4M5ZL

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
SYVLTQPPSVSVAPGETARISCGGNNIGTKVLHWYQQTPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDISTDQAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1 chain
total genus 42
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL01
5JHDB 3RIFK 3OF6D 3UYRL 4KXZH 1OTTC 5DEGA 1OLLA 1CU4H 5D1QC 1MQKH 1AGDA 5K9OA 4HKZA 1F8TL 4RA3A 4F15C 5FGBC 3V2AR 3RTQB 3KPRB 4TSAL 4WNQB 5FK9A 5I16A 2NNAB 5JOFB 3OXRA 4OUOA 1JGEB 3TFKC 3VG0L 3O9WB 2D9CA 5ICYB 4P3DA 3R0MA 1DDHA 1KYOJ 4WV1C 1FORH 4ELMA 5C07D 4RIRB 3Q6GL 1CLYH 4IMLA 5IW1A 2QQNH 1UJ3B 4GH7B 5DWUL 2Y36H 2LFGA 4LRNL 3MNZB 3RI5K 5CZVL 4WGWB 3MRNA 3FT4B 4RRPA 2G75A 2RJMA 1INEH 5F7EL 3MRFA 1FCGA 1YEEH 1IGJA 2YPLA 4DZ8A 5IFJB 1GIGH 3CLFH 2QEJA 4PJDB 1B6DA 1YMMA 3EYOA 4JQXA 4XNMA 4W4NA 4LPXA 5DHVA 2K7PA 8FABA 1IC4L 4NZUL 5HGBB 3SE8L 1DSFH 3B5GA 4OD1L 1T2JA 2RAMA 1DBJL 1V7NH 5HHNA 1S9XA 1FO0B 4L8SB 3O8XB 3TCXA 3NCJH 4WY7L 5TFSL 3TNMB 4LPUA 2ERJB 2BDNL 3IXTB 4M6MH 3MFGB 1JPFB 5E95B 1R6VA 3T65B 1YY9D 3MV9E 4M8VA 2Q7YB 5KVGH 1EJOH 4NDMB 1FGNL 3FOLB 3V5HA 1XGYL 4MNQB 5I16B 1XGQB 2XKNB 4WW2B 2ED7A 5C0EB 4X7SH 5CBEB 1VHPA 1U3HB 4JHWL 2AEWA 4RIRA 2CRMA 1T83C 4ONGL 5A2IH 5J1AB 2NZ9C 3BSZL 5CGMA 2EDQA 5K9KB 3FO9A 2ZCHH 4JDVB 1Z6JT 3IJHA 4AIZA 5BZDA 2LAGB 3KYNB 2QQLL 4HXAH 1WBZB 5AZ2L 5GGVY 3MRFB 1MPAL 2BVQA 4WGVB 4DUXA 1BP3B 1UB6A 2HLFD 3BKML 2EH8L 2QKIB 2DQCL 3FN3A 3OQ3B 2HFGL 3MREB 2BNRE 2L7UA 4WO4A 4G8FA 4ELKB 4CNIB 4X5XB 4KKNA 1NMBH 1MFDL 1P4LB 3CH1B 3REVA 1MUJA 1Q94B 3HUJE 3K80A 5HYJB 4ZD3H 5DMIH 5LQBH 3T8XB 1ZLUH 1U93B 4GBXB 2J8UE 2RGSA 1K3ZA 3OMZA 3O4LD 4N8VG 4UQ3B 5D96C 3U30B 2OP4H 5CILL 4YC2C 1ZVSA 4HFUL 1WQVT 5C0AD 4P2QA 2YA0A 4OV6F 3FONA 2HLAB 3TO4D 2EKSB 3M17B 4MAUL 1O7SA 2VYRE 4LAJH 4LKXB 1NGXB 4JAMA 3GSNH 3LMJL 5HHPA 3A6CH 4GSDL 1F4XH 4KUZH 1WIOA 2IQ9L 3O11B 3O2WH 1AHWA 1FZKB 3FOMB 2DL2A 1QACA 4QRUA 1Y6NR 3QXAB 1RIVL 4O00A 2V7HB 3TYFA 5EORH 1C16B 1G7JA 5IF0A 4JQIH 1NGYB 1DVFC 4YHOL 3WBDA 5J8OA 2UUDH 3UROR 4OV5A 3SQBA 3HR5B 1CFSA 2PW2A 4MXVF 5KVGL 4U1NB 4ERSH 1E28B 5EU6A 1XR9B 3GSOB 4AM0A 4JO4H 2FZ3A 2I9LA 1E4WL 5A2JH 5IB5B 3SE3C 3TA3D 3TZVA 4WJ5A 1ZA6A 1GVIA 5IIEB 3DMMA 3JUZA 3G08B 1DANU 1EIBA 2E7CA 4LNRB 3OKMB 2NY0B 4BQ8A 2Q8AH 4RAUB 4NBZB 3T8XA 2AXGB 2EDTA 4OCMC 5BS0B 4YZFE 4AL8L 2VDKL 3J8F7 3BKMH 2FJGA 1T1WA 3RVTC 1ZGLP 4L3AA 3TA3B 1HQ4A 1QSFD 3MXVH 3MUY1 2WLYA 5F9WB 2YPKB 4Z7WB 2HG5A 4JKMA 5E1HB 4AMKL 3CFDB 3MGTA 2AJ3B 3RIAK 3SCMC 4OZGA 3C8KA 2L4OA 3O6FD 4PRBA 1CTOA 5CEXA 4LAQL 1C16A 5IF0B 1NGYA 4JY5H 1Q9OA 4ZSOB 5F3HB 3HC4H 5EUKB 3HR5A 3FTGB 1ZOXA 4Y4FA 1AGEB 3PE9A 4QHLA 2G2RB 4NQSB 1RK1B 3K4AA 4W70A 3JV5A 5C0IB 5A16B 3NGBC 4PFEA 4K8RL 3TZVB 1ONQA 3OJMB 4PJIF 5IV2A 3WFCL 1DVFD 5BW7C 1CICB 2H32H 3LKOB 1W0WA 3JVGA 3CVHH 4J7RA 4WWKD 3P0YH 3OKMA 5DC0A 2VISB 4RAUA 5D1QB 1I3GL 3F7PC 1ZT7B 2G60H 2H26B 4OFIA 4Y5XA 5I6XC 1U8HB 4GXUN 3V6ZA 1C5DB 3MLWH 2BNQE 3L3IA 5I17B 4FG6C 4S1DD 4BZ2L 1T1WB 5B8CC 1IAKB 2XTJE 1LK2A 1CICC 3UDWA 2DBLH 3QEQE 5E2TL 2R8SH 1EZVY 4WY7H 3MV9D 2YUVA 4M7KH 1U8OB 2UWEA 3DYMA 4HH8A 1YYML 1KCKA 2FLRT 4PJAE 1GOFA 2CO7B 3I2CL 4HUVA 1G7LA 1UH4A 1RJLA 1F11A 4KKAD 3D69A 1HNFA 5SWQB 5CEXB 2XI9A 4PLKC 2A6JA 4QWWD 4NQEE 5C70A 1TVBA 4ZQKA 3RY6C 2PKDA 1ZE3C 5D1XD 1OP3K 4M6AA 2CKBA 1BGXH 3PDGA 3MLTB 1C5CH 4GJTB 4XGZB 5INCA 5A16A 1WT5A 3AREA 4NO0B 5L2KB 4Z78B 5DTFA 4ZG1A 3KNBA 3EGSA 1MWAB 1G7HA 5E9DB 4NRXA 3EO0B 3WHE0 5KAQG 3ROLB 3LKOA 2WQRA 3PHSA 4I48B 3P9WB 2W65B 1FNSH 1WCBB 3WYRA 2G5BA 4OLVL 5C7XH 5HHQB 3AS1A 6FABL 2BERA 4OCYL 3ULSA 4PJBF 4QTHA 3EYSL 2DQHL 3HC3L 4RMUA 3ZKXC 3O6LH 3I50H 3MR9A 4TUOB 4DKFH 3TEUA 2IBZY 3O3AB 4ZMAT 1SEBB 4NUJA 5IW3A 3TCLB 4RMQA 1MCWM 2BOBA 5J9PB 5I8EB 4JRXD 1VACB 1YN7A 1WC7A 4C56B 3VRJB 1C7SA 4QRSA 4K71C 3QHTC 3JBG7 3RDTD 1RJLB 4D9RD 4GMSH 4OGYL 4NKMB 4XI5D 2R0KH 4Y5YA 4M43L 1HQRB 4N0UE 3B83A 4GRLB 2HH0H 3FT3B 2I07B 2AI0H 2VDQL 4KUZL 4G9FA 1EEQA 3GMQB 4QOKD 1EAPB 1AXSA 1HCFX 4NWTL 4XNUH 5ID1A 3T0WA 2P24B 3EOBB 2IMNA 1L6XA 5IBUG 3BGMB 1IGML 4Y5VB 1N5YH 3VXMB 2BSRB 1XGRB 1AQKL 3VA6A 1JI1A 3VXSA 1T3FA 1DL7L 3REWB 3KPMA 2GSGB 2E5EA 2EDWA 4ZOEA 3CDCA 3HAEA 4PTTA 1WZKA 4OQTL 4D8PA 4TUOA 3EFFA 3V7AE 3DETD 4BK4A 3NPZB 1OAZL 1T80A 3RWFB 3MA9L 4N1CA 4NWUH 1QVOB 2XACC 15C8L 2H8PA 5GGTL 2FECI 3VRJA 4JFFE 5FV2A 2VLRE 4GAYA 1OF2A 1DBAL 1HHHA 2PCPB 5C0CB 2BHYA 5E2JA 5C07A 4HPYL 4PLJC 2A9NH 2KUTA 1C08A 1MCPL 3HKFA 2XZAL 2JB6B 2FL5B 4DUWA 3FT3A 3GKWL 4YH6A 3KPQB 3NOIA 2VL5A 2I07A 3HPLB 3CIQA 5FDWB 4NSKB 3H42H 2APBA 1U0QA 3T0DA 3S3SA 2QJDA 4EN3C 3SDXB 3K8KA 4LAQH 2DYPA 5IVXB 1OAXH 3RHWF 3BVNA 4NFDA 5D7SL 2R29H 4D3CL 1A6UL 1U8MA 1OB1A 1NCTA 1YMMD 1GPOL 3CC5B 4ZPTB 1U92B 4DZBB 3I02B 4QRRB 2YKLH 1G0XA 3BO8A 4MA3A 2XZQL 4PJHA 4CMMB 5GRXG 5HD8C 3MBED 1K8IB 5IJVA 3FFDB 1RSFA 3O3EA 1T7XA 1MREL 1QFUH 1L0QA 5FYJL 4JY6B 2H8PB 4PJCE 1QLRB 4M9PA 5T3XH 1BHGA 3FT4A 1ZT1A 5GHWL 4WTWA 2G75B 1DL7H 5E5UB 3AROA 5DMGD 1FL3B 1U91B 5BMFH 4XNXH 5B38G 2PCPA 3MA7A 2HTKD 3G6JB 3IFPB 1OWRM 1G9MH 4M1DH 