAQA 3GFZA 3VZIA 3WIVA 3JSMB 2QJ3A 3K2YA 4LSLA 5G0RA 2OTJS 1Z4UA 1IKWB 3TUJC 4YOEA 3MM9B 2CQBA 2F3JA 3DLGB 2W7AA 3G8QA 1NLKL 3JSYA 4IG3B 3KKFA 4ZPWR 3TAMA 3ZZZA 1JLAB 4V1Ak 1F2HA 3U1LA 1S99A 3DRRB 1VISA 4OYOA 1TQLA 2W9BA 4O0IA 3CC7S 5THWA 1VYAA 2ZZMA 1ZM9A 2ZFHA 1VOMA 2DGTA 4MYTA 5KFNA 1P1LA 4C0OC 1WC3A 2R8KA 1IR1A 5G4DA 2FLLA 4PAAA 2PC6A 3UFCX 3MD1A 3KJVA 1HNWF 1N48A 4I2PB 2A6MA 2BJEA 4TU8A 4ZP8A 5HMYA 4ZVOB 3R7NB 2ZH2A 4ED2A 4ED6A 4J9OA 3A8IA 2KO1A 1RA7A 3DKDA 3O5TB 2OHDA 4DV5J 3V6DB 1PJ5A 4IRCA 2HVIA 3NBPA 3OR2B 4ANEA 4Q5VA 4UOHA 4UOGA 2NYHA 3DDIA 1LWXA 2Z2ZA 2EWHA 2FGOA 1SJQA 2GJ2A 3IR5B 3MR2A 1P1TA 4LUBA 4F7VA 4V19J 1B64A 1WEZA 2GAGC 4TY8B 1RU2A 2GVDB 3NKYA 3D2WA 3KTQA 3OV7A 3SZ2A 4DV3J 3HSZA 3M8WA 1TZ0A 2MKSA 3BM7A 8RUCA 3VAMA 4DV1J 2LDIA 1S0MA 3NNCA 2FC9A 4IH7A 2OFHX 3QNWB 3CDWA 4Y28C 1R8AA 4ANCA 2QA4S 3MGJA 1RWVB 2JFKA 2CPYA 1HYSB 3CCMS 4RJVA 4JBCA 4BWMA 2DO0A 3ET6A 1HW9A 3P5TL 5D0GA 4HL9A 2Y1IA 2MZQA 1S1WA 1VI7A 3AJDA 3PO4A 3GG0A 2EFVA 4OMFG 4P72A 3CCQS 2ZH6A 2FY1A 4MMOA 1RLDA 1KQKA 5CCMA 1KDNA 4HTIA 4J9PA 4EO8A 1TK8A 2CQGA 4LF9J 1KKHA 4NXMJ 3Q22A 3PEJA 1FJCA 4U8YA 2VUGA 4NLYA 1JX4A 1T8EA 4GVLA 1RWOB 1CG2A 2GHPA 1XMOF 1NJWA 2NXEA 3FC9A 2CWXA 1KEKA 2VQFJ 1BQNB 1Q5YA 4NLTA 1R3NA 2P6SA 5KT2A 2YBVA 2XSFA 3OL7A 2BJ3A 2XO7A 1VC6A 1SKWA 3NP5A 3KLHA 3M8PB 3HI9A 2X7IA 2J9EA 3VVUA 3F41A 2G2OA 3DCAA 1VHIA 3SCKE 3SSRA 2Q6CA 4C0HA 1I5OB 2CZ4A 2UV8G 1Q53A 2LEBA 3RR8A 3G82A 4CO4A 2XGPA 2A10A 1U1LA 2NPIA 4EEYA 2IIHA 4GVBB 4N77A 1Y00A 3KNGA 3RR7A 3L95X 4MIAA 3H90A 1WHYA 1S76D 2W8LA 2JEGA 4PYDA 1N5QA 1SH2A 3DXSX 5A6PA 5I4MA 2DNGA 2HGMA 2RDIA 2FHMA 2J7UA 5A8KA 1T9WA 1SPBP 4PCQA 2KFNA 1MWYA 2XMAA 1RT7B 5ETVA 4Z7CA 3H42A 3V6HA 2CXEA 2R42A 2VG6B 4C4WA 1JWWA 4X4PA 1S1XA 1YHQS 4WF9Q 2IVYA 1VBYA 1WKJA 2CVIA 5F41A 3A8JA 2FGCA 4ALZA 1XJWB 3QT7A 4RW4A 4KB7A 3NGSA 4XAKA 2FVSA 3O2IA 1P27B 3GQCA 1HQ2A 1YKWA 2AZ3A 1N36F 4OZ5A 4MT1A 1JNZB 1N88A 1UP1A 1P6TA 3Q23A 1NCLA 1HNVA 2ZM6F 4H4KA 2CZVC 3FNNA 2LDYA 3HZGA 3DI6B 3T9NA 2F63A 2OSRA 4U7UK 4F3MA 1TAUA 1YJ7A 5C42B 4KGKA 3ISNC 2IHR1 4E8UA 1C1BB 3I56S 2WVDA 2E5GA 4YB7A 5AE2A 2MQOA 1FE4A 3J7Z5 4ZP7A 1V5VA 4CM0A 3T1HJ 2A1BA 4QWAA 1KTVA 2RQKA 1T9UA 3N79A 3EJMA 2BJ9A 3PRDA 5HO4A 5D8HB 3HMJG 4X4QA 3BO3A 2JVRA 4JV2A 2DITA 3R6GB 3TVYA 4XO0A 3BO4A 2FVCA 3GONA 5D0RA 2A0FB 1DTTA 4URGA 3CJSA 2RRAA 3DFEA 1XMQF 1G2EA 3H4BA 1J5EF 1G6BA 5CD4H 4P75A 3CGIA 2AYMA 3OFFA 3LP2A 3LP0A 2KT5A 2XQCA 1YRXA 4JP8A 3SDEA 2ZH7A 1EETA 5C5JA 5BR8F 4KQZA 4RNNA 4LF6F 4LFCF 3H98A 5H1SV 4ZPDA 1FJ7A 4X4RA 3SI8A 3NCQA 2HNZA 1Q8LA 4RW9B 4ILMA 3PZPA 1RAFB 2YKMA 5F8MA 4O4RA 2NQPA 3H8YA 5ETMA 5LMUF 3A8EA 4F26A 2QGFB 2XMMA 1NK6A 3W5ZA 3MPUB 1U6BA 1A7GE 1WF2A 2MZSA 2OSQA 1RBOB 1N52B 1UFLA 1V9OA 1X5PA 3MI7X 3QWPA 4MJKA 2XCAA 1F5BA 4EBDA 4P6QA 2ZNZA 3SQGA 2IVMA 4A47A 3FEZA 4RPFA 1TV6B 1GNKA 4TNOA 1XIQA 3GYXB 3MUMP 1LNQA 5LM7E 4XK8C 4R8UB 2QFJA 1EJ7L 5CYQB 4IOCQ 2OMOA 3M6VA 3GYGA 2BE2B 5EX0A 1TKZB 2EBGA 4G1PA 2KI2A 4NRTA 3RBZA 5E3RA 3PYEA 4R5PA 2AGOA 5L38A 4RW8B 3MEEB 2J6TA 1KWMA 1YSJA 2B5JA 1KFDA 2IDLA 4B3RJ 4NMLA 1HYSA 3CO0P 2YTCA 1M90T 1VQ4S 5B09A 4X66J 3MEDA 4ID8A 4L6V3 4ZVSB 3RAXA 1XBWA 3F73A 1S0OA 3I0RA 3W3SA 1KN6A 3CD7A 3Q8UA 4Q45A 1S7IA 1WC5A 1YJ9S 4PQUA 1FK9A 2MLZA 2EK6A 2UXCJ 2F8EX 1AZSA 3H25A 4FPRA 2H1YA 1DARA 2VOOA 1RYRA 1V3SA 2IJFA 2DGVA 4OHZA 4Q0BA 5L1JA 1HWIA 1RTHB 1FX4A 2R2SA 2UVUA 4JV1A 4IR9A 2D3ZA 4ICLB 2LXUA 4HVZA 3HLUA 3NMRA 1HQEA 3ZFVA 1JLEA 3I31A 1HI0P 2ZM6J 5GVQA 3PR5B 3MCNA 3T5JA 2MTLA 3HHLA 2ASYA 3S01A 1CJTB 3UDEA 5DETA 5EWGA 1KQSR 3V81A 4G3IA 4C98A 1UVNA 3ZZOA 1ROFA 1X4AA 3A1YG 4DN9A 5EGYA 1R31A 3DLEB 3JXOA 3OBIA 5KT3A 1IQTA 2CJBA 2LVWA 3F56A 3I0SA 5D78A 2E9TA 1S6PA 1UETA 3KUGA 5I3PA 4FYYB 2J0WA 2XG8A 2RJZA 1OY9A 3DHWC 3K58A 1QDUB 1S6QA 2FJEB 1C4AA 4QU7A 4G65A 2HIQA 2D3UA 1RWKB 1SXLA 3UN2A 3QRQA 4X4NA 1Q5VA 2CPJA 2DIUA 2OPSB 2OMLA 5IC6B 4ZVGA 4LFBF 4QBUA 9ATCB 3Q0AA 2W4PA 1PAEX 2XZDB 2UXBJ 2ZE2A 1HBNB 1LQ9A 2C2EA 1WSRA 1Y11A 2N4CA 3GR1A 3HFVA 5D4OA 4OZ2A 4JI7J 3M6XA 2C2KB 4JV5F 3BQ1A 4RNHA 2JNJA 3U1MA 1SVDA 2YKOA 3JB9k 1S77D 1QLNA 3NOGA 1OPZA 3GPAA 4FYVB 4FZVA 2D74B 3RJMB 2MKCA 5LMNF 1FRMA 2Y1RI 1DTQA 1LWFB 2V8HA 3PIOQ 2WVEA 1MN7A 3TX0A 1UZHA 1QUVA 1SUQB 2V34A 3BGOP 1ZBTA 3C14B 2FJBB 1KVKA 1SC4B 4RO0A 4A8SA 4OYXA 4ED7A 5IQQA 1C1BA 2HVEA 1UEKA 3G86A 2GMLA 4FVCA 2W2NP 1S9GB 1PKUA 2DGUA 2EVZA 3LAKA 4A8YA 4E2FB 5KFJA 2EC2A 4JV0A 5DG8A 4LFBJ 2HGNA 3R7SB 2AD9A 2LQ8A 1HBMB 1HPZB 3OD2A 4I7FB 5KFUA 5MLCV 1VQ9S 1FI4A 4EZ9A 2XS7A 1UJ6A 4ZMMA 2Q6BA 1YBAA 4HHJA 3M1VB 5DG9A 2HIYA 2R7OA 1TUWA 2E1AA 2BJ1A 1P9QC 2IVFB 2IAJB 3OXLA 1R8CA 5D4PA 1D9FA 4TVAB 3UNYA 1OSDA 1HNXJ 5IT9U 3UW1A 5KFWA 3BQ2A 3MUVP 2HS0A 4GKKJ 5F8NA 2XTJP 2Z2LA 1RWWB 2FDNA 3QGGA 3HPOA 3T1YJ 2GX8A 2BW2A 3LWLA 2ZC4A 5IXUA 4OZNA 3FRZA 3C6UA 1JKHB 3EVMA 5DQHA 1C4CA 1URRA 3UDLA 4YB5A 1FEHA 2V2QA 2BANA 4CZCA 5CXTA 4NLWA 1DRZA 1TKXA 2M8DB 1LW2A 1B70B 4F4AA 4DX5A 4JI5J 2B4UA 1V5IB 5L39A 2ZD1A 3M2VB 5KFHA 4RWWA 3LGHA 2IC3B 2OPPA 3OHAA 3HT3A 1IM6A 3IM8A 1F5CA 4K4VA 3ENAA 2MJNA 1NKBA 3A3OB 4TQRA 4F2RA 1QTMA 3LF0A 2MB0B 3CMES 4B3SJ 5LMUJ 1S72S 4E98A 5H9EJ 3O44A 1NSQA 4TLRA 4NEZA 1YGYA 4PG6A 4NLQA 5KFVA 4ILRA 3QAEA 3NWRA 2DTJA 3QJLA 1DZ5A 4TYAA 5B0GA 3AFGA 3E01B 3TA1A 1TR0A 3PJXA 1L3TA 1NJIT 3D1QA 3FFIB 4FF3A 3QO9A 3HKWA 4A8OA 1HQUB 3J7YU 2ILYA 3KDNA 3LTOA 3AOAA 5ETRA 1U1MA 3CCES 4B3TJ 2DHXA 1AXQA 2BXJA 3P8BB 3ETMA 4QIWD 4WK3A 4ZPBA 2KRRA 2UUBF 4WP8A 2RQ4A 1RXOB 3HHKA 3LH2S 4USKA 5GAEI 1BWEA 5BJRA 4NLOA 3FCVA 3C19A 5KFIA 3W61A 4GC7A 3MTKA 5K20B 1FNOA 3KJVB 4MIWA 4X4TA 4G1QA 1W2BR 4O0NA 3KLVA 3VAHA 3UCUP 3BBBA 4OZJA 5GAGI 1RTHA 4P7TA 4ED8A 2VA2A 3C66A 2OEMA 1S49A 3D67A 2GIRA 3LGNA 2DKOB 3MZIA 2GVZA 4PUOA 3EE3A 2QC3A 4LRBA 3KFWX 2HFNA 2ACMA 3ILLA 5HJXA 4PR6A 5GAEU 3J80U 3CUNA 1VRTB 3THVA 4C8OA 2DH7A 2CIMA 3N01A 1RYSA 2DYAA 2WHOA 2YWHA 3TANA 2F65A 1Q7LB 5ETOA 4ETZA 1TKTA 3GILA 2RNEA 5T7LA 2FHJD 1AT1B 3NGTA 2VL1A 4LFCJ 1EQMA 2YQ0A 2MKYA 2GS8A 4DSLA 2HRTA 2AP6A 2IA0A 1RCXB 1HWKA 1TVRA 3RRKA 1H98A 1F6TA 4MFBA 4RUAA 1HWJA 3TW0A 5EHHA 4PXCA 2VG7B 4ECTA 1ZETA 2YXLA 4ZKAA 2Y3YA 3N6MA 3AA9A 3C8YA 2QT7A 5KFKA 5J1NA 4MTPA 2F4FA 1I3OB 1OQ6A 2W2OP 1M1GA 3PG9A 5K9FA 2BE9B 2EFGA 4URSA 5DDPC 4A8WA 2PI4A 3M6WA 1ZM3A 4OIXA 3J81j 2ZH3A 2DPJA 3PY8A 4JI8F 3GIIA 4JI4J 3MCMA 1RT3B 1DQAA 1JLGA 2OEJA 3PM9A 1NSAA 1BMQB 2IM3A 5D0HA 4XIUA 1K44A 2KM8C 2HBYB 1VC0A 2MHNA 2D9OA 4KIAA 4KV8B 3CDEA 1WDDA 2HQ3A 4I1TA 2NXNA 4UW2A 1UVMA 3DYAB 5DDRC 4CLFA 4ES1A 3PKYA 2QIFA 1LW0A 3CSKA 3KLHB 2IM0A 2POKA 1WTFA 4QQBA 5DM7Q 3W9IA 2AEMA 3GJQB 1PCAA 5L9NA 1RU1A 1L3KA 2W9AA 1BD6A 1EQ0A 4DHVA 1H7WA 4IRKA 3EZ5A 4P52A 4B3OB 2F7VA 4DV6J 1ZZNA 3TYTA 2UXDJ 2ATLA 1C0UB 2VC0A 3O6QA 4NOHA 5J1PA 3AXKA 2ASLA 1HD1A 3R9LA 1RBAA 4ES3A 3EPIA 3J7AN 2VIHA 4WBFA 1MROB 4WCEQ 3MXHP 2CQ4A 1CQNA 2AKWB 5A8KB 2QSFA 2DXDA 5A8WA 9RUBA 4YEAA 3CXCR 2YPYA 4QWDA 1RUSA 5M2PA 3QZ8A 5FDLB 1LWCB 1FRHA 1WKKA 2A2DA 2NLWA 3IG1A 1S1VB 2IJNA 1ZH5A 4CH7A 5K8NA 3DRSB 1U49A 3C46A 1APSA 1U0HA 3CD6S 2BUNA 3BN7A 5M2UA 1HNVB 3RB0A 2HFOA 1HIYA 3GIKA 4LFAF 1BE4A 2RSQA 2F9DA 4S0MA 4AUKA 2YX1A 2VQEF 1RT4A 2L48A 2VQFF 3DN9A 5BR8J 1XMOJ 4QOTA 4CTAB 5IWAJ 2R2UA 4DR3J 2AYBA 2ZD1B 1BGXT 4JUZA 4WYWA 5HQ8A 5AJ3F 5HLFA 3OVSA 3ILJA 1J2VA 2Q43A 4OX8A 3HHLD 4ZJOA 1T03A 1WC4A 4Q43A 2VPZB 2KVIA 4DR1J 2WCXA 2YKAA 4OI4A 3UR3C 4DQRA 1Y10A 3W2WB 4DR5J 4M1KA 2J9CA 3B78A 3IAS9 3OJUA 1NB2A 4YS2A 1U1OA 4NCAA 2GJIA 2VPXB 2YWGA 2OD4A 3BR8A 2FJWA 1QUPA 2BOAA 3PW7A 1RJJA 2WOMB 2AHOB 1WOOA 4PEOA 2FVQA 1NNDA 2QN6B 4DV1F 2VOPA 2ZDOA 1NEEA 1X5OA 3FKBA 4I64A 4N56A 3Q86A 2M5YA 2WSEC 2Z57B 2RDDA 1S9EB 1HWLA 1H72C 4RL1A 4DR1F 4N8NA 2XC9A 1HNZF 2YNIB 2KHCA 3B8HA 4L3KA 4Y6IA 5ETQA 4DR4F 2MLXA 3KUHA 1Q8IA 1NK9A 1XMQJ 1T7PA 3Q2SC 4WPAA 1K47A 1RA6A 3MECA 3HXMA 4G1QB 1ZA1B 2DCLA 2OGUA 1MG7A 2CNNB 2JWNA 5HQMA 3QJJA 4PPZA 4U67Q 4LSNB 1HBUB 3MHYA 5EUHA 5DG7A 3T6BA 4LFAJ 3TVKA 1RI7A 2JVOA 3IBCB 3NS5A 4O4GB 3MPVA 3ZZ0A 3HSDA 3HVRA 2L3MA 2V8DA 2VZ9A 2KU7A 4ITSA 5CD4A 3G6ES 2AGPA 1IXKA 4NLGA 3CULA 2RF2A 1RSCA 2CNOB 4YR2A 5HROA 2DGWA 1JLFA 1FWPA 3IRXA 1VLYA 2VDHA 1VBXA 4C8LA 3VWSA 3I4PA 2DB1A 2L41A 3T1AA 2NSCA 3LALA 3QPIA 1NK7A 4C8NA 3PIPQ 1T9TA 4ECZA 2O01C 3C15B 2H4YB 2M8HA 4L76A 3FSYA 3ZZYA 3AD9C 1T9VA 4J7CA 2E9RX 1N5YA 1VS3A 2RU3A 2CPEA 4K4SA 2WVFA 3D7SB 4OHWA 4F3QA 1MSWD 2SXLA 2AJ2A 4IQXA 4PWDA 2OLWA 1NSKL 4CRJA 4IDKB 5LMNJ 4NLXA 3VCDA 3CCSS 2R7QA 4IOAQ 2XYGB 3D1HA 3L9ZA 2CKWA 4Z7YA 2ZH9A 5IT9Y 3M30A 1RT3A 1DJ0A 1NH8A 2V5HG 1S0NA 2RD5C 3UR0A 4FPIA 4YB6A 4RUCA 4NMXA 2UUCJ 3KWMA 4K2XA 1KQGB 3B54A 3HVAA 8AT1B 1X4BA 4B9UA 2GQ2A 2F4VJ 2J0SD 3K7RA 1HLWA 1SV5B 2K3IA 1U6FA 2W2PP 4B17A 3ITHA 1HQEB 1X4DA 2JJ4D 1VQNS 5KT7A 4PXDA 1S5ZA 1JLEB 3GCXP 1PGZA 4DV4J 1VQOS 2A18A 2CADA 4JI8J 3MM5B 1WG1A 4O3OA 3OUYB 4RWXA 2W2QP 3BZQA 3B82A 2BJDA 3MCSA 2YPZA 3J81Y 2ZKTA 5IFMA 3R2CJ 2F40A 3KHGA 3W63A 3X1LB 1JLQB 1U02A 1NKEA 1ZS6A 1VQPS 4NZ6A 4LREA 2ZDPA 4NLDA 4DL0C 5HI7A 3BBFA 4OJHA 4OLPA 3L3CA 3HT0A 3WIUA 3MM6B 2KXFA 5IM0A 2MGZB 4X84A 2XBPA 2ZJPQ 5KT4A 2FUG9 2KH9A 3MMAB 4UQGA 1M5KC 2FLNA 1OQ3A 2DH9A 