4M5JA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
157
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 42
structure length 157
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5jA00
3QBCA 5ETRA 4M5KA 1RB0A 3ILLA 4CYUB 4M5NA 1DY3A 1RTZA 5ETMA 3HT0A 5ETVA 4M5IA 2BMBA 3HCXA 3ILOA 5ETNA 1RU2A 4CRJA 3IP0A 1F9HA 4M5JA 1EQMA 5ETSA 3HD1A 1TMMA 3HD2A 1G4CA 3KUEA 1HQ2A 3UDVA 1TMJA 5ETTA 4AD6A 5ETOA 3HSZA 2QX0A 4CYUA 5ETQA 5ETKA 1EX8A 3HSDA 5ETPA 1KBRA 2CG8A 3HSJA 3MCNA 3HSGA 4M5MA 4PZVA 4F7VA 1CBKA 3UD5A 3ILIA 3MCMA 1HKAA 3UDEA 2F65A 1EQ0A 1IM6A 1RAOA 2F63A 3KUHA 3MCOA 4M5LA 4CWBA 3ILJA 4M5GA 1Q0NA 4M5HA 3KUGA 5ETLA 1RU1A
chains in the Genus database with same CATH superfamily
4HHUA 4ECYA 5EX3A 3ZZOA 1VCTA 3GIIA 2X7IA 3KG4A 1JLAB 3FCVA 4LR7A 1EP4A 3MM8B 3U1LA 2YKPA 1HQUB 4NX9A 3W9IA 4LBIA 1K9MT 3Q8PB 2YKMA 2DR6A 2ZZTA 3EMTA 1SJQA 3TA0A 3QZ8A 2ZD1B 2LQ9A 3MURP 4IDKA 2AHOB 1SL1A 4YS2A 1TK5A 1JXEA 4ZIVA 4USTA 1IBLJ 4O3SA 5JMNA 1VHIA 2ATCB 2O66A 2VPXB 1VQOS 5FDLA 2GGPA 3QAUA 3OTOJ 2RHQB 1AROP 5LMUF 1IBKJ 3MCNA 3C8YA 3QQCD 1HA1A 2NCKL 3BDEA 1S9EA 2HNYB 4OLPA 1WKLA 3S7RA 1JLCA 1QTNB 2HIQA 1TAQA 2BUNA 2ZVIA 3E51A 1JLFA 1C0TA 2CJAA 1CS4B 1NPPA 3IA0A 5HJYA 3OVBA 4LF7F 1M1KT 3SEOA 2EXUA 2AKWB 3DCAA 2HHXA 1GX6A 2DHGA 2HFUA 2O1PA 2YKOA 4G6VB 3ZZ0A 3TP2A 2OUGA 4X84A 4IRDA 3NWRA 1BE4A 2L9NA 3UDCA 5LSRA 2DHSA 4HH1A 4RW7B 1HI1A 3KJVA 3UNGC 1TUVA 1HI0P 3SI8A 1NPRA 4DF4A 4B3TJ 4EBDA 4DWIA 4WIQA 3CDWA 3M2RA 3B78A 3KHRA 4EYIB 1FJCA 5K9FA 1XMQF 1KDNA 1K8AT 4MT1A 2O3DA 1HBNA 3FSXA 2FB0A 2CPJA 4OZJA 3VCDA 2UXCJ 3W1YC 1RT5B 2MZTA 3CW2C 1FE0A 1GTHA 1RJJA 2EKNA 2WVFA 4HHHA 1REVB 1SH3A 1HNVA 2HBRB 2UZAA 3TZZA 1DLOB 2BE9B 2AF6A 1YK9A 3CIMA 3D1HA 2UXDF 3HVRA 2QFJA 3UN3A 4C8YA 3S6EA 4M5IA 5AJ3J 1K73T 2HZCA 5KFDA 1UVKA 1Q53A 4NCBA 4USHA 5FIIA 2Y1LB 3FKBA 4ZVHA 2DY1A 1NSPA 4DN0A 1H73A 5K8MA 4GKKF 3H98A 2QTWA 2IVFB 2POKA 3O8WA 5IQQA 1HPZB 3CTRA 5DDOC 5LMNJ 4YY3J 2ROEA 4N56A 4LBHA 3X1LB 2QN6B 1URRA 5DM7Q 1L3UA 3POTA 1S1TB 4KPCA 2VONA 3SBMA 2FLPA 2UV8G 2IMWP 1Y00A 2ZUGA 1D8ZA 3CJ3A 3H5UA 3U7JA 4WFXA 4K7QA 3MFIA 2RQCA 2OJ3A 3A13A 1MMLA 3ONQA 2CJKA 2E7WA 1YHQS 2N7YA 3FK4A 4JOUA 4PG8A 3UCUP 1NAQA 3IAM9 1SKSA 2VOPA 1TAUA 3MMCB 2QO3A 4ANCA 2JEJA 1FRHA 2J0WA 2KDOA 1VGYA 3A12A 4N8OA 3IAS9 5B09A 3MPVA 1H38A 2M9KA 4WFYA 2WONA 4Q7AA 5KG5A 4Q0BB 3OR1B 2GA7A 1WOPA 2NXJA 3GYGA 2W8KA 5HLFB 3MMBA 4CLTA 3DRPA 3MMBB 3KWMA 2ADBA 3J81Y 2ZITA 2FY1A 2KFNA 3N6MA 3H4DA 3SZ2A 2APOA 1YTYA 2OPRA 1H3DA 4J9KA 4NXNJ 3GMGA 5T7LA 2EC2A 1LFPA 4OQJA 2LEAA 3J7YI 2FHOB 2UUCF 4B9TA 1RK8A 3O1LA 4WP9A 2H4YB 5I3UB 4BDPA 2WVBA 4YN3B 4DSLA 4BHQA 4USJC 2AGQA 2YY3A 4GKKJ 2CWKA 2A1BA 5FDLB 2XSJA 4WBFA 1SKWA 4B3RF 1Z2LA 1R27B 2VB6A 3RW6A 2ZBRA 2KG1A 1NJWA 4ECVA 3A3PB 3M9OB 3N01A 2GJ2A 3CJQA 2B8QA 3PEHA 5KT7A 1EIYB 1UAWA 4KC5A 4CLSA 1SXLA 2X1FA 4OZ2A 4JI4J 5D0GA 2OSRA 3VAKA 2KHCA 4R8UB 2LFVA 2P9CA 3LWLA 1NK8A 4WE1B 3VTIA 4KGZB 2RD5C 3UE2A 3CJ4A 4UZCA 5LOQA 1RT2B 2MZSA 1IR0A 4F4ZA 2MLZA 4C8ZA 2IIHA 3D28A 1VQPS 2D41A 3IR7B 1FKPA 1AZSB 1C1CA 2M7SA 3US5A 2D3O1 4ZPAA 4Y2MA 2GJIA 1BUXA 1RBAA 2KO1A 2VBYA 3LP1A 3PW4A 1T05B 1WEXA 1RCOB 2XCAA 5D4PA 5KT6A 2XQCA 2DT9A 2QLBB 4JYAF 2CVEA 3JTNA 2BZ2A 1L3SA 4JV0A 3N79A 4G1IA 4OX9J 1W7WA 4DV4J 2P8IA 3QBCA 4KAIA 1R89A 2XMUA 4O4GB 5IT0A 2HG4A 1RAAB 2RAQA 2LQBA 2XMMA 2VKRA 1NK7A 2VDIA 1Q4RA 3MM6B 1JJ2R 1M5KC 5HATA 2V8DA 4IRCA 3NAIA 1RT7A 2OO4A 1DJ0A 2Z2LA 3IBFB 2R2UA 1SUQB 2XMKA 3C6UA 3NKYA 1G2EA 3BF4A 1FRIA 4USUA 1HQ2A 4C97A 4B02A 2YVSA 4I7FB 5AE3A 5DDPC 2CQBA 4UT4A 1ROFA 3K8VA 4C11A 3EXCX 5HQLA 1T02A 1UEKA 1B3TA 1S72S 4X4SA 1S6OA 2D3OR 1R6YA 2K3IA 3M32A 3CCRS 2WOMA 1A0OB 1CJTB 4HT5A 3MPYA 4CM2A 2RE1A 3FBBA 2M52A 5HBMA 3IR6B 4OJHA 3IO1A 2R7WA 1Q81T 3ZTOA 2OPQA 3Q8QB 2Y0BB 4KV8B 1K47A 1X4BA 1MW7A 2XMVA 4DHVA 3DLEB 4IG3B 3AB4B 4NI2A 3BKFA 5C24A 4GC7A 1UKUA 1LW2A 3AH6A 2CPFA 4GMKA 2D3UA 3MMJA 1RCXB 3MR7A 4JV5J 5ETSA 4JBCA 2C28A 1HNZJ 1WC1A 4DV7J 2ASYA 3RJMB 4JI4F 5JUMA 2OPPB 1Q82T 2E5LF 3D2WA 3HZEA 3CC4S 5ETOA 1C4AA 2DNOA 2V2QA 3ETOA 1QE1B 2J7WA 2ZH9A 1DRZA 4WJBA 4CLKA 1JIHA 1QE1A 1R31A 2ASJA 1PJ7A 3LTOA 3TAPA 1CBKA 3UD3P 3ADAC 1PIEA 3GJRB 4DL7A 2DEJA 1MMDA 2FUG9 2C42A 4ZLNA 1UCNA 2X3DA 3MGJA 2ZH1A 4DS5A 3W64A 1YBTA 3N5BA 2BRLA 3K5OA 3KHHA 2P5VA 1MU2A 1VIOA 3D6HB 3VGTA 4DF8A 2OPRB 2AEJA 2J6UA 5GAEI 4PKDB 1RT6B 3M7VA 5T7LB 3E01B 4DQRA 2JJ4D 3Q0AA 4V19X 2K1RA 4BWJA 4FF4A 1HYSA 2C3MA 5D4NA 4YHHF 3U27A 1WHYA 1KQFB 4MYUA 4ZJQA 2WVCA 2HVHA 2KKHA 4ZPVR 5D4OA 1X8DA 3UVJA 1CJUB 1O8BA 3FMWA 4AL7A 1VC5A 2IBKA 2CPEA 1RBOB 1XQIA 2MHNA 5KT3A 3AQOA 1BQNB 4Y0FA 3MZIA 5CYQA 3CCSS 4LFAF 1YRXA 2NPIA 2HQCA 4AT1B 5A0YB 5KT4A 1X0PA 1EKRA 3CCTA 4P75A 5IT9Y 3D54A 3NWGA 3R7SB 3GV7B 2XY7A 1TL3A 2IPOB 3KTQA 5A8WB 1H2VZ 3DOKA 5IM0B 2EFOA 1JQGA 2QEXS 2ZZMA 3A3OB 3DOKB 3C6UB 3OTCA 4RW8B 2WTFA 4NCGA 1DARA 2VIHA 4KIAA 4WWSA 3MECB 4USWA 4N76A 2BOAA 4NLSA 3Q2TC 1S57A 1R0BG 3T1HF 2XB2D 1MN7A 2PFFB 3HKWA 4DFKA 1CJVA 5HVFA 2YWGA 1KQGB 1B7YB 1SC4B 2KXFA 4CLZA 3VGUA 3VALA 1HNWJ 3MEEB 1YIJS 3QJPA 3CCQS 5DLFA 5DJBA 4AQYF 3HO1A 4LSLB 5IOLA 2FJVA 3K5PA 2YQ1A 4ECZA 1RWPB 2YNFB 2YPZA 4NMLA 3B54A 4CTAA 4TVAB 2P9EA 1EARA 1LWEA 4IG0B 3R2CJ 3Q8VA 4LUBA 2V69A 1YJTA 5CHCB 3W2VB 1FKOA 1RYRA 3K5NA 4FYXB 3EPIA 2UXBF 1YGYA 4ZCLA 2MQ8A 3UD5A 2RRBA 5L1IA 4B9VA 2DO4A 2XWYA 1VBZA 1WEYA 3RRGA 2MJUA 3DU5A 2DH7A 4X62F 3ISND 4KHPJ 2X3GA 3MECA 1NXIA 1NHKL 1YZ6A 4OYXA 2FVQA 3KMSA 1PYTA 2V2VA 3QT6A 1SJ4P 3CUNA 4MIWA 1WOSA 2Y1RI 1DAXA 2ZHBA 4ZMMA 3KK1A 4LFBJ 1T9TA 1RWVB 2BKOA 3OXLA 5HN0A 3PIPQ 1UVJA 2HQ3A 1QDUB 1HBOB 3ZZRA 1WDTA 2JOQA 4YEAA 2D1CA 4UY85 4NI2B 2GZOA 2HFSA 3M6WA 3KJVB 2CQ1A 5D3GB 4HL9A 5FD1A 1H7XA 4PQUB 5G0RB 4EU0A 2UU9J 1WTFA 3Q89A 3PKYA 3CJKB 1HMVA 2J7KA 4KFBA 1JLBA 2W7AA 2HQIA 4DCOB 2PEHA 1BMQB 2F8EX 1X4CA 1JJ4A 2HVDA 3QPIA 5H9FJ 2B7BB 4DSFA 5HROA 1N36F 5F8NA 2DH9A 3BKUA 5LMNF 2IVMA 2GQQA 1GXTA 3DLKA 4IH6A 1NJZA 1VMBA 4X4OA 5C42A 3ISZA 1FJGF 4Y00A 5HP1B 1V3RA 1X5PA 3MFHA 2GIFA 3PFEA 1TMMA 1VQYA 1H7WA 2A3JA 3I0RB 4DX6A 5A8KA 2X1AA 2F9JA 1L3VA 1Q7YT 2V94A 1T9WA 2ZHAA 4DV2J 1U48A 3BGRA 5KAKA 1T03A 4ER8A 1TKDA 1T7PA 2RF2A 2IYIA 2BQ3A 3U1NA 3HMJG 2A18A 4OJ3A 3DMJB 4RW4A 1ITPA 1NEEA 4IQMA 3PW2A 4AL5A 4LFBF 5B0FA 1SV5A 2AU0A 1Q5VA 4DV5F 4ZP9A 4HR2A 2V8GA 4OV1A 3NRBA 4JI0F 4AL6A 3J80U 1FEHA 1W2BR 4KQZA 2Z57B 4O3RA 1LEOA 2CDRB 2BJ8A 4OMFG 3MR6A 1QJHA 4CNZA 3W2WA 1HW9A 3FDSA 5ETNA 3AQPA 3R7NB 1X31C 1PBUA 3OLBA 2MPUA 2QC3A 1ZETA 4MMOA 1X5OA 3BM7A 2G0CA 2CJ9A 3RGIA 4A4JA 2GMHA 1REVA 3BN4A 2DGQA 1HNXF 3AHPA 4ED8A 1S1VA 3BGRB 4HDGA 2KTQA 2YNIB 2XEXA 2IM0A 3N4WA 1UPPA 4MKBA 4NYZA 4C11B 4C7QA 3HJVA 4N5SA 2RQKA 1XR7A 3PRDA 3HHKA 1U0HB 3IBWA 5G4DA 5M2PA 5MAOA 4K4SA 2YKNA 4KKOA 1DZ5A 1L3KA 5KFGA 1Q8BA 2KU7A 2IMOA 3K89A 3QIPA 2F8MA 4CO4A 1B0VA 3TUPA 2RKIA 1T8EA 1I6JA 3KUHA 3NNHA 1Q8IA 2MLYA 3Q86A 3RRKA 3RTVA 2FHKA 3SV4A 1FT8A 5K14B 2G4BA 2WK4A 3MM5B 4P7VA 2IRXA 1Y5NB 2HWTA 2ZKUA 3IGVA 1VDHA 2QA4S 1TKXB 2BJ3A 2VASA 1IKVB 2CQCA 1OY8A 2PD1A 3PJWA 3R6GB 5KG1A 1F3VA 3DU6A 3QNWB 3R5GA 5J2MB 5GADU 4DDFA 5J1EB 3QO9A 4ZN3A 4RUCA 3PFOA 2OEJA 4TU7A 2CPDA 1RHQB 1S9GB 2R4FA 3GLJA 5C7PA 4DV5J 2WW4A 4DG1B 2FLLA 2C2DA 4Q2MA 2CQDA 3OBIA 2AIRB 3BGUA 1J5EF 5HQ8A 3EVMA 2EI5A 2HWHA 2NSBA 3GFZA 1KS2A 2V8HA 1RGVA 3NCPA 1JJHA 4XK8C 1WHWA 2QFIA 2ILZA 3GSDA 1S76D 4WPAA 3JTOA 1H2UX 1FRJA 1WF2A 1ZAXA 2WBRA 2Z0GA 3NG8A 5GAGI 3QZ7A 2DPJA 1VYAA 1Q0NA 2DNYA 4BCAA 3V6DA 2DXEA 2JL9A 3DC2A 3EICA 4W98A 5GAHI 3KK2A 3HDSA 2R9LA 1DQ9A 3VAGA 2ZBPA 2QV6A 5J2PA 4FP9A 4QYZK 2E7XA 1FVQA 1KKHA 1VK8A 2J5AA 3A8IA 4I64A 3UCGA 1M0SA 1NSAA 2R8HA 4ZN1A 1SV5B 1N6QA 1XK8A 1QAJA 3EGVA 2KJVA 4USMA 1RT3A 4FF1A 2HLTA 2J8SA 4IH5A 1QAYA 3HHLA 4PXEA 2F4VF 4FKXA 5KFHA 4ED5A 3UCZP 2OFGX 4O3OA 3SV3A 4U7CA 1SC6A 3Q83A 3I5AA 4F3QA 3G6VA 4DFJA 4MK8A 5D77A 2NUUG 3H8YA 2R8KA 1WKKA 2IAJA 2A2CA 2FHJD 3FCWA 4RW8A 4X4TA 2DK2A 2WZ1A 1B0PA 4NCGB 4C9DA 3HFKA 4I6WA 4I7FA 2CWXA 5KFQA 1W2IA 3ZFVA 2R8IA 2IBOA 4F2RA 2G2YA 4CYUB 2HS0A 1YJNS 1WORA 4RR5A 4ZS6A 1KQSR 2HMIA 3LP0B 3LPEA 5CA5A 8AT1B 2BJ9A 3TVYA 2OELA 3WDOA 1WELA 1NK9A 5E5NA 2DEIA 4ZVFA 3QLHB 4I2QA 4KT0C 3TZWA 1G4CA 2IA0A 1UFWA 3JQKA 4GVBB 1PJ5A 3HSZA 3K7RA 4ECQA 1J27A 3DRPB 4OYPA 1KD1T 1FDNA 2B9XA 3R5BA 4PYAA 2GS8A 1PBAA 2NYHA 3NGRA 5GAGU 1D09B 1NB7A 5D3GA 3D67A 1OWXA 4YQWA 1RWWB 2E1RA 2XSFA 1B99A 3ZTPA 1NSQA 2P9GA 2BE7D 5F8HA 4DL2A 2JEFA 1JKHA 2LQJA 1B64A 3QWUA 2ZZNA 5CD4H 1N52B 2GIRA 7AT1B 1Q7LB 2X1GA 1VHFA 2HMIB 1GNKA 1QUPA 2XG8A 5F8IA 5KFPA 1FDDA 1WF0A 4OZLA 1S10A 2FJWA 1F2HA 1U09A 3PIOQ 1IBMF 1F0XA 4N77A 2LXIA 5CCLA 1WNEA 2HHPA 4WK3A 3GV5B 1KNZA 2JEIA 1T0TV 3MPWA 2ZM6J 2VJUA 3I96A 2RS2A 1O51A 4F4WA 4CH7A 4B3RJ 1MNEA 1UWBB 3C14B 4I1TA 3OUYB 1D0EA 2PEBA 3MI7X 4B9NA 4OHZA 4TQRA 2XYGB 4LREA 1N56A 4F0HA 3T19A 3MXHP 1X4FA 3PTWA 1HBUB 3MM7B 3KHGA 3HJFA 3P8BB 4EO6A 4KGXB 1Y5IB 1HYSB 3D5MA 1FTRA 4CIOA 2WSEC 4J9MA 3J81j 5BR8J 1FWLA 2E1MC 2N3OA 4E98A 4J7CA 4NZ7A 5JJBA 3FBFA 3N6NA 4KGKA 4ZIWA 2CZ9A 2Z4PA 1IKYB 3CJ8A 4HTJA 2HNDA 2CIMA 2J9EA 4F50A 1Y3JA 3C3LA 3DGPB 3IS9A 4F8RA 2K7KA 1RAJA 1VQLS 1U0SA 2BKNA 3DRSB 4P6QA 2CJXB 4OIXA 4OFZA 2JEGA 2DNQA 5LJ5Y 2EFVA 6FDRA 1FVSA 2A6OA 2AEMA 1Y11A 3CT9A 5EX0A 2W9AA 1OY9A 7FDRA 1NHVA 1T9VA 2C2OB 2DNRA 2OD4A 5HSPA 3E8OA 1WOOA 2CFXA 1T9YA 3MUMP 3DDKA 1RE1B 4UOFA 2YQ0A 2PMWA 4CT8A 2VUGA 3KDNA 1WC5A 3PACA 3UO0A 1TL5A 2XZDB 3IM8A 1R8HA 2W4DA 4EK2A 1S6QA 1HPZA 2OPQB 1QLNA 4X2BA 2PA3A 1F9FA 1S6QB 1KLMA 4IO1A 4IH7A 3NAHA 1X4DA 3KHLA 1N34J 4NOHA 5EGYA 2R8GA 2ZH6A 1RAIB 2AJ0A 1BC6A 3IP0A 1DBDA 4NA2A 3PXGa 3W8GA 3PRBA 5HO4A 2L48A 2KRRA 3R6LB 1TR0A 3UN5A 3BO4A 3TO8A 2EFQA 5BR8F 4WYLA 2H5JB 5IZHA 3CCMS 2J6TA 2RHSB 4CYUA 3MMCA 4CO3A 3EZ5A 3S8SA 3D6TB 2GIQA 2YKNB 4GVLA 4OZ0A 4F36A 3HHEA 1P8GA 1U0HA 3T9ZA 1LXNA 1M5OC 3T5JA 3JAMY 3NBPB 1V3SA 2WHOA 3GWCA 1NKBA 1RAOA 4NLWA 1S4EA 5C25B 3FVYA 1YJWS 2UXCF 3V81A 3CD6S 3J7ZT 1BGXT 3RBEA 2XLKA 1RA7A 5L38A 2MTLA 1HLWA 1S0MA 1YVFA 3B4DA 2ZHOA 4C0OC 5B7WA 5C24B 4RZRA 9RUBA 4M5NA 5KFLA 4JI3J 2BJEA 2M8DB 1LWFA 2HFVA 1R0AB 2VA2A 2CQPA 5J1EA 3NP5A 4IFVA 2GO9A 1U47A 3P4UB 2YH1A 5KFVA 1AYEA 4M94A 4USVA 5SZTA 2VFUA 2QA4G 