4M5ZL

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
b'SYVLTQPPSVSVAPGETARISCGGNNIGTKVLHWYQQTPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDISTDQAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 42
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL01
1H9VA 2GUOB 1AXTH 1I9IL 2QSVA 3SY0A 2O61A 1UB6B 1CU4H 4E0RB 4KZDL 4JCMA 1R3LA 2ZUSA 2H2SC 1XT5A 1WWCA 1G7HA 5CGYC 5EUOF 5IT2H 3CSYA 4TULH 5JNYA 4X99B 3QUZA 3EO1B 5ESAB 1J0HA 3HB3C 2GJJA 2NY0D 2R2HB 2Q3ZA 2XTLA 3D87B 3BO8A 3IDYC 4J6RH 4HIXH 4KMLB 4X8JB 1L6ZA 2BY3A 2FSEA 1T2XA 1B4JL 5I6XB 1MQ8A 1ZAGA 5FYLD 5SV4A 3GMMB 4HIHB 3BDBA 1F8TL 3UTSA 4OLUH 4QOKE 5IB4A 3V5HA 3T0XA 5FEBA 1JHLL 1D5XA 1CXFA 4GQPH 3NCMA 4TSBH 2MSPA 4F7EA 5HVFB 1PW3A 4GRLD 3HLAA 1NCAL 4FQQA 3P4NA 3B9VA 3O2DH 4FMFA 2PKDA 3HC4H 1MOEA 4RWYH 3BKCL 2CDEA 2OTUA 4NFDA 2VDQH 5BXFB 5I19H 2DQJL 4L8DB 4WHCA 2YD6A 5C6TL 3RUGE 4ZNEE 3C60C 1YN7A 5JDJA 5I71B 3OKKB 4LU5H 1KLFA 3GSWB 3H9SE 4Z7VA 4MD5B 1BIIB 4P57B 4PRHB 1Q94A 1KTRL 5DVKA 3ZT5A 1UYWL 2PTVA 5LAXB 1WVZA 1INDL 3WJLC 5CUSH 4DGIL 2CLRB 2VLKD 5A16B 3EDJA 2ED8A 5AZ2H 4ODWA 2VWEE 2AK1H 2NR6C 4LFHD 1QPPA 2W9EH 3AS0A 2R9HC 4X7EC 5DJXB 3VDBA 4LCWD 3MRCA 5D2LF 2IH1A 4G6JH 3PWVA 1XGTA 1CTNA 3QWRD 5EORH 3NAAL 2ZUUA 3HUJA 1WZ1H 3WDHA 2B5IC 3ULVH 5DYOB 1BX2B 1RUKL 4Y16A 3X12B 3KYAA 3LSOB 5B39A 4MAYB 4PREA 5EFIB 2C7UA 3KDMA 4K3HA 1CQKA 1UKQA 4W4OC 3RP1A 3FFCE 4LASH 1U8KB 3PV6A 4P5MA 4GG8B 2Y07L 1U8LA 4GW5B 4NQUA 3DX6B 1EA9C 2P5WA 3I3BA 3MA9H 4LCWB 5BS0D 1FQ9C 4HC1L 2ZNXA 3C5JA 1E28A 2QBWA 3OZ9L 3QEQA 4JO2H 1A21A 1CD1B 4LHUD 5LKNA 3NA4A 3WO4C 3P40A 4F57L 2J12B 4NOFA 4PRID 1AGEB 3PHQB 4JM2A 3LKRA 3KPRE 5ESVB 1EAPB 1DEDA 1NMBH 1A14L 5E2WH 1K2DA 2P8LA 5GPRA 3RWIB 1N8ZB 1OGTB 1Y18A 1P1ZB 5AD0A 1BPVA 4YO0A 1YMHA 2V7NB 1JWSA 1IAKB 5IUSA 2VDNH 5DZLA 2C3WA 3V8CA 1QLEH 3KLSA 5E9DB 1ZVSB 4P2RA 4OD1L 3PXJA 1YMME 1JPGA 5GGUB 3OKNB 4YZFE 4Q9RH 3WE6B 2GYSA 3RWHB 4TQEL 4QHLB 1CICA 4LHUB 4PFEA 4POZC 4ZYKA 2XXMB 5DJ8A 4DKEL 5D2NB 3RWFB 4XP1H 5CEYB 3L3HA 5IOPA 1RI8A 1KTKE 2X70B 4NRZB 1A6AA 1NBVL 4WWKC 4ESKA 4J3VA 4KHTL 1OPGH 4OLZH 5DHYB 4JR9L 1JI2A 1KPVA 3GSNL 5LXGL 1GPOL 1I1FB 5DJCB 4JRWA 4R26H 5IMLA 5D8JH 3MCG1 2YBRB 3MV9E 3PWPD 4FQIH 5B8CA 2AXGB 4GQ9L 1FCCA 4UAOC 4ZTPL 1TZGL 2G5BA 5I0ZA 4BQ8A 4OCXH 4PLOB 4M1DL 4BKLB 2F58H 4XZUB 3L9RA 5MEPB 3WS6A 4IJ3C 4GAFB 3I6KA 5CZVL 5FYKL 2I9TA 1J0ZA 4NT6A 2OTWA 4HIJA 3IXAA 2ZPKL 3FMGL 1FVEA 3P4OB 3G6DH 2WW8A 1I85C 4F8TA 1VADB 2JJTC 4TSAH 4TYUA 4YEEA 4MCYB 2CLVA 4YFLI 3E6HA 5T33H 3HNVH 4QRTA 3PWPB 5H35A 1EVTC 3BHBB 1A8JH 3O3EB 1SJEB 2BNRA 1QLFA 2OJZL 3HI1A 4AMKH 5T3ZL 4N8VA 5IB5A 3TNNA 1UM6L 3Q1SL 1QEWA 2A83B 2D31B 5F70A 4JAMA 5F7UA 2HWZL 1DN0A 2IJ0C 5IVXB 5GRUH 1KCSL 1BVLA 1I75A 2DYPA 5CHNB 4HAFA 1KC5L 4IMKA 5DR5H 3PV7A 5GGSA 5JORB 1P84J 4YUEL 1Z5LB 3V7MA 2FLRT 3DYMA 1KENL 1TVHB 2BY2A 5FHAL 3LQMA 4R4FL 4TNVF 3OX8A 4GMSH 5FXCH 3CLFL 3EYQC 5DTFA 1LILA 5TH2B 2HJKB 3SDCA 4FNLL 1J1OL 1RURL 2D0FA 3UDWA 3OAYH 3DIFB 4GRWE 1SYSB 5CGMA 2EYRB 1WISA 3LKSA 2UV3A 1UXWA 3GSRA 3MCLL 1LE5B 5DVLA 3BT2L 4WUUB 4NO3B 3DECA 5KSAD 3X13A 3HI6H 5F9DC 1VFBA 1KLUB 1ZLSL 4EQ3A 3MBEC 1N5YL 4KAQL 4XBEH 3H42H 3KYMB 4MXWL 1D9KA 3D9AL 3BH8B 3U6RB 2BVPA 5JUEH 3BP4A 1X7QB 1NMCC 2FX8L 4CU6A 3A6CL 2GCYA 2R0KL 3EAKA 2VWEC 4KMTH 4GW4A 1TNMA 3LKNA 4WW2F 3QA3B 1CD8A 2V5MA 4DVRH 5T1KD 5K9KB 5KS9B 2X4TA 3WIFB 1YQVL 1LO5A 2R0WL 2JKXA 4QHNA 1AY1H 5BRZE 3G5VA 5KSAB 1B3JA 1EHLH 3HNTH 3MV7E 4RBPH 5E03A 4ZMAT 1NCWL 4NZUH 5DGRA 4NQEE 2EDNA 1YNTA 3IB4A 3KYKL 5GJSH 2FWOA 3B4NA 1CGUA 3IFPB 3CDCA 4WI8A 1SEBB 