3MM8B 4O44B 1UWBB 3J7YI 2I5JA 5D77A 5HBMB 3WZ0A 1MLAA 1TL7B 2KB2A 1RBLA 3KNAA 2CAJA 1HMVB 3UNGC 4ZIWA 2JEJA 2B0GA 2XSJA 4USWA 1HNWJ 4J5OA 4KH1B 2DEJA 2W24A 4NI2A 2NSBA 2VASA 3H5UA 2XLIA 3C14A 4UF4A 3LOUA 3IM9A 2RS8A 4LVOP 3W2VB 5J2QB 4DR5F 1SH3A 4OV1A 4CO2A 4H4OB 4LR8A 1R0AA 1R0BG 2RKIA 1JK9B 5KG4A 2C2ZB 3WBZA 5F3ZA 4Q2MA 2JDJA 2HVHA 3DLBA 5AJ3J 1C1CB 1EAYC 4TXSA 5KFLA 3FK4A 4PRFA 1SC1B 1TL5A 1RT2B 4BC7A 3ENWA 1HNZJ 2VQEJ 1S1UB 1PYTA 4DV0J 1EHWA 4I2QB 4M8LA 1R7IA 3QGIA 2LEPA 2DNQA 2YWFA 1BQMB 3H20A 2CDRB 3C16A 4OJGA 4OX6A 5E3CA 5F8LA 2MYFA 1JXLA 4LF4J 4PABA 5EN1A 2EG2A 4KGVB 2G0JA 3M2RB 2HQDA 3CCJS 5HQLA 2G2ZA 4HLBA 4AT1B 5HMXA 3CCRS 1KVIA 4X4UA 2B9XA 2LMIA 3PYFA 4IO9Q 1LOUA 1YBUA 4NA3A 2GO9A 2YNHB 2MZ1A 2ZOFA 1DQ8A 2QYGA 1I51B 3DOLB 3F44A 3MEGB 3I9V9 1NH7A 4NE9C 2VFUA 4NXNF 2E9ZA 5ETPA 3G8SA 4PZVA 3GSIA 3MMCB 4WJBA 1JXEA 3ZZUA 2OPPB 3AB4B 2DRDA 4L74A 2G9OA 4O4GA 3VALA 5J2NA 2XNRA 1ZZFA 2GIFA 2QLBB 3FQKA 4NCGB 3Q8PB 1ZAVA 4DUZJ 3H5XA 1VHFA 1UMJA 2W2MP 3EICA 2AJFE 2DNLA 2FD2A 2LA6A 1CJUB 4LF7J 2RUGA 4B9TA 1RABB 3AH6A 2BKPA 2DHHA 4AQYJ 2E1RA 4DLEA 3PDNA 5D3GA 2CG4A 2DNKA 2GO8A 5C2CA 5A2QY 4XTTA 1E6VB 1YDLA 1TFYA 2ZUGA 2RB7A 1U0SA 1H74A 3UD4P 2IDEA 5F3TA 4JV5J 2JEIA 3OTEA 3PFEA 1E6YB 3TEGA 3MMBB 4GKJJ 4KAIA 5DLFA 2E5HA 4FF1A 2FZKB 2KXHA 4WZQA 1FXDA 5A0YB 2GHVC 1X7VA 2CG8A 1VCTA 1VJQA 3CC4S 2IY5B 3V5RA 1JLCA 3I5AA 3TZZA 3G96A 3VV2B 4EBEA 2BR0A 1D0EA 1AA1B 1H3DA 3FEXB 3MFHA 4USMA 3P96A 2B51A 1CPZA 5I42A 2HQCA 4RW6B 3ZTOA 2GJFA 2NYIA 1N36J 1R6VA 3LQVA 4ZN1A 3ZO7A 1F3FA 4OI2A 3BB5A 4BBYA 3D0IE 1TL1A 1U45A 4DX8H 3RAQA 1L3VA 1I94F 2K3KA 4IFYB 4NLVA 4NCBA 3GIJA 3RB6A 1RHUB 1GTHA 1NHKL 2QL5B 4M5KA 1JJ2R 2BDPA 2RUSA 4EYIB 5D3GB 2R7RA 3NXZA 1LK7A 3D9BA 3GV5B 1RTDB 4C11A 2XCPA 1HKAA 2VPYB 2XGQA 2XMVA 2QA1A 3D54A 2XY5A 3ET6B 4AFFA 1ZA2B 2KM8B 2GW8A 2P9GA 2DR9A 2HHWA 1YJRA 5B0FA 3IA0A 3Q8YA 3BQ0A 1Z2LA 1RKJA 1RTJB 3DOKB 1BUXA 3GFYA 3NLCA 1WWHA 4MFBB 1ACMB 4DI6A 4IG0A 5KFGA 1NSPA 3BH6B 1N5VA 1HBOA 3R27A 1RLCL 1RWPB 2EFOA 4FVMA 2QFIA 1F9HA 4USVA 1R6YA 2DNOA 2ZBPA 1KNZA 3CJ5A 1RWNB 2YVSA 2R8GA 1G7CB 2O3DA 2KFZA 4WFYA 3W9JA 1PYSB 1RKIA 3FRYA 2I1RA 1HMVA 4K2JA 4ZPCA 1S57A 3PVXA 1FERA 1PIEA 2QX0A 3ZTRA 2MY8A 5C24B 1GXTA 3I5BA 4RLEA 3VF0B 2JLEA 1FA0A 2XWXA 4NI2B 1B0PA 3HO1A 3BYRA 4P74A 4KHRA 1ZTTA 1NK4A 1VMBA 1R89A 3KLFB 1Q79A 3W2VA 1H2TZ 4Q0BB 2YKNB 2M7SA 3I9ZA 1WNEA 1T0TV 1YVFA 3RUBL 3W60A 1N54B 2K1RB 1GAOA 2DXFA 2EFPA 4ETXA 1B7YB 5FLXU 3CVKA 3JTNA 3KXDA 4LF4F 2V67A 3A12A 1LWEB 4M5GA 3VHQA 3CC2S 1Q16B 4DL3A 3CJKA 3R7BB 1KLMB 2NUHA 4K4ZA 2CJKA 2LQ9A 2M0GB 1SL1A 1NKCA 2AIRB 2B3TB 4OJ3A 3C2PA 5HAOA 2F5GA 4QW9A 2YKMB 1NB7A 2KL8A 3ETOA 3FMBA 1OYEA 2RH3A 1KHVA 1Y0HA 1JJCB 4ZPVR 3KJNB 1AUSL 2ASDA 4RUBA 1FDDA 2IRUA 4P7VA 2Y1JA 4OYIA 2WRMA 1SJFA 1KRPA 4DCOB 2V4JA 3MD3A 4DSEA 1UA0A 4XDDA 1S1WB 1U6ZA 3AOCA 2DR5A 1CS4B 3DDKA 4N47A 2YH1A 2ZHOA 3BN4A 4OX9J 3PCOB 1U25A 3CCUS 2EEYA 1C0TB 2IRYA 3ISZA 1RP5A 4CH1A 4IRDA 3M8QB 2HS3A 3BS9A 2I8EA 4CLYA 3MPDA 1VRQC 2M52A 2MKHA 5KOWA 4ED1A 2RIJA 3SSSA 4USJC 5E41A 2COLA 1M5OC 1K8AT 2JZ5A 3KK2B 3CCLS 1NDCA 2MDAA 2KRBA 2M9KA 2WW4A 2XWYA 3L09A 1V6HA 2ILZA 3R5GA 4J90A 1J5EJ 1WDTA 4G6VB 4KJIA 1HA1A 2W4CA 4KPCA 1MU2A 4N76A 4X4OA 4DZ6A 3OTCA 2ZH8A 2NREA 1GMVA 2ZVIA 2R7VA 2KKHA 3DGPA 1NHVA 1NPRA 3LP1A 4KFBA 3BDPA 4WTOB 2G1DA 1FFSB 3HHDA 3SYZA 2QLWA 6AT1B 3K8WA 2CA9A 3CF5Q 4A8FA 1JLBA 1RQ0A 5EX3A 3D0HE 2CDQA 3NBPB 3PJWA 2KG1A 2CNKB 2KVQE 1PBUA 3AB2B 3PX0A 1N33F 3KLIB 2HSEB 2ALZA 1TV6A 2RE1A 3MECB 4JI0F 3QAUA 4QIFA 4C3MA 4CNYA 2MZJA 7FD1A 2ZH5A 2JRSA 3N5BA 3AD8C 2JH3A 2GVDA 2DT9A 2WSCC 4QR1A 3NNAA 3TUIC 3R8YA 2XI3A 4UTGA 4O3PA 1F0XA 2KFYA 3GU0A 2UUCF 3JAMU 2BYCA 1WSVA 4LVNP 1LEOA 3MEEA 2X3DA 4KTQA 5IV3A 1QSYA 4K0KF 3US5A 1XNRF 1UZDA 4JI6F 5JXSA 4WFXA 3K0JA 1WJ9A 1NPKA 4DFJA 4FYDA 3TP2A 4DMZA 3MM9A 6FD1A 3VGVA 1EIYB 1YX2A 3UE2A 3BPSP 4ES2A 4YB1P 2FZCB 2VC1A 4ZLNA 1NXIA 3DRRA 1RHMB 2FVPA 2ZE2B 1UJ4A 3EPGA 3ZZRA 4LF9F 2VFTA 4CO1A 3R1HA 2H51B 1NAQA 3KJFB 2O1PA 4WU2A 4CLZA 2W1BA 1SKRA 4B9MA 1PAUB 4NXNJ 4WYLA 3NS7B 4A8KA 1OY6A 3IGVA 1WOSA 3HCXA 2QA2A 2WW8A 4MAKA 1QM9A 1RAOA 2IMOA 2RAQA 2PD1A 2MXYA 1IBMJ 4DR2J 2Z30B 1NUEA 1X31C 1JNRB 2CUYA 4DPUA 4PG5A 2E1MC 4DCPB 1FX2A 3GJRB 2ROPA 2XI2A 3D6TB 5C24A 2VF3A 3QWUA 5FD1A 2R7UA 1RT6B 2V69A 1ZAWA 2HEKA 3EWGA 5KFSA 1IQZA 1IJEB 1QTNB 1R0CB 2HNYA 2YQ1A 1ELOA 4Y65A 4ZLJA 3KK3B 1WOPA 4ZLLA 2FTRA 2QRRA 2KG0A 1NZ8A 3P45B 1OPIA 3M1VA 3HD1A 4DV4F 3OXFA 4K4TA 2CRLA 1VC5A 4PKDB 3LANA 2DBBA 5KFMA 3PHTA 3QIPB 4OHYA 4Y2CA 3VGSA 3D5MA 5KFZA 2DGSA 3FSIA 3MAQA 4X65F 5KG3A 5KFBA 1F9FA 2N7YA 2M88A 3TJ8A 3JQJA 4C97A 3OXGA 5IQ6A 4ZCIA 1RTIA 4DBQA 3VAKA 1S59A 4QR0A 5LSRA 1S9FA 1SC3B 1XNQJ 3VGUA 1U1NA 1XC9A 2XYHB 3DLHA 3D66A 1Q8KA 4EWTA 2PO4A 5IM0B 2JC0A 2K8GA 3EVWA 4F50A 4H4KC 1W26A 2Y1LB 2YH0A 3UO0A 3ZNJ1 2YWKA 5JJBA 5GAGU 4BCAA 2GNKA 2UV8A 4FBUA 2GQCA 4R5PB 4C8YA 1B99A 4U6PA 3K8VA 5D6GA 5LOQA 1MNEA 3M7VA 4JI2F 4DLGA 1HHTP 2AF6A 4B9LA 1VBKA 4H4MA 4A4JA 2D69A 3DM2B 3QRRA 3P6YC 5CZXA 1WD6A 4WXWA 5SZTA 4IG3A 4F36A 3RB3A 1S4EA 3TAMB 2BW7A 3G4SS 4ZLPA 3M8SA 4HT5A 2AEFA 5CYMB 1C0TA 4BS2A 1NDKA 1HNXF 2ZVSA 2C2OB 4DX7A 2V6AA 2QL9B 4Y2IA 1FF2A 2OFGX 2JL9A 2LXFA 3UVJB 4I2PA 2CPFA 1HHSA 2QTWA 4OZ3A 4NEYA 2BJ8A 1L3SA 4ZCMA 4ID5A 4KBIA 1KFSA 2VPWB 4ZN3A 3G71S 1X4HA 4LF5J 1PC4A 2E44A 1CC8A 3SDEB 1HWUA 1YG0A 2FZGB 3HHLB 1JKHA 4N8OA 1N33J 4K8RA 4PG4A 2EXUA 3OFEA 3QJPA 3V4IA 4JI1F 4DS5A 4HR2A 4KKOB 1MMLA 1RCOB 1V3RA 5IC4B 3THPA 2ZJRQ 4J9NA 1FKPA 2DNYA 2LP4A 3ZZPA 2W8KA 2HYIB 4PQAA 2DHSA 4KY3A 4WXOA 2RRNA 3ICLA 3UN3A 4Q2LA 1FESA 3EXYA 4ZVFA 4ECWA 2KDOA 2P9EA 1IKVB 3M9NB 4DL5A 3M8ZA 1YRUA 3RBEA 1EP4B 3HVTA 4RBTA 3EM1A 3PJ9A 1X9MA 4TKTA 4R8UA 3MEGA 3MOZA 3PYGA 3R5AA 1CJKB 4GMKA 3RBXA 4ZDNA 4YP3A 2U1AA 2BE2A 2FVRA 2KXNB 4F67A 1KOOA 3DLJA 1O8BA 4HACA 2PEHA 4KGZB 2AW0A 2HWTA 4K5RA 4OZLA 4ATNA 5J1EB 3PW4A 1W25A 4DDFA 3R5DA 1M5HA 2HNDB 4WTYA 1B4SA 2K7JA 2VFSA 2DNMA 1YZ7A 4CO5A 5H9EK 2DCUB 4CLUA 4JI4F 3OVBA 5F8JA 1HARA 5BYSA 2KTQA 2O66A 3MEDB 3V4MA 2NR0A 3CWJA 4BHQA 4NRUA 3HM9A 4MK9A 3I0RB 1WELA 2BKNA 4KH0B 4A8QA 1SUQA 2H5JB 2H5EA 4U9RA 2C3UA 3SCJE 2VBYA 4GO7X 1N0UA 2WONB 3TARA 1HFEL 5HP1B 1KC8T 3KK1B 1H38A 1VQMS 3A8KA 3IBFB 4NYOA 2ASJA 4WKRA 2AZ1A 3KJQB 1CLFA 1S1TB 3QT6A 2W7PA 2KT3A 1CJVA 4FF4A 1D8ZA 5LSOA 3B6BA 4P2SA 3DYAA 4MKVA 3ZTSA 1M1HA 5DRKA 3S7RA 3RBDA 2B6AB 4RW7B 3KHRA 4EU0A 3D6MB 5LJ3Y 1F60B 4M5MA 2IAJA 4YY3J 4F4XA 5AT1B 1F3VA 4DPYA 1CJTA 2UZAA 4LF8F 3I55S 4HHUA 3FCHA 1UPMB 3RW6A 4DUYF 3GTYX 2RRBA 1TL1B 2XLKA 3DLEA 2OI2A 5JMNA 5A2QU 4QU6A 1DHMA 3B4MA 2UU9F 2MQLA 1T05B 3VZHA 4Y00A 1UVJA 5CH7B 5AXNA 1R27B 1REVB 3BYPA 3NCPA 2A3JA 4E0DA 2HFSA 4X66F 2W4DA 1QY7A 2C2MB 1NDLA 2D7SA 1RAIB 2H9ZA 3WHIA 4BC9A 1H2UX 2XY6A 3HHNB 3POTA 2XMWA 3M2VA 2FLOA 2XS2A 2Q1LA 5C42A 1FK9B 3R97A 3VTIA 3EDQB 3M4XA 1Q78A 3N5FA 4MKAA 2XLJA 2BMBA 3KYLA 2WBMA 3IG1B 3W5YA 1FTRA 2AX0A 4JYAJ 2VJUA 2C1EB 4FP9A 4EI2A 3JSBA 5KG1A 3MR7A 4DV5F 3CD5A 1L3UA 3BEGB 1VQSA 4K50A 1NM2A 1T9YA 3PHEA 1U2FA 4GKKF 5DZ7A 3RGIA 3R6LB 1HR0F 2R9LA 2D3O1 1XEZA 2YY3A 3LUYA 2B7CB 3SBMA 5GMEA 5A8RB 5B08A 2ZZTA 4B3MJ 3LPYA 4B3MF 1LFWA 2C3MA 3TZWA 3EDRB 3FFIA 4M5NA 3W9HA 3PYDA 1HQUA 3IFEA 4DUTA 1S9GA 4NYZA 3PO5A 2RHSB 2HWIA 3H0PA 2AWZA 3Q89A 3KHLA 4JI5F 2PEBA 4LBPA 3KUEA 3JYTA 1IBLF 4FF2A 3I0SB 4HI1A 1UL3A 4OQJA 1X60A 5KG6A 1C0UA 4DSFA 4JI3F 4FXWA 1C2PA 1S6OA 1VIOA 2V8PA 5CYMA 4DG1A 4YHHF 2UVWA 1FHTA 1SB6A 2GMJA 2V2ZA 2BX6A 4M5DA 4CO0A 5IZHA 2OH2A 3FUYA 4DSJA 2E66A 3T19A 3L7OA 3G6XA 3D3BJ 2CJYB 4RW9A 3TO8A 3W65A 2OUGA 3FQLA 4CLTA 1KSPA 4O3SA 1YZ6A 2P6TA 4IKAA 5KFYA 1BXNA 4ECYA 3CIZA 1YJNS 3FBFA 1Y7PA 3L7PA 4ANDA 1GX6A 4DL4A 3O8WA 2PFFB 3EGZA 4TYBA 3TX8A 1U7LA 2LU2A 5CHCB 4J9VA 1FRJA 1K1SA 4IYQA 2OTLS 3E51A 2ZH1A 3DHXA 5T7LB 2BANB 3W5XA 4F4WA 3SV4A 2XULA 1TL3B 1LW2B 2N3LA 1RT4B 3QFHA 4LR9A 2HHHF 2N4DA 2VFRA 1WG5A 1YJUA 2B4VA 3MM7B 5LXYA 1FO1A 2HKEA 4NPOA 2HAIA 3QIDA 4MK8A 5E0OA 3M9MB 3ILIA 3T9ZA 2DIVA 3SFGA 4RNMA 1X8DA 2RVJA 3FZBA 5J2PB 3SSQA 5T14A 2HRYA 1VFJA 3PFOA 4LQ3A 5B0CA 3W2WA 1UEVA 5L1LA 1RWUA 2V9KA 3PRVA 3GZ7A 3DOMB 5I3UA 4I7FA 2Z8QA 3FGVA 4LBIA 4FXVA 1T3NA 4HACB 3J81U 1IKXB 1AZSB 3NOCA 3R1LA 2J9DE 1VBZA 4JI1J 1CULA 5GAHU 4F4YA 2D9PA 2AT1B 2ALYB 1Y3KA 2J5AA 4DWIA 2HFUA 2PDAA 4M94A 3AJ2A 4BDPA 4DR4J 3OL8A 2PA8D 4FNHA 1D1UA 2HHHJ 4UY8T 5AXLA 5F9NA 1R8PA 3BDEA 4IO1A 4DPWA 1WHWA 2MKKA 3MURP 4HH1A 4U8VA 3R5CA 4TLQA 3QLHB 1MWQA 2HHVA 3OFHA 2L9WA 3DGPB 3W62A 4GC6A 1N6QA 1FNMA 5CCLA 5BYRA 4KFBB 4YR3A 1S48A 3ILOA 1VQ5S 4B3OA 4IUFA 8ATCB 1HBUA 1S6PB 2ZWOA 2HQIA 5ETKA 1WG4A 2MZTA 2CQPA 2YQ3A 4CWBA 3N6LA 4ZPAA 2PFDA 3HSJA 4DV7J 1IUJA 2W25A 2G4BA 3J7A1 3VQTA 3UCZP 1SQFA 1QVGR 2BOPA 4I0WA 3HK2A 1DBDA 3DRYA 2IBKA 4DUZF 4QCLA 1Z1ZA 3CE8A 5CA5A 4ZPTR 2OPSA 1VIXA 3DRXA 3GWCA 4I4BA 4MH8A 4JI2J 4OYWA 2HURA 4K4UA 3KG4A 4ECRA 2FYXA 2OPQA 2LYVA 3PW0A 3QQCD 5KFFA 2HFVA 4DR7J 1JQGA 4AD6A 1S1VA 2BM0A 5LJ5Y 2AJ0A 3TAQA 4J91A 3C15A 1ZM2A 5HATA 2MQQA 3LGMA 2PT0A 5E7OB 1FKOB 2B9WA 4USIA 3NGRA 3RB4A 1ZTWA 3OTBA 1VQ6S 1S10A 2BM1A 4RZRA 2DY9A 5GMDA 4Y3CA 4ECVA 2Y8WA 