4M5JA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
157
Chain Sequence
b'MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 42
structure length 157
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5jA00
3HCXA 4CWBA 1CBKA 1RU1A 4M5KA 2BMBA 1EQMA 3HT0A 2CG8A 2F65A 1DY3A 3KUEA 3MCNA 3KUHA 3ILOA 1G4CA 1HKAA 4CYUA 3ILLA 1RAOA 3MCMA 1TMMA 3ILJA 4M5HA 1Q0NA 4PZVA 5ETOA 3HD2A 1F9HA 3HSZA 3MCOA 3QBCA 1RTZA 3HSJA 5ETRA 3UD5A 4M5GA 4CRJA 3HSGA 3IP0A 1IM6A 4M5LA 5ETTA 5ETQA 1HQ2A 5ETSA 1KBRA 1EQ0A 1RB0A 1RU2A 4CYUB 3HD1A 5ETMA 1TMJA 4M5NA 3HSDA 1EX8A 5ETVA 3KUGA 4M5MA 5ETPA 5ETNA 4AD6A 5ETLA 4F7VA 2F63A 4M5IA 3UDVA 3ILIA 5ETKA 3UDEA 4M5JA 2QX0A
chains in the Genus database with same CATH superfamily
4ZITA 2BJ8A 2LKZA 2LDYA 4E0DA 3T9NA 4B3TJ 3KHLA 2C2NA 3DOLA 3TZZA 4DUTA 1SCJB 2YVSA 1XNQJ 4NA1A 3U1LA 1YHQS 2RJZA 5GADU 1IKYB 3A3NB 4ZJOA 3T19A 2GIFA 4V1Ak 2CQ2A 4FXWA 1FESA 1C4AA 3E51A 4I6YA 4FDFA 2BQUA 4GVLA 2LECA 4EEYA 3DHWC 3AODA 5B0DA 2H9ZA 1FJEB 2KO1A 5B0BA 3LP1A 2OKQA 1CJKB 3NAHA 4B3MJ 1OIAA 1T9WA 3AD8C 4Y6IA 4N8OA 1H2UX 1VMBA 4ZVOB 1YKWA 1HYSA 4DEZA 3JB9k 2P6TA 2NCKL 4BS2A 4QU6A 2ADCA 1H98A 3R27A 4W98A 3OXGA 2GGPA 1G3OA 2MDAA 1B3TA 3CT9A 2HK3A 2XLJA 3CCQS 2YXLA 1N8RT 4RNMA 5H9FJ 2E9TA 3DXBA 3KHHA 2MQOA 5G0RB 3B4MA 4UQTA 1LWFA 4A8MP 1HNVA 2AZ3A 1NK6A 4PWDA 1U1NA 1S59A 1Y5NB 3M1VB 3PX4A 4ID8A 1HNIB 5A8RA 4DU8A 2Q6BA 3HULA 4CO0A 1U24A 1JKHB 1FKOA 2EPIA 2VDIA 1UFLA 4IH7A 3EVWA 1RUSA 1RT6B 2CQ1A 1F2HA 4ED6A 2VODA 1S9GA 2IPOB 4F67A 4H4OB 2FDNA 1DLOA 3TA0A 4ZKAA 4RW9A 2VQFJ 1KNZA 4CYUB 5GMDA 1LW2B 1T8EA 2FC9A 3FEXB 4QWAA 2DY1A 3H0PA 4HL9A 2ZOGA 3RG6A 3HVAA 2WBMA 1ICEB 2QFIA 1RTDA 2B4VA 3DNCA 1AFIA 3GZ7A 2VBWA 4JV0A 2JNJA 1FX4A 1RE1B 2ZH5A 3TEHB 2OSRA 2RHSB 2MXYA 3UCUP 3VWSA 3D4JA 4DPYA 1NBEB 2B0GA 2B9WA 1RWOB 3GJQB 2RQMA 3TUZC 3OFGA 4O4GB 3R5GA 3W2WA 2C3MA 2AMCB 2UUAF 1SKWA 5KFSA 3PX0A 3PW7A 1QDUB 1RACB 4F3MA 3OUYB 2BM0A 1X9SA 4YOEA 2Q79A 2ZBRA 3UD4P 3Q8YA 4A8OA 2EWHA 5CAAA 3M8WA 4RBTA 1VR6A 2V2KA 3UE2A 1SV5B 4A46A 1WG5A 3GSDA 1H7WA 3TX0A 1T03A 3JTOA 2DO4A 4DV6J 3O44A 4R5PB 5B09A 1ZAWA 4IG3B 3T1YJ 2KJVA 3C66A 1OSDA 5A0YA 2DPIA 3QRQA 2P9CA 2RQCA 1O5JA 4PXDA 4AQYF 1KVJA 4N77A 2YKNB 2D3OR 2J8SA 5L1IA 4TY8B 2SXLA 1DZ5A 3PRVA 2W2QP 4L6V3 1LOUA 4FXDA 1G7CB 1FVSA 2M0GB 4NXMJ 1VC0A 3GFXA 3MR6A 2JC0A 2R7SA 4TNOA 4OX9F 4LSNB 2PA8D 1WUUA 5HMXA 4DQRA 4LUBA 2P5VA 3MEDB 2IJFA 4HYKA 2OPRB 2M88A 1FJ7A 3KUHA 1JK9B 7FDRA 2GC8A 3CJ5A 5DG7A 1X4HA 4DSJA 1B7FA 2CNOB 3V6JA 3OTEA 3C19A 2GAGC 3KKFA 3V4IB 4FS2A 2GHVC 3W9JA 2W1BA 2BKOA 4J7CA 2N7CA 2M3DA 4K4VA 4A8WA 3IM9A 3KLGB 4K0KF 4G1PA 3HF5A 3VZHA 1DRZA 2EC0A 4WYLA 1MLAA 2WBRA 1VQOS 1RDRA 2O67A 3LWMA 3TEGA 2LP4A 2QO3A 4OI3A 3VF0B 3W7BA 4P9SA 3M8QB 3ULHA 4JV1A 2CQ3A 2RUGA 1N5QA 4YB5A 4ED8A 2X7IA 4JI1F 1UJ4A 1CULB 2AGPA 1S1VB 2YPZA 4CNYA 2Y8WA 4M63A 4OX6A 2VPWB 2EK6A 4JI3F 3LPYA 2ALZA 3FJ2A 5D4PA 1IKVB 2EK1A 4AXIA 3C14A 2UUTA 3PVXA 2BA9A 4DL6A 2R7RA 2U1AA 1LWEB 1N33J 3U7JA 5M2PA 3EVOA 4DG1A 4FF3A 3M2UA 3HDSA 2Z30B 1AUSL 1SJQA 4AUKA 1WHWA 1Q1KA 4ECXA 2FLOA 3SQOP 2CQ4A 2CZVC 1TVRB 4KBIA 3QFHA 2GZOA 4DV0J 2HHXA 3D6TB 3NS7B 4H54A 3OBIA 5F8LA 1D9FA 5HQMA 1NZAA 2DHAA 3RGIA 3S8SA 2ZVIA 3R97A 3DN9A 1NM2A 5KT7A 1U1LA 1J5EJ 1FFGB 3QRRA 2Q66A 4YUDA 3AOBA 2E5IA 2WVCA 2RF2A 4R0EA 1UP1A 2CDQA 2VKZG 2CPXA 2OGUA 2YPYA 2V8HA 4I2QA 3UDLA 4DJBA 1EP4B 1SJ1A 1TV6B 2NZ4A 4FPIA 3RAMA 4NZ0A 2JOQA 3JSYA 4B9LA 4WF9Q 4KB7A 2R8KA 1K1QA 5HP1A 5KG3A 4A8KA 3RRGA 4ZA1A 1S6QA 3BBCA 2EFQA 4A8SA 5LT5A 4DFKA 1LFWA 2O3DA 4OZ1A 2YTCA 4N8NA 2HRYA 3R3TA 2ASDA 3MGJA 4JB8B 3NY0A 2XZDB 4DCJB 4ECVA 4YEAA 2GV1A 2FLPA 3T6JA 1XNRJ 2K06A 3B78A 2XBPA 1YIJS 4WIIA 1GAOA 1N6QA 1A6LA 3EGZA 1EETA 2NPFA 2HGMA 2UXBF 4I1TA 2LU1A 3M05A 2NYHA 1N36F 5IM0B 4KIAA 3M2VB 2VICA 1RKJA 5FD1A 2A6OA 1X4GA 3CCVS 2DXFA 3MMCA 5CYMA 1HD0A 2VF3A 1HL6A 2G2ZA 3OJSA 2VDHA 3CF5Q 1ZAXA 4QWBA 4J9NA 1KLMA 1NNDA 1WACA 4K2JA 3QRPA 4IKAA 5E3CA 1W26A 3ICLA 3LP0B 1TUWA 2F7VA 1N56A 3IRXA 5SUHA 2MLXA 3Q0AA 3RBXA 2XLIA 4NCBA 1X0PA 2HEKA 2FJBB 5EHHA 9ATCB 3GONA 5D3GB 4QR1A 5KG7A 4CZCA 5GAGU 2VONA 2V2QA 4EZ6A 2R8HA 5IOLA 4BCAA 3FKBA 5J2MA 1WSRA 1B7YB 3LF0A 2ACMA 3CJ3A 2CPIA 2AHOB 2VFUA 5H1SV 2HNZA 3M6XA 2ZHAA 5KFKA 2XTJP 3DMJB 4W92B 4C0HA 4MAKA 2WB4A 1JIHA 3Q8RB 3J7AN 1FXRA 4FYXB 3UDVA 1NCLA 3CUNA 2C22A 4I7FA 4LF7J 3GTYX 5L1LA 4UTGA 4LR7A 1B0VA 5KOXA 1BGXT 3BBFA 1YBAA 4YQWA 3KK1A 3EPGA 2VBZA 4ZP7A 2F63A 2QJ3A 2PFDA 4NLWA 3KG4A 4F4WA 2W25A 1BMQB 3DGPA 1OQ3A 3HFKA 3MMAB 1WD6A 5FIIA 2YWFA 4ELVA 2B8PA 2G0CA 2UUAJ 1D0EA 1TKTB 1Q86T 2EBGA 5IZHA 4DL3A 2ZJRQ 1BQXA 4X4RA 1S0VA 2GVZB 5DM7Q 1DTTA 2PGCA 4WP8A 3MUMP 4N41A 4URQU 1PYSB 3KK2B 2J6SA 4DWIA 3J7ZT 5KFNA 2GHPA 4EFAC 3DOKA 3Q22A 4OQJA 4N5SA 2Q6CA 4GVBA 3FBCA 1NHUA 3OD2A 4EO8A 4DV5F 1VQ4S 2MQPA 2HHHF 3VVUA 2NXEA 4AQYJ 2WSFC 1KVIA 1HA1A 2V8GA 2ATCB 3IA0A 2F8MA 3KLHB 3M8YA 1R8PA 4ZVRB 3TANA 5E3QA 3FBBA 1RTIB 3OR1A 2UU9F 4OX9J 1YG0A 4UF4A 4CH0S 2M52A 4ZP8A 4PXEA 3PJXA 4O3NA 1P1TA 1KC8T 4QIFA 3AOCA 4HLBA 1Y5LB 5C25B 3EZOA 3CJ0A 5DETA 1D9AA 1X8DA 1K8AT 2MZTA 1IXKA 2B7CB 2L41A 2YKAA 2QRRA 2PEBA 5KFGA 2IY5B 4QBUA 2C42A 1ZPWX 2G4BA 2AGQA 2AZ1A 3GV8B 3I96A 3QT6A 3CDBA 1PSDA 2QLXA 2BXJA 1H2TZ 2YKOA 1FD2A 3MTKA 2DD8S 4FXVA 1NK4A 4LF4F 1BE4A 1C4CA 4F3OA 4O0IA 1WG4A 4P2SA 2AJ1A 1Q8BA 4JI1J 2YKMB 4R8UA 4O3QA 1AB8A 4ZCMA 3HT0A 4XIUA 5J2NB 1M0SA 1TU0B 5K9FA 2HHUA 2DR9A 3CSKA 2M8HA 2IC3A 3D2WA 3ENAA 4WZQA 5KFVA 1RT5A 3W64A 5FLXU 2MQQA 4M5JA 3S1TA 3ZZPA 2HVHA 2WW4A 2QZ8A 3HP6A 1NPKA 2GMHA 2ZZNA 2QLFB 1R31A 3JQKA 1SKRA 1WWHA 4B9NA 3IRWP 1WC0A 1FWKA 3HK2A 3H2VE 3W61A 1FKPB 4C11A 5RUBA 4A4JA 2VG5A 4OLPA 3RAQA 2Y0SD 4B3OB 4QW8A 5DRKA 2XI2A 1FRHA 1RLDA 2DO0A 3BGLA 2YNIB 5HANA 4GKKF 4MIWA 1JLQB 3AB2B 4LF5F 1C1CA 4WFNQ 4IDKB 4XTTA 5HK4A 5LJ5Y 1CJUA 3MM8A 1QUVA 3TOQA 4DN0A 2ZH1A 4DF4A 2RS8A 3TQ1A 2C2DA 4F02A 1S7HA 2EKNA 1GX5A 5C5JA 3AFGA 3DRRB 3W9IA 3LH2S 3ISNC 4J9KA 1JLEA 3IS9B 4CDIA 4NL5A 2V4QA 1HNWJ 4DPOA 2ZKTA 2Z2MA 3NLCA 1HW8A 3BKTA 1AW0A 3OL9A 2GQQA 5KG6A 5IWAF 4HVZA 5FLXY 3HHLD 4CLLA 3IC1A 2Y3YA 4NI2A 2OMLA 1FA0A 1F9FA 2W9CA 2K7KA 2PMZD 4USHA 2W2OP 3D3BJ 3PR4A 2JLFA 5L46A 3R7NB 4FBTA 4LF9J 5D78A 4LFCF 2BKPA 1N36J 4A48A 4KH1B 1KHWA 3C6UA 1KLNA 2C2MB 4NLUA 4EMDA 5C42B 4ETZA 1JNRB 4XPEA 1F9EB 1HFEL 2MQMA 3KNAA 1O0PA 1HLWA 1MWZA 1QLNA 4KHPF 1QVGR 2YX4A 1YDLA 2Z2ZA 5L9XA 4Y3CA 4NA3A 3FQKA 3BGRA 3OW2R 1WC3A 3CIMA 5D8HB 4WFYA 4C6AA 2CAJA 3CCWA 4ZLPA 1LV5A 2P9GA 2XYPB 3GYNA 1VQ8S 5AXNA 3P5BP 4DV4J 2M9KA 3PXGa 4JI8F 3O2IA 1R7IA 2IVMA 5D15A 3W8GA 2EG2A 2CXEA 3BYRA 2DGVA 4A8FA 2OLWA 1X7VA 3ZZRA 3N01A 1CQNA 1HYSB 1RBLA 4PUOA 5A2QU 3THPA 4I2PA 2NUHA 2OPPA 3L7OA 4G65A 3M8SA 3CDAA 2B4PA 2L9NA 1VDHA 5KFXA 3DLLQ 4CNZA 2MB0B 3FEYB 2DNMA 1L3KA 1FXLA 4PKDB 2GGPB 1VBXA 3FFIB 2POKA 1RAHB 2FHJA 3C16B 4PZVA 2NXJA 2IRYA 3K59A 3QGHA 5EWEA 2XB2D 4PYDA 2JH3A 4IRDA 4KC5A 2JLGA 2OELA 1VK3A 3J81U 5A8RB 2ZE2B 1T9TA 4U95A 1XMOF 4J9LA 1KBRA 1B0PA 4DZDA 3HSDA 2ZC3A 5GMEA 3MURP 2BDPA 2PIIA 4ZN3A 2F9DA 4X4TA 3LGHA 1U2FA 8ATCB 2BACA 3AB4B 2CVEA 1UEKA 2AF6A 3ITHA 2HURA 4RW9B 2HHPA 5T14A 4QOTA 4JYAF 1U8SA 1OS5A 2CJYB 1HHQA 2VG6A 1YJRA 1HPZA 4NLSA 2F65A 2Z0GA 3HFVA 3QT5A 3EVMA 4JI2F 2DIUA 3EMTA 2JHEA 1TKDA 2J5AA 2DYAA 1S77D 3RUBL 2OD6A 1ZPVA 3I56S 3PV8A 3QWUA 5K14B 2OPQB 1RTDB 3Q83A 2Y9HA 3H42A 3CCRS 1H73A 3KFWX 3CGIA 2UU9J 2YNHB 1U7LA 4QU7A 2IHR1 4NLQA 2XYGB 1OY8A 4UOGA 2CQDA 3PFEA 1HBMA 3BH7B 1XK8A 3R1LA 3FCVA 3GMGA 2RSQA 1TTHB 4ATNA 2V4RA 4TYAA 1FK9A 4ID5A 3UVJB 1YJUA 1AA1B 1IN0A 2EBEA 5CXTA 4J90A 4OL8A 2KN4A 3CE8A 1LFPA 3G82B 1NPRA 4USWA 3P8BB 4J9UE 3J81Y 3NOGA 5JVGQ 2CNNB 3MHYA 4RKUC 5F3TA 2DRAA 1T03B 1FWLA 5MLCV 1M5HA 4P52A 4JI4F 2B6AA 2CQHA 4LF4J 4C8KA 2XSJA 1VOMA 3CCTA 1J5OA 3GCWP 4MYUA 2K7JA 4DR6F 3VGVA 1FE0A 1QSYA 2KFZA 5EGYA 5F9LA 2ROPA 3LWLA 1KEKA 3VTIA 4YY3F 1F1BB 1RT3A 1HKAA 2DRBA 3M8PB 1RQ0A 2YKQA 4GMKA 2MKKA 2CRLA 4CO4A 3WX8A 4MKVA 3P5TL 3FRYA 3S01A 3F44A 5E41A 1REVB 1D1UA 5IV4A 3EDQB 3H4BA 3J7YU 4DS4A 4ZP6A 3OFEA 3GJSB 2KZZA 1U1MA 1IKYA 2GFFA 4E2FB 2NSCA 4BC9A 3SQGB 3CJTA 5HN0A 5U47A 1WNEA 4F4YA 1S49A 2VB6A 2UV8G 4CLUA 3BO3A 1VFJA 3GFYA 2XSFA 4EWTA 2LQBA 4PG8A 4KT0C 3MEGA 5CZXA 1FF2A 1X5SA 1OPIA 3K5OA 3KLIA 1CJKA 4PPZA 1U25A 5CZVA 1WDDA 3ADAC 1RTZA 4HR2A 2KXHA 1OSCA 1KN6A 2CYYA 3DLBA 2DGQA 5E2QA 2HMIB 3NG8A 2ZDPA 4LF5J 2XC9A 2KM8B 1P8GA 1WC5A 3J7A1 1WEZA 1TL7A 2NYIA 4DSLA 3J80U 3CJ2A 2KJWA 1FCAA 1WKKA 2AJ4A 2YBVA 4ECQA 4YB1P 5D0EA 1FDNA 2N4CA 4K2XA 4DG1B 3C15B 2RRNA 1UPMB 4ERDA 3QIPB 3TO8A 4WU3A 5G0RA 2ZJQQ 5AE3A 3M7VA 2UUBJ 1NRKA 2R7OA 4IH6A 2OTLS 1R0BG 3ZZZA 3BQ1A 1HNIA 3Q2SC 2V5HG 3GIIA 4RW8B 2M70A 3GCXP 2AEFA 4GRSA 1JKHA 2DNGA 3MMBA 1WC4A 4K5SA 4B3SJ 2B9XA 1RT6A 1TKXA 3CW2C 4H4OA 3I5CA 3LGNA 4TQRA 1WOOA 2VL1A 4LSZB 1V3ZA 3VVTA 4M5KA 2UVWA 3MAQA 2AX0A 2MMYA 1Q82T 4CYUA 1B0TA 1DURA 1M5VC 4O3SA 3LAMA 1HBNA 5KFMA 3MXHP 3ILIA 1Y10A 2P6SA 5HP1B 2YWWA 2XWYA 4YHHF 4C9DA 1S6QB 3B4DA 3QMQA 4EUVA 1X0FA 2IRXA 5L9NA 2B7BB 2GVDB 3CJ4A 1FDBA 2H48B 2CDRB 5DQHA 4D3HA 2E7WA 3J80Y 4ZPTR 2XS5A 4IFYB 4XPCA 1UW4A 4O4GA 4USJC 1RWVB 2CZ4A 4G1IA 3E8OA 1JLFB 2JDJA 2NPIA 4OHWA 4ILLA 2VQEJ 1YLXA 2VG7B 1EETB 2HAFA 3OUYA 2AIRB 4LREA 2BJDA 2NSBA 2MJUA 2C2RA 1R43A 1KFDA 2HFVA 1TK0A 1SV5A 3RTVA 5KT2A 1Q16B 1VQ5S 3O5TB 4RX6A 4R5PA 1QJHA 5J2QB 1OQ6A 2DNHA 1NKBA 1YRTA 4KPCA 4KHRA 1NEEA 2E1PA 3BDPA 2X1GA 4KRWA 5E7OB 4Q44A 3D9BA 2H5IB 4USIA 4TY8A 2P9EA 2QA4S 1F60B 2XYHB 3ZZTA 1P9QC 4BC7A 1R8BA 2H3EB 3KJFB 4WFBQ 2RD5C 3IRXB 3IR5B 1UFWA 1K44A 1H3DA 3EWGA 4RZRA 1CS4A 4ZIWA 1DQ9A 4FYWB 3EYZA 4ZPWR 2DITA 3MEDA 1OYEA 2OPRA 4FYDA 4QR2A 1TMJA 4TLRA 4C8LA 1JJCB 4MMOA 2E9RX 3IAS9 4RLEA 3FBFA 1NU4A 1PJ5A 2HNZB 1NK5A 4NLTA 3D66A 3HHDA 5CABA 4JI6F 3MUTP 1JQGA 3WIVA 2LEPA 3QGGA 3MM6A 1VRUB 3A12A 1U1OA 3D6MB 3KLGA 1SPBP 4F2RA 1FI4A 3HO1A 3DFEA 3IP0A 2IA0A 1ZA1B 2ZFHA 4ZOSA 1GK8A 3Q23A 5CD4H 3O3LA 2VHGA 2B9EA 3OL7A 5CD4A 4YR3A 2GJIA 3OHAA 1GNKA 3M8QA 4OHZA 1SJ4P 2DEIA 5LXRA 3BGOP 4ZPAA 2OPSB 3I0SB 5EWGA 1SJ3P 1RBOB 3THVA 1F2GA 1CULA 1T9VA 2AP6A 2CKWA 1S1VA 4JI7F 2GW8A 1NSQA 1RAAB 3PZPA 3QATA 1NSAA 2JEIA 2AX1A 2HZVA 1DTTB 4ZN1A 4KYZA 3TARA 3CCES 3QWPA 