2KKQA 2F5AH 4Z18A 5IW3A 4JCLA 1OM3L 4LSUH 2YZ1A 5BO1L 4B7LA 1PKQA 4L3EA 1NEZA 1OAQL 3DV4B 1FNLA 1IM9B 1QYGL 5F1IB 3W0WE 5T1KB 1N0XL 4M43H 5CJXA 1FE8L 2DOCA 1LP9B 3QIWA 5AYUH 3WUZA 2OK0L 1N3NB 1FV1A 4LQFH 1T20A 3MMEB 3TO4D 2Z93A 1YPZE 3U0WH 4KHXH 2A6IA 1MFBH 4FZ8H 1U8JB 3C6LB 1DQML 4V2CB 1U8MB 4LLDA 4F9LC 2APBA 2NTSP 4K3EL 2OXGA 5C0GA 4UDTA 1T03L 2F54D 1CGSH 5HYEA 5L2KD 4JKPH 2ORBL 4X6CF 4Z95L 3GK8H 5I9QB 4K07A 1NBQA 1FNEA 4P2OA 1D5MB 5JO5B 4HUUB 5JOPD 5DFVC 4G6KH 1DLHA 7FABL 3HC3L 5B21A 1QFPA 1OAYH 4QCIA 2AVGA 1FNGB 3ARBD 2R0LL 2YEZB 5DC0A 1KJVA 1J87A 5FCUL 4WCYH 3SOBH 3MV11 3PQYB 1CE1H 3TF7C 1J1XL 3QXTA 3PHOA 1ZMYA 1JGVH 3IETA 2PN5A 4XAWL 4JO3L 4LLAA 1X3DA 4N0UE 4RGMB 3CDGA 1YDPB 2XIDA 1S7WB 1GC1H 2F54B 5I15L 4U1SA 3TIDB 2X10A 3BISA 4D8PB 4EKXA 1L9NA 5F21B 1IGFL 2J8UA 5FGSA 3SDXA 3TPKA 2BCKA 1A4KA 3O11B 4R8WH 3MLYH 1HHGB 4WDIA 1HCVA 4OGAD 4D0BA 1N64H 4XWOC 4NBXB 3S5LA 1UFUA 5ICYA 2MQCA 1NSNL 3AROA 3MA7A 43CAB 4NZRL 1DBJH 3BD4A 4L3CA 4HWBA 1KJ2A 4PJGB 2PO6B 4JY5L 3LMJH 4KKBD 1J8HB 1RJLB 1V3KA 3FO2B 2H32H 3VWKD 1YY9D 2VQ1A 4YBHA 1F6AA 5FYKD 3UJJL 3L7EA 3SKMA 4L4TE 4X98A 5IQ9B 1GAFH 2HG5B 3R1GH 1CG9A 3LN5A 1S5IH 3UYOD 2EDEA 4LHJB 1NBYA 3UBXG 5J12B 3BIAX 2FATL 2VQTA 4H26A 1BJMA 3L3DB 3GB7B 3MRJB 1KOAA 3HMXH 4H8WH 1ADQL 4KDVA 4JJ5A 5EO1B 4HUVA 4JQIH 5C2BH 3PL6A 1AP2B 3GMNB 2HRPL 5JHLL 2LTQC 4OF8A 2XKNB 4C4KO 1TJGH 3HZYB 1ZGLM 5KSBF 4ZTOH 1NLDH 1X4XA 3RIFF 4CADB 4WTZA 4JFXB 3VXNB 4IRJD 3JWOC 5HI3C 1FN4B 1YEHH 1I3GL 4NNYA 4S1DD 1QFUH 5DJ2A 3WLWC 1QSZA 3IRZA 3QIBC 5HHOB 2AEQL 4Z5RA 3I84A 3CAFA 5FOBB 1A1NB 1H3VA 1IQWL 4ZQKA 5EIQA 2OMNA 2NW2A 1IZKA 4FTVE 3VW3H 3IDYB 5EU3B 1WT5C 4GBXA 3HZVB 1RY7B 4J8RA 5FUZL 4PJIA 3S88H 3FTGA 1NC4B 4HK0B 1FHGA 2NYYD 3SGJC 4HPOL 4NUJA 5ETUA 4HJGB 4OJFL 2DTSA 1MRCL 2EDJA 4PJBE 4ZAKC 3CDFA 2NX5A 2A6KA 1A5FL 1EHNA 5IP4A 1MCQA 4MJ2A 5CJOL 1F11B 2V2TA 3FN0H 2BZDA 4X7FC 1UZ8B 3KJ4B 1KGCE 5FYJL 2W91A 1FFRA 5CCKL 4PB9H 2H3NB 4F3FB 1QSEB 1O7VA 4NZTL 4PJ7A 2F19H 4XNYL 3QNYA 3WHE0 1JV5B 4B41A 1H3PH 5F3HA 5FGCB 4OTXH 3C60B 4ZPTB 5HJ3B 1BOGB 3FQNA 4QNPF 1AE6H 1RZJH 4OFIA 2P7TA 4TRPL 1H5BC 5GGQL 5GGTA 5C0FA 4MCZB 1KB5A 5D1QA 2OL3B 3MACH 1TITA 1IAIH 3UX9B 5TFSL 4LLWA 2AABL 3DGGB 3UPRB 4DGYH 4IMLB 3W5NA 5E6IA 2FCBA 1MVUA 3BXNA 4JREB 3E2HC 2PTUA 2NLJB 3D69B 5EN2B 2ADGB 3PNWB 2ADJA 4UBDC 4UUJA 2X1XR 4XPTL 3WMSA 1P6AB 2DQTL 4FS0A 5IW1A 1I9RL 1OCWL 2YPLB 4Y19A 1RJZB 3KYOB 1DE4B 3I2CH 3WDJA 4QRRE 4EDXB 2EDDA 2B1HL 3ARDD 2DL9A 3WNMA 3N9GL 3DX8A 1OD7A 2YHGA 4N0FB 3T4AA 2HFEA 3K2UL 4K2UH 4BSWA 3EIFA 2VDRL 1F00I 1CFQA 2GJ6D 3F58L 3FRUB 4Y8DC 4NC2B 4R3SB 4MJ4A 1YN6B 1E6JL 1FNAA 5SWZE 3DMMA 4R0LA 3VXQA 2CO6B 1M6OA 3P0YH 4Y1AE 5AWNL 4C56E 4Y7MA 3WO4B 4NN6B 4P9HC 4YHNB 3VWJC 1DQJB 3HN3A 4K7PL 4MA1C 4WU7B 3JTSB 4MQTB 1YEIL 1QRNA 3NCEB 2P5EA 4NKIH 1MI5E 1MH5A 4XRCB 1OQOA 5FHBH 5JZ7C 4DGVL 1JWMA 2D7MA 5IK3B 1F45A 2ICCA 3GRWA 5C0AD 5BZWA 1JZ6A 3NFNA 4KK8C 2DWDB 3FFDB 8FABA 4DK6A 4NM8L 3M45A 1SJVA 2GJ6B 3FQWA 4XBGA 5DLML 4FQXC 1RZ8B 4XPAH 3DBXB 3QUXD 4MNGE 4N1HB 3RVXD 3RWDA 1GCFA 2JJVA 4F8QA 5EOCH 5IVZA 1FH5H 2AXJA 4R90L 1KCRH 2V2WA 1J12A 4HG4K 2FECL 4IIQA 2DJUA 4J3XA 2BX5A 3MLVH 1UKSA 3HNSL 3M17B 3JV4B 4QHKJ 4Z7WB 3CFKB 4HDIA 4WWKB 1T0NB 1DVFD 1LO3L 3QG6A 1VGKA 1BQLL 1KG0A 5IBUG 3VGGA 5DJYB 5GS0H 1KV3A 3EOBB 3RGVD 4O5LH 1S7RA 5F7FA 3MNZB 3B43A 3OV6A 4WIQA 4UAOB 4UQ3B 5KAQF 1A9BA 1IGYB 1P4IL 1Q8MA 5E8DH 2OZ4L 5K59E 1LVEA 1HILA 4IOIB 3RPKA 3T1WA 1RIHH 3H0TA 4LLUA 4IJ3B 3U36B 2ZOKB 2ZCLH 4F37K 3ZHDA 2W0PA 1DVFB 1H8NA 4G3YH 1CDUA 4H88L 3CK0L 2I27N 1CLYL 1E0OB 