1RHKB 4DQPA 4C2MA 1D9AA 4NE9C 2B9YA 2JZ5A 1U1PA 2BR0A 2CPXA 2E1AA 3OL8A 3BJYA 3BR9A 3C66A 3ZZUA 4CH1A 3G4SS 4ELUA 3N28A 1N5TA 4WFBQ 2EPIA 2PN6A 1Y10A 5A8KB 1F6TA 3NS7B 4P10A 4GRSA 2W2PP 4EMDA 1YJUA 5A8WA 5HANA 3L09A 1P27B 1SUQA 2FGOA 5AT1B 5IM0A 4O0NA 1GAOA 4ZJOA 2DD8S 3IC1A 1H6KX 4IYQA 5DM6Q 2C3PA 4TQSA 2BBEA 2I0XA 3R3TA 4JI5J 4PUOA 4ZVTB 4NXMJ 1CJKB 1ZAWA 4ILRA 1Q78A 2DTJA 2IC3A 5KOWA 3VAFA 4XDDA 4ED3A 4PAAA 1Q16B 1RTHA 4QWBA 5GMDA 1XWLA 2AX1A 5FLXU 1TMJA 3PDNA 2CDQA 3AXKA 4LT6A 3T6JA 1RT3B 2DIUA 5ETQA 3N6LA 3JXOA 2UVWA 3GPAA 1G6BA 3OPKA 3MUVP 2MMYA 3FBCA 3O3LA 4YMEA 2AYBA 4DMZA 3L4BC 4CT9A 4RU2A 1HNVB 5A2QU 3MEDB 4F4AA 5LXYA 4FYYB 5KFKA 1NU4A 3FSYA 1EHWA 2ZUAA 3KJFB 5F0UA 1T3OA 1SC3B 3QRRA 1NK4A 4OX8A 2F9DA 3G6ES 2CQGA 2ASDA 2JVRA 4ED1A 4X4VA 3KFWX 3O44A 2FIUA 4QCLA 1TV6A 3CD7A 3BSOA 3CNQP 1RAHB 2GW8A 3H20A 5K5MA 3OV7A 1OSCA 1DQAA 1S48A 3M1VB 1GMWD 1U4BA 1FA0A 4J9PA 5FJ4A 1U2RA 1TZ0A 1LW2B 1NDPA 2IFXA 1HR0J 3GB0A 1VQNS 2AT1B 2OGUA 4MKVA 4X64F 1R0AA 3LUYA 3J7YU 3PO5A 2QRRA 1OIAA 3CDBA 3DGVA 8ATCB 3BQ1A 5KG6A 2E5IA 2NXCA 1PAUB 1T9XA 3MOJB 2CRLA 4DR4J 2WB1D 1J5OB 1TUGB 3FJ2A 1F60B 4FPIA 3C19A 1S9FA 4C0BA 1RT1B 2XLJA 1RTZA 1TP7A 2WVDA 3D0GE 3MWBA 4A48A 2JX2A 3J80Y 2GC8A 1SKRA 2RUGA 2WB4A 3RBZA 5EWGA 2BRKA 1VC0A 1HBMA 4DV0F 1VI7A 3QMQA 3MM9B 3TANA 5CCMA 3I0RA 2JC1A 3N9UC 2XCPA 2ZFHA 3QYYA 4DUYF 1QVFR 4P2SA 3KLEA 4O3PA 4A8KA 1U1NA 2LLZA 4PXDA 1HQUA 2V2KA 3GIMA 1YJ9S 5E33A 1FXRA 1REGX 3NGTA 1VS3A 3QO9B 1HMVB 3DRXA 3ZTRA 3OSNA 3JSBA 2VBWA 3NGSA 3K59A 1UJ5A 3UVJB 2HSEB 4DL4A 1EAYC 1NJIT 1KVIA 2J7UA 4GC6A 4JI6F 3CCUS 3TA1A 3UFCX 4YP3A 1JK9B 2CA9A 3ELHA 2VBXA 3VZIA 1RHRB 1RTDB 1BD6A 1GTEA 3D0HE 3I0SA 4OYMA 3KLIA 4ANDA 4K4YA 3TUJC 4IUFA 2HEKA 2PSZA 4KJIA 1QSYA 1S0NA 1BXNA 3DRRB 3ICLA 4ZPDA 4A46A 4DX5A 4ZITA 1RQ0A 2EG1A 3IXQA 3RAMA 4B3MJ 1FK9A 2J9DE 3PYEA 2I6WA 4Q8EA 1LFWA 2RF2B 1ZPWX 3EE3A 2VKZG 3EZUA 5B0EA 4FXWA 2V0NA 5KFOA 2DCUB 4KO0B 4PZVA 4KO0A 1JNRB 2OI2A 2IDEA 1XEZA 3DDIA 3KLHA 1HNXJ 4TY8B 4USIA 4M5LA 3D68A 2MKIA 1I94F 3FRYA 4CQ1A 3S1TA 2I2YA 2KG0A 5AXKA 3SQOP 3CJ5A 4MIBA 4Q2LA 1JXLA 2VQFJ 2QMXA 3H0PA 3Q2SC 3I0SB 2PA8D 4CTAB 5DGBA 3PW0A 1LWEB 4IG0A 3FRZA 1A9NB 3CJSA 4OI1A 3RG6A 1RAEB 1RBLA 2XGPA 2V5HG 3HD1A 2DKOB 3GP9A 1ZBTA 3T41A 1T9UA 3KUEA 2X51A 4EFAC 2XC9A 3K57A 2H4WB 5I42A 1TTHB 1N5YA 2YWHA 3QATA 2BJ1A 3PX0A 1UVLA 1P9QC 4NLRA 3NNCA 1H72C 2BJ7A 3VZHA 1XR6A 2UP1A 3KOAA 1UJ4A 2C2EA 5A8RB 4K2XA 2C22A 2H3EB 2RH3A 4DV7F 2HK3A 4OYAA 1S1UA 3TUZC 1RWKB 4CP5A 3K58A 4CWBA 5HQMA 4DR5F 4ELVA 2MZRA 2VC1A 4B3OB 2B9EA 2R3VA 1OS5A 3FSIA 1L5UA 2QIFA 4RPFA 2GVZA 3SCJE 2YQ3A 1JWWA 1KQKA 2LEPA 4NEYA 1GX5A 3MM8A 2WW8A 4OHYA 1Y3KA 1WSVA 3HHLC 2UV8A 1HHTP 3K8WA 5K8OA 3G8QA 4M5JA 3G2XA 4ZPWR 1U25A 5AE2A 1PC4A 1OJ4A 4TLQA 1EB0A 4DX7A 2RUSA 1R3NA 1ULRA 1M1HA 1WC3A 4UF4A 5F8MA 2XMJA 4G1PA 3MR2A 4RUAA 3CDUA 1IVZA 2CJBA 3BBFA 1GH8A 2A6MA 1N32J 1JJCB 1WC4A 3QSYB 4OLOA 3WBZA 1SIWB 3FEXB 5A2QY 2FJEB 4G65A 3DM2A 3J7A1 2BACA 4KRWA 3PYGA 4M5DA 1RAFB 4R8UA 4WE1A 4ZP8A 2BQRA 4B3TF 3DXSX 2R7OA 3EZOA 4I4BA 2Y3YA 3CVKA 4ZPCA 4CO0A 4BS2A 2IY5B 4NLDA 3T1YJ 1Q79A 3RAXA 3QSIA 2L9WA 4AE5A 2HHWA 3AOBA 4FYWB 2DGSA 4NLTA 2FTRA 4TYAA 3RRHA 1FRKA 3I31A 5H9EK 3QRQA 2MXYA 3CD0A 3R5JB 2HQDA 5THWA 1FTCA 2W2QP 3AY0A 2KT3A 4OI6A 4DR6J 1IXKA 5HROB 4O4RA 3AAWB 4I6YA 4EBEA 5LXRA 2QL5B 1VQMS 2Q79A 1B4SA 1RTDA 4LF9F 2Q43A 4X4UA 2E44A 1JNZB 1SIZA 4DZDA 2BANA 1TKXA 2ZVSA 4YFUA 4W90B 2FY8A 1IKVA 1UA1A 4ED6A 3MUTP 2LYVA 4L74A 2XS2A 3PW5A 4ZOSA 5HP1A 3ILJA 1IN0A 2RRNA 4U95A 2ZJPQ 2KZZA 3KUGA 3T6BA 3MOZA 4ETXA 2F5GA 4PG6A 4DL0C 3FGVA 2Y8WA 4AUKA 3M6VA 4LIRA 4M5KA 3TJ8A 4YY3F 2R7SA 1Q8LA 4RW9A 4K8RA 1N5SA 1RWOB 1TV6B 3CO0P 4KKOB 4A47A 4DPOA 1CVJA 5B08A 5LJ3Y 4R0JA 3HVTA 3ZZYA 2BQUA 1D8YA 1PCAA 1N88A 2J9CA 3NCRA 4G1QA 3SSSA 1S4FA 3A8JA 2VA3A 4YB6A 2IM2A 4DR6F 4X4PA 1HWUA 2CVIA 1TKTB 3T1YF 3RR8A 2BDPA 1S49A 4RBUA 4TLRA 2NS1B 2JWNA 4RNHA 2JVOA 4URQU 5J1NA 1N48A 2ASLA 4NL5A 2FZCB 4CLLA 2D74B 3H5XA 1FRXA 5I4MA 5DQHA 2Q6BA 1APSA 5L9XA 4W92B 4HTIA 3TZYA 3CF5Q 3KMQA 2BA9A 5E3RA 2Z30B 4P74A 4J9LA 1WD6A 3KYLA 1VQ7S 4J9SA 4UOHA 1YJVA 4Q0BA 2MKYA 4QBUA 5C25A 3ZO7A 3ZZPA 1MWYA 1R8BA 2R8JA 1V5VA 2FVPA 4JI1F 3UDVA 2V63A 3NGKA 3TX8A 1FX2A 3HLUA 3KLEB 4WZMA 2KM8B 5L1LA 2W9BB 4LRAA 1YBAA 3HP6A 3LP2A 3TW0A 4O3QA 1JLEB 2YNGA 2C2NA 4HKQA 2BKPA 2QL7B 3PW7A 4TNOA 3AD9C 1FF2A 3DLJA 2V9KA 3H40A 4DV2F 2F8HA 2Y8YA 4HI1A 5T41A 2CQ4A 3M2UA 3VGSA 2QE5A 4GKJJ 4DR2F 2IJNA 3CB4A 3CCLS 3AD7C 3QFHA 1OO0B 3GILA 2OHDA 4I2PB 3ENVA 3TUIC 2LXFA 3IFEA 4OHXA 5KFIA 3DXBA 2MQQA 4NLPA 4C8OA 4IQXA 2BANB 2Y1IA 3F56A 2OAUA 4J9QA 2M70A 2V68A 4IO9Q 1TL1A 1X4AA 2WBMA 1RT4A 3DOMA 3CDAA 1OY6A 1UFKA 2E1PA 3KLVA 1WG5A 5D6GA 3QJJA 5EWEA 2U2FA 5H1SV 3H4BA 3KLHB 2CQ3A 2KT2A 3CCZA 4RUBA 4QYRA 3Q8YA 4RW9B 3PYDA 2CUYA 3I5BA 3NBPA 4F3MA 3KLGA 4K0KF 4JI7J 1RTIA 2UUAJ 1SPBP 1ZZFA 3BSCA 2OD6A 4KB7A 2NSCA 5DQIA 1AFJA 3VAIA 4O4GA 3VQSA 3FEYB 2GCFA 4ZHRA 3MDFA 4PG5A 4RNFA 2HK2A 4QWEA 4MJKA 1CLFA 4NLQA 4PQUA 1UTAA 3ULHA 4B9LA 4IFVB 5KFAA 2V4RA 1WDDA 2CZVC 4X4QA 3M05A 4ICLB 1Y5LB 4OI4A 4A8FA 4K4XA 4JI3F 4PWDA 1RXOB 1KP6A 2ROGA 4ID5B 2IM3A 5DS7A 4DU8A 2AEFA 5AJ3F 4NA1A 4YR2A 2DGXA 1JLGA 4BBYA 5EWFA 2E1CA 1JLCB 1RUSA 1DFDA 3TOQA 2YWKA 3NOCA 5M2RA 5B0DA 4QIGA 1P1LA 3M8SA 3AOAA 1RT5A 3P5TL 3SIPB 4P73A 3W5ZA 4DR1F 3UW1A 4B3OA 3CULA 1S7IA 1UETA 3OJUA 2C2MB 4RKUC 5L39A 4NLGA 2C3UA 1UJ6A 3ILOA 3R9LA 2JRSA 3LF0A 4WU2A 3CJ2A 1ZM2A 3FQLA 3M9MB 3BO3A 1AT1B 1V9OA 2QSFA 3UN2A 4DV3F 2H54B 1ZS6A 2VH7A 1S9GA 2IRYA 1TK0A 2XY6A 4JI7F 1CJUA 3J7AN 3R8YA 2ZKTA 3QT5A 3OHAA 1NJXA 4K4UA 3WX4A 1LW0A 3OQ2A 1KLMB 3PRVA 1LW0B 2H5IB 3ZNJ1 4I2PA 1EETB 3ZZZA 3MAQA 2VQFF 3RB4A 1YI2S 3PY8A 4NCAA 4EEYA 1C4CA 4ECRA 1KHVA 2CQIA 2V8PA 3DOLB 3MPUB 2DNLA 3OFEA 3PCOB 1RKJA 1HD0A 2COLA 3SFGA 3V2UC 4F02A 2F4VJ 5D15A 5KFFA 3H90A 3W61A 4ANEA 3K5MA 5IV3A 3AJDA 2Y1JA 2GFFA 1R8PA 4KPYA 1NLKL 3GJSB 1NK0A 1FHTA 1S6PA 1RHUB 1S6UA 2DY9A 2KN4A 3W66A 3ENQA 2AGOA 4ELTA 1FD8A 1P6TA 3FFIA 4LVNP 1IJEB 4RLEA 2G1HA 1SJRA 1X4EA 5DO2A 4DV6J 3GFXA 2UUTA 1BQNA 2VJVA 4JB8B 1NSKL 5ETKA 3LALA 1UZHA 2ZJQQ 3V4MA 3NNAA 2RS8A 4DSJA 1TL4A 1H0HB 5CH7B 1YQHA 3DLEA 4IG3A 1FKOB 2CNOB 1ZAVA 5IFMA 1N0VC 1EQ0A 2XGQA 2CZ4A 4P9SA 3VAHA 3OL9A 4KTQA 3BGOP 2DR7A 4M5HA 4OZ5A 1NDCA 3LW5C 4QW8A 1VRTA 3V4IB 3H2UB 3C15A 3DMJA 1WJ9A 1OQ3A 3UPFA 3PX6A 5J2MA 2MSSA 2WRMA 5J2QA 3M32B 1VFJA 2BMBA 2XMWA 5IWAJ 1QTMA 2DNNA 2EWHA 3BO2A 1VBXA 4K4TA 1GXUA 3W62A 2VFSA 1WC6A 4FPRA 1KFSA 4PRFA 1YG0A 2ZNZA 1U6BA 2FQQB 4UZBA 3C16A 4I69A 3NMAA 1FRLA 1Q86T 1VRUB 2O5DA 1RA6A 2J76E 2VG5B 4MH8A 1N5QA 4LR9A 3O2IA 1YKWA 1S1WB 2E5JA 4IOAQ 2HNZA 4NLVA 4JI8F 3GV8B 2HQGA 1YITS 2BOPA 5CZVA 2ALYB 2DGTA 4KHRA 4DI6A 3NL0A 3Q22A 4C4WA 1JLBB 1Q95G 1X4GA 4WKRA 3D3CJ 2J8AA 2FLOA 4M95A 5DG7A 2CPYA 2FVCA 5RUBA 2HS3A 2ZJRQ 1VQKS 1FXLA 5CAAA 2LP4A 3W60A 3JB9k 3IG1A 3RAQA 2BXJA 1VLYA 4L72B 4CLFA 1SJFA 2HVIA 4I0WA 2VG7B 3KKFA 3R1LA 3HD2A 5LL6d 5IT4A 4OYBA 1ACMB 3KK2B 3H5SA 4PPZA 2DNHA 4Q44A 2B3TB 3FZ2A 3I56S 4KH0B 4DL6A 2Q66A 4ILLA 2RVJA 4QQBA 2JSXA 1KLNA 1S59A 4O23A 4Y2IA 4CLWA 4CH0S 2G2OA 4ZLPA 3GIKA 4H4OB 1F5AA 3T5LA 4YUDA 1NB2A 2YWFA 4Q5VA 2KH9A 1E6YA 1RABB 2XSJB 4HEA9 1ZA2B 5EUHA 2PMHA 4WU3A 4DPTA 3PR4A 3OTOF 5KG4A 2IRUA 3AB2B 5LMUJ 3RB0A 2ZE2B 5EDWA 3HHLB 1LNQA 3D6MB 3LH2S 1M90T 4JI2J 3P3DA 4FS1A 3BBBA 3KLIB 4QR0A 4ZLJA 1MG7A 2MQLA 1QAIA 2V9WA 3ZZTA 4NXNF 4IFYA 2EVZA 2MEWA 3PR5B 2ZWPA 1XC9A 3EVWA 2R2RA 4R5PB 4JI8J 1XTZA 3IWLA 3PX4A 5D0RA 4F67A 1UFLA 5L8RC 3R97A 3MEKA 3ITHB 3KK3A 1GQEA 4P72A 4RW6B 2HHHJ 2LA6A 2LQ5A 2M88A 5CYMA 3W63A 3JSRA 4TKTA 5J2PB 4PXCA 1N34F 1F9EB 1Z2ZA 1CJKA 3DHWC 5CZXA 1UMJA 2IC3B 1RZMA 2VC0A 2UUWA 2RKIB 2NXUA 4B9SA 2F63A 1PILA 2MKJA 4MFBB 3MM9A 3EYZA 2HVZA 1ZM3A 2I1RA 4EZ6A 1ZA1B 1ICEB 1NDKA 4K4ZA 3THVA 3CMES 3DN9A 1QD1A 4ZPTR 3RZAA 1UEUA 3KJQB 2KXHA 1U1LA 2IM1A 4RW7A 4XPCA 3IM9A 4A8XA 4QPXA 4KFBB 3GQCA 2B4UA 2LEBA 2AYGA 4CLPA 2DH8A 3MAAB 4ZK7M 3IN5A 5F9NA 1KTQA 6FD1A 1OQ6A 1X60A 3HSDA 2DVIA 1DTQB 2MQMA 3HULA 4NA3A 1NPKA 4ZLLA 3JQJA 4EYHB 1BQMB 3B82A 3UDEA 2V4QA 1S9EB 2DB1A 2HNYA 3BYPA 3CCWA 3MCOA 5D0HA 3VVTA 4AQYJ 3V81B 3I82A 5B0BA 1WF1A 4BC9A 1VRUA 1UWBA 3OUYA 2W9BA 1U26A 1D9DA 2MY8A 4JP8A 4Y65A 4LF2A 3AA8A 3LP2B 5ETRA 4DUZF 5CXTA 2XHWA 3VQTA 3ISNC 4HYKA 3KNAA 1YRUA 2J9DA 1IBCB 1FFGB 2YKMB 2PI4A 3FUYA 3HHLD 4DL3A 1UW4A 1VRQC 4KHPF 4YB7A 4U67Q 1FO1A 1N33J 1PYSB 4WKYA 3PHTA 1FJ7A 2UUAF 3M2RB 2CQ0A 3O5TB 3U02A 4LMZA 4NXMF 4QYZJ 5E41A 3W2VA 1V6HA 4F7VA 4QZVB 5MLCV 2FJXA 2LU1A 1EETA 2HIYA 4M1KA 4XTTA 2W7PA 3GIJA 2RSQA 2VFTA 4X66J 1AA1B 1TL7B 1MROA 4IOCQ 4UUXA 2HHUA 3QGGA 2QL9B 3D9BA 4H4KC 3X3UA 4DN9A 4RWXA 2GHWA 2ZNYA 4ECXA 2XHCA 2PDAA 4QJVA 4QW9A 5KFMA 3MD1A 2KM8C 2Z2YB 2FPHX 4PR6A 1S6PB 4TN2A 5GADI 4C3MA 4P2XA 3C6TB 1S1UB 2HGNA 2LQ8A 1RAGB 3HVTB 3N5FA 2OFHX 2LXUA 2ZBQA 1SI9A 1Z4UA 4P52A 1DHMA 3QT8A 4C6AA 5A0YA 1FNMA 1RLDA 1U7LA 4Y34A 3SMZA 2XS7A 1D3WA 2L3MA 1NH8A 1XMBA 1PKUA 1X9WA 2GQ2A 2QYGA 1YJRA 1CG2A 1SQEA 1MWZA 1WI8A 2YPYA 4KBIA 1BLUA 6AT1B 5I42B 5T14A 5F41A 3CJKA 4B08A 5KFTA 4DV3J 1SBRA 3RU0A 3ZTSA 3GONA 1HNIA 5DDQC 4CLYA 2GQCA 4FBUA 1PJ6A 3W3SA 2I5JA 4X64J 1YRTA 2RJZA 4DV1F 2R7RA 2MQOA 3LAMA 4CRJA 2XS5A 3UR3C 2DNZA 1CC7A 4DR4F 1ZH5A 4RWWA 1KVKA 2C3OA 3HVAA 4UUWA 2EFNA 4CCHA 3FMBA 2VD3A 1P9YA 2JDJA 3FC9A 3V6DB 1R8CA 2XYHB 2HGMA 4O0IA 3TNVA 2VHGA 1TFWA 3LQVA 3MEGB 4UQTA 5AXMA 2DBBA 4QIEA 5JVHQ 1RADB 3T1HJ 1PO6A 2CYYA 4HHJA 1MSWD 2OPPA 1BQXA 2J0XA 1FI4A 4DV0J 4J91A 4J9NA 3QRPA 2XI2A 3LPYA 2R2TA 5F8LA 1CPZA 4MAKA 1QVGR 5AXLA 2E9ZA 3GYNA 2V2ZA 2H1YA 5A6WA 2HW3A 5F0WA 1HARA 3HX9A 4OYIA 2CNNB 2YKQA 2YTCA 1BHNA 1C2PA 2BVZA 3D3BJ 1O0PA 3IG1B 1C1BA 1U45A 1HWIA 1UP1A 4N47A 5L1KA 3QGIA 3EGNA 2XWXA 1SKUB 3L9ZA 1IKXA 2HAFA 3SXLA 3CO9A 3W5YA 3BV8A 5I3PA 4ES3A 3BBCA 2B5JA 2L41A 2B43A 1S1XA 2XNRA 1EX8A 2VQEJ 3KNGA 5KT2A 4Q45A 4BWMA 1XMOF 1UVIA 3I6PA 4NMXA 5IXUA 1HNZF 2Z2MA 4ENOA 4EUVA 3M4XA 5JVGQ 1FNXH 2E5LJ 2IA6A 2C1EB 4A8SA 5DETA 4C8NA 4LRCA 4M5GA 4RJVA 4MFBA 2GVDA 3DDNA 5KFNA 3P6YC 4ID8A 1RU1A 3G87A 3BSNA 4OX6A 2RQMA 3DNCA 4U8VA 1KN6A 2RNEA 2DJWA 2G0IA 3DGPA 1KR4A 1NM2A 3IS9B 