5EWFA 4F0MA 1IVZA 1FFWB 5HLFB 2UU9J 2CQ2A 1SKSA 1Q82T 3FJ2A 2IJRA 4CCHA 2MKIA 2P5VA 3P49B 3AXMA 2AV5A 2ERRA 5A6WA 3OR1B 1OS5A 2F1FA 5IS2A 4X65J 1D9AA 1FNXH 3Q8RB 4HTJA 1U47A 1LXNA 2JFDA 5A76A 3EMTA 1R8BA 3M6UA 2DR7A 2ROEA 4NLRA 2HHUA 2R7TA 2A2CA 2K06A 2QV6A 3WX8A 3UD3P 4P10A 1D9DA 2UUAJ 4NA1A 1FVQA 2DR6A 2MQMA 4KE5A 5A8RA 4QW8A 2CQ1A 3FBCA 4U7UD 3FZ2A 3BGRA 3QBCA 4L75A 1IBCB 4I69A 3I6PA 4B3SF 3J7ZT 1XQIA 2QL7B 1TMMA 2P2CB 2P8IA 2HWHA 3UDCA 1U8WA 2X1GA 4MIBA 4MYUA 1N5SA 1RGVA 3OR2A 4USTA 3THTA 3K5NA 1FJGJ 4ILLA 4C7QA 1GXLA 2YNGB 4ZVTB 3G8TA 1RWXB 2EK1A 2J7KA 2VU5A 3M2UB 1Q0NA 4NLPA 2GGPB 3TWZA 2HHSA 2H54B 5ETSA 3KLGA 1UVIA 4DR7F 2HLTA 3HD2A 3HULA 4LRFA 1NU4A 3GP9A 4PG8A 2AJ1A 1BQMA 4ZA1A 2CQ0A 5ETNA 2HZCA 3NY0A 4KGXB 4USUA 2NUUG 1EB0A 4DQIA 1FXLA 1O6XA 1QAIA 1M0SA 2IC3A 1RTIB 2V2KA 1IBKF 2DJWA 3M2RA 3HSGA 2E5LF 5KTQA 3QYYA 4FKYA 4QWEA 3FDSA 1J5OB 4X64F 3ZZTA 4RBVA 3TAPA 2LEAA 3S1TA 3OL6A 2ZOMA 4OZ0A 1IKWA 3NGKA 5M2RA 3KLEB 4KHPF 3Q2TC 1HI8A 1FRXA 2GMHA 4OFZA 1TL3A 4AE5A 5KFXA 3ZTQA 3QZ7A 4JI6J 4NWBA 2W9BB 3CNQP 1SQEA 5DDOC 1IM4A 3IP0A 4CIOA 4ECUA 1WC1A 3PX6A 3MAHA 2X1BA 1U2CA 2MKJA 2KZZA 4WZMA 5J2PA 1GMUA 4H4MB 4YDDB 1R0AB 5GMKa 2RKIB 2DY1A 2X1AA 3QSIA 1FEEA 4DQPA 4C3KA 4P2FA 4ZS6A 4O23A 4JI0J 4Q8EA 1T9XA 2CFXA 4F02A 3D0GE 4ZHRB 4ZOSA 5GADI 2FLPA 3M30B 4QIEA 3GYNA 3QGHA 1N4LA 4AL6A 2EC0A 4KO0A 3UD5A 4I2QA 5DZ6A 3OLBA 2Q3PA 5KFRA 3H4DA 4DPXA 4W92B 2X51A 1NK8A 1U1RA 4TY8A 4Y2AA 2LU1A 1FJEB 2MY7A 5A8WB 3GJTB 1S6UA 2HBQB 2GVZB 4PUOB 3UQSA 1KP6A 2V4RA 5EWEA 1JLCB 1WI8A 1RACB 1YJVA 3DNCA 3G2XA 3LAMA 1JMTA 2ZHAA 1AYEA 1K9MT 4M5IA 2MPUA 3U7JA 3K5MA 2AX1A 3LA0A 2VKRA 2EKYA 2HZAA 2BACA 2V68A 2XM3A 1S1XB 5HVHA 5E3AA 4UUWA 4CLWA 3FSXA 3GMGA 2C3OA 4CT9A 2JOQA 4KC5A 5L8RC 2VFVA 3JSRA 2KJWA 4DL6A 2ZZNA 3H7HB 3QMQA 4OX9F 3FEYB 3TA2A 2V50A 3AQPA 1D3WA 1H0HB 4A8MP 3RAMA 5D0EA 1HL6A 1IKVA 2CNLB 2PMWA 2QLJB 2PN6A 4MKBA 3RRHA 4PYAA 4B9VA 4KPYA 4J9RA 4DU7A 2XHWA 5DGBA 1LFPA 4F04B 5L1IA 2A6OA 3RRGA 2FHOB 3O1LA 3GLJA 4C3LA 4WKYA 2PGCA 1JLAA 4CI0B 3PX4A 4EZ6A 3AODA 3HP6A 3GV8B 3M8PA 4XDCA 4RNFA 2J9DA 2J6SA 4LRDA 1VRUA 1FE0A 2LQ5A 3D6HB 1JLGB 2WOMA 2XZTB 1AW0A 3M32A 3BKFA 1XK8A 2ZBCA 3G82B 3U27A 1XN9A 4JYAF 4O3RA 4J9KA 2MSSA 1RT5B 2YWEA 3OPKA 2B4PA 4KV8A 3H5YA 2WAQD 3EVOA 1VQKS 2V9WA 5D15A 2N82B 1WHVA 2NZCA 2VONA 3CMQA 1UEUA 2VBXA 3BGUA 4KT0C 3NCRA 1LW0B 3PNIA 4ZIVA 4IDKA 2DRBA 2XMKA 1KOHA 2YNIA 2V8GA 3JTPA 3RTVA 1QSLA 4RU2A 3KK1A 1OMSA 1Y5NB 3IS9B 3GE9A 2V63A 4FN5A 1VK3A 4NASA 2H48B 4EMDA 4HEA9 3MPWA 1QD1A 5HL7Q 5ADZA 2FC8A 3BSNA 2W01A 1RT1A 4DZDA 1CSJA 1TMJA 2HHTA 4X2BA 4UOCA 1CJVB 1O51A 2WVBA 5F0UA 3IXQA 3LP0B 5KFTA 3CJ0A 2LFVA 3MR3A 3ITHB 4QR2A 4HDHA 2FPHX 1RT2A 1OSCA 4LF8J 3DDNA 2MEWA 3MF5A 5I3QA 3T3FA 4NL5A 2QMXA 4ELUA 4M5JA 2IYIA 3JAMY 3G9CA 4DF8A 5KFOA 1JLFB 3QT5A 4ER8A 2VHGA 1YJWS 1Q86T 3IRXB 2DPIA 4YN3B 1SL2A 4CLSA 4FKXA 4M63A 2XZWA 1UAWA 5FDLA 5KFPA 1GEHA 3VAFA 4EGLA 1PC5A 3HZEA 1DY3A 3MAAA 5KFCA 5H9FJ 1RAGB 2YNGA 3DRSA 2ABYA 3M2UA 5F0WA 5DQIA 5DS7A 4DV7F 1Q95G 1T94A 1TK5A 1UPPA 3ISND 4ED4A 2AU0A 5KG0A 2Q79A 2ZBRA 1WC6A 2RT3A 4DR6F 6FDRA 4YMEA 4M95A 3BSCA 1TKZA 1DTQB 2KN4A 3NS6A 3POTB 4LT6A 4O44A 4P2MA 4TY9A 2E1CA 4ELVA 1UWAA 4H54A 2LKZA 2W9CA 2ZWPA 2HMIB 4N5SA 2B5JB 1DLOB 2C2RA 2RHQB 1NK0A 5B7WA 1UFKA 3BKTA 4LSLB 1X4EA 4ZVEA 2CYYA 2G0IA 3L4BC 1B0TA 2FHKA 3WC2A 1QJHA 4K4WA 3PKMA 4UZBA 1BWVA 5DO2A 3IR6B 1G3OA 5KFAA 3UWTA 3AHPA 3KHHA 1L5UA 1KQFB 3EGWB 4I56A 2MMYA 4A46A 3D6FB 1RDRA 1DFDA 1OY8A 4ERDA 3CCZA 3KMSA 3W1YC 1SL0A 2ZBIA 4DL2A 3CDAA 3LO3A 1RT7A 3K57A 2DGQA 2FJXA 5CZVA 4OJ1A 3KK2A 1RAJA 4OZ1A 4DXLA 2EPIA 1LWEA 3V6JA 4W90B 2HFZA 2EKNA 3OW2R 3Q24A 3PEHA 3CJKB 4DG1B 1QAYA 4RW6A 1K73T 3Q8QB 2HBZB 1N34J 4CYUA 1GQEA 3W7BA 2UXBF 4FYXB 1SIZA 1LV5A 1RHQB 2MSTA 2MZRA 5KFQA 4ED3A 3V81B 2D3OR 4IFVB 5K14B 1ULRA 1Y4ZB 2KJVA 4K4XA 1ZAXA 4FS2A 3MEKA 3MR6A 2AJQA 1LK5A 2UXCF 2MQ8A 3TUZC 3N9UC 2R4FA 2PSZA 4DOZA 3IRWP 4F8RA 2YNFA 1JLBB 5HBMA 5HN0A 4DR6J 4FS1A 3QATA 4RW8A 1JJ4A 1X4FA 2RQMA 1PBAA 3DLKB 4F4ZA 3A13A 2GIQA 4KHPJ 3P5BP 4HT7A 5LXRA 3K89A 5IT4A 4C8ZA 2AYGA 3GG1A 3OVAA 4B9SA 2L08A 2DGXA 3WX4A 1EKRA 3M8YA 3MM7A 4QYRA 1UVKA 2B8PA 5KFEA 1DAXA 3GIMA 1N0VC 5U47A 5HVFA 3QGPA 2HAFA 3N0VA 1IBKJ 2CZ9A 3HFKA 4C8KA 1BQXA 2B43A 4OHVA 4X62F 3J80Y 1HHQA 2QE5A 4M5LA 1U48A 3PR4A 1CJUA 1IBLJ 3OL9A 2Z0GA 1RHKB 2ATCB 1T02A 4GKJF 3VR1A 3VAIA 3V6DA 3SXLA 3VAGA 1E6VA 4F0HA 1P9YA 1XMBA 5C7PA 1XR7A 1IKXA 2E29A 1EETB 3GFHA 5K8MA 2K7KA 4LRCA 2M2BA 4B02A 1ZPWX 3QT8A 3SV3A 1RAAB 3VVTA 3MMBA 3GJSB 2CQDA 5B0BA 3NAIA 2C2DA 3A3NB 2HG4A 4PXEA 4DFKA 1GX5A 2IM1A 2Y0BB 2E7XA 2GA7A 3CEDA 3EXCX 4NXMF 1A9NB 1N32F 4DFPA 4C8MA 1S6QB 2ZH4A 1NDPA 2QO3A 4K7QA 5B0AA 3OUYA 3IS9A 1KONA 3SQGB 3FMWA 4JI3J 2MLYA 3IMQJ 4Q8FA 2VG6A 4LQ9A 3IN5A 4J9MA 2PE8A 1UVLA 2ROGA 4UOFA 4LMZA 1FXRA 1AB8A 1X5SA 5AE3A 3AJ1A 2DNZA 3HHLC 3W8PA 1Z2ZA 2ZBQA 4UZCA 2FY8A 5E33A 4CLLA 4CQ1A 7FDRA 1V3ZA 3LW5C 4M5HA 1FDAA 1KR4A 3T6JA 3IO1A 2VG5B 4J37A 1GK8A 2CQIA 3C6UB 3EYZA 3MOJB 2HK3A 4IQMA 1WF1A 2GC8A 2XNQA 1NJYA 1YBTA 1N56A 2MQPA 3SCLE 1AFJA 2HLUA 4MK7A 2LXIA 3DI6A 3AQOA 1AROP 1BQNA 3U02A 2L9NA 4PQUB 3H5SA 1OJ4A 4GO5X 2E5IA 4CDIA 4AXIA 3MAAB 2AQ4A 1H7XA 4DX6A 1SJ4P 2HVZA 3GCWP 4N41A 4ZITA 3W8GA 2RILA 1D09B 1E6YA 4V19X 3CMAS 2JEFA 5IV4A 1UFWA 2MHEA 1TUGB 1GTEA 2F8MA 3CO9A 3K59A 5C2GA 2HHQA 3ZC4A 2QYCA 5JVHQ 3TQEA 4B9NA 2CPDA 1GMWD 1XERA 2C3PA 4WE1A 1ITPA 3N6NA 3TZXA 2W9CB 1P8GA 3TOQA 1I94J 1WI6A 3OQ2A 2WTFA 1W2IA 2FJAB 1S12A 3E3XA 5J2MB 4H4OA 2QA4G 2R8IA 4U96A 1VQYA 4TN2A 2KYZA 3CTRA
chains in the Genus database with same CATH topology
4F7VA 1TMJA 3ILOA 5ETMA 1RU2A 2CG8A 1TMMA 3MCOA 5ETPA 3HCXA 4PZVA 5ETKA 3HSZA 3KUGA 1KBRA 4CWBA 1RB0A 1RAOA 3UDVA 3HSJA 3ILJA 3ILLA 5ETQA 3IP0A 4M5IA 1HQ2A 3KUHA 3MCMA 1Q0NA 4M5NA 4CYUA 4CYUB 4M5JA 5ETLA 2F65A 5ETOA 1G4CA 3HD2A 4M5LA 5ETSA 5ETRA 1F9HA 5ETNA 2F63A 3KUEA 5ETTA 1EQMA 4M5KA 4M5GA 4M5HA 4CRJA 1CBKA 3HSGA 3HSDA 1IM6A 1DY3A 1EX8A 2BMBA 4AD6A 3ILIA 1HKAA 1RTZA 3HD1A 3MCNA 3HT0A 4M5MA 3UDEA 3QBCA 5ETVA 1RU1A 3UD5A 2QX0A 1EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7V A;  1TMJ A;  3ILO A;  5ETM A;  1RU2 A;  2CG8 A;  1TMM A;  3MCO A;  5ETP A;  3HCX A;  4PZV A;  5ETK A;  3HSZ A;  3KUG A;  1KBR A;  4CWB A;  1RB0 A;  1RAO A;  3UDV A;  3HSJ A;  3ILJ A;  3ILL A;  5ETQ A;  3IP0 A;  4M5I A;  1HQ2 A;  3KUH A;  3MCM A;  1Q0N A;  4M5N A;  4CYU A;  4CYU B;  4M5J A;  5ETL A;  2F65 A;  5ETO A;  1G4C A;  3HD2 A;  4M5L A;  5ETS A;  5ETR A;  1F9H A;  5ETN A;  2F63 A;  3KUE A;  5ETT A;  1EQM A;  4M5K A;  4M5G A;  4M5H A;  4CRJ A;  1CBK A;  3HSG A;  3HSD A;  1IM6 A;  1DY3 A;  1EX8 A;  2BMB A;  4AD6 A;  3ILI A;  1HKA A;  1RTZ A;  3HD1 A;  3MCN A;  3HT0 A;  4M5M A;  3UDE A;  3QBC A;  5ETV A;  1RU1 A;  3UD5 A;  2QX0 A;  1EQ0 A; 
#chains in the Genus database with same CATH topology
 2FIU A;  3WC0 A;  2LLZ A;  3DXB A;  3R3T A;  4JI7 F;  1FT8 A;  1GT8 A;  1YIT S;  1KLN A;  1YLX A;  3RG6 A;  1U4B A;  3NGU A;  4QPX A;  4PWU A;  3NGD A;  1RHJ B;  4C2M A;  2IRX A;  3MDF A;  2H65 B;  3ELH A;  3JQK A;  2BQR A;  1EAR A;  5D4N A;  4PG7 A;  4WFB Q;  2BV3 A;  2XO6 A;  1Y5I B;  4F0K A;  2YKN A;  5LT5 A;  3BGR B;  4KHM A;  4DFM A;  4N7T A;  2R8J A;  3O3L A;  4RNO A;  2NS1 B;  1TKX B;  5KG7 A;  3M9O B;  2EG1 A;  4J9L A;  5HK4 A;  4Q44 A;  4DV2 F;  5DDQ C;  3I82 A;  2RU9 A;  1RTJ A;  2FB0 A;  4WU3 A;  2GHW A;  4LF7 F;  1PJ7 A;  3EZO A;  2PA3 A;  2DD8 S;  2QG9 B;  3AA8 A;  4WFN Q;  4X64 J;  1YTY A;  1HBO B;  4UT4 A;  3R5B A;  2Y8Y A;  1CC7 A;  3E2E A;  1QVF R;  3RYL A;  5FLX Y;  1TEL A;  5GAH I;  2UUT A;  2CJA A;  3D68 A;  5B0E A;  2R7W A;  1RWM B;  2G1H A;  2LQJ A;  2YNF B;  1YIJ S;  4WII A;  2CJX B;  3BGL A;  4WK1 A;  2MQN A;  3ZNU A;  1PO6 A;  1DTT B;  1SC6 A;  2IA6 A;  1NJX A;  4X4V A;  2WBR A;  2WB1 D;  2HQG A;  4HHH A;  1FD8 A;  5E3P A;  4BWJ A;  2W7O A;  1DQ9 A;  5F8I A;  2HVD A;  4KR0 B;  4D3H A;  1EZZ B;  1O0P A;  2GFF A;  1CS4 A;  2IPO B;  3G87 A;  4QIV A;  2PMH A;  3H59 A;  4F4K A;  1JXV A;  1WEX A;  2WB4 A;  3LP2 B;  5CAA A;  4R0E A;  3R5J B;  2QSW A;  1TKD A;  3BH7 B;  3W66 A;  4FXD A;  4DL7 A;  4Z37 A;  3L7U A;  1EX8 A;  1ICE B;  4DQS A;  5BXI A;  3KLF A;  1S7H A;  5ITH A;  3TNV A;  1FFG B;  2X1F A;  3FCW A;  3HKZ D;  4OYZ A;  2Z56 B;  5LSL A;  2RML A;  5AE1 A;  3Q83 A;  2AGQ A;  2HHX A;  1RIS A;  1QSS A;  2M3D A;  1FTC A;  3OSN A;  3BJY A;  3EGN A;  5HP1 A;  4OL8 A;  4OI0 A;  5K8P A;  2E5L J;  2XMT A;  3SCI E;  2I6W A;  4OYB A;  5DQG A;  2RS2 A;  1X4C A;  4RR5 A;  4UY8 5;  3PRB A;  5CYQ A;  1MMD A;  1RT6 A;  4KKO A;  1RAE B;  1F9E B;  5KFD A;  2EBE A;  3D3C J;  3GIR A;  2Q66 A;  2BRL A;  1HR0 J;  2GV1 A;  2HNY B;  2K2P A;  2ZNY A;  2PMZ D;  4JB8 B;  2IBO A;  3KK3 A;  4FYW B;  2VBW A;  1TTH B;  2E5J A;  1Q4R A;  1R8H A;  3AD7 C;  5E2Q A;  1UCN A;  5CYJ A;  1Q8B A;  3HJV A;  1A6L A;  2KHD A;  2RF2 B;  3QIP A;  1EP4 A;  1HD0 A;  3CD0 A;  1XTZ A;  3HVT B;  4Y0F A;  5F9L A;  1YRT A;  3K5L A;  4NZ7 A;  4ED5 A;  1BC6 A;  3V6K A;  2RDJ A;  1MMN A;  1Q1K A;  