4WK3A 1VK8A 5A8WB 3DOKB 1LWEA 4OI6A 4JI4J 1N32J 2UV8A 3TUJC 4ELTA 1HQ2A 5HMWA 4Y28C 3BQ2A 3EPIA 4YP3A 3RBZA 3DRXA 4DR6J 5E33A 4DR4J 5F8IA 1IKWB 2LEAA 1TVRA 4YFUA 3W5ZA 4EYIB 3UWTA 1LXJA 4K4UA 2RU9A 2JEGA 3AAWB 3MD1A 4X4SA 4HEA9 4DHVA 1QY7A 1VS3A 4LF6J 1UVMA 1H72C 2DGTA 2M2BA 1ZM2A 4OYXA 1OO0B 3PYEA 1RWWB 4RBVA 1U1KA 4P2MA 2BV3A 2MQLA 2H51B 1ZETA 1M5SA 4C97A 1XERA 3NKYA 1C0TB 2VC1A 4S0MA 1KOOA 4C98A 3KWMA 1T7PA 4PG6A 2Z2LA 3G4SS 1EP4A 5JVHQ 4AL6A 5HAOA 4U96A 2Z57B 1LNQA 1TV6A 2FC8A 2K8GA 4M8LA 2Z58B 1T9YA 2JVOA 4M5DA 3R7BB 1U8WA 5IS2A 2FGOA 2FVSA 1ROFA 4OYIA 5DLFA 2W2MP 2ZJPQ 1AT1B 2B4UA 1SXLA 1HWIA 2PMHA 4IOCQ 2V6AA 5HL7Q 1R0CB 3TAQA 3HHEA 4LQ3A 2HVIA 4HHJA 4DU7A 2E7XA 4K8RA 2CWXA 1AYEA 4HI2A 2IVYA 4FF4A 2CADA 4X2BA 2P8IA 2UP1A 3TAPA 4H4KC 1UJ5A 1ZZNA 3T5JA 2QMXA 2IJRA 2VPXB 4WPAA 2RQ4A 5KG0A 4LRCA 2RILA 2DIVA 4RNOA 3PFOA 5JXSA 1BHNA 3HHNB 5IFMA 3M2RA 5B0AA 2IC3B 3M2VA 3BQ0A 3NNCA 5CYJA 1T9UA 4HH0A 2WVBA 2OIHA 2J9DE 5AE2A 4DV1J 5LSOA 4OZNA 2ZUGA 2V8DA 1Q5VA 1KTQA 1FEHA 3OQ2A 2UUCJ 3DM2B 4MJKA 5LMNF 1IR1A 3QYYA 1S1UB 4X4PA 5HJXA 4PQUB 1S0OA 5MAOA 1HI1A 4ZCIA 3CIZA 2VFSA 2J76E 1CC7A 2XMWA 2HVEA 1CSJA 2C2KB 3MCNA 4RPFA 1B70B 1U48A 1WF1A 2VG5B 2VD3A 2GQCA 2HFSA 1UWBB 1S6UA 2WOMB 1G1XA 1UKUA 3A1YG 2VFVA 4K4XA 5B0FA 3M6UA 1MWYA 5LL6d 2RKIB 1PGZA 1FERA 4F50A 4RO0A 2FHMA 3WHIA 3AA9A 2COLA 2MZJA 2I0XA 1Y11A 5LXYA 4OJHA 1X9WA 4B9TA 3MM8B 4RUBA 1H38A 3U1MA 1WKJA 4Q2LA 2QN6B 2HHSA 1RA6A 4WXOA 4KSEB 4WFZA 2HRTA 1VHIA 3GYXB 4OYWA 1KKHA 4I4BA 3HM9A 3T6BA 3I9ZA 3H20A 1U47A 4WCEQ 3AD9C 4L3NA 1XC9A 2ZUAA 2E5HA 2KVQE 2EW9A 4OZ5A 1NKCA 2FGCA 2IAJB 3PEJA 5HMYA 4C48A 3MMAA 3HHLC 4TQSA 4I56A 5KG2A 1E6VB 4IH5A 4DR1J 2W9CB 4JUZA 3PIOQ 1TKTA 1A9NB 4DQPA 3PR5B 3VCDA 1CJTB 5B0CA 2BX6A 1FRLA 3MM5B 4X65J 4M5MA 4DUZJ 2I2YA 2GVZA 1JX4A 3SCLE 3H8YA 1V9OA 3BREA 3PM9A 2ZEJA 3EXYA 5BR8F 3HHKA 2MHNA 2PMWA 5IT0A 4PG7A 1QD1A 4DUYF 3T1HF 1JB0C 2NR0A 3K0JA 4OYOA 4URSA 1YJ9S 3DDIA 2FVPA 3ZTQA 1Z4UA 4YB7A 4DSIA 4M1KA 4M5NA 3N0VA 3JQJA 1JXVA 3PO5A 1RTIA 4OFZA 1LW0A 1VC5A 4USTA 1MN9A 1ELOA 3CCMS 4DR2J 5EWFA 5HMZA 5AXKA 3VHQA 2BE2A 3DLGB 3H5XA 1ZBTA 3ONQA 5KFZA 3UN3A 2PN6A 2PE8A 3JAMU 1AZSA 3DHXA 1I3OB 3K7RA 3NS5A 5KFOA 2WSEC 2OPPB 5A6WA 3N4WA 2XS2A 3G96A 2E1MC 1XN9A 5C24B 4X66J 1RK8A 4LR8A 6AT1B 1PBAA 4DLGA 3HZEA 2CQPA 3M8RA 4NA2A 3G8TA 3ETMA 3SEOA 4EBCA 3BGUA 2C1EB 3X1LB 2HWTA 3N5BA 3BEGB 3MECA 3NWGA 4CLYA 3QGPA 4P6QA 4TKTA 4M94A 2LDIA 4MT1A 4CO1A 8AT1B 4LF8J 3ISZA 3W1YC 2D1CA 3CDWA 3D1OA 1DY3A 2BJ7A 1X4FA 4OX7A 1O51A 2HGNA 1LKZA 5K8NA 5CYQB 3GIRA 4B9SA 4ZS6A 1NMEB 4Z37A 2D9PA 2F4VF 1HI8A 1KDNA 1Y00A 2YKMA 2I6WA 3VGTA 3IWLA 3JQMA 5C7PA 3EJMA 2FJXA 3G6ES 5J2NA 1APSA 2KDOA 4NEYA 3PRDA 3MUVP 2ZITA 1R3NA 1WOPA 4N7TA 2R42A 2MJNA 3JSRA 3Q8SB 4ILMA 2H65B 1XJWB 4DQIA 2I38A 3RRHA 2HZCA 1I94F 4TXSA 2HSEB 1SH2A 2YNGB 3SIPB 4AT1B 2D3O1 2AW0A 1ZTWA 1FKPA 4BLGA 4DL2A 4M95A 2CPDA 5C2CA 4P2XA 1KSPA 4B02A 3MEEA 2ILZA 5KFWA 3Q8QB 2Z8QA 2RU3A 1KWMA 1NHKL 4B3OA 1Z2LA 2HQIA 1FK9B 2YNIA 3LUYA 3W60A 4DSKA 2A3JA 2E9ZA 3DI6A 2MKJA 1TAQA 1JLQA 3I4HX 3AY0A 4IDKA 3C2PA 3VAKA 2QGFB 3PHTA 2I9SA 5B7WA 2BRKA 3K5LA 3G6XA 2KI2A 3HMJG 4J9VA 2B9YA 4CRJA 3MM9B 3DRRA 2IBKA 1SQGA 3I0RB 4Y0FA 3IS9A 1WORA 2B6AB 3RB0A 3WIUA 4URGA 2PC6A 3ZTPA 3GJRB 3QT7A 4CO5A 2DHHA 1U1QA 1S6PA 4CT8A 3VV2B 1I51B 5ETLA 4DOZA 2HLTA 3LP2B 2KT3A 4I64A 3CCLS 4OJGA 1FRXA 2E5LF 3DLEA 2W4CA 3SYZA 4OV6A 4TY9A 5LMUF 3L7UA 3RAXA 5KOWA 2OD4A 5L38A 1RT3B 4DLEA 1ULRA 5KTQA 4O3OA 4QIEA 1RWKB 4PAAA 3UW1A 2BM1A 3AXMA 5M2RA 1KQSR 3D0HE 3A3OB 4UT4A 3QFWA 3TI0A 5DDRC 1CPZA 4U7UK 3ILOA 1RHUB 4C3LA 1EIYB 3QPIA 5C42A 3K5MA 1BQNB 4V19X 1WHXA 3HVTB 3KJVA 2MKIA 2FY1A 4GKJF 2WONB 3MMJA 1OY6A 4PWUA 2KFNA 5LMNJ 2UXCJ 5C2GA 2JRSA 1JLCB 4JI5F 1BLUA 4DV2F 2C3OA 1R8AA 3JTNA 4ECRA 3MEGB 1U45A 1F0XA 3TVKA 2ZD1B 3KLIB 1RABB 1JNZB 2AJQA 3UFCX 1NDPA 3PW0A 1QAXA 1N34F 4ES1A 2XGQA 3IBCB 2ZM6F 3J81j 1VBZA 4O44A 2VPZB 2ACYA 4HACB 4QYZK 3BSOA 4KE5A 5F3ZA 2ATLA 1EKSA 4X62J 4LIRA 1CEZA 1TL7B 2HLUA 5IQQA 3ETOA 1NJWA 1EQMA 1Q7LB 2XMKA 4NPOA 4FYVB 2FZCB 4Q8EA 2J9EA 3QBCA 2LXIA 1IBMJ 3FFIA 4TU8A 1FDAA 3C16A 2J6TA 4JOUA 5HROB 1IJEB 1RHQB 4ZVHA 3NAIA 5KFAA 1VCTA 4J91A 4B3RF 2NXNA 2ZKUA 5KT4A 4OZ3A 3CWJA 4GC6A 2ZE2A 2MSSA 2Q3PA 2IJNA 5KT5A 4K4TA 1YRXA 3I9V9 3FCHA 2A18A 5CA5A 3V81B 2ADBA 2RDDA 3MMBB 4J9PA 2ZH8A 4ETXA 4RU9A 1QTMA 4H4MB 1RT4B 1MWQA 4MKAA 4F2SA 1TKXB 4RUAA 4IR1A 2CUYA 3B6BA 3B8HA 2HAIA 5DDOC 4L73A 2FHJD 2BVZA 3A8JA 4OYAA 4YDDB 3FZBA 4DV7J 3R5BA 2WVFA 1HWJA 3VQTA 1WC6A 3D3CJ 1EX8A 1S1TA 1JWWA 1SH0A 1ITPA 2CVIA 1HBNB 1PBUA 1DFDA 4CLZA 2MEWA 4DUYJ 3N6NA 1S76D 3DCAA 5K14A 2OPQA 4QIGA 5IQ6A 4M5GA 4M5LA 1N0UA 4QIVA 1Z1ZA 3VGUA 1U09A 1QTNB 1RZMA 3AXKA 3BJYA 4F0HA 2CWKA 5SZTA 2YNHA 1YBTA 5A8KB 4Y2AA 3V4MA 3EDRB 3OXFA 3TJ9A 2M8DB 2R2UA 3H59A 2OHDA 2DNPA 1ZM4A 5EX3A 2MZRA 4DR3J 1R0AB 4KGZB 1RU2A 3G6VA 1S12A 1OMSA 1KQKA 4BDPA 2DGWA 1ZH5A 3CMAS 1CQMA 3AH6A 4FS1A 1YQHA 4JV5F 3EICA 2B51A 1BUXA 2JWNA 1LQ9A 2QMWA 1RT2A 2OO4A 3UVJA 1S1XB 4DR5J 4L72B 3B54A 2XZWA 4Y65A 1Q8LA 2PDAA 2IM0A 3G82A 5GVQA 5KFBA 1TL4A 4L3KA 4XDCA 4C4WA 3MPVA 3SMZA 3GV7B 4NLXA 4LVNP 1AFJA 1V6HA 2C3PA 5HJYA 2WHOA 3UDEA 2LQ9A 2J7WA 1KHVA 4CQ1A 1S6OA 2ZH3A 1UVLA 1U0HB 3CJKB 1NDKA 3MOZA 3PYFA 1B4SA 4LF2A 1T95A 2H1YA 4I6AA 2F4FA 3KJNB 2HQ3A 4QR0A 3TA1A 4XAKA 3I4PA 1OPZA 5G4DA 2RUSA 2IMOA 4ZHRB 2R8GA 1CS4B 2G13A 3TAMA 3FNNA 2V8PA 4DFMA 3M8PA 3R2CJ 4ZP9A 3BSAA 4PCQA 5KFCA 4LRAA 1REVA 2DY9A 5FJ4A 2QE5A 4U8YA 2DNNA 1HQUB 2BW2A 3HXMA 2LFVA 2LXFA 5KFYA 4PG5A 1YJVA 4QPXA 3SQGA 4DX5A 3T3FA 1F3VA 3PDNA 1UVNA 1XR5A 3MM6B 1I94J 4Q0BB 3OT9A 4KV8B 1FHTA 2CFXA 2HWIA 4RW7A 3IBFB 2JZ5A 2HS0A 4ZVPB 6FD1A 1N5VA 1VIXA 4RWWA 2K1RA 5DDPC 4DFJA 3FGVA 3IMQJ 4JI0F 2FJVA 4L75A 3BO4A 4ANDA 1X4AA 4IRCA 4RW4A 4LFAJ 5DZ7A 3P6YC 2HMIA 4W90B 3D54A 4OYPA 2HNDB 3KUGA 2OUGA 2DCLA 4P2FA 4OZ0A 2BJ1A 2WCXA 3BGFA 2M4MA 1V5IB 1S1WB 2EFGA 4Y2MA 2FYXA 1Q53A 3POTA 3C6TA 2W9BA 2MGZB 3M32B 2B3TB 5EX0A 4F4XA 1TELA 1RWNB 4U6PA 3Q2TC 4K59A 3C15A 3GYGA 4PRFA 2YWGA 1VLYA 3QIPA 5KT6A 1V3RA 5HQLA 3MD3A 4IR9A 2CQIA 1Q95G 2ZWPA 1C1BA 1VLOA 3MFIA 4N47A 3DRPA 4RW8A 1B64A 2AWZA 2KM8C 3UN2A 2DGOA 1VQMS 2QEXS 1EQ0A 4P71A 4OZLA 2ZOFA 2FTRA 3O1LA 3TWZA 4B3TF 2QG9B 1RWXB 4G1QA 4WXWA 2HG4A 1Q4RA 2XULA 4Q7AA 1U49A 2CPZA 1OYDA 4B9VA 2BOAA 3JYTB 2AEMA 3D1QA 2QMUB 3H5YA 4DQQA 2DH7A 3QJLA 3IBWA 1S0NA 2E1AA 5E3AA 2V69A 2L08A 4GKJJ 1P1LA 1YITS 1MSWD 3S7RA 3NCQA 2GS8A 3HD2A 4M5DB 2HBRB 4HT5A 5BYQA 3TNVA 3D67A 3OPKA 3LW5C 4DV2J 1V5VA 1RWPB 1VQYA 4GO7X 2KYXA 5DO2A 1Y3JA 3GR0A 3R8YA 3US5A 2FY8A 2G1DA 1N88A 4ECUA 3DC2A 3FCWA 3UCZP 3HKZD 1NO8A 4UOCA 3HSGA 3GV5B 4NLDA 2GVDA 1U1RA 5GAEI 4UW2A 4B3MF 4IFYA 1FDDA 1N34J 1K0TA 3SFUA 4OHYA 3L4BC 2V67A 2ZM6J 4DCOB 1JLFA 4LBPA 3VAMA 4C8YA 1IBLF 4WTYA 2VG7A 2CPHA 4C0BA 2GJFA 1ZS6A 4JV2A 2N3OA 3OV7A 1DTQB 2MKYA 3M2RB 1ZM9A 4IOBA 4ED5A 2RDIA 1TL1A 4UZBA 3R5AA 2FVCA 2MPUA 1VRTB 1NUEA 5BYSA 3TP2A 2R3VA 1L5UA 1N5SA 5J2QA 2O5DA 3NMRA 1SKSA 1S9FA 2ROEA 3I87A 4ZK7M 2KRBA 2VZ9A 2JL9A 2N3LA 1TKZA 5KFIA 2DGSA 2WRMA 3SSRA 1YX2A 1SL2A 2B4OA 4CI0B 3GLJA 4B3RJ 2C2ZB 2MQ8A 1U6FA 1HHTP 4I67A 5M2UA 4XK8C 3DRYA 2W7AA 3MM7A 2EFOA 2DT9A 2HKEA 4MIAA 2HVZA 1FNMA 4K7QA 2EXUA 3MPWA 2A2CA 5CQGA 1U6ZA 4FNIA 3NGRA 5I42B 2NLWA 3KHRA 3W63A 2QYCA 1O6XA 1PC5A 4L76A 4A8XA 2VQFF 2QA2A 4Y2KA 1OJ4A 1SC3B 3BM7A 1M5OC 2L3MA 3KTQA 3VAHA 1VQNS 2FJWA 2ASLA 1VISA 2RIJA 4O4RA 1W7WA 3UD3P 1DQ8A 3G6YA 1FRJA 3HSJA 2HS4A 1SC4B 2DNZA 1XTZA 1VRUA 1LWXA 4NE9C 3HVWA 1VHFA 5T41A 3J7Z5 2DNOA 3GFZA 3VAFA 1SBRA 3QJPA 4ZPDA 3WZ0A 2AJFE 1LEOA 3QJJA 1AUDA 3C8YA 3GFHA 1NB7A 2HFUA 1R6YA 3SV4A 2YY3A 1UVJA 2DVIA 1A0OB 2XZTB 4JV5J 4TVAB 2B8QA 2X1AA 2AKWB 2XMJA 1GEHA 2OPSA 4FF2A 3I0SA 1IKXB 1RHMB 1NXIA 1S7IA 3TQEA 1R8CA 4QW9A 2E5JA 1WEXA 1WTBA 4K5RA 4BBYA 5F8GA 1Q0NA 4ZPBA 1KVKA 3BDEA 4O0NA 2KHCA 5A8WA 3DLJA 2C28A 1IWAA 2HRUA 3SSSA 1RP5A 2ZBPA 5KFRA 2OAUA 5LJ3Y 4F04B 3H90A 5AT1B 3W2VB 4DR7F 3KDOA 2M5YA 4CM2A 1IKWA 4IUFA 2VIHA 5D0RA 1FNOA 1YWXA 1YJ7A 1JLBB 2VJVA 5HQ8A 3M6VA 1LW0B 2XQCA 6FDRA 1UVIA 4L74A 2R7QA 1EAYC 1XIQA 3BF4A 5J1EB 2V9WA 1WHYA 2R8IA 2BE2B 4A47A 4X4NA 1AZSB 3HLUA 1C0TA 1FEEA 4AXJA 2D41A 2I8EA 1Q7YT 4AL5A 3LALA 3TX8A 5DJBA 4DPWA 1RCOB 1HBUB 4K0KJ 1SVDA 4LBHA 3HJFA 3HPOA 2Z4PA 3MECB 2BQ3A 3LTOA 3ZNJ1 1UETA 3PNIA 2V9KA 4ZJQA 4MK9A 4ANEA 1HQEB 3GU0A 2N82B 4EK2A 3PY8A 1HARA 4FKXA 2HHVA 3PW4A 5I3QA 1Q81T 1N48A 4WIQA 2GA7A 3KG1A 2QTWA 1PAEX 4IO9Q 3BPSP 1TR0A 1RJJA 3HJVA 1RYRA 4JI3J 3FSXA 3DKDA 1H6KX 1HWKA 3D5MA 2M7SA 2CG4A 4NLYA 2HBZB 2VFRA 4K4WA 4DN9A 2J0SD 5CH7B 4NZ7A 1J2VA 1N33F 1KP6A 2FQQB 2RB7A 2VFTA 4UY8T 5FDLB 5EDWA 1B99A 3MR3A 1MMDA 2XHWA 2K2PA 2V2ZA 3U27A 3PW5A 1RT1B 4OI0A 4P10A 3DM2A 2BE7D 2DHSA 2B5JB 5GAHI 2W7PA 1S1UA 2A1BA 4DV0F 2R9LA 1FKAF 3Q8VA 2WB1D 4PQUA 1C0UB 2NS1B 1RI7A 4IYQA 2DBBA 2F3JA 4J9MA 2PA3A 3IG1B 3V2UC 1T3NA 2O01C 2DNRA 4U67Q 3MEEB 2D69A 1J5EF 3UQSA 1UWBA 2CQCA 2WOMA 4CTAB 5F0UA 1LXNA 3EGNA 2RKIA 2VBXA 3N6MA 3DI6B 3KJQB 2BJ3A 2R2SA 4P74A 2BJEA 4QJVA 5IXUA 2LEBA 1T3OA 2PT0A 2UVVA 7FD1A 5F8MA 2MZQA 3JSMB 1S5ZA 3V6HA 1NB2A 4N56A 4BWJA 4CWBA 3CJRA 3MPDA 4CO3A 1Y4ZB 4RWXA 5GADI 2LQJA 3F73A 2X1FA 1EB0A 5AXLA 2WTFA 2VUGA 3KLVA 5BYRA 3QZ8A 2X3DA 3T9ZA 5DG9A 4J5OA 2IAJA 2F5GA 1S6PB 2VASA 3M30B 4KAIA 1RTJA 2XCPA 1XNRF 1UW9A 1E6VA 3EGWB 3DLEB 5ETTA 3JTPA 1IBLJ 3CTRA 2KVIA 2CJBA 2UXBJ 2YNFB 3CXCR 5L8RC 3CMES 1CJTA 2BANA 3R9LA 2CNLB 3MM5A 4IQXA 4CCHA 3D28A 4NRUA 2GQ2A 4Q45A 3RB4A 4ILRA 3OVAA 1NHVA 3KJVB 1K0VA 1NH7A 3MEKA 2P2CB 2G2OA 3VAJA 4U7CA 3GJTB 1M1KT 3UO0A 2E1CA 4YDXA 2ERRA 3IAM9 2V94A 2J0QD 1U0SA 1PIEA 2JSXA 1MNEA 3G8QA 2F8EX 2V0NA 4CH1A 3UN5A 2A6MA 1NJYA 3E2EA 4C0OC 1IQZA 4AL7A 1JMTA 4DF8A 1HIYA 1CLFA 2DH9A 2E66A 3IGNA 3CC4S 3DLGA 3MCOA 4IFVA 2CJKA 2PI5A 2JVRA 2NUUG 5ETSA 4FKYA 3FMWA 2ZVSA 3MAAB 4O44B 1FWPA 3I82A 4CLWA 4C8ZA 3SFGA 3ZZ0A 3V5RA 2W7OA 2EFNA 1VGYA 5F8JA 5C24A 2D3ZA 3H7HB 1FJGF 2GIQA 3M4XA 3R2DJ 2RNEA 4ZVTB 3CD0A 2QL5B 3L95X 5HVFA 2OI2A 1S48A 4ED4A 4PG4A 4LF7F 2JFKA 1FO1A 1TL3B 1X4CA 1G4CA 4WU2A 1Y3KA 5D0HA 4FNHA 1PC4A 3ZTRA 4OZ2A 3PRBA 2J9CA 1T94A 1HNZF 5A76A 5CYQA 4KO0A 2ZHOA 4DL5A 