3TN0A 1EGJA 4U0RB 5TE7L 1EPFA 4ZFGH 1C08B 4TRPH 3DHJA 3H9SD 1TQBC 4C56E 4OGXL 2DKMA 3EIFA 4XNMB 43CAA 2DWEA 4BSVA 5C6PB 4DEPC 3UYOD 3VE0A 1FH5L 1CF8H 2AJSL 3RQ3A 2E7LA 3OXSA 4L8SA 4G43A 3QQ3B 4MXWL 5FYLD 2Q6WA 3RA7H 3MLRL 3QDMD 5DSCB 1U8LA 4KV5E 1NGZA 4N0CD 1AD9B 3BKYH 4QRRA 2V2XB 4R2GD 43C9B 3FB5A 4P2YA 1MAKA 2XQYK 4DEPB 3T08A 2HT2D 5AWNH 3H9ZA 3MBXH 3BDXA 1NL0L 3NFPA 1MY5A 2FCBA 2ZJSL 2DQEL 4UTAH 4YE4H 4PG2A 4JFOB 2HN7A 1AGDB 2Y6SC 5KVDH 5I1DA 3FO9B 1D9KC 5MEOA 5BZDB 5TGBA 3BISA 5L2JB 1F5WA 4RDQG 5J1SC 1QFPA 3PHOA 3LOWA 2XFXB 2ATPB 3MA7B 1XGTA 3G6JA 1KG0B 4MD5A 4OCXH 1RV6X 4HC1A 4L8CB 5K93A 4DKAA 3WNOA 3CUPA 1LO4H 3RDTB 4YBLB 1Q9KA 3CD4A 5I30H 1A6ZB 4BQBA 1HKFA 4BSVB 3AM8C 4PGDA 5FYJH 1F3JA 4GUPA 5DK0A 1OTTD 1MUJB 2NY1C 3RVVD 3SKOB 5E6IA 4RBPK 4ZUWB 2X4QA 1N3NA 3D85A 3TZVD 5IB4B 1FGVL 5HYFA 3PP4H 4WFFD 3VG9B 5JHDD 3ZLQC 2AQ3A 3ULUL 4LLMA 4NWTH 4ZUVB 2DJUA 5DJXB 4P2QB 3F7VB 5SV4A 1B6UA 3M17A 4M7ZB 5I76A 2J8UB 5FO9B 3PWLA 3T77A 2AJZA 4JRYD 1Q38A 1LQSR 4D0CA 1CDCA 4G6FB 2KQNA 1ZANH 4K94H 5FYKE 32C2B 4EDWH 4PJEA 1CGXA 4Y4HD 1MCQA 2E3VA 4I3SL 4LKCA 1FZMB 3UZVB 2HH0L 4I4WA 5A3IC 1JTPA 5GS0D 2X70A 5AWNL 5DA4A 4Z7NF 5CSZA 3ZDXE 1R5WA 4PYHA 4XMLH 2ITCA 3H0TB 1A6ZA 5KSBA 4Y19E 1I1CA 1PG7H 3HZMB 3DMMB 3H3PH 5IBLD 5L9DL 5EFIB 1Q9LA 4YEFA 1NUNB 3G08A 5CP3H 4K7PH 5TF1L 4P2QE 3ZTJG 4OCWL 2FO4A 4I2XB 3WHXB 4ZXBC 5IESL 3TBSB 4RX4D 1VERA 5JA9A 5TDNB 5BS0A 2WNGA 3MREA 1A5FH 3RUGB 1R3LB 5BVJA 1LO2H 1QFHA 4WI5A 3OB0K 1BFTA 3QUYB 2BXZA 2BVPB 1YNKH 2FDBP 1ZSDB 1BZ7B 5T5NG 3TZVC 5KSVB 4KZEL 5DYOB 1KNOB 5I76B 5D7SH 1OAZH 1P9MC 5HYJA 1PEZA 3MGTB 3TWCL 1YUHB 4FQQB 3MRKB 2W0KA 3WL9B 4KMQA 4PP2B 2AAVA 3ZKSD 1MFNA 2GW5A 3D2UD 2OL3H 2FB4L 3DI3B 2ZCKH 4GRMA 2OR8A 3RX8A 5EA0L 5DGQA 3VMNA 1AGEA 5I6XB 2RB8A 4UDUB 2G2RA 3E3QE 3QIUA 4RBPH 5TDPA 4KHTL 3UPRA 1XIWB 4RWYH 3O0RH 4PBXA 1R5WB 1U3HC 3N9GL 5EUOF 3S34H 3NIFF 4F7EA 1CICA 2A2QT 2RFXB 1YC7A 1HH6A 5EIIB 3U1SL 5KTEL 2OTWA 3SO3B 5GRUH 1CVSC 2FHFA 3GMNA 1CDIA 3NMEA 1AR1C 3RUGF 2XZQH 1F4WL 3T3MF 1E28A 2OJEB 3HS0B 3QUMH 5IJKC 4FS0A 2C9AA 1U8HA 1C5DA 3L3IB 5I17A 1G7IB 3KLSA 1J05A 2IH3A 5IB2A 2AW2A 5EZIL 4JR9H 3GSQB 4RRPG 4ZUTA 2P8PA 1X5ZA 2BVPA 4N0UB 1EK3A 4PJBB 4M8QA 3SGJC 3SGDI 2P5WE 1BFOA 2DS4A 5EO9A 5EBGA 4KK5D 4Q2ZA 3TP4A 1A7OH 2DLTA 4X8XA 4Z5RA 5JZ7C 2NY6B 4LSRL 2V7NB 5GS1B 1QFWM 3UPCA 4F37F 2Z91B 3FQXB 2LAAA 3P73B 4UDUA 2FYYA 3A6BH 3M1BA 1XIWA 2YD5A 3GHEL 4OZGB 4WHDA 2Q7NA 4FTVE 5L2KA 4Y7MA 4PJXA 1IQWH 3GJFB 4P59L 1L0YA 4HSQA 2A73B 1RZIB 1VFBB 4BZYA 1WCBA 4S0TD 2VLJE 2EDXA 2XZZA 2B2XL 4QHKI 3KR3L 2VC2L 5DQJA 1TJIL 4KK8C 2R4RL 4GG6E 4MJ2A 2HJLA 4NRYB 3ES6A 2O5XH 5CKGA 5HPMB 5HHMB 1INQA 5HHME 3DSFL 4NCC1 4UTAL 5L8JB 3RVWC 1O0VA 3CDYA 2XZCH 5IWLC 1FN4B 5HYQB 4WI8A 4HS6B 1BM3L 5I1JH 3BOVA 1T1XB 4H20H 1MAJA 5ESQA 3O6KL 1Q0XL 1KFAL 4NKIH 5EWIL 3V6ZB 1IGCH 3GSXB 3QEGH 4IJ3B 3H42L 1PY9A 4QRQA 1OAKH 1CDYA 4LHJB 4YLQT 2DQFA 4NGHH 4Y5YB 4MNGA 4P3CH 4A6YH 3LKRB 4JPWL 2NX5B 4DKDC 4XX1E 4P23B 1LHZA 4QHNB 4QRTB 1CFTB 3GUTB 3QDGB 4U1HA 5JDSB 1U8OA 4OZ4A 1EEYB 5A40E 4LCIL 5KANG 5J13B 3G6DL 3QWOA 3MOAL 2IALB 3U4BL 3QPXH 4WUKL 1UH3A 3SJVA 5IJKA 2H2SD 1RJYA 4PY7B 3OHXB 3SEPA 4HK3N 1OTUD 2EDBA 1T3FB 1HINH 1PEWA 3QJFB 3REWA 1JJUA 1I1AB 2GSGA 1PZ5B 3RIAF 4AJ0A 1ZMYA 3FZUD 5DD5L 1OPGL 4P4KD 4OLEA 4XNQA 5FF6A 3DYOA 3IFNH 4LCWB 3VDAA 2PTTB 4NZRL 1M71B 1G7HB 2FRGP 5E9DA 3NIDE 4M7LT 1XGPA 4Z7UF 4YHKL 5FGCB 1WAAF 3NZ8A 2K7QA 4HS6A 3HN3A 3C6LD 4MAYC 1YEGH 5LGHL 2CUHA 1TPXB 1Q9WB 5CS7A 1MCOL 4H1LB 1TQCB 5CIPA 5DJCB 3NABH 4P5TB 4XVTH 3EJZC 3SKJL 5KW9H 4PRPB 3V8OA 1VEMA 1I1YA 4Q7DA 4QXWA 4C4KT 3MRPB 3TCLA 4J12A 4YHIB 3RA7L 4U1HB 2VDLH 4GMTH 4IRSC 1I7ZB 4FZEL 1KIQB 4KQ3H 5F7MC 2HT4D 1CG9A 3QCVL 2EIZA 1NKOA 2NY6D 5F7KC 3B5TA 2OCFD 5TPWH 5C8JA 4JO4L 4KHXH 3RZCD 1HQRA 3V0VB 3GSNA 3CC5A 2NXYD 3NCEB 2DWDA 4O5LH 4MXQD 3WFEL 1HDMA 1PZ5A 5DZNA 3ULUC 3IU4H 3C5SA 3O4LB 1EAPA 1WFTA 2COQA 4H0GA 5I19H 2EE3A 4KPHL 3SDAD 3GJEA 4L8BA 3BPCB 1RPQA 2VQUA 3FFDA 3QI9D 4PRNB 4HWNA 3QRGL 5DWUH 4ODXB 5F9OL 2AV7B 1B3JA 4QRRD 4M93B 4Q6IA 5L0QC 4EEEA 3SO3C 2A1WL 1SM3L 3C5ZA 3MLSL 1OY3B 4PJ8C 4NQTA 1N4XL 3TF7C 3PJSB 4JHZA 4YHYB 1YN6A 2DM7A 5D1XC 4G6AD 5F96L 4Z7VF 3EFFB 5E8PA 3EOAB 5FHAH 5GSRA 1VEOA 2ZUWA 4MJIE 3LPFA 1P7HL 4X7TA 2R1XB 1WWAX 2ZPKL 3RWIA 3UTOA 1CDHA 1NEUA 1A7QL 4POUB 1UWEH 3ARYA 4OD2B 2Z8SA 4OCNC 1HHHB 3L7EB 3TA3C 3OB8A 4DN3H 4V2BA 3QQ3A 1GGUA 3K4ZA 4GXUM 3FQRB 1JPSH 3IDJB 3PP3H 4QCIA 5ACLA 5FGBA 1QBLH 2IAMA 1I9IL 4KK5C 3LEVL 4EDXB 2ORBH 1RJCA 4GG6A 3AM8A 1YYLL 1I3GH 2XA8L 2BNUB 3SKNB 3F7YA 1U8NA 3D85D 1JNHA 1U8IA 3T2PA 1RY7B 1W0YT 3BJLA 4M5YL 3VFOA 4APQC 2YMXL 1ZEAH 3I02A 3BE1L 3FFCD 4GRWB 4MLSA 3G6JF 3MUJA 2ID5A 3BDYH 4R96A 2X4NB 2DTML 3UPAA 1QBBA 3ARWA 2KBGA 2ATPA 5ACMA 1EEUA 3S97C 2XKSA 1HIMH 4NHUB 3QUZB 1E4KC 3PG2A 4PB0L 3L3KA 1NCWH 2VABA 1A4JB 4PJGF 1ZHNB 3N1MC 1ZGLA 3O2DA 3KLAA 2WK2A 1L7TH 1B4JH 4FQCH 5D70L 5ICZB 1WWBX 4I3RL 4FHBD 1F3JB 2F5BL 1MHHB 3U79A 2C4FT 4F3FB 1W72H 3SKOA 3GI9H 4S1QH 5F6IB 2W0PA 4NC0B 4QCIB 5HGAA 