4NQCA 5KZCB 1D7FA 4MVBC 1S9WA 4NWUL 3RGVB 4F7MA 4LLMB 1MRFH 1CLZL 4PGDB 4U6YA 2F74A 2VAAA 4IRSC 4R7NA 1RZGA 2YA2A 5EZLA 3MRFA 4D0CA 5L9DH 3I50L 1LO0L 2XZCL 4QY8B 4JDZB 3IU4L 4XGZB 5K9QG 1XGRB 3JWDH 2ZJSH 1Z9MA 2LQRA 2DJSA 4I18C 4MA7L 4OAWB 2IPKA 1R24B 1KCUH 4XNXL 2OTPA 3U7WL 2FGWL 2P8MB 3WFEL 4BZ1H 4ZFGL 4LGPB 3D5OF 3AM8A 1JJUA 3HZMA 3OKMB 3PGFL 3SQBA 4Y5YA 2ADIB 3GMQB 2FIRT 5EO0A 2NXZD 3UJTL 4U0RC 5JW5A 3CVIL 1XCTB 4Z78A 5GIRB 2FJFA 4H25A 3SBWA 4Q9CA 1MHCB 3OG4B 4YXLH 5GGSY 1QFOA 2FJHA 4JFFD 1S7XB 4FFZL 3KJ6H 5CSGA 5HHPB 5AEAA 3TCXA 3N1MC 1JNLH 4X9GA 3VFNA 2XZQL 3RUGB 5I30L 2AW2A 2WINA 3E8UL 2IBBA 5DMGD 5J1TC 1RJCA 4OZ4B 2JIXD 3B9KA 3H9SB 3MBEB 3O6FD 3HCVA 3KPPB 3MRHA 1G9EA 4S1QL 3GJEA 4JHZA 1W8OA 4N9GA 2X4NB 1JBJA 4JM4H 5D7IE 5K9OB 4OCNC 1FRGH 2CKBA 4X5WA 1PG7H 4KXZH 4XPFL 1FAIL 1YC8A 4I3SH 2CUIA 4JB9H 2ZNWA 2GK2A 1RSFA 2I60H 3UROR 3V4VL 4UT9H 2GIYA 1T1ZB 4KJWC 3LQAH 3TT1L 3H3KA 2H2PD 2XA3A 5GRZA 3C2SA 1AGFB 1A6VH 2JIXB 4PJ5E 1WBYB 2HT2D 1AHWC 1IKNC 3DO7B 4ZFFA 5KANG 1U8PB 4JDTL 1VERA 3LV3A 1EBAA 1MCWM 3G9VA 3H7BB 3ZKMC 4LAQH 5EBMB 5LGHL 3SO5A 3U46A 1F90L 1T21A 1YEKH 3HAEA 3F12A 3FFCB 1WCBA 3KXFA 1CXKA 4YQXL 2V9TA 1NL0L 4JANB 5GSRB 2CO7B 4EUPB 5EPMA 4M7JH 1EHAA 1RUML 5GZNC 4YDKL 4KV5F 4KK6D 5GSVA 3D39D 5I8CB 1FFNA 1KF9B 5IVXF 4XX1E 3TBWA 4NKOB 4OLVH 4HF5H 3I3EA 3VFPB 3MYJB 2DQUH 1OAUL 4PJCE 4TSCL 3KPRB 2MKWA 4S1RH 1SYVA 3C5SB 2GSGB 1CFNB 5IB2A 3V6BR 1YEJL 4Y4KD 1C1EL 2BSRA 3HE7D 4HKZA 3OJVC 2Q8AL 1CL7I 5B22A 1A7BA 4M7LL 5T3ZE 4RISH 4PJ9C 4P4KC 4OZFA 3TBVB 1YMMB 1A6TB 1BFVH 4PRAA 2APWA 1EZVX 4GXVH 4YDJB 3D85B 5SWSE 2FX9L 4MD4A 4DQOH 5DD3L 5HHME 3AMKA 2AGJL 2NPLX 1R5WB 2R1XB 3S36X 4MQSB 2AV7B 3O3BA 3OG6B 4ISVA 1JFQL 5C8JB 4KKNA 1IGMH 1EZVY 2YC1B 2RFXA 4AQOA 1KIRB 4WHDA 3REWA 1KJMB 2UWEB 3BP7B 4Z7NF 5IMOB 5KG9A 2YD2A 5E8NB 5IM7B 3C8KA 4XMKH 1WBZB 4CW1A 1NBZB 1IC7L 3SDDA 3BQUD 4OLYH 3T0VA 4M03A 1MHPH 2EH7H 1NAKH 3OGCA 3S9DB 4N0YH 1R3HA 3JTTB 2Y5TA 4E41D 1NCNA 4KRPD 1I1AC 3OF6A 1HH6B 1U6AH 5DD0L 4P4RA 2WUBL 2X1OA 4FQ1H 4Y8AA 1BBJA 2DM2A 3DETD 4LKXB 1ZSDB 1I9EA 3KPNA 4XP5H 5CGTA 2GHWB 1HDMB 2ICWJ 5D1XD 1AR1D 4WV1B 5F7NC 3MJ7A 3TESA 4PR5A 5TE4L 3MO1A 3UTQB 1NCTA 2DAVA 4HMDA 3I3DA 3UYPA 1A7NH 4ELME 2AJVH 4LSSH 3SCMA 3OXRA 5FYKU 1UJTA 4PY7B 5EZJA 4FXKB 1AD9B 1F3RB 1C5DB 5I8OL 5DQJA 2VDLL 1LP9F 4BA8A 1QTYT 4NHUA 2AJYL 2LTQB 1UWXH 1CDHA 3NCJL 4ZUVA 5L8KB 3A6OA 5E5MB 4DJMA 1E6OL 3BDYH 2KH2B 2HMIC 1AIFA 4OLWH 3QQ9D 3O9WA 2VISA 4QTHA 1T04B 2W60B 3BGMA 4RGOH 2NY5C 1MPAL 3QIBB 3EYOA 2L7UA 4Y5XB 2L0DA 2C3XA 4P23C 3WUWB 2DM7A 2NY2C 2K1MA 1OTTC 1ZA6B 3EO9H 4E9LA 3VFSB 4J4PD 4NQVB 3PABA 1SMOA 3RRQA 3STLA 3V6ZA 3OKDA 3N0PB 4DZBB 5CEZH 4FQJH 4BUHA 1XZ0A 2R23A 1A4JA 3B2UD 3QHFL 3CFBB 2X1PA 4NM4L 1FZOB 4JZJB 3UTPD 1SBBA 4Z76A 2GAZB 3MLUH 4I0PD 3PJSB 3RX5A 1BREA 3B5HA 1QA9A 1J11A 1HCFX 2VXUH 5I1DB 2XN9A 3S35L 1AQDA 4KPHL 4EBQL 1JMXA 3Q2CA 2WWKT 1JHKL 4OIBA 3ZDXE 3SKJL 4MX7A 1NLBL 3SO3B 3ALWA 1KEMH 4TUKL 4WO4C 2VZ1A 2DLFL 2XG4A 2NZ9D 4PPTA 5ACLA 4K94H 4WTXA 5HYJA 4PJGF 4PJXE 1YUHA 3AAZA 3TWCH 3F6LA 4XAKE 3IAGC 4YGVB 5F6IC 3DGCR 1A2YA 3A67H 3W81A 5DD1H 2ZOLA 3O3DA 3RDTD 1C7SA 2X4OA 3QDJD 1B0GA 5D2LA 2EC8A 3MV7B 1G7MA 5IHUL 4S0SD 4LEOA 4NQEB 3CFDA 5IIEA 4AENB 4YBQC 3RNQB 3CSGA 2E8YA 3E2HB 4KUZH 3V6FB 4PUBL 3VRLF 2WP3T 2VDPH 4P2QA 3W11C 4YHMH 3LD8C 3T8XA 4HUWB 2XTJD 5C0CD 1UCTA 4U1GB 1BD2E 3DUSA 5C0ND 5AG9A 3O3AB 1A6UL 4OF5A 4XI5C 3WFHB 5HHXH 1AKJA 2FBJL 2UY7A 1KEGL 5TF0A 2VDMH 2XQBL 3LKPB 5HYSB 1YPZB 2VLJE 5FM4A 2X4PB 1HKLL 2K7QA 3V6OA 1IBGH 3C9NA 4ZSOA 4HS3B 4U1LB 2BOCB 