2JLEA 3GSIA 4Y2CA 4NCGB 4QZVB 1PILA 2YQ1A 1VYAA 4YR0A 1UA0A 4C8NA 5I3UB 3W62A 3IXQA 3QSYB 2QLBB 3D6FB 5K5MA 2ZC4A 3DDNA 4JBCA 3ZZUA 1FNXH 4RNHA 4YB6A 1D09B 1RAFB 3VQSA 1QE1B 2FHKA 3OVSA 4C3KA 3CCSS 1S1TB 3RBEA 1HMVB 2FZGB 4DV5J 2J0WA 2HHHJ 1RISA 4NOHA 1S97A 4LSLB 1T05A 4WFAQ 3UI3A 4DR7J 3G87A 2JC1A 3RR8A 4WE1B 2FB0A 3BZQA 1HI0P 4WKYA 1H74A 3V6DB 3EE3A 3DDKA 2YNGA 2ZOMA 5IC6B 3HD1A 1N4LA 2ZZMA 3RW7A 4USUA 3MI7X 2C3UA 4AE5A 3D0GE 1RLCL 5DQGA 2XY6A 4HH1A 1MU2A 4IG0A 1GQEA 3K17A 3I5AA 2C3YA 4ES2A 1TFWA 3PYDA 1RT2B 3DXSX 1XMQF 5KFEA 3TVZA 1WC1A 2CPYA 3MR2A 1IBKF 5JMNA 3KLEA 2IM1A 1YI2S 2LU2A 4ZDNA 1F9HA 3PW2A 2LCWA 3K89A 1N5TA 5ETMA 1KTVA 2NXCA 2DR5A 3OL8A 5DGBA 3I5BA 2EC2A 4F25A 2B43A 3MM9A 3CMQA 2PEHA 4GO5X 3Q89A 3I0RA 4ZVGA 2UVUA 3WQPA 4GC7A 2DKOB 2PSZA 2MSTA 1DQAA 4RW6B 4Y34A 5F8HA 3NBPB 2AQ4A 2OP5A 2XO7A 1GX6A 3UNGC 2J9DA 1U2CA 2DGXA 3R6LB 4DCPB 2R2RA 3LP2A 5DLGA 2MY7A 2HNYA 4C2MA 4DPTA 3CDEA 3TAMB 3TZYA 3FSYA 2W2NP 4P7VA 2MKSA 4ICLB 2GO8A 2JEFA 4NX9A 4QWDA 4EO6A 1RT7B 3MZIA 1RHRB 1BWEA 3KYLA 3A8EA 2IMWP 1F5BA 1ZAVA 1BQNA 4F4ZA 3HVTA 2GNKA 1IBCB 1NK9A 3OVBA 2Y8YA 2WONA 2XNRA 4WWSA 1S99A 1RU1A 1JLCA 2QA1A 3SDEA 3ZTSA 3AA8A 1OWXA 3LO3A 4RW7B 1D9DA 2E5GA 3TR5A 4HT7A 5ETNA 2BRLA 2ZD1A 4TYBA 2WW8A 3CULA 2K1RB 1C2PA 1SIWB 1WELA 4ITSA 4M5HA 3NXZA 1RAJA 3BR9A 5GMKa 4O3PA 2AYGA 3M8ZA 4TU7A 4RW4B 4GKKJ 3NMAA 4HACA 4AYBD 3NCPA 1JLGB 2APOA 1Z2ZA 4E8UA 3Q8UA 4U7UD 4NYOA 5ETPA 2ZNZA 2G0JA 4OI1A 4KPYA 2HIQA 3POTB 3C6TB 2W9BB 1K73T 3ZFVA 4QYZJ 4PXCA 2W24A 2BZ2A 2QFJA 1HNWF 2MZ1A 5HROA 4OI2A 3RJMB 5KAKA 1W2BR 4HKQA 1WKLA 1GMWA 1MROA 1TAUA 4X4QA 2XMAA 2VA3A 4FVCA 5IWAJ 1C1BB 1H0HB 4ZVFA 3DRPB 1VQPS 5I4MA 3E3XA 1FRIA 2YH1A 3V81A 2VH7A 4LF9F 3SSQA 4H4MA 4LRDA 1RT4A 3HKWA 3ET6A 4LFCJ 1FTRA 5F9NA 3EGVA 3CJQA 4G1QB 2DK2A 2KFYA 3DYAA 4LFBF 4KKOB 3PACA 1NK0A 2OH2A 3DOMB 3OTBA 5DG8A 1S9EB 3BSCA 1IJFB 3KLFA 5EUHA 5KT3A 2XM3A 3NGDA 1RAIB 3DLKA 4KHPJ 5LSLA 4ECTA 4NLOA 3QNWB 3H2UB 1WF0A 3OR2B 3SCJE 1P27B 2HPUA 3A8IA 4DXLA 2XY7A 5K8MA 2F1FA 4I69A 1S0MA 3K2YA 2L48A 4BWMA 5A8KA 4ZVQB 3GG1A 3D6HB 3P96A 3RB6A 3SBMA 4DV4F 1R0AA 1JLAB 3FEZA 4JI8J 3QLHB 2XCAA 3RB3A 1WOSA 4EZ9A 3AJ1A 1T02A 5CHCB 4LIWA 2Y0BB 5H9EK 3HHLB 3N5FA 4XDDA 1S1XA 1SKUB 3B82A 2E1RA 4R25A 4WZMA 1SQFA 2XMMA 5L1KA 4LT6A 5GAGI 4RUCA 7AT1B 1FJGJ 3MR7A 2YWEA 5KFTA 3HX9A 4Z2XA 1TL1B 3R5DA 2DPJA 4KFBB 3EUNA 3TJAA 2BYCA 2YH0A 1R89A 4TLQA 4CLKA 4MFBB 4I68A 3OL6A 2XNQA 2BR0A 1TKZB 2G0IA 5KFUA 1U0HA 1SL1A 1XR7A 2BMBA 4NXNF 3CJKA 3ENWA 1HNZJ 4DX6A 4ECYA 2V4JB 1IR0A 2I5JB 1XMOJ 2R4FA 1RKIA 4ZVUB 4DX8H 3MM7B 3M9OB 4ZIVA 4DV3F 1EJ7L 4ZHRA 2W8LA 4X4OA 2DJWA 2IA6A 1RBAA 3L9ZA 3DRSB 1TFYA 4B17A 4G6VB 4DSEA 3FK4A 1WJ9A 3JS9A 5HBMA 3LANA 5AXMA 4JYAJ 3GIJA 2VBYA 3OSNA 4DZ6A 3CJ8A 3QO9B 1HQUA 1UWAA 2VU5A 4JI2J 2LMIA 3OXLA 4KGVB 5I3PA 5J2PA 1RB0A 3KMSA 2R8JA 5L39A 2XMUA 4UQGA 2R7WA 2GX8A 4Q0BA 3NGUA 3LPEA 9RUBA 4KV8A 1RWUA 3K5PA 1KD1T 1F5CA 4LQ9A 2ZH9A 2CQBA 2DH8A 2FJAB 3OFFA 2C2OB 1VQSA 3W66A 5ITHA 1L3SA 2F40A 4ER8A 1HNXF 2KL8A 4B9UA 3FRZA 4HHHA 2KTQA 2GIRA 1UMJA 1XMQJ 1YBUA 1IBKJ 2HNDA 2BQRA 4A8YA 3ZC4A 1PAUB 3GPAA 1SUQB 3I32A 5K20B 3Q24A 1VQ9S 3O6QA 2R7XA 1S1WA 3D1HA 2E29A 2DR6A 2R2TA 3QAUA 1PKUA 3MOJB 2DTJA 3IR7B 1UEUA 4HI1A 2VC0A 3U02A 2MGZA 3M32A 3FQLA 4ZLLA 2DR7A 3D68A 2CJ9A 5T7LA 5E5NA 2DB1A 2KT2A 3WC2A 5D4LA 4ED2A 1EZZB 4NLVA 4FPRA 1CC8A 4ZPCA 3H40A 1KFSA 4F26A 2F9JA 2PD1A 2QLJB 4YY3J 2GMLA 3N6LA 1L3UA 3C3LA 2H54B 3ENVA 4PXBA 4NRTA 4ZVSB 1ZOTA 4EU0A 2XG8A 3CC2S 5AJ3F 3CC7S 4ALZA 3VGSA 4DDFA 2CPEA 2LXUA 1R27B 3JYTA 2DCUB 4ENOA 4X64F 3TW0A 2AYEA 1XMBA 2FZKB 1DARA 3UCGA 2PO4A 1CG2A 1N5YA 3KHGA 5DM6Q 5D77A 1WDTA 2AV5A 2LA6A 3DGVA 2DNYA 2ZBIA 1W25A 3G9CA 4CO2A 3KOAA 1GTHA 3A13A 1TUGB 2RQKA 5HSPA 2CZ9A 2KU7A 4FF1A 2EI5A 1NKEA 3OHBA 2O66A 1UCNA 3W3SA 4OZJA 1KR4A 1Q5YA 4PABA 3CJSA 4N76A 2ZH2A 3N28A 3KK3B 1SQEA 4ED1A 4UUWA 5B0EA 2HGLA 5D4OA 4KGKA 3WC0A 2D9OA 3UR3C 2DNKA 4XO0A 1IVZA 1RA7A 1PJ7A 3EM1A 2H4YB 1NH8A 2HW3A 4P75A 1DTQA 3VAGA 1IR2A 4V19J 2GAHC 5K8OA 4UOHA 3P49B 4FBUA 2ZNYA 1RTHB 2AGOA 1VRTA 4YMEA 5KFQA 1JJ4A 5KFHA 3KNGA 3THTA 1S57A 4F7VA 3PKYA 2UUBF 4RNFA 2YQ0A 4DPXA 2Z2YB 3MFHA 1VC6A 2DNQA 3A3PB 1QAJA 2CJAA 2OEMA 2W2PP 4ZPVR 1CJVA 1QVFR 4B3SF 1PCAA 3VALA 2KB2A 1URRA 1S79A 3PO4A 3QZ7A 5I42A 3DOLB 3RU0A 3GG0A 1S10A 4LFBJ 2ZBQA 4M5IA 2R7TA 1RHKB 1FX2A 5HLFA 1TK5A 3TUIC 2N7YA 3CB4A 1M5PC 4NLGA 1UFKA 2MHEA 2LLZA 1WG1A 4J9SA 4RR5A 4OHXA 5F8NA 2AJ0A 3RW6A 2J8AA 2FHOB 1MG7A 3I31A 2N4DA 4YHHJ 3H5UA 1N52B 4QWCA 3R5JB 1J27A 3LP1B 4WJBA 3FBEA 1HD1A 4Y2IA 4Q8FA 4TU9A 4CIOA 5JJBA 2WVDA 3T5HA 3HFZB 5HO4A 2QLWA 2FVRA 2KXNB 4J37A 1NPPA 4DFPA 3VAIA 3MPUB 1RTJB 1GXTA 4UOFA 1P9YA 1Q8IA 2WZ1A 3FDSA 2VQEF 2HQDA 3V6KA 5H9FK 1M1GA 1X31C 3EZUA 1IKXA 1XEZA 3RBDA 2YX1A 5KFFA 2OTJS 2BANB 4WBFA 2KH9A 4NMLA 3IWXA 1QM9A 2H5EA 3ZTOA 1BQMA 4WKRA 1EKRA 2BBEA 3AJ2A 4CT9A 2ZWOA 2UXDF 2EKYA 3LQVA 2V63A 4E98A 2QSFA 2DRDA 2WSCC 1LWFB 3P3DA 2Y1JA 1HNVB 4I0WA 4NXNJ 1RWMB 4PWDB 2BEFA 2VOPA 3W2VA 5J1PA 1GMVA 3EX7B 2HZAA 4B08A 1FKOB 2QIFA 2HBYB 1NJIT 1JLBA 2JFDA 4DV3J 1X9MA 1E6YA 1EARA 5KG4A 3SCKE 1S9GB 3HSZA 5J1EA 2RAQA 3GWCA 1DLOB 3R5CA 1V3SA 1VJWA 1Q78A 2V68A 4IFVB 4BHQA 3PYGA 1CVJA 2FUG9 3P45B 2LVWA 3VZIA 4KQZA 4R0JA 3K5NA 4JI6J 2BW7A 1YZ6A 4AFFA 3JXOA 3H2LA 4LMZA 1HBUA 4DL7A 4B9MA 3G71S 1FTCA 1SI9A 5A2QY 4ECWA 2VJUA 2O1PA 3OLBA 1GXUA 2CPFA 2OEKA 2DEJA 1NK8A 3GR1A 2HFZA 1BC6A 2CG8A 3BH6B 1VBKA 1HQEA 2DHXA 3CNQP 4LRFA 2OJ3A 4WTOB 3MTJA 4DSFA 1HNXJ 3W2WB 4FZVA 1DAXA 4KO0B 4CH7A 1WSVA 3E01A 2L9DA 2HIYA 3BYPA 4USKA 3GE9A 1JJHA 4OJ3A 1JJ2R 5LOQA 1FRMA 2ILYA 2NQPA 4ELUA 1FD8A 4JI7J 3NL0A 2GO9A 1JXLA 3UR0A 3GQCA 1T11A 2W8KA 2R7VA 4WYWA 1LWCA 3CEDA 1NLKL 4OMFG 3Q8PB 1N32F 1VQLS 5FDLA 1W2IA 5A0YB 1S4FA 1HBOA 2G9OA 2XWXA 1VQ6S 4Y00A 4OLOA 1RT1A 1T05B 2W4DA 5BJRA 4DR4F 2ZDOA 5D4NA 1S72S 2B56A 4LJMA 2B5JA 2WK4A 1YZ7A 1WTFA 3F0NA 2NREA 2HVDA 2JEJA 5LSRA 1RHJB 1C0UA 4FN5A 4X84A 2YWHA 2DISA 4ZCLA 4I6WA 4O3RA 3VR1A 4LF6F 1PJ6A 1KRPA 2FIUA 2KG1A 1WI6A 3IG1A 5ETOA 2OSQA 3DU5A 5AJ3J 2HHTA 1MU2B 4IG0B 1G6BA 2D3UA 4CTAA 3TZXA 3NEKA 3CCUS 3PEHA 4MK8A 2V34A 2ZBCA 5BXIA 4X64J 1X60A 1IM6A 3KLEB 4ZLNA 1NJZA 2ROGA 1R6VA 2KG0A 2EEYA 3CD5A 2Z56B 4IO1A 2QT7A 4FP9A 3JSMA 1TL5A 3IWNC 1WEYA 2QSWA 4WP9A 1ZM3A 3J7YI 5IT4A 2D74B 2X3GA 1FE4A 5IV3A 3L7PA 5DGAA 3CDUA 3U1NA 1U1PA 3PIPQ 2MQNA 2U2FA 1PYTA 3ELHA 1RADB 1QSLA 3M30A 4QWEA 1SJRA 2IIHA 2HNYB 3MR5A 4F3QA 2AD9A 1UEVA 1YVFA 4UZCA 4K4SA 4PPDA 5F0WA 3WX4A 2YNFA 1IUJA 2IYGA 3C14B 3W9HA 2EFPA 4P72A 4CLTA 3MDFA 3PCOB 3CO9A 4MH8A 3OTOF 3G2XA 2KYZA 1HWLA 4DV1F 1NDCA 5THWA 4TN2A 1UTAA 3M2UB 2QC3A 2UUCF 1QSSA 1KONA 1HWUA 4NLPA 3M9NB 3RZAA 3T5KA 1RYSA 3M1VA 1WF2A 1UVKA 4HDHA 2AJ2A 4OX8A 3SDEB 2ZH7A 4ES3A 4PR6A 3BKUA 2Y1IA 4ED3A 5LM7E 2QL7B 3AQPA 2W9AA 4KTQA 4IRKA 2QV6A 2CQ0A 1BXNA 2KT5A 3ENQA 2BABA 4F0MA 2WVEA 1N54B 3TRGA 1UJ6A 1L3VA 3IM8A 4P73A 4QIWD 1SH3A 2LQ8A 1GT8A 3RRKA 3BB5A 2RF2B 1AXQA 2AU0A 5IC4B 3MAAA 4X4VA 3UDCA 4I2QB 4UUXA 4MYTA 1NZ8A 1LW2A 3T41A 1X5PA 2E7VA 3R1HA 3EXCX 4Z7CA 1DJ0A 1VQ7S 4RU2A 1U26A 2MKCA 2DHGA 3G8SA 1TL3A 4EBEA 1WI8A 1ZA2B 3EZ5A 4C8OA 2ALYB 2KZMA 2DXEA 1MROB 4LVOP 3PG9A 2YQ3A 3KG0A 5E3RA 3N79A 4F36A 2OMOA 1YJTA 3TYTA 1HW9A 1F3FA 5CCMA 1UL3A 2WAQD 4DR1F 1VBYA 2QA4G 2KRRA 1UAWA 3BN4A 3MPYA 3IO1A 4NCGA 2ASJA 1N6QB 1RAOA 3K8VA 4NWBA 5I3UA 3K58A 1QAYA 3ET6B 4X65F 4PEOA 4C8MA 4DUZF 3NP5A 2IFXA 3DYAB 1MN7A 5F41A 4W4MA 2X1BA 1VQKS 3I55S 4EBDA 5BR8J 1QE1A 3NGKA 1RXOB 3MMCB 5CYMB 1Y5IB 3KLFB 4IG3A 3K8WA 3CO0P 4HTIA 2UXDJ 1HMVA 2OFGX 3CD7A 3MCSA 4LSLA 3DLKB 4CLFA 2H4WB 2YKNA 1KLMB 3T1HJ 2RRAA 4MK7A 2RT3A 1PO6A 4DL0C 1BD6A 5K8PA 2QYGA 1VI7A 4CM0A 4USMA 4EYHB 4WE1A 3PJ9A 4Q5VA 2MYFA 4NCAA 3PKMA 4LSNA 3KDNA 3V6DA 3L09A 4J9RA 2J6UA 4DR2F 2CQGA 1JXEA 4ZLJA 4Q2MA 4OHVA 1YJWS 1DBDA 2HQGA 4JP8A 5J2MB 1OY9A 1X4BA 5KG5A 4F8RA 1O8BA 4DS5A 2AYBA 3ILLA 3OLAA 2X51A 2VA2A 2RMLA 3V4IA 2RRBA 4IQMA 4YR2A 4X66F 4ZMMA 1MW7A 1G2EA 3LA0A 1YJNS 4DI6A 1H7XA 1QAIA 3QIDA 4I7FB 3D7SB 3T1AA 1T9XA 3WBZA 4AD6A 1RAEB 1RAGB 2HFNA 4USVA 2AT1B 4LF8F 4OV1A 5D6GA 2MZSA 3KK1B 3IN5A 4RW6A 3NBPA 5ETRA 3AT1B 3DGPB 2KKHA 2QL9B 3H25A 4NEZA 2VOOA 2JJ4D 2IM2A 2F4VJ 2L9WA 2HYIB 2HWHA 3IFEA 2GJ2A 3OJUA 3AOAA 5IT9U 1U02A 3M9MB 2NZCA 1WHVA 2CPJA 2LQ5A 3NNAA 1KS2A 2EG1A 3NWRA 1IKVA 4CP5A 4ICLA 3LAKA 3HCXA 5KFLA 5HBMB 5HVHA 1RT7A 2RS2A 3H5SA 2LA4A 4KR0B 3UD5A 4GVBB 4WP3A 2FLLA 5ETKA 2QX0A 5J2PB 4C7QA 4KH0B 1D8ZA 5E3PA 1Y0HA 3BBBA 3D0IE 5HATA 3SV3A 1UZDA 2I1RA 4NYZA 1SJFA 3OR1B 3OFHA 3QSIA 3HT3A 3K57A 2IVFB 2J0XA 2RHQB 1I5OB 1YRUA 2OFHX 3BKFA 1H2VZ 2J7UA 2IYIA 5KFJA 1VJQA 4PYAA 3SCIE 3S6EA 2XGPA 3R6GB 2OEJA 4ANCA 1NSPA 4DQSA 4KGXB 2F8HA 3NGSA 4H4KA 5HI7A 3FUYA 1JLGA 2K3IA 2IM3A 3TVYA 4DX7A 3ZZYA 2FJEB 3FC9A 1X4EA 4MKBA 1GTEA 4LRBA 1ZYQA 4OYMA 2HHWA 3IGVA 1NSKL 5IT9Y 3NGTA 3ZNUA 1K47A 3HI9A 5T7LB 3W5XA 2KHDA 5B0GA 4EI2A 2UUWA 2MLYA 2CIMA 1P6TA 2ZH6A 5J1NA 4R8UB 2E5LJ 3G86A 3OTCA 2BOPA 5LMUJ 1HR0F 2BE9B 4F0KA 4J9QA 2DXDA 3FZ2A 1VIOA 4ECZA 5D0GA 5IM0A 1M1HA 5E0OA 3TZWA 3BS9A 4G3IA 1RT5B 2V50A 3KUEA 3WDOA 3OTOJ 1M90T 4KKOA 3DOMA 1XNQF 8RUCA 3F41A 1S9EA 2V2VA 3NOCA 1GMWD 4PWWA 2YX7A 3N9UC 2GHWA 1FRKA 3BPDA 4LF1A 3IR6B 4HTJA 1N5YB 5GAEU 2UXCF 4RBUA 4JI5J 2RVJA 3OR2A 3DLHA 1TUVA 3LP0A 2JX2A 1L3TA 4MKYA 3BSNA 2BKNA 3X3UA 4C11B 3UNYA 1RGVA 1N0VC 3A4TA 2IDLA 4FYYB 1YGYA 1TQLA 5D3GA 4K4ZA 4KY3A 3DU6A 3FVYA 4YS2A 1EHWA 2BUNA 4EGLA 1JLAA 3QLHA 3W8PA 1CBKA 1X4DA 3LOUA 1FXDA 3MCMA 1ACMB 3HHLA 1D3WA 4NMXA 3R7SB 2XS7A 1C1CB 1HHSA 3KXDA 1CJUB 4X62F 3DMJA 2BJ9A 2VKRA 4A8QA 2D7SA 3MF5A 1UZHA 1IM4A 4KJIA 3TJ8A 3F56A 4DBQA 1X5OA 1NAQA 2NXUA 3PTWA 3SI8A 1IBMF 4KFBA 1JLEB 5H9EJ 5ETVA 2MKHA 1PYOB 2R7UA 1ZTTA 4OYZA 4C3MA 4K4YA 3UPFA 2DGUA 4K50A 4MFBA 1M5KC 1XBWA 3CPWR 1KQFB 4QCLA 1GFWB 4QYRA 4PQAA 3NCRA 2HFOA 1TK8A 4D3GA 1SC6A 2DNLA 4NI2B 2V4JA 4HHUA 2I5JA 3BO2A 3RR7A 2VV5A 3P4UB 2K3KA 1CJVB 3FSIA 4ED0A 3NRBA 2MY8A 2MTLA 2XY5A 3AHPA 3DRSA 3PJWA 1NJXA 4DL4A 3RYLA 3GP9A 3C6UB 5KG1A 2ASYA 1YK9A 4QQBA 4RL1A 2CNKB 4DV7F 4U8VA 3GIMA 1ZZFA 3KK2A 5HLFB 2MLZA 5JUMA 4ECSA 2ABYA 4Q43A 3QO9A 4OYBA 3NS6A 3W5YA 4NASA 