3QAZB 2OR9H 5DD0H 5GSVB 2DWEB 1DJSA 5K9QG 3RU8H 4TOYL 2HA1A 3RBGA 1BD2A 3QDJA 4WDIB 5SWZD 3IF1A 2NY0D 1Z9LA 3HA0A 2YEZB 5BO1L 2UUDK 2UWEF 5EBWB 1OP5K 4I0PC 4G42B 1A2YB 1G7PA 2E27L 3BZFA 3X17A 4ETYA 4JGJA 1WFOA 2HFFB 5GRYA 5DD3L 4JKPL 4LCWD 3G5VB 5DHYA 4G3YH 1MJ7H 2ZOLB 3ULVH 1NDGB 3RL1A 1GOGA 1HHKA 3U1SH 2ADFL 1KGCE 4KRNA 5GQBA 4LASH 1WTGT 5ESAB 4FTVB 3F65A 4CN6A 4FQIL 1ZLUK 2ESVE 1JF1B 1UQSB 3HZMA 3FO2B 4X9FA 2JIXA 2MCPH 1ADQA 3DIFB 2VN7A 5L2JA 3EBAA 1RI8A 4NJ9L 3RWDA 5DUML 2OZ4L 3QXWA 4ZTPH 3S88L 1KTKE 4JFED 5LAXB 2A6IB 3O2VL 5E70A 1CLOH 1J8HA 4KKCC 4YFEA 1GGIL 4PG9B 5E8EA 3GRWA 1DBKL 1MJUH 3FB8A 1NH6A 2HT3C 5DR5H 1B0WA 4DTGH 3L5IA 4AMKH 3QFJD 4UAOC 4PJ8A 2YEZA 4XNUL 4HWBH 2CXKA 4G80A 1YUHA 3V7AG 3VRIA 5D7LA 1ULVA 4Y16A 2AABL 3T65A 4PLNC 3SDAB 1NDMB 4HJ0D 5FDYA 5I1EL 5DHYB 3UP1A 5JMOC 3NFNB 4XTRC 2GTZB 5DD0L 2R4SL 4IRJC 4PJAF 1KB5B 2VXSL 1NCDL 2V17L 4X7DC 3ZTNL 5TPWL 3KR3H 4QRPA 3QYCA 1JPGB 3FO1A 1CLZH 4BH7B 3S3PA 4D9QD 1CD1B 3U4EB 5IMOA 4WTZA 3RVUC 2RFXA 2VDRH 3HAEH 4XC3L 3FB7A 5ANME 3QXDB 1T2XA 2BVQB 4IRSA 4YDLC 5CSZB 1T7VA 4K55A 1AGFA 2ADFH 4HJJL 5F9OH 1X6LA 7CGTA 2V2WB 1GGCH 2NY3B 3G6AA 4H88L 1SBSH 4R7NA 3TVMC 5EBLA 5C0AB 4F9LA 4OLUH 5E2WH 5D2LE 5C0GA 3B4NA 2Z93B 2J4WL 5FKPA 3BHBB 1E4XL 1ODAA 2BZDA 4UTBL 2C7UB 2YSSB 1FCCA 5L0QB 4P46D 4Z8FH 3U7WH 4UQ3A 3JWDL 4N9GB 3NZHL 1Z2KA 1NDMA 5ETUB 3GO1L 1KN4H 3BQUD 1XF2A 3EHBD 1FFQA 1NQBA 1BFVL 5LCVL 4N0CC 2ICWA 4JKWA 2EDFA 1NGXA 5ISZA 2BFVL 2ZKHL 3WS6A 2NMSA 1T21B 2F53E 3RWJA 2LE9A 1DQJA 5C2BH 5I0ZA 1SYSA 1I9RL 3PNWB 3ARRA 4HWEL 1FSKC 2EYTA 1YEHH 4I77L 5DRNA 2C1PA 1UWGH 1JNNH 3LSOA 2PW2B 4I0CC 3LS4H 2IPUK 5J56B 3QXDA 4Y2DB 5BOZG 4Q9RH 3HC3H 2NX5D 1CD8A 3H9HB 3U36B 4R3SB 4QOKE 4F7MA 1EAJA 2H1PL 5LGKA 4U1LB 4MJ4A 3V5DA 2ARJQ 2UZXB 4GKNB 3GJFK 1B0RA 4JFPA 2M2DA 2FHBA 3HI6H 4LRNH 1RMFH 1VFUA 1GRWA 2HTLD 3QXTA 1OHQA 5C09D 7FABL 5FKPB 1QPXA 1RHHB 1JP5A 3BDYL 5CEZL 5H2BB 2FBJL 4XP1H 5SWZE 2GJ6D 2DD8H 4JQXC 4OF8A 5KVFL 5JDJA 3MQIA 4YDJB 1G7IA 2IH3B 5E9DD 5K59F 5E94B 1MY7A 4PJ5A 3ARFA 4Z9KB 2I25N 2N56A 2HFEA 1HQ4B 3HE7C 3WNKA 3NFSH 1UM4L 1ZWIB 3C6LA 3INUL 3BYTA 3BH8B 3L1OH 4UV4L 2DQIH 4UV7L 1P7QA 3IKKA 4OZ4B 5EO9B 2J6EA 1BJMA 3PWVA 2X4UB 4XPGH 2VLKD 5ICXA 1DN0B 5DJZA 4L4TE 1DP0A 3HG1E 4KPHH 4I18A 4UB0H 3NTCH 4S11A 4U0QB 4G5ZL 1JYNA 1Q9OB 4ZSOA 4GBXC 5EUKA 1HEZB 1RIHL 3LSOB 3S3JA 3QPQC 4OGAD 4M48H 4LOUD 1CZ8L 3P77A 3Q5OA 4PRPD 3LD8C 4L4VE 1HXMA 5GJTH 2R2BA 5GGRA 2OR9L 1I1AA 2VTFA 5TH2B 4JO1H 4JLRA 4GXVH 4KJQD 4NQSA 1QO3A 2P7TA 2Z31C 4XCCL 1X44A 5BS0E 3RVUD 3V5DB 2BX5A 3VD4A 4GKNA 4HMEA 5LGJA 3QIBC 2E27H 1Z3GL 2PTTA 5DRWB 1TVDA 4L29B 3DRTB 2VSDA 3HE6B 3UC0L 1H5BC 5C6TL 2Y9RT 3O2DH 4POYA 3KLHC 1RU9L 5E2UL 4PP1D 5DQJB 2UV3A 5H2BA 5CJQL 4AY0A 3QEQB 5HGGS 1GGBH 1I9JL 5GGSY 5HYJE 3Q0HA 5E94A 3BW9B 1NMBL 2Y1VA 5AUMA 1LNUA 1NJ9A 1NAMB 4U6VH 5D6DC 5F7WC 2JE8A 4UDTA 2J88H 3HI1A 2EDYA 5HYQA 5DJYB 1NLDH 3QQ9C 4HK0B 4H25B 3VDCA 2I27N 1T1XA 4F9LC 3MACH 3IETA 3SJVE 2N1KA 1I7ZA 1IBGL 5KOMC 1MRDL 1Z9SA 3UTPD 4A6YB 1A14L 1CBVH 1QNZL 3UDWC 2ZG1A 3OAZH 2AEPL 2D7QA 2EE9A 3GBMH 5KSAC 3BD3A 2DWDB 4K3JL 5L6YL 1IC1A 2D7MA 4FQ2L 5ITFA 1TVBB 2B1AH 1CXHA 1NCDH 4X0KB 5C92A 3TLRA 3QIWB 3WLWD 3HZKA 1AIFA 1QO3B 2E7MA 2P7TB 2OSLB 3GJEB 1OAQH 2F9BT 1FVDB 4L8BB 1URLA 2UZYB 4OZHF 3I6KB 1ZGLM 1NCCH 2AKRB 2JELL 1BBJA 2W0LA 4FFVD 1MELA 4UT7L 4XCYA 4ODVL 4C55A 1V5JA 4OIIH 2I24N 3CCHB 4TNWF 2OZ4A 2R15A 4ZFOB 2WIIB 4KZEH 3D3VA 3C5ZB 3HG1B 1E4WH 1SVCP 1W0VA 1JN6B 3QA3B 1G9ML 4M1DL 1UM6L 3LKQB 1U42A 1P84K 1D5BB 1I7TA 2CJUL 2A83B 2Z4QB 2C3VA 4OZHE 3O3AA 2AK4D 4QEGA 4U0RC 3OKOB 2DM3A 4KHTH 4WW1A 4JJ5B 5DQ9B 2FGZA 3L9RA 2XWTA 1GC1C 3C9NA 2ICEB 4HF5L 1A0QH 4LSPH 1BQSA 3PABB 4F8TA 3MLRH 3X3GH 4M62L 1P4BL 5EZOH 1WZLA 1KLUA 3EKCA 1AP2B 3L7EA 3VXRA 3TVMD 1Q72H 2ATKB 3BUYA 4K23H 5MHSD 4ERSL 4FOMA 4JFZH 3TV3L 4HV8A 5BCAA 4FQXC 4G9FB 1QYGH 4GAGH 4P23C 2CO6B 3P9MA 1IGTB 4M03A 3VRLF 3ZSTA 3NN8A 1LE5A 4L4TB 1KIQA 3SDDD 5IB1A 3STLA 4OZFB 2Q3ZA 1F3DH 4M7LL 1AI1H 2AERT 3TNNB 1MI5A 3RKDC 2C4FU 2FGWH 4OBSA 1RAMA 3MLUL 2HLFC 3WLBB 2Y06L 1E6JH 4XCYB 3VWJC 4W68A 5TE6L 5HDBE 5B3JE 3ZKMD 3E2HB 4PB9H 5KZCD 5FHBH 1D6VH 1KTLA 3QDJD 1BD2D 5SWZA 3MJ6A 3GMOB 1EGJL 2X89A 2B0SH 3QA3A 2BFVH 5EOTB 4HWUA 3LKQA 1SEQL 2GYSA 4JCMA 5D6CA 4PTTB 4XWOD 5DS8B 1YMHB 1CR9L 4M7KL 5JO5B 2A83A 4S1SH 3MJGX 4NM4H 1DDHB 1DVFA 2JJUA 3QUZA 4X99B 2ZWLT 2AV7A 4K07A 3V4UL 3AU1B 4YJZL 1A4JA 5F88B 4PJEF 3ULVC 5AZ2H 1QVOA 4I13B 2R0ZH 1TMCB 5E6IC 5BV7C 1G9NC 3P0YL 5CLTA 1FAKT 1HHJB 4C83A 5HHXL 4XZUA 2F74A 3MLWL 5AG9A 1C5BH 3KYKH 1OTSC 2RCSL 1QLFB 4YC2B 4KDWA 1IKFL 1JFQL 1S5IH 2DQCH 2AJUH 3L5WA 5C07B 1U8QB 1FP5A 3L5XL 3W11C 2DBLL 2E6PA 4I1NB 2FL5A 3BI9X 3MGOB 4RFNB 5GSVA 3EDJA 1G9EA 5BJTA 1S9VA 1RMFL 1A1NB 4KKLC 1IM9B 4UU9A 2WWKO 3OX8B 1FPTL 4U49A 4Z7UE 4OZFA 1EX0A 1LILA 3NCFB 1YEFL 3C87A 2VXSH 1JPFA 1U8KB 1ETZB 2N7BA 5D7JC 3DV4A 5FYKU 1MH5B 4PJCA 5AAWA 1KTLB 2P45B 1WEJL 3HRPA 3W39A 1VKXB 1MF2H 4WW2A 1EFQA 1NCUA 4L5FL 3O6KH 1KCLA 4U1SB 2VLLB 4L3EA 3P0VH 2BCKA 