3QWPA 1S1TA 4J90A 4ZVRB 1EP4B 5IQ6A 3ENWA 3QJLA 2E5HA 2K2PA 4LF4J 1FDBA 4CNYA 1FCAA 4I56A 2MGZA 3ITHA 4R5PA 2UUCJ 4PABA 4NRUA 1M5SA 3G6YA 4B3SF 2KVIA 4A8QA 4OZ3A 2FJDB 3SCIE 2V50A 3AFGA 3CWJA 3MTJA 7FD1A 1RACB 3JSYA 2JFDA 3OXGA 2NZCA 4FZVA 4ITSA 4Z7CA 1RWMB 1SC1B 2BV3A 2KT5A 1S12A 3JTPA 1TK8A 3M8RA 2YNHA 5AXNA 4FF2A 1T94A 4QR2A 4F4YA 1M5HA 1XN9A 3IR5B 1QM9A 4EZ9A 3D0IE 1VJQA 2NLWA 4X65J 1HFEL 3CJTA 4FDFA 4K2JA 1Y7PA 2ZBIA 3OJSA 1S77D 1RLCL 4MKAA 1O6XA 2WSFC 3CC2S 2OTLS 2BX6A 2XZWA 4HVZA 5D78A 5KOXA 3NY0A 4KY3A 3PJ9A 2RB7A 5IC4B 2ADCA 4MTPA 3CDEA 2HQFA 2LA4A 3BR8A 5H9FK 2G0JA 2DISA 3MF5A 3DHXA 3BQ2A 3KXDA 5KFZA 4DSEA 1CQMA 2QMUB 5F3ZA 1N54B 3PM9A 5E7OB 4DL5A 2ZEJA 2XNQA 3GCWP 2I5JB 2R2SA 3FQKA 3O6QA 4PYDA 2PIIA 3HF5A 4ES1A 4TU9A 4DV4F 4FF3A 2HHSA 2FHMA 4C8LA 3MPDA 1U1OA 2EW9A 1PG5B 1CS4A 3R1HA 2DHAA 4C8MA 1U1QA 2AJQA 3R5CA 4USKA 4WF9Q 3HVWA 1MU2B 2YXLA 3SFUA 2B4VA 4J9UE 4B3SJ 4FVCA 4WP8A 2Z2ZA 3Q8UA 1T03B 2NZ4A 2R42A 1JLEA 4KH1B 1KRPA 1CC8A 5KTQA 4UW2A 4ZKAA 4DR3F 3CJ0A 3LP0A 3IRXB 2HWIA 4D3GA 1XNRF 2WSCC 1BWEA 3IRXA 3W9JA 1U8WA 2MHEA 3K0JA 2VBZA 4XO0A 4FNIA 5C2GA 5HL7Q 3C6TA 2KI2A 2LECA 4H4KA 1I5OB 2ERRA 2CPHA 2FJBB 1WI6A 4UOGA 5B0GA 2O67A 4W4MA 2H5EA 3HM9A 4RL1A 1IBMJ 2QMWA 2NREA 1JLAA 1ZOTA 4WFZA 3D4JA 4DQSA 4OHWA 3TI0A 2BEFA 2QLJB 3D1OA 4ZVOB 5J1PA 4DU7A 4LQ9A 2MDAA 3PG9A 2ZC3A 2W9CB 2AD9A 4DR7J 2ACMA 2V4JB 3BPSP 1WEZA 5J2NB 5JXSA 1AZSA 1C1CB 1FNOA 1K1QA 2BYCA 2W01A 4S0MA 4Y6IA 1R6VA 3W7BA 3GE9A 3KK1B 2RU9A 1LQ9A 2XI3A 2M0GB 1OMSA 2AJFE 2DITA 4O3NA 1MWQA 4RO0A 5GMEA 4A8OA 4U6PA 3RB3A 5I3QA 2PGCA 3AA9A 4G1QB 4ECUA 2C2RA 4RNMA 3MCSA 3VF0B 4F0KA 4DSKA 1IKWA 4XPEA 2J0SD 3EPGA 2QJ3A 1Z1ZA 2AMCB 2CG8A 3M30B 4IOBA 4M5MA 5F9LA 3KLFA 5DGAA 4DXLA 2PC6A 5BJRA 3G8TA 2UVRA 3RBDA 4JV1A 3UI3A 2VZ9A 5I3UA 3VWSA 1JKHB 2V4JA 1AUDA 1YLXA 5HI7A 1N5YB 1DTQA 1J5OA 2HRYA 4FBTA 2ZBCA 4KHMA 3NEKA 4DCPB 5ETMA 4URGA 1KONA 3SYZA 2QG9B 2DIVA 1DTTB 2F1FA 3HCXA 3M8QB 3P96A 1HR0F 3GFYA 1HI8A 2AW0A 4HLBA 1JLFB 4K4WA 4N41A 2HKEA 3EDRB 1WHXA 4JI0J 2DO0A 3L7PA 5ETTA 4AD6A 1HBOA 1JMTA 2NXEA 2NPFA 1F1BB 4WXWA 3G6XA 2VPZB 4XAKA 1U2FA 3RR7A 2LCWA 1NKEA 2QSWA 4NRTA 3TJAA 2HFNA 5A76A 3JSMB 2GV1A 2NYIA 5FLXY 3BGFA 4RNOA 4QIWD 2ZH2A 2J6SA 1HNWF 2HFZA 4RNNA 4IR1A 3H7HB 2VPYB 2F40A 3MR5A 4Y2AA 4DPYA 2MQPA 2HPUA 2GNKA 2YH0A 5K8NA 4B9MA 4AYBD 3HT0A 2HGLA 2W7OA 3OTEA 4ZA1A 2VG7A 3BH7B 2PMZD 3BQ0A 1CQNA 3TX0A 1O5JA 4RBTA 2MGZB 4OX9F 3OVAA 1L3TA 1M5PC 2FYXA 1VLOA 4OI2A 5BXIA 2DGWA 4RW4B 1EKSA 2OIHA 1LK5A 1XBWA 5IT9U 1SCJB 5KT5A 4TY8A 4U96A 3M9NB 4ED7A 1AW0A 2K3KA 5DG9A 2QT7A 1IM6A 3BYRA 3NS5A 3LWMA 1S0OA 2D69A 4GO7X 1RTIB 1J5EJ 4F3OA 3NXZA 4K0KJ 9ATCB 1OYEA 2HLUA 2OMOA 5L9NA 3UWTA 4UY8T 2AP6A 5C42B 2BE2A 1DY3A 4OZNA 3SSQA 2DYAA 1GMUA 1RHJB 1RT7B 2P6TA 4RX6A 3DI6A 3DRSA 4LF6J 2DHXA 3MM6A 1R7IA 3OSPA 1FFSB 1T95A 1H74A 2F4FA 2FC8A 5U47A 3TR5A 2A10A 2EK6A 3R5AA 2EFPA 5KFCA 1XNQF 2GAGC 4YDXA 5CYMB 4QU6A 3C15B 4A8WA 1VIXA 3TA2A 8RUCA 3MAAA 2XO7A 3M2VA 1VQ6S 3S01A 4K50A 4AXJA 5KG7A 2OMLA 1IR2A 5AE1A 4JV5F 3LGHA 4WIIA 2WONB 3OTBA 1S79A 3K2YA 2P6SA 2A0FB 2E7VA 4H4MA 4O44A 1FJEB 2MKCA 3C2PA 4GO5X 2ZH5A 3MMAA 2RQ4A 4LRDA 2GO8A 5DZ7A 3NLCA 3GG1A 3T9NA 4A8MP 1NJYA 1RDRA 3TVZA 2M3DA 4C0HA 3JQMA 2BE2B 4DEZA 4YR3A 4OYOA 1S1WA 4E2FB 4MKYA 3CCVS 3A1YG 2ZDPA 4HDHA 2M8HA 1SVDA 1LWCA 3SDEB 1RU2A 2OSQA 3W9HA 2W4PA 2YX7A 4AFFA 1KFDA 1TKZB 2AZ3A 3QT7A 1ZTTA 1E6VB 2FDNA 5L1JA 3KG0A 4ZCMA 1I3OB 1KC8T 3WX8A 5HVHA 2DHHA 5IC6B 1LWXA 4PQAA 1B70B 4YB5A 4RU9A 4DR1J 4PWUA 1Y9OA 3BS9A 4K5RA 3HSJA 1S7HA 4MK7A 5IV4A 3T5KA 4N7TA 1X4HA 3A4TA 2Y9HA 1V3ZA 2XTJP 4IFYB 2KYXA 2OPSA 4KE5A 3RYLA 2OPSB 4ECSA 2E9TA 4JYAJ 5KG0A 1RT2A 1JLQA 3E2EA 2DPIA 4QU7A 3GIRA 3EX7B 3T3FA 2HRTA 1DLOA 3TAMB 2HBQB 1MMNA 3PKMA 3F41A 1FEEA 5KFSA 4WK1A 2KJWA 3DFEA 1F5BA 4H4OA 2JLEA 4X66F 2BJDA 1OYDA 2VL1A 1E6VA 1VC6A 4B9UA 2KYZA 3KLGB 4BC7A 4JV2A 3H5YA 2HHQA 3U1MA 5BYSA 3LGNA 4X65F 3WC0A 4EBCA 4ZDNA 2DCLA 1XR5A 4B17A 2UXDJ 4TY9A 2AX0A 3ILIA 2M2BA 3CJRA 2LMIA 1RT4B 2DXFA 4DV6F 4U7UD 4J9OA 2W1BA 1IKXB 2QGFB 1TL7A 5E0OA 2Z8QA 2L9DA 1RWXB 4Y28C 4CO5A 5DZ6A 1AFIA 1ZM9A 3WZ0A 3BH6B 4DPWA 1VQ4S 2GHVC 1DURA 3OVSA 1NDLA 1TVRB 1VR6A 2HHTA 1VQ9S 1TQLA 3M2VB 4QR1A 5HMWA 2AYMA 1HQEB 1U8SA 4D3HA 3PYFA 5DQGA 1KSPA 2EFGA 4I2QB 1MLAA 3SCLE 2BW2A 4X62J 4OZ1A 3D6FB 3BPDA 3LO3A 3QLHA 3W8PA 2LVWA 3M1VA 1NZ8A 2KB2A 3D66A 3R27A 2AV5A 5EHHA 3VAJA 3UQSA 5BYQA 5LSLA 1K1SA 2AJ2A 2PFDA 2V6AA 3C16B 2ZOGA 3NCQA 5ITHA 3HXMA 1C0UB 2ALZA 2FGCA 4E0DA 2W2OP 1YX2A 4QIFA 4DFMA 1S97A 1QSSA 1TELA 1UVNA 3SDEA 3CC7S 5KG3A 3JSMA 2CJYB 4B3MF 2I38A 4F2SA 3EGZA 1CEZA 2XLIA 2DNGA 2LDIA 4PXBA 3DKDA 2NUHA 4K59A 4E8UA 5B0CA 3THPA 2XBPA 4FS2A 2O01C 4DG1A 1UVMA 1WKJA 3I87A 2IVYA 4PWDB 2OTJS 1HD1A 3HFZB 3H25A 3PJXA 4OV6A 4ED2A 4LF8F 2R7XA 4NPOA 4OYZA 2ZH8A 4K5SA 5E3CA 2JNJA 3HPOA 2NR0A 3V6JA 4KR0B 2ZH7A 1Y4ZB 4P71A 4L73A 4LRFA 2XYPB 2AYEA 2JFKA 4LFCJ 2DR5A 3DRYA 3L95X 5HJXA 1OPIA 4ZHRB 1FXDA 4EI2A 1SJ3P 1SH2A 2YKAA 3OD2A 3V6KA 4CI0B 2DRBA 3DLHA 1T11A 1VK3A 4P2MA 1KVJA 3HSGA 1IR1A 3LA0A 3L7UA 2VDHA 3MHYA 4I67A 3TARA 2P2CB 2SXLA 1K44A 1YZ7A 3R5DA 4ED4A 2FVRA 4Q8FA 4C3KA 2VFRA 2B6AB 4DX8H 2VPWB 2HAIA 4DQIA 2QLWA 4FXDA 2VICA 1U6FA 4R0EA 1IWGA 5CYQB 4DOZA 3POTB 5C2CA 3GJTB 3H2VE 3DOLA 3HKZD 2YBVA 1TL1B 1J2VA 4UQGA 5DG8A 1XERA 1NBEB 2RDIA 2EEYA 2IHR1 3TEGA 3IWNC 3EWGA 2VG6A 2J0QD 2DRDA 3WIVA 1UWAA 2KRBA 2VG6B 2YWEA 3OFHA 4YB1P 2E9RX 4Z2XA 1GK8A 3E01A 2DGVA 3A8KA 2M5YA 3OL6A 1U1MA 1SL2A 1UW9A 4JI2F 4J9RA 1GMVA 2K8GA 4HACB 5HMZA 4LF8J 3OFGA 3M2UB 5GAEU 1FX4A 1Q5YA 2W2NP 1HW8A 4MYTA 4X4NA 2NXNA 3MR3A 1GMWA 3J7Z5 2B6AA 4ES2A 3GTYX 4NLXA 4DUTA 3OHBA 4DJBA 3H2LA 1KOHA 4DPUA 2E66A 4LRBA 4C48A 4WYWA 2MY7A 4F04B 1CULB 2W2MP 3ILLA 3TYTA 3DYAA 5ETVA 3CMQA 2KXNB 1CULA 1WG4A 3AODA 1C0UA 4FN5A 2XM3A 2DR9A 3WQPA 2B9WA 1A6LA 4Y2KA 4JUZA 4PEOA 2PE8A 3A3NB 3EGWB 4M63A 5E3QA 1IJFB 5KFYA 2CPZA 5BYRA 2QX0A 1NNDA 2MLXA 4LSZB 2RU3A 1F3FA 5ADZA 4JI5F 4JI6J 2Z58B 4F4XA 4ECWA 2QA1A 4HACA 1CSJA 1KWMA 3OT9A 4H4MB 4TXSA 5HVGA 1NKCA 1K0TA 3CD5A 2QA2A 4P2FA 1LKZA 4ZVUB 3TAQA 2HRUA 1JB0C 1UL3A 2G1DA 4LSNA 4ECTA 2N4DA 4LF1A 3GCXP 1C0TB 3I32A 2UVVA 4IRKA 5HLFA 2W24A 4LF9J 1FESA 4TU8A 3MD3A 3SCKE 3GZ7A 1VBKA 3LAKA 4EO8A 3ZC4A 2I8EA 3CIZA 5CD4A 2HNZB 1JX4A 4Z7YA 2DXDA 3D1QA 2I9SA 4PUOB 1TKZA 2C2KB 3TQEA 4WFAQ 3ZTQA 1U49A 4F26A 3OR2B 1YDLA 4U7UK 4KGVB 2K7JA 3OR2A 2V34A 1P1TA 2RILA 3AD8C 3RB6A 1XIQA 1B0TA 2FJAB 3H59A 3VHQA 1I94J 2UUBF 3F44A 2NQPA 5ETPA 4MIAA 4DR3J 4DUZJ 4L6V3 2HNDB 4DPXA 5F8GA 2PO4A 3ETMA 4M8LA 5M2UA 3KG1A 4ERDA 3DM2B 3EVOA 1AB8A 4PG4A 5LT5A 3CCJS 1TU0B 3TZXA 4F4KA 1JLQB 1RSCA 1X5SA 4YR0A 1S99A 3KK3B 1RWUA 2KFYA 3ZXWA 3GG0A 1RT6A 1PSDA 1WWHA 1FKPB 1WG1A 4QPTA 5D8HB 4DLGA 1WHVA 1NO8A 1QAXA 4NZ6A 4LFAJ 4ZVSB 2AJ4A 3DLGA 4ZVGA 4EWTA 1NRKA 2B56A 2DNPA 3AXMA 3N0VA 4ZVEA 3Q8SB 2MJNA 2QZ8A 3OFFA 3QIPB 1E6YB 4DR7F 2KFZA 4DR5J 3IMQJ 3BGLA 4L3KA 1GXLA 3V5RA 1YWXA 2AQ4A 3FBEA 1U1KA 2AWZA 4ED0A 1XJWB 5K20B 1HHSA 4F0MA 3I4PA 2Q1LA 1HWLA 3DYAB 2A2DA 1QUVA 1UEVA 1ZM4A 3NGDA 3MEDA 4JI1J 2ATLA 2FD2A 2YWWA 1VRTB 5L46A 4Y3CA 4L3NA 2XY5A 1IUJA 2FHJA 2JHEA 2UXBJ 1HNIB 3M8YA 2ZH3A 3EXYA 1NK6A 4ZP7A 2AJ1A 2OEKA 1GFWB 4FVMA 2MYFA 3EUNA 3QAEA 3JAMU 1DTTA 3M8QA 3B4MA 2W25A 1R8AA 1FDAA 3M8PB 4NZ0A 5KFUA 5HBMB 3HHNB 1HIYA 1CJTA 1H98A 2MKKA 3CE8A 3Q8RB 3CSKA 3GR1A 3MM5A 3MTKA 1D9FA 1SJ1A 2XMAA 1BWVA 3C14A 5K14A 3NMRA 4DV1J 2B7CB 2F7VA 4LIWA 4PCQA 3M8WA 2VG5A 3DI6B 4F25A 4XIUA 3I5CA 3HT3A 4FXVA 1FERA 3MCMA 2YNGB 1LWCB 3IGNA 3RBXA 3WIUA 3M8ZA 4ZCIA 5KFWA 2ZD1A 2N3LA 3IBCB 2FZKB 1SQGA 3TWZA 3KLFB 4V1Ak 2CG4A 3SQGA 3OLAA 2YX1A 1RT1A 1UA0A 2QLFB 3TRGA 1IKYA 2B0GA 3TQ1A 2MZQA 4O44B 1QSLA 3VGVA 1RP5A 2RIJA 4LQ3A 2EBEA 4LSNB 4L76A 3CEDA 1DQ8A 1AXQA 1OPZA 2MSTA 2MKHA 2QYCA 1VQ5S 1K0VA 2Q3PA 5E3PA 2FC9A 4RUHA 4Z37A 1KHWA 5SUHA 3L3CA 4C8KA 1B7FA 4PWWA 1LWFB 2W4CA 2DNKA 3A8EA 3HHDA 4IKAA 1MN9A 1X5TA 3NOGA 4H54A 5DDRC 4YOEA 3KJNB 2HBZB 3QIDA 1CJVB 5KG2A 4ATNA 1PAEX 2FZGB 2B4PA 2B8PA 3PNIA 4ZVPB 3ZNUA 3PEJA 3FFIB 2B4OA 2M4MA 4N8NA 4NLOA 1U02A 5ETLA 3PZPA 1M5VC 1UZDA 2IDLA 3NGUA 3QGPA 2GMLA 5K8PA 1HWKA 1RB0A 2RRAA 2RDDA 1HBNB 4CDIA 3P5BP 1NUEA 1SH0A 1NHUA 1HBMB 3T5HA 3BDPA 3PV8A 3DRRA 4DQQA 1IQZA 1S5ZA 2EK1A 3EDQB 4NYPA 5LM7E 4LF7J 1F2GA 1VOMA 1RISA 1WTBA 2DRAA 3DOMB 1Q8KA 3HFVA 1U1RA 1S1XB 2BW7A 4FYVB 4NASA 5J2NA 4ICLA 2ZDOA 5D4LA 3F73A 3R2DJ 4G3IA 2XO6A 2D9OA 2MZ1A 3G71S 1HQEA 2K06A 2CQHA 2XULA 4FYDA 1SL0A 1WUUA 1BY9A 2E5GA 4ALZA 3EM1A 3G8SA 1D1UA 2HVEA 3MEEA 1PC5A 4LF5F 4WZQA 5KFBA 2D7SA 1EJ7L 2WOMB 2Z56B 3RUBL 4WTYA 2HURA 3TJ9A 3VVUA 4GVBA 2OH2A 3OR1A 5F8JA 1R43A 2QLXA 3UDLA 2CJQA 3GYXB 5D0EA 4ZCKA 3K17A 3T1AA 4DUYJ 3I9V9 1XMQJ 2ROPA 1VISA 2GVZB 2JLGA 1U2CA 1KEKA 4LFCF 1UPMB 1X0FA 2VODA 1JXVA 3EJMA 4Y2CA 5B0AA 3M30A 3SSRA 4KYZA 2XMTA 2G13A 4OX7A 5DRKA 2H65B 4I68A 4QWAA 4I6AA 3MEGA 4P7TA 2X1BA 4BLGA 4QWDA 4IDKB 2CKWA 2VU5A 2BABA 5A6PA 4DFPA 3PO4A 5GMKa 1U24A 2DNMA 4DSIA 2CNLB 1FFWB 3JS9A 4DR2J 2LU2A 2LKZA 1JLGB 4CLUA 2WCXA 3V6HA 2MZJA 1ZTWA 1X9SA 1TUWA 2PT0A 2XZTB 3H42A 2G9OA 4CO2A 3FZBA 4ZVQB 3IRWP 1OSDA 4OYWA 1C1BB 1KOOA 2EC0A 3VV2B 2R7UA 3NS6A 2AGPA 3BN7A 2ZOFA 4NEZA 4ZP6A 1W25A 2CXEA 2AZ1A 2KHDA 5KFEA 1NK5A 4KV8A 2W8LA 4QIVA 4U8YA 1G3OA 1URNA 1LOUA 1Y0HA 3UNYA 1I51B 3HZGA 4U9RA 1N0UA 1W26A 3KDOA 4J5OA 2H48B 1HBUA 1RKIA 3BREA 3MM7A 4XDCA 5KFJA 4NYOA 2IJRA 4OI0A 1RWNB 1V5IB 1NCLA 4LF5J 5C5JA 4KSEB 3ENAA 2Y0SD 2HYIB 3Q24A 3WC2A 2GVDB 1RYSA 2WAQD 4WXOA 5H9EJ 1TFYA 5IWAF 5E3AA 4WFNQ 1M1GA 1AUSL 4DS4A 1XNRJ 3GU0A 3RW7A 1PGZA 1FRMA 2CADA 1RTJA 3QFWA 4M5DB 2BM0A 4NLUA 4QWCA 3CMAS 3W2WB 1ZZNA 1WACA 3P45B 1RI7A 4RBVA 5HK4A 4YHHJ 4X4RA 4LR8A 3F0NA 3C46A 2B5JB 3IWXA 3PVXA 4UTGA 3CXCR 1N33F 1U6ZA 3BB5A 2W9CA 2HS4A 2IJFA 1RHMB 4RW6A 2GX8A 1GEHA 5GAHU 2MB0B 5E2QA 2VFVA 4PG7A 4HT7A 4R25A 2CAJA 1F5CA 4LBPA 2DGUA 2RT3A 1VQ8S 3B6BA 1VBYA 1NH7A 4WCEQ 3CCES 1EZZB 1IM4A 1IWAA 2R7QA 3LP1B 1IQTA 2HBYB 4K4VA 1RTHB 3AOCA 4IR9A 2HZAA 1HL6A 2OKQA 3AT1B 3BZQA 4YDDB 3I55S 2LDYA 3DLBA 2EBGA 1RTJB 3TVKA 1LXJA 3BEGB 3MAHA 3J81U 3FEZA 2DGOA 3M6UA 1TL3B 5F3TA 1IBKF 1HKAA 5CABA 3FNNA 1S0VA 3WHIA 