1RSCA 1Y9OA 2HHQA 1YTYA 4KGMA 5B08A 3BGRB 4HDGA 5EN1A 3KLHA 1XR6A 1U4BA 3BN7A 1Y7PA 2Q1LA 3LGMA 5L1JA 3BR8A 2XLKA 2E44A 2HS3A 3TA2A 4OI4A 2IBOA 2XO6A 4DR3F 1K9MT 1NK7A 1DHMA 3AD7C 2HQFA 2Q43A 2XMTA 1I1GA 2LYVA 3AQOA 4MIBA 5C25A 2ZH4A 1KOHA 2XHCA 2PFFB 4OJ1A 2C2EA 4WK1A 4PUOB 2HK2A 1TP7A 2XEXA 1SIZA 4I2PB 1PG5B 4DR5F 2G1HA 3ZZOA 2AEJA 1I6JA 2EFVA 5DQIA 1Q8KA 3SXLA 3FMBA 2YKPA 2HQCA 1SUQA 2UZAA 1K1SA 1UA1A 1FJCA 3NNHA 3CD6S 3PHEA 1BQMB 2AYMA 4ZVEA 1LK7A 1SB6A 4DV6F 4F4AA 3M6WA 3BV8A 3T1YF 3OTDA 2FJDB 3CCJS 2FPHX 2YWKA 3Q86A 1MMNA 4ZJLA 2HBQB 1D8YA 4MTPA 5DZ6A 1U6BA 3ZO7A 3GIKA 3GB0A 3QQCD 4NXMF 2CA9A 2G2YA 2ZHBA 2FVQA 2CJXB 3AJDA 2GCFA 4WFXA 1FT8A 3KMQA 2ZZTA 3QT8A 2A10A 3MAHA 1E6YB 2FD2A 4OIXA 1UPPA 3HZGA 1IWGA 2KXFA 1S4EA 5DS7A 2W4PA 2XI3A 3CCZA 3ITHB 2PI4A 5ADZA 1A7GE 3PX6A 3ILJA 2RH3A 2Y1LB 4ED7A 1XQIA 2GMJA 2VG6B 4YN3B 1REGX 1HPZB 1Q79A 2Y1RI 3HVRA 3ZXWA 1QUPA 1GH8A 1T0TV 5HVGA 3MWBA 1XWLA 4U9RA 1TMMA 3OSPA 2EVZA 1BY9A 1IQTA 3L3CA 3JAMY 4ZCKA 3C46A 3W65A 5CCLA 5DDQC 4QPTA 1KQGB 2VPYB 3I6PA 1F5AA 4UY85 4F4KA 1FFWB 3JSBA 4KHMA 1SC1B 3GILA 1HBMB 2IDEA 3H4DA 1NDLA 1BWVA 1U2RA 4JI0J 3H98A 3KK3A 4LR9A 3E01B 4ID5B 4LFAF 3TUPA 1MMLA 2A0FB 3A8KA 5AE1A 4CLPA 2J7KA 2W01A 2CJQA 3SZ2A 1TZ0A 4X4UA 3T5LA 4IOAQ 4NZ6A 1URNA 1SL0A 4DPUA 4NYPA 4FVMA 5GAHU 4NLRA 1LWCB 1RCXB 1RTHA 3ISND 2FLNA 2H5JB 2RDJA 1AROP 1HBOB 1VRQC 4DMZA 1X5TA 2XSJB 2RE1A 1J5OB 4O23A 1GMUA 1GXLA 3QAEA 2IRUA 4Z7YA 1YSJA 4RNNA 3O8WA 4J9OA 3QGIA 1R8HA 4LBIA 1LK5A 5KFDA 3CVKA 4CLSA 4P7TA 1FFSB 4RUHA 1FVQA 2XMVA 5A6PA 1HR0J 1F6TA 5ETQA 2UVRA 4RJVA 2A2DA 5KFPA 2V8VA 2DR8A
chains in the Genus database with same CATH topology
3HCXA 4CWBA 1CBKA 1RU1A 4M5KA 2BMBA 1EQMA 3HT0A 2CG8A 2F65A 1DY3A 3KUEA 3MCNA 3KUHA 3ILOA 1G4CA 1HKAA 4CYUA 3ILLA 1RAOA 3MCMA 1TMMA 3ILJA 4M5HA 1Q0NA 4PZVA 5ETOA 3HD2A 1F9HA 3HSZA 3MCOA 3QBCA 1RTZA 3HSJA 5ETRA 3UD5A 4M5GA 4CRJA 3HSGA 3IP0A 1IM6A 4M5LA 5ETTA 5ETQA 1HQ2A 5ETSA 1KBRA 1EQ0A 1RB0A 1RU2A 4CYUB 3HD1A 5ETMA 1TMJA 4M5NA 3HSDA 1EX8A 5ETVA 3KUGA 4M5MA 5ETPA 5ETNA 4AD6A 5ETLA 4F7VA 2F63A 4M5IA 3UDVA 3ILIA 5ETKA 3UDEA 4M5JA 2QX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCX A;  4CWB A;  1CBK A;  1RU1 A;  4M5K A;  2BMB A;  1EQM A;  3HT0 A;  2CG8 A;  2F65 A;  1DY3 A;  3KUE A;  3MCN A;  3KUH A;  3ILO A;  1G4C A;  1HKA A;  4CYU A;  3ILL A;  1RAO A;  3MCM A;  1TMM A;  3ILJ A;  4M5H A;  1Q0N A;  4PZV A;  5ETO A;  3HD2 A;  1F9H A;  3HSZ A;  3MCO A;  3QBC A;  1RTZ A;  3HSJ A;  5ETR A;  3UD5 A;  4M5G A;  4CRJ A;  3HSG A;  3IP0 A;  1IM6 A;  4M5L A;  5ETT A;  5ETQ A;  1HQ2 A;  5ETS A;  1KBR A;  1EQ0 A;  1RB0 A;  1RU2 A;  4CYU B;  3HD1 A;  5ETM A;  1TMJ A;  4M5N A;  3HSD A;  1EX8 A;  5ETV A;  3KUG A;  4M5M A;  5ETP A;  5ETN A;  4AD6 A;  5ETL A;  4F7V A;  2F63 A;  4M5I A;  3UDV A;  3ILI A;  5ETK A;  3UDE A;  4M5J A;  2QX0 A; 
#chains in the Genus database with same CATH topology
 4ZIT A;  2BJ8 A;  2LKZ A;  2LDY A;  4E0D A;  3T9N A;  4B3T J;  3KHL A;  2C2N A;  3DOL A;  3TZZ A;  4DUT A;  1SCJ B;  2YVS A;  1XNQ J;  4NA1 A;  3U1L A;  1YHQ S;  2RJZ A;  5GAD U;  1IKY B;  3A3N B;  4ZJO A;  3T19 A;  2GIF A;  4V1A k;  2CQ2 A;  4FXW A;  1FES A;  1C4A A;  3E51 A;  4I6Y A;  4FDF A;  2BQU A;  4GVL A;  2LEC A;  4EEY A;  3DHW C;  3AOD A;  5B0D A;  2H9Z A;  1FJE B;  2KO1 A;  5B0B A;  3LP1 A;  2OKQ A;  1CJK B;  3NAH A;  4B3M J;  1OIA A;  1T9W A;  3AD8 C;  4Y6I A;  4N8O A;  1H2U X;  1VMB A;  4ZVO B;  1YKW A;  1HYS A;  4DEZ A;  3JB9 k;  2P6T A;  2NCK L;  4BS2 A;  4QU6 A;  2ADC A;  1H98 A;  3R27 A;  4W98 A;  3OXG A;  2GGP A;  1G3O A;  2MDA A;  1B3T A;  3CT9 A;  2HK3 A;  2XLJ A;  3CCQ S;  2YXL A;  1N8R T;  4RNM A;  5H9F J;  2E9T A;  3DXB A;  3KHH A;  2MQO A;  5G0R B;  3B4M A;  4UQT A;  1LWF A;  4A8M P;  1HNV A;  2AZ3 A;  1NK6 A;  4PWD A;  1U1N A;  1S59 A;  1Y5N B;  3M1V B;  3PX4 A;  4ID8 A;  1HNI B;  5A8R A;  4DU8 A;  2Q6B A;  3HUL A;  4CO0 A;  1U24 A;  1JKH B;  1FKO A;  2EPI A;  2VDI A;  1UFL A;  4IH7 A;  3EVW A;  1RUS A;  1RT6 B;  2CQ1 A;  1F2H A;  4ED6 A;  2VOD A;  1S9G A;  2IPO B;  4F67 A;  4H4O B;  2FDN A;  1DLO A;  3TA0 A;  4ZKA A;  4RW9 A;  2VQF J;  1KNZ A;  4CYU B;  5GMD A;  1LW2 B;  1T8E A;  2FC9 A;  3FEX B;  4QWA A;  2DY1 A;  3H0P A;  4HL9 A;  2ZOG A;  3RG6 A;  3HVA A;  2WBM A;  1ICE B;  2QFI A;  1RTD A;  2B4V A;  3DNC A;  1AFI A;  3GZ7 A;  2VBW A;  4JV0 A;  2JNJ A;  1FX4 A;  1RE1 B;  2ZH5 A;  3TEH B;  2OSR A;  2RHS B;  2MXY A;  3UCU P;  3VWS A;  3D4J A;  4DPY A;  1NBE B;  2B0G A;  2B9W A;  1RWO B;  3GJQ B;  2RQM A;  3TUZ C;  3OFG A;  4O4G B;  3R5G A;  3W2W A;  2C3M A;  2AMC B;  2UUA F;  1SKW A;  5KFS A;  3PX0 A;  3PW7 A;  1QDU B;  1RAC B;  4F3M A;  3OUY B;  2BM0 A;  1X9S A;  4YOE A;  2Q79 A;  2ZBR A;  3UD4 P;  3Q8Y A;  4A8O A;  2EWH A;  5CAA A;  3M8W A;  4RBT A;  1VR6 A;  2V2K A;  3UE2 A;  1SV5 B;  4A46 A;  1WG5 A;  3GSD A;  1H7W A;  3TX0 A;  1T03 A;  3JTO A;  2DO4 A;  4DV6 J;  3O44 A;  4R5P B;  5B09 A;  1ZAW A;  4IG3 B;  3T1Y J;  2KJV A;  3C66 A;  1OSD A;  5A0Y A;  2DPI A;  3QRQ A;  2P9C A;  2RQC A;  1O5J A;  4PXD A;  4AQY F;  1KVJ A;  4N77 A;  2YKN B;  2D3O R;  2J8S A;  5L1I A;  4TY8 B;  2SXL A;  1DZ5 A;  3PRV A;  2W2Q P;  4L6V 3;  1LOU A;  4FXD A;  1G7C B;  1FVS A;  2M0G B;  4NXM J;  1VC0 A;  3GFX A;  3MR6 A;  2JC0 A;  2R7S A;  4TNO A;  4OX9 F;  4LSN B;  2PA8 D;  1WUU A;  5HMX A;  4DQR A;  4LUB A;  2P5V A;  3MED B;  2IJF A;  4HYK A;  2OPR B;  2M88 A;  1FJ7 A;  3KUH A;  1JK9 B;  7FDR A;  2GC8 A;  3CJ5 A;  5DG7 A;  1X4H A;  4DSJ A;  1B7F A;  2CNO B;  3V6J A;  3OTE A;  3C19 A;  2GAG C;  3KKF A;  3V4I B;  4FS2 A;  2GHV C;  3W9J A;  2W1B A;  2BKO A;  4J7C A;  2N7C A;  2M3D A;  4K4V A;  4A8W A;  3IM9 A;  3KLG B;  4K0K F;  4G1P A;  3HF5 A;  3VZH A;  1DRZ A;  2EC0 A;  4WYL A;  1MLA A;  2WBR A;  1VQO S;  1RDR A;  2O67 A;  3LWM A;  3TEG A;  2LP4 A;  2QO3 A;  4OI3 A;  3VF0 B;  3W7B A;  4P9S A;  3M8Q B;  3ULH A;  4JV1 A;  2CQ3 A;  2RUG A;  1N5Q A;  4YB5 A;  4ED8 A;  2X7I A;  4JI1 F;  1UJ4 A;  1CUL B;  2AGP A;  1S1V B;  2YPZ A;  4CNY A;  2Y8W A;  4M63 A;  4OX6 A;  2VPW B;  2EK6 A;  4JI3 F;  3LPY A;  2ALZ A;  3FJ2 A;  5D4P A;  1IKV B;  2EK1 A;  4AXI A;  3C14 A;  2UUT A;  3PVX A;  2BA9 A;  4DL6 A;  2R7R A;  2U1A A;  1LWE B;  1N33 J;  3U7J A;  5M2P A;  3EVO A;  4DG1 A;  4FF3 A;  3M2U A;  3HDS A;  2Z30 B;  1AUS L;  1SJQ A;  4AUK A;  1WHW A;  1Q1K A;  4ECX A;  2FLO A;  3SQO P;  2CQ4 A;  2CZV C;  1TVR B;  4KBI A;  3QFH A;  2GZO A;  4DV0 J;  2HHX A;  3D6T B;  3NS7 B;  4H54 A;  3OBI A;  5F8L A;  1D9F A;  5HQM A;  1NZA A;  2DHA A;  3RGI A;  3S8S A;  2ZVI A;  3R97 A;  3DN9 A;  1NM2 A;  5KT7 A;  1U1L A;  1J5E J;  1FFG B;  3QRR A;  2Q66 A;  4YUD A;  3AOB A;  2E5I A;  2WVC A;  2RF2 A;  4R0E A;  1UP1 A;  2CDQ A;  2VKZ G;  2CPX A;  2OGU A;  2YPY A;  2V8H A;  4I2Q A;  3UDL A;  4DJB A;  1EP4 B;  1SJ1 A;  1TV6 B;  2NZ4 A;  4FPI A;  3RAM A;  4NZ0 A;  2JOQ A;  3JSY A;  4B9L A;  4WF9 Q;  4KB7 A;  2R8K A;  1K1Q A;  5HP1 A;  5KG3 A;  4A8K A;  3RRG A;  4ZA1 A;  1S6Q A;  3BBC A;  2EFQ A;  4A8S A;  5LT5 A;  4DFK A;  1LFW A;  2O3D A;  4OZ1 A;  2YTC A;  4N8N A;  2HRY A;  3R3T A;  2ASD A;  3MGJ A;  4JB8 B;  3NY0 A;  2XZD B;  4DCJ B;  4ECV A;  4YEA A;  2GV1 A;  2FLP A;  3T6J A;  1XNR J;  2K06 A;  3B78 A;  2XBP A;  1YIJ S;  4WII A;  1GAO A;  1N6Q A;  1A6L A;  3EGZ A;  1EET A;  2NPF A;  2HGM A;  2UXB F;  4I1T A;  2LU1 A;  3M05 A;  2NYH A;  1N36 F;  5IM0 B;  4KIA A;  3M2V B;  2VIC A;  1RKJ A;  5FD1 A;  2A6O A;  1X4G A;  3CCV S;  2DXF A;  3MMC A;  5CYM A;  1HD0 A;  2VF3 A;  1HL6 A;  2G2Z A;  3OJS A;  2VDH A;  3CF5 Q;  1ZAX A;  4QWB A;  4J9N A;  1KLM A;  1NND A;  1WAC A;  4K2J A;  3QRP A;  4IKA A;  5E3C A;  1W26 A;  3ICL A;  3LP0 B;  1TUW A;  2F7V A;  1N56 A;  3IRX A;  5SUH A;  2MLX A;  3Q0A A;  3RBX A;  2XLI A;  4NCB A;  1X0P A;  2HEK A;  2FJB B;  5EHH A;  9ATC B;  3GON A;  5D3G B;  4QR1 A;  5KG7 A;  4CZC A;  5GAG U;  2VON A;  2V2Q A;  4EZ6 A;  2R8H A;  5IOL A;  4BCA A;  3FKB A;  5J2M A;  1WSR A;  1B7Y B;  3LF0 A;  2ACM A;  3CJ3 A;  2CPI A;  2AHO B;  2VFU A;  5H1S V;  2HNZ A;  3M6X A;  2ZHA A;  5KFK A;  2XTJ P;  3DMJ B;  4W92 B;  4C0H A;  4MAK A;  2WB4 A;  1JIH A;  3Q8R B;  3J7A N;  1FXR A;  4FYX B;  3UDV A;  1NCL A;  3CUN A;  2C22 A;  4I7F A;  4LF7 J;  3GTY X;  5L1L A;  4UTG A;  4LR7 A;  1B0V A;  5KOX A;  1BGX T;  3BBF A;  1YBA A;  4YQW A;  3KK1 A;  3EPG A;  2VBZ A;  4ZP7 A;  2F63 A;  2QJ3 A;  2PFD A;  4NLW A;  3KG4 A;  4F4W A;  2W25 A;  1BMQ B;  3DGP A;  1OQ3 A;  3HFK A;  3MMA B;  1WD6 A;  5FII A;  2YWF A;  4ELV A;  2B8P A;  2G0C A;  2UUA J;  1D0E A;  1TKT B;  1Q86 T;  2EBG A;  5IZH A;  4DL3 A;  2ZJR Q;  1BQX A;  4X4R A;  1S0V A;  2GVZ B;  5DM7 Q;  1DTT A;  2PGC A;  4WP8 A;  3MUM P;  4N41 A;  4URQ U;  1PYS B;  3KK2 B;  2J6S A;  4DWI A;  3J7Z T;  5KFN A;  2GHP A;  4EFA C;  3DOK A;  3Q22 A;  4OQJ A;  4N5S A;  2Q6C A;  4GVB A;  3FBC A;  1NHU A;  3OD2 A;  4EO8 A;  4DV5 F;  1VQ4 S;  2MQP A;  2HHH F;  3VVU A;  2NXE A;  4AQY J;  2WSF C;  1KVI A;  1HA1 A;  2V8G A;  2ATC B;  3IA0 A;  2F8M A;  3KLH B;  3M8Y A;  1R8P A;  4ZVR B;  3TAN A;  5E3Q A;  3FBB A;  1RTI B;  3OR1 A;  2UU9 F;  4OX9 J;  1YG0 A;  4UF4 A;  4CH0 S;  2M52 A;  4ZP8 A;  4PXE A;  3PJX A;  4O3N A;  1P1T A;  1KC8 T;  4QIF A;  3AOC A;  4HLB A;  1Y5L B;  5C25 B;  3EZO A;  3CJ0 A;  5DET A;  1D9A A;  1X8D A;  1K8A T;  2MZT A;  1IXK A;  2B7C B;  2L41 A;  2YKA A;  2QRR A;  2PEB A;  5KFG A;  2IY5 B;  4QBU A;  2C42 A;  1ZPW X;  2G4B A;  2AGQ A;  2AZ1 A;  3GV8 B;  3I96 A;  3QT6 A;  3CDB A;  1PSD A;  2QLX A;  2BXJ A;  1H2T Z;  2YKO A;  1FD2 A;  3MTK A;  2DD8 S;  4FXV A;  1NK4 A;  4LF4 F;  1BE4 A;  1C4C A;  4F3O A;  4O0I A;  1WG4 A;  4P2S A;  2AJ1 A;  1Q8B A;  4JI1 J;  2YKM B;  4R8U A;  4O3Q A;  1AB8 A;  4ZCM A;  3HT0 A;  4XIU A;  5J2N B;  1M0S A;  1TU0 B;  5K9F A;  2HHU A;  2DR9 A;  3CSK A;  2M8H A;  2IC3 A;  3D2W A;  3ENA A;  4WZQ A;  5KFV A;  1RT5 A;  3W64 A;  5FLX U;  2MQQ A;  4M5J A;  3S1T A;  3ZZP A;  2HVH A;  2WW4 A;  2QZ8 A;  3HP6 A;  1NPK A;  2GMH A;  2ZZN A;  2QLF B;  