4CM2 A;  1S97 A;  3E8O A;  4IOB A;  1TFW A;  3IWN C;  2R3V A;  1W7W A;  2IM2 A;  3JS9 A;  5SUH A;  4DPO A;  1GXU A;  1YJT A;  1MW7 A;  1QE1 A;  1S4F A;  2DNN A;  2VG5 A;  4IG0 B;  5FII A;  1SBR A;  4Z2X A;  1YWX A;  2NXC A;  2BE7 D;  4DF4 A;  5LL6 d;  4DCJ B;  2OPR B;  2CQC A;  2ADC A;  4ICL A;  3I5C A;  4AYB D;  2VOD A;  1FWK A;  1VR6 A;  2QZ8 A;  2XMJ A;  3CJ8 A;  5JVG Q;  4UQT A;  3EUN A;  3TVZ A;  1B3T A;  5HJY A;  1JB0 C;  2WON A;  1U2R A;  2JHE A;  1N5T A;  3HVW A;  4DJB A;  1T03 B;  2BA9 A;  2HBR B;  3K17 A;  3KDO A;  4EFA C;  5KAK A;  1S1T A;  3S8S A;  2IMW P;  2UVR A;  1G1X A;  2YWW A;  1RT5 A;  1ZPV A;  1HBM A;  1HPZ A;  1LXJ A;  1S79 A;  2GAH C;  4DSK A;  4ECX A;  4YY3 F;  3A4T A;  1U8S A;  1VDH A;  4YUD A;  1FRI A;  4ZJQ A;  2AYE A;  3BPD A;  3B4D A;  1EKS A;  1MRO A;  3MPY A;  4LF1 A;  3IWX A;  2E1P A;  1OWX A;  2JLG A;  3KLI A;  4LF2 A;  2ZHB A;  3TEH B;  1ZYQ A;  2B4O A;  3DGV A;  3QFW A;  4K5S A;  4P2X A;  5K8O A;  4U95 A;  3T5K A;  4DSI A;  3BSA A;  1MWZ A;  4RX6 A;  3KMQ A;  1NZA A;  1T11 A;  3BSO A;  1D8Y A;  1HBN A;  4A8X A;  1LWC A;  3ENQ A;  4O3Q A;  4OYP A;  3NAH A;  3LWM A;  1HNI A;  3KOA A;  3IAM 9;  4QIG A;  1IWG A;  3OFG A;  4XPE A;  2QLF B;  1LWF A;  1Q81 T;  2UVV A;  3FBB A;  4Y2M A;  3G6Y A;  2NCK L;  1UWB A;  5DGA A;  1X9S A;  1XNQ F;  2I5J B;  1K0T A;  2B9Y A;  2F8H A;  2GCF A;  3AOB A;  4CLP A;  4NYP A;  3C6T A;  2VD3 A;  3CT9 A;  1JIH A;  3BGF A;  5G0R B;  2V0N A;  4DV6 F;  2UXD F;  1K0V A;  3KG0 A;  1WTB A;  2R7S A;  3DLG A;  1ZOT A;  4ZCL A;  2HHP A;  1CJK A;  2EFN A;  4DV2 J;  1BHN A;  2DNH A;  1URN A;  3DMJ B;  1WUU A;  3M8Q A;  4PXB A;  3BBC A;  3E01 A;  2E7W A;  2CQ3 A;  3QO9 B;  2DEI A;  1M1K T;  1WC0 A;  4URQ U;  1NHU A;  3DM2 A;  4DN0 A;  3UPF A;  3MUT P;  4B08 A;  1FRK A;  4LBH A;  3DRP A;  3TJA A;  3GSD A;  2DNP A;  3TZY A;  2VKZ G;  2OEK A;  5E5N A;  1C1C A;  1F1B B;  4QWB A;  5RUB A;  1U1P A;  4CP5 A;  2FHJ A;  2H3E B;  2IFX A;  4ZP6 A;  2C3Y A;  2I9S A;  5KT5 A;  2DR8 A;  4LF5 F;  2N7C A;  2Y0S D;  4K0K J;  1MN9 A;  1G4C A;  4OI6 A;  2LEC A;  3LP1 B;  1FJG F;  2XB2 D;  2BQ3 A;  2R8H A;  1N32 J;  2J0X A;  4LSN A;  2CPZ A;  1SV5 A;  4OHX A;  3TRG A;  3CJ4 A;  4ZVH A;  1VQL S;  5D4L A;  3G6V A;  2JLF A;  2B6A A;  1NRK A;  2OD6 A;  3AT1 B;  3D4J A;  1WKL A;  3AY0 A;  1VRT A;  3LPE A;  4ZJL A;  3TA0 A;  3BV8 A;  3GV7 B;  3T5H A;  4ZVU B;  2ZOG A;  1U1Q A;  2M4M A;  3CDU A;  2FJD B;  3M05 A;  4KYZ A;  5E3Q A;  4A48 A;  5HRO B;  1YK9 A;  3BRE A;  1TKT B;  1OO0 B;  2R2R A;  1U1K A;  2UUB J;  4X4S A;  2XEX A;  4DV3 F;  1PIL A;  1F5A A;  3MCO A;  1FKP B;  2D41 A;  3MFI A;  2Z2Y B;  1SCJ B;  2EFQ A;  3OT9 A;  1KS2 A;  3UDV A;  4ENO A;  5J2N B;  1YQH A;  5IWA F;  2C22 A;  4EUV A;  4LSZ B;  2DH8 A;  2HPU A;  4CLK A;  3QRP A;  2NPF A;  2XMU A;  2YX7 A;  2JSX A;  1QAX A;  3I4H X;  4F25 A;  3N28 A;  1T3O A;  4OX7 A;  2CPI A;  1WAC A;  1X5T A;  2VDI A;  3MTJ A;  2WSF C;  3MM8 A;  2XHC A;  4DR2 F;  1UKU A;  2I0X A;  4QZV B;  1NBE B;  3OTD A;  4OYA A;  4C0B A;  4I6W A;  1A0O B;  2B8Q A;  3SFU A;  3R2D J;  2XSJ B;  4NX9 A;  1I1G A;  3VGT A;  4RU9 A;  4DQQ A;  2HGL A;  2J8A A;  5KOX A;  4NA2 A;  4EYH B;  4C48 A;  2HRU A;  4GVB A;  3RW7 A;  3CDB A;  4F2S A;  2ZUA A;  2IYG A;  4HH0 A;  2ZJQ Q;  4RUH A;  2YKP A;  4I6A A;  1S9E A;  3FBE A;  3SEO A;  3HFZ B;  3NG8 A;  3OHB A;  2E7V A;  2JC1 A;  1IR0 A;  2UUW A;  3CCW A;  3T1Y F;  1FKA F;  4NLS A;  4WWS A;  3OTO F;  4L72 B;  4ZVP B;  2O67 A;  2CJQ A;  2QMW A;  3NWG A;  5I42 B;  3OSP A;  2I2Y A;  2LCW A;  2AEJ A;  4PPD A;  3P3D A;  3JQM A;  1SH0 A;  1XNR J;  2C28 A;  4LR7 A;  5C25 B;  2DNR A;  7AT1 B;  3JYT B;  4IFY A;  1B0V A;  1JLQ A;  1VJW A;  4USH A;  5CAB A;  1TVR B;  4DUY J;  2H4W B;  1CBK A;  3VQS A;  2J76 E;  1H6K X;  1TP7 A;  4NZ0 A;  1X0P A;  3ENV A;  3OJS A;  3DC2 A;  1S1U A;  4LF6 J;  2VG7 A;  4UUX A;  4HKQ A;  4JOU A;  5BYQ A;  4IR1 A;  1N34 F;  5DLG A;  1SI9 A;  1IN0 A;  4J9Q A;  4ZK7 M;  2VBZ A;  4KSE B;  2QLX A;  1H73 A;  1NME B;  1BLU A;  1SJ1 A;  1TL7 A;  1XR5 A;  3IWL A;  4OYM A;  4QWC A;  3I32 A;  4QYZ J;  3WQP A;  2G2Y A;  5J1E A;  4DEZ A;  1U0H B;  1HNI B;  4Y34 A;  2HND A;  2ZEJ A;  3UI3 A;  2CJ9 A;  4MKY A;  3SIP B;  4YDX A;  4CO3 A;  1X9W A;  4Q7A A;  3Q8S B;  3OLA A;  2V2V A;  2LQB A;  2P9C A;  3H40 A;  1NK5 A;  4RBU A;  1IJF B;  1FDN A;  2B9E A;  3TQ1 A;  4CTA A;  4EBC A;  2Z58 B;  3U1N A;  4DU8 A;  4PWD B;  2DHA A;  3CPW R;  2CVE A;  4W98 A;  4J9S A;  1SJ3 P;  1CEZ A;  4HI2 A;  1IKY A;  3S6E A;  3DLL Q;  1BY9 A;  1RE1 B;  3C6T B;  4EK2 A;  5IT0 A;  1TK0 A;  1M5S A;  3HHE A;  4K59 A;  5L46 A;  5GAD U;  2NZ4 A;  3NNH A;  1M5V C;  1OYD A;  5HMW A;  1AFI A;  4OI1 A;  3CIM A;  2J6U A;  2AJ4 A;  2AMC B;  1Y9O A;  1NPP A;  4P71 A;  3CCV S;  1CVJ A;  1Q7Y T;  3BF4 A;  1SJR A;  3FVY A;  4WE1 B;  3DMJ A;  2C2N A;  4RW7 A;  3HX9 A;  3ONQ A;  4I67 A;  2VA3 A;  3F0N A;  2DO4 A;  3MM5 A;  2QMU B;  4QJV A;  5T41 A;  3UVJ A;  5J2M A;  2MJU A;  5HMZ A;  2HNZ B;  4NLU A;  2QEX S;  3C16 B;  3PXG a;  3TR5 A;  1WHX A;  3NEK A;  4ID5 B;  2J8S A;  3GR0 A;  5AXK A;  2DK2 A;  2LA4 A;  3DRP B;  2OJ3 A;  1SKU B;  3H2V E;  1GFW B;  4ZHR A;  2BQU A;  1REV A;  1NJZ A;  1KLM A;  3PAC A;  4HDG A;  3DU5 A;  3PV8 A;  3X3U A;  4AL5 A;  4M5D B;  2GGP A;  2DGO A;  2R7X A;  2DXE A;  4WFA Q;  4IH5 A;  1HW8 A;  1SIW B;  3V4I B;  4WP9 A;  4YR0 A;  4FDF A;  1SQG A;  5HVG A;  1AUD A;  3AAW B;  3TJ9 A;  1JJH A;  3BR9 A;  2VIC A;  4IH6 A;  1U26 A;  1I6J A;  4FBT A;  2BRK A;  3A3P B;  3ADA C;  4BLG A;  4C11 B;  1TU0 B;  2G0C A;  3JSM A;  1PG5 B;  4AXJ A;  1U24 A;  2JX2 A;  1KTQ A;  4TQS A;  3KLE A;  4XPC A;  4J9U E;  4P9S A;  3CJR A;  4Y2K A;  1HI1 A;  2OEL A;  4U7C A;  1Y5L B;  3OTO J;  4B3R F;  1TUV A;  3HJF A;  2C42 A;  3TUP A;  2OKQ A;  3BO2 A;  2UUA F;  2NXU A;  1U09 A;  4DV0 F;  2GZO A;  1LKZ A;  3WDO A;  1VLO A;  1K1Q A;  2CQH A;  3NMA A;  2NXJ A;  3K5O A;  1WEY A;  2B7B B;  3IR7 B;  4ZCK A;  5MAO A;  2YKQ A;  3CJT A;  3T5L A;  1Y3J A;  4P73 A;  2VH7 A;  3UN5 A;  3PW2 A;  5A0Y A;  1FDB A;  2BBE A;  2ZIT A;  4DR3 F;  3MMJ A;  4ELT A;  4ZP9 A;  3MR5 A;  1XWL A;  2HS4 A;  2CWK A;  3SQO P;  3DOM A;  5HAN A;  2PII A;  5I3U B;  4CNZ A;  2EW9 A;  3D1O A;  5KG2 A;  1VQ8 S;  2M70 A;  4LJM A;  5AXM A;  4HYK A;  3OR1 A;  2XY7 A;  5JUM A;  3TI0 A;  4L3N A;  3I87 A;  5HSP A;  2DRA A;  2WK4 A;  5ETL A;  4KO0 B;  4O3N A;  4F3O A;  2G13 A;  1QAJ A;  1F2G A;  1UA1 A;  1B7F A;  2H5I B;  1IBM F;  1KHW A;  2BVZ A;  1UW4 A;  3CW2 C;  4YQW A;  4R0J A;  3CB4 A;  5K5M A;  1REG X;  1RAD B;  2BAB A;  3M8R A;  4X62 J;  1RTD A;  3D28 A;  1S0V A;  3RZA A;  3HF5 A;  3IGN A;  1KVJ A;  5F8G A;  2X3G A;  4R25 A;  4G1I A;  4RKU C;  4OLO A;  5L9X A;  1NO8 A;  3CJ3 A;  4I68 A;  2VV5 A;  4KGM A;  4W4M A;  2KYX A;  3IC1 A;  1IWA A;  1RT1 B;  5C25 A;  2OAU A;  1H2V Z;  1T05 A;  3EZU A;  2HZV A;  4TU9 A;  1RK8 A;  4D3G A;  1RB0 A;  3DOK A;  2BEF A;  1WOR A;  2V94 A;  3MMC A;  1ZM4 A;  1T95 A;  2Z4P A;  2D1C A;  4C6A A;  5KT6 A;  1UJ5 A;  3QSY B;  3BKU A;  4WIQ A;  1RAH B;  1R43 A;  2O5D A;  4ECQ A;  3KLG B;  1UTA A;  4ZVR B;  2XS5 A;  2ACY A;  2EI5 A;  2HW3 A;  2DIS A;  3I96 A;  3N4W A;  3MWB A;  3ZTP A;  1N5Y B;  3NL0 A;  2F9J A;  3V2U C;  5B0D A;  3Q8V A;  2BKO A;  1WF0 A;  4PWW A;  1N8R T;  1CQM A;  1KD1 T;  4WP3 A;  2Y9H A;  2V8V A;  1VRU B;  1J5O A;  3ULH A;  4C9D A;  5FJ4 A;  1QE1 B;  3JTO A;  3M32 B;  2CPX A;  2V4J B;  1CUL B;  1O5J A;  4LIR A;  2ADB A;  4ECS A;  2OP5 A;  2CPH A;  2OPR A;  1YI2 S;  3VAJ A;  2B56 A;  4L73 A;  1PJ6 A;  4CT8 A;  2FJV A;  1FWL A;  5L1K A;  1VK8 A;  2XYP B;  3K5P A;  1KBR A;  3EGV A;  3P4U B;  3EX7 B;  3GB0 A;  4CH0 S;  2J0Q D;  5IOL A;  4AQY F;  2HMI A;  2HQF A;  1DLO A;  4DS4 A;  1OIA A;  5DM6 Q;  1IKY B;  3PW5 A;  2GQQ A;  4WFZ A;  3RU0 A;  3QLH A;  5EDW A;  3H2U B;  1IR2 A;  2K1R A;  1N6Q B;  3T41 A;  3GFX A;  2OIH A;  2Z2M A;  2DHG A;  5ETT A;  3T1H F;  2UP1 A;  3H2L A;  4DPT A;  3C3L A;  3HDS A;  1VGY A;  4RW4 B;  2N3O A;  1FD2 A;  2WZ1 A;  1MU2 B;  2YX4 A;  3NRB A;  3IBW A;  1X0F A;  2KZM A;  3KG1 A;  3DU6 A;  2BJ7 A;  3PTW A;  3MM6 A;  2MGZ A;  2J7W A;  1FVS A;  1PYO B;  2BZ2 A;  2U2F A;  3CJ2 A;  4I6Y A;  4ZVQ B;  1X4G A;  2DVI A;  1J27 A;  3CCT A;  3MMA A;  5DJB A;  3W64 A;  5F8H A;  2F4V F;  4FNI A;  2I38 A;  2KT2 A;  4GRS A;  4K4Y A;  1GH8 A;  2APO A;  1VQ7 S;  2VB6 A;  4QYZ K;  4TU7 A;  4KRW A;  4LRA A;  2OPQ B;  4OI3 A;  3UCG A;  4QPT A;  2V4Q A;  1M5P C;  2VJV A;  4AL7 A;  2WVC A;  2ZKU A;  5KG5 A;  2R2T A;  2L9D A;  1UW9 A;  4CYU B;  4EO6 A;  2YNH A;  1RZM A;  1DUR A;  1FKO A;  1FRL A;  3DOL A;  3ZXW A;  1GMW A;  4IFV A;  5K14 A;  1TL4 A;  2FQQ B;  1PSD A;  2HK2 A;  3CJQ A;  5CQG A;  4ED0 A;  2PI5 A;  5H9F K;  3SMZ A;  4B3T F;  4YHH J;  4OV6 A;  2OO4 A;  2ZC3 A;  1FCA A;  1XR6 A;  1RHR B;  4YFU A;  2RQC A;  5J2Q A;  4NCG A;  4LIW A;  3DLK A;  1RTZ A;  1TAQ A;  3GFZ A;  3VZI A;  3WIV A;  3JSM B;  2QJ3 A;  