3G9CA 2F3JA 1S1VB 1G7CB 4DZ6A 2KVQE 3G82B 2YNIA 3OXFA 4FNHA 1PYOB 1YBUA 4ETZA 2ACYA 3LOUA 4A8YA 1GT8A 2RMLA 2CNKB 1HWJA 5HMYA 1YSJA 2UUBJ 3L7OA 4NWBA 4OJ1A 1H2TZ 5J2QB 2YNHB 1ZYQA 4ID5A 2DR8A 1G1XA 3I9ZA 4C98A 2ZH4A 1N32F 2G2ZA 2H9ZA 5CQGA 3M8PA 3VAMA 1F9HA 4TYBA 1EQMA 1NMEB 3W5XA 3PHEA 3OL7A 4GKJF 1FWKA 1VJWA 1X9MA 2KZMA 4QOTA 5EN1A 3I4HX 2D9PA 4J9VA 3UR0A 3CGIA 1I1GA 3BKTA 4CO1A 1KBRA 2L08A 2V8VA 3AJ2A 1TKTA 5HAOA 1SQFA 2ILYA 2N4CA 2U1AA 2GMJA 3E3XA 2C3YA 3G82A 5IS2A 4AXIA 4PPDA 2HHHF 3SQGB 1VQSA 4DLEA 2ZM6F 1ELOA 1N5VA 2GGPB 3GSIA 4MK9A 4UOCA 4OJGA 2N82B 4ZPBA 3HI9A 2BM1A 1ZPVA 2B51A 4DCJB 2R7TA 3DLKB 3OTDA 4FKYA 5A8RA 1HHQA 3GJQB 4LJMA 1FKAF 3GR0A 1KTVA 3P49B 3THTA 3M6XA 3QGHA 2HZVA 2UU9F 3UD4P 1T3NA 3MMAB 4HH0A 3OW2R 2PI5A 3G96A 2OEMA 1N4LA 3K5LA 1MROB 5CYJA 4ZJLA 2C2ZB 1NZAA 1TVRA 2VF3A 3ET6A 3GFHA 2OLWA 2ZOMA 4HI2A 1N36J 2EG2A 3BSAA 3ET6B 5G0RA 3Q23A 2ZC4A 1LV5A 2JC0A 4DBQA 2K1RB 3DLLQ 2IYGA 1T05A 2RDJA 1FJGJ 1FD2A 5DLGA 2YX4A 3W65A 1LK7A 2CQ2A 4URSA 4Q43A 3FCHA 4OL8A 1SB6A 2ABYA 2JH3A 3LANA 2HHVA 2ZE2A 2D3ZA 2GHPA 3LGMA 2GJFA 2KL8A 4ILMA 5KFRA 2JLFA 2VV5A 1IKWB 4CZCA 2UVUA 1FWPA 2HFOA 5KFXA 4NLYA 5HMXA 2VQEF 3CPWR 1WC0A 4OI3A 4KGMA 4EGLA 2OP5A 2VOOA 1XMOJ 4WP3A 1IBLF 1QY7A 4C3LA 2MKSA 2MQNA 3AJ1A 2IAJB 3R7BB 2H51B 4CM0A 2FLNA 5LSOA 1FE4A 1FK9B 3TEHB 2N7CA 1Q1KA 3D7SB 3TAMA 2GAHC 1N8RT 2FVSA 1WSRA 3V4IA 4V19J 4LF6F 2CPIA 3DLGB 4LVOP 1YJ7A 2WVEA 2R7VA 1BQMA 2V67A 2E29A 2F65A 3JYTA 3VR1A 3HK2A 1XNQJ 2Q6CA 4LSLA 4OHVA 3JYTB 1N6QB 3B8HA 2YNFA 1A7GE 1R0CB 2EKYA 2ZWOA 5GVQA 4WTOB 3G86A 4LF4F 4L75A 1X7VA 4J37A
chains in the Genus database with same CATH topology
3QBCA 5ETRA 4M5KA 1RB0A 3ILLA 4CYUB 4M5NA 1DY3A 1RTZA 5ETMA 3HT0A 5ETVA 4M5IA 2BMBA 3HCXA 3ILOA 5ETNA 1RU2A 4CRJA 3IP0A 1F9HA 4M5JA 1EQMA 5ETSA 3HD1A 1TMMA 3HD2A 1G4CA 3KUEA 1HQ2A 3UDVA 1TMJA 5ETTA 4AD6A 5ETOA 3HSZA 2QX0A 4CYUA 5ETQA 5ETKA 1EX8A 3HSDA 5ETPA 1KBRA 2CG8A 3HSJA 3MCNA 3HSGA 4M5MA 4PZVA 4F7VA 1CBKA 3UD5A 3ILIA 3MCMA 1HKAA 3UDEA 2F65A 1EQ0A 1IM6A 1RAOA 2F63A 3KUHA 3MCOA 4M5LA 4CWBA 3ILJA 4M5GA 1Q0NA 4M5HA 3KUGA 5ETLA 1RU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBC A;  5ETR A;  4M5K A;  1RB0 A;  3ILL A;  4CYU B;  4M5N A;  1DY3 A;  1RTZ A;  5ETM A;  3HT0 A;  5ETV A;  4M5I A;  2BMB A;  3HCX A;  3ILO A;  5ETN A;  1RU2 A;  4CRJ A;  3IP0 A;  1F9H A;  4M5J A;  1EQM A;  5ETS A;  3HD1 A;  1TMM A;  3HD2 A;  1G4C A;  3KUE A;  1HQ2 A;  3UDV A;  1TMJ A;  5ETT A;  4AD6 A;  5ETO A;  3HSZ A;  2QX0 A;  4CYU A;  5ETQ A;  5ETK A;  1EX8 A;  3HSD A;  5ETP A;  1KBR A;  2CG8 A;  3HSJ A;  3MCN A;  3HSG A;  4M5M A;  4PZV A;  4F7V A;  1CBK A;  3UD5 A;  3ILI A;  3MCM A;  1HKA A;  3UDE A;  2F65 A;  1EQ0 A;  1IM6 A;  1RAO A;  2F63 A;  3KUH A;  3MCO A;  4M5L A;  4CWB A;  3ILJ A;  4M5G A;  1Q0N A;  4M5H A;  3KUG A;  5ETL A;  1RU1 A; 
#chains in the Genus database with same CATH topology
 4HHU A;  4ECY A;  5EX3 A;  3ZZO A;  1VCT A;  3GII A;  2X7I A;  3KG4 A;  1JLA B;  3FCV A;  4LR7 A;  1EP4 A;  3MM8 B;  3U1L A;  2YKP A;  1HQU B;  4NX9 A;  3W9I A;  4LBI A;  1K9M T;  3Q8P B;  2YKM A;  2DR6 A;  2ZZT A;  3EMT A;  1SJQ A;  3TA0 A;  3QZ8 A;  2ZD1 B;  2LQ9 A;  3MUR P;  4IDK A;  2AHO B;  1SL1 A;  4YS2 A;  1TK5 A;  1JXE A;  4ZIV A;  4UST A;  1IBL J;  4O3S A;  5JMN A;  1VHI A;  2ATC B;  2O66 A;  2VPX B;  1VQO S;  5FDL A;  2GGP A;  3QAU A;  3OTO J;  2RHQ B;  1ARO P;  5LMU F;  1IBK J;  3MCN A;  3C8Y A;  3QQC D;  1HA1 A;  2NCK L;  3BDE A;  1S9E A;  2HNY B;  4OLP A;  1WKL A;  3S7R A;  1JLC A;  1QTN B;  2HIQ A;  1TAQ A;  2BUN A;  2ZVI A;  3E51 A;  1JLF A;  1C0T A;  2CJA A;  1CS4 B;  1NPP A;  3IA0 A;  5HJY A;  3OVB A;  4LF7 F;  1M1K T;  3SEO A;  2EXU A;  2AKW B;  3DCA A;  2HHX A;  1GX6 A;  2DHG A;  2HFU A;  2O1P A;  2YKO A;  4G6V B;  3ZZ0 A;  3TP2 A;  2OUG A;  4X84 A;  4IRD A;  3NWR A;  1BE4 A;  2L9N A;  3UDC A;  5LSR A;  2DHS A;  4HH1 A;  4RW7 B;  1HI1 A;  3KJV A;  3UNG C;  1TUV A;  1HI0 P;  3SI8 A;  1NPR A;  4DF4 A;  4B3T J;  4EBD A;  4DWI A;  4WIQ A;  3CDW A;  3M2R A;  3B78 A;  3KHR A;  4EYI B;  1FJC A;  5K9F A;  1XMQ F;  1KDN A;  1K8A T;  4MT1 A;  2O3D A;  1HBN A;  3FSX A;  2FB0 A;  2CPJ A;  4OZJ A;  3VCD A;  2UXC J;  3W1Y C;  1RT5 B;  2MZT A;  3CW2 C;  1FE0 A;  1GTH A;  1RJJ A;  2EKN A;  2WVF A;  4HHH A;  1REV B;  1SH3 A;  1HNV A;  2HBR B;  2UZA A;  3TZZ A;  1DLO B;  2BE9 B;  2AF6 A;  1YK9 A;  3CIM A;  3D1H A;  2UXD F;  3HVR A;  2QFJ A;  3UN3 A;  4C8Y A;  3S6E A;  4M5I A;  5AJ3 J;  1K73 T;  2HZC A;  5KFD A;  1UVK A;  1Q53 A;  4NCB A;  4USH A;  5FII A;  2Y1L B;  3FKB A;  4ZVH A;  2DY1 A;  1NSP A;  4DN0 A;  1H73 A;  5K8M A;  4GKK F;  3H98 A;  2QTW A;  2IVF B;  2POK A;  3O8W A;  5IQQ A;  1HPZ B;  3CTR A;  5DDO C;  5LMN J;  4YY3 J;  2ROE A;  4N56 A;  4LBH A;  3X1L B;  2QN6 B;  1URR A;  5DM7 Q;  1L3U A;  3POT A;  1S1T B;  4KPC A;  2VON A;  3SBM A;  2FLP A;  2UV8 G;  2IMW P;  1Y00 A;  2ZUG A;  1D8Z A;  3CJ3 A;  3H5U A;  3U7J A;  4WFX A;  4K7Q A;  3MFI A;  2RQC A;  2OJ3 A;  3A13 A;  1MML A;  3ONQ A;  2CJK A;  2E7W A;  1YHQ S;  2N7Y A;  3FK4 A;  4JOU A;  4PG8 A;  3UCU P;  1NAQ A;  3IAM 9;  1SKS A;  2VOP A;  1TAU A;  3MMC B;  2QO3 A;  4ANC A;  2JEJ A;  1FRH A;  2J0W A;  2KDO A;  1VGY A;  3A12 A;  4N8O A;  3IAS 9;  5B09 A;  3MPV A;  1H38 A;  2M9K A;  4WFY A;  2WON A;  4Q7A A;  5KG5 A;  4Q0B B;  3OR1 B;  2GA7 A;  1WOP A;  2NXJ A;  3GYG A;  2W8K A;  5HLF B;  3MMB A;  4CLT A;  3DRP A;  3MMB B;  3KWM A;  2ADB A;  3J81 Y;  2ZIT A;  2FY1 A;  2KFN A;  3N6M A;  3H4D A;  3SZ2 A;  2APO A;  1YTY A;  2OPR A;  1H3D A;  4J9K A;  4NXN J;  3GMG A;  5T7L A;  2EC2 A;  1LFP A;  4OQJ A;  2LEA A;  3J7Y I;  2FHO B;  2UUC F;  4B9T A;  1RK8 A;  3O1L A;  4WP9 A;  2H4Y B;  5I3U B;  4BDP A;  2WVB A;  4YN3 B;  4DSL A;  4BHQ A;  4USJ C;  2AGQ A;  2YY3 A;  4GKK J;  2CWK A;  2A1B A;  5FDL B;  2XSJ A;  4WBF A;  1SKW A;  4B3R F;  1Z2L A;  1R27 B;  2VB6 A;  3RW6 A;  2ZBR A;  2KG1 A;  1NJW A;  4ECV A;  3A3P B;  3M9O B;  3N01 A;  2GJ2 A;  3CJQ A;  2B8Q A;  3PEH A;  5KT7 A;  1EIY B;  1UAW A;  4KC5 A;  4CLS A;  1SXL A;  2X1F A;  4OZ2 A;  4JI4 J;  5D0G A;  2OSR A;  3VAK A;  2KHC A;  4R8U B;  2LFV A;  2P9C A;  3LWL A;  1NK8 A;  4WE1 B;  3VTI A;  4KGZ B;  2RD5 C;  3UE2 A;  3CJ4 A;  4UZC A;  5LOQ A;  1RT2 B;  2MZS A;  1IR0 A;  4F4Z A;  2MLZ A;  4C8Z A;  2IIH A;  3D28 A;  1VQP S;  2D41 A;  3IR7 B;  1FKP A;  1AZS B;  1C1C A;  2M7S A;  3US5 A;  2D3O 1;  4ZPA A;  4Y2M A;  2GJI A;  1BUX A;  1RBA A;  2KO1 A;  2VBY A;  3LP1 A;  3PW4 A;  1T05 B;  1WEX A;  1RCO B;  2XCA A;  5D4P A;  5KT6 A;  2XQC A;  2DT9 A;  2QLB B;  4JYA F;  2CVE A;  3JTN A;  2BZ2 A;  1L3S A;  4JV0 A;  3N79 A;  4G1I A;  4OX9 J;  1W7W A;  4DV4 J;  2P8I A;  3QBC A;  4KAI A;  1R89 A;  2XMU A;  4O4G B;  5IT0 A;  2HG4 A;  1RAA B;  2RAQ A;  2LQB A;  2XMM A;  2VKR A;  1NK7 A;  2VDI A;  1Q4R A;  3MM6 B;  1JJ2 R;  1M5K C;  5HAT A;  2V8D A;  4IRC A;  3NAI A;  1RT7 A;  2OO4 A;  1DJ0 A;  2Z2L A;  3IBF B;  2R2U A;  1SUQ B;  2XMK A;  3C6U A;  3NKY A;  1G2E A;  3BF4 A;  1FRI A;  4USU A;  1HQ2 A;  4C97 A;  4B02 A;  2YVS A;  4I7F B;  5AE3 A;  5DDP C;  2CQB A;  4UT4 A;  1ROF A;  3K8V A;  4C11 A;  3EXC X;  5HQL A;  1T02 A;  1UEK A;  1B3T A;  1S72 S;  4X4S A;  1S6O A;  2D3O R;  1R6Y A;  2K3I A;  3M32 A;  3CCR S;  2WOM A;  1A0O B;  1CJT B;  4HT5 A;  3MPY A;  4CM2 A;  2RE1 A;  3FBB A;  2M52 A;  5HBM A;  3IR6 B;  4OJH A;  3IO1 A;  2R7W A;  1Q81 T;  3ZTO A;  2OPQ A;  3Q8Q B;  2Y0B B;  4KV8 B;  1K47 A;  1X4B A;  1MW7 A;  2XMV A;  4DHV A;  3DLE B;  4IG3 B;  3AB4 B;  4NI2 A;  3BKF A;  5C24 A;  4GC7 A;  1UKU A;  1LW2 A;  3AH6 A;  2CPF A;  4GMK A;  2D3U A;  3MMJ A;  1RCX B;  3MR7 A;  4JV5 J;  5ETS A;  4JBC A;  2C28 A;  1HNZ J;  1WC1 A;  4DV7 J;  2ASY A;  3RJM B;  4JI4 F;  5JUM A;  2OPP B;  1Q82 T;  2E5L F;  3D2W A;  3HZE A;  3CC4 S;  5ETO A;  1C4A A;  2DNO A;  2V2Q A;  3ETO A;  1QE1 B;  2J7W A;  2ZH9 A;  1DRZ A;  4WJB A;  4CLK A;  1JIH A;  1QE1 A;  1R31 A;  2ASJ A;  1PJ7 A;  3LTO A;  3TAP A;  1CBK A;  3UD3 P;  3ADA C;  1PIE A;  3GJR B;  4DL7 A;  2DEJ A;  1MMD A;  2FUG 9;  2C42 A;  4ZLN A;  1UCN A;  2X3D A;  3MGJ A;  2ZH1 A;  4DS5 A;  3W64 A;  1YBT A;  3N5B A;  2BRL A;  3K5O A;  3KHH A;  2P5V A;  1MU2 A;  1VIO A;  3D6H B;  3VGT A;  4DF8 A;  2OPR B;  2AEJ A;  2J6U A;  5GAE I;  4PKD B;  1RT6 B;  3M7V A;  5T7L B;  3E01 B;  4DQR A;  2JJ4 D;  3Q0A A;  4V19 X;  2K1R A;  4BWJ A;  4FF4 A;  1HYS A;  2C3M A;  5D4N A;  4YHH F;  3U27 A;  1WHY A;  1KQF B;  4MYU A;  4ZJQ A;  2WVC A;  2HVH A;  2KKH A;  4ZPV R;  5D4O A;  1X8D A;  3UVJ A;  1CJU B;  1O8B A;  3FMW A;  4AL7 A;  1VC5 A;  2IBK A;  2CPE A;  1RBO B;  1XQI A;  2MHN A;  5KT3 A;  3AQO A;  1BQN B;  4Y0F A;  3MZI A;  5CYQ A;  3CCS S;  4LFA F;  1YRX A;  2NPI A;  2HQC A;  4AT1 B;  5A0Y B;  5KT4 A;  1X0P A;  1EKR A;  3CCT A;  4P75 A;  5IT9 Y;  3D54 A;  3NWG A;  3R7S B;  3GV7 B;  2XY7 A;  1TL3 A;  2IPO B;  3KTQ A;  5A8W B;  1H2V Z;  3DOK A;  5IM0 B;  2EFO A;  1JQG A;  2QEX S;  2ZZM A;  3A3O B;  3DOK B;  3C6U B;  3OTC A;  4RW8 B;  2WTF A;  4NCG A;  1DAR A;  2VIH A;  4KIA A;  4WWS A;  3MEC B;  4USW A;  4N76 A;  2BOA A;  4NLS A;  3Q2T C;  1S57 A;  1R0B G;  3T1H F;  2XB2 D;  1MN7 A;  2PFF B;  3HKW A;  4DFK A;  1CJV A;  5HVF A;  2YWG A;  1KQG B;  1B7Y B;  1SC4 B;  2KXF A;  4CLZ A;  3VGU A;  3VAL A;  1HNW J;  3MEE B;  1YIJ S;  3QJP A;  3CCQ S;  5DLF A;  5DJB A;  4AQY F;  3HO1 A;  4LSL B;  5IOL A;  2FJV A;  3K5P A;  2YQ1 A;  4ECZ A;  1RWP B;  2YNF B;  2YPZ A;  4NML A;  3B54 A;  4CTA A;  4TVA B;  2P9E A;  1EAR A;  1LWE A;  4IG0 B;  3R2C J;  3Q8V A;  4LUB A;  2V69 A;  1YJT A;  5CHC B;  3W2V B;  1FKO A;  1RYR A;  3K5N A;  4FYX B;  3EPI A;  2UXB F;  1YGY A;  4ZCL A;  2MQ8 A;  3UD5 A;  2RRB A;  5L1I A;  4B9V A;  2DO4 A;  2XWY A;  1VBZ A;  1WEY A;  3RRG A;  2MJU A;  3DU5 A;  2DH7 A;  4X62 F;  3ISN D;  4KHP J;  2X3G A;  3MEC A;  1NXI A;  1NHK L;  1YZ6 A;  4OYX A;  2FVQ A;  3KMS A;  1PYT A;  2V2V A;  3QT6 A;  1SJ4 P;  3CUN A;  4MIW A;  1WOS A;  2Y1R I;  1DAX A;  2ZHB A;  4ZMM A;  3KK1 A;  4LFB J;  