1IAOB 4JB9L 5F9DC 3SQOL 4P57B 4Y16D 4MZ2A 4NM8L 3CLEH 1AI1L 2P8LB 3FRUB 3O2DL 1NC4B 2V5YA 1TTGA 4XPGL 2QBWA 5K9KA 4JY6A 1KF9B 2XZCL 3IJHB 5DMGC 3HE6D 2CDEB 1BOGB 4MCZB 5F6HI 3LEXA 3WFBL 3GMPB 2XN9D 3I50L 4WEBL 1RZ8A 2GY7B 2HMIC 2EYRA 3QPXL 4WUKH 1A6WH 1UZ8B 3LEYH 3FB8B 1WIPA 2DMCA 2NR6D 4DVBA 4KI5D 2FJFB 4LDOB 3P9LA 5FO7A 2YUWA 2LU3A 4IRSD 1Q94A 4AL8H 4GLRI 5DJ2A 3HNTH 3FFCB 4JY4B 3VRIB 3TT3H 4LLYA 1U8LB 4MJ5B 1FFNB 3UTSD 2X9XA 2R9HD 2A74A 4NO5B 1MH5A 4PJCB 5J11C 2V2XA 3GMRA 1VKXA 1IVLA 3FONB 4HPOL 3VXMD 4JM2F 3L3HA 4B7LA 1RULL 5DK2A 4ZDHB 1NLDL 4P46A 4O2FB 1T22B 5FM4A 4JFOA 2IFGA 3T04D 1FV1B 5EZJB 2AS5M 5E00B 1GZQB 4PJ7A 2MHAB 2GT9A 2CLRA 2D7TH 3RWCA 3STBA 4LLVA 3MV8E 1WEJH 3PHOB 3HTLX 5F1OB 1G9NL 4ZODA 1FDLH 2FZ3B 2I9LB 4F33B 4OF6A 2ZUQB 5FYLH 2G9HA 3BKJL 3FB6A 1OT2A 2P49B 5HDQL 4JN2A 4HDIA 2JIXB 2MFNA 2FJFA 2RR3A 4NQED 4XPAH 3PGFH 3CNKA 5C0GB 5HI3D 5EC1A 2VQTA 2Z93A 2W9EH 2GEEA 3BHBA 2PN5A 3VXPB 5T1KD 2CUIA 2X4QB 4TUJA 3VCLB 4JY4A 3UJIL 1GJIA 3U82B 4R4BB 4FABL 2W0FA 1IC7L 1XF2B 2F8OA 5EOCH 3CDGA 1KEMH 2PYED 5C0ND 5J11B 3L3HB 1Y18A 2WBKA 3P30H 4FMKA 1IAIL 4RGND 4JO3H 5T1LA 4P46B 2IGFH 1U95A 4K7PY 4U2ZA 3RWJB 2Q1EA 3HI5H 1VFAA 2NY5L 4ZNCD 3QUMA 5D7LB 5EO0B 4BUHA 3HC0A 4Q0XH 4PJFE 4PRBB 1IZKA 1QG3A 1EMTH 1FLRH 2X9YA 1ZLSL 4XVUD 3OWEA 5B38B 1I8KB 4OAWB 3DHMA 4X9GA 4X6BB 4LSUH 2WANA 3C8HA 1JIBA 3C2AL 3NFNA 3VFMB 4OGXH 3MRHB 2EDOA 5DT1L 4GRWH 3O81A 4NN7C 1CU4L 3V4UH 4R3SA 4ODTH 5DJ8B 3D6GA 4F7MB 1JWUB 5EBMB 4NQDE 1FHGA 5AD0B 1NCAL 1HN1A 1MRCL 5KS9E 4LCCA 5J4MA 1JPGA 3FO1B 4NFCA 4BH7A 3F7QA 2X05A 2X10A 3DX7A 1D6VL 3CSYA 5EWIH 3DVGA 4X98B 2DKSA 2FO4B 3QEUA 4G7YL 1A3RL 1MHPL 3UTQA 3TN0D 4TUJB 4NQCE 3B43A 3JTTA 3H9SA 4OFPA 1G9MC 1K9TA 5IK3B 1JZ4A 4I0PB 2MPAH 1I85A 1TZIB 2FSEB 4S1SL 3CDGB 2C5DC 3LQZA 4G8GB 4JO2H 1P1ZA 3BKJH 2ICCA 4E41E 1IAII 3Q1SH 2AI0L 2VDQH 5DVOA 1PD6A 2X4UA 2YWZA 3OV6A 3BPNB 3ZE1E 3UTSB 1DUYA 4MJIB 2UY6A 4Z7QF 3AS3A 3RZCB 1I8KA 1ZT4A 5JIHA 3GSRB 4H1LH 4LF3A 1ZLVK 5I15H 4UZGA 4OCSH 1HYSD 4RFOL 5E8NA 5TH2A 1OARL 3UYPA 5KSBE 4UNVA 5DJ8A 1JWUA 5EBMA 3DARA 4R0LA 5CGYD 4YHKH 2ZUSA 4LVEA 2XN9E 3PNWA 5IHBA 1MFBH 3VGEA 4ZNEE 5IB3B 1BOYA 3CX5K 3CU7A 5GS3A 3MLXL 2VXVL 5DLML 1PYWA 2OM5A 5EULV 4OZFH 5D2LA 3LN4B 2I5YH 4F9PA 3TIDB 1T04A 1ZLSH 2NR6C 3GMNB 4XWOC 3QEUB 3EJYC 5HGHA 5C08E 3WJLC 5HHQA 3H9HA 3U36A 3KYOA 3MYZA 1G1YA 2BP3A 4U1LA 3ULSB 3EDKA 5D8JH 1OW0C 3FQUA 3QEQA 3PQYA 5D2NB 1SJEA 4Y1AA 2XA3A 3ARSA 1H0DA 4I0PA 4GRWF 1KPUB 1TZIA 2FSEA 4EIGB 5GGTH 4ODUB 4N0UA 4QHKJ 2V6HA 4OLYL 3V6FA 3WHE1 5DC9B 2H3NA 2NYYC 3ULVL 1HI6B 5C86A 3PXHA 2I9TA 2HVKB 4NO0D 1J0YA 2X4SA 2ZUUA 4V1DD 4YDJA 5DJDA 1JYVA 2AK4A 4XNZB 2D9QB 4L3CB 4XRCA 1MFDH 1LEIA 2Q76A 2Q8BH 4N90D 4C4KO 1ORSB 2R39A 3F58H 2O61B 3P73A 1TTUA 1TZGH 3VMPA 4ZS7H 4PB9L 5ID1B 5ICXB 2OSLA 3RPIA 3VXRD 2PO6B 4TVPE 1REIA 1P6FA 4PRIB 3EYVB 3DMMC 1T6VN 3LN4A 4G6FD 3S96A 4X6CF 1RZIA 2NY4D 5IFAH 4GG6F 1MJ8L 1KEGH 5ENWA 1YEKL 4ZFOA 3PWPD 3D3VB 5EH1A 2OZ4H 5TJWK 2HWZH 4R26H 4PTUB 3K1DA 5B4MC 1J5OH 4KV5F 1CE6B 5GGUB 4HIHB 4DGYL 1OARH 5F7FA 4OI7A 5D2NA 3CK0L 4DOHE 1QFWI 2R4SH 4OCWH 4E0RA 1UWEL 3KPSA 3MJ7B 4YZFF 3S36X 3CPLB 5T3ZE 5ESQB 2ZCKL 3ARGB 5MENB 3RFZC 5DEZA 2Y36L 4NOFA 4X6DA 1KLUB 3B9AA 3HLAA 1OF2B 3MSPA 3SE4A 4LSSL 3BUYB 2V2TA 5H94A 1CDJA 3LKRA 2BC4B 2ADIA 2OR7A 4P23A 3WFHB 2W60B 3K7UA 5CCKH 1SJHB 2Z0BA 4O58L 2O61A 5D2NE 1X5XA 3EJZD 3GIZH 4XBGB 4A6YA 2R0LL 3H9SE 2YUZA 4XVSL 5MI0C 3DGGA 4NC1E 3U83A 3D48R 4PY7A 4ZO7A 5AZEL 1BAFH 4TPRL 1U92A 2AJXL 5FUOH 4JB9H 4DZBA 4ODTL 4HKJA 3WO4C 3IDYB 3CU1A 3ECBB 3QDME 4HFWB 4OZHA 4PTUA 3S35L 4S2SB 1JHLL 1CE6A 3GKZA 2DICA 4XNQB 4HIHA 5FF6B 2C4XA 5JO5A 1YEDB 3QG6A 3VWJB 3WFBH 3O4OB 2B1HH 4XBPB 2MKLC 2XXCB 2P5WA 1VA9A 1JGLL 1V05A 1SBSL 3SGKA 5BRZA 1C1EH 4RNRB 2P47B 2WIIA 2D03H 4AEIH 1JTTA 3HG1A 2X2YA 2FD6H 1T2QL 2F8VA 2IJ0C 5H8DA 4LVHB 1WGOA 2FX7L 1FFOA 3PHQA 4WO4C 4Z95L 3QO0A 3O8XC 3VW3L 4PY8I 5ANMB 3MGOA 3I3DA 1DFBH 2XY1A 3U9UA 43CAB 2OX5A 4HUWA 1MRCH 1MLCA 2BNRB 1IM9A 3P11L 1M7DB 3HB3C 4MMZC 1HWGB 2A38A 1H3GA 1JF6A 4GKSB 1AP2A 4HBQA 1OW0A 2NY7H 3VXRB 4Z7OF 5DA0B 2V5TA 1R5IB 4CAGA 3RL2B 1EUTA 5I15L 4I77H 1RZKC 3L3JA 1EHLL 3MV7D 1HSBB 1TNMA 1A6VH 5TQ2L 1ETZA 3RTQD 1FYTD 3DO7A 1KJMA 1IEBB 4HKJB 2J3SA 4N8CL 3RAJL 2GK0B 3NN8B 5GGVL 3STLB 5FM5O 4KAQH 1IEHA 5F3BB 4J23A 4U1SA 3HAEG 2VLLA 3C08L 4PJGE 4ODXA 3GIZL 4CRPA 2P5WB 5EZLB 5E9DE 1MLBB 2AEQL 2Q20A 1NGQH 3GI8H 1N59B 1ZK9A 5MEOB 2J5LC 5SWZB 5TGBB 5E7FA 1KCUH 4HGWA 4MCZA 1OL0A 1S9YA 4MHHI 3VJ6B 4Q9QH 3TBYB 4FQ1L 3CGTA 1DVFB 2HTKC 4MD5B 3N1PC 3WMSA 1FFOB 4J2XA 4L8CA 5I1IH 1X5KA 3AU1A 1F6FB 1FAIH 1VDGA 1UEMA 3KWWA 2FHCA 2HRPL 2LTQC 3VFRB 3MRBB 5IFHL 1T5XB 3QEGL 5I75C 2X4PA 1A3LH 1HINL 4OD2A 1KFAH 2D7PA 2I5YL 3NA4A 1MQ8A 3MCLH 4BSJA 4MAYB 4ZUUB 3P4OB 1AC0A 1U8QA 2PETA 4YDLB 3CX5J 4ALAH 4EOWL 3AS0A 5JQ6L 1HNGA 1FC1A 1KN2H 3QR2A 3ALPA 4NQEA 4ZUVA 3U9PL 2GK0A 3ARFC 5E2VL 1KENL 5EU3B 1FL5A 35C8H 2Y7QB 2BVUA 4LQFL 4WUUB 2A6DB 3F7YB 3EOYG 4F7PB 1XF4A 4GAJL 1AE6L 2EDLA 2CDGA 1RZGA 