1H0DA 4XPGH 4XPBL 2YXFA 3FT2A 1OAXH 4G5ZH 5T3XH 1XGUA 3U1SH 2FJGB 4P46C 3RA7H 3WS3A 4ZDHA 1DQDH 1G7LA 5HHQB 1LNUB 4G43B 2ATPA 2JJSC 4JPIA 1I3RA 4BK5A 1NGPH 2IPUG 4G7VL 5D93C 1ZHLB 4KJPC 4I77L 1G0XA 1SHMA 4NQDD 1U3JA 4PJEB 4LMQI 5DK0B 3G6JF 4QRPA 4L4VA 4P3DB 2Y06L 3BWAA 5ICZB 1E4XL 5H94A 4FHBD 3TYFB 4M48H 4FQXB 3TBTB 3O4LA 3CLEL 4N0UB 4L4TD 2FD6L 2X5PA 2A73B 2VLLB 1TJHH 1B6DA 3HE6A 3FT3A 4B7IA 1T2QL 1CFSA 2FHCA 4M3JA 4JPVL 4ZUUB 4HEPG 3ES6A 5FECA 3MRQB 4MA8L 3EBAA 1CR9L 3EKCA 3VMNA 2ADFH 2BC4A 2R2BB 2I5YH 4P3CL 4RFNB 2JCCF 2AK4A 4M6OL 5HGDB 1UH4A 4RNRA 1EH9A 3UTSD 5JPNA 4NWTL 4OCYL 3ZE1E 3WFBL 1FPTL 2J2ZA 5I17A 3QO0A 3P9MB 1W72B 5GS3A 5C0EB 4OIIL 4L4TB 4LCYA 4OB5L 3S34H 3VXUE 4CRPA 3NA9H 3CXHK 1CDGA 1WK0A 1S9YB 1QFHA 3BD5A 5TGBA 4X6EA 5CJQL 5D5ME 1RULL 4YNYA 4LKCA 3MJ9H 4WI6A 1R3KA 5E8OB 1DCLA 5KVDH 3MUHL 3ZKND 1CFVL 3IDMB 4I3GA 5DHXB 1YEEH 2BOBB 1LD9B 4OZHE 3KS0H 2XWBB 1SJXA 4PJHA 2YPKA 3W9EB 2DQCL 4IHOB 1UZ6E 3QUYA 4LARH 3TN0C 1NDGB 1M4KA 2I9LA 4QRUB 2NY4C 4OSUH 1X5IA 4JN2B 4MQXC 4P49A 2R4SL 1R3IL 4WHTB 1R3JB 4ZUWB 1RK0A 1RMFH 2VXVL 3VFVA 1KBGH 2CIKA 4FTVB 1ITCA 5HDBF 3RZCA 1WCQA 5DWUH 3RU8H 3KPMB 3O6KH 1UEMA 1OD9A 4Y16D 4PTUA 3REVA 5CP3H 3F6IA 2ITDB 1T22A 2RCSL 3T65A 4LSTH 4PJBB 1TETH 4MXVF 5AG8A 2CRYA 1ORQA 4K9EL 5JXEC 3AS2A 2HKFL 3QUMA 1JGUL 1FVDA 2PYEE 4UT7H 2P5WD 4U3CA 1IKFL 3IFNH 4N5UA 1KYOK 3KGRA 3GKWL 4EXKA 3SKNA 5J13B 2FYYB 3QEQD 1N2RA 1NCBL 4JFZH 1X5FA 5GRVL 5FYJU 3VXOA 4G9FE 1TENA 3N1QC 1RFDH 1MHEB 3IS0X 5EU6E 3QUXC 2Y36H 1IC1A 2EICA 1F3DH 4OQTL 1OGAD 5AUMB 1HINH 5I18H 5HYSG 4Z7UE 3BJ91 1YYLL 3T2NL 5DQDL 1UM5L 1OVZA 4Z7QF 3OL2A 4FQ2H 1ACYH 5IV2A 3HA0A 5SWZD 3MOAH 1EMTL 4M93B 4OIAA 4XPHH 5TDNB 5A2KH 3I6LE 2VABB 5FK9B 2DM3A 4LRIA 4XBPA 1A7PH 2AJSL 1CXIA 3D25A 1CDJA 3BUYA 4GFTB 1KUMA 2Z91B 4LCIH 4JFQB 1NGXA 1AHWB 4X7CC 4QRRB 2A6DA 3EO0A 3QI9A 3D0LB 1ZEAL 1OAZL 1JRHI 3FONB 1QFWL 1JZ5A 1T66D 3AXLB 1KXVC 1OGAB 1RJYB 1UH2A 3O2WH 5DUMH 3V7AG 3UAJD 3S6CA 2AJXL 1BGXL 5E08H 4OM0H 5E2UL 1AXSA 4ONHB 2HJLA 5SWZB 4GAJL 1QBLL 4U1NA 3ZL4L 4Y1AB 1T1YB 2IPTL 4C56B 2BDNH 1KJ2L 5E8PA 1M7IB 4DZ8A 2ZUTA 3ZHLA 4HPYL 4LLYB 4HFWB 1P7QA 4NNPH 5C0RL 3U2SA 5IFHL 1NQBA 5C3TA 1J5OL 1F4WH 3MUY1 4X6CA 1MI5B 4HGWB 4QEGA 5CSZB 5K9JL 1EEYB 3VXRA 4O2EA 2QHRH 4PRPA 1YEDB 4PJ9B 4P4KB 5A2FA 3DSFH 4P9ML 1J18A 4G80A 2DQDH 5DJDA 5I75B 3BX7C 5I1GL 4MNGB 5EWIL 2BNRD 2P42B 4OZGE 5DRZA 1NCDL 1HSAB 3IAPA 1BMGA 3WEXA 4Z6AT 5A2LH 2R0ZH 1FC2D 3OJDA 4ZS6D 3RUGF 1B4RA 1RK1B 4AG4L 2PW1A 5KSVB 1S9KC 2FZ3A 3HPJA 1DBBH 3UP1A 2VL5A 2B0SH 5EZIL 3ULUL 1TCRB 3LPGA 4MXQD 3JBG7 4M5ZH 1MCIA 1LHZA 1K4CB 1HHKA 5T1LA 3X11B 5E24E 4PLKD 4HWNA 2Z8VC 4TTDD 3TGXA 3DUHA 3NIDE 4WNQA 2IAMA 5DD6B 1A3RH 3WSQL 3O6FC 4YXHH 3CVHB 2HN7A 4UIKH 3QEGH 4LSRH 1I1AB 3ULSA 3BRDA 4NNXA 5D7LE 2XNAA 3M8OL 2IADA 5INDA 4BJLA 2X4UB 4YHPB 3BAEH 3R4DA 3QZWA 2XWTA 5LWYL 2PW2B 2JB6A 4LSDA 4PD4K 3AVEA 5ALCH 3STBA 4ZPVA 5ITBL 4Q97A 1KCVH 3IFLL 3RI5F 1D9KD 2V17L 3G5XA 3NABL 2AI0H 3H6JA 1ODAA 3P4LA 5F96L 4BSVB 2WBJC 3MV8A 5E5RB 1UB5A 5DF0A 3GUTB 4ZD3H 3GSXB 4S11A 1TIUA 1MY5A 4QYOB 2H32A 3HFML 4QHMA 4OLXH 4ZXBC 4I2XE 5KSBA 4EVNA 2PYFB 5GGTL 4YHOH 3MOBH 3UPCA 5KVMC 4MNQA 1KB5L 2HA1A 3VFUB 5A40E 2LVEA 3MX0A 4L9LA 2FO4B 5TDPB 2ATKA 1JF5A 2YUVA 4ONFH 3V0AC 3JV6B 3SE3A 1SJHA 4BYHA 1FL5B 1OAKH 4LIQE 3DVFA 4M62L 3TJHD 4PJ8C 4P23B 4DKFH 3AY4A 5IF0A 1W0VB 2NY2B 2W9LA 2FX7L 4V1DE 5F71A 4A6YH 4ZOBA 4YZFF 3EFFA 5I1JL 3FO9B 1UWEH 3MZTA 4WFED 1JZ4A 3TV3H 1OHQA 5CSBA 4JFDE 3L1OH 4D9RE 1S8DA 1C12B 4ODUB 5HY9B 1YEGH 5I76B 3TO2B 1TPXC 4NDMA 1DQQA 4LSPH 