3K2Y A;  4LSL A;  5G0R A;  2OTJ S;  1Z4U A;  1IKW B;  3TUJ C;  4YOE A;  3MM9 B;  2CQB A;  2F3J A;  3DLG B;  2W7A A;  3G8Q A;  1NLK L;  3JSY A;  4IG3 B;  3KKF A;  4ZPW R;  3TAM A;  3ZZZ A;  1JLA B;  4V1A k;  1F2H A;  3U1L A;  1S99 A;  3DRR B;  1VIS A;  4OYO A;  1TQL A;  2W9B A;  4O0I A;  3CC7 S;  5THW A;  1VYA A;  2ZZM A;  1ZM9 A;  2ZFH A;  1VOM A;  2DGT A;  4MYT A;  5KFN A;  1P1L A;  4C0O C;  1WC3 A;  2R8K A;  1IR1 A;  5G4D A;  2FLL A;  4PAA A;  2PC6 A;  3UFC X;  3MD1 A;  3KJV A;  1HNW F;  1N48 A;  4I2P B;  2A6M A;  2BJE A;  4TU8 A;  4ZP8 A;  5HMY A;  4ZVO B;  3R7N B;  2ZH2 A;  4ED2 A;  4ED6 A;  4J9O A;  3A8I A;  2KO1 A;  1RA7 A;  3DKD A;  3O5T B;  2OHD A;  4DV5 J;  3V6D B;  1PJ5 A;  4IRC A;  2HVI A;  3NBP A;  3OR2 B;  4ANE A;  4Q5V A;  4UOH A;  4UOG A;  2NYH A;  3DDI A;  1LWX A;  2Z2Z A;  2EWH A;  2FGO A;  1SJQ A;  2GJ2 A;  3IR5 B;  3MR2 A;  1P1T A;  4LUB A;  4F7V A;  4V19 J;  1B64 A;  1WEZ A;  2GAG C;  4TY8 B;  1RU2 A;  2GVD B;  3NKY A;  3D2W A;  3KTQ A;  3OV7 A;  3SZ2 A;  4DV3 J;  3HSZ A;  3M8W A;  1TZ0 A;  2MKS A;  3BM7 A;  8RUC A;  3VAM A;  4DV1 J;  2LDI A;  1S0M A;  3NNC A;  2FC9 A;  4IH7 A;  2OFH X;  3QNW B;  3CDW A;  4Y28 C;  1R8A A;  4ANC A;  2QA4 S;  3MGJ A;  1RWV B;  2JFK A;  2CPY A;  1HYS B;  3CCM S;  4RJV A;  4JBC A;  4BWM A;  2DO0 A;  3ET6 A;  1HW9 A;  3P5T L;  5D0G A;  4HL9 A;  2Y1I A;  2MZQ A;  1S1W A;  1VI7 A;  3AJD A;  3PO4 A;  3GG0 A;  2EFV A;  4OMF G;  4P72 A;  3CCQ S;  2ZH6 A;  2FY1 A;  4MMO A;  1RLD A;  1KQK A;  5CCM A;  1KDN A;  4HTI A;  4J9P A;  4EO8 A;  1TK8 A;  2CQG A;  4LF9 J;  1KKH A;  4NXM J;  3Q22 A;  3PEJ A;  1FJC A;  4U8Y A;  2VUG A;  4NLY A;  1JX4 A;  1T8E A;  4GVL A;  1RWO B;  1CG2 A;  2GHP A;  1XMO F;  1NJW A;  2NXE A;  3FC9 A;  2CWX A;  1KEK A;  2VQF J;  1BQN B;  1Q5Y A;  4NLT A;  1R3N A;  2P6S A;  5KT2 A;  2YBV A;  2XSF A;  3OL7 A;  2BJ3 A;  2XO7 A;  1VC6 A;  1SKW A;  3NP5 A;  3KLH A;  3M8P B;  3HI9 A;  2X7I A;  2J9E A;  3VVU A;  3F41 A;  2G2O A;  3DCA A;  1VHI A;  3SCK E;  3SSR A;  2Q6C A;  4C0H A;  1I5O B;  2CZ4 A;  2UV8 G;  1Q53 A;  2LEB A;  3RR8 A;  3G82 A;  4CO4 A;  2XGP A;  2A10 A;  1U1L A;  2NPI A;  4EEY A;  2IIH A;  4GVB B;  4N77 A;  1Y00 A;  3KNG A;  3RR7 A;  3L95 X;  4MIA A;  3H90 A;  1WHY A;  1S76 D;  2W8L A;  2JEG A;  4PYD A;  1N5Q A;  1SH2 A;  3DXS X;  5A6P A;  5I4M A;  2DNG A;  2HGM A;  2RDI A;  2FHM A;  2J7U A;  5A8K A;  1T9W A;  1SPB P;  4PCQ A;  2KFN A;  1MWY A;  2XMA A;  1RT7 B;  5ETV A;  4Z7C A;  3H42 A;  3V6H A;  2CXE A;  2R42 A;  2VG6 B;  4C4W A;  1JWW A;  4X4P A;  1S1X A;  1YHQ S;  4WF9 Q;  2IVY A;  1VBY A;  1WKJ A;  2CVI A;  5F41 A;  3A8J A;  2FGC A;  4ALZ A;  1XJW B;  3QT7 A;  4RW4 A;  4KB7 A;  3NGS A;  4XAK A;  2FVS A;  3O2I A;  1P27 B;  3GQC A;  1HQ2 A;  1YKW A;  2AZ3 A;  1N36 F;  4OZ5 A;  4MT1 A;  1JNZ B;  1N88 A;  1UP1 A;  1P6T A;  3Q23 A;  1NCL A;  1HNV A;  2ZM6 F;  4H4K A;  2CZV C;  3FNN A;  2LDY A;  3HZG A;  3DI6 B;  3T9N A;  2F63 A;  2OSR A;  4U7U K;  4F3M A;  1TAU A;  1YJ7 A;  5C42 B;  4KGK A;  3ISN C;  2IHR 1;  4E8U A;  1C1B B;  3I56 S;  2WVD A;  2E5G A;  4YB7 A;  5AE2 A;  2MQO A;  1FE4 A;  3J7Z 5;  4ZP7 A;  1V5V A;  4CM0 A;  3T1H J;  2A1B A;  4QWA A;  1KTV A;  2RQK A;  1T9U A;  3N79 A;  3EJM A;  2BJ9 A;  3PRD A;  5HO4 A;  5D8H B;  3HMJ G;  4X4Q A;  3BO3 A;  2JVR A;  4JV2 A;  2DIT A;  3R6G B;  3TVY A;  4XO0 A;  3BO4 A;  2FVC A;  3GON A;  5D0R A;  2A0F B;  1DTT A;  4URG A;  3CJS A;  2RRA A;  3DFE A;  1XMQ F;  1G2E A;  3H4B A;  1J5E F;  1G6B A;  5CD4 H;  4P75 A;  3CGI A;  2AYM A;  3OFF A;  3LP2 A;  3LP0 A;  2KT5 A;  2XQC A;  1YRX A;  4JP8 A;  3SDE A;  2ZH7 A;  1EET A;  5C5J A;  5BR8 F;  4KQZ A;  4RNN A;  4LF6 F;  4LFC F;  3H98 A;  5H1S V;  4ZPD A;  1FJ7 A;  4X4R A;  3SI8 A;  3NCQ A;  2HNZ A;  1Q8L A;  4RW9 B;  4ILM A;  3PZP A;  1RAF B;  2YKM A;  5F8M A;  4O4R A;  2NQP A;  3H8Y A;  5ETM A;  5LMU F;  3A8E A;  4F26 A;  2QGF B;  2XMM A;  1NK6 A;  3W5Z A;  3MPU B;  1U6B A;  1A7G E;  1WF2 A;  2MZS A;  2OSQ A;  1RBO B;  1N52 B;  1UFL A;  1V9O A;  1X5P A;  3MI7 X;  3QWP A;  4MJK A;  2XCA A;  1F5B A;  4EBD A;  4P6Q A;  2ZNZ A;  3SQG A;  2IVM A;  4A47 A;  3FEZ A;  4RPF A;  1TV6 B;  1GNK A;  4TNO A;  1XIQ A;  3GYX B;  3MUM P;  1LNQ A;  5LM7 E;  4XK8 C;  4R8U B;  2QFJ A;  1EJ7 L;  5CYQ B;  4IOC Q;  2OMO A;  3M6V A;  3GYG A;  2BE2 B;  5EX0 A;  1TKZ B;  2EBG A;  4G1P A;  2KI2 A;  4NRT A;  3RBZ A;  5E3R A;  3PYE A;  4R5P A;  2AGO A;  5L38 A;  4RW8 B;  3MEE B;  2J6T A;  1KWM A;  1YSJ A;  2B5J A;  1KFD A;  2IDL A;  4B3R J;  4NML A;  1HYS A;  3CO0 P;  2YTC A;  1M90 T;  1VQ4 S;  5B09 A;  4X66 J;  3MED A;  4ID8 A;  4L6V 3;  4ZVS B;  3RAX A;  1XBW A;  3F73 A;  1S0O A;  3I0R A;  3W3S A;  1KN6 A;  3CD7 A;  3Q8U A;  4Q45 A;  1S7I A;  1WC5 A;  1YJ9 S;  4PQU A;  1FK9 A;  2MLZ A;  2EK6 A;  2UXC J;  2F8E X;  1AZS A;  3H25 A;  4FPR A;  2H1Y A;  1DAR A;  2VOO A;  1RYR A;  1V3S A;  2IJF A;  2DGV A;  4OHZ A;  4Q0B A;  5L1J A;  1HWI A;  1RTH B;  1FX4 A;  2R2S A;  2UVU A;  4JV1 A;  4IR9 A;  2D3Z A;  4ICL B;  2LXU A;  4HVZ A;  3HLU A;  3NMR A;  1HQE A;  3ZFV A;  1JLE A;  3I31 A;  1HI0 P;  2ZM6 J;  5GVQ A;  3PR5 B;  3MCN A;  3T5J A;  2MTL A;  3HHL A;  2ASY A;  3S01 A;  1CJT B;  3UDE A;  5DET A;  5EWG A;  1KQS R;  3V81 A;  4G3I A;  4C98 A;  1UVN A;  3ZZO A;  1ROF A;  1X4A A;  3A1Y G;  4DN9 A;  5EGY A;  1R31 A;  3DLE B;  3JXO A;  3OBI A;  5KT3 A;  1IQT A;  2CJB A;  2LVW A;  3F56 A;  3I0S A;  5D78 A;  2E9T A;  1S6P A;  1UET A;  3KUG A;  5I3P A;  4FYY B;  2J0W A;  2XG8 A;  2RJZ A;  1OY9 A;  3DHW C;  3K58 A;  1QDU B;  1S6Q A;  2FJE B;  1C4A A;  4QU7 A;  4G65 A;  2HIQ A;  2D3U A;  1RWK B;  1SXL A;  3UN2 A;  3QRQ A;  4X4N A;  1Q5V A;  2CPJ A;  2DIU A;  2OPS B;  2OML A;  5IC6 B;  4ZVG A;  4LFB F;  4QBU A;  9ATC B;  3Q0A A;  2W4P A;  1PAE X;  2XZD B;  2UXB J;  2ZE2 A;  1HBN B;  1LQ9 A;  2C2E A;  1WSR A;  1Y11 A;  2N4C A;  3GR1 A;  3HFV A;  5D4O A;  4OZ2 A;  4JI7 J;  3M6X A;  2C2K B;  4JV5 F;  3BQ1 A;  4RNH A;  2JNJ A;  3U1M A;  1SVD A;  2YKO A;  3JB9 k;  1S77 D;  1QLN A;  3NOG A;  1OPZ A;  3GPA A;  4FYV B;  4FZV A;  2D74 B;  3RJM B;  2MKC A;  5LMN F;  1FRM A;  2Y1R I;  1DTQ A;  1LWF B;  2V8H A;  3PIO Q;  2WVE A;  1MN7 A;  3TX0 A;  1UZH A;  1QUV A;  1SUQ B;  2V34 A;  3BGO P;  1ZBT A;  3C14 B;  2FJB B;  1KVK A;  1SC4 B;  4RO0 A;  4A8S A;  4OYX A;  4ED7 A;  5IQQ A;  1C1B A;  2HVE A;  1UEK A;  3G86 A;  2GML A;  4FVC A;  2W2N P;  1S9G B;  1PKU A;  2DGU A;  2EVZ A;  3LAK A;  4A8Y A;  4E2F B;  5KFJ A;  2EC2 A;  4JV0 A;  5DG8 A;  4LFB J;  2HGN A;  3R7S B;  2AD9 A;  2LQ8 A;  1HBM B;  1HPZ B;  3OD2 A;  4I7F B;  5KFU A;  5MLC V;  1VQ9 S;  1FI4 A;  4EZ9 A;  2XS7 A;  1UJ6 A;  4ZMM A;  2Q6B A;  1YBA A;  4HHJ A;  3M1V B;  5DG9 A;  2HIY A;  2R7O A;  1TUW A;  2E1A A;  2BJ1 A;  1P9Q C;  2IVF B;  2IAJ B;  3OXL A;  1R8C A;  5D4P A;  1D9F A;  4TVA B;  3UNY A;  1OSD A;  1HNX J;  5IT9 U;  3UW1 A;  5KFW A;  3BQ2 A;  3MUV P;  2HS0 A;  4GKK J;  5F8N A;  2XTJ P;  2Z2L A;  1RWW B;  2FDN A;  3QGG A;  3HPO A;  3T1Y J;  2GX8 A;  2BW2 A;  3LWL A;  2ZC4 A;  5IXU A;  4OZN A;  3FRZ A;  3C6U A;  1JKH B;  3EVM A;  5DQH A;  1C4C A;  1URR A;  3UDL A;  4YB5 A;  1FEH A;  2V2Q A;  2BAN A;  4CZC A;  5CXT A;  4NLW A;  1DRZ A;  1TKX A;  2M8D B;  1LW2 A;  1B70 B;  4F4A A;  4DX5 A;  4JI5 J;  2B4U A;  1V5I B;  5L39 A;  2ZD1 A;  3M2V B;  5KFH A;  4RWW A;  3LGH A;  2IC3 B;  2OPP A;  3OHA A;  3HT3 A;  1IM6 A;  3IM8 A;  1F5C A;  4K4V A;  3ENA A;  2MJN A;  1NKB A;  3A3O B;  4TQR A;  4F2R A;  1QTM A;  3LF0 A;  2MB0 B;  3CME S;  4B3S J;  5LMU J;  1S72 S;  4E98 A;  5H9E J;  3O44 A;  1NSQ A;  4TLR A;  4NEZ A;  1YGY A;  4PG6 A;  4NLQ A;  5KFV A;  4ILR A;  3QAE A;  3NWR A;  2DTJ A;  3QJL A;  1DZ5 A;  4TYA A;  5B0G A;  3AFG A;  3E01 B;  3TA1 A;  1TR0 A;  3PJX A;  1L3T A;  1NJI T;  3D1Q A;  3FFI B;  4FF3 A;  3QO9 A;  3HKW A;  4A8O A;  1HQU B;  3J7Y U;  2ILY A;  3KDN A;  3LTO A;  3AOA A;  5ETR A;  1U1M A;  3CCE S;  4B3T J;  2DHX A;  1AXQ A;  2BXJ A;  3P8B B;  3ETM A;  4QIW D;  4WK3 A;  4ZPB A;  2KRR A;  2UUB F;  4WP8 A;  2RQ4 A;  1RXO B;  3HHK A;  3LH2 S;  4USK A;  5GAE I;  1BWE A;  5BJR A;  4NLO A;  3FCV A;  3C19 A;  5KFI A;  3W61 A;  4GC7 A;  3MTK A;  5K20 B;  1FNO A;  3KJV B;  4MIW A;  4X4T A;  4G1Q A;  1W2B R;  4O0N A;  3KLV A;  3VAH A;  3UCU P;  3BBB A;  4OZJ A;  5GAG I;  1RTH A;  4P7T A;  4ED8 A;  2VA2 A;  3C66 A;  2OEM A;  1S49 A;  3D67 A;  2GIR A;  3LGN A;  2DKO B;  3MZI A;  2GVZ A;  4PUO A;  3EE3 A;  2QC3 A;  4LRB A;  3KFW X;  2HFN A;  2ACM A;  3ILL A;  5HJX A;  4PR6 A;  5GAE U;  3J80 U;  3CUN A;  1VRT B;  3THV A;  4C8O A;  2DH7 A;  2CIM A;  3N01 A;  1RYS A;  2DYA A;  2WHO A;  2YWH A;  3TAN A;  2F65 A;  1Q7L B;  5ETO A;  4ETZ A;  1TKT A;  3GIL A;  2RNE A;  5T7L A;  2FHJ D;  1AT1 B;  3NGT A;  2VL1 A;  4LFC J;  1EQM A;  2YQ0 A;  2MKY A;  2GS8 A;  4DSL A;  2HRT A;  2AP6 A;  2IA0 A;  1RCX B;  1HWK A;  1TVR A;  3RRK A;  1H98 A;  1F6T A;  4MFB A;  4RUA A;  1HWJ A;  3TW0 A;  5EHH A;  4PXC A;  2VG7 B;  4ECT A;  