1WZMA 4FP8L 4UINL 2Z31B 2YPVH 5FYJU 5SWSD 5T3ZL 2IFFH 4ZO6A 3DROB 3VJ6A 2V9TA 4OSUH 2PF6A 5I8OL 5M95B 3CK0H 5T1LD 4I4WB 5I1LA 5ABDE 1ZA3A 2H6PA 2UZIL 3R8QA 6CGTA 1YQ2A 4G6MH 1ES0A 3P4MB 4F37K 1ZGLB 4OQTA 4XAKD 3KLAB 5MERB 3VFRA 2J8OA 5IFAL 1U36A 2P43B 3WSQL 1J86A 2CDEA 3HUJF 3JV4B 5C9JB 2ZNWA 4O5LL 1AD0B 3FQTB 1GGTA 5I1KH 4WEUD 3MX0A 1QNZH 2DJ4A 2LVCA 2GAZB 5E5RB 2NW3A 5C0FB 2DLHA 2WIMA 1MHCB 3B3IA 4W4OC 3AC0A 4XPHL 5BVJB 5L6YH 4DVBB 3QUYA 2IMMA 2JJTA 4XC1H 3MRRA 4DKEH 4BZ2H 2BJMH 3Q3GA 2Z8VC 1RIUL 3C09B 4HAGA 5FV1L 5EBWA 1MWAL 4UOJA 4FQQA 4NWUL 4LGRB 1DQDL 1VFAB 3WJJA 1KBGH 4DQOH 2YD8A 3OAYK 4HXBL 2VAAA 5IW6A 4NDMA 2X4RA 1QSEA 4WHTB 5HHVH 3L7FA 1F4YL 3RVXC 3SHSA 15C8H 5DVLA 2VR9A 2BK8A 4XBEH 1CGSH 4KTYA 4YHYC 5DK2B 2FX8L 4R4FL 4HLZH 1AR2A 4M62H 5EZOL 5HGDA 1LGVA 3BP7A 1U3HA 2R69L 3TIEB 4TN9A 4L9LB 3U0WH 4CVZA 3EJJX 3QIWD 5J1AA 5I2IB 3FKUS 4MXVE 5HHOD 4TPRH 3T4AA 4NKDA 4HBCL 1HH6B 5EIIA 4QXTA 3MJ9A 2R4RH 2ARJA 3DVGB 4BFGA 3RWDB 3C60B 1IFHH 4J4PA 4AENB 1F13A 3NH7L 3R0NA 2VXTH 1EGJH 2R2EB 1J05B 4FFWC 2R1YA 1FE8H 5IK3A 3KPPB 3KS0H 3KXFE 4ELKA 3VXNB 3U48A 1N6QL 1XCTB 1BFOB 5JPMA 1MQKL 2GKIA 1BZQK 4NGHL 4G5ZH 2NY3C 4NYLA 5IR1A 3KPOB 3PQYD 1UXSA 3VG0H 4Y16B 4KQ4H 5CUSH 1QFUL 4KKBD 3PL6B 3MOAH 2BSTA 2XA8H 4DJMA 3FQXA 3LH2H 5EU6D 1YEJL 5HHPB 3U4BH 5JOEA 1I3RB 3BP7B 5D2NC 2XRAH 2P5EA 4L9LA 5HVWA 1MCKA 4XH2B 3HC0B 4PJXE 3AREC 3MNVB 4MCYB 4TYUA 3GBLA 1F8TH 3T3PE 2ESVA 4QXGH 4U1IB 1NC2A 1JWSB 3ZL4H 2ARJB 2DQJH 4JKKA 2HT3D 1A6VL 3FRPA 2XKUA 1I1RA 5E1AA 1IKFH 1JFQH 3GNMH 3ROOB 5EG6C 2ITDA 4XBEL 2B7DT 3K74B 4H5SB 4RGMB 4WJ5B 4KTEL 3E3QC 4JREC 2D31A 3QJHB 5F1KC 2QQNL 2DM4A 5D7LE 3O6FC 3GI8L 2PO6D 3FAXA 4FQCL 2OJZH 1CBVL 3V6FB 4B50A 3O6FA 3R1GH 1HE7A 2Y72A 4JDZB 2W9DL 4N9GA 4R97B 2WWKT 3SOBL 1UFUA 1W8NA 3GDBA 3SQOH 1CIDA 4YHLL 4Y4FD 4L3CA 4XRCB 4M1GH 4U6HA 4BSWB 3EW3B 1VADB 3PL6C 3IU3B 2ICWB 3HB3D 3WJJC 5ILTL 3HE6C 3HCVB 2HRPH 3EYQC 2FIRT 4HCRA 1LWRA 3V52L 5JW3H 4PRIA 5IGXH 5IM7B 3VFWA 1X5HA 4U1IA 3K2UL 1JWSA 3AFLA 3CVIH 4PJCF 3G5XA 1U58B 3IFOB 5FYKL 4P2RB 5C0IA 3QG7H 4X6DE 3P3YA 1PG7W 3N85H 1K4DA 2OS7A 4XP5H 4WU5B 1AE6H 3I6LE 2D31B 4L9DA 1MFEH 1QRND 2YD7A 4FP8H 3DXAA 3KPSB 4R90L 4YDKL 3D25B 2J7LA 1EBAA 4MLIA 2E9JA 2FO1A 4UINH 1A02N 4NZTH 2E9BA 2MMXA 1B90A 5CIPB 5DJCA 3WNMA 2X5PA 3HMXL 4DOHB 3HLAB 3TO2A 1ADQL 3PQYB 3LKPB 2B4CH 2V5RA 4P5MB 5DHXB 4XP6H 4LCWE 3T1WA 2NY1D 1U3JA 3I6GA 4R9HA 5IVZA 4UT9H 4LVOB 2K9UA 1LK2B 1ZVYA 4BSWA 5LKNA 1WBXB 5E03A 4ZTOH 5IUSA 2AJVL 1QKZL 3MGAA 1VPOL 2DM2A 4B5EA 2F54A 5D1XB 5FEBA 3LEVH 4H8WH 5EORL 1A5FL 5HJ3A 3ILPA 4APQB 1G7LB 4EUPH 5DJZB 3OKEB 2NCMA 5SWQA 3G04B 3FJTA 4TULH 1T03H 4RMRA 1OLZA 3V0VA 5DRZA 1ZTXH 1VEPA 2EEDA 1YQVH 1R0AL 3S36L 5I9QB 1TTFA 1HDMB 3IXAB 1FNEB 1IM9D 2VXQL 4JPIA 3RGHA 5E5MA 2EH7H 4OJFH 4MQTB 4B41A 1Z0NA 2WV3A 1UYWL 4LPCA 4JN1L 2BNRD 3MRQB 3NAAH 1DQDH 3E0GA 1PDKA 3MRDB 4Q9QL 3VWJA 2CR6A 4XP9H 4TTDC 3X11A 1NBYA 3SE9H 4I48A 3CLFL 3DXAB 4P9HH 2B5IC 3UX9B 3D25A 1PJ9A 5E6ZA 4JM4H 3K8MA 4N5EC 1VGKB 4F15B 3C09C 3H7LA 3O4LE 2JK5A 2WWMC 3IS0X 3MRMB 3JWOC 5IFHH 3MR9B 3QCTH 3O4OC 1D5MA 4K8RC 1RVFH 3I6GB 1SEBA 3AY4C 5AUMB 4RMSA 1H3PH 4R4FH 1LNUB 1BQLH 1WBXA 3FN9A 3N85L 4UDTB 4BH8B 3WDJA 2HT2C 3DRQB 4U1MB 4X7TB 3L5JA 1W72L 3X3FL 3O0RL 1T6WA 4D0DA 1OD9A 2F5AH 5HYIA 1S5HB 3HUJA 2CGRL 2QSCL 4PV9A 1MFAL 3QULB 1R5IA 3BQUA 1IJ9A 3CJJA 3RL2A 3RWEB 2J5LB 1AJ7H 1CFNA 1BQHB 1FNEA 4HJJH 4LCUB 1O7VA 5JR1L 3LV3B 4M1CC 2Q86B 5DDHB 5GRUL 4A2MA 3RWGA 4Z7OE 1JPTL 1FO0L 2OLDA 5I75B 1A4KA 1A7PH 1CT8A 5BXFB 3BGMA 3ULVF 1G7QA 4MNHB 5DMJB 5HSFA 3VXSE 3CCHA 1JHTB 3MLVL 2G60L 1A7OL 3BESR 2BOCB 1X9QA 3T4YB 3SY0B 3D39B 3D0LB 2HT4C 1RUAH 2YRPA 4WFFE 4U4BA 1QR1A 4ONGH 5GISH 4BK5A 3QUYC 5ICYA 1YEDA 3QG6B 4OCRL 5D1ZD 5DEFB 4M9OA 3ZT5A 4OCSL 2BNQD 3ARGD 3L3KB 5FGRA 3SGKC 3BXNB 1ZHNA 5ITBH 3AB0C 2GITB 4G9DA 3UTTD 1CL7L 4YK4C 4UB0L 3QNZB 4JO2L 4X80L 5DQ9A 1J87A 2O93L 2F8XC 2NLJA 3PABA 2GJ6A 1S5HA 2JJWA 1MHHA 3Q1SL 4YHLH 4Z7QE 4F3FA 3VMOA 4JE4B 4MAYA 3SE3A 1MCJA 4CVWA 4MA8H 3E6FB 2EYSA 4OT1H 2DQIL 3KPQA 1TZHA 4HV8B 1CFNB 1PGRB 2VL5B 1BQHA 1JRHL 3U9UB 4JPVL 1JGUH 3F12A 4LCUA 4NQEB 3Q5TA 3KLHD 3IF1B 1S7UB 5I74C 2DYPB 4I5BB 1T5WA 1RIHH 2EO9A 3X12A 2M8XA 4YPJA 3IXTA 3BZFB 5H37G 4MNHA 3L3JB 2CDGB 3VXQB 4W6XB 3QRFM 3T0VA 4Y5VC 2Z31A 5HDOA 1KIUA 4PJHE 2BHUA 1BM3H 3SY0A 2UVFA 1XZ0A 2PYEE 3T0EA 5DS8A 3KYMB 1QR1B 4RMVA 4PJIE 1ZA3B 2H6PB 1H5BB 1J7VR 5JW3L 4UOW0 3WDHA 1WT5C 3L3DB 3MC0A 2GITA 4X6CE 1F6LL 4EN3B 1KB9K 3GSUA 4AIZB 4XPBL 2F74B 3NIGE 3F8UB 2NLJB 3DIFA 4X8JA 1WBZA 3FQTA 1NGPH 5GJSH 2YN5A 3GM8A 1T0MB 3TN0B 2VLJB 1YC8A 1GGBL 1I9JH 4TVPD 2EYSB 4OUUA 5IVOA 3D39E 4WO4B 4EI6B 1J5OL 3F62A 4G8FB 1WAAA 3WE6A 1WTLA 3PWUB 4UU9B 1KEGL 3RNQA 4QNPE 1IGMH 5T1DL 3SKJH 1SQ2N 1BFVH 1V3MA 4XXDB 2VNCA 2PR4H 3W11D 1F00I 2D4DA 2GCYA 5J3HD 1IC5L 1X3DA 4HUMB 4PRHE 1JNLL 4D0BB 5EU3A 5C2BL 3MA9H 1C12A 3TT1H 3P0GB 1VPOH 4OD3H 4QXGL 2A6DA 2AK1H 2OI9B 1KB5A 3MLZL 1OAQL 3BJ91 3EO1A 3QHZL 4BKLB 1RJZB 1KIRA 4P9HL 3BPNC 4U1JA 3L3DA 5IROC 1NC4A 