1T9T A;  1RWV B;  2BKO A;  3OXL A;  5HN0 A;  3PIP Q;  1UVJ A;  2HQ3 A;  1QDU B;  1HBO B;  3ZZR A;  1WDT A;  2JOQ A;  4YEA A;  2D1C A;  4UY8 5;  4NI2 B;  2GZO A;  2HFS A;  3M6W A;  3KJV B;  2CQ1 A;  5D3G B;  4HL9 A;  5FD1 A;  1H7X A;  4PQU B;  5G0R B;  4EU0 A;  2UU9 J;  1WTF A;  3Q89 A;  3PKY A;  3CJK B;  1HMV A;  2J7K A;  4KFB A;  1JLB A;  2W7A A;  2HQI A;  4DCO B;  2PEH A;  1BMQ B;  2F8E X;  1X4C A;  1JJ4 A;  2HVD A;  3QPI A;  5H9F J;  2B7B B;  4DSF A;  5HRO A;  1N36 F;  5F8N A;  2DH9 A;  3BKU A;  5LMN F;  2IVM A;  2GQQ A;  1GXT A;  3DLK A;  4IH6 A;  1NJZ A;  1VMB A;  4X4O A;  5C42 A;  3ISZ A;  1FJG F;  4Y00 A;  5HP1 B;  1V3R A;  1X5P A;  3MFH A;  2GIF A;  3PFE A;  1TMM A;  1VQY A;  1H7W A;  2A3J A;  3I0R B;  4DX6 A;  5A8K A;  2X1A A;  2F9J A;  1L3V A;  1Q7Y T;  2V94 A;  1T9W A;  2ZHA A;  4DV2 J;  1U48 A;  3BGR A;  5KAK A;  1T03 A;  4ER8 A;  1TKD A;  1T7P A;  2RF2 A;  2IYI A;  2BQ3 A;  3U1N A;  3HMJ G;  2A18 A;  4OJ3 A;  3DMJ B;  4RW4 A;  1ITP A;  1NEE A;  4IQM A;  3PW2 A;  4AL5 A;  4LFB F;  5B0F A;  1SV5 A;  2AU0 A;  1Q5V A;  4DV5 F;  4ZP9 A;  4HR2 A;  2V8G A;  4OV1 A;  3NRB A;  4JI0 F;  4AL6 A;  3J80 U;  1FEH A;  1W2B R;  4KQZ A;  2Z57 B;  4O3R A;  1LEO A;  2CDR B;  2BJ8 A;  4OMF G;  3MR6 A;  1QJH A;  4CNZ A;  3W2W A;  1HW9 A;  3FDS A;  5ETN A;  3AQP A;  3R7N B;  1X31 C;  1PBU A;  3OLB A;  2MPU A;  2QC3 A;  1ZET A;  4MMO A;  1X5O A;  3BM7 A;  2G0C A;  2CJ9 A;  3RGI A;  4A4J A;  2GMH A;  1REV A;  3BN4 A;  2DGQ A;  1HNX F;  3AHP A;  4ED8 A;  1S1V A;  3BGR B;  4HDG A;  2KTQ A;  2YNI B;  2XEX A;  2IM0 A;  3N4W A;  1UPP A;  4MKB A;  4NYZ A;  4C11 B;  4C7Q A;  3HJV A;  4N5S A;  2RQK A;  1XR7 A;  3PRD A;  3HHK A;  1U0H B;  3IBW A;  5G4D A;  5M2P A;  5MAO A;  4K4S A;  2YKN A;  4KKO A;  1DZ5 A;  1L3K A;  5KFG A;  1Q8B A;  2KU7 A;  2IMO A;  3K89 A;  3QIP A;  2F8M A;  4CO4 A;  1B0V A;  3TUP A;  2RKI A;  1T8E A;  1I6J A;  3KUH A;  3NNH A;  1Q8I A;  2MLY A;  3Q86 A;  3RRK A;  3RTV A;  2FHK A;  3SV4 A;  1FT8 A;  5K14 B;  2G4B A;  2WK4 A;  3MM5 B;  4P7V A;  2IRX A;  1Y5N B;  2HWT A;  2ZKU A;  3IGV A;  1VDH A;  2QA4 S;  1TKX B;  2BJ3 A;  2VAS A;  1IKV B;  2CQC A;  1OY8 A;  2PD1 A;  3PJW A;  3R6G B;  5KG1 A;  1F3V A;  3DU6 A;  3QNW B;  3R5G A;  5J2M B;  5GAD U;  4DDF A;  5J1E B;  3QO9 A;  4ZN3 A;  4RUC A;  3PFO A;  2OEJ A;  4TU7 A;  2CPD A;  1RHQ B;  1S9G B;  2R4F A;  3GLJ A;  5C7P A;  4DV5 J;  2WW4 A;  4DG1 B;  2FLL A;  2C2D A;  4Q2M A;  2CQD A;  3OBI A;  2AIR B;  3BGU A;  1J5E F;  5HQ8 A;  3EVM A;  2EI5 A;  2HWH A;  2NSB A;  3GFZ A;  1KS2 A;  2V8H A;  1RGV A;  3NCP A;  1JJH A;  4XK8 C;  1WHW A;  2QFI A;  2ILZ A;  3GSD A;  1S76 D;  4WPA A;  3JTO A;  1H2U X;  1FRJ A;  1WF2 A;  1ZAX A;  2WBR A;  2Z0G A;  3NG8 A;  5GAG I;  3QZ7 A;  2DPJ A;  1VYA A;  1Q0N A;  2DNY A;  4BCA A;  3V6D A;  2DXE A;  2JL9 A;  3DC2 A;  3EIC A;  4W98 A;  5GAH I;  3KK2 A;  3HDS A;  2R9L A;  1DQ9 A;  3VAG A;  2ZBP A;  2QV6 A;  5J2P A;  4FP9 A;  4QYZ K;  2E7X A;  1FVQ A;  1KKH A;  1VK8 A;  2J5A A;  3A8I A;  4I64 A;  3UCG A;  1M0S A;  1NSA A;  2R8H A;  4ZN1 A;  1SV5 B;  1N6Q A;  1XK8 A;  1QAJ A;  3EGV A;  2KJV A;  4USM A;  1RT3 A;  4FF1 A;  2HLT A;  2J8S A;  4IH5 A;  1QAY A;  3HHL A;  4PXE A;  2F4V F;  4FKX A;  5KFH A;  4ED5 A;  3UCZ P;  2OFG X;  4O3O A;  3SV3 A;  4U7C A;  1SC6 A;  3Q83 A;  3I5A A;  4F3Q A;  3G6V A;  4DFJ A;  4MK8 A;  5D77 A;  2NUU G;  3H8Y A;  2R8K A;  1WKK A;  2IAJ A;  2A2C A;  2FHJ D;  3FCW A;  4RW8 A;  4X4T A;  2DK2 A;  2WZ1 A;  1B0P A;  4NCG B;  4C9D A;  3HFK A;  4I6W A;  4I7F A;  2CWX A;  5KFQ A;  1W2I A;  3ZFV A;  2R8I A;  2IBO A;  4F2R A;  2G2Y A;  4CYU B;  2HS0 A;  1YJN S;  1WOR A;  4RR5 A;  4ZS6 A;  1KQS R;  2HMI A;  3LP0 B;  3LPE A;  5CA5 A;  8AT1 B;  2BJ9 A;  3TVY A;  2OEL A;  3WDO A;  1WEL A;  1NK9 A;  5E5N A;  2DEI A;  4ZVF A;  3QLH B;  4I2Q A;  4KT0 C;  3TZW A;  1G4C A;  2IA0 A;  1UFW A;  3JQK A;  4GVB B;  1PJ5 A;  3HSZ A;  3K7R A;  4ECQ A;  1J27 A;  3DRP B;  4OYP A;  1KD1 T;  1FDN A;  2B9X A;  3R5B A;  4PYA A;  2GS8 A;  1PBA A;  2NYH A;  3NGR A;  5GAG U;  1D09 B;  1NB7 A;  5D3G A;  3D67 A;  1OWX A;  4YQW A;  1RWW B;  2E1R A;  2XSF A;  1B99 A;  3ZTP A;  1NSQ A;  2P9G A;  2BE7 D;  5F8H A;  4DL2 A;  2JEF A;  1JKH A;  2LQJ A;  1B64 A;  3QWU A;  2ZZN A;  5CD4 H;  1N52 B;  2GIR A;  7AT1 B;  1Q7L B;  2X1G A;  1VHF A;  2HMI B;  1GNK A;  1QUP A;  2XG8 A;  5F8I A;  5KFP A;  1FDD A;  1WF0 A;  4OZL A;  1S10 A;  2FJW A;  1F2H A;  1U09 A;  3PIO Q;  1IBM F;  1F0X A;  4N77 A;  2LXI A;  5CCL A;  1WNE A;  2HHP A;  4WK3 A;  3GV5 B;  1KNZ A;  2JEI A;  1T0T V;  3MPW A;  2ZM6 J;  2VJU A;  3I96 A;  2RS2 A;  1O51 A;  4F4W A;  4CH7 A;  4B3R J;  1MNE A;  1UWB B;  3C14 B;  4I1T A;  3OUY B;  1D0E A;  2PEB A;  3MI7 X;  4B9N A;  4OHZ A;  4TQR A;  2XYG B;  4LRE A;  1N56 A;  4F0H A;  3T19 A;  3MXH P;  1X4F A;  3PTW A;  1HBU B;  3MM7 B;  3KHG A;  3HJF A;  3P8B B;  4EO6 A;  4KGX B;  1Y5I B;  1HYS B;  3D5M A;  1FTR A;  4CIO A;  2WSE C;  4J9M A;  3J81 j;  5BR8 J;  1FWL A;  2E1M C;  2N3O A;  4E98 A;  4J7C A;  4NZ7 A;  5JJB A;  3FBF A;  3N6N A;  4KGK A;  4ZIW A;  2CZ9 A;  2Z4P A;  1IKY B;  3CJ8 A;  4HTJ A;  2HND A;  2CIM A;  2J9E A;  4F50 A;  1Y3J A;  3C3L A;  3DGP B;  3IS9 A;  4F8R A;  2K7K A;  1RAJ A;  1VQL S;  1U0S A;  2BKN A;  3DRS B;  4P6Q A;  2CJX B;  4OIX A;  4OFZ A;  2JEG A;  2DNQ A;  5LJ5 Y;  2EFV A;  6FDR A;  1FVS A;  2A6O A;  2AEM A;  1Y11 A;  3CT9 A;  5EX0 A;  2W9A A;  1OY9 A;  7FDR A;  1NHV A;  1T9V A;  2C2O B;  2DNR A;  2OD4 A;  5HSP A;  3E8O A;  1WOO A;  2CFX A;  1T9Y A;  3MUM P;  3DDK A;  1RE1 B;  4UOF A;  2YQ0 A;  2PMW A;  4CT8 A;  2VUG A;  3KDN A;  1WC5 A;  3PAC A;  3UO0 A;  1TL5 A;  2XZD B;  3IM8 A;  1R8H A;  2W4D A;  4EK2 A;  1S6Q A;  1HPZ A;  2OPQ B;  1QLN A;  4X2B A;  2PA3 A;  1F9F A;  1S6Q B;  1KLM A;  4IO1 A;  4IH7 A;  3NAH A;  1X4D A;  3KHL A;  1N34 J;  4NOH A;  5EGY A;  2R8G A;  2ZH6 A;  1RAI B;  2AJ0 A;  1BC6 A;  3IP0 A;  1DBD A;  4NA2 A;  3PXG a;  3W8G A;  3PRB A;  5HO4 A;  2L48 A;  2KRR A;  3R6L B;  1TR0 A;  3UN5 A;  3BO4 A;  3TO8 A;  2EFQ A;  5BR8 F;  4WYL A;  2H5J B;  5IZH A;  3CCM S;  2J6T A;  2RHS B;  4CYU A;  3MMC A;  4CO3 A;  3EZ5 A;  3S8S A;  3D6T B;  2GIQ A;  2YKN B;  4GVL A;  4OZ0 A;  4F36 A;  3HHE A;  1P8G A;  1U0H A;  3T9Z A;  1LXN A;  1M5O C;  3T5J A;  3JAM Y;  3NBP B;  1V3S A;  2WHO A;  3GWC A;  1NKB A;  1RAO A;  4NLW A;  1S4E A;  5C25 B;  3FVY A;  1YJW S;  2UXC F;  3V81 A;  3CD6 S;  3J7Z T;  1BGX T;  3RBE A;  2XLK A;  1RA7 A;  5L38 A;  2MTL A;  1HLW A;  1S0M A;  1YVF A;  3B4D A;  2ZHO A;  4C0O C;  5B7W A;  5C24 B;  4RZR A;  9RUB A;  4M5N A;  5KFL A;  4JI3 J;  2BJE A;  2M8D B;  1LWF A;  2HFV A;  1R0A B;  2VA2 A;  2CQP A;  5J1E A;  3NP5 A;  4IFV A;  2GO9 A;  1U47 A;  3P4U B;  2YH1 A;  5KFV A;  1AYE A;  4M94 A;  4USV A;  5SZT A;  2VFU A;  2QA4 G;  1RHK B;  4DQP A;  4C2M A;  1D9A A;  4NE9 C;  2B9Y A;  2JZ5 A;  1U1P A;  2BR0 A;  2CPX A;  2E1A A;  3OL8 A;  3BJY A;  3BR9 A;  3C66 A;  3ZZU A;  4CH1 A;  3G4S S;  4ELU A;  3N28 A;  1N5T A;  4WFB Q;  2EPI A;  2PN6 A;  1Y10 A;  5A8K B;  1F6T A;  3NS7 B;  4P10 A;  4GRS A;  2W2P P;  4EMD A;  1YJU A;  5A8W A;  5HAN A;  3L09 A;  1P27 B;  1SUQ A;  2FGO A;  5AT1 B;  5IM0 A;  4O0N A;  1GAO A;  4ZJO A;  2DD8 S;  3IC1 A;  1H6K X;  4IYQ A;  5DM6 Q;  2C3P A;  4TQS A;  2BBE A;  2I0X A;  3R3T A;  4JI5 J;  4PUO A;  4ZVT B;  4NXM J;  1CJK B;  1ZAW A;  4ILR A;  1Q78 A;  2DTJ A;  2IC3 A;  5KOW A;  3VAF A;  4XDD A;  4ED3 A;  4PAA A;  1Q16 B;  1RTH A;  4QWB A;  5GMD A;  1XWL A;  2AX1 A;  5FLX U;  1TMJ A;  3PDN A;  2CDQ A;  3AXK A;  4LT6 A;  3T6J A;  1RT3 B;  2DIU A;  5ETQ A;  3N6L A;  3JXO A;  2UVW A;  3GPA A;  1G6B A;  3OPK A;  3MUV P;  2MMY A;  3FBC A;  3O3L A;  4YME A;  2AYB A;  4DMZ A;  3L4B C;  4CT9 A;  4RU2 A;  1HNV B;  5A2Q U;  3MED B;  4F4A A;  5LXY A;  4FYY B;  5KFK A;  1NU4 A;  3FSY A;  1EHW A;  2ZUA A;  3KJF B;  5F0U A;  1T3O A;  1SC3 B;  3QRR A;  1NK4 A;  4OX8 A;  2F9D A;  3G6E S;  2CQG A;  2ASD A;  2JVR A;  4ED1 A;  4X4V A;  3KFW X;  3O44 A;  2FIU A;  4QCL A;  1TV6 A;  3CD7 A;  3BSO A;  3CNQ P;  1RAH B;  2GW8 A;  3H20 A;  5K5M A;  3OV7 A;  1OSC A;  1DQA A;  1S48 A;  3M1V B;  1GMW D;  1U4B A;  1FA0 A;  4J9P A;  5FJ4 A;  1U2R A;  1TZ0 A;  1LW2 B;  1NDP A;  2IFX A;  1HR0 J;  3GB0 A;  1VQN S;  2AT1 B;  2OGU A;  4MKV A;  4X64 F;  1R0A A;  3LUY A;  3J7Y U;  3PO5 A;  2QRR A;  1OIA A;  3CDB A;  3DGV A;  8ATC B;  3BQ1 A;  5KG6 A;  2E5I A;  2NXC A;  1PAU B;  1T9X A;  3MOJ B;  2CRL A;  4DR4 J;  2WB1 D;  1J5O B;  1TUG B;  3FJ2 A;  1F60 B;  4FPI A;  3C19 A;  1S9F A;  4C0B A;  1RT1 B;  2XLJ A;  1RTZ A;  1TP7 A;  2WVD A;  3D0G E;  3MWB A;  4A48 A;  2JX2 A;  3J80 Y;  2GC8 A;  1SKR A;  2RUG A;  2WB4 A;  3RBZ A;  5EWG A;  2BRK A;  1VC0 A;  1HBM A;  4DV0 F;  1VI7 A;  3QMQ A;  3MM9 B;  3TAN A;  5CCM A;  3I0R A;  2JC1 A;  3N9U C;  2XCP A;  2ZFH A;  3QYY A;  4DUY F;  1QVF R;  4P2S A;  3KLE A;  4O3P A;  4A8K A;  1U1N A;  2LLZ A;  4PXD A;  1HQU A;  2V2K A;  3GIM A;  1YJ9 S;  5E33 A;  1FXR A;  1REG X;  3NGT A;  1VS3 A;  3QO9 B;  1HMV B;  3DRX A;  3ZTR A;  3OSN A;  3JSB A;  2VBW A;  3NGS A;  3K59 A;  1UJ5 A;  3UVJ B;  2HSE B;  4DL4 A;  1EAY C;  1NJI T;  1KVI A;  2J7U A;  4GC6 A;  4JI6 F;  3CCU S;  3TA1 A;  3UFC X;  4YP3 A;  1JK9 B;  2CA9 A;  3ELH A;  2VBX A;  3VZI A;  1RHR B;  1RTD B;  1BD6 A;  1GTE A;  3D0H E;  3I0S A;  4OYM A;  3KLI A;  4AND A;  4K4Y A;  3TUJ C;  4IUF A;  2HEK A;  2PSZ A;  4KJI A;  1QSY A;  1S0N A;  1BXN A;  3DRR B;  3ICL A;  4ZPD A;  4A46 A;  4DX5 A;  4ZIT A;  1RQ0 A;  2EG1 A;  3IXQ A;  3RAM A;  4B3M J;  1FK9 A;  2J9D E;  3PYE A;  2I6W A;  4Q8E A;  1LFW A;  2RF2 B;  1ZPW X;  3EE3 A;  2VKZ G;  3EZU A;  5B0E A;  4FXW A;  2V0N A;  5KFO A;  2DCU B;  4KO0 B;  4PZV A;  4KO0 A;  1JNR B;  2OI2 A;  2IDE A;  1XEZ A;  3DDI A;  3KLH A;  1HNX J;  4TY8 B;  4USI A;  4M5L A;  3D68 A;  2MKI A;  1I94 F;  3FRY A;  4CQ1 A;  3S1T A;  2I2Y A;  2KG0 A;  5AXK A;  3SQO P;  3CJ5 A;  4MIB A;  4Q2L A;  1JXL A;  2VQF J;  2QMX A;  3H0P A;  3Q2S C;  