1ZET A;  2YXL A;  4ZKA A;  2Y3Y A;  3N6M A;  3AA9 A;  3C8Y A;  2QT7 A;  5KFK A;  5J1N A;  4MTP A;  2F4F A;  1I3O B;  1OQ6 A;  2W2O P;  1M1G A;  3PG9 A;  5K9F A;  2BE9 B;  2EFG A;  4URS A;  5DDP C;  4A8W A;  2PI4 A;  3M6W A;  1ZM3 A;  4OIX A;  3J81 j;  2ZH3 A;  2DPJ A;  3PY8 A;  4JI8 F;  3GII A;  4JI4 J;  3MCM A;  1RT3 B;  1DQA A;  1JLG A;  2OEJ A;  3PM9 A;  1NSA A;  1BMQ B;  2IM3 A;  5D0H A;  4XIU A;  1K44 A;  2KM8 C;  2HBY B;  1VC0 A;  2MHN A;  2D9O A;  4KIA A;  4KV8 B;  3CDE A;  1WDD A;  2HQ3 A;  4I1T A;  2NXN A;  4UW2 A;  1UVM A;  3DYA B;  5DDR C;  4CLF A;  4ES1 A;  3PKY A;  2QIF A;  1LW0 A;  3CSK A;  3KLH B;  2IM0 A;  2POK A;  1WTF A;  4QQB A;  5DM7 Q;  3W9I A;  2AEM A;  3GJQ B;  1PCA A;  5L9N A;  1RU1 A;  1L3K A;  2W9A A;  1BD6 A;  1EQ0 A;  4DHV A;  1H7W A;  4IRK A;  3EZ5 A;  4P52 A;  4B3O B;  2F7V A;  4DV6 J;  1ZZN A;  3TYT A;  2UXD J;  2ATL A;  1C0U B;  2VC0 A;  3O6Q A;  4NOH A;  5J1P A;  3AXK A;  2ASL A;  1HD1 A;  3R9L A;  1RBA A;  4ES3 A;  3EPI A;  3J7A N;  2VIH A;  4WBF A;  1MRO B;  4WCE Q;  3MXH P;  2CQ4 A;  1CQN A;  2AKW B;  5A8K B;  2QSF A;  2DXD A;  5A8W A;  9RUB A;  4YEA A;  3CXC R;  2YPY A;  4QWD A;  1RUS A;  5M2P A;  3QZ8 A;  5FDL B;  1LWC B;  1FRH A;  1WKK A;  2A2D A;  2NLW A;  3IG1 A;  1S1V B;  2IJN A;  1ZH5 A;  4CH7 A;  5K8N A;  3DRS B;  1U49 A;  3C46 A;  1APS A;  1U0H A;  3CD6 S;  2BUN A;  3BN7 A;  5M2U A;  1HNV B;  3RB0 A;  2HFO A;  1HIY A;  3GIK A;  4LFA F;  1BE4 A;  2RSQ A;  2F9D A;  4S0M A;  4AUK A;  2YX1 A;  2VQE F;  1RT4 A;  2L48 A;  2VQF F;  3DN9 A;  5BR8 J;  1XMO J;  4QOT A;  4CTA B;  5IWA J;  2R2U A;  4DR3 J;  2AYB A;  2ZD1 B;  1BGX T;  4JUZ A;  4WYW A;  5HQ8 A;  5AJ3 F;  5HLF A;  3OVS A;  3ILJ A;  1J2V A;  2Q43 A;  4OX8 A;  3HHL D;  4ZJO A;  1T03 A;  1WC4 A;  4Q43 A;  2VPZ B;  2KVI A;  4DR1 J;  2WCX A;  2YKA A;  4OI4 A;  3UR3 C;  4DQR A;  1Y10 A;  3W2W B;  4DR5 J;  4M1K A;  2J9C A;  3B78 A;  3IAS 9;  3OJU A;  1NB2 A;  4YS2 A;  1U1O A;  4NCA A;  2GJI A;  2VPX B;  2YWG A;  2OD4 A;  3BR8 A;  2FJW A;  1QUP A;  2BOA A;  3PW7 A;  1RJJ A;  2WOM B;  2AHO B;  1WOO A;  4PEO A;  2FVQ A;  1NND A;  2QN6 B;  4DV1 F;  2VOP A;  2ZDO A;  1NEE A;  1X5O A;  3FKB A;  4I64 A;  4N56 A;  3Q86 A;  2M5Y A;  2WSE C;  2Z57 B;  2RDD A;  1S9E B;  1HWL A;  1H72 C;  4RL1 A;  4DR1 F;  4N8N A;  2XC9 A;  1HNZ F;  2YNI B;  2KHC A;  3B8H A;  4L3K A;  4Y6I A;  5ETQ A;  4DR4 F;  2MLX A;  3KUH A;  1Q8I A;  1NK9 A;  1XMQ J;  1T7P A;  3Q2S C;  4WPA A;  1K47 A;  1RA6 A;  3MEC A;  3HXM A;  4G1Q B;  1ZA1 B;  2DCL A;  2OGU A;  1MG7 A;  2CNN B;  2JWN A;  5HQM A;  3QJJ A;  4PPZ A;  4U67 Q;  4LSN B;  1HBU B;  3MHY A;  5EUH A;  5DG7 A;  3T6B A;  4LFA J;  3TVK A;  1RI7 A;  2JVO A;  3IBC B;  3NS5 A;  4O4G B;  3MPV A;  3ZZ0 A;  3HSD A;  3HVR A;  2L3M A;  2V8D A;  2VZ9 A;  2KU7 A;  4ITS A;  5CD4 A;  3G6E S;  2AGP A;  1IXK A;  4NLG A;  3CUL A;  2RF2 A;  1RSC A;  2CNO B;  4YR2 A;  5HRO A;  2DGW A;  1JLF A;  1FWP A;  3IRX A;  1VLY A;  2VDH A;  1VBX A;  4C8L A;  3VWS A;  3I4P A;  2DB1 A;  2L41 A;  3T1A A;  2NSC A;  3LAL A;  3QPI A;  1NK7 A;  4C8N A;  3PIP Q;  1T9T A;  4ECZ A;  2O01 C;  3C15 B;  2H4Y B;  2M8H A;  4L76 A;  3FSY A;  3ZZY A;  3AD9 C;  1T9V A;  4J7C A;  2E9R X;  1N5Y A;  1VS3 A;  2RU3 A;  2CPE A;  4K4S A;  2WVF A;  3D7S B;  4OHW A;  4F3Q A;  1MSW D;  2SXL A;  2AJ2 A;  4IQX A;  4PWD A;  2OLW A;  1NSK L;  4CRJ A;  4IDK B;  5LMN J;  4NLX A;  3VCD A;  3CCS S;  2R7Q A;  4IOA Q;  2XYG B;  3D1H A;  3L9Z A;  2CKW A;  4Z7Y A;  2ZH9 A;  5IT9 Y;  3M30 A;  1RT3 A;  1DJ0 A;  1NH8 A;  2V5H G;  1S0N A;  2RD5 C;  3UR0 A;  4FPI A;  4YB6 A;  4RUC A;  4NMX A;  2UUC J;  3KWM A;  4K2X A;  1KQG B;  3B54 A;  3HVA A;  8AT1 B;  1X4B A;  4B9U A;  2GQ2 A;  2F4V J;  2J0S D;  3K7R A;  1HLW A;  1SV5 B;  2K3I A;  1U6F A;  2W2P P;  4B17 A;  3ITH A;  1HQE B;  1X4D A;  2JJ4 D;  1VQN S;  5KT7 A;  4PXD A;  1S5Z A;  1JLE B;  3GCX P;  1PGZ A;  4DV4 J;  1VQO S;  2A18 A;  2CAD A;  4JI8 J;  3MM5 B;  1WG1 A;  4O3O A;  3OUY B;  4RWX A;  2W2Q P;  3BZQ A;  3B82 A;  2BJD A;  3MCS A;  2YPZ A;  3J81 Y;  2ZKT A;  5IFM A;  3R2C J;  2F40 A;  3KHG A;  3W63 A;  3X1L B;  1JLQ B;  1U02 A;  1NKE A;  1ZS6 A;  1VQP S;  4NZ6 A;  4LRE A;  2ZDP A;  4NLD A;  4DL0 C;  5HI7 A;  3BBF A;  4OJH A;  4OLP A;  3L3C A;  3HT0 A;  3WIU A;  3MM6 B;  2KXF A;  5IM0 A;  2MGZ B;  4X84 A;  2XBP A;  2ZJP Q;  5KT4 A;  2FUG 9;  2KH9 A;  3MMA B;  4UQG A;  1M5K C;  2FLN A;  1OQ3 A;  2DH9 A;  3MM8 B;  4O44 B;  1UWB B;  3J7Y I;  2I5J A;  5D77 A;  5HBM B;  3WZ0 A;  1MLA A;  1TL7 B;  2KB2 A;  1RBL A;  3KNA A;  2CAJ A;  1HMV B;  3UNG C;  4ZIW A;  2JEJ A;  2B0G A;  2XSJ A;  4USW A;  1HNW J;  4J5O A;  4KH1 B;  2DEJ A;  2W24 A;  4NI2 A;  2NSB A;  2VAS A;  3H5U A;  2XLI A;  3C14 A;  4UF4 A;  3LOU A;  3IM9 A;  2RS8 A;  4LVO P;  3W2V B;  5J2Q B;  4DR5 F;  1SH3 A;  4OV1 A;  4CO2 A;  4H4O B;  4LR8 A;  1R0A A;  1R0B G;  2RKI A;  1JK9 B;  5KG4 A;  2C2Z B;  3WBZ A;  5F3Z A;  4Q2M A;  2JDJ A;  2HVH A;  3DLB A;  5AJ3 J;  1C1C B;  1EAY C;  4TXS A;  5KFL A;  3FK4 A;  4PRF A;  1SC1 B;  1TL5 A;  1RT2 B;  4BC7 A;  3ENW A;  1HNZ J;  2VQE J;  1S1U B;  1PYT A;  4DV0 J;  1EHW A;  4I2Q B;  4M8L A;  1R7I A;  3QGI A;  2LEP A;  2DNQ A;  2YWF A;  1BQM B;  3H20 A;  2CDR B;  3C16 A;  4OJG A;  4OX6 A;  5E3C A;  5F8L A;  2MYF A;  1JXL A;  4LF4 J;  4PAB A;  5EN1 A;  2EG2 A;  4KGV B;  2G0J A;  3M2R B;  2HQD A;  3CCJ S;  5HQL A;  2G2Z A;  4HLB A;  4AT1 B;  5HMX A;  3CCR S;  1KVI A;  4X4U A;  2B9X A;  2LMI A;  3PYF A;  4IO9 Q;  1LOU A;  1YBU A;  4NA3 A;  2GO9 A;  2YNH B;  2MZ1 A;  2ZOF A;  1DQ8 A;  2QYG A;  1I51 B;  3DOL B;  3F44 A;  3MEG B;  3I9V 9;  1NH7 A;  4NE9 C;  2VFU A;  4NXN F;  2E9Z A;  5ETP A;  3G8S A;  4PZV A;  3GSI A;  3MMC B;  4WJB A;  1JXE A;  3ZZU A;  2OPP B;  3AB4 B;  2DRD A;  4L74 A;  2G9O A;  4O4G A;  3VAL A;  5J2N A;  2XNR A;  1ZZF A;  2GIF A;  2QLB B;  3FQK A;  4NCG B;  3Q8P B;  1ZAV A;  4DUZ J;  3H5X A;  1VHF A;  1UMJ A;  2W2M P;  3EIC A;  2AJF E;  2DNL A;  2FD2 A;  2LA6 A;  1CJU B;  4LF7 J;  2RUG A;  4B9T A;  1RAB B;  3AH6 A;  2BKP A;  2DHH A;  4AQY J;  2E1R A;  4DLE A;  3PDN A;  5D3G A;  2CG4 A;  2DNK A;  2GO8 A;  5C2C A;  5A2Q Y;  4XTT A;  1E6V B;  1YDL A;  1TFY A;  2ZUG A;  2RB7 A;  1U0S A;  1H74 A;  3UD4 P;  2IDE A;  5F3T A;  4JV5 J;  2JEI A;  3OTE A;  3PFE A;  1E6Y B;  3TEG A;  3MMB B;  4GKJ J;  4KAI A;  5DLF A;  2E5H A;  4FF1 A;  2FZK B;  2KXH A;  4WZQ A;  1FXD A;  5A0Y B;  2GHV C;  1X7V A;  2CG8 A;  1VCT A;  1VJQ A;  3CC4 S;  2IY5 B;  3V5R A;  1JLC A;  3I5A A;  3TZZ A;  3G96 A;  3VV2 B;  4EBE A;  2BR0 A;  1D0E A;  1AA1 B;  1H3D A;  3FEX B;  3MFH A;  4USM A;  3P96 A;  2B51 A;  1CPZ A;  5I42 A;  2HQC A;  4RW6 B;  3ZTO A;  2GJF A;  2NYI A;  1N36 J;  1R6V A;  3LQV A;  4ZN1 A;  3ZO7 A;  1F3F A;  4OI2 A;  3BB5 A;  4BBY A;  3D0I E;  1TL1 A;  1U45 A;  4DX8 H;  3RAQ A;  1L3V A;  1I94 F;  2K3K A;  4IFY B;  4NLV A;  4NCB A;  3GIJ A;  3RB6 A;  1RHU B;  1GTH A;  1NHK L;  2QL5 B;  4M5K A;  1JJ2 R;  2BDP A;  2RUS A;  4EYI B;  5D3G B;  2R7R A;  3NXZ A;  1LK7 A;  3D9B A;  3GV5 B;  1RTD B;  4C11 A;  2XCP A;  1HKA A;  2VPY B;  2XGQ A;  2XMV A;  2QA1 A;  3D54 A;  2XY5 A;  3ET6 B;  4AFF A;  1ZA2 B;  2KM8 B;  2GW8 A;  2P9G A;  2DR9 A;  2HHW A;  1YJR A;  5B0F A;  3IA0 A;  3Q8Y A;  3BQ0 A;  1Z2L A;  1RKJ A;  1RTJ B;  3DOK B;  1BUX A;  3GFY A;  3NLC A;  1WWH A;  4MFB B;  1ACM B;  4DI6 A;  4IG0 A;  5KFG A;  1NSP A;  3BH6 B;  1N5V A;  1HBO A;  3R27 A;  1RLC L;  1RWP B;  2EFO A;  4FVM A;  2QFI A;  1F9H A;  4USV A;  1R6Y A;  2DNO A;  2ZBP A;  1KNZ A;  3CJ5 A;  1RWN B;  2YVS A;  2R8G A;  1G7C B;  2O3D A;  2KFZ A;  4WFY A;  3W9J A;  1PYS B;  1RKI A;  3FRY A;  2I1R A;  1HMV A;  4K2J A;  4ZPC A;  1S57 A;  3PVX A;  1FER A;  1PIE A;  2QX0 A;  3ZTR A;  2MY8 A;  5C24 B;  1GXT A;  3I5B A;  4RLE A;  3VF0 B;  2JLE A;  1FA0 A;  2XWX A;  4NI2 B;  1B0P A;  3HO1 A;  3BYR A;  4P74 A;  4KHR A;  1ZTT A;  1NK4 A;  1VMB A;  1R89 A;  3KLF B;  1Q79 A;  3W2V A;  1H2T Z;  4Q0B B;  2YKN B;  2M7S A;  3I9Z A;  1WNE A;  1T0T V;  1YVF A;  3RUB L;  3W60 A;  1N54 B;  2K1R B;  1GAO A;  2DXF A;  2EFP A;  4ETX A;  1B7Y B;  5FLX U;  3CVK A;  3JTN A;  3KXD A;  4LF4 F;  2V67 A;  3A12 A;  1LWE B;  4M5G A;  3VHQ A;  3CC2 S;  1Q16 B;  4DL3 A;  3CJK A;  3R7B B;  1KLM B;  2NUH A;  4K4Z A;  2CJK A;  2LQ9 A;  2M0G B;  1SL1 A;  1NKC A;  2AIR B;  2B3T B;  4OJ3 A;  3C2P A;  5HAO A;  2F5G A;  4QW9 A;  2YKM B;  1NB7 A;  2KL8 A;  3ETO A;  3FMB A;  1OYE A;  2RH3 A;  1KHV A;  1Y0H A;  1JJC B;  4ZPV R;  3KJN B;  1AUS L;  2ASD A;  4RUB A;  1FDD A;  2IRU A;  4P7V A;  2Y1J A;  4OYI A;  2WRM A;  1SJF A;  1KRP A;  4DCO B;  2V4J A;  3MD3 A;  4DSE A;  1UA0 A;  4XDD A;  1S1W B;  1U6Z A;  3AOC A;  2DR5 A;  1CS4 B;  3DDK A;  4N47 A;  2YH1 A;  2ZHO A;  3BN4 A;  4OX9 J;  3PCO B;  1U25 A;  3CCU S;  2EEY A;  1C0T B;  2IRY A;  3ISZ A;  1RP5 A;  4CH1 A;  4IRD A;  3M8Q B;  2HS3 A;  3BS9 A;  2I8E A;  4CLY A;  3MPD A;  1VRQ C;  2M52 A;  2MKH A;  5KOW A;  4ED1 A;  2RIJ A;  3SSS A;  