2I60L 4TSBH 4HPYH 1UACL 1CD1A 3U4EA 3T4AB 1U6AL 1ND0B 5IVXF 1RZ7L 1EXUB 4QXTB 2APTA 5IQ7L 4HX1A 1ZLWK 5DF0A 2VL4A 4NP4L 2RQ8A 1AFVL 1BX2A 4MA1B 1XGTB 5HI5D 5CEZE 2P5ED 2VDPH 3ZSSA 1T0MA 1XR9A 2X1WL 5JQHC 3B2VL 5DO2D 1ES0B 3P4MA 2R2EA 2O5YL 4QHMA 3W5NA 4UOW1 2HVJB 3TVMB 2BVYA 5F9AC 1A3QA 5TE6H 4J1UB 2BY1A 5C0RL 1IARB 4LNRA 1AD0A 4YAQB 1Q72L 3SE9L 1U2CA 2CK2A 3FT2B 3ZKMC 5FHAL 4I2XE 3L1OL 3D2UB 2NW2B 1RFDH 3LDBC 3U46B 3ZE0F 4EI5A 3ZE2F 5CD5C 2D03L 2VIRB 4AEIL 4Y4HA 2CXGA 3BWUC 4GAFB 4NO5A 4UV4H 4U1GB 3EYUH 3TV3H 2FJGB 1P4IL 4MSWB 4Y4KD 4QRRE 4D0BA 4JZJA 4NZJA 5EUOB 1PSKH 3QHFH 2XQBH 3RVVC 1KJVB 1MI5D 4BKLA 5GRWA 1I9IH 5I18L 5BMFL 4M00A 2P8MA 1P4BH 2EYTB 5IW6B 5DRNB 4BFIB 2VR4A 2X89D 1UVQB 4XP5L 5E99H 4XNXL 1EO8H 1OSPL 4QTIL 5D7JB 3KJ6H 1CYGA 1IEAB 3DGCR 2NY2D 2VQ1B 4XHJC 3TIEA 1ZEAL 2ITDB 4PRID 2NTFB 3IAPA 3GEWB 3V6OC 3V5KA 2Q87A 2Z35A 4NZTL 4HWBA 3H0TA 5KSBB 4PJ9C 3TC9A 1IRAY 4JFEB 4LMQE 4OLXH 4EKXA 5CBAA 3IDGA 1YA5A 2EO1A 4S10A 4PRHA 3C60A 3O6FB 5AYQA 1XCQB 5D7JD 3VCLA 3IGAB 3D2UA 5TDNA 1XH3A 2X40A 4R2GC 2Q8BL 5F44A 4KI5F 1RK0B 4Q9CA 1FBIL 4EQ2A 1H15B 2C1OA 4JM2B 4KRPC 3V4PH 5GRZA 3DV6B 4D2NA 4MD4B 4DWHA 4KVNL 5KVDL 5EUOA 2O5YH 1KNOA 3GI9L 2R23B 3QT2A 4FNLL 2Y5EA 5KSUB 1P7QB 5T1LB 1KB5L 3HCVA 3QWRD 1AY1L 4L1HA 4LARL 4HH9B 4CU7A 4BFIA 4PG2C 4KRPB 3GBNH 4QNPF 5BO1H 3EFDL 3P77B 1MJJB 4G6JH 1HXMB 1KCVH 3GB7A 5HVHC 5J12B 3VDBA 2F54D 1U58A 4L3ED 1NCCL 5TDPB 5LVEA 1FYTB 3WJLA 4JM4L 4HKXB 2ZSVA 2AXFA 2CIKA 2E6JA 4TOYH 4H0HB 4XPBH 2NY2C 2V5SA 3MRJA 3THML 3EO0A 4HMCA 3HE6A 1LO0L 5HI5C 1BIIA 3QCUH 4O2EB 1LO5A 4X98A 1I4FB 1U9KA 3WDIA 2BVOA 4UNUA 3UTQB 1M7IA 5F71A 3TPUA 3BRDA 5LJYH 2JCCF 3LKPA 4Z0BH 3X3GL 1QFWL 2P8PB 4G8GA 2BOBB 2DLIA 3M8OH 4JEGB 3SDDC 1PKQB 4K23L 4FXGA 2VH5L 3EAKA 2FR4B 3K81A 4H25A 2IFFL 3TT3L 2VJXA 4XCEB 3FO0H 5HDBF 5F1NB 5CWSB 5DVNA 4MAUH 1U3YA 4YXKH 4YHMH 3UTSA 1OTUC 3H7BA 1NANH 5C0AE 4R7DA 4YDVB 3WNNA 1HYSC 3RGVD 1TJGL 3CXHK 4WI7A 2F19L 3U0TB 2ENSA 3WIFB 1KACB 2Y06H 1ITCA 1CLOL 3BH9B 4GFTB 3UEZA 4E42A 5IEHA 5TE4L 3HE7D 4Z77B 4XVUC 1IE5A 1LEKA 2ORBL 4D3CH 3M1BB 5ELIA 4HKXA 1GPOH 2XWJA 1OSZB 3H3BC 4WFEE 4PREA 3B6SB 1A7NL 4DCQA 3D18A 4Z7NE 3NIFE 1FFRA 4Y19D 1NAKL 1I4FA 5EOCL 2BVOB 5I1KL 4GRWE 1JN6A 1VGKA 3GHBL 4HXBH 2EXWD 5K9JH 1LP9F 3CFEA 5H35A 2QL1A 1UM5H 5JUEL 4RFEA 4ACPA 1KPUA 4IMKC 5SWSE 4ODUA 1CGSL 3CFBA 3PDDA 4NN5C 4BH8A 4PY8J 4H26A 1U41A 2IPKB 3DRQA 2IWGA 5EO1A 4YIQA 2P44B 4HG4K 5E0QA 3T3PF 3OJVC 3SBWA 3TO2B 1JYXA 5DJDB 4PV9B 2R69H 5C0CA 4P5MA 4NQVB 5EA0H 2P42B 2OTUA 1G9NH 1D5XA 3RWEA 5GGSA 4HGKC 3MODL 3P30L 5FO8A 1FGNH 2W07A 3KDMB 3KS0J 3QDGA 3OSKA 1NFDE 5IEHB 4NSKA 4OF5A 4RMTA 1LE5B 2OMBA 5IB1B 1EMTL 1FLRL 2ZG2A 5HJ3B 4MAYD 4PJAA 4OIBA 1BWWA 2FNBA 1L9MA 2ZUVA 4GS7B 2MKWA 2J4WH 1PBYA 1BQHG 4P2RD 1JGVL 1JHTA 1S9KC 1RUQH 2ZJSH 4BZ1H 3O6ML 3UAJC 3D39A 1EJOL 1M7XA 2H9GB 5H35B 1QEWB 5DJ6A 5IJVB 1AGBA 5FKAB 5I74B 4NN6B 5GS2D 3I85A 1F2QA 1KYOK 1TLKA 3IS1X 1NBYB 5I18H 2Z31D 3MOQA 5MENA 4M5ZH 1ZT1B 1YEJH 3LZFL 3TJEH 1WIUA 2P4AB 1QLFA 3ARBA 1FL3A 1U91A 5A1AA 1JZ8A 2ICWJ 3QAZC 4BA8A 2FIKA 2ZCHL 1JK8B 3WXWH 4KQ4L 2V2TB 4MNGE 3LRGA 5GGSB 1QRKA 3RGVC 2ADIB 2HJFB 4Z76A 1JHKH 4YHIA 5FUCE 2NXZD 4U1MA 4OKDA 5IWLA 1YDPB 3MZGB 4K3EL 3PDOA 2FECL 4D0DB 5L7XH 4EUPB 3OX8A 2FEEI 1CG9B 3GK8H 4PJFF 3MPCA 4OZGE 3T0EE 4ZSOE 3NCYP 1FQ9C 4N68A 2AGJL 4HJGA 1C5CL 2VOTA 3SGDH 4WI6A 5T3ZH 3T2NL 1NGZB 4TNVF 1IM3B 1DQLH 1UCBL 2VITA 3ORJA 5AG8A 4XMLL 5KVFH 2WZPD 3C5SB 3O4LA 4HFWA 4I3GA 4OZHB 5L2KE 2CD0A 4WW2F 4S2SA 3IDXL 4NC1C 2A0LC 5HY9B 1AGBB 4L3EB 1CGWA 2EICA 3INUH 1IAOA 4ZOBA 3QCUL 4X5WA 1R5VB 5JXEC 5C9KA 3O2WL 1S7VB 2OQJB 4ZXBD 3V0WL 2P48B 1N7MH 4MDJA 2IQ9H 4JQIL 1OWWA 4X8JB 4YHOH 3BGFB 4Z0BL 3VXOB 1YN6B 5C0RH 3QEQD 2W9DH 4WW2C 1KCVL 1JK8A 4I0PD 1CTNA 2YD3A 1EHNA 3QO0B 4YX2L 3WUWA 5MP6H 3BXNA 2J6EH 3CUPB 3FCTB 3B9EA 3VFGL 2D7NA 3SDDB 1U8JB 5EOQH 3BYYA 1EV2E 3CFCH 3EYUL 4IOSD 3WO4B 2GUOA 5DFVC 3GFUA 2LABA 3ULVE 4GXVL 1A64A 2JB5L 3DMMD 5E6IB 4ZUWA 1QSVA 5BV7B 4R90H 3FFCA 5DUBB 3UJTH 2VZ3A 4S1RH 1P53A 2IAMB 2F53A 5L8KB 5FOBA 5HYEA 5J6GA 1A1OA 4DAGH 2YD4A 2VITB 1IBGH 5JOPE 4JANA 2FX8H 3F7VA 4FN0A 3V4VL 4HCRL 4WHYH 4LLUB 1WFNA 4U6VL 2KKQA 4IJ3C 1JNHB 5CJQH 4X5WB 4OQ1A 1J12A 1KXTB 3VFOB 4NNXA 3OG4B 3FAWA 1FV1A 4LSSH 3BKCL 4R26L 1A6AB 3LQAL 4Z18A 3LB6D 2MHAA 1YEKH 3QUZC 1HXYA 1EXUA 1FVEA 4CADA 5JOFA 1J88A 1JGEA 1WUNT 4BELD 3QO1A 4WI9A 1F45A 5GZOC 4RAVB 3MNWB 4QXUL 1H5BA 2VZSA 2QQKL 3AAZB 5HXMA 4F33A 1FNFA 1NBZA 1OQXA 4R4ND 4EBQH 1U8JA 3DVNA 1F6AB 4XTRD 2FBOJ 5D72L 2EH7L 4J3SA 2EEBA 4AIXA 4KZDL 3FT2A 3WHXA 2YPLB 4KK6C 5TQ0L 5B8CB 1I8LC 1UJ3C 4WWKA 1MCFA 5J1TC 3MXWL 4PJDA 1NMCC 4P23D 1F4AA 4TVPL 4ZAKA 4ODSH 3RUGA 1DQQA 5J6GB 4M61B 3ZHLA 4QY8A 1R0AH 5JUEH 2YOCA 1BZ7A 2J6EL 2VXQH 4O51B 3UBXA 3C60D 5DJ0A 2A6KA 4YHPB 4PJIB 5KAQF 4WUUA 4CVXA 5DD1L 3WFZA 5CJXC 4JFZL 4YHZL 5D7IA 1FSKB 3MRKA 4ZS6D 2XIDA 5JPNB 1DBBL 5IBLC 3JV0A 4MQSB 2ZP0T 3MV9A 1CQYA 2DQJL 3I75A 3ZO0A 3VFNB 3GKWH 1K2DA 2AJXH 2CLVA 5FUOL 2X1PA 1AXTH 3V5HB 1A6TB 