3I0S B;  2PA8 D;  4CTA B;  5DGB A;  3PW0 A;  1LWE B;  4IG0 A;  3FRZ A;  1A9N B;  3CJS A;  4OI1 A;  3RG6 A;  1RAE B;  1RBL A;  2XGP A;  2V5H G;  3HD1 A;  2DKO B;  3GP9 A;  1ZBT A;  3T41 A;  1T9U A;  3KUE A;  2X51 A;  4EFA C;  2XC9 A;  3K57 A;  2H4W B;  5I42 A;  1TTH B;  1N5Y A;  2YWH A;  3QAT A;  2BJ1 A;  3PX0 A;  1UVL A;  1P9Q C;  4NLR A;  3NNC A;  1H72 C;  2BJ7 A;  3VZH A;  1XR6 A;  2UP1 A;  3KOA A;  1UJ4 A;  2C2E A;  5A8R B;  4K2X A;  2C22 A;  2H3E B;  2RH3 A;  4DV7 F;  2HK3 A;  4OYA A;  1S1U A;  3TUZ C;  1RWK B;  4CP5 A;  3K58 A;  4CWB A;  5HQM A;  4DR5 F;  4ELV A;  2MZR A;  2VC1 A;  4B3O B;  2B9E A;  2R3V A;  1OS5 A;  3FSI A;  1L5U A;  2QIF A;  4RPF A;  2GVZ A;  3SCJ E;  2YQ3 A;  1JWW A;  1KQK A;  2LEP A;  4NEY A;  1GX5 A;  3MM8 A;  2WW8 A;  4OHY A;  1Y3K A;  1WSV A;  3HHL C;  2UV8 A;  1HHT P;  3K8W A;  5K8O A;  3G8Q A;  4M5J A;  3G2X A;  4ZPW R;  1U25 A;  5AE2 A;  1PC4 A;  1OJ4 A;  4TLQ A;  1EB0 A;  4DX7 A;  2RUS A;  1R3N A;  1ULR A;  1M1H A;  1WC3 A;  4UF4 A;  5F8M A;  2XMJ A;  4G1P A;  3MR2 A;  4RUA A;  3CDU A;  1IVZ A;  2CJB A;  3BBF A;  1GH8 A;  2A6M A;  1N32 J;  1JJC B;  1WC4 A;  3QSY B;  4OLO A;  3WBZ A;  1SIW B;  3FEX B;  5A2Q Y;  2FJE B;  4G65 A;  3DM2 A;  3J7A 1;  2BAC A;  4KRW A;  3PYG A;  4M5D A;  1RAF B;  4R8U A;  4WE1 A;  4ZP8 A;  2BQR A;  4B3T F;  3DXS X;  2R7O A;  3EZO A;  4I4B A;  2Y3Y A;  3CVK A;  4ZPC A;  4CO0 A;  4BS2 A;  2IY5 B;  4NLD A;  3T1Y J;  1Q79 A;  3RAX A;  3QSI A;  2L9W A;  4AE5 A;  2HHW A;  3AOB A;  4FYW B;  2DGS A;  4NLT A;  2FTR A;  4TYA A;  3RRH A;  1FRK A;  3I31 A;  5H9E K;  3QRQ A;  2MXY A;  3CD0 A;  3R5J B;  2HQD A;  5THW A;  1FTC A;  2W2Q P;  3AY0 A;  2KT3 A;  4OI6 A;  4DR6 J;  1IXK A;  5HRO B;  4O4R A;  3AAW B;  4I6Y A;  4EBE A;  5LXR A;  2QL5 B;  1VQM S;  2Q79 A;  1B4S A;  1RTD A;  4LF9 F;  2Q43 A;  4X4U A;  2E44 A;  1JNZ B;  1SIZ A;  4DZD A;  2BAN A;  1TKX A;  2ZVS A;  4YFU A;  4W90 B;  2FY8 A;  1IKV A;  1UA1 A;  4ED6 A;  3MUT P;  2LYV A;  4L74 A;  2XS2 A;  3PW5 A;  4ZOS A;  5HP1 A;  3ILJ A;  1IN0 A;  2RRN A;  4U95 A;  2ZJP Q;  2KZZ A;  3KUG A;  3T6B A;  3MOZ A;  4ETX A;  2F5G A;  4PG6 A;  4DL0 C;  3FGV A;  2Y8W A;  4AUK A;  3M6V A;  4LIR A;  4M5K A;  3TJ8 A;  4YY3 F;  2R7S A;  1Q8L A;  4RW9 A;  4K8R A;  1N5S A;  1RWO B;  1TV6 B;  3CO0 P;  4KKO B;  4A47 A;  4DPO A;  1CVJ A;  5B08 A;  5LJ3 Y;  4R0J A;  3HVT A;  3ZZY A;  2BQU A;  1D8Y A;  1PCA A;  1N88 A;  2J9C A;  3NCR A;  4G1Q A;  3SSS A;  1S4F A;  3A8J A;  2VA3 A;  4YB6 A;  2IM2 A;  4DR6 F;  4X4P A;  1HWU A;  2CVI A;  1TKT B;  3T1Y F;  3RR8 A;  2BDP A;  1S49 A;  4RBU A;  4TLR A;  2NS1 B;  2JWN A;  4RNH A;  2JVO A;  4URQ U;  5J1N A;  1N48 A;  2ASL A;  4NL5 A;  2FZC B;  4CLL A;  2D74 B;  3H5X A;  1FRX A;  5I4M A;  5DQH A;  2Q6B A;  1APS A;  5L9X A;  4W92 B;  4HTI A;  3TZY A;  3CF5 Q;  3KMQ A;  2BA9 A;  5E3R A;  2Z30 B;  4P74 A;  4J9L A;  1WD6 A;  3KYL A;  1VQ7 S;  4J9S A;  4UOH A;  1YJV A;  4Q0B A;  2MKY A;  4QBU A;  5C25 A;  3ZO7 A;  3ZZP A;  1MWY A;  1R8B A;  2R8J A;  1V5V A;  2FVP A;  4JI1 F;  3UDV A;  2V63 A;  3NGK A;  3TX8 A;  1FX2 A;  3HLU A;  3KLE B;  4WZM A;  2KM8 B;  5L1L A;  2W9B B;  4LRA A;  1YBA A;  3HP6 A;  3LP2 A;  3TW0 A;  4O3Q A;  1JLE B;  2YNG A;  2C2N A;  4HKQ A;  2BKP A;  2QL7 B;  3PW7 A;  4TNO A;  3AD9 C;  1FF2 A;  3DLJ A;  2V9K A;  3H40 A;  4DV2 F;  2F8H A;  2Y8Y A;  4HI1 A;  5T41 A;  2CQ4 A;  3M2U A;  3VGS A;  2QE5 A;  4GKJ J;  4DR2 F;  2IJN A;  3CB4 A;  3CCL S;  3AD7 C;  3QFH A;  1OO0 B;  3GIL A;  2OHD A;  4I2P B;  3ENV A;  3TUI C;  2LXF A;  3IFE A;  4OHX A;  5KFI A;  3DXB A;  2MQQ A;  4NLP A;  4C8O A;  4IQX A;  2BAN B;  2Y1I A;  3F56 A;  2OAU A;  4J9Q A;  2M70 A;  2V68 A;  4IO9 Q;  1TL1 A;  1X4A A;  2WBM A;  1RT4 A;  3DOM A;  3CDA A;  1OY6 A;  1UFK A;  2E1P A;  3KLV A;  1WG5 A;  5D6G A;  3QJJ A;  5EWE A;  2U2F A;  5H1S V;  3H4B A;  3KLH B;  2CQ3 A;  2KT2 A;  3CCZ A;  4RUB A;  4QYR A;  3Q8Y A;  4RW9 B;  3PYD A;  2CUY A;  3I5B A;  3NBP A;  4F3M A;  3KLG A;  4K0K F;  4JI7 J;  1RTI A;  2UUA J;  1SPB P;  1ZZF A;  3BSC A;  2OD6 A;  4KB7 A;  2NSC A;  5DQI A;  1AFJ A;  3VAI A;  4O4G A;  3VQS A;  3FEY B;  2GCF A;  4ZHR A;  3MDF A;  4PG5 A;  4RNF A;  2HK2 A;  4QWE A;  4MJK A;  1CLF A;  4NLQ A;  4PQU A;  1UTA A;  3ULH A;  4B9L A;  4IFV B;  5KFA A;  2V4R A;  1WDD A;  2CZV C;  4X4Q A;  3M05 A;  4ICL B;  1Y5L B;  4OI4 A;  4A8F A;  4K4X A;  4JI3 F;  4PWD A;  1RXO B;  1KP6 A;  2ROG A;  4ID5 B;  2IM3 A;  5DS7 A;  4DU8 A;  2AEF A;  5AJ3 F;  4NA1 A;  4YR2 A;  2DGX A;  1JLG A;  4BBY A;  5EWF A;  2E1C A;  1JLC B;  1RUS A;  1DFD A;  3TOQ A;  2YWK A;  3NOC A;  5M2R A;  5B0D A;  4QIG A;  1P1L A;  3M8S A;  3AOA A;  1RT5 A;  3P5T L;  3SIP B;  4P73 A;  3W5Z A;  4DR1 F;  3UW1 A;  4B3O A;  3CUL A;  1S7I A;  1UET A;  3OJU A;  2C2M B;  4RKU C;  5L39 A;  4NLG A;  2C3U A;  1UJ6 A;  3ILO A;  3R9L A;  2JRS A;  3LF0 A;  4WU2 A;  3CJ2 A;  1ZM2 A;  3FQL A;  3M9M B;  3BO3 A;  1AT1 B;  1V9O A;  2QSF A;  3UN2 A;  4DV3 F;  2H54 B;  1ZS6 A;  2VH7 A;  1S9G A;  2IRY A;  1TK0 A;  2XY6 A;  4JI7 F;  1CJU A;  3J7A N;  3R8Y A;  2ZKT A;  3QT5 A;  3OHA A;  1NJX A;  4K4U A;  3WX4 A;  1LW0 A;  3OQ2 A;  1KLM B;  3PRV A;  1LW0 B;  2H5I B;  3ZNJ 1;  4I2P A;  1EET B;  3ZZZ A;  3MAQ A;  2VQF F;  3RB4 A;  1YI2 S;  3PY8 A;  4NCA A;  4EEY A;  1C4C A;  4ECR A;  1KHV A;  2CQI A;  2V8P A;  3DOL B;  3MPU B;  2DNL A;  3OFE A;  3PCO B;  1RKJ A;  1HD0 A;  2COL A;  3SFG A;  3V2U C;  4F02 A;  2F4V J;  5D15 A;  5KFF A;  3H90 A;  3W61 A;  4ANE A;  3K5M A;  5IV3 A;  3AJD A;  2Y1J A;  2GFF A;  1R8P A;  4KPY A;  1NLK L;  3GJS B;  1NK0 A;  1FHT A;  1S6P A;  1RHU B;  1S6U A;  2DY9 A;  2KN4 A;  3W66 A;  3ENQ A;  2AGO A;  4ELT A;  1FD8 A;  1P6T A;  3FFI A;  4LVN P;  1IJE B;  4RLE A;  2G1H A;  1SJR A;  1X4E A;  5DO2 A;  4DV6 J;  3GFX A;  2UUT A;  1BQN A;  2VJV A;  4JB8 B;  1NSK L;  5ETK A;  3LAL A;  1UZH A;  2ZJQ Q;  3V4M A;  3NNA A;  2RS8 A;  4DSJ A;  1TL4 A;  1H0H B;  5CH7 B;  1YQH A;  3DLE A;  4IG3 A;  1FKO B;  2CNO B;  1ZAV A;  5IFM A;  1N0V C;  1EQ0 A;  2XGQ A;  2CZ4 A;  4P9S A;  3VAH A;  3OL9 A;  4KTQ A;  3BGO P;  2DR7 A;  4M5H A;  4OZ5 A;  1NDC A;  3LW5 C;  4QW8 A;  1VRT A;  3V4I B;  3H2U B;  3C15 A;  3DMJ A;  1WJ9 A;  1OQ3 A;  3UPF A;  3PX6 A;  5J2M A;  2MSS A;  2WRM A;  5J2Q A;  3M32 B;  1VFJ A;  2BMB A;  2XMW A;  5IWA J;  1QTM A;  2DNN A;  2EWH A;  3BO2 A;  1VBX A;  4K4T A;  1GXU A;  3W62 A;  2VFS A;  1WC6 A;  4FPR A;  1KFS A;  4PRF A;  1YG0 A;  2ZNZ A;  1U6B A;  2FQQ B;  4UZB A;  3C16 A;  4I69 A;  3NMA A;  1FRL A;  1Q86 T;  1VRU B;  2O5D A;  1RA6 A;  2J76 E;  2VG5 B;  4MH8 A;  1N5Q A;  4LR9 A;  3O2I A;  1YKW A;  1S1W B;  2E5J A;  4IOA Q;  2HNZ A;  4NLV A;  4JI8 F;  3GV8 B;  2HQG A;  1YIT S;  2BOP A;  5CZV A;  2ALY B;  2DGT A;  4KHR A;  4DI6 A;  3NL0 A;  3Q22 A;  4C4W A;  1JLB B;  1Q95 G;  1X4G A;  4WKR A;  3D3C J;  2J8A A;  2FLO A;  4M95 A;  5DG7 A;  2CPY A;  2FVC A;  5RUB A;  2HS3 A;  2ZJR Q;  1VQK S;  1FXL A;  5CAA A;  2LP4 A;  3W60 A;  3JB9 k;  3IG1 A;  3RAQ A;  2BXJ A;  1VLY A;  4L72 B;  4CLF A;  1SJF A;  2HVI A;  4I0W A;  2VG7 B;  3KKF A;  3R1L A;  3HD2 A;  5LL6 d;  5IT4 A;  4OYB A;  1ACM B;  3KK2 B;  3H5S A;  4PPZ A;  2DNH A;  4Q44 A;  2B3T B;  3FZ2 A;  3I56 S;  4KH0 B;  4DL6 A;  2Q66 A;  4ILL A;  2RVJ A;  4QQB A;  2JSX A;  1KLN A;  1S59 A;  4O23 A;  4Y2I A;  4CLW A;  4CH0 S;  2G2O A;  4ZLP A;  3GIK A;  4H4O B;  1F5A A;  3T5L A;  4YUD A;  1NB2 A;  2YWF A;  4Q5V A;  2KH9 A;  1E6Y A;  1RAB B;  2XSJ B;  4HEA 9;  1ZA2 B;  5EUH A;  2PMH A;  4WU3 A;  4DPT A;  3PR4 A;  3OTO F;  5KG4 A;  2IRU A;  3AB2 B;  5LMU J;  3RB0 A;  2ZE2 B;  5EDW A;  3HHL B;  1LNQ A;  3D6M B;  3LH2 S;  1M90 T;  4JI2 J;  3P3D A;  4FS1 A;  3BBB A;  3KLI B;  4QR0 A;  4ZLJ A;  1MG7 A;  2MQL A;  1QAI A;  2V9W A;  3ZZT A;  4NXN F;  4IFY A;  2EVZ A;  2MEW A;  3PR5 B;  2ZWP A;  1XC9 A;  3EVW A;  2R2R A;  4R5P B;  4JI8 J;  1XTZ A;  3IWL A;  3PX4 A;  5D0R A;  4F67 A;  1UFL A;  5L8R C;  3R97 A;  3MEK A;  3ITH B;  3KK3 A;  1GQE A;  4P72 A;  4RW6 B;  2HHH J;  2LA6 A;  2LQ5 A;  2M88 A;  5CYM A;  3W63 A;  3JSR A;  4TKT A;  5J2P B;  4PXC A;  1N34 F;  1F9E B;  1Z2Z A;  1CJK A;  3DHW C;  5CZX A;  1UMJ A;  2IC3 B;  1RZM A;  2VC0 A;  2UUW A;  2RKI B;  2NXU A;  4B9S A;  2F63 A;  1PIL A;  2MKJ A;  4MFB B;  3MM9 A;  3EYZ A;  2HVZ A;  1ZM3 A;  2I1R A;  4EZ6 A;  1ZA1 B;  1ICE B;  1NDK A;  4K4Z A;  3THV A;  3CME S;  3DN9 A;  1QD1 A;  4ZPT R;  3RZA A;  1UEU A;  3KJQ B;  2KXH A;  1U1L A;  2IM1 A;  4RW7 A;  4XPC A;  3IM9 A;  4A8X A;  4QPX A;  4KFB B;  3GQC A;  2B4U A;  2LEB A;  2AYG A;  4CLP A;  2DH8 A;  3MAA B;  4ZK7 M;  3IN5 A;  5F9N A;  1KTQ A;  6FD1 A;  1OQ6 A;  1X60 A;  3HSD A;  2DVI A;  1DTQ B;  2MQM A;  3HUL A;  4NA3 A;  1NPK A;  4ZLL A;  3JQJ A;  4EYH B;  1BQM B;  3B82 A;  3UDE A;  2V4Q A;  1S9E B;  2DB1 A;  2HNY A;  3BYP A;  3CCW A;  3MCO A;  5D0H A;  3VVT A;  4AQY J;  3V81 B;  3I82 A;  5B0B A;  1WF1 A;  4BC9 A;  1VRU A;  1UWB A;  3OUY A;  2W9B A;  1U26 A;  1D9D A;  2MY8 A;  4JP8 A;  4Y65 A;  4LF2 A;  3AA8 A;  3LP2 B;  5ETR A;  4DUZ F;  5CXT A;  2XHW A;  3VQT A;  3ISN C;  4HYK A;  3KNA A;  1YRU A;  2J9D A;  1IBC B;  1FFG B;  2YKM B;  2PI4 A;  3FUY A;  3HHL D;  4DL3 A;  1UW4 A;  1VRQ C;  4KHP F;  4YB7 A;  4U67 Q;  1FO1 A;  1N33 J;  1PYS B;  4WKY A;  3PHT A;  1FJ7 A;  2UUA F;  3M2R B;  2CQ0 A;  3O5T B;  3U02 A;  4LMZ A;  4NXM F;  4QYZ J;  5E41 A;  3W2V A;  1V6H A;  4F7V A;  4QZV B;  5MLC V;  2FJX A;  2LU1 A;  1EET A;  2HIY A;  4M1K A;  4XTT A;  2W7P A;  3GIJ A;  2RSQ A;  2VFT A;  4X66 J;  1AA1 B;  1TL7 B;  1MRO A;  4IOC Q;  4UUX A;  2HHU A;  3QGG A;  2QL9 B;  3D9B A;  4H4K C;  3X3U A;  4DN9 A;  4RWX A;  2GHW A;  2ZNY A;  4ECX A;  2XHC A;  2PDA A;  4QJV A;  4QW9 A;  5KFM A;  3MD1 A;  2KM8 C;  2Z2Y B;  2FPH X;  4PR6 A;  1S6P B;  4TN2 A;  5GAD I;  4C3M A;  4P2X A;  3C6T B;  1S1U B;  2HGN A;  2LQ8 A;  1RAG B;  3HVT B;  3N5F A;  2OFH X;  2LXU A;  2ZBQ A;  1SI9 A;  1Z4U A;  4P52 A;  1DHM A;  3QT8 A;  4C6A A;  5A0Y A;  1FNM A;  1RLD A;  1U7L A;  