3GI9H 3QIWD 4QXTA 4HK3N 3FB8A 1KFAL 1XEDA 3DJ9A 4F7PB 5A2IH 1CTOA 2J88H 2VH5H 2HLFD 3X14A 1NFIA 2IQ9L 2UWEF 3T77B 2B7DT 4UV4H 3WFDL 3GHBL 5D7IB 3CX2A 1ERNA 4M61B 4Z0XA 2LABA 5DA4A 5F44A 3IVKB 5F9OH 4NP4H 3GMPA 3ORJA 3Q5YA 3TCLA 1NMAL 1UM4H 3VXME 4AIZA 4WO4B 3C5ZA 3LEXA 4P2OD 5DQ9A 3VFOB 4KZEL 4IOFC 3OKEB 1LWRA 2BSTA 4GS7C 4KKAD 1KPUB 3GRWL 3H9HA 3EJYD 1AO7A 3DUUB 5D7SL 1JP5A 4EI5C 1HQRA 4PJ5B 1A7QL 1DSFL 3JWOH 4BK4A 1LQSR 1OWRM 4F33A 5I74B 1J0IA 4GH7B 3IJHA 5D1ZA 1ZLWH 4KRPC 4O02L 4OV5B 3OHXA 2AEPH 4I1NB 3LD8B 2GUOA 2ERJC 4FQPA 1WAAF 4Y5VC 3RWJB 3STZB 4LVNC 2PR4H 1UB6A 2R2EB 4E0RA 1BFTA 4HKJB 5F6HI 4GRWH 4JFHD 3MNWB 4JDVB 1SQ2N 3RQ3A 2DQIL 4XVJL 1DBMH 4PBWD 3OPZL 1D6EB 5DT1H 1F4XH 4NOBA 4PJCB 4HD9A 4X99A 3EO1A 1G6RL 5ESAA 5DJ6B 1IEBB 2R2HA 1ZGLP 4O2FB 5H37G 1LGVA 1WF5A 4X8JA 1CDYA 3IDUA 3UTOA 3NBNA 1GGIL 4P46B 5IVOA 4PRBB 1F2XK 1BZ7B 2Z35B 1GIGL 1BBDL 3GMMA 3W39B 1DBKH 3RAJH 4HIHA 4Q58C 5L88L 2EXYD 4JQXA 5C08E 5SWSB 3T0BA 4X80L 2VJXA 5M95B 5HHMB 1LEKB 1WTLA 2LAAA 3GI8H 3PL6D 4J3TA 5GGVY 1OB1B 4X7TB 5I1HL 2UZXB 1GGBL 2MHAB 4LCCC 2NY1D 5BXFA 3MLZH 3OKLB 4L8DA 4PGEB 3KLDA 2Q8BL 3BN9D 5TQ0L 3TT3H 1JPSH 1PDKA 3OKKA 1UENA 3V0VB 3GSWA 2O5XL 1FJ1B 3B2UC 1X6NA 1FCGA 4MD5A 1BIIA 4P57A 4PRHA 1ZHBB 2L7JA 5FA3B 4GBXD 5LAXA 5I1CH 3CZFB 5F8QC 5DJ0B 4G8GE 2CLRA 4DOHB 5A16A 1LE9B 4KVNH 3RTQB 4MAUH 3IAQA 2AQ1A 2NX5D 4P5KB 5DJXA 2CRMA 1MJUL 1OL0A 5F7EH 4FQCH 1Z3GH 4L29B 1Z9LA 2R4RL 2ZSVB 2W07A 4ORZC 1C5CL 3DNKA 4AEHH 1EERB 5DYOA 1BX2A 3VGHA 3X12A 3LSOA 4ELMB 1CGXA 1HI6B 5EFIA 3QEUB 4JY4B 3FOMB 4P59H 3AREC 4P9HH 4P2RE 4MJ6B 5C7XH 3CMOL 1U8KA 2HKHH 4QWWC 3SGEI 4GG8A 3HI5L 2BRRH 4GW5A 1CT8B 2C5DC 3QNZB 1MCPL 5JHDE 3DX6A 4UINL 1I7RB 4LCWA 4GAGH 4ZOEA 5D1QD 3X3GL 1CD1A 3CUPB 5E5UB 3IJSB 4UV7H 2XTJC 3QWRA 1AGEA 4XHQA 4WEBL 3PHQA 1J1PL 1PLGH 2NY4B 5ESVA 4NJ9H 4C59B 1EAPA 4MS8C 5KVEL 3MRMB 1IGCL 3VFGH 2E8ZA 3EDFA 4U1MB 4ODTH 3RWIA 1N8ZA 1OGTA 4XC1L 1P1ZA 5F7WC 2V7NA 4K8RL 4NO5B 3I9GH 1IAKA 2DKMA 1T1WB 5E9DA 1ZVSA 1YECH 4PG2C 4PJEF 4Z0BL 2FH8A 3VD3A 4N1CA 5GGUA 3OKNA 2GFBB 1N4XH 1S7TB 5J57B 1Q9KB 3WE6A 1HNGA 4PJDB 2DBLL 3RWHA 4LDOB 4L8CB 3QCVL 4QHLA 1IC5L 3U7YH 4LHUA 4PS4H 4YJZL 4JRXE 4PRIA 1JMZA 4K23L 2E7LC 5D2NA 3RWFA 5CEYA 3LKOB 1D6VH 2X70A 4NRZA 4H0GA 3R06B 2FEDD 5E00B 4KQ3H 2ZCHH 3QWQB 1RIUL 4IDJH 4OGZA 5DHYA 3CXDH 1I1FA 5DJCA 1F58L 2N56A 1BD2D 4JFYB 5HXMA 4MYWB 1QRND 2YBRA 4M3KB 5DURD 3NIGE 2AXGA 5TQ2L 1DLFL 3MLPA 3QUZC 3QFJD 2NQCA 5E0QA 4PLJC 5T5NF 15C8H 4X5XB 1INEL 4X9BA 3V4PL 4K71B 5FUCC 4M6NL 1URLA 4WRLA 4BKLA 1ULVA 3N06B 4XZUA 1V7NH 5MEPA 5AYQA 4XMPL 2WUCH 2DQGH 2DQHH 3FQRB 3P4OA 3AC0A 5TF1L 3SE9L 4MCYA 1BD2B 2GJZB 3RHWF 1MREL 4Q7DA 3DTXB 3HRZB 1P4BL 3PWPA 1S78C 3BHBA 4OZIB 5DEFB 2ICWB 3O3EA 1SJEA 1ZTXL 1MJ7L 1JNNH 2JJUA 4XCYB 3QFJB 1KN2L 1EO5A 3WD5H 2A83A 5IESH 2D31A 4D3CL 4Q9QH 5IVXA 2H1PH 4CVUA 5B38G 4JGJA 2A9MH 5CHNA 3MRPB 5CFHA 4M4RA 3NZ8B 5JORA 1Z5LA 4KVCL 3ZKNC 2IQAB 1CGWA 1M7DB 3BPLC 1T7YA 1TTGA 1TVHA 3QRGH 3C09C 3KLAB 3NOIA 5TH2A 3QDME 2HJKA 4X8XA 5C09E 2PUQT 4GKSB 3IFOB 4PJBF 1N5AB 1YYMH 1UWGL 1V5JA 3QHZL 3VI4E 4AEFA 1GGUA 5DS8B 2VNCA 3V5DB 3DIFA 1SYSA 4NQCD 5CINH 2EYRA 4RAVB 1BQSA 4XNUH 2MCG1 4FXGB 3W2DL 2NW3B 2XACC 1V7ML 1LE5A 3BE1H 1E4WH 4KTDL 4WUUA 3GJFH 3H7LA 4EDWH 1DL7H 4YHZL 4NO3A 1MSPA 3BRFA 2HFGL 4G42B 1FLRL 1S9VB 3KYMA 4PP2B 2CD0A 2H9GB 3HUJF 3HMWL 4K3GA 5HGAB 3SDYH 3BH8A 3U6RA 1EO7A 3WLBB 4JHAL 3UCRA 5GS2H 1X7QA 3K4ZA 4XHJC 3C6SB 3DHMA 1AH1A 3EHBC 1UH3A 4BSJA 3QA3A 2APFA 4APQC 4D9QD 5JTWA 2CJUL 4G6AD 4N0CD 1AXTL 5K9KA 5KS9A 3WIFA 3MGTB 