4USJ C;  5E41 A;  2COL A;  1M5O C;  1K8A T;  2JZ5 A;  3KK2 B;  3CCL S;  1NDC A;  2MDA A;  2KRB A;  2M9K A;  2WW4 A;  2XWY A;  3L09 A;  1V6H A;  2ILZ A;  3R5G A;  4J90 A;  1J5E J;  1WDT A;  4G6V B;  4KJI A;  1HA1 A;  2W4C A;  4KPC A;  1MU2 A;  4N76 A;  4X4O A;  4DZ6 A;  3OTC A;  2ZH8 A;  2NRE A;  1GMV A;  2ZVI A;  2R7V A;  2KKH A;  3DGP A;  1NHV A;  1NPR A;  3LP1 A;  4KFB A;  3BDP A;  4WTO B;  2G1D A;  1FFS B;  3HHD A;  3SYZ A;  2QLW A;  6AT1 B;  3K8W A;  2CA9 A;  3CF5 Q;  4A8F A;  1JLB A;  1RQ0 A;  5EX3 A;  3D0H E;  2CDQ A;  3NBP B;  3PJW A;  2KG1 A;  2CNK B;  2KVQ E;  1PBU A;  3AB2 B;  3PX0 A;  1N33 F;  3KLI B;  2HSE B;  2ALZ A;  1TV6 A;  2RE1 A;  3MEC B;  4JI0 F;  3QAU A;  4QIF A;  4C3M A;  4CNY A;  2MZJ A;  7FD1 A;  2ZH5 A;  2JRS A;  3N5B A;  3AD8 C;  2JH3 A;  2GVD A;  2DT9 A;  2WSC C;  4QR1 A;  3NNA A;  3TUI C;  3R8Y A;  2XI3 A;  4UTG A;  4O3P A;  1F0X A;  2KFY A;  3GU0 A;  2UUC F;  3JAM U;  2BYC A;  1WSV A;  4LVN P;  1LEO A;  3MEE A;  2X3D A;  4KTQ A;  5IV3 A;  1QSY A;  4K0K F;  3US5 A;  1XNR F;  1UZD A;  4JI6 F;  5JXS A;  4WFX A;  3K0J A;  1WJ9 A;  1NPK A;  4DFJ A;  4FYD A;  3TP2 A;  4DMZ A;  3MM9 A;  6FD1 A;  3VGV A;  1EIY B;  1YX2 A;  3UE2 A;  3BPS P;  4ES2 A;  4YB1 P;  2FZC B;  2VC1 A;  4ZLN A;  1NXI A;  3DRR A;  1RHM B;  2FVP A;  2ZE2 B;  1UJ4 A;  3EPG A;  3ZZR A;  4LF9 F;  2VFT A;  4CO1 A;  3R1H A;  2H51 B;  1NAQ A;  3KJF B;  2O1P A;  4WU2 A;  4CLZ A;  2W1B A;  1SKR A;  4B9M A;  1PAU B;  4NXN J;  4WYL A;  3NS7 B;  4A8K A;  1OY6 A;  3IGV A;  1WOS A;  3HCX A;  2QA2 A;  2WW8 A;  4MAK A;  1QM9 A;  1RAO A;  2IMO A;  2RAQ A;  2PD1 A;  2MXY A;  1IBM J;  4DR2 J;  2Z30 B;  1NUE A;  1X31 C;  1JNR B;  2CUY A;  4DPU A;  4PG5 A;  2E1M C;  4DCP B;  1FX2 A;  3GJR B;  2ROP A;  2XI2 A;  3D6T B;  5C24 A;  2VF3 A;  3QWU A;  5FD1 A;  2R7U A;  1RT6 B;  2V69 A;  1ZAW A;  2HEK A;  3EWG A;  5KFS A;  1IQZ A;  1IJE B;  1QTN B;  1R0C B;  2HNY A;  2YQ1 A;  1ELO A;  4Y65 A;  4ZLJ A;  3KK3 B;  1WOP A;  4ZLL A;  2FTR A;  2QRR A;  2KG0 A;  1NZ8 A;  3P45 B;  1OPI A;  3M1V A;  3HD1 A;  4DV4 F;  3OXF A;  4K4T A;  2CRL A;  1VC5 A;  4PKD B;  3LAN A;  2DBB A;  5KFM A;  3PHT A;  3QIP B;  4OHY A;  4Y2C A;  3VGS A;  3D5M A;  5KFZ A;  2DGS A;  3FSI A;  3MAQ A;  4X65 F;  5KG3 A;  5KFB A;  1F9F A;  2N7Y A;  2M88 A;  3TJ8 A;  3JQJ A;  4C97 A;  3OXG A;  5IQ6 A;  4ZCI A;  1RTI A;  4DBQ A;  3VAK A;  1S59 A;  4QR0 A;  5LSR A;  1S9F A;  1SC3 B;  1XNQ J;  3VGU A;  1U1N A;  1XC9 A;  2XYH B;  3DLH A;  3D66 A;  1Q8K A;  4EWT A;  2PO4 A;  5IM0 B;  2JC0 A;  2K8G A;  3EVW A;  4F50 A;  4H4K C;  1W26 A;  2Y1L B;  2YH0 A;  3UO0 A;  3ZNJ 1;  2YWK A;  5JJB A;  5GAG U;  4BCA A;  2GNK A;  2UV8 A;  4FBU A;  2GQC A;  4R5P B;  4C8Y A;  1B99 A;  4U6P A;  3K8V A;  5D6G A;  5LOQ A;  1MNE A;  3M7V A;  4JI2 F;  4DLG A;  1HHT P;  2AF6 A;  4B9L A;  1VBK A;  4H4M A;  4A4J A;  2D69 A;  3DM2 B;  3QRR A;  3P6Y C;  5CZX A;  1WD6 A;  4WXW A;  5SZT A;  4IG3 A;  4F36 A;  3RB3 A;  1S4E A;  3TAM B;  2BW7 A;  3G4S S;  4ZLP A;  3M8S A;  4HT5 A;  2AEF A;  5CYM B;  1C0T A;  4BS2 A;  1NDK A;  1HNX F;  2ZVS A;  2C2O B;  4DX7 A;  2V6A A;  2QL9 B;  4Y2I A;  1FF2 A;  2OFG X;  2JL9 A;  2LXF A;  3UVJ B;  4I2P A;  2CPF A;  1HHS A;  2QTW A;  4OZ3 A;  4NEY A;  2BJ8 A;  1L3S A;  4ZCM A;  4ID5 A;  4KBI A;  1KFS A;  2VPW B;  4ZN3 A;  3G71 S;  1X4H A;  4LF5 J;  1PC4 A;  2E44 A;  1CC8 A;  3SDE B;  1HWU A;  1YG0 A;  2FZG B;  3HHL B;  1JKH A;  4N8O A;  1N33 J;  4K8R A;  4PG4 A;  2EXU A;  3OFE A;  3QJP A;  3V4I A;  4JI1 F;  4DS5 A;  4HR2 A;  4KKO B;  1MML A;  1RCO B;  1V3R A;  5IC4 B;  3THP A;  2ZJR Q;  4J9N A;  1FKP A;  2DNY A;  2LP4 A;  3ZZP A;  2W8K A;  2HYI B;  4PQA A;  2DHS A;  4KY3 A;  4WXO A;  2RRN A;  3ICL A;  3UN3 A;  4Q2L A;  1FES A;  3EXY A;  4ZVF A;  4ECW A;  2KDO A;  2P9E A;  1IKV B;  3M9N B;  4DL5 A;  3M8Z A;  1YRU A;  3RBE A;  1EP4 B;  3HVT A;  4RBT A;  3EM1 A;  3PJ9 A;  1X9M A;  4TKT A;  4R8U A;  3MEG A;  3MOZ A;  3PYG A;  3R5A A;  1CJK B;  4GMK A;  3RBX A;  4ZDN A;  4YP3 A;  2U1A A;  2BE2 A;  2FVR A;  2KXN B;  4F67 A;  1KOO A;  3DLJ A;  1O8B A;  4HAC A;  2PEH A;  4KGZ B;  2AW0 A;  2HWT A;  4K5R A;  4OZL A;  4ATN A;  5J1E B;  3PW4 A;  1W25 A;  4DDF A;  3R5D A;  1M5H A;  2HND B;  4WTY A;  1B4S A;  2K7J A;  2VFS A;  2DNM A;  1YZ7 A;  4CO5 A;  5H9E K;  2DCU B;  4CLU A;  4JI4 F;  3OVB A;  5F8J A;  1HAR A;  5BYS A;  2KTQ A;  2O66 A;  3MED B;  3V4M A;  2NR0 A;  3CWJ A;  4BHQ A;  4NRU A;  3HM9 A;  4MK9 A;  3I0R B;  1WEL A;  2BKN A;  4KH0 B;  4A8Q A;  1SUQ A;  2H5J B;  2H5E A;  4U9R A;  2C3U A;  3SCJ E;  2VBY A;  4GO7 X;  1N0U A;  2WON B;  3TAR A;  1HFE L;  5HP1 B;  1KC8 T;  3KK1 B;  1H38 A;  1VQM S;  3A8K A;  3IBF B;  4NYO A;  2ASJ A;  4WKR A;  2AZ1 A;  3KJQ B;  1CLF A;  1S1T B;  3QT6 A;  2W7P A;  2KT3 A;  1CJV A;  4FF4 A;  1D8Z A;  5LSO A;  3B6B A;  4P2S A;  3DYA A;  4MKV A;  3ZTS A;  1M1H A;  5DRK A;  3S7R A;  3RBD A;  2B6A B;  4RW7 B;  3KHR A;  4EU0 A;  3D6M B;  5LJ3 Y;  1F60 B;  4M5M A;  2IAJ A;  4YY3 J;  4F4X A;  5AT1 B;  1F3V A;  4DPY A;  1CJT A;  2UZA A;  4LF8 F;  3I55 S;  4HHU A;  3FCH A;  1UPM B;  3RW6 A;  4DUY F;  3GTY X;  2RRB A;  1TL1 B;  2XLK A;  3DLE A;  2OI2 A;  5JMN A;  5A2Q U;  4QU6 A;  1DHM A;  3B4M A;  2UU9 F;  2MQL A;  1T05 B;  3VZH A;  4Y00 A;  1UVJ A;  5CH7 B;  5AXN A;  1R27 B;  1REV B;  3BYP A;  3NCP A;  2A3J A;  4E0D A;  2HFS A;  4X66 F;  2W4D A;  1QY7 A;  2C2M B;  1NDL A;  2D7S A;  1RAI B;  2H9Z A;  3WHI A;  4BC9 A;  1H2U X;  2XY6 A;  3HHN B;  3POT A;  2XMW A;  3M2V A;  2FLO A;  2XS2 A;  2Q1L A;  5C42 A;  1FK9 B;  3R97 A;  3VTI A;  3EDQ B;  3M4X A;  1Q78 A;  3N5F A;  4MKA A;  2XLJ A;  2BMB A;  3KYL A;  2WBM A;  3IG1 B;  3W5Y A;  1FTR A;  2AX0 A;  4JYA J;  2VJU A;  2C1E B;  4FP9 A;  4EI2 A;  3JSB A;  5KG1 A;  3MR7 A;  4DV5 F;  3CD5 A;  1L3U A;  3BEG B;  1VQS A;  4K50 A;  1NM2 A;  1T9Y A;  3PHE A;  1U2F A;  4GKK F;  5DZ7 A;  3RGI A;  3R6L B;  1HR0 F;  2R9L A;  2D3O 1;  1XEZ A;  2YY3 A;  3LUY A;  2B7C B;  3SBM A;  5GME A;  5A8R B;  5B08 A;  2ZZT A;  4B3M J;  3LPY A;  4B3M F;  1LFW A;  2C3M A;  3TZW A;  3EDR B;  3FFI A;  4M5N A;  3W9H A;  3PYD A;  1HQU A;  3IFE A;  4DUT A;  1S9G A;  4NYZ A;  3PO5 A;  2RHS B;  2HWI A;  3H0P A;  2AWZ A;  3Q89 A;  3KHL A;  4JI5 F;  2PEB A;  4LBP A;  3KUE A;  3JYT A;  1IBL F;  4FF2 A;  3I0S B;  4HI1 A;  1UL3 A;  4OQJ A;  1X60 A;  5KG6 A;  1C0U A;  4DSF A;  4JI3 F;  4FXW A;  1C2P A;  1S6O A;  1VIO A;  2V8P A;  5CYM A;  4DG1 A;  4YHH F;  2UVW A;  1FHT A;  1SB6 A;  2GMJ A;  2V2Z A;  2BX6 A;  4M5D A;  4CO0 A;  5IZH A;  2OH2 A;  3FUY A;  4DSJ A;  2E66 A;  3T19 A;  3L7O A;  3G6X A;  3D3B J;  2CJY B;  4RW9 A;  3TO8 A;  3W65 A;  2OUG A;  3FQL A;  4CLT A;  1KSP A;  4O3S A;  1YZ6 A;  2P6T A;  4IKA A;  5KFY A;  1BXN A;  4ECY A;  3CIZ A;  1YJN S;  3FBF A;  1Y7P A;  3L7P A;  4AND A;  1GX6 A;  4DL4 A;  3O8W A;  2PFF B;  3EGZ A;  4TYB A;  3TX8 A;  1U7L A;  2LU2 A;  5CHC B;  4J9V A;  1FRJ A;  1K1S A;  4IYQ A;  2OTL S;  3E51 A;  2ZH1 A;  3DHX A;  5T7L B;  2BAN B;  3W5X A;  4F4W A;  3SV4 A;  2XUL A;  1TL3 B;  1LW2 B;  2N3L A;  1RT4 B;  3QFH A;  4LR9 A;  2HHH F;  2N4D A;  2VFR A;  1WG5 A;  1YJU A;  2B4V A;  3MM7 B;  5LXY A;  1FO1 A;  2HKE A;  4NPO A;  2HAI A;  3QID A;  4MK8 A;  5E0O A;  3M9M B;  3ILI A;  3T9Z A;  2DIV A;  3SFG A;  4RNM A;  1X8D A;  2RVJ A;  3FZB A;  5J2P B;  3SSQ A;  5T14 A;  2HRY A;  1VFJ A;  3PFO A;  4LQ3 A;  5B0C A;  3W2W A;  1UEV A;  5L1L A;  1RWU A;  2V9K A;  3PRV A;  3GZ7 A;  3DOM B;  5I3U A;  4I7F A;  2Z8Q A;  3FGV A;  4LBI A;  4FXV A;  1T3N A;  4HAC B;  3J81 U;  1IKX B;  1AZS B;  3NOC A;  3R1L A;  2J9D E;  1VBZ A;  4JI1 J;  1CUL A;  5GAH U;  4F4Y A;  2D9P A;  2AT1 B;  2ALY B;  1Y3K A;  2J5A A;  4DWI A;  2HFU A;  2PDA A;  4M94 A;  3AJ2 A;  4BDP A;  4DR4 J;  3OL8 A;  2PA8 D;  4FNH A;  1D1U A;  2HHH J;  4UY8 T;  5AXL A;  5F9N A;  1R8P A;  3BDE A;  4IO1 A;  4DPW A;  1WHW A;  2MKK A;  3MUR P;  4HH1 A;  4U8V A;  3R5C A;  4TLQ A;  3QLH B;  1MWQ A;  2HHV A;  3OFH A;  2L9W A;  3DGP B;  3W62 A;  4GC6 A;  1N6Q A;  1FNM A;  5CCL A;  5BYR A;  4KFB B;  4YR3 A;  1S48 A;  3ILO A;  1VQ5 S;  4B3O A;  4IUF A;  8ATC B;  1HBU A;  1S6P B;  2ZWO A;  2HQI A;  5ETK A;  1WG4 A;  2MZT A;  2CQP A;  2YQ3 A;  4CWB A;  3N6L A;  4ZPA A;  2PFD A;  3HSJ A;  4DV7 J;  1IUJ A;  2W25 A;  2G4B A;  3J7A 1;  3VQT A;  3UCZ P;  1SQF A;  1QVG R;  2BOP A;  4I0W A;  3HK2 A;  1DBD A;  3DRY A;  2IBK A;  4DUZ F;  4QCL A;  1Z1Z A;  3CE8 A;  5CA5 A;  4ZPT R;  2OPS A;  1VIX A;  3DRX A;  3GWC A;  4I4B A;  4MH8 A;  4JI2 J;  4OYW A;  2HUR A;  4K4U A;  3KG4 A;  4ECR A;  2FYX A;  2OPQ A;  2LYV A;  3PW0 A;  3QQC D;  5KFF A;  2HFV A;  4DR7 J;  1JQG A;  4AD6 A;  1S1V A;  2BM0 A;  5LJ5 Y;  2AJ0 A;  3TAQ A;  4J91 A;  3C15 A;  1ZM2 A;  5HAT A;  2MQQ A;  3LGM A;  2PT0 A;  5E7O B;  1FKO B;  2B9W A;  4USI A;  3NGR A;  3RB4 A;  1ZTW A;  3OTB A;  1VQ6 S;  1S10 A;  2BM1 A;  4RZR A;  2DY9 A;  5GMD A;  4Y3C A;  4ECV A;  2Y8W A;  5EWF A;  4F0M A;  1IVZ A;  1FFW B;  5HLF B;  2UU9 