1R31 A;  3JQK A;  1SKR A;  1WWH A;  4B9N A;  3IRW P;  1WC0 A;  1FWK A;  3HK2 A;  3H2V E;  3W61 A;  1FKP B;  4C11 A;  5RUB A;  4A4J A;  2VG5 A;  4OLP A;  3RAQ A;  2Y0S D;  4B3O B;  4QW8 A;  5DRK A;  2XI2 A;  1FRH A;  1RLD A;  2DO0 A;  3BGL A;  2YNI B;  5HAN A;  4GKK F;  4MIW A;  1JLQ B;  3AB2 B;  4LF5 F;  1C1C A;  4WFN Q;  4IDK B;  4XTT A;  5HK4 A;  5LJ5 Y;  1CJU A;  3MM8 A;  1QUV A;  3TOQ A;  4DN0 A;  2ZH1 A;  4DF4 A;  2RS8 A;  3TQ1 A;  2C2D A;  4F02 A;  1S7H A;  2EKN A;  1GX5 A;  5C5J A;  3AFG A;  3DRR B;  3W9I A;  3LH2 S;  3ISN C;  4J9K A;  1JLE A;  3IS9 B;  4CDI A;  4NL5 A;  2V4Q A;  1HNW J;  4DPO A;  2ZKT A;  2Z2M A;  3NLC A;  1HW8 A;  3BKT A;  1AW0 A;  3OL9 A;  2GQQ A;  5KG6 A;  5IWA F;  4HVZ A;  5FLX Y;  3HHL D;  4CLL A;  3IC1 A;  2Y3Y A;  4NI2 A;  2OML A;  1FA0 A;  1F9F A;  2W9C A;  2K7K A;  2PMZ D;  4USH A;  2W2O P;  3D3B J;  3PR4 A;  2JLF A;  5L46 A;  3R7N B;  4FBT A;  4LF9 J;  5D78 A;  4LFC F;  2BKP A;  1N36 J;  4A48 A;  4KH1 B;  1KHW A;  3C6U A;  1KLN A;  2C2M B;  4NLU A;  4EMD A;  5C42 B;  4ETZ A;  1JNR B;  4XPE A;  1F9E B;  1HFE L;  2MQM A;  3KNA A;  1O0P A;  1HLW A;  1MWZ A;  1QLN A;  4KHP F;  1QVG R;  2YX4 A;  1YDL A;  2Z2Z A;  5L9X A;  4Y3C A;  4NA3 A;  3FQK A;  3BGR A;  3OW2 R;  1WC3 A;  3CIM A;  5D8H B;  4WFY A;  4C6A A;  2CAJ A;  3CCW A;  4ZLP A;  1LV5 A;  2P9G A;  2XYP B;  3GYN A;  1VQ8 S;  5AXN A;  3P5B P;  4DV4 J;  2M9K A;  3PXG a;  4JI8 F;  3O2I A;  1R7I A;  2IVM A;  5D15 A;  3W8G A;  2EG2 A;  2CXE A;  3BYR A;  2DGV A;  4A8F A;  2OLW A;  1X7V A;  3ZZR A;  3N01 A;  1CQN A;  1HYS B;  1RBL A;  4PUO A;  5A2Q U;  3THP A;  4I2P A;  2NUH A;  2OPP A;  3L7O A;  4G65 A;  3M8S A;  3CDA A;  2B4P A;  2L9N A;  1VDH A;  5KFX A;  3DLL Q;  4CNZ A;  2MB0 B;  3FEY B;  2DNM A;  1L3K A;  1FXL A;  4PKD B;  2GGP B;  1VBX A;  3FFI B;  2POK A;  1RAH B;  2FHJ A;  3C16 B;  4PZV A;  2NXJ A;  2IRY A;  3K59 A;  3QGH A;  5EWE A;  2XB2 D;  4PYD A;  2JH3 A;  4IRD A;  4KC5 A;  2JLG A;  2OEL A;  1VK3 A;  3J81 U;  5A8R B;  2ZE2 B;  1T9T A;  4U95 A;  1XMO F;  4J9L A;  1KBR A;  1B0P A;  4DZD A;  3HSD A;  2ZC3 A;  5GME A;  3MUR P;  2BDP A;  2PII A;  4ZN3 A;  2F9D A;  4X4T A;  3LGH A;  1U2F A;  8ATC B;  2BAC A;  3AB4 B;  2CVE A;  1UEK A;  2AF6 A;  3ITH A;  2HUR A;  4RW9 B;  2HHP A;  5T14 A;  4QOT A;  4JYA F;  1U8S A;  1OS5 A;  2CJY B;  1HHQ A;  2VG6 A;  1YJR A;  1HPZ A;  4NLS A;  2F65 A;  2Z0G A;  3HFV A;  3QT5 A;  3EVM A;  4JI2 F;  2DIU A;  3EMT A;  2JHE A;  1TKD A;  2J5A A;  2DYA A;  1S77 D;  3RUB L;  2OD6 A;  1ZPV A;  3I56 S;  3PV8 A;  3QWU A;  5K14 B;  2OPQ B;  1RTD B;  3Q83 A;  2Y9H A;  3H42 A;  3CCR S;  1H73 A;  3KFW X;  3CGI A;  2UU9 J;  2YNH B;  1U7L A;  4QU7 A;  2IHR 1;  4NLQ A;  2XYG B;  1OY8 A;  4UOG A;  2CQD A;  3PFE A;  1HBM A;  3BH7 B;  1XK8 A;  3R1L A;  3FCV A;  3GMG A;  2RSQ A;  1TTH B;  4ATN A;  2V4R A;  4TYA A;  1FK9 A;  4ID5 A;  3UVJ B;  1YJU A;  1AA1 B;  1IN0 A;  2EBE A;  5CXT A;  4J90 A;  4OL8 A;  2KN4 A;  3CE8 A;  1LFP A;  3G82 B;  1NPR A;  4USW A;  3P8B B;  4J9U E;  3J81 Y;  3NOG A;  5JVG Q;  2CNN B;  3MHY A;  4RKU C;  5F3T A;  2DRA A;  1T03 B;  1FWL A;  5MLC V;  1M5H A;  4P52 A;  4JI4 F;  2B6A A;  2CQH A;  4LF4 J;  4C8K A;  2XSJ A;  1VOM A;  3CCT A;  1J5O A;  3GCW P;  4MYU A;  2K7J A;  4DR6 F;  3VGV A;  1FE0 A;  1QSY A;  2KFZ A;  5EGY A;  5F9L A;  2ROP A;  3LWL A;  1KEK A;  3VTI A;  4YY3 F;  1F1B B;  1RT3 A;  1HKA A;  2DRB A;  3M8P B;  1RQ0 A;  2YKQ A;  4GMK A;  2MKK A;  2CRL A;  4CO4 A;  3WX8 A;  4MKV A;  3P5T L;  3FRY A;  3S01 A;  3F44 A;  5E41 A;  1REV B;  1D1U A;  5IV4 A;  3EDQ B;  3H4B A;  3J7Y U;  4DS4 A;  4ZP6 A;  3OFE A;  3GJS B;  2KZZ A;  1U1M A;  1IKY A;  2GFF A;  4E2F B;  2NSC A;  4BC9 A;  3SQG B;  3CJT A;  5HN0 A;  5U47 A;  1WNE A;  4F4Y A;  1S49 A;  2VB6 A;  2UV8 G;  4CLU A;  3BO3 A;  1VFJ A;  3GFY A;  2XSF A;  4EWT A;  2LQB A;  4PG8 A;  4KT0 C;  3MEG A;  5CZX A;  1FF2 A;  1X5S A;  1OPI A;  3K5O A;  3KLI A;  1CJK A;  4PPZ A;  1U25 A;  5CZV A;  1WDD A;  3ADA C;  1RTZ A;  4HR2 A;  2KXH A;  1OSC A;  1KN6 A;  2CYY A;  3DLB A;  2DGQ A;  5E2Q A;  2HMI B;  3NG8 A;  2ZDP A;  4LF5 J;  2XC9 A;  2KM8 B;  1P8G A;  1WC5 A;  3J7A 1;  1WEZ A;  1TL7 A;  2NYI A;  4DSL A;  3J80 U;  3CJ2 A;  2KJW A;  1FCA A;  1WKK A;  2AJ4 A;  2YBV A;  4ECQ A;  4YB1 P;  5D0E A;  1FDN A;  2N4C A;  4K2X A;  4DG1 B;  3C15 B;  2RRN A;  1UPM B;  4ERD A;  3QIP B;  3TO8 A;  4WU3 A;  5G0R A;  2ZJQ Q;  5AE3 A;  3M7V A;  2UUB J;  1NRK A;  2R7O A;  4IH6 A;  2OTL S;  1R0B G;  3ZZZ A;  3BQ1 A;  1HNI A;  3Q2S C;  2V5H G;  3GII A;  4RW8 B;  2M70 A;  3GCX P;  2AEF A;  4GRS A;  1JKH A;  2DNG A;  3MMB A;  1WC4 A;  4K5S A;  4B3S J;  2B9X A;  1RT6 A;  1TKX A;  3CW2 C;  4H4O A;  3I5C A;  3LGN A;  4TQR A;  1WOO A;  2VL1 A;  4LSZ B;  1V3Z A;  3VVT A;  4M5K A;  2UVW A;  3MAQ A;  2AX0 A;  2MMY A;  1Q82 T;  4CYU A;  1B0T A;  1DUR A;  1M5V C;  4O3S A;  3LAM A;  1HBN A;  5KFM A;  3MXH P;  3ILI A;  1Y10 A;  2P6S A;  5HP1 B;  2YWW A;  2XWY A;  4YHH F;  4C9D A;  1S6Q B;  3B4D A;  3QMQ A;  4EUV A;  1X0F A;  2IRX A;  5L9N A;  2B7B B;  2GVD B;  3CJ4 A;  1FDB A;  2H48 B;  2CDR B;  5DQH A;  4D3H A;  2E7W A;  3J80 Y;  4ZPT R;  2XS5 A;  4IFY B;  4XPC A;  1UW4 A;  4O4G A;  4USJ C;  1RWV B;  2CZ4 A;  4G1I A;  3E8O A;  1JLF B;  2JDJ A;  2NPI A;  4OHW A;  4ILL A;  2VQE J;  1YLX A;  2VG7 B;  1EET B;  2HAF A;  3OUY A;  2AIR B;  4LRE A;  2BJD A;  2NSB A;  2MJU A;  2C2R A;  1R43 A;  1KFD A;  2HFV A;  1TK0 A;  1SV5 A;  3RTV A;  5KT2 A;  1Q16 B;  1VQ5 S;  3O5T B;  4RX6 A;  4R5P A;  1QJH A;  5J2Q B;  1OQ6 A;  2DNH A;  1NKB A;  1YRT A;  4KPC A;  4KHR A;  1NEE A;  2E1P A;  3BDP A;  2X1G A;  4KRW A;  5E7O B;  4Q44 A;  3D9B A;  2H5I B;  4USI A;  4TY8 A;  2P9E A;  2QA4 S;  1F60 B;  2XYH B;  3ZZT A;  1P9Q C;  4BC7 A;  1R8B A;  2H3E B;  3KJF B;  4WFB Q;  2RD5 C;  3IRX B;  3IR5 B;  1UFW A;  1K44 A;  1H3D A;  3EWG A;  4RZR A;  1CS4 A;  4ZIW A;  1DQ9 A;  4FYW B;  3EYZ A;  4ZPW R;  2DIT A;  3MED A;  1OYE A;  2OPR A;  4FYD A;  4QR2 A;  1TMJ A;  4TLR A;  4C8L A;  1JJC B;  4MMO A;  2E9R X;  3IAS 9;  4RLE A;  3FBF A;  1NU4 A;  1PJ5 A;  2HNZ B;  1NK5 A;  4NLT A;  3D66 A;  3HHD A;  5CAB A;  4JI6 F;  3MUT P;  1JQG A;  3WIV A;  2LEP A;  3QGG A;  3MM6 A;  1VRU B;  3A12 A;  1U1O A;  3D6M B;  3KLG A;  1SPB P;  4F2R A;  1FI4 A;  3HO1 A;  3DFE A;  3IP0 A;  2IA0 A;  1ZA1 B;  2ZFH A;  4ZOS A;  1GK8 A;  3Q23 A;  5CD4 H;  3O3L A;  2VHG A;  2B9E A;  3OL7 A;  5CD4 A;  4YR3 A;  2GJI A;  3OHA A;  1GNK A;  3M8Q A;  4OHZ A;  1SJ4 P;  2DEI A;  5LXR A;  3BGO P;  4ZPA A;  2OPS B;  3I0S B;  5EWG A;  1SJ3 P;  1RBO B;  3THV A;  1F2G A;  1CUL A;  1T9V A;  2AP6 A;  2CKW A;  1S1V A;  4JI7 F;  2GW8 A;  1NSQ A;  1RAA B;  3PZP A;  3QAT A;  1NSA A;  2JEI A;  2AX1 A;  2HZV A;  1DTT B;  4ZN1 A;  4KYZ A;  3TAR A;  3CCE S;  3QWP A;  4WK3 A;  1VK8 A;  5A8W B;  3DOK B;  1LWE A;  4OI6 A;  4JI4 J;  1N32 J;  2UV8 A;  3TUJ C;  4ELT A;  1HQ2 A;  5HMW A;  4Y28 C;  3BQ2 A;  3EPI A;  4YP3 A;  3RBZ A;  3DRX A;  4DR6 J;  5E33 A;  4DR4 J;  5F8I A;  1IKW B;  2LEA A;  1TVR A;  4YFU A;  3W5Z A;  4EYI B;  3UWT A;  1LXJ A;  4K4U A;  2RU9 A;  2JEG A;  3AAW B;  3MD1 A;  4X4S A;  4HEA 9;  4DHV A;  1QY7 A;  1VS3 A;  4LF6 J;  1UVM A;  1H72 C;  2DGT A;  2M2B A;  1ZM2 A;  4OYX A;  1OO0 B;  3PYE A;  1RWW B;  4RBV A;  1U1K A;  4P2M A;  2BV3 A;  2MQL A;  2H51 B;  1ZET A;  1M5S A;  4C97 A;  1XER A;  3NKY A;  1C0T B;  2VC1 A;  4S0M A;  1KOO A;  4C98 A;  3KWM A;  1T7P A;  4PG6 A;  2Z2L A;  3G4S S;  1EP4 A;  5JVH Q;  4AL6 A;  5HAO A;  4U96 A;  2Z57 B;  1LNQ A;  1TV6 A;  2FC8 A;  2K8G A;  4M8L A;  2Z58 B;  1T9Y A;  2JVO A;  4M5D A;  3R7B B;  1U8W A;  5IS2 A;  2FGO A;  2FVS A;  1ROF A;  4OYI A;  5DLF A;  2W2M P;  2ZJP Q;  1AT1 B;  2B4U A;  1SXL A;  1HWI A;  2PMH A;  4IOC Q;  2V6A A;  5HL7 Q;  1R0C B;  3TAQ A;  3HHE A;  4LQ3 A;  2HVI A;  4HHJ A;  4DU7 A;  2E7X A;  4K8R A;  2CWX A;  1AYE A;  4HI2 A;  2IVY A;  4FF4 A;  2CAD A;  4X2B A;  2P8I A;  2UP1 A;  3TAP A;  4H4K C;  1UJ5 A;  1ZZN A;  3T5J A;  2QMX A;  2IJR A;  2VPX B;  4WPA A;  2RQ4 A;  5KG0 A;  4LRC A;  2RIL A;  2DIV A;  4RNO A;  3PFO A;  5JXS A;  1BHN A;  3HHN B;  5IFM A;  3M2R A;  5B0A A;  2IC3 B;  3M2V A;  3BQ0 A;  3NNC A;  5CYJ A;  1T9U A;  4HH0 A;  2WVB A;  2OIH A;  2J9D E;  5AE2 A;  4DV1 J;  5LSO A;  4OZN A;  2ZUG A;  2V8D A;  1Q5V A;  1KTQ A;  1FEH A;  3OQ2 A;  2UUC J;  3DM2 B;  4MJK A;  5LMN F;  1IR1 A;  3QYY A;  1S1U B;  4X4P A;  5HJX A;  4PQU B;  1S0O A;  5MAO A;  1HI1 A;  4ZCI A;  3CIZ A;  2VFS A;  2J76 E;  1CC7 A;  2XMW A;  2HVE A;  1CSJ A;  2C2K B;  3MCN A;  4RPF A;  1B70 B;  1U48 A;  1WF1 A;  2VG5 B;  2VD3 A;  2GQC A;  2HFS A;  1UWB B;  1S6U A;  2WOM B;  1G1X A;  1UKU A;  3A1Y G;  2VFV A;  4K4X A;  5B0F A;  3M6U A;  1MWY A;  5LL6 d;  2RKI B;  1PGZ A;  1FER A;  4F50 A;  4RO0 A;  2FHM A;  3WHI A;  3AA9 A;  2COL A;  2MZJ A;  2I0X A;  1Y11 A;  5LXY A;  4OJH A;  1X9W A;  4B9T A;  3MM8 B;  4RUB A;  1H38 A;  3U1M A;  1WKJ A;  4Q2L A;  2QN6 B;  2HHS A;  1RA6 A;  4WXO A;  4KSE B;  4WFZ A;  2HRT A;  1VHI A;  3GYX B;  4OYW A;  1KKH A;  4I4B A;  3HM9 A;  3T6B A;  3I9Z A;  3H20 A;  1U47 A;  4WCE Q;  3AD9 C;  4L3N A;  1XC9 A;  2ZUA A;  2E5H A;  2KVQ E;  2EW9 A;  4OZ5 A;  1NKC A;  2FGC A;  2IAJ B;  3PEJ A;  5HMY A;  4C48 A;  3MMA A;  3HHL C;  4TQS A;  4I56 A;  5KG2 A;  1E6V B;  4IH5 A;  4DR1 J;  2W9C B;  4JUZ A;  3PIO Q;  1TKT A;  1A9N B;  4DQP A;  3PR5 B;  3VCD A;  1CJT B;  5B0C A;  2BX6 A;  1FRL A;  3MM5 B;  4X65 J;  4M5M A;  4DUZ J;  2I2Y A;  2GVZ A;  1JX4 A;  3SCL E;  3H8Y A;  1V9O A;  3BRE A;  3PM9 A;  2ZEJ A;  3EXY A;  5BR8 F;  3HHK A;  2MHN A;  2PMW A;  5IT0 A;  4PG7 A;  1QD1 A;  4DUY F;  3T1H F;  1JB0 C;  2NR0 A;  3K0J A;  4OYO A;  4URS A;  1YJ9 S;  3DDI A;  2FVP A;  3ZTQ A;  1Z4U A;  4YB7 A;  4DSI A;  4M1K A;  4M5N A;  3N0V A;  3JQJ A;  1JXV A;  3PO5 A;  1RTI A;  4OFZ A;  1LW0 A;  1VC5 A;  4UST A;  1MN9 A;  1ELO A;  3CCM S;  4DR2 J;  5EWF A;  5HMZ A;  5AXK A;  3VHQ A;  2BE2 A;  3DLG B;  3H5X A;  1ZBT A;  3ONQ A;  5KFZ A;  3UN3 