4Y34 A;  3SMZ A;  2XS7 A;  1D3W A;  2L3M A;  1NH8 A;  1XMB A;  1PKU A;  1X9W A;  2GQ2 A;  2QYG A;  1YJR A;  1CG2 A;  1SQE A;  1MWZ A;  1WI8 A;  2YPY A;  4KBI A;  1BLU A;  6AT1 B;  5I42 B;  5T14 A;  5F41 A;  3CJK A;  4B08 A;  5KFT A;  4DV3 J;  1SBR A;  3RU0 A;  3ZTS A;  3GON A;  1HNI A;  5DDQ C;  4CLY A;  2GQC A;  4FBU A;  1PJ6 A;  3W3S A;  2I5J A;  4X64 J;  1YRT A;  2RJZ A;  4DV1 F;  2R7R A;  2MQO A;  3LAM A;  4CRJ A;  2XS5 A;  3UR3 C;  2DNZ A;  1CC7 A;  4DR4 F;  1ZH5 A;  4RWW A;  1KVK A;  2C3O A;  3HVA A;  4UUW A;  2EFN A;  4CCH A;  3FMB A;  2VD3 A;  1P9Y A;  2JDJ A;  3FC9 A;  3V6D B;  1R8C A;  2XYH B;  2HGM A;  4O0I A;  3TNV A;  2VHG A;  1TFW A;  3LQV A;  3MEG B;  4UQT A;  5AXM A;  2DBB A;  4QIE A;  5JVH Q;  1RAD B;  3T1H J;  1PO6 A;  2CYY A;  4HHJ A;  1MSW D;  2OPP A;  1BQX A;  2J0X A;  1FI4 A;  4DV0 J;  4J91 A;  4J9N A;  3QRP A;  2XI2 A;  3LPY A;  2R2T A;  5F8L A;  1CPZ A;  4MAK A;  1QVG R;  5AXL A;  2E9Z A;  3GYN A;  2V2Z A;  2H1Y A;  5A6W A;  2HW3 A;  5F0W A;  1HAR A;  3HX9 A;  4OYI A;  2CNN B;  2YKQ A;  2YTC A;  1BHN A;  1C2P A;  2BVZ A;  3D3B J;  1O0P A;  3IG1 B;  1C1B A;  1U45 A;  1HWI A;  1UP1 A;  4N47 A;  5L1K A;  3QGI A;  3EGN A;  2XWX A;  1SKU B;  3L9Z A;  1IKX A;  2HAF A;  3SXL A;  3CO9 A;  3W5Y A;  3BV8 A;  5I3P A;  4ES3 A;  3BBC A;  2B5J A;  2L41 A;  2B43 A;  1S1X A;  2XNR A;  1EX8 A;  2VQE J;  3KNG A;  5KT2 A;  4Q45 A;  4BWM A;  1XMO F;  1UVI A;  3I6P A;  4NMX A;  5IXU A;  1HNZ F;  2Z2M A;  4ENO A;  4EUV A;  3M4X A;  5JVG Q;  1FNX H;  2E5L J;  2IA6 A;  2C1E B;  4A8S A;  5DET A;  4C8N A;  4LRC A;  4M5G A;  4RJV A;  4MFB A;  2GVD A;  3DDN A;  5KFN A;  3P6Y C;  4ID8 A;  1RU1 A;  3G87 A;  3BSN A;  4OX6 A;  2RQM A;  3DNC A;  4U8V A;  1KN6 A;  2RNE A;  2DJW A;  2G0I A;  3DGP A;  1KR4 A;  1NM2 A;  3IS9 B;  3QWP A;  1S1T A;  4J90 A;  4ZVR B;  1EP4 B;  5IQ6 A;  3ENW A;  3QJL A;  2E5H A;  2K2P A;  4LF4 J;  1FDB A;  4CNY A;  1FCA A;  4I56 A;  2MGZ A;  3ITH A;  4R5P A;  2UUC J;  4PAB A;  4NRU A;  1M5S A;  3G6Y A;  4B3S F;  2KVI A;  4A8Q A;  4OZ3 A;  2FJD B;  3SCI E;  2V50 A;  3AFG A;  3CWJ A;  3MTJ A;  7FD1 A;  1RAC B;  3JSY A;  2JFD A;  3OXG A;  2NZC A;  4FZV A;  4ITS A;  4Z7C A;  1RWM B;  1SC1 B;  2BV3 A;  2KT5 A;  1S12 A;  3JTP A;  1TK8 A;  3M8R A;  2YNH A;  5AXN A;  4FF2 A;  1T94 A;  4QR2 A;  4F4Y A;  1M5H A;  1XN9 A;  3IR5 B;  1QM9 A;  4EZ9 A;  3D0I E;  1VJQ A;  2NLW A;  4X65 J;  1HFE L;  3CJT A;  4FDF A;  4K2J A;  1Y7P A;  2ZBI A;  3OJS A;  1S77 D;  1RLC L;  4MKA A;  1O6X A;  2WSF C;  3CC2 S;  2OTL S;  2BX6 A;  2XZW A;  4HVZ A;  5D78 A;  5KOX A;  3NY0 A;  4KY3 A;  3PJ9 A;  2RB7 A;  5IC4 B;  2ADC A;  4MTP A;  3CDE A;  2HQF A;  2LA4 A;  3BR8 A;  5H9F K;  2G0J A;  2DIS A;  3MF5 A;  3DHX A;  3BQ2 A;  3KXD A;  5KFZ A;  4DSE A;  1CQM A;  2QMU B;  5F3Z A;  1N54 B;  3PM9 A;  5E7O B;  4DL5 A;  2ZEJ A;  2XNQ A;  3GCW P;  2I5J B;  2R2S A;  3FQK A;  3O6Q A;  4PYD A;  2PII A;  3HF5 A;  4ES1 A;  4TU9 A;  4DV4 F;  4FF3 A;  2HHS A;  2FHM A;  4C8L A;  3MPD A;  1U1O A;  2EW9 A;  1PG5 B;  1CS4 A;  3R1H A;  2DHA A;  4C8M A;  1U1Q A;  2AJQ A;  3R5C A;  4USK A;  4WF9 Q;  3HVW A;  1MU2 B;  2YXL A;  3SFU A;  2B4V A;  4J9U E;  4B3S J;  4FVC A;  4WP8 A;  2Z2Z A;  3Q8U A;  1T03 B;  2NZ4 A;  2R42 A;  1JLE A;  4KH1 B;  1KRP A;  1CC8 A;  5KTQ A;  4UW2 A;  4ZKA A;  4DR3 F;  3CJ0 A;  3LP0 A;  3IRX B;  2HWI A;  4D3G A;  1XNR F;  2WSC C;  1BWE A;  3IRX A;  3W9J A;  1U8W A;  2MHE A;  3K0J A;  2VBZ A;  4XO0 A;  4FNI A;  5C2G A;  5HL7 Q;  3C6T A;  2KI2 A;  2LEC A;  4H4K A;  1I5O B;  2ERR A;  2CPH A;  2FJB B;  1WI6 A;  4UOG A;  5B0G A;  2O67 A;  4W4M A;  2H5E A;  3HM9 A;  4RL1 A;  1IBM J;  2QMW A;  2NRE A;  1JLA A;  1ZOT A;  4WFZ A;  3D4J A;  4DQS A;  4OHW A;  3TI0 A;  2BEF A;  2QLJ B;  3D1O A;  4ZVO B;  5J1P A;  4DU7 A;  4LQ9 A;  2MDA A;  3PG9 A;  2ZC3 A;  2W9C B;  2AD9 A;  4DR7 J;  2ACM A;  2V4J B;  3BPS P;  1WEZ A;  5J2N B;  5JXS A;  1AZS A;  1C1C B;  1FNO A;  1K1Q A;  2BYC A;  2W01 A;  4S0M A;  4Y6I A;  1R6V A;  3W7B A;  3GE9 A;  3KK1 B;  2RU9 A;  1LQ9 A;  2XI3 A;  2M0G B;  1OMS A;  2AJF E;  2DIT A;  4O3N A;  1MWQ A;  4RO0 A;  5GME A;  4A8O A;  4U6P A;  3RB3 A;  5I3Q A;  2PGC A;  3AA9 A;  4G1Q B;  4ECU A;  2C2R A;  4RNM A;  3MCS A;  3VF0 B;  4F0K A;  4DSK A;  1IKW A;  4XPE A;  2J0S D;  3EPG A;  2QJ3 A;  1Z1Z A;  2AMC B;  2CG8 A;  3M30 B;  4IOB A;  4M5M A;  5F9L A;  3KLF A;  5DGA A;  4DXL A;  2PC6 A;  5BJR A;  3G8T A;  2UVR A;  3RBD A;  4JV1 A;  3UI3 A;  2VZ9 A;  5I3U A;  3VWS A;  1JKH B;  2V4J A;  1AUD A;  1YLX A;  5HI7 A;  1N5Y B;  1DTQ A;  1J5O A;  2HRY A;  4FBT A;  2ZBC A;  4KHM A;  3NEK A;  4DCP B;  5ETM A;  4URG A;  1KON A;  3SYZ A;  2QG9 B;  2DIV A;  1DTT B;  2F1F A;  3HCX A;  3M8Q B;  3P96 A;  1HR0 F;  3GFY A;  1HI8 A;  2AW0 A;  4HLB A;  1JLF B;  4K4W A;  4N41 A;  2HKE A;  3EDR B;  1WHX A;  4JI0 J;  2DO0 A;  3L7P A;  5ETT A;  4AD6 A;  1HBO A;  1JMT A;  2NXE A;  2NPF A;  1F1B B;  4WXW A;  3G6X A;  2VPZ B;  4XAK A;  1U2F A;  3RR7 A;  2LCW A;  1NKE A;  2QSW A;  4NRT A;  3TJA A;  2HFN A;  5A76 A;  3JSM B;  2GV1 A;  2NYI A;  5FLX Y;  3BGF A;  4RNO A;  4QIW D;  2ZH2 A;  2J6S A;  1HNW F;  2HFZ A;  4RNN A;  4IR1 A;  3H7H B;  2VPY B;  2F40 A;  3MR5 A;  4Y2A A;  4DPY A;  2MQP A;  2HPU A;  2GNK A;  2YH0 A;  5K8N A;  4B9M A;  4AYB D;  3HT0 A;  2HGL A;  2W7O A;  3OTE A;  4ZA1 A;  2VG7 A;  3BH7 B;  2PMZ D;  3BQ0 A;  1CQN A;  3TX0 A;  1O5J A;  4RBT A;  2MGZ B;  4OX9 F;  3OVA A;  1L3T A;  1M5P C;  2FYX A;  1VLO A;  4OI2 A;  5BXI A;  2DGW A;  4RW4 B;  1EKS A;  2OIH A;  1LK5 A;  1XBW A;  5IT9 U;  1SCJ B;  5KT5 A;  4TY8 A;  4U96 A;  3M9N B;  4ED7 A;  1AW0 A;  2K3K A;  5DG9 A;  2QT7 A;  1IM6 A;  3BYR A;  3NS5 A;  3LWM A;  1S0O A;  2D69 A;  4GO7 X;  1RTI B;  1J5E J;  4F3O A;  3NXZ A;  4K0K J;  9ATC B;  1OYE A;  2HLU A;  2OMO A;  5L9N A;  3UWT A;  4UY8 T;  2AP6 A;  5C42 B;  2BE2 A;  1DY3 A;  4OZN A;  3SSQ A;  2DYA A;  1GMU A;  1RHJ B;  1RT7 B;  2P6T A;  4RX6 A;  3DI6 A;  3DRS A;  4LF6 J;  2DHX A;  3MM6 A;  1R7I A;  3OSP A;  1FFS B;  1T95 A;  1H74 A;  2F4F A;  2FC8 A;  5U47 A;  3TR5 A;  2A10 A;  2EK6 A;  3R5A A;  2EFP A;  5KFC A;  1XNQ F;  2GAG C;  4YDX A;  5CYM B;  4QU6 A;  3C15 B;  4A8W A;  1VIX A;  3TA2 A;  8RUC A;  3MAA A;  2XO7 A;  3M2V A;  1VQ6 S;  3S01 A;  4K50 A;  4AXJ A;  5KG7 A;  2OML A;  1IR2 A;  5AE1 A;  4JV5 F;  3LGH A;  4WII A;  2WON B;  3OTB A;  1S79 A;  3K2Y A;  2P6S A;  2A0F B;  2E7V A;  4H4M A;  4O44 A;  1FJE B;  2MKC A;  3C2P A;  4GO5 X;  2ZH5 A;  3MMA A;  2RQ4 A;  4LRD A;  2GO8 A;  5DZ7 A;  3NLC A;  3GG1 A;  3T9N A;  4A8M P;  1NJY A;  1RDR A;  3TVZ A;  2M3D A;  4C0H A;  3JQM A;  2BE2 B;  4DEZ A;  4YR3 A;  4OYO A;  1S1W A;  4E2F B;  4MKY A;  3CCV S;  3A1Y G;  2ZDP A;  4HDH A;  2M8H A;  1SVD A;  1LWC A;  3SDE B;  1RU2 A;  2OSQ A;  3W9H A;  2W4P A;  2YX7 A;  4AFF A;  1KFD A;  1TKZ B;  2AZ3 A;  3QT7 A;  1ZTT A;  1E6V B;  2FDN A;  5L1J A;  3KG0 A;  4ZCM A;  1I3O B;  1KC8 T;  3WX8 A;  5HVH A;  2DHH A;  5IC6 B;  1LWX A;  4PQA A;  1B70 B;  4YB5 A;  4RU9 A;  4DR1 J;  4PWU A;  1Y9O A;  3BS9 A;  4K5R A;  3HSJ A;  1S7H A;  4MK7 A;  5IV4 A;  3T5K A;  4N7T A;  1X4H A;  3A4T A;  2Y9H A;  1V3Z A;  2XTJ P;  4IFY B;  2KYX A;  2OPS A;  4KE5 A;  3RYL A;  2OPS B;  4ECS A;  2E9T A;  4JYA J;  5KG0 A;  1RT2 A;  1JLQ A;  3E2E A;  2DPI A;  4QU7 A;  3GIR A;  3EX7 B;  3T3F A;  2HRT A;  1DLO A;  3TAM B;  2HBQ B;  1MMN A;  3PKM A;  3F41 A;  1FEE A;  5KFS A;  4WK1 A;  2KJW A;  3DFE A;  1F5B A;  4H4O A;  2JLE A;  4X66 F;  2BJD A;  1OYD A;  2VL1 A;  1E6V A;  1VC6 A;  4B9U A;  2KYZ A;  3KLG B;  4BC7 A;  4JV2 A;  3H5Y A;  2HHQ A;  3U1M A;  5BYS A;  3LGN A;  4X65 F;  3WC0 A;  4EBC A;  4ZDN A;  2DCL A;  1XR5 A;  4B17 A;  2UXD J;  4TY9 A;  2AX0 A;  3ILI A;  2M2B A;  3CJR A;  2LMI A;  1RT4 B;  2DXF A;  4DV6 F;  4U7U D;  4J9O A;  2W1B A;  1IKX B;  2QGF B;  1TL7 A;  5E0O A;  2Z8Q A;  2L9D A;  1RWX B;  4Y28 C;  4CO5 A;  5DZ6 A;  1AFI A;  1ZM9 A;  3WZ0 A;  3BH6 B;  4DPW A;  1VQ4 S;  2GHV C;  1DUR A;  3OVS A;  1NDL A;  1TVR B;  1VR6 A;  2HHT A;  1VQ9 S;  1TQL A;  3M2V B;  4QR1 A;  5HMW A;  2AYM A;  1HQE B;  1U8S A;  4D3H A;  3PYF A;  5DQG A;  1KSP A;  2EFG A;  4I2Q B;  1MLA A;  3SCL E;  2BW2 A;  4X62 J;  4OZ1 A;  3D6F B;  3BPD A;  3LO3 A;  3QLH A;  3W8P A;  2LVW A;  3M1V A;  1NZ8 A;  2KB2 A;  3D66 A;  3R27 A;  2AV5 A;  5EHH A;  3VAJ A;  3UQS A;  5BYQ A;  5LSL A;  1K1S A;  2AJ2 A;  2PFD A;  2V6A A;  3C16 B;  2ZOG A;  3NCQ A;  5ITH A;  3HXM A;  1C0U B;  2ALZ A;  2FGC A;  4E0D A;  2W2O P;  1YX2 A;  4QIF A;  4DFM A;  1S97 A;  1QSS A;  1TEL A;  1UVN A;  3SDE A;  3CC7 S;  5KG3 A;  3JSM A;  2CJY B;  4B3M F;  2I38 A;  4F2S A;  3EGZ A;  1CEZ A;  2XLI A;  2DNG A;  2LDI A;  4PXB A;  3DKD A;  2NUH A;  4K59 A;  4E8U A;  5B0C A;  3THP A;  2XBP A;  4FS2 A;  2O01 C;  4DG1 A;  1UVM A;  1WKJ A;  3I87 A;  2IVY A;  4PWD B;  2OTJ S;  1HD1 A;  3HFZ B;  3H25 A;  3PJX A;  4OV6 A;  4ED2 A;  4LF8 F;  2R7X A;  4NPO A;  4OYZ A;  2ZH8 A;  4K5S A;  5E3C A;  2JNJ A;  3HPO A;  2NR0 A;  3V6J A;  4KR0 B;  2ZH7 A;  1Y4Z B;  4P71 A;  4L73 A;  4LRF A;  2XYP B;  2AYE A;  2JFK A;  4LFC J;  2DR5 A;  3DRY A;  3L95 X;  5HJX A;  1OPI A;  4ZHR B;  1FXD A;  4EI2 A;  1SJ3 P;  1SH2 A;  2YKA A;  3OD2 A;  3V6K A;  4CI0 B;  2DRB A;  3DLH A;  1T11 A;  1VK3 A;  4P2M A;  1KVJ A;  3HSG A;  1IR1 A;  3LA0 A;  3L7U A;  2VDH A;  3MHY A;  4I67 A;  3TAR A;  2P2C B;  2SXL A;  1K44 A;  1YZ7 A;  3R5D A;  4ED4 A;  2FVR A;  4Q8F A;  4C3K A;  2VFR A;  2B6A B;  4DX8 H;  2VPW B;  2HAI A;  4DQI A;  2QLW A;  4FXD A;  2VIC A;  1U6F A;  4R0E A;  1IWG A;  5CYQ B;  4DOZ A;  3POT B;  5C2C A;  3GJT B;  3H2V E;  3DOL A;  3HKZ D;  2YBV A;  1TL1 B;  1J2V A;  4UQG A;  5DG8 A;  1XER A;  1NBE B;  2RDI A;  2EEY A;  2IHR 1;  3TEG A;  3IWN C;  3EWG A;  2VG6 A;  2J0Q D;  2DRD A;  3WIV A;  1UWA A;  2KRB A;  2VG6 B;  2YWE A;  3OFH A;  4YB1 P;  2E9R X;  4Z2X A;  1GK8 A;  3E01 A;  2DGV A;  3A8K A;  2M5Y A;  3OL6 A;  1U1M A;  1SL2 A;  1UW9 A;  4JI2 F;  4J9R A;  1GMV A;  2K8G A;  4HAC B;  