J;  2CQ2 A;  1SKS A;  1Q82 T;  3FJ2 A;  2IJR A;  4CCH A;  2MKI A;  2P5V A;  3P49 B;  3AXM A;  2AV5 A;  2ERR A;  5A6W A;  3OR1 B;  1OS5 A;  2F1F A;  5IS2 A;  4X65 J;  1D9A A;  1FNX H;  3Q8R B;  4HTJ A;  1U47 A;  1LXN A;  2JFD A;  5A76 A;  3EMT A;  1R8B A;  3M6U A;  2DR7 A;  2ROE A;  4NLR A;  2HHU A;  2R7T A;  2A2C A;  2K06 A;  2QV6 A;  3WX8 A;  3UD3 P;  4P10 A;  1D9D A;  2UUA J;  4NA1 A;  1FVQ A;  2DR6 A;  2MQM A;  4KE5 A;  5A8R A;  4QW8 A;  2CQ1 A;  3FBC A;  4U7U D;  3FZ2 A;  3BGR A;  3QBC A;  4L75 A;  1IBC B;  4I69 A;  3I6P A;  4B3S F;  3J7Z T;  1XQI A;  2QL7 B;  1TMM A;  2P2C B;  2P8I A;  2HWH A;  3UDC A;  1U8W A;  2X1G A;  4MIB A;  4MYU A;  1N5S A;  1RGV A;  3OR2 A;  4UST A;  3THT A;  3K5N A;  1FJG J;  4ILL A;  4C7Q A;  1GXL A;  2YNG B;  4ZVT B;  3G8T A;  1RWX B;  2EK1 A;  2J7K A;  2VU5 A;  3M2U B;  1Q0N A;  4NLP A;  2GGP B;  3TWZ A;  2HHS A;  2H54 B;  5ETS A;  3KLG A;  1UVI A;  4DR7 F;  2HLT A;  3HD2 A;  3HUL A;  4LRF A;  1NU4 A;  3GP9 A;  4PG8 A;  2AJ1 A;  1BQM A;  4ZA1 A;  2CQ0 A;  5ETN A;  2HZC A;  3NY0 A;  4KGX B;  4USU A;  2NUU G;  1EB0 A;  4DQI A;  1FXL A;  1O6X A;  1QAI A;  1M0S A;  2IC3 A;  1RTI B;  2V2K A;  1IBK F;  2DJW A;  3M2R A;  3HSG A;  2E5L F;  5KTQ A;  3QYY A;  4FKY A;  4QWE A;  3FDS A;  1J5O B;  4X64 F;  3ZZT A;  4RBV A;  3TAP A;  2LEA A;  3S1T A;  3OL6 A;  2ZOM A;  4OZ0 A;  1IKW A;  3NGK A;  5M2R A;  3KLE B;  4KHP F;  3Q2T C;  1HI8 A;  1FRX A;  2GMH A;  4OFZ A;  1TL3 A;  4AE5 A;  5KFX A;  3ZTQ A;  3QZ7 A;  4JI6 J;  4NWB A;  2W9B B;  3CNQ P;  1SQE A;  5DDO C;  1IM4 A;  3IP0 A;  4CIO A;  4ECU A;  1WC1 A;  3PX6 A;  3MAH A;  2X1B A;  1U2C A;  2MKJ A;  2KZZ A;  4WZM A;  5J2P A;  1GMU A;  4H4M B;  4YDD B;  1R0A B;  5GMK a;  2RKI B;  2DY1 A;  2X1A A;  3QSI A;  1FEE A;  4DQP A;  4C3K A;  4P2F A;  4ZS6 A;  4O23 A;  4JI0 J;  4Q8E A;  1T9X A;  2CFX A;  4F02 A;  3D0G E;  4ZHR B;  4ZOS A;  5GAD I;  2FLP A;  3M30 B;  4QIE A;  3GYN A;  3QGH A;  1N4L A;  4AL6 A;  2EC0 A;  4KO0 A;  3UD5 A;  4I2Q A;  5DZ6 A;  3OLB A;  2Q3P A;  5KFR A;  3H4D A;  4DPX A;  4W92 B;  2X51 A;  1NK8 A;  1U1R A;  4TY8 A;  4Y2A A;  2LU1 A;  1FJE B;  2MY7 A;  5A8W B;  3GJT B;  1S6U A;  2HBQ B;  2GVZ B;  4PUO B;  3UQS A;  1KP6 A;  2V4R A;  5EWE A;  1JLC B;  1WI8 A;  1RAC B;  1YJV A;  3DNC A;  3G2X A;  3LAM A;  1JMT A;  2ZHA A;  1AYE A;  1K9M T;  4M5I A;  2MPU A;  3U7J A;  3K5M A;  2AX1 A;  3LA0 A;  2VKR A;  2EKY A;  2HZA A;  2BAC A;  2V68 A;  2XM3 A;  1S1X B;  5HVH A;  5E3A A;  4UUW A;  4CLW A;  3FSX A;  3GMG A;  2C3O A;  4CT9 A;  2JOQ A;  4KC5 A;  5L8R C;  2VFV A;  3JSR A;  2KJW A;  4DL6 A;  2ZZN A;  3H7H B;  3QMQ A;  4OX9 F;  3FEY B;  3TA2 A;  2V50 A;  3AQP A;  1D3W A;  1H0H B;  4A8M P;  3RAM A;  5D0E A;  1HL6 A;  1IKV A;  2CNL B;  2PMW A;  2QLJ B;  2PN6 A;  4MKB A;  3RRH A;  4PYA A;  4B9V A;  4KPY A;  4J9R A;  4DU7 A;  2XHW A;  5DGB A;  1LFP A;  4F04 B;  5L1I A;  2A6O A;  3RRG A;  2FHO B;  3O1L A;  3GLJ A;  4C3L A;  4WKY A;  2PGC A;  1JLA A;  4CI0 B;  3PX4 A;  4EZ6 A;  3AOD A;  3HP6 A;  3GV8 B;  3M8P A;  4XDC A;  4RNF A;  2J9D A;  2J6S A;  4LRD A;  1VRU A;  1FE0 A;  2LQ5 A;  3D6H B;  1JLG B;  2WOM A;  2XZT B;  1AW0 A;  3M32 A;  3BKF A;  1XK8 A;  2ZBC A;  3G82 B;  3U27 A;  1XN9 A;  4JYA F;  4O3R A;  4J9K A;  2MSS A;  1RT5 B;  2YWE A;  3OPK A;  2B4P A;  4KV8 A;  3H5Y A;  2WAQ D;  3EVO A;  1VQK S;  2V9W A;  5D15 A;  2N82 B;  1WHV A;  2NZC A;  2VON A;  3CMQ A;  1UEU A;  2VBX A;  3BGU A;  4KT0 C;  3NCR A;  1LW0 B;  3PNI A;  4ZIV A;  4IDK A;  2DRB A;  2XMK A;  1KOH A;  2YNI A;  2V8G A;  3JTP A;  3RTV A;  1QSL A;  4RU2 A;  3KK1 A;  1OMS A;  1Y5N B;  3IS9 B;  3GE9 A;  2V63 A;  4FN5 A;  1VK3 A;  4NAS A;  2H48 B;  4EMD A;  4HEA 9;  3MPW A;  1QD1 A;  5HL7 Q;  5ADZ A;  2FC8 A;  3BSN A;  2W01 A;  1RT1 A;  4DZD A;  1CSJ A;  1TMJ A;  2HHT A;  4X2B A;  4UOC A;  1CJV B;  1O51 A;  2WVB A;  5F0U A;  3IXQ A;  3LP0 B;  5KFT A;  3CJ0 A;  2LFV A;  3MR3 A;  3ITH B;  4QR2 A;  4HDH A;  2FPH X;  1RT2 A;  1OSC A;  4LF8 J;  3DDN A;  2MEW A;  3MF5 A;  5I3Q A;  3T3F A;  4NL5 A;  2QMX A;  4ELU A;  4M5J A;  2IYI A;  3JAM Y;  3G9C A;  4DF8 A;  5KFO A;  1JLF B;  3QT5 A;  4ER8 A;  2VHG A;  1YJW S;  1Q86 T;  3IRX B;  2DPI A;  4YN3 B;  1SL2 A;  4CLS A;  4FKX A;  4M63 A;  2XZW A;  1UAW A;  5FDL A;  5KFP A;  1GEH A;  3VAF A;  4EGL A;  1PC5 A;  3HZE A;  1DY3 A;  3MAA A;  5KFC A;  5H9F J;  1RAG B;  2YNG A;  3DRS A;  2ABY A;  3M2U A;  5F0W A;  5DQI A;  5DS7 A;  4DV7 F;  1Q95 G;  1T94 A;  1TK5 A;  1UPP A;  3ISN D;  4ED4 A;  2AU0 A;  5KG0 A;  2Q79 A;  2ZBR A;  1WC6 A;  2RT3 A;  4DR6 F;  6FDR A;  4YME A;  4M95 A;  3BSC A;  1TKZ A;  1DTQ B;  2KN4 A;  3NS6 A;  3POT B;  4LT6 A;  4O44 A;  4P2M A;  4TY9 A;  2E1C A;  4ELV A;  1UWA A;  4H54 A;  2LKZ A;  2W9C A;  2ZWP A;  2HMI B;  4N5S A;  2B5J B;  1DLO B;  2C2R A;  2RHQ B;  1NK0 A;  5B7W A;  1UFK A;  3BKT A;  4LSL B;  1X4E A;  4ZVE A;  2CYY A;  2G0I A;  3L4B C;  1B0T A;  2FHK A;  3WC2 A;  1QJH A;  4K4W A;  3PKM A;  4UZB A;  1BWV A;  5DO2 A;  3IR6 B;  1G3O A;  5KFA A;  3UWT A;  3AHP A;  3KHH A;  1L5U A;  1KQF B;  3EGW B;  4I56 A;  2MMY A;  4A46 A;  3D6F B;  1RDR A;  1DFD A;  1OY8 A;  4ERD A;  3CCZ A;  3KMS A;  3W1Y C;  1SL0 A;  2ZBI A;  4DL2 A;  3CDA A;  3LO3 A;  1RT7 A;  3K57 A;  2DGQ A;  2FJX A;  5CZV A;  4OJ1 A;  3KK2 A;  1RAJ A;  4OZ1 A;  4DXL A;  2EPI A;  1LWE A;  3V6J A;  4W90 B;  2HFZ A;  2EKN A;  3OW2 R;  3Q24 A;  3PEH A;  3CJK B;  4DG1 B;  1QAY A;  4RW6 A;  1K73 T;  3Q8Q B;  2HBZ B;  1N34 J;  4CYU A;  1GQE A;  3W7B A;  2UXB F;  4FYX B;  1SIZ A;  1LV5 A;  1RHQ B;  2MST A;  2MZR A;  5KFQ A;  4ED3 A;  3V81 B;  2D3O R;  4IFV B;  5K14 B;  1ULR A;  1Y4Z B;  2KJV A;  4K4X A;  1ZAX A;  4FS2 A;  3MEK A;  3MR6 A;  2AJQ A;  1LK5 A;  2UXC F;  2MQ8 A;  3TUZ C;  3N9U C;  2R4F A;  2PSZ A;  4DOZ A;  3IRW P;  4F8R A;  2YNF A;  1JLB B;  5HBM A;  5HN0 A;  4DR6 J;  4FS1 A;  3QAT A;  4RW8 A;  1JJ4 A;  1X4F A;  2RQM A;  1PBA A;  3DLK B;  4F4Z A;  3A13 A;  2GIQ A;  4KHP J;  3P5B P;  4HT7 A;  5LXR A;  3K89 A;  5IT4 A;  4C8Z A;  2AYG A;  3GG1 A;  3OVA A;  4B9S A;  2L08 A;  2DGX A;  3WX4 A;  1EKR A;  3M8Y A;  3MM7 A;  4QYR A;  1UVK A;  2B8P A;  5KFE A;  1DAX A;  3GIM A;  1N0V C;  5U47 A;  5HVF A;  3QGP A;  2HAF A;  3N0V A;  1IBK J;  2CZ9 A;  3HFK A;  4C8K A;  1BQX A;  2B43 A;  4OHV A;  4X62 F;  3J80 Y;  1HHQ A;  2QE5 A;  4M5L A;  1U48 A;  3PR4 A;  1CJU A;  1IBL J;  3OL9 A;  2Z0G A;  1RHK B;  2ATC B;  1T02 A;  4GKJ F;  3VR1 A;  3VAI A;  3V6D A;  3SXL A;  3VAG A;  1E6V A;  4F0H A;  1P9Y A;  1XMB A;  5C7P A;  1XR7 A;  1IKX A;  2E29 A;  1EET B;  3GFH A;  5K8M A;  2K7K A;  4LRC A;  2M2B A;  4B02 A;  1ZPW X;  3QT8 A;  3SV3 A;  1RAA B;  3VVT A;  3MMB A;  3GJS B;  2CQD A;  5B0B A;  3NAI A;  2C2D A;  3A3N B;  2HG4 A;  4PXE A;  4DFK A;  1GX5 A;  2IM1 A;  2Y0B B;  2E7X A;  2GA7 A;  3CED A;  3EXC X;  4NXM F;  1A9N B;  1N32 F;  4DFP A;  4C8M A;  1S6Q B;  2ZH4 A;  1NDP A;  2QO3 A;  4K7Q A;  5B0A A;  3OUY A;  3IS9 A;  1KON A;  3SQG B;  3FMW A;  4JI3 J;  2MLY A;  3IMQ J;  4Q8F A;  2VG6 A;  4LQ9 A;  3IN5 A;  4J9M A;  2PE8 A;  1UVL A;  2ROG A;  4UOF A;  4LMZ A;  1FXR A;  1AB8 A;  1X5S A;  5AE3 A;  3AJ1 A;  2DNZ A;  3HHL C;  3W8P A;  1Z2Z A;  2ZBQ A;  4UZC A;  2FY8 A;  5E33 A;  4CLL A;  4CQ1 A;  7FDR A;  1V3Z A;  3LW5 C;  4M5H A;  1FDA A;  1KR4 A;  3T6J A;  3IO1 A;  2VG5 B;  4J37 A;  1GK8 A;  2CQI A;  3C6U B;  3EYZ A;  3MOJ B;  2HK3 A;  4IQM A;  1WF1 A;  2GC8 A;  2XNQ A;  1NJY A;  1YBT A;  1N56 A;  2MQP A;  3SCL E;  1AFJ A;  2HLU A;  4MK7 A;  2LXI A;  3DI6 A;  3AQO A;  1ARO P;  1BQN A;  3U02 A;  2L9N A;  4PQU B;  3H5S A;  1OJ4 A;  4GO5 X;  2E5I A;  4CDI A;  4AXI A;  3MAA B;  2AQ4 A;  1H7X A;  4DX6 A;  1SJ4 P;  2HVZ A;  3GCW P;  4N41 A;  4ZIT A;  3W8G A;  2RIL A;  1D09 B;  1E6Y A;  4V19 X;  3CMA S;  2JEF A;  5IV4 A;  1UFW A;  2MHE A;  1TUG B;  1GTE A;  2F8M A;  3CO9 A;  3K59 A;  5C2G A;  2HHQ A;  3ZC4 A;  2QYC A;  5JVH Q;  3TQE A;  4B9N A;  2CPD A;  1GMW D;  1XER A;  2C3P A;  4WE1 A;  1ITP A;  3N6N A;  3TZX A;  2W9C B;  1P8G A;  3TOQ A;  1I94 J;  1WI6 A;  3OQ2 A;  2WTF A;  1W2I A;  2FJA B;  1S12 A;  3E3X A;  5J2M B;  4H4O A;  2QA4 G;  2R8I A;  4U96 A;  1VQY A;  4TN2 A;  2KYZ A;  3CTR A; 
#chains in the Genus database with same CATH homology
 4F7V A;  1TMJ A;  3ILO A;  5ETM A;  1RU2 A;  2CG8 A;  1TMM A;  3MCO A;  5ETP A;  3HCX A;  4PZV A;  5ETK A;  3HSZ A;  3KUG A;  1KBR A;  4CWB A;  1RB0 A;  1RAO A;  3UDV A;  3HSJ A;  3ILJ A;  3ILL A;  5ETQ A;  3IP0 A;  4M5I A;  1HQ2 A;  3KUH A;  3MCM A;  1Q0N A;  4M5N A;  4CYU A;  4CYU B;  4M5J A;  5ETL A;  2F65 A;  5ETO A;  1G4C A;  3HD2 A;  4M5L A;  5ETS A;  5ETR A;  1F9H A;  5ETN A;  2F63 A;  3KUE A;  5ETT A;  1EQM A;  4M5K A;  4M5G A;  4M5H A;  4CRJ A;  1CBK A;  3HSG A;  3HSD A;  1IM6 A;  1DY3 A;  1EX8 A;  2BMB A;  4AD6 A;  3ILI A;  1HKA A;  1RTZ A;  3HD1 A;  3MCN A;  3HT0 A;  4M5M A;  3UDE A;  3QBC A;  5ETV A;  1RU1 A;  3UD5 A;  2QX0 A;  1EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...