3CXDH 3DROA 3B5HA 5CSGA 2BSED 3QO1B 2XY2A 4K9EH 4LVHC 3QIUB 1I85C 5IVNA 4PJDE 3O6LL 4RZCA 1JCKA 4KVCH 5MERA 4HUKB 3HG1D 5CBAB 1L7IL 5ACZA 5LG1A 3DVIA 5D96B 3QNXB 3HPJB 4WUUE 2XOTA 5ECJE 3ESVF 2APXA 3OKKB 3WNPA 2WUCL 2OXGA 2E8ZA 1J8HE 1UB6B 3U6RA 1MCEA 1J8HB 2NW3B 3QZWG 1NCNA 5CFHA 5E8EB 3JTTB 3MJ9L 3UZQA 2D7OA 2YR3A 2HVJA 3KYKL 4X5XA 5IHLB 2BSSB 4HS8L 1NEZA 2NY0C 4J3WA 1SHMA 4OCRH 3CH1A 4PJ8B 4JCLA 4PJIA 1YECH 1DLHB 2DQTL 2ZUQC 4M5ZL 1BJ1H 3V52H 2WP3T 4N0RA 3EOTH 4QRPD 3MV11 4Q2ZB 5JNYB 3JWOL 4Y2OA 4Z0XB 5F7LB 3WS3A 4MNQD 1DZBA 3U46A 3MV7A 4FQHA 4EI5B 5D93B 2DI8A 3PGCB 1RUPL 4D94A 4ZFGL 4EJ1C 2X4RB 4G8GD 4WHTA 1TZGL 2UVEA 3QIBB 4JQVA 3GSRA 4Z95H 3BIKB 2R0KL 3EDEA 1HIML 4MXWH 4RGOH 1AKJA 1KJVA 3X13B 1DEDA 4R0LC 3C8DA 4K3HA 3RGVB 3C6SB 1JPST 5IBTH 3W0WA 3MV8A 2OI9C 4QRPB 5DMYA 4ZNEA 2P8MB 5IB3A 5T5NF 3MRJB 1X7QA 3KLDA 2IH1A 2JCCB 2YMXH 3CSPA 4XVTL 5FYJE 3ILQC 4O02L 3GZKA 4LU5H 2CLZB 1KIPA 3HE7A 3IFNL 4IRSB 2DTMH 3F7RA 5DXWA 1UCBH 5B39G 1RZKL 5ADPH 2C3WA 3VXSD 4AT6A 1YEFH 2NTFA 5HPMA 3TPUB 3BZ4B 8CGTA 1SMOA 1TCMA 4Y19A 1ZAGA 4P2OD 1DE4A 1NEZB 1FN4A 2HTLC 4F7TA 4FXGB 2FR4A 1DLHA 4U1KA 1HI6A 1UC6A 2HVKA 1FZJB 4XCEA 1YMME 5F1NA 2YSSA 3TESA 1BVKB 3TBWA 3V0WH 3FQWA 2F58L 5FECA 2JTDA 2WUCH 5ETUA 4WV1A 4O58H 1SY6L 2FH6A 4MNGB 1DCLA 3QIBA 2NX5A 1J0ZA 5CEYA 2PXYA 3HFML 3LKNB 5ISZB 5C0DA 4IBLT 1MRFH 3A6OA 1T21A 4PJFA 1DQJB 3G9VA 1MAML 1OGTA 4P9ML 3VGFA 3QWOB 4OFKA 1BAFL 2ZSWB 2XWJB 3BN9C 4ZTPL 4POZC 2YPVL 4LDEB 4NQDA 2W1NA 2YXFA 4HUXB 1ZKAA 4I18C 5F3HA 5SX5K 2ESVB 5SWSA 3L3GB 4OKVA 4NN7B 2MSPA 5JW4N 2CLZA 3WV0A 4Y2DA 1F2XK 2V5MA 3GB7B 2CKBH 1FG2A 4FQLH 4KI5C 4DN4H 5BQ7A 2HYMA 4X7EC 4MZ3A 5E2VH 4FQJH 4KUCD 4TUKH 5TE7H 1B0RB 1FZOA 1H3VA 4I3SH 1S7QB 3KXFA 1EA9C 3CFBB 1KJ2H 3RKPA 3KVQA 1KJ2B 4W81A 1SJVA 3VW3H 3RWHA 2OP4L 5D1QA 3FQNB 3MXWH 1VFOA 1J1OH 1BVKA 4H1LA 4O4YH 3TBWB 1M7IB 2EIDA 3TH3T 4KK9C 4NQVA 4PRPA 4MA1C 1D5XB 2XPGA 3H3PL 3VFPB 2X4OA 4EBQL 3SGJA 1I8IB 5MEND 3UTTE 2NY7L 1BLNA 5LWYH 3QFJB 4HIIB 3HZYA 3WSQH 1XAUA 3ME0A 1D5ZB 4XXCA 4OB5L 5D72H 4JFFB 3NH7H 1HEZA 4N9OB 3U0TA 3WIFA 2JKXA 3ZYZA 3BH9A 4E42B 1NGQL 4LLWB 5FA3A 1U3HD 4JGMA 1IGFL 4NNYA 4P46C 5DZLA 3AREB 3BPCA 5LGJB 1OSZA 3UBXI 3ARPA 4BQCA 1UZ6F 3D18B 4HHAA 3G6JE 5ESVA 2BY3A 1NBVL 4FQXB 5EU5A 5I66B 1LE9B 2WINB 3GO1H 1J1XH 1WAAE 4J4PD 1M05B 4KJPD 1FFPB 4IRJA 3ELAT 3IVKA 2CRZA 2QR0B 4OD1H 2M1KA 4KKCD 2NY5H 2VKWA 5T33H 4HQQL 5IVZB 1X5FA 1NAMA 2X1XR 4X7SL 3VFPA 2B4CC 3HI1B 2IPKA 4LHQB 1RUMH 5CD3A 1FVCB 3S5LA 1I8IA 4HUWB 1EO8L 3RWIB 4OFYA 1MLCB 3PDOB 4YIQB 2J8UF 3KJ6L 1M7DA 5GZND 2FEEL 2ED8A 4CU6A 1MSPA 4FFZH 2ARWA 4PBWD 4AEHH 4NT6B 4W6YB 3MFFB 5KG9B 3BGFC 3CFIC 3G04A 4D9LH 3GSWA 4E9LA 4JHBA 3D3VD 4XMPH 1DQML 4AK1A 2VXTL 3KDMA 3DO7B 4GAJH 4X6EA 4MS8D 1TVHB 1AIFB 4ORGB 5FYJD 2SEBA 5FA3B 3BT2L 1FIGL 5CP3A 5JHDA 4NBXB 3VGAC 4PJAB 1MCLA 2DQGH 2BNUA 3DXAE 3SKNA 2VDML 1BQUA 5DUMH 3SDXF 2EDHA 2F53D 2BSRA 1UA6H 3KPLB 2GTWA 4MQXD 4K3GA 4YO0A 3ZL4L 2OQJA 1M05A 1E6OH 1S9YB 2ILLA 3HAEB 3GGWA 2D4FA 3GBNL 5HI4C 2ZOKA 1CE1H 1JF5A 4NQXB 4ELMB 4LARH 1LO3H 2LQRA 3IAGC 3O3UN 4C59B 3SDDA 2XWTB 1RZJH 4YGAB 1ITBB 3C9NB 2F58H 2ICEA 3KPRE 4M6NL 3QUXC 4NNPH 1EJ6A 2O26U 5J6HA 3EYFA 3MFFA 5KG9A 4ZUUA 3GSNL 2CRIA 1G6RB 2YRZA 5FYKH 4ZFOL 3S35X 3MYJB 1R24A 2FWOA 3IT8D 4KU1A 3THMH 5ADPL 2W91A 1BBDH 5FDWA 4NKIL 1ZHKB 3VXUD 1RIVH 3JVGC 1YDPA 2DQUH 2DIJA 2V9RA 8FABB 4TTGA 4WFHE 5IGXL 3MUHL 5IVXA 1CI5A 1TFHA 4ISVB 3BVNB 2WP3O 1UACH 4NJAH 2M26A 1G7QB 3NACL 3CVIL 1F4YH 4JO3L 1RZ7H 1QUNA 1K6QH 3E6HB 3OZ9L 4KRLB 3F6LA 3HI5L 2Q7YA 1IM3A 3ZKND 2KZ1B 4HZLA 1HXYB 4CADB 2GFBB 2OL3L 3D0LA 4FZ8H 4OFDA 4CMMA 1UKSA 2XTJB 1GZPA 1T1ZB 4OCLC 1YMHA 3VI3E 1XGUB 4X9IA 5FM5M 4NUGH 5CBEA 4O9HL 4KGJA 4LPTA 5CJOH 1R3KB 2J2ZA 4XP4H 5GRJL 5GZOD 1MAMH 1GAFH 2YC1A 3QDMB 5L88H 3QIUD 4IIQC 3GMMA 4C83B 3KYNA 4MDJB 3JV4A 5FGCE 4JHAL 5C9JA 2B39A 2B4CL 5IVXE 4G8EA 5EUOE 5KVMC 1CICD 2OXHA 3QUXB 4ZUSA 5B8CA 3E6FA 3I3BA 4TUKL 4YFLI 2QKIA 2FWOB 3EOTL 1TZHB 1JRHI 3GHBH 1CE1L 4IOFD 1KPVA 5DO2C 4K8RH 1MCHA 1IGIH 3MRRB 2IPUG 5DJ0B 3S4SB 9CGTA 2OK0H 1HYRC 1AC6A 1DANT 4LLQB 3RY4A 1G6VK 4I5BA 1T5WB 1KOAA 4OGAC 1QSZA 4O4YL 5EZIH 1U93A 4GBXA 1HSAB 2QSQA 5JPNA 2F53B 5DD6B 2DIBA 2VLJD 3LH2L 1JTOA 5F70A 3WXVL 4Z7VE 43C9A 1B4RA 4HZLB 3T2OA 4CN1A 2GFBA 2EKSA 2XRAL 4LLUA 4AIOA 3RZCC 1J8KA 1LVEA 3QB7C 1W72B 1GH7A 3QUXD 4N1HB 4NBYB 4PV8A 4JFXA 3ZDYE 5CZXC 2DD8L 1HZHH 1S3KL 3GSUB 3GMMB 2VDOH 5IMOB 4NKDB 2AQ2A 5AAMA 1CFSB 5ACZB 3FB7B 3QNXA 2FJHB 1O5DT 1Q0XH 1FL6B 5T3XE 4EI5C 1MCPH 2EE2A 5MHSE 2BVTA 1IGCL 1IQWL 1QFOA 3GSOA 4AM0B 2EYRB 4OUUB 5FUZH 5JHLL 1KLFA 4J3XA 2IBZX 4KJPC 3KPPA 1BZ9A 4KMLB 4MQXC 3VFVA 1YNTB 3NAAL 3PWUA 3S4SG 5I73B 5FO7B 3MLVH 3N50A 5DK0B 3VFTA 4LLQA 5JPMB 4XXDA 1UH2A 4OLYH 5ILTH 4N8VA 2UYLA 3W0WE 3HNVL 3KPOA 1FFNA 1YNLL 1UEYA 1ACYH 3J7HA 2DLFH 3UYRH 4LLMB 1IT9H 1RUQL 3OAYH 2YPKA 2A6KB 4YHPA 3U0PB 2CK0H 3DUSA 4FA8A 1IGYB 3X13A 3DPBA 5D71L 3C6SA 5C6TH 3F58L 1T22A 3BRGC 2IF7A 4XXCC 3N0PB 2EXYC 1QHOA 3ALXA 4AG4H 2C1PB 3GM0A 