1CU4L 4JM2C 5J7CC 2EEAA 3J7HA 2XRAH 1HOCB 3BEVB 5KSAA 3VXUB 1IRAY 3BD3A 3QDGD 4HJJH 5IT2L 4AJ0A 1WIOA 5EU7E 1QQDB 4DCQB 5JIHA 3NTCL 1Q0YH 2F53E 2NY7H 3MLTB 1F3JB 5D5MB 1J8KA 3TA3C 3IFPA 4AEEA 1IC4L 3DARA 1SEBA 1I9IH 1CGYA 1K3IA 3C8HA 3B9KD 4G6FB 5HI4C 5KJRH 4CU8A 1BIHA 2HVJA 3DV4A 4OZHB 3GBMH 1CICC 1IM9A 5F1IA 3K81A 5T1KA 5A3ID 1LP9A 1N3NA 3FB5B 3MMEA 4WGVB 2ESVE 3TLRA 1H3GA 2Z8WC 3ILQC 3QDGB 1V3LA 1B4JH 1MHHB 3C6LA 3HC4L 4RDQG 1T66C 1U8MA 2WIIB 3KPLB 2R29L 5I73C 1MF2L 3K0WA 1XF5B 2QADD 2D4FA 1ITBB 3ZKSD 4FP8L 1MJJB 1FL3B 3KYNB 2JB5L 4F9PC 5CKAA 5JXAL 2R8SL 1D5MA 5JO5A 2EDBA 4HUUA 2YUXA 2X05A 5EOCJ 4EQ2A 4ETQB 4ZO8A 4A2LA 1HQ4B 3BKCH 3KXFD 1GYAA 3ZTNL 5CUSL 2VUYA 4CDHA 4TOYL 1FNGA 3WS6C 5JOEA 2YEZA 3L3OB 2PYEB 3ALPA 5C6TH 3GDBA 5SX4H 3PQYA 5AZ2L 1MQKL 2AK1L 2C1PB 1BQUA 3DYOA 2GSIB 4OM1H 1DP0A 3EYUL 3MRLB 1YDPA 2BVYA 3LZFH 1S7WA 2F54A 4WFGE 1ORSB 3TIDA 4D8PA 2VRAA 4G9FB 1INDH 1DZBA 4DGIH 5EU6B 4TNWK 3O11A 3BEWB 1KULA 1HHGA 3U7AA 3OGOE 1U3HC 1AFVL 3B9AA 1MWAB 5LVEA 3F5WB 5IJKA 43CAA 4Z7UB 3QB7C 4PJGA 5KSUB 2PO6A 5D6DC 1J8HA 1RJLA 3FO2A 4CL7A 3GSVB 5HPMB 4EIGB 4GS7B 1RUKH 3ZDZE 3MA9L 3ULUE 1Q0XL 5IQ9A 1FO0B 2HG5A 3ARWA 3PDOB 1TQCC 2H26B 4JO2L 4C58B 3QHTC 4L3AA 3SDCC 3QISA 2XY2A 5KVGL 3L3DA 3GB7A 3MRJA 3UDWC 2W1NA 1JNHB 2Y07H 4XC3L 2NY5H 2OSLB 2CDFB 5EO1A 4G6ML 4HC1H 4KRNA 2VDNL 4NRYB 1AP2A 3GMNA 4O58L 2F9BT 3OZ9H 2EXWD 5GISL 2XKNA 3SDDD 3HZYA 4LVNB 4F57H 4CADA 1RZ7L 1F4YL 4JFXA 3PUCA 3P30L 3VXNA 1FN4A 1A14H 1XF2B 1FORL 1HXYB 1TJIL 4OD2B 3OF6D 2CMRL 5HHOA 2B4CL 5FOBA 1KIQB 3QH3B 1A1NA 2HT4D 1U3YA 1A0QH 3K2MC 5M94B 3VH8B 1KB9K 4OD1H 2IPUK 4ODHL 5EU3A 2EC9T 3Q0HA 3HZVA 3OAUL 4KTEL 4MB5A 1U2HA 1NC4A 3SDAC 4HK0A 4OLZL 4YXKL 1UA6L 2X1QA 2OJEB 4TQEH 4OCLC 1OP5K 3ARYA 3B83A 4HJGA 1ES0B 3DSNA 3H3BC 4OCWH 4X6DE 1NC2B 3LB6D 4WJ5B 5CKGA 5D8JL 4OZGB 4FQIL 3TH4T 4DKEH 5J8OA 3TIEB 1F11A 3T0EE 5MHSE 1UZ8A 1S7SB 1NBVH 4TVPD 3QFDB 4KK5D 2H3NA 4HWZB 1QSEA 4F3FA 5JW4N 1UC6A 4KHTH 3VI3E 1CFBA 3OAZH 4JR9H 4OCXL 4K9EC 4LCCB 5LXGH 1HXMB 1GPOH 3G9AB 1JV5A 4U0QB 1RZFL 3O9WD 1QKZL 5D7IF 4CVXB 1LDSA 3GO1L 3C60A 4ZPTA 5HJ3A 1BOGA 4GQ9H 5J0BA 2CLZB 3G6DL 5SX5H 3QIWC 1KSRA 1TZGH 5L6YL 4TSAL 3BYYA 1F97A 4MCZA 2GTWB 3H3PL 5DC9B 1INQB 1I3UA 2OL3A 4P5TD 5HHNB 4M1DH 3RL2B 1G9NL 3ZSTA 3DGGA 5CZVH 3UPRA 3S36H 2FEEI 4R6UA 1X6LA 3CH8A 4IMLA 4G8FB 1B9ZA 5D7LB 3FMGH 3ZKQD 1QRKA 4RAUB 2HT3C 1C08B 4Z77B 2ZUYA 3QUML 2NLJA 3D69A 2WBKA 2WLZA 1WFOA 3DWTA 2RB8A 5EN2A 2ADGA 2A0LD 1J86A 3PNWA 4LLVB 5C07E 1FZMB 5DR5L 2BHUA 1I8IB 2EZ0D 2XN9D 3IDIB 4U05A 3GIZL 4JKLA 2YPLA 2P5EE 1RJZA 5L2JB 1DE4A 3KYOA 3NCYS 3SGDI 4H0IA 4EDXA 5T3ZH 3BMVA 1UM6H 1TMCB 3AREB 1MFDL 4P5TB 2HWZH 4N0FA 1KCSH 5F1KC 4JFDD 1A6ZB 4I2XB 1KC5H 3TP4A 4D9RD 2EDFA 3FRUA 4ENEC 4R3SA 4YUEH 1YN6A 3AS1A 5CBEB 3MFFB 1KENH 5FHAH 4FFWC 1P2CB 4QO1A 4R4FH 5ISZD 3CLFH 3ME0A 3DVIA 3MJ9A 1DQJA 3HI6L 3UZVB 5LQBL 4WU7A 1J1OH 3H42L 1RURH 2J8UF 3JTSA 3ISWA 2FB4L 3DVGB 3T0DA 3DHJA 3UZQA 5C0JB 5DVNA 1NFDE 5JUEL 4XRCA 3ESUF 4IEFB 5IK3A 3D3VE 3MCLH 3CMGA 4JFDB 3BT2H 3TJEL 4QRQB 2DWDA 3FFDA 4HUMB 2QL1A 2GJ6A 5DO2D 4EXPX 1RZ8A 3I6GB 1ZLSH 2B39A 3DBXA 3LRSB 1N5YH 4KAQH 1AKJD 4MXWH 3CFIC 3D9AH 4YIQB 5KTEL 5ISZB 4EN3C 1FG9C 4K3DH 2FX8H 3HNTL 2OS7A 2EDKA 3ULVD 4LPXA 3F7RA 3M17A 3JV4A 5CP3A 3WV0A 4Z7WA 3CFKA 3QDAA 5GJSL 3ZE2E 1T0NA 2XY1A 3EOTL 2DIJA 4HT1H 4NUGL 1SVZA 5JDSB 1F42A 1T5XB 1YQVH 3RFZC 3VXMB 2R0WH 5IR1B 2Z4QB 5SV3A 5DJYA 3EOBA 3TEUA 2IH3B 3MNZA 4DTGL 3ULUC 1NCWH 5I1KH 4UQ3A 4L4VD 5AYUL 3KYKH 5GXBB 2CUMA 1IGYA 1MCCA 5FGBC 3TM6A 2DD8L 3BVNB 3VH8G 4GBXC 