A;  2PN6 A;  2PE8 A;  3JAM U;  1AZS A;  3DHX A;  1I3O B;  3K7R A;  3NS5 A;  5KFO A;  2WSE C;  2OPP B;  5A6W A;  3N4W A;  2XS2 A;  3G96 A;  2E1M C;  1XN9 A;  5C24 B;  4X66 J;  1RK8 A;  4LR8 A;  6AT1 B;  1PBA A;  4DLG A;  3HZE A;  2CQP A;  3M8R A;  4NA2 A;  3G8T A;  3ETM A;  3SEO A;  4EBC A;  3BGU A;  2C1E B;  3X1L B;  2HWT A;  3N5B A;  3BEG B;  3MEC A;  3NWG A;  4CLY A;  3QGP A;  4P6Q A;  4TKT A;  4M94 A;  2LDI A;  4MT1 A;  4CO1 A;  8AT1 B;  4LF8 J;  3ISZ A;  3W1Y C;  2D1C A;  3CDW A;  3D1O A;  1DY3 A;  2BJ7 A;  1X4F A;  4OX7 A;  1O51 A;  2HGN A;  1LKZ A;  5K8N A;  5CYQ B;  3GIR A;  4B9S A;  4ZS6 A;  1NME B;  4Z37 A;  2D9P A;  2F4V F;  1HI8 A;  1KDN A;  1Y00 A;  2YKM A;  2I6W A;  3VGT A;  3IWL A;  3JQM A;  5C7P A;  3EJM A;  2FJX A;  3G6E S;  5J2N A;  1APS A;  2KDO A;  4NEY A;  3PRD A;  3MUV P;  2ZIT A;  1R3N A;  1WOP A;  4N7T A;  2R42 A;  2MJN A;  3JSR A;  3Q8S B;  4ILM A;  2H65 B;  1XJW B;  4DQI A;  2I38 A;  3RRH A;  2HZC A;  1I94 F;  4TXS A;  2HSE B;  1SH2 A;  2YNG B;  3SIP B;  4AT1 B;  2D3O 1;  2AW0 A;  1ZTW A;  1FKP A;  4BLG A;  4DL2 A;  4M95 A;  2CPD A;  5C2C A;  4P2X A;  1KSP A;  4B02 A;  3MEE A;  2ILZ A;  5KFW A;  3Q8Q B;  2Z8Q A;  2RU3 A;  1KWM A;  1NHK L;  4B3O A;  1Z2L A;  2HQI A;  1FK9 B;  2YNI A;  3LUY A;  3W60 A;  4DSK A;  2A3J A;  2E9Z A;  3DI6 A;  2MKJ A;  1TAQ A;  1JLQ A;  3I4H X;  3AY0 A;  4IDK A;  3C2P A;  3VAK A;  2QGF B;  3PHT A;  2I9S A;  5B7W A;  2BRK A;  3K5L A;  3G6X A;  2KI2 A;  3HMJ G;  4J9V A;  2B9Y A;  4CRJ A;  3MM9 B;  3DRR A;  2IBK A;  1SQG A;  3I0R B;  4Y0F A;  3IS9 A;  1WOR A;  2B6A B;  3RB0 A;  3WIU A;  4URG A;  2PC6 A;  3ZTP A;  3GJR B;  3QT7 A;  4CO5 A;  2DHH A;  1U1Q A;  1S6P A;  4CT8 A;  3VV2 B;  1I51 B;  5ETL A;  4DOZ A;  2HLT A;  3LP2 B;  2KT3 A;  4I64 A;  3CCL S;  4OJG A;  1FRX A;  2E5L F;  3DLE A;  2W4C A;  3SYZ A;  4OV6 A;  4TY9 A;  5LMU F;  3L7U A;  3RAX A;  5KOW A;  2OD4 A;  5L38 A;  1RT3 B;  4DLE A;  1ULR A;  5KTQ A;  4O3O A;  4QIE A;  1RWK B;  4PAA A;  3UW1 A;  2BM1 A;  3AXM A;  5M2R A;  1KQS R;  3D0H E;  3A3O B;  4UT4 A;  3QFW A;  3TI0 A;  5DDR C;  1CPZ A;  4U7U K;  3ILO A;  1RHU B;  4C3L A;  1EIY B;  3QPI A;  5C42 A;  3K5M A;  1BQN B;  4V19 X;  1WHX A;  3HVT B;  3KJV A;  2MKI A;  2FY1 A;  4GKJ F;  2WON B;  3MMJ A;  1OY6 A;  4PWU A;  2KFN A;  5LMN J;  2UXC J;  5C2G A;  2JRS A;  1JLC B;  4JI5 F;  1BLU A;  4DV2 F;  2C3O A;  1R8A A;  3JTN A;  4ECR A;  3MEG B;  1U45 A;  1F0X A;  3TVK A;  2ZD1 B;  3KLI B;  1RAB B;  1JNZ B;  2AJQ A;  3UFC X;  1NDP A;  3PW0 A;  1QAX A;  1N34 F;  4ES1 A;  2XGQ A;  3IBC B;  2ZM6 F;  3J81 j;  1VBZ A;  4O44 A;  2VPZ B;  2ACY A;  4HAC B;  4QYZ K;  3BSO A;  4KE5 A;  5F3Z A;  2ATL A;  1EKS A;  4X62 J;  4LIR A;  1CEZ A;  1TL7 B;  2HLU A;  5IQQ A;  3ETO A;  1NJW A;  1EQM A;  1Q7L B;  2XMK A;  4NPO A;  4FYV B;  2FZC B;  4Q8E A;  2J9E A;  3QBC A;  2LXI A;  1IBM J;  3FFI A;  4TU8 A;  1FDA A;  3C16 A;  2J6T A;  4JOU A;  5HRO B;  1IJE B;  1RHQ B;  4ZVH A;  3NAI A;  5KFA A;  1VCT A;  4J91 A;  4B3R F;  2NXN A;  2ZKU A;  5KT4 A;  4OZ3 A;  3CWJ A;  4GC6 A;  2ZE2 A;  2MSS A;  2Q3P A;  2IJN A;  5KT5 A;  4K4T A;  1YRX A;  3I9V 9;  3FCH A;  2A18 A;  5CA5 A;  3V81 B;  2ADB A;  2RDD A;  3MMB B;  4J9P A;  2ZH8 A;  4ETX A;  4RU9 A;  1QTM A;  4H4M B;  1RT4 B;  1MWQ A;  4MKA A;  4F2S A;  1TKX B;  4RUA A;  4IR1 A;  2CUY A;  3B6B A;  3B8H A;  2HAI A;  5DDO C;  4L73 A;  2FHJ D;  2BVZ A;  3A8J A;  4OYA A;  4YDD B;  3FZB A;  4DV7 J;  3R5B A;  2WVF A;  1HWJ A;  3VQT A;  1WC6 A;  3D3C J;  1EX8 A;  1S1T A;  1JWW A;  1SH0 A;  1ITP A;  2CVI A;  1HBN B;  1PBU A;  1DFD A;  4CLZ A;  2MEW A;  4DUY J;  3N6N A;  1S76 D;  3DCA A;  5K14 A;  2OPQ A;  4QIG A;  5IQ6 A;  4M5G A;  4M5L A;  1N0U A;  4QIV A;  1Z1Z A;  3VGU A;  1U09 A;  1QTN B;  1RZM A;  3AXK A;  3BJY A;  4F0H A;  2CWK A;  5SZT A;  2YNH A;  1YBT A;  5A8K B;  4Y2A A;  3V4M A;  3EDR B;  3OXF A;  3TJ9 A;  2M8D B;  2R2U A;  3H59 A;  2OHD A;  2DNP A;  1ZM4 A;  5EX3 A;  2MZR A;  4DR3 J;  1R0A B;  4KGZ B;  1RU2 A;  3G6V A;  1S12 A;  1OMS A;  1KQK A;  4BDP A;  2DGW A;  1ZH5 A;  3CMA S;  1CQM A;  3AH6 A;  4FS1 A;  1YQH A;  4JV5 F;  3EIC A;  2B51 A;  1BUX A;  2JWN A;  1LQ9 A;  2QMW A;  1RT2 A;  2OO4 A;  3UVJ A;  1S1X B;  4DR5 J;  4L72 B;  3B54 A;  2XZW A;  4Y65 A;  1Q8L A;  2PDA A;  2IM0 A;  3G82 A;  5GVQ A;  5KFB A;  1TL4 A;  4L3K A;  4XDC A;  4C4W A;  3MPV A;  3SMZ A;  3GV7 B;  4NLX A;  4LVN P;  1AFJ A;  1V6H A;  2C3P A;  5HJY A;  2WHO A;  3UDE A;  2LQ9 A;  2J7W A;  1KHV A;  4CQ1 A;  1S6O A;  2ZH3 A;  1UVL A;  1U0H B;  3CJK B;  1NDK A;  3MOZ A;  3PYF A;  1B4S A;  4LF2 A;  1T95 A;  2H1Y A;  4I6A A;  2F4F A;  3KJN B;  2HQ3 A;  4QR0 A;  3TA1 A;  4XAK A;  3I4P A;  1OPZ A;  5G4D A;  2RUS A;  2IMO A;  4ZHR B;  2R8G A;  1CS4 B;  2G13 A;  3TAM A;  3FNN A;  2V8P A;  4DFM A;  3M8P A;  3R2C J;  4ZP9 A;  3BSA A;  4PCQ A;  5KFC A;  4LRA A;  1REV A;  2DY9 A;  5FJ4 A;  2QE5 A;  4U8Y A;  2DNN A;  1HQU B;  2BW2 A;  3HXM A;  2LFV A;  2LXF A;  5KFY A;  4PG5 A;  1YJV A;  4QPX A;  3SQG A;  4DX5 A;  3T3F A;  1F3V A;  3PDN A;  1UVN A;  1XR5 A;  3MM6 B;  1I94 J;  4Q0B B;  3OT9 A;  4KV8 B;  1FHT A;  2CFX A;  2HWI A;  4RW7 A;  3IBF B;  2JZ5 A;  2HS0 A;  4ZVP B;  6FD1 A;  1N5V A;  1VIX A;  4RWW A;  2K1R A;  5DDP C;  4DFJ A;  3FGV A;  3IMQ J;  4JI0 F;  2FJV A;  4L75 A;  3BO4 A;  4AND A;  1X4A A;  4IRC A;  4RW4 A;  4LFA J;  5DZ7 A;  3P6Y C;  2HMI A;  4W90 B;  3D54 A;  4OYP A;  2HND B;  3KUG A;  2OUG A;  2DCL A;  4P2F A;  4OZ0 A;  2BJ1 A;  2WCX A;  3BGF A;  2M4M A;  1V5I B;  1S1W B;  2EFG A;  4Y2M A;  2FYX A;  1Q53 A;  3POT A;  3C6T A;  2W9B A;  2MGZ B;  3M32 B;  2B3T B;  5EX0 A;  4F4X A;  1TEL A;  1RWN B;  4U6P A;  3Q2T C;  4K59 A;  3C15 A;  3GYG A;  4PRF A;  2YWG A;  1VLY A;  3QIP A;  5KT6 A;  1V3R A;  5HQL A;  3MD3 A;  4IR9 A;  2CQI A;  1Q95 G;  2ZWP A;  1C1B A;  1VLO A;  3MFI A;  4N47 A;  3DRP A;  4RW8 A;  1B64 A;  2AWZ A;  2KM8 C;  3UN2 A;  2DGO A;  1VQM S;  2QEX S;  1EQ0 A;  4P71 A;  4OZL A;  2ZOF A;  2FTR A;  3O1L A;  3TWZ A;  4B3T F;  2QG9 B;  1RWX B;  4G1Q A;  4WXW A;  2HG4 A;  1Q4R A;  2XUL A;  4Q7A A;  1U49 A;  2CPZ A;  1OYD A;  4B9V A;  2BOA A;  3JYT B;  2AEM A;  3D1Q A;  2QMU B;  3H5Y A;  4DQQ A;  2DH7 A;  3QJL A;  3IBW A;  1S0N A;  2E1A A;  5E3A A;  2V69 A;  2L08 A;  4GKJ J;  1P1L A;  1YIT S;  1MSW D;  3S7R A;  3NCQ A;  2GS8 A;  3HD2 A;  4M5D B;  2HBR B;  4HT5 A;  5BYQ A;  3TNV A;  3D67 A;  3OPK A;  3LW5 C;  4DV2 J;  1V5V A;  1RWP B;  1VQY A;  4GO7 X;  2KYX A;  5DO2 A;  1Y3J A;  3GR0 A;  3R8Y A;  3US5 A;  2FY8 A;  2G1D A;  1N88 A;  4ECU A;  3DC2 A;  3FCW A;  3UCZ P;  3HKZ D;  1NO8 A;  4UOC A;  3HSG A;  3GV5 B;  4NLD A;  2GVD A;  1U1R A;  5GAE I;  4UW2 A;  4B3M F;  4IFY A;  1FDD A;  1N34 J;  1K0T A;  3SFU A;  4OHY A;  3L4B C;  2V67 A;  2ZM6 J;  4DCO B;  1JLF A;  4LBP A;  3VAM A;  4C8Y A;  1IBL F;  4WTY A;  2VG7 A;  2CPH A;  4C0B A;  2GJF A;  1ZS6 A;  4JV2 A;  2N3O A;  3OV7 A;  1DTQ B;  2MKY A;  3M2R B;  1ZM9 A;  4IOB A;  4ED5 A;  2RDI A;  1TL1 A;  4UZB A;  3R5A A;  2FVC A;  2MPU A;  1VRT B;  1NUE A;  5BYS A;  3TP2 A;  2R3V A;  1L5U A;  1N5S A;  5J2Q A;  2O5D A;  3NMR A;  1SKS A;  1S9F A;  2ROE A;  3I87 A;  4ZK7 M;  2KRB A;  2VZ9 A;  2JL9 A;  2N3L A;  1TKZ A;  5KFI A;  2DGS A;  2WRM A;  3SSR A;  1YX2 A;  1SL2 A;  2B4O A;  4CI0 B;  3GLJ A;  4B3R J;  2C2Z B;  2MQ8 A;  1U6F A;  1HHT P;  4I67 A;  5M2U A;  4XK8 C;  3DRY A;  2W7A A;  3MM7 A;  2EFO A;  2DT9 A;  2HKE A;  4MIA A;  2HVZ A;  1FNM A;  4K7Q A;  2EXU A;  3MPW A;  2A2C A;  5CQG A;  1U6Z A;  4FNI A;  3NGR A;  5I42 B;  2NLW A;  3KHR A;  3W63 A;  2QYC A;  1O6X A;  1PC5 A;  4L76 A;  4A8X A;  2VQF F;  2QA2 A;  4Y2K A;  1OJ4 A;  1SC3 B;  3BM7 A;  1M5O C;  2L3M A;  3KTQ A;  3VAH A;  1VQN S;  2FJW A;  2ASL A;  1VIS A;  2RIJ A;  4O4R A;  1W7W A;  3UD3 P;  1DQ8 A;  3G6Y A;  1FRJ A;  3HSJ A;  2HS4 A;  1SC4 B;  2DNZ A;  1XTZ A;  1VRU A;  1LWX A;  4NE9 C;  3HVW A;  1VHF A;  5T41 A;  3J7Z 5;  2DNO A;  3GFZ A;  3VAF A;  1SBR A;  3QJP A;  4ZPD A;  3WZ0 A;  2AJF E;  1LEO A;  3QJJ A;  1AUD A;  3C8Y A;  3GFH A;  1NB7 A;  2HFU A;  1R6Y A;  3SV4 A;  2YY3 A;  1UVJ A;  2DVI A;  1A0O B;  2XZT B;  4JV5 J;  4TVA B;  2B8Q A;  2X1A A;  2AKW B;  2XMJ A;  1GEH A;  2OPS A;  4FF2 A;  3I0S A;  1IKX B;  1RHM B;  1NXI A;  1S7I A;  3TQE A;  1R8C A;  4QW9 A;  2E5J A;  1WEX A;  1WTB A;  4K5R A;  4BBY A;  5F8G A;  1Q0N A;  4ZPB A;  1KVK A;  3BDE A;  4O0N A;  2KHC A;  5A8W A;  3DLJ A;  2C28 A;  1IWA A;  2HRU A;  3SSS A;  1RP5 A;  2ZBP A;  5KFR A;  2OAU A;  5LJ3 Y;  4F04 B;  3H90 A;  5AT1 B;  3W2V B;  4DR7 F;  3KDO A;  2M5Y A;  4CM2 A;  1IKW A;  4IUF A;  2VIH A;  5D0R A;  1FNO A;  1YWX A;  1YJ7 A;  1JLB B;  2VJV A;  5HQ8 A;  3M6V A;  1LW0 B;  2XQC A;  6FDR A;  1UVI A;  4L74 A;  2R7Q A;  1EAY C;  1XIQ A;  3BF4 A;  5J1E B;  2V9W A;  1WHY A;  2R8I A;  2BE2 B;  4A47 A;  4X4N A;  1AZS B;  3HLU A;  1C0T A;  1FEE A;  4AXJ A;  2D41 A;  2I8E A;  1Q7Y T;  4AL5 A;  3LAL A;  3TX8 A;  5DJB A;  4DPW A;  1RCO B;  1HBU B;  4K0K J;  1SVD A;  4LBH A;  3HJF A;  3HPO A;  2Z4P A;  3MEC B;  2BQ3 A;  3LTO A;  3ZNJ 1;  1UET A;  3PNI A;  2V9K A;  4ZJQ A;  4MK9 A;  4ANE A;  1HQE B;  3GU0 A;  2N82 B;  4EK2 A;  3PY8 A;  1HAR A;  4FKX A;  2HHV A;  3PW4 A;  5I3Q A;  1Q81 T;  1N48 A;  4WIQ A;  2GA7 A;  3KG1 A;  2QTW A;  1PAE X;  4IO9 Q;  3BPS P;  1TR0 A;  1RJJ A;  3HJV A;  1RYR A;  4JI3 J;  3FSX A;  3DKD A;  1H6K X;  1HWK A;  3D5M A;  2M7S A;  2CG4 A;  4NLY A;  2HBZ B;  2VFR A;  4K4W A;  4DN9 A;  2J0S D;  5CH7 B;  4NZ7 A;  1J2V A;  1N33 F;  1KP6 A;  2FQQ B;  2RB7 A;  2VFT A;  4UY8 T;  5FDL B;  5EDW A;  1B99 A;  3MR3 A;  1MMD A;  2XHW A;  2K2P A;  2V2Z A;  3U27 A;  3PW5 A;  1RT1 B;  4OI0 A;  4P10 A;  3DM2 A;  2BE7 D;  2DHS A;  2B5J B;  5GAH I;  2W7P A;  1S1U A;  2A1B A;  4DV0 F;  2R9L A;  1FKA F;  3Q8V A;  2WB1 D;  4PQU A;  1C0U B;  2NS1 B;  1RI7 A;  4IYQ A;  2DBB A;  2F3J A;  4J9M A;  2PA3 A;  3IG1 B;  3V2U C;  1T3N A;  2O01 C;  2DNR A;  4U67 Q;  3MEE B;  2D69 A;  1J5E F;  3UQS A;  1UWB A;  2CQC