5HVGB 4JO1L 4ZXBB 4H0IA 2CLRB 3VFUA 4LEOB 4PRDA 4LKCB 5I71C 4YPGA 4YXHL 4F7CB 3SJVD 2O5ZH 3P40A 4QHLB 2B5IB 1K8DB 1Y0LA 3IRPX 5CZVH 4HKBB 2WQ8A 1QA9B 1EVTC 1FH5H 1OPGH 2AJSH 3KG5A 4QHMB 4X6CB 5C0JB 1OAUL 5EFIA 4LVOC 5A2KH 4P4KA 4N8CH 2DIAA 5I1GH 4Z7VA 4PLJD 4K3JH 4CDGC 3AS2A 4K7FB 4XMKL 4OM0L 2NPLX 3OPZH 1N64L 3NCBB 1OVZA 4G8IA 1FNLA 5LWYL 4Y4HB 2D3VA 4HIXL 4R4BA 5TFSH 3MBXL 4BYHA 4I3RH 4XCFH 1IAKA 3ARGC 4CJ1A 1VADA 2BSSA 4Y2DC 2Z9TA 2PXYB 3LKNA 3Q6FB 2H2SC 5B39B 1WBYB 4NM8H 4ZOCA 1VSCA 1A9BB 1U95B 4X80H 3ZE1F 5JNYA 4MGXA 4Z0XA 4UT6L 3WS3B 2WWMD 1F11B 3PGCA 4ORZC 1IMHC 1KENH 4AH2B 5FAAA 3SE4C 1UVQA 4MX7A 4LQFH 4XP9L 3MRHA 2XV6B 4TVSa 5E24E 3LAFA 4HS3B 1FG2B 5ALBL 2VZ1A 3IFOA 3VWKB 2CKBB 1PLGL 3S6CA 2Y4SA 2YWYA 4RSVA 5DD3H 2CIIB 4LP5A 2R2HB 1T1YA 1OGAE 3U9PH 2CSPA 4HKBA 4LCCB 5DTFB 3EGSB 2AEIT 2GIYA 3Q2CA 3QH3A 3PV7A 3OTTA 4LIQE 4U1GC 1A6UH 4P2OC 3HNTL 1KJ2A 4N5UA 2EDDA 3QISA 1JNLH 1WF5A 4EQ3A 2VR5A 4FQIH 4QTHB 4DN3L 5I1AA 1CFQA 1XF3A 1BEYH 3UJTL 3MRCB 3VD5A 3CSBA 4IOIB 3UTSE 4Z7UA 4M8QB 1P1ZB 2I60H 1M6OB 4U1KB 4X83A 4KROD 5B39A 1OAUH 1FZJA 4YHNA 4F57H 5CJXA 1A9BA 4Z7WF 4K94L 3HZYB 3FQWB 4OZIF 3TO4A 1KXQE 2IPTL 3JSSA 1JPTH 5SX5H 3QIUC 3TGXA 1KGCD 4A2LA 3SDCD 4LSDA 4RCAA 5JR1H 1KTRL 4GRLA 3ULVD 5C0DB 4X7FC 2FYYB 5DVMA 1ERNA 1SBBA 4OD3L 3OKLA 1E6JL 3BD5A 3P4NB 2EC9U 2R2HA 4R0LB 3MOBH 2MCG1 1C5BL 3AB0B 2AXFB 3I6KA 3W2DH 2NY5C 2AKRA 2H2PD 3MRQA 5T1DH 2EC9T 1H8OA 2IBGA 4HUXA 3ZKNC 4DGIL 5IQ7H 4HC1L 4LLDB 4YQXH 3X11B 1AQDA 4I8DA 2A73A 1L7TL 3V9FA 1RUAL 1T04B 2V17H 4J3UA 4WFGD 2DMKA 1RIUH 1S78C 3BKYL 3O3DA 3RJDA 3VGHA 1D5BA 3IVKB 4Y1AE 1FLTX 1G0YR 1INQB 2BRQA 1INEL 1GIGL 4Y1AB 5F7EH 3TT1L 3WFDL 1F3RB 1RURH 4NPYA 5E7BA 2Q8AL 2VMFA 3D9AL 3DWTA 1ACZA 1FVCA 4QKXB 1M6OA 4WW1B 1H9VA 1CGYA 2AJUL 3MCG1 3EDFA 4QGTA 1ACYL 4JZOA 3GSXA 1QSFA 4QRQB 1QBAA 1CLYL 3OJDA 1QOKA 2AK4B 5B4MD 4KDTC 4R7DB 2ATKA 3ULUE 2PUQT 3GSWB 2HJKA 4NO2B 4QRTA 4JVUA 3GIVB 5F8RC 1RD6A 4RWYL 4L4TA 3RWGB 1T66D 3V8CA 3W82A 1I3VA 4MS8C 1A4KB 1CT8B 4OZFG 4BUGA 3QXVA 3KPSD 3EYVA 3QXUA 1B2WL 3OHXA 2WBJB 1CK0H 2O5ZL 2AXHA 3TJHD 2HKFH 3T4YA 1P4IH 1IL1A 5KS9A 2LTQB 3ULUH 2RBLA 3MO1B 3GGWB 1G1CA 3TBVA 4G3YL 1AHWC 1DEEA 4LCWA 3GJFH 2YUXA 4RAHA 3AMLA 4X99A 3T3ME 5CGTA 3ZMRA 1RUKH 5F88A 1KV3A 4XPTH 4Q9RL 3IDIA 3QNZA 1LDPH 3LS4L 2DLEA 3CPLA 3R4DA 1NSNL 1ZANL 5JHDE 1B9ZA 3C5ZC 4QWWC 4X4YA 4X6DB 4LHUA 4IRJB 4ZD3L 2MCPL 4ELME 2XG5A 3S37H 3ABZA 2EZ0C 2QR0A 3EYFB 4PD4K 1TENA 3IFPA 4NJ9H 4ZPVB 1RUPH 1VGEH 5T1MA 1UB5B 5GGRY 2X1OA 1SJHA 1RZKH 5BJTB 5MI0B 2DQDH 1A1NA 4OIAA 4JFHE 3VE0B 4EDWL 3EUUA 5DR5L 5D1ZB 1ORQA 1JUFA 3L3OA 4OM0H 1DBKH 1MJUL 2P5WD 4S1DC 3HNSH 2BJML 3BKCH 3DX8B 5DSCA 2Q6WB 1UGNA 3MLZH 3QHZH 1PY4A 2B2XH 4RA0C 1NMCB 1ZHBA 4NRZA 5C0BE 1AD9A 2VLMD 3H3KA 1MHEA 2IADB 5E2TH 5CP7A 3SOBH 2XNAB 2NZ9D 2BVEA 2QQKH 3FN0L 3MO1A 2H9GA 4LMQI 2VB5A 1QEWA 5DJ6B 1DEEB 3DLQR 1I7RA 2BCKB 5CIPH 4HUUB 3U7YL 3CSGA 1V3KA 4YUEH 2LU4A 1QZ1A 4MQ7B 5IP4A 1AY1H 2R2CA 4OLUL 3LHPL 5INDB 1M4KA 3EYSH 4M1CD 1LO2L 3LEXB 4LHUB 1LD9B 3LS5L 4G8EB 5EU4B 5D8JL 3TN0C 3QUXA 4JRXA 1GSMA 2HJFA 4Z76B 5IT2H 3ULUF 3RDTA 3FRPG 1Q9KB 4EI6A 4LIQH 4CUCA 3MRIA 1WCQA 4QOKB 2VWEE 3T2QA 1CS6A 1HHIA 1EH9A 5IKCA 4L8SC 3K2MC 5J57B 1JZ7A 5D1ZC 4G9FD 1N3NB 2F15A 2PW1B 4P2OB 5IB4A 2YD2A 1PX3A 1Q8MA 5DD6A 3DX6A 1EFXA 5F6HJ 1ZLVH 4WTXA 3W81A 3SPVA 3PF2A 3H6JA 4MB4A 3DJ9A 4XP6L 3RDTC 5F7HA 1C12B 2J8UA 1HCVA 4W6WB 5E99L 5FO9A 4L9LC 4FQJL 2VH5H 4GS7C 4QTIH 1KIRB 3IFLL 2EXWC 4GMSL 3S36H 1MHPH 1A3RH 1MLBA 4H8WL 3IYLW 4LPYA 2MQ0A 5EZJA 1KULA 3PXJA 4PJEB 3UXFA 1FNGA 5INDA 5E00A 1ND0A 2JJSC 5FK9B 2MPAL 1GOHA 3OXRB 2NXZC 3OKNB 2X4NA 4UIKH 5DUPH 2NY6C 1NCAH 4NN5B 5F1IA 5HHMD 4GOSA 3PWJA 1FRGL 3B9KD 3RVWD 1X5AA 4P3DB 3LN9A 1QR4A 2X70B 3WKMH 5CCKL 4OIIL 3O8XD 3TM6A 1R3KA 5MEPB 4BFEA 4ODVH 5EU6E 2G9HB 4DGIH 2H1PH 4JM2C 1P7KB 3ARVA 3NFSL 1YNTA 3MNZA 4UBDC 4HIXH 3MRBA 1S7RB 1Q0YL 3U2SA 1V8HA 3DTXA 3EO9L 2G5RA 3QUKA 4XCNB 5CAYB 5IKCB 1MIMH 4AEEA 4XWGH 4V2CB 1UWXK 2E7BA 1YY8B 5HD8D 5IFJA 2NW2A 1JV5A 3ILQD 3D0VA 1HK6A 5C09A 3EYOB 3I2CH 2DYPD 3DX6B 5IMLB 1A0QL 4HF5H 3D9AH 3LPWA 5D5MA 2A77L 4JZJB 4L4VD 3MLXH 4BJLA 3U0PA 3DUSB 1BGXL 1FO0A 4PJ5D 3ARFD 5EC2B 1A2YA 3JTSA 3BDBA 4QHUB 4HW6A 3WL9A 4PP2A 3QUMB 1RZGB 1ZV5A 3X3FH 4I9WE 3QDJE 1BD2E 2QV2A 5B38A 3CMGA 4KJWC 3VFUB 1XGQA 4ONFH 4PRPE 3G5YA 5F1IB 5I1LB 4Y5YC 4AEHL 5GJTL 1W72A 4PV8B 1HKLL 1ZS8A 1Y0LB 3QUYD 4JQVC 4HMDA 1I1AD 3B2UD 3MV01 4RQQA 3L5XH 3BT2H 5BW7A 1P7KA 2QHLA 3FO2A 2JJTC 5E4IA 5FUCC 1DBMH 5BVPL 1EHLH 2OTWB 4XB8A 4YGVA 1F6AA 3QUKB 3CSYB 5KS9F 4Z7VB 1T2QH 1QP1A 4R97C 2YHGA 3ISWA 3WN5C 2X4TA 4J3OC 1JV5B 4HAFA 4OM1H 4KI1A 1MHCA 1NUDA 1DQQB 1ZLWH 5IMLA 1H15A 2C1OB 4QY8B 4ZFZB 1BZ9B 3BIAX 3MV7E 2Q3AA 1UA6L 3GSQA 4ZUTB 4LHUG 1F58L 1NBQA 4MD4A 4IEFB 4LGSB 4YNYA 3REVB 1WVZA 4JZJC 3O45A 2ZZUT 4X6FA 1LDPL 4N8VB 1XF1A 3SE8H 3BE1H 3ALWA 4Y4HC 1V7ML 3DBXA 2OYPA 2RHEA 3RVTD 4JFFD 1U2HA 1LO3L 4ZS6C 1A6TA 2VRAA 4OZIB 1TQCC 1A7NH 2Z91A 4KXZI 4DFHA 5T3ZD 1IGYA 1PFCA 5E8NB 4HS3A 2D0GA 4N5ED