3O4LD 4KHXL 4IOIA 3U36A 2CXKA 3DRTB 3ZYOA 1CLCA 2ZOKA 3HE6D 4ELMF 3E1F1 1XCQB 1OAQH 1DVFA 1QYGH 3W9DB 3LN4B 1I85A 2JJTA 5F93C 3V5HB 5IQ7L 3ZE0E 1AJ7L 3MLXL 1BVKB 2IANE 3RGVA 1QHOA 4LLMA 4PGDA 1ZT4B 4G6KL 1PG7X 2Q6WB 3KLHC 1G6VK 4X5LA 3SKOB 1NGWB 4NCC1 1I7ZB 4OUUB 1DQMH 2P47B 1MAKA 1ACZA 1T03H 2P8PB 4U1IB 4NN5C 2W9DL 4LVOC 4QY8A 4WCYL 2ORBH 4JDZA 4RGNE 4XGZA 1XGRA 1WJ3A 1L4IA 2VMFA 3FQTB 4OAWA 7FABH 1LK2B 1R24A 3HC3H 1LEGB 3BPLB 3ZSSA 2I07B 1UKTA 4XVUD 4Q74A 2A77L 2P8MA 3NFSL 2Y23A 5C08B 1PYWB 1GVIA 3C09B 2R0LH 3OKMA 3T0WA 5FCUH 4G8GD 2ADIA 3GMQA 3T0EC 4HH8A 4LF3B 1J1XH 2UYLB 1XCTA 3QULB 1NH6A 5E6IC 5DJZB 4PJDF 5GIRA 4JO3H 5T1DL 4N0RA 1MHCA 3DURB 4ZUTB 2UZIL 1S7XA 5HHPA 2P1YA 1F6LL 2GT9B 1IGFH 3T2QA 3QUYD 3RUGA 4ZNEA 3ZDXF 4GOSA 1CGVA 5GS1C 4OZ4A 4NRXB 3MBEA 3H9SA 3R1GL 5CBAB 1WFNA 2EO1A 1CD9B 4R7DB 2X4NA 4X6FB 3CX5J 1NSNH 5DVMA 5K9OA 1MFEL 2DLEA 4NZRH 4I4WB 2EIZB 3HS0B 2ZZUT 3MZGB 4UU9B 4G8GB 5HVGB 2VDKH 4QKXB 3QO1B 4WENB 4Y4HC 3GSOB 2OR7A 3DMMC 3UJJH 4C83B 2YKLL 4Y4FD 4APQB 3PP4H 5CJBA 3T3ME 3QQ4B 1T1ZA 1OTSD 1OTUD 4MMXC 2W0FB 1AGFA 1YEHL 1VKXB 1AGDB 1QFUL 1A1OB 1IGJB 2JIXA 1ADQH 1WBYA 1R0AL 3TBSB 5CEXB 4KRMB 3DO7A 4NN7B 1X4YA 2VXSL 1U8PA 3H7BA 1EV2E 5EBMA 5JHLH 3P0GB 4PB0L 3TA3B 4GG6B 2C3VB 2HTKD 1TXKA 1BQHB 3FFCA 4OZIF 3QWOB 3QPXL 5E4IA 4LRNL 4JO4L 1O7SA 5GSRA 4JANA 1I4FB 1PX3A 4EUPA 3S88L 5CD5C 3T0AA 1IFHH 3VJ6B 5JHDB 1REIA 4KC3B 4Y4FB 3OQ3B 5HHVL 1JZ8A 5I8CA 4GAYB 3VA6A 4C54A 3MRDB 1IQWH 4XNQB 4NKOA 3VFPA 3MYJA 5HD8D 2OP4L 1BFOB 4XXDB 3KPRA 3WHXB 5IGXH 1QBML 1OARL 4PB9L 4YWGL 4KROD 1W0YT 3C5SA 5JW4Q 2GSGA 1CFNA 4HUXB 3M07A 3WIIL 1T0MB 4HPOH 4YC2C 4WU5B 3BZFB 5ICXB 4OJFH 3U0TB 1MRCH 1H3PL 2BNQD 1A5FH 3ROOB 3CFCL 1ZS8B 3TBVA 5CJOH 1YMMA 3GJFK 1A6TA 3QI9D 3VD7A 4YDJA 3NGBC 3D85A 4KI5E 5HI5D 5FYJH 5BW7C 5FM5O 4LPTA 4S1SL 4NZTH 2XG5A 3ZKXB 1R5WA 1G9MC 4JRXB 1EXUB 2R1XA 4ODXB 2AV7A 3KR3H 5C8JA 4O4YL 3WYRA 2YC1A 3ZHKA 4R2GC 4CGTA 2O5ZL 1KIRA 4XTRC 1KJMA 2UWEA 3BP7A 4TRPH 4ZODA 5I1AB 5GGQH 1I7TB 3QXDB 5IMOA 2QLVB 5E8NA 5IM7A 1WBZA 3I75B 4AY0A 5KOMC 3TH2T 1NBZA 2DLHA 5TFSH 2AABH 2VQUA 1N6QH 4AT6B 4WY7L 2GTZB 3I2CL 1K6QL 5EZOL 2M26A 3VXRD 1U3HB 3JTTA 4RMUA 4GXUM 1NGZB 4RCAA 3ET9F 3MJ8B 5EUOE 1HH6A 4ZOAA 3GM0A 4C57C 3FQXB 3FZUD 3ZYJA 1IEAB 4LKXA 1ZSDA 1I9RH 1OCWH 3PP3K 1HDMA 5GRJL 1TQCB 4KH2A 4WV1A 3BZ4B 3KS0J 1U93B 3UTQA 5D7JC 2DI7A 3N9GH 4DAGL 4HBCL 2WZPD 1FC1A 3K2UH 4M1GL 4N5EC 5T1MB 3X3FL 3HZKB 2XYCA 3ZDYF 4PY7A 3BQUA 2VDRH 2MFNA 5EC2B 1JL8A 3P9LB 4FXKA 1AD9A 3F58H 4OZHF 3SBWC 1C5DA 2PTTB 2Q7NA 5FYLL 5ENWB 1NANI 2EYSB 5FHBL 5C86A 2IBZX 1U91B 5T1LD 3F7PC 4F7CB 4RGNC 1CF8H 1J05B 3ARPA 3H2WA 5E5MA 2FRGP 4K7PH 3GMOB 4YHKH 5B39G 1T04A 2W60A 4TVSa 1L6XA 5T3XE 3QIBA 3TH3T 4Y5XA 2IBZY 3T1FB 4U33A 4DGVH 3WUWA 3V0WH 1NKOA 3AB0C 2LE9A 1ZA6A 3QDMB 3WCYA 5C09B 3WNLA 1SVCP 2IF7A 3VFSA 1PBYA 4NQVA 3VRIB 3QPQD 4DEPC 3SDAB 1FFPB 4DZBA 5HYJE 1MNUL 4K55A 3SGJA 1MWAH 3MV8D 4LAJH 4M02A 3CFBA 4FMKA 2IFFL 1FZOA 4K8RC 4R90H 4JZJA 3JV5A 2GAZA 1S9XB 3PJSA 2JJWA 1X44A 3NPZB 2VXTL 4O5LL 2CIIB 3E3QC 4X4ZA 2PXYD 3IDJB 3HNSH 2J4WL 5C71A 4OGYH 3RWGB 2DI8A 5I1DA 3FAWA 4F80A 2F53D 1LO3H 1VFUA 3FT4B 1QUNA 5E8DL 1BQLH 4ZFZB 1RIHL 1BQHG 4LOUD 3NZHH 2LFGA 3VCLB 4J4PA 2P43B 5AAWA 4R96B 1R5VB 3LEYL 4Z7UF 1GGTA 1MY7A 5DRWB 2EE9A 4JQVC 5EG6C 4YGVA 5J06A 1P4IH 2WV3A 1IL1B 1Y6NR 2OZ4H 3RVVC 2PXYB 1LO4L 1TQBC 3MV7A 2VZUA 1MCJA 3GMRB 3BGAA 4NQEA 2F53B 4LLDB 3B9DA 3IJYB 4AENA 3RNQA 4LVEA 4WI3A 3CK0H 3P11L 3V6FA 1JTTA 1CLYH 5C9JB 5IG7B 5C9KA 1JPST 3JWDL 4NWUH 2ZUXA 4HUWA 1CIDA 3T4YB 5JA9A 1U36A 