A;  2WOM A;  4CTA B;  5F0U A;  1LXN A;  3EGN A;  2RKI A;  2VBX A;  3N6M A;  3DI6 B;  3KJQ B;  2BJ3 A;  2R2S A;  4P74 A;  2BJE A;  4QJV A;  5IXU A;  2LEB A;  1T3O A;  2PT0 A;  2UVV A;  7FD1 A;  5F8M A;  2MZQ A;  3JSM B;  1S5Z A;  3V6H A;  1NB2 A;  4N56 A;  4BWJ A;  4CWB A;  3CJR A;  3MPD A;  4CO3 A;  1Y4Z B;  4RWX A;  5GAD I;  2LQJ A;  3F73 A;  2X1F A;  1EB0 A;  5AXL A;  2WTF A;  2VUG A;  3KLV A;  5BYR A;  3QZ8 A;  2X3D A;  3T9Z A;  5DG9 A;  4J5O A;  2IAJ A;  2F5G A;  1S6P B;  2VAS A;  3M30 B;  4KAI A;  1RTJ A;  2XCP A;  1XNR F;  1UW9 A;  1E6V A;  3EGW B;  3DLE B;  5ETT A;  3JTP A;  1IBL J;  3CTR A;  2KVI A;  2CJB A;  2UXB J;  2YNF B;  3CXC R;  5L8R C;  3CME S;  1CJT A;  2BAN A;  3R9L A;  2CNL B;  3MM5 A;  4IQX A;  4CCH A;  3D28 A;  4NRU A;  2GQ2 A;  4Q45 A;  3RB4 A;  4ILR A;  3OVA A;  1NHV A;  3KJV B;  1K0V A;  1NH7 A;  3MEK A;  2P2C B;  2G2O A;  3VAJ A;  4U7C A;  3GJT B;  1M1K T;  3UO0 A;  2E1C A;  4YDX A;  2ERR A;  3IAM 9;  2V94 A;  2J0Q D;  1U0S A;  1PIE A;  2JSX A;  1MNE A;  3G8Q A;  2F8E X;  2V0N A;  4CH1 A;  3UN5 A;  2A6M A;  1NJY A;  3E2E A;  4C0O C;  1IQZ A;  4AL7 A;  1JMT A;  4DF8 A;  1HIY A;  1CLF A;  2DH9 A;  2E66 A;  3IGN A;  3CC4 S;  3DLG A;  3MCO A;  4IFV A;  2CJK A;  2PI5 A;  2JVR A;  2NUU G;  5ETS A;  4FKY A;  3FMW A;  2ZVS A;  3MAA B;  4O44 B;  1FWP A;  3I82 A;  4CLW A;  4C8Z A;  3SFG A;  3ZZ0 A;  3V5R A;  2W7O A;  2EFN A;  1VGY A;  5F8J A;  5C24 A;  2D3Z A;  3H7H B;  1FJG F;  2GIQ A;  3M4X A;  3R2D J;  2RNE A;  4ZVT B;  3CD0 A;  2QL5 B;  3L95 X;  5HVF A;  2OI2 A;  1S48 A;  4ED4 A;  4PG4 A;  4LF7 F;  2JFK A;  1FO1 A;  1TL3 B;  1X4C A;  1G4C A;  4WU2 A;  1Y3K A;  5D0H A;  4FNH A;  1PC4 A;  3ZTR A;  4OZ2 A;  3PRB A;  2J9C A;  1T94 A;  1HNZ F;  5A76 A;  5CYQ A;  4KO0 A;  2ZHO A;  4DL5 A;  2JLE A;  3GSI A;  4Y2C A;  4NCG B;  4QZV B;  1PIL A;  2YQ1 A;  1VYA A;  4YR0 A;  1UA0 A;  4C8N A;  5I3U B;  3W62 A;  3IXQ A;  3QSY B;  2QLB B;  3D6F B;  5K5M A;  2ZC4 A;  3DDN A;  4JBC A;  3ZZU A;  1FNX H;  4RNH A;  4YB6 A;  1D09 B;  1RAF B;  3VQS A;  1QE1 B;  2FHK A;  3OVS A;  4C3K A;  3CCS S;  1S1T B;  3RBE A;  1HMV B;  2FZG B;  4DV5 J;  2J0W A;  2HHH J;  1RIS A;  4NOH A;  1S97 A;  4LSL B;  1T05 A;  4WFA Q;  3UI3 A;  4DR7 J;  3G87 A;  2JC1 A;  3RR8 A;  4WE1 B;  2FB0 A;  3BZQ A;  1HI0 P;  4WKY A;  1H74 A;  3V6D B;  3EE3 A;  3DDK A;  2YNG A;  2ZOM A;  5IC6 B;  3HD1 A;  1N4L A;  2ZZM A;  3RW7 A;  4USU A;  3MI7 X;  2C3U A;  4AE5 A;  3D0G E;  1RLC L;  5DQG A;  2XY6 A;  4HH1 A;  1MU2 A;  4IG0 A;  1GQE A;  3K17 A;  3I5A A;  2C3Y A;  4ES2 A;  1TFW A;  3PYD A;  1RT2 B;  3DXS X;  1XMQ F;  5KFE A;  3TVZ A;  1WC1 A;  2CPY A;  3MR2 A;  1IBK F;  5JMN A;  3KLE A;  2IM1 A;  1YI2 S;  2LU2 A;  4ZDN A;  1F9H A;  3PW2 A;  2LCW A;  3K89 A;  1N5T A;  5ETM A;  1KTV A;  2NXC A;  2DR5 A;  3OL8 A;  5DGB A;  3I5B A;  2EC2 A;  4F25 A;  2B43 A;  3MM9 A;  3CMQ A;  2PEH A;  4GO5 X;  3Q89 A;  3I0R A;  4ZVG A;  2UVU A;  3WQP A;  4GC7 A;  2DKO B;  2PSZ A;  2MST A;  1DQA A;  4RW6 B;  4Y34 A;  5F8H A;  3NBP B;  2AQ4 A;  2OP5 A;  2XO7 A;  1GX6 A;  3UNG C;  2J9D A;  1U2C A;  2DGX A;  3R6L B;  4DCP B;  2R2R A;  3LP2 A;  5DLG A;  2MY7 A;  2HNY A;  4C2M A;  4DPT A;  3CDE A;  3TAM B;  3TZY A;  3FSY A;  2W2N P;  4P7V A;  2MKS A;  4ICL B;  2GO8 A;  2JEF A;  4NX9 A;  4QWD A;  4EO6 A;  1RT7 B;  3MZI A;  1RHR B;  1BWE A;  3KYL A;  3A8E A;  2IMW P;  1F5B A;  1ZAV A;  1BQN A;  4F4Z A;  3HVT A;  2GNK A;  1IBC B;  1NK9 A;  3OVB A;  2Y8Y A;  2WON A;  2XNR A;  4WWS A;  1S99 A;  1RU1 A;  1JLC A;  2QA1 A;  3SDE A;  3ZTS A;  3AA8 A;  1OWX A;  3LO3 A;  4RW7 B;  1D9D A;  2E5G A;  3TR5 A;  4HT7 A;  5ETN A;  2BRL A;  2ZD1 A;  4TYB A;  2WW8 A;  3CUL A;  2K1R B;  1C2P A;  1SIW B;  1WEL A;  4ITS A;  4M5H A;  3NXZ A;  1RAJ A;  3BR9 A;  5GMK a;  4O3P A;  2AYG A;  3M8Z A;  4TU7 A;  4RW4 B;  4GKK J;  3NMA A;  4HAC A;  4AYB D;  3NCP A;  1JLG B;  2APO A;  1Z2Z A;  4E8U A;  3Q8U A;  4U7U D;  4NYO A;  5ETP A;  2ZNZ A;  2G0J A;  4OI1 A;  4KPY A;  2HIQ A;  3POT B;  3C6T B;  2W9B B;  1K73 T;  3ZFV A;  4QYZ J;  4PXC A;  2W24 A;  2BZ2 A;  2QFJ A;  1HNW F;  2MZ1 A;  5HRO A;  4OI2 A;  3RJM B;  5KAK A;  1W2B R;  4HKQ A;  1WKL A;  1GMW A;  1MRO A;  1TAU A;  4X4Q A;  2XMA A;  2VA3 A;  4FVC A;  5IWA J;  1C1B B;  1H0H B;  4ZVF A;  3DRP B;  1VQP S;  5I4M A;  3E3X A;  1FRI A;  2YH1 A;  3V81 A;  2VH7 A;  4LF9 F;  3SSQ A;  4H4M A;  4LRD A;  1RT4 A;  3HKW A;  3ET6 A;  4LFC J;  1FTR A;  5F9N A;  3EGV A;  3CJQ A;  4G1Q B;  2DK2 A;  2KFY A;  3DYA A;  4LFB F;  4KKO B;  3PAC A;  1NK0 A;  2OH2 A;  3DOM B;  3OTB A;  5DG8 A;  1S9E B;  3BSC A;  1IJF B;  3KLF A;  5EUH A;  5KT3 A;  2XM3 A;  3NGD A;  1RAI B;  3DLK A;  4KHP J;  5LSL A;  4ECT A;  4NLO A;  3QNW B;  3H2U B;  1WF0 A;  3OR2 B;  3SCJ E;  1P27 B;  2HPU A;  3A8I A;  4DXL A;  2XY7 A;  5K8M A;  2F1F A;  4I69 A;  1S0M A;  3K2Y A;  2L48 A;  4BWM A;  5A8K A;  4ZVQ B;  3GG1 A;  3D6H B;  3P96 A;  3RB6 A;  3SBM A;  4DV4 F;  1R0A A;  1JLA B;  3FEZ A;  4JI8 J;  3QLH B;  2XCA A;  3RB3 A;  1WOS A;  4EZ9 A;  3AJ1 A;  1T02 A;  5CHC B;  4LIW A;  2Y0B B;  5H9E K;  3HHL B;  3N5F A;  4XDD A;  1S1X A;  1SKU B;  3B82 A;  2E1R A;  4R25 A;  4WZM A;  1SQF A;  2XMM A;  5L1K A;  4LT6 A;  5GAG I;  4RUC A;  7AT1 B;  1FJG J;  3MR7 A;  2YWE A;  5KFT A;  3HX9 A;  4Z2X A;  1TL1 B;  3R5D A;  2DPJ A;  4KFB B;  3EUN A;  3TJA A;  2BYC A;  2YH0 A;  1R89 A;  4TLQ A;  4CLK A;  4MFB B;  4I68 A;  3OL6 A;  2XNQ A;  2BR0 A;  1TKZ B;  2G0I A;  5KFU A;  1U0H A;  1SL1 A;  1XR7 A;  2BMB A;  4NXN F;  3CJK A;  3ENW A;  1HNZ J;  4DX6 A;  4ECY A;  2V4J B;  1IR0 A;  2I5J B;  1XMO J;  2R4F A;  1RKI A;  4ZVU B;  4DX8 H;  3MM7 B;  3M9O B;  4ZIV A;  4DV3 F;  1EJ7 L;  4ZHR A;  2W8L A;  4X4O A;  2DJW A;  2IA6 A;  1RBA A;  3L9Z A;  3DRS B;  1TFY A;  4B17 A;  4G6V B;  4DSE A;  3FK4 A;  1WJ9 A;  3JS9 A;  5HBM A;  3LAN A;  5AXM A;  4JYA J;  3GIJ A;  2VBY A;  3OSN A;  4DZ6 A;  3CJ8 A;  3QO9 B;  1HQU A;  1UWA A;  2VU5 A;  4JI2 J;  2LMI A;  3OXL A;  4KGV B;  5I3P A;  5J2P A;  1RB0 A;  3KMS A;  2R8J A;  5L39 A;  2XMU A;  4UQG A;  2R7W A;  2GX8 A;  4Q0B A;  3NGU A;  3LPE A;  9RUB A;  4KV8 A;  1RWU A;  3K5P A;  1KD1 T;  1F5C A;  4LQ9 A;  2ZH9 A;  2CQB A;  2DH8 A;  2FJA B;  3OFF A;  2C2O B;  1VQS A;  3W66 A;  5ITH A;  1L3S A;  2F40 A;  4ER8 A;  1HNX F;  2KL8 A;  4B9U A;  3FRZ A;  4HHH A;  2KTQ A;  2GIR A;  1UMJ A;  1XMQ J;  1YBU A;  1IBK J;  2HND A;  2BQR A;  4A8Y A;  3ZC4 A;  1PAU B;  3GPA A;  1SUQ B;  3I32 A;  5K20 B;  3Q24 A;  1VQ9 S;  3O6Q A;  2R7X A;  1S1W A;  3D1H A;  2E29 A;  2DR6 A;  2R2T A;  3QAU A;  1PKU A;  3MOJ B;  2DTJ A;  3IR7 B;  1UEU A;  4HI1 A;  2VC0 A;  3U02 A;  2MGZ A;  3M32 A;  3FQL A;  4ZLL A;  2DR7 A;  3D68 A;  2CJ9 A;  5T7L A;  5E5N A;  2DB1 A;  2KT2 A;  3WC2 A;  5D4L A;  4ED2 A;  1EZZ B;  4NLV A;  4FPR A;  1CC8 A;  4ZPC A;  3H40 A;  1KFS A;  4F26 A;  2F9J A;  2PD1 A;  2QLJ B;  4YY3 J;  2GML A;  3N6L A;  1L3U A;  3C3L A;  2H54 B;  3ENV A;  4PXB A;  4NRT A;  4ZVS B;  1ZOT A;  4EU0 A;  2XG8 A;  3CC2 S;  5AJ3 F;  3CC7 S;  4ALZ A;  3VGS A;  4DDF A;  2CPE A;  2LXU A;  1R27 B;  3JYT A;  2DCU B;  4ENO A;  4X64 F;  3TW0 A;  2AYE A;  1XMB A;  2FZK B;  1DAR A;  3UCG A;  2PO4 A;  1CG2 A;  1N5Y A;  3KHG A;  5DM6 Q;  5D77 A;  1WDT A;  2AV5 A;  2LA6 A;  3DGV A;  2DNY A;  2ZBI A;  1W25 A;  3G9C A;  4CO2 A;  3KOA A;  1GTH A;  3A13 A;  1TUG B;  2RQK A;  5HSP A;  2CZ9 A;  2KU7 A;  4FF1 A;  2EI5 A;  1NKE A;  3OHB A;  2O66 A;  1UCN A;  3W3S A;  4OZJ A;  1KR4 A;  1Q5Y A;  4PAB A;  3CJS A;  4N76 A;  2ZH2 A;  3N28 A;  3KK3 B;  1SQE A;  4ED1 A;  4UUW A;  5B0E A;  2HGL A;  5D4O A;  4KGK A;  3WC0 A;  2D9O A;  3UR3 C;  2DNK A;  4XO0 A;  1IVZ A;  1RA7 A;  1PJ7 A;  3EM1 A;  2H4Y B;  1NH8 A;  2HW3 A;  4P75 A;  1DTQ A;  3VAG A;  1IR2 A;  4V19 J;  2GAH C;  5K8O A;  4UOH A;  3P49 B;  4FBU A;  2ZNY A;  1RTH B;  2AGO A;  1VRT A;  4YME A;  5KFQ A;  1JJ4 A;  5KFH A;  3KNG A;  3THT A;  1S57 A;  4F7V A;  3PKY A;  2UUB F;  4RNF A;  2YQ0 A;  4DPX A;  2Z2Y B;  3MFH A;  1VC6 A;  2DNQ A;  3A3P B;  1QAJ A;  2CJA A;  2OEM A;  2W2P P;  4ZPV R;  1CJV A;  1QVF R;  4B3S F;  1PCA A;  3VAL A;  2KB2 A;  1URR A;  1S79 A;  3PO4 A;  3QZ7 A;  5I42 A;  3DOL B;  3RU0 A;  3GG0 A;  1S10 A;  4LFB J;  2ZBQ A;  4M5I A;  2R7T A;  1RHK B;  1FX2 A;  5HLF A;  1TK5 A;  3TUI C;  2N7Y A;  3CB4 A;  1M5P C;  4NLG A;  1UFK A;  2MHE A;  2LLZ A;  1WG1 A;  4J9S A;  4RR5 A;  4OHX A;  5F8N A;  2AJ0 A;  3RW6 A;  2J8A A;  2FHO B;  1MG7 A;  3I31 A;  2N4D A;  4YHH J;  3H5U A;  1N52 B;  4QWC A;  3R5J B;  1J27 A;  3LP1 B;  4WJB A;  3FBE A;  1HD1 A;  4Y2I A;  4Q8F A;  4TU9 A;  4CIO A;  5JJB A;  2WVD A;  3T5H A;  3HFZ B;  5HO4 A;  2QLW A;  2FVR A;  2KXN B;  4J37 A;  1NPP A;  4DFP A;  3VAI A;  3MPU B;  1RTJ B;  1GXT A;  4UOF A;  1P9Y A;  1Q8I A;  2WZ1 A;  3FDS A;  2VQE F;  2HQD A;  3V6K A;  5H9F K;  1M1G A;  1X31 C;  3EZU A;  1IKX A;  1XEZ A;  3RBD A;  2YX1 A;  5KFF A;  2OTJ S;  2BAN B;  4WBF A;  2KH9 A;  4NML A;  3IWX A;  1QM9 A;  2H5E A;  3ZTO A;  1BQM A;  4WKR A;  1EKR A;  2BBE A;  3AJ2 A;  4CT9 A;  2ZWO A;  2UXD F;  2EKY A;  3LQV A;  2V63 A;  4E98 A;  2QSF A;  2DRD A;  2WSC C;  1LWF B;  3P3D A;  2Y1J A;  1HNV B;  4I0W A;  4NXN J;  1RWM B;  4PWD B;  2BEF A;  2VOP A;  3W2V A;  5J1P A;  1GMV A;  3EX7 B;  2HZA A;  4B08 A;  1FKO B;  2QIF A;  2HBY B;  1NJI T;  1JLB A;  2JFD A;  4DV3 J;  1X9M A;  1E6Y A;  1EAR A;  5KG4 A;  3SCK E;  1S9G B;  3HSZ A;  5J1E A;  2RAQ A;  3GWC A;  1DLO B;  3R5C A;  1V3S A;  1VJW A;  1Q78 A;  2V68 A;  4IFV B;  4BHQ A;  3PYG A;  1CVJ A;  2FUG 9;  3P45 B;  2LVW A;  3VZI A;  4KQZ A;  4R0J A;  3K5N A;  4JI6 J;  2BW7 A;  1YZ6 A;  4AFF A;  3JXO A;  3H2L A;  4LMZ A;  1HBU A;  4DL7 A;  4B9M A;  3G71 S;  1FTC A;  1SI9 A;  5A2Q Y;  4ECW A;  2VJU A;  2O1P A;  3OLB A;  1GXU A;  2CPF A;  2OEK A;  2DEJ A;  1NK8 A;  3GR1 A;  2HFZ A;  1BC6 A;  2CG8 A;  3BH6 B;  1VBK A;  1HQE A;  2DHX A;  3CNQ P;  4LRF A;  2OJ3 A;  4WTO B;  3MTJ A;  4DSF A;  1HNX J;  3W2W B;  4FZV A;  1DAX A;  4KO0 B;  4CH7 A;  1WSV