5HMZ A;  4LF8 J;  3OFG A;  3M2U B;  5GAE U;  1FX4 A;  1Q5Y A;  2W2N P;  1HW8 A;  4MYT A;  4X4N A;  2NXN A;  3MR3 A;  1GMW A;  3J7Z 5;  2B6A A;  4ES2 A;  3GTY X;  4NLX A;  4DUT A;  3OHB A;  4DJB A;  3H2L A;  1KOH A;  4DPU A;  2E66 A;  4LRB A;  4C48 A;  4WYW A;  2MY7 A;  4F04 B;  1CUL B;  2W2M P;  3ILL A;  3TYT A;  3DYA A;  5ETV A;  3CMQ A;  2KXN B;  1CUL A;  1WG4 A;  3AOD A;  1C0U A;  4FN5 A;  2XM3 A;  2DR9 A;  3WQP A;  2B9W A;  1A6L A;  4Y2K A;  4JUZ A;  4PEO A;  2PE8 A;  3A3N B;  3EGW B;  4M63 A;  5E3Q A;  1IJF B;  5KFY A;  2CPZ A;  5BYR A;  2QX0 A;  1NND A;  2MLX A;  4LSZ B;  2RU3 A;  1F3F A;  5ADZ A;  4JI5 F;  4JI6 J;  2Z58 B;  4F4X A;  4ECW A;  2QA1 A;  4HAC A;  1CSJ A;  1KWM A;  3OT9 A;  4H4M B;  4TXS A;  5HVG A;  1NKC A;  1K0T A;  3CD5 A;  2QA2 A;  4P2F A;  1LKZ A;  4ZVU B;  3TAQ A;  2HRU A;  1JB0 C;  1UL3 A;  2G1D A;  4LSN A;  4ECT A;  2N4D A;  4LF1 A;  3GCX P;  1C0T B;  3I32 A;  2UVV A;  4IRK A;  5HLF A;  2W24 A;  4LF9 J;  1FES A;  4TU8 A;  3MD3 A;  3SCK E;  3GZ7 A;  1VBK A;  3LAK A;  4EO8 A;  3ZC4 A;  2I8E A;  3CIZ A;  5CD4 A;  2HNZ B;  1JX4 A;  4Z7Y A;  2DXD A;  3D1Q A;  2I9S A;  4PUO B;  1TKZ A;  2C2K B;  3TQE A;  4WFA Q;  3ZTQ A;  1U49 A;  4F26 A;  3OR2 B;  1YDL A;  4U7U K;  4KGV B;  2K7J A;  3OR2 A;  2V34 A;  1P1T A;  2RIL A;  3AD8 C;  3RB6 A;  1XIQ A;  1B0T A;  2FJA B;  3H59 A;  3VHQ A;  1I94 J;  2UUB F;  3F44 A;  2NQP A;  5ETP A;  4MIA A;  4DR3 J;  4DUZ J;  4L6V 3;  2HND B;  4DPX A;  5F8G A;  2PO4 A;  3ETM A;  4M8L A;  5M2U A;  3KG1 A;  4ERD A;  3DM2 B;  3EVO A;  1AB8 A;  4PG4 A;  5LT5 A;  3CCJ S;  1TU0 B;  3TZX A;  4F4K A;  1JLQ B;  1RSC A;  1X5S A;  4YR0 A;  1S99 A;  3KK3 B;  1RWU A;  2KFY A;  3ZXW A;  3GG0 A;  1RT6 A;  1PSD A;  1WWH A;  1FKP B;  1WG1 A;  4QPT A;  5D8H B;  4DLG A;  1WHV A;  1NO8 A;  1QAX A;  4NZ6 A;  4LFA J;  4ZVS B;  2AJ4 A;  3DLG A;  4ZVG A;  4EWT A;  1NRK A;  2B56 A;  2DNP A;  3AXM A;  3N0V A;  4ZVE A;  3Q8S B;  2MJN A;  2QZ8 A;  3OFF A;  3QIP B;  1E6Y B;  4DR7 F;  2KFZ A;  4DR5 J;  3IMQ J;  3BGL A;  4L3K A;  1GXL A;  3V5R A;  1YWX A;  2AQ4 A;  3FBE A;  1U1K A;  2AWZ A;  4ED0 A;  1XJW B;  5K20 B;  1HHS A;  4F0M A;  3I4P A;  2Q1L A;  1HWL A;  3DYA B;  2A2D A;  1QUV A;  1UEV A;  1ZM4 A;  3NGD A;  3MED A;  4JI1 J;  2ATL A;  2FD2 A;  2YWW A;  1VRT B;  5L46 A;  4Y3C A;  4L3N A;  2XY5 A;  1IUJ A;  2FHJ A;  2JHE A;  2UXB J;  1HNI B;  3M8Y A;  2ZH3 A;  3EXY A;  1NK6 A;  4ZP7 A;  2AJ1 A;  2OEK A;  1GFW B;  4FVM A;  2MYF A;  3EUN A;  3QAE A;  3JAM U;  1DTT A;  3M8Q A;  3B4M A;  2W25 A;  1R8A A;  1FDA A;  3M8P B;  4NZ0 A;  5KFU A;  5HBM B;  3HHN B;  1HIY A;  1CJT A;  1H98 A;  2MKK A;  3CE8 A;  3Q8R B;  3CSK A;  3GR1 A;  3MM5 A;  3MTK A;  1D9F A;  1SJ1 A;  2XMA A;  1BWV A;  3C14 A;  5K14 A;  3NMR A;  4DV1 J;  2B7C B;  2F7V A;  4LIW A;  4PCQ A;  3M8W A;  2VG5 A;  3DI6 B;  4F25 A;  4XIU A;  3I5C A;  3HT3 A;  4FXV A;  1FER A;  3MCM A;  2YNG B;  1LWC B;  3IGN A;  3RBX A;  3WIU A;  3M8Z A;  4ZCI A;  5KFW A;  2ZD1 A;  2N3L A;  3IBC B;  2FZK B;  1SQG A;  3TWZ A;  3KLF B;  4V1A k;  2CG4 A;  3SQG A;  3OLA A;  2YX1 A;  1RT1 A;  1UA0 A;  2QLF B;  3TRG A;  1IKY A;  2B0G A;  3TQ1 A;  2MZQ A;  4O44 B;  1QSL A;  3VGV A;  1RP5 A;  2RIJ A;  4LQ3 A;  2EBE A;  4LSN B;  4L76 A;  3CED A;  1DQ8 A;  1AXQ A;  1OPZ A;  2MST A;  2MKH A;  2QYC A;  1VQ5 S;  1K0V A;  2Q3P A;  5E3P A;  2FC9 A;  4RUH A;  4Z37 A;  1KHW A;  5SUH A;  3L3C A;  4C8K A;  1B7F A;  4PWW A;  1LWF B;  2W4C A;  2DNK A;  3A8E A;  3HHD A;  4IKA A;  1MN9 A;  1X5T A;  3NOG A;  4H54 A;  5DDR C;  4YOE A;  3KJN B;  2HBZ B;  3QID A;  1CJV B;  5KG2 A;  4ATN A;  1PAE X;  2FZG B;  2B4P A;  2B8P A;  3PNI A;  4ZVP B;  3ZNU A;  3PEJ A;  3FFI B;  2B4O A;  2M4M A;  4N8N A;  4NLO A;  1U02 A;  5ETL A;  3PZP A;  1M5V C;  1UZD A;  2IDL A;  3NGU A;  3QGP A;  2GML A;  5K8P A;  1HWK A;  1RB0 A;  2RRA A;  2RDD A;  1HBN B;  4CDI A;  3P5B P;  1NUE A;  1SH0 A;  1NHU A;  1HBM B;  3T5H A;  3BDP A;  3PV8 A;  3DRR A;  4DQQ A;  1IQZ A;  1S5Z A;  2EK1 A;  3EDQ B;  4NYP A;  5LM7 E;  4LF7 J;  1F2G A;  1VOM A;  1RIS A;  1WTB A;  2DRA A;  3DOM B;  1Q8K A;  3HFV A;  1U1R A;  1S1X B;  2BW7 A;  4FYV B;  4NAS A;  5J2N A;  4ICL A;  2ZDO A;  5D4L A;  3F73 A;  3R2D J;  4G3I A;  2XO6 A;  2D9O A;  2MZ1 A;  3G71 S;  1HQE A;  2K06 A;  2CQH A;  2XUL A;  4FYD A;  1SL0 A;  1WUU A;  1BY9 A;  2E5G A;  4ALZ A;  3EM1 A;  3G8S A;  1D1U A;  2HVE A;  3MEE A;  1PC5 A;  4LF5 F;  4WZQ A;  5KFB A;  2D7S A;  1EJ7 L;  2WOM B;  2Z56 B;  3RUB L;  4WTY A;  2HUR A;  3TJ9 A;  3VVU A;  4GVB A;  2OH2 A;  3OR1 A;  5F8J A;  1R43 A;  2QLX A;  3UDL A;  2CJQ A;  3GYX B;  5D0E A;  4ZCK A;  3K17 A;  3T1A A;  4DUY J;  3I9V 9;  1XMQ J;  2ROP A;  1VIS A;  2GVZ B;  2JLG A;  1U2C A;  1KEK A;  4LFC F;  1UPM B;  1X0F A;  2VOD A;  1JXV A;  3EJM A;  4Y2C A;  5B0A A;  3M30 A;  3SSR A;  4KYZ A;  2XMT A;  2G13 A;  4OX7 A;  5DRK A;  2H65 B;  4I68 A;  4QWA A;  4I6A A;  3MEG A;  4P7T A;  2X1B A;  4BLG A;  4QWD A;  4IDK B;  2CKW A;  2VU5 A;  2BAB A;  5A6P A;  4DFP A;  3PO4 A;  5GMK a;  1U24 A;  2DNM A;  4DSI A;  2CNL B;  1FFW B;  3JS9 A;  4DR2 J;  2LU2 A;  2LKZ A;  1JLG B;  4CLU A;  2WCX A;  3V6H A;  2MZJ A;  1ZTW A;  1X9S A;  1TUW A;  2PT0 A;  2XZT B;  3H42 A;  2G9O A;  4CO2 A;  3FZB A;  4ZVQ B;  3IRW P;  1OSD A;  4OYW A;  1C1B B;  1KOO A;  2EC0 A;  3VV2 B;  2R7U A;  3NS6 A;  2AGP A;  3BN7 A;  2ZOF A;  4NEZ A;  4ZP6 A;  1W25 A;  2CXE A;  2AZ1 A;  2KHD A;  5KFE A;  1NK5 A;  4KV8 A;  2W8L A;  4QIV A;  4U8Y A;  1G3O A;  1URN A;  1LOU A;  1Y0H A;  3UNY A;  1I51 B;  3HZG A;  4U9R A;  1N0U A;  1W26 A;  3KDO A;  4J5O A;  2H48 B;  1HBU A;  1RKI A;  3BRE A;  3MM7 A;  4XDC A;  5KFJ A;  4NYO A;  2IJR A;  4OI0 A;  1RWN B;  1V5I B;  1NCL A;  4LF5 J;  5C5J A;  4KSE B;  3ENA A;  2Y0S D;  2HYI B;  3Q24 A;  3WC2 A;  2GVD B;  1RYS A;  2WAQ D;  4WXO A;  5H9E J;  1TFY A;  5IWA F;  5E3A A;  4WFN Q;  1M1G A;  1AUS L;  4DS4 A;  1XNR J;  3GU0 A;  3RW7 A;  1PGZ A;  1FRM A;  2CAD A;  1RTJ A;  3QFW A;  4M5D B;  2BM0 A;  4NLU A;  4QWC A;  3CMA S;  3W2W B;  1ZZN A;  1WAC A;  3P45 B;  1RI7 A;  4RBV A;  5HK4 A;  4YHH J;  4X4R A;  4LR8 A;  3F0N A;  3C46 A;  2B5J B;  3IWX A;  3PVX A;  4UTG A;  3CXC R;  1N33 F;  1U6Z A;  3BB5 A;  2W9C A;  2HS4 A;  2IJF A;  1RHM B;  4RW6 A;  2GX8 A;  1GEH A;  5GAH U;  2MB0 B;  5E2Q A;  2VFV A;  4PG7 A;  4HT7 A;  4R25 A;  2CAJ A;  1F5C A;  4LBP A;  2DGU A;  2RT3 A;  1VQ8 S;  3B6B A;  1VBY A;  1NH7 A;  4WCE Q;  3CCE S;  1EZZ B;  1IM4 A;  1IWA A;  2R7Q A;  3LP1 B;  1IQT A;  2HBY B;  4K4V A;  1RTH B;  3AOC A;  4IR9 A;  2HZA A;  1HL6 A;  2OKQ A;  3AT1 B;  3BZQ A;  4YDD B;  3I55 S;  2LDY A;  3DLB A;  2EBG A;  1RTJ B;  3TVK A;  1LXJ A;  3BEG B;  3MAH A;  3J81 U;  3FEZ A;  2DGO A;  3M6U A;  1TL3 B;  5F3T A;  1IBK F;  1HKA A;  5CAB A;  3FNN A;  1S0V A;  3WHI A;  3G9C A;  2F3J A;  1S1V B;  1G7C B;  4DZ6 A;  2KVQ E;  3G82 B;  2YNI A;  3OXF A;  4FNH A;  1PYO B;  1YBU A;  4ETZ A;  2ACY A;  3LOU A;  4A8Y A;  1GT8 A;  2RML A;  2CNK B;  1HWJ A;  5HMY A;  1YSJ A;  2UUB J;  3L7O A;  4NWB A;  4OJ1 A;  1H2T Z;  5J2Q B;  2YNH B;  1ZYQ A;  4ID5 A;  2DR8 A;  1G1X A;  3I9Z A;  4C98 A;  2ZH4 A;  1N32 F;  2G2Z A;  2H9Z A;  5CQG A;  3M8P A;  3VAM A;  1F9H A;  4TYB A;  1EQM A;  1NME B;  3W5X A;  3PHE A;  3OL7 A;  4GKJ F;  1FWK A;  1VJW A;  1X9M A;  2KZM A;  4QOT A;  5EN1 A;  3I4H X;  2D9P A;  4J9V A;  3UR0 A;  3CGI A;  1I1G A;  3BKT A;  4CO1 A;  1KBR A;  2L08 A;  2V8V A;  3AJ2 A;  1TKT A;  5HAO A;  1SQF A;  2ILY A;  2N4C A;  2U1A A;  2GMJ A;  3E3X A;  2C3Y A;  3G82 A;  5IS2 A;  4AXI A;  4PPD A;  2HHH F;  3SQG B;  1VQS A;  4DLE A;  2ZM6 F;  1ELO A;  1N5V A;  2GGP B;  3GSI A;  4MK9 A;  4UOC A;  4OJG A;  2N82 B;  4ZPB A;  3HI9 A;  2BM1 A;  1ZPV A;  2B51 A;  4DCJ B;  2R7T A;  3DLK B;  3OTD A;  4FKY A;  5A8R A;  1HHQ A;  3GJQ B;  4LJM A;  1FKA F;  3GR0 A;  1KTV A;  3P49 B;  3THT A;  3M6X A;  3QGH A;  2HZV A;  2UU9 F;  3UD4 P;  1T3N A;  3MMA B;  4HH0 A;  3OW2 R;  2PI5 A;  3G96 A;  2OEM A;  1N4L A;  3K5L A;  1MRO B;  5CYJ A;  4ZJL A;  2C2Z B;  1NZA A;  1TVR A;  2VF3 A;  3ET6 A;  3GFH A;  2OLW A;  2ZOM A;  4HI2 A;  1N36 J;  2EG2 A;  3BSA A;  3ET6 B;  5G0R A;  3Q23 A;  2ZC4 A;  1LV5 A;  2JC0 A;  4DBQ A;  2K1R B;  3DLL Q;  2IYG A;  1T05 A;  2RDJ A;  1FJG J;  1FD2 A;  5DLG A;  2YX4 A;  3W65 A;  1LK7 A;  2CQ2 A;  4URS A;  4Q43 A;  3FCH A;  4OL8 A;  1SB6 A;  2ABY A;  2JH3 A;  3LAN A;  2HHV A;  2ZE2 A;  2D3Z A;  2GHP A;  3LGM A;  2GJF A;  2KL8 A;  4ILM A;  5KFR A;  2JLF A;  2VV5 A;  1IKW B;  4CZC A;  2UVU A;  1FWP A;  2HFO A;  5KFX A;  4NLY A;  5HMX A;  2VQE F;  3CPW R;  1WC0 A;  4OI3 A;  4KGM A;  4EGL A;  2OP5 A;  2VOO A;  1XMO J;  4WP3 A;  1IBL F;  1QY7 A;  4C3L A;  2MKS A;  2MQN A;  3AJ1 A;  2IAJ B;  3R7B B;  2H51 B;  4CM0 A;  2FLN A;  5LSO A;  1FE4 A;  1FK9 B;  3TEH B;  2N7C A;  1Q1K A;  3D7S B;  3TAM A;  2GAH C;  1N8R T;  2FVS A;  1WSR A;  3V4I A;  4V19 J;  4LF6 F;  2CPI A;  3DLG B;  4LVO P;  1YJ7 A;  2WVE A;  2R7V A;  1BQM A;  2V67 A;  2E29 A;  2F65 A;  3JYT A;  3VR1 A;  3HK2 A;  1XNQ J;  2Q6C A;  4LSL A;  4OHV A;  3JYT B;  1N6Q B;  3B8H A;  2YNF A;  1A7G E;  1R0C B;  2EKY A;  2ZWO A;  5GVQ A;  4WTO B;  3G86 A;  4LF4 F;  4L75 A;  1X7V A;  4J37 A; 
#chains in the Genus database with same CATH homology
 3QBC A;  5ETR A;  4M5K A;  1RB0 A;  3ILL A;  4CYU B;  4M5N A;  1DY3 A;  1RTZ A;  5ETM A;  3HT0 A;  5ETV A;  4M5I A;  2BMB A;  3HCX A;  3ILO A;  5ETN A;  1RU2 A;  4CRJ A;  3IP0 A;  1F9H A;  4M5J A;  1EQM A;  5ETS A;  3HD1 A;  1TMM A;  3HD2 A;  1G4C A;  3KUE A;  1HQ2 A;  3UDV A;  1TMJ A;  5ETT A;  4AD6 A;  5ETO A;  3HSZ A;  2QX0 A;  4CYU A;  5ETQ A;  5ETK A;  1EX8 A;  3HSD A;  5ETP A;  1KBR A;  2CG8 A;  3HSJ A;  3MCN A;  3HSG A;  4M5M A;  4PZV A;  4F7V A;  1CBK A;  3UD5 A;  3ILI A;  3MCM A;  1HKA A;  3UDE A;  2F65 A;  1EQ0 A;  1IM6 A;  1RAO A;  2F63 A;  3KUH A;  3MCO A;  4M5L A;  4CWB A;  3ILJ A;  4M5G A;  1Q0N A;  4M5H A;  3KUG A;  5ETL A;  1RU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...