A;  3E01 A;  2L9D A;  2HIY A;  3BYP A;  4USK A;  3GE9 A;  1JJH A;  4OJ3 A;  1JJ2 R;  5LOQ A;  1FRM A;  2ILY A;  2NQP A;  4ELU A;  1FD8 A;  4JI7 J;  3NL0 A;  2GO9 A;  1JXL A;  3UR0 A;  3GQC A;  1T11 A;  2W8K A;  2R7V A;  4WYW A;  1LWC A;  3CED A;  1NLK L;  4OMF G;  3Q8P B;  1N32 F;  1VQL S;  5FDL A;  1W2I A;  5A0Y B;  1S4F A;  1HBO A;  2G9O A;  2XWX A;  1VQ6 S;  4Y00 A;  4OLO A;  1RT1 A;  1T05 B;  2W4D A;  5BJR A;  4DR4 F;  2ZDO A;  5D4N A;  1S72 S;  2B56 A;  4LJM A;  2B5J A;  2WK4 A;  1YZ7 A;  1WTF A;  3F0N A;  2NRE A;  2HVD A;  2JEJ A;  5LSR A;  1RHJ B;  1C0U A;  4FN5 A;  4X84 A;  2YWH A;  2DIS A;  4ZCL A;  4I6W A;  4O3R A;  3VR1 A;  4LF6 F;  1PJ6 A;  1KRP A;  2FIU A;  2KG1 A;  1WI6 A;  3IG1 A;  5ETO A;  2OSQ A;  3DU5 A;  5AJ3 J;  2HHT A;  1MU2 B;  4IG0 B;  1G6B A;  2D3U A;  4CTA A;  3TZX A;  3NEK A;  3CCU S;  3PEH A;  4MK8 A;  2V34 A;  2ZBC A;  5BXI A;  4X64 J;  1X60 A;  1IM6 A;  3KLE B;  4ZLN A;  1NJZ A;  2ROG A;  1R6V A;  2KG0 A;  2EEY A;  3CD5 A;  2Z56 B;  4IO1 A;  2QT7 A;  4FP9 A;  3JSM A;  1TL5 A;  3IWN C;  1WEY A;  2QSW A;  4WP9 A;  1ZM3 A;  3J7Y I;  5IT4 A;  2D74 B;  2X3G A;  1FE4 A;  5IV3 A;  3L7P A;  5DGA A;  3CDU A;  3U1N A;  1U1P A;  3PIP Q;  2MQN A;  2U2F A;  1PYT A;  3ELH A;  1RAD B;  1QSL A;  3M30 A;  4QWE A;  1SJR A;  2IIH A;  2HNY B;  3MR5 A;  4F3Q A;  2AD9 A;  1UEV A;  1YVF A;  4UZC A;  4K4S A;  4PPD A;  5F0W A;  3WX4 A;  2YNF A;  1IUJ A;  2IYG A;  3C14 B;  3W9H A;  2EFP A;  4P72 A;  4CLT A;  3MDF A;  3PCO B;  3CO9 A;  4MH8 A;  3OTO F;  3G2X A;  2KYZ A;  1HWL A;  4DV1 F;  1NDC A;  5THW A;  4TN2 A;  1UTA A;  3M2U B;  2QC3 A;  2UUC F;  1QSS A;  1KON A;  1HWU A;  4NLP A;  3M9N B;  3RZA A;  3T5K A;  1RYS A;  3M1V A;  1WF2 A;  1UVK A;  4HDH A;  2AJ2 A;  4OX8 A;  3SDE B;  2ZH7 A;  4ES3 A;  4PR6 A;  3BKU A;  2Y1I A;  4ED3 A;  5LM7 E;  2QL7 B;  3AQP A;  2W9A A;  4KTQ A;  4IRK A;  2QV6 A;  2CQ0 A;  1BXN A;  2KT5 A;  3ENQ A;  2BAB A;  4F0M A;  2WVE A;  1N54 B;  3TRG A;  1UJ6 A;  1L3V A;  3IM8 A;  4P73 A;  4QIW D;  1SH3 A;  2LQ8 A;  1GT8 A;  3RRK A;  3BB5 A;  2RF2 B;  1AXQ A;  2AU0 A;  5IC4 B;  3MAA A;  4X4V A;  3UDC A;  4I2Q B;  4UUX A;  4MYT A;  1NZ8 A;  1LW2 A;  3T41 A;  1X5P A;  2E7V A;  3R1H A;  3EXC X;  4Z7C A;  1DJ0 A;  1VQ7 S;  4RU2 A;  1U26 A;  2MKC A;  2DHG A;  3G8S A;  1TL3 A;  4EBE A;  1WI8 A;  1ZA2 B;  3EZ5 A;  4C8O A;  2ALY B;  2KZM A;  2DXE A;  1MRO B;  4LVO P;  3PG9 A;  2YQ3 A;  3KG0 A;  5E3R A;  3N79 A;  4F36 A;  2OMO A;  1YJT A;  3TYT A;  1HW9 A;  1F3F A;  5CCM A;  1UL3 A;  2WAQ D;  4DR1 F;  1VBY A;  2QA4 G;  2KRR A;  1UAW A;  3BN4 A;  3MPY A;  3IO1 A;  4NCG A;  2ASJ A;  1N6Q B;  1RAO A;  3K8V A;  4NWB A;  5I3U A;  3K58 A;  1QAY A;  3ET6 B;  4X65 F;  4PEO A;  4C8M A;  4DUZ F;  3NP5 A;  2IFX A;  3DYA B;  1MN7 A;  5F41 A;  4W4M A;  2X1B A;  1VQK S;  3I55 S;  4EBD A;  5BR8 J;  1QE1 A;  3NGK A;  1RXO B;  3MMC B;  5CYM B;  1Y5I B;  3KLF B;  4IG3 A;  3K8W A;  3CO0 P;  4HTI A;  2UXD J;  1HMV A;  2OFG X;  3CD7 A;  3MCS A;  4LSL A;  3DLK B;  4CLF A;  2H4W B;  2YKN A;  1KLM B;  3T1H J;  2RRA A;  4MK7 A;  2RT3 A;  1PO6 A;  4DL0 C;  1BD6 A;  5K8P A;  2QYG A;  1VI7 A;  4CM0 A;  4USM A;  4EYH B;  4WE1 A;  3PJ9 A;  4Q5V A;  2MYF A;  4NCA A;  3PKM A;  4LSN A;  3KDN A;  3V6D A;  3L09 A;  4J9R A;  2J6U A;  4DR2 F;  2CQG A;  1JXE A;  4ZLJ A;  4Q2M A;  4OHV A;  1YJW S;  1DBD A;  2HQG A;  4JP8 A;  5J2M B;  1OY9 A;  1X4B A;  5KG5 A;  4F8R A;  1O8B A;  4DS5 A;  2AYB A;  3ILL A;  3OLA A;  2X51 A;  2VA2 A;  2RML A;  3V4I A;  2RRB A;  4IQM A;  4YR2 A;  4X66 F;  4ZMM A;  1MW7 A;  1G2E A;  3LA0 A;  1YJN S;  4DI6 A;  1H7X A;  1QAI A;  3QID A;  4I7F B;  3D7S B;  3T1A A;  1T9X A;  3WBZ A;  4AD6 A;  1RAE B;  1RAG B;  2HFN A;  4USV A;  2AT1 B;  4LF8 F;  4OV1 A;  5D6G A;  2MZS A;  3KK1 B;  3IN5 A;  4RW6 A;  3NBP A;  5ETR A;  3AT1 B;  3DGP B;  2KKH A;  2QL9 B;  3H25 A;  4NEZ A;  2VOO A;  2JJ4 D;  2IM2 A;  2F4V J;  2L9W A;  2HYI B;  2HWH A;  3IFE A;  2GJ2 A;  3OJU A;  3AOA A;  5IT9 U;  1U02 A;  3M9M B;  2NZC A;  1WHV A;  2CPJ A;  2LQ5 A;  3NNA A;  1KS2 A;  2EG1 A;  3NWR A;  1IKV A;  4CP5 A;  4ICL A;  3LAK A;  3HCX A;  5KFL A;  5HBM B;  5HVH A;  1RT7 A;  2RS2 A;  3H5S A;  2LA4 A;  4KR0 B;  3UD5 A;  4GVB B;  4WP3 A;  2FLL A;  5ETK A;  2QX0 A;  5J2P B;  4C7Q A;  4KH0 B;  1D8Z A;  5E3P A;  1Y0H A;  3BBB A;  3D0I E;  5HAT A;  3SV3 A;  1UZD A;  2I1R A;  4NYZ A;  1SJF A;  3OR1 B;  3OFH A;  3QSI A;  3HT3 A;  3K57 A;  2IVF B;  2J0X A;  2RHQ B;  1I5O B;  1YRU A;  2OFH X;  3BKF A;  1H2V Z;  2J7U A;  2IYI A;  5KFJ A;  1VJQ A;  4PYA A;  3SCI E;  3S6E A;  2XGP A;  3R6G B;  2OEJ A;  4ANC A;  1NSP A;  4DQS A;  4KGX B;  2F8H A;  3NGS A;  4H4K A;  5HI7 A;  3FUY A;  1JLG A;  2K3I A;  2IM3 A;  3TVY A;  4DX7 A;  3ZZY A;  2FJE B;  3FC9 A;  1X4E A;  4MKB A;  1GTE A;  4LRB A;  1ZYQ A;  4OYM A;  2HHW A;  3IGV A;  1NSK L;  5IT9 Y;  3NGT A;  3ZNU A;  1K47 A;  3HI9 A;  5T7L B;  3W5X A;  2KHD A;  5B0G A;  4EI2 A;  2UUW A;  2MLY A;  2CIM A;  1P6T A;  2ZH6 A;  5J1N A;  4R8U B;  2E5L J;  3G86 A;  3OTC A;  2BOP A;  5LMU J;  1HR0 F;  2BE9 B;  4F0K A;  4J9Q A;  2DXD A;  3FZ2 A;  1VIO A;  4ECZ A;  5D0G A;  5IM0 A;  1M1H A;  5E0O A;  3TZW A;  3BS9 A;  4G3I A;  1RT5 B;  2V50 A;  3KUE A;  3WDO A;  3OTO J;  1M90 T;  4KKO A;  3DOM A;  1XNQ F;  8RUC A;  3F41 A;  1S9E A;  2V2V A;  3NOC A;  1GMW D;  4PWW A;  2YX7 A;  3N9U C;  2GHW A;  1FRK A;  3BPD A;  4LF1 A;  3IR6 B;  4HTJ A;  1N5Y B;  5GAE U;  2UXC F;  4RBU A;  4JI5 J;  2RVJ A;  3OR2 A;  3DLH A;  1TUV A;  3LP0 A;  2JX2 A;  1L3T A;  4MKY A;  3BSN A;  2BKN A;  3X3U A;  4C11 B;  3UNY A;  1RGV A;  1N0V C;  3A4T A;  2IDL A;  4FYY B;  1YGY A;  1TQL A;  5D3G A;  4K4Z A;  4KY3 A;  3DU6 A;  3FVY A;  4YS2 A;  1EHW A;  2BUN A;  4EGL A;  1JLA A;  3QLH A;  3W8P A;  1CBK A;  1X4D A;  3LOU A;  1FXD A;  3MCM A;  1ACM B;  3HHL A;  1D3W A;  4NMX A;  3R7S B;  2XS7 A;  1C1C B;  1HHS A;  3KXD A;  1CJU B;  4X62 F;  3DMJ A;  2BJ9 A;  2VKR A;  4A8Q A;  2D7S A;  3MF5 A;  1UZH A;  1IM4 A;  4KJI A;  3TJ8 A;  3F56 A;  4DBQ A;  1X5O A;  1NAQ A;  2NXU A;  3PTW A;  3SI8 A;  1IBM F;  4KFB A;  1JLE B;  5H9E J;  5ETV A;  2MKH A;  1PYO B;  2R7U A;  1ZTT A;  4OYZ A;  4C3M A;  4K4Y A;  3UPF A;  2DGU A;  4K50 A;  4MFB A;  1M5K C;  1XBW A;  3CPW R;  1KQF B;  4QCL A;  1GFW B;  4QYR A;  4PQA A;  3NCR A;  2HFO A;  1TK8 A;  4D3G A;  1SC6 A;  2DNL A;  4NI2 B;  2V4J A;  4HHU A;  2I5J A;  3BO2 A;  3RR7 A;  2VV5 A;  3P4U B;  2K3K A;  1CJV B;  3FSI A;  4ED0 A;  3NRB A;  2MY8 A;  2MTL A;  2XY5 A;  3AHP A;  3DRS A;  3PJW A;  1NJX A;  4DL4 A;  3RYL A;  3GP9 A;  3C6U B;  5KG1 A;  2ASY A;  1YK9 A;  4QQB A;  4RL1 A;  2CNK B;  4DV7 F;  4U8V A;  3GIM A;  1ZZF A;  3KK2 A;  5HLF B;  2MLZ A;  5JUM A;  4ECS A;  2ABY A;  4Q43 A;  3QO9 A;  4OYB A;  3NS6 A;  3W5Y A;  4NAS A;  1RSC A;  1Y9O A;  2HHQ A;  1YTY A;  4KGM A;  5B08 A;  3BGR B;  4HDG A;  5EN1 A;  3KLH A;  1XR6 A;  1U4B A;  3BN7 A;  1Y7P A;  2Q1L A;  3LGM A;  5L1J A;  3BR8 A;  2XLK A;  2E44 A;  2HS3 A;  3TA2 A;  4OI4 A;  2IBO A;  2XO6 A;  4DR3 F;  1K9M T;  1NK7 A;  1DHM A;  3AD7 C;  2HQF A;  2Q43 A;  2XMT A;  1I1G A;  2LYV A;  3AQO A;  4MIB A;  5C25 A;  2ZH4 A;  1KOH A;  2XHC A;  2PFF B;  4OJ1 A;  2C2E A;  4WK1 A;  4PUO B;  2HK2 A;  1TP7 A;  2XEX A;  1SIZ A;  4I2P B;  1PG5 B;  4DR5 F;  2G1H A;  3ZZO A;  2AEJ A;  1I6J A;  2EFV A;  5DQI A;  1Q8K A;  3SXL A;  3FMB A;  2YKP A;  2HQC A;  1SUQ A;  2UZA A;  1K1S A;  1UA1 A;  1FJC A;  3NNH A;  3CD6 S;  3PHE A;  1BQM B;  2AYM A;  4ZVE A;  1LK7 A;  1SB6 A;  4DV6 F;  4F4A A;  3M6W A;  3BV8 A;  3T1Y F;  3OTD A;  2FJD B;  3CCJ S;  2FPH X;  2YWK A;  3Q86 A;  1MMN A;  4ZJL A;  2HBQ B;  1D8Y A;  4MTP A;  5DZ6 A;  1U6B A;  3ZO7 A;  3GIK A;  3GB0 A;  3QQC D;  4NXM F;  2CA9 A;  2G2Y A;  2ZHB A;  2FVQ A;  2CJX B;  3AJD A;  2GCF A;  4WFX A;  1FT8 A;  3KMQ A;  2ZZT A;  3QT8 A;  2A10 A;  3MAH A;  1E6Y B;  2FD2 A;  4OIX A;  1UPP A;  3HZG A;  1IWG A;  2KXF A;  1S4E A;  5DS7 A;  2W4P A;  2XI3 A;  3CCZ A;  3ITH B;  2PI4 A;  5ADZ A;  1A7G E;  3PX6 A;  3ILJ A;  2RH3 A;  2Y1L B;  4ED7 A;  1XQI A;  2GMJ A;  2VG6 B;  4YN3 B;  1REG X;  1HPZ B;  1Q79 A;  2Y1R I;  3HVR A;  3ZXW A;  1QUP A;  1GH8 A;  1T0T V;  5HVG A;  3MWB A;  1XWL A;  4U9R A;  1TMM A;  3OSP A;  2EVZ A;  1BY9 A;  1IQT A;  3L3C A;  3JAM Y;  4ZCK A;  3C46 A;  3W65 A;  5CCL A;  5DDQ C;  4QPT A;  1KQG B;  2VPY B;  3I6P A;  1F5A A;  4UY8 5;  4F4K A;  1FFW B;  3JSB A;  4KHM A;  1SC1 B;  3GIL A;  1HBM B;  2IDE A;  3H4D A;  1NDL A;  1BWV A;  1U2R A;  4JI0 J;  3H98 A;  3KK3 A;  4LR9 A;  3E01 B;  4ID5 B;  4LFA F;  3TUP A;  1MML A;  2A0F B;  3A8K A;  5AE1 A;  4CLP A;  2J7K A;  2W01 A;  2CJQ A;  3SZ2 A;  1TZ0 A;  4X4U A;  3T5L A;  4IOA Q;  4NZ6 A;  1URN A;  1SL0 A;  4DPU A;  4NYP A;  4FVM A;  5GAH U;  4NLR A;  1LWC B;  1RCX B;  1RTH A;  3ISN D;  2FLN A;  2H5J B;  2RDJ A;  1ARO P;  1HBO B;  1VRQ C;  4DMZ A;  1X5T A;  2XSJ B;  2RE1 A;  1J5O B;  4O23 A;  1GMU A;  1GXL A;  3QAE A;  2IRU A;  4Z7Y A;  1YSJ A;  4RNN A;  3O8W A;  4J9O A;  3QGI A;  1R8H A;  4LBI A;  1LK5 A;  5KFD A;  3CVK A;  4CLS A;  4P7T A;  1FFS B;  4RUH A;  1FVQ A;  2XMV A;  5A6P A;  1HR0 J;  1F6T A;  5ETQ A;  2UVR A;  4RJV A;  2A2D A;  5KFP A;  2V8V A;  2DR8 A; 
#chains in the Genus database with same CATH homology
 3HCX A;  4CWB A;  1CBK A;  1RU1 A;  4M5K A;  2BMB A;  1EQM A;  3HT0 A;  2CG8 A;  2F65 A;  1DY3 A;  3KUE A;  3MCN A;  3KUH A;  3ILO A;  1G4C A;  1HKA A;  4CYU A;  3ILL A;  1RAO A;  3MCM A;  1TMM A;  3ILJ A;  4M5H A;  1Q0N A;  4PZV A;  5ETO A;  3HD2 A;  1F9H A;  3HSZ A;  3MCO A;  3QBC A;  1RTZ A;  3HSJ A;  5ETR A;  3UD5 A;  4M5G A;  4CRJ A;  3HSG A;  3IP0 A;  1IM6 A;  4M5L A;  5ETT A;  5ETQ A;  1HQ2 A;  5ETS A;  1KBR A;  1EQ0 A;  1RB0 A;  1RU2 A;  4CYU B;  3HD1 A;  5ETM A;  1TMJ A;  4M5N A;  3HSD A;  1EX8 A;  5ETV A;  3KUG A;  4M5M A;  5ETP A;  5ETN A;  4AD6 A;  5ETL A;  4F7V A;  2F63 A;  4M5I A;  3UDV A;  3ILI A;  5ETK A;  3UDE A;  4M5J A;  2QX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...