4M1CC 3O3AA 2ARJA 3ARFD 1EEUA 2G2RB 2X4RB 3WFHA 5J56B 3MUGB 1LO0H 2XZCH 2Y25A 3C5ZD 3IU4H 2ESVB 3LKPA 5HYSA 1YPZA 3VDAA 1CZ8L 5D96B 3NCCB 1QSFE 4U7KA 2X4PA 4MA7H 3C2AL 4HS3A 2BOCA 4U1LA 1AO7D 4XNXH 1WC7B 2F8OA 3U7WH 2FGWH 2FJGA 5EU4B 3WFEH 3G08B 5HHQA 4ZFGH 1LNUA 3PGFH 4M5YL 4G43A 4LLQB 1G7QB 3UJTH 4KI5C 2A9NL 1BWWA 1ZHLA 3GMLB 5E6YA 5DUBB 4ERSH 3QIUD 4PJEA 4YK4C 3ARFB 3RBGA 1KT2B 3PWJB 5DK0A 3B2VL 4FFZH 1CXHA 1U42A 4OZGF 3OR7B 1PG7L 4P3DA 4Q2ZB 5ICZA 5I30H 3E8UH 2F5BL 3TYFA 5ADPL 4FQXA 3TBTA 3BGFB 5F88B 1D5IL 5ITFB 4N0UA 4S1QH 2A73A 2ICWI 2VLLA 3BKYH 3SCMC 2VITB 4EN3B 1J7VR 3DO3A 5DC4B 4ZUUA 1VGEL 4XPFH 3KPTA 2E5EA 3MRQA 2B2XL 4JFEE 4N68A 2C1OB 1IQDB 5FO8B 4G7YH 3QIUB 2R2BA 2XT1B 4LAQL 3CNKA 2AEWA 4KK5C 3Q5TA 3NIDF 3V4VH 4W6YB 5HGDA 1JVKA 3ALXA 3TZVB 3TT1H 3RVTC 3G04B 1ZT7B 4OLEA 1U92B 1NCCL 5F9WB 4M7JL 1JIBA 3P9MA 1W72A 3EDEA 4NQSB 1YNKL 5C0EA 5DMYA 4L4TA 1LEIB 1MFNA 2J8OA 5LGHH 5TPWL 5I16B 1F90H 1S9YA 2DQUL 2H6PB 4OF7A 5E2TH 2VLMD 5GRXG 2G5RA 3TVMD 1NL0H 2YPVL 2QQQA 2GK0B 5E8OA 3DX9B 4LIQH 1RUMH 5MENE 2QQNL 4JFPB 3MJ6A 4L8SB 1BAFL 4PRHD 3IDMA 3OXSB 4G8EB 3S4SB 3AUVA 2BOBA 1LD9A 1L0QA 5HYQB 4LSVH 4X6BB 1OAUH 2XWBA 4WFHE 4TSCH 3W9EA 2B1AH 5E7FA 4IHOA 5E8EB 3S3PA 5DD5L 4XNZC 2FHFA 1NDGA 4QRUA 2R1WB 3V2AR 4JN2A 3VXPB 2Q8AH 4WHTA 1WIPA 1R3JA 4ZUWA 3FN9A 2YD9A 4M7LH 4JZOB 4NN5B 4Y2DC 3LS5L 3TVMB 5D72H 3V79C 1KB9J 4FTVA 4GW1B 5ANME 3CPLB 2Q1EA 3KPMA 1NEZG 4W70A 2FX9H 5C0BE 2LU4A 5DD3H 4MAYD 3S37L 2ITDA 2EECA 4WGWB 4PJBA 3ARGC 2O93L 4X6DB 2Y4SA 1A6PA 1KACB 4LHQB 4XVTH 2NXYB 1ZA3B 1JYXA 4U4BA 5GS0D 3RVUD 1JFQH 1N7MH 3SJVE 3OB0K 3T0EB 1NAKL 2BNUB 1FYTD 2BJML 5M7QA 1V3JA 4E42B 2FYYA 4TTGA 3U9PH 4FQ1L 4LCUB 3BPOC 4U49A 5C07D 5GGVH 2E9IA 4CNIB 3D6GA 5GS1B 5J11C 3K80A 3LKQB 4F58H 1BHGA 1MHEA 4JG0H 5FM5M 4PP1D 2DDQL 1XF1A 1AGCB 5IHZB 5J6GB 4LSSL 2YRZA 3K7UA 2VOTA 5BMFH 4M7KL 1HYSC 5E9DD 1SBSL 1BOYA 5AUMA 2WUBH 4MHHI 4K3JL 2VERN 4Y4HB 1G0YR 1FYTB 3QXAB 4NYLB 4FFVD 5TDNA 1B2WL 1L9MA 4MWFB 2VABA 4ONGL 5FK9A 3ULVF 3BDYL 2NY6D 2V5RA 5C07B 4CMHB 2E9WA 3MREB 1EJOH 2VN4A 4OF0A 2Z31D 3K1DA 4B53A 2DQEH 3E6FB 3S5LG 2AEIT 2D03L 2Z91A 1JRHL 2VDLH 4JFQA 1AHWA 4QRRA 4UTBL 3D0LA 1XF4B 2AJYH 3FONA 3RWCB 1JE6A 3AXLA 4UOJA 3D3VD 1OGAA 1RJYA 3IDXH 2QSCH 3EO9L 4F37F 5GZOC 1E6OH 4QHUB 1GGCL 1HYRC 1T3FB 1BEYL 5CJ5A 5CILL 5SWZA 4ONHA 3MPCA 2NY3C 1MPAH 2V7HB 3GBNL 4Y1AA 1T1YA 4C56A 3ARQA 2NY6B 1M7IA 3TPUB 4UOW0 2Z31B 5DMIL 2G9HB 4LLYA 4UQ2B 4HFWA 2VXUL 1R6VA 2VR4A 3ZTJH 4XP6L 5CD3B 3EYSL 5TE6L 1MI5A 4HGWA 5CSZA 5ESQB 3IRPX 1A1MB 1NFDB 1EEYA 3QHFH 3D3VB 2B4CC 1YEDA 1G6RB 1AGBB 4PJ9A 1ZWIB 4P4KA 4WTZG 3MLRL 2JTDA 4M6AA 2FR4B 4K94L 3RKDD 3NGBB 4MNGA 1HSAA 3O3UN 3LPFA 4XCCL 3TWCL 1N0LA 2MTPA 1JHKH 5DGQA 3SKJH 5DD1L 3H8NA 4YX2L 1RK1A 1NLBH 5KSVA 4Z7OE 4FG6C 1FNSL 4TUKH 5EUKB 5I2IB 2DLFH 4GLRI 4JVWA 1TCRA 5FKPB 1J0YA 5IBLD 3S4SG 1R5IB 4MNHB 2MWCA 1U58B 3BZDA 3I85A 3X11A 5IHUH 4NFBA 4TPRH 5DD6A 1JF1B 4PJHF 3CVHA 3V52H 1K85A 2J5LC 4DN3H 4DKDC 1OSPH 2Q3AA 3DXAE 1I1AA 2HFTA 4PUBH 1S3KH 1ZOXA 4F7TB 3RZCC 4WUUD 2W0LA 1A6WL 2X4UA 4YHPA 1IBGL 2BHYA 3ILPB 2PW2A 1G9NC 1RUPH 4XPGL 4HCRL 5FA4B 4XXCC 3RA7L 4GG6F 3VD4A 4D9LL 4R4BB 1JZ3A 3LOWA 3UBXB 1JPFB 5D7JB 4BSVA 1O0VA 3IGAB 4OFPA 5CZXD 1WSST 2IANB 2XQBH 3JSSA 1IAOB 3GUTA 3GSXA 1XIWC 4OCMC 4KKCD 4QYOA 1MRDL 2ZUWA 4X83A 2WQRA 1NGQH 4XPBH 4UILL 2PYFA 4F15C 2FLBT 4CN4A 1QHPA 2QTEA 2OL3L 3VFUA 1JGLL 1MCOL 3Q6GL 2HTKC 4KK9C 1PKOA 2BY0A 3HG1D 2FO4A 5TDPA 4G7VH 3JV6A 1MIML 4I77H 1FL5A 3RVWD 1U3ZA 1KNOB 1X5XA 4LVHC 2Y6SC 4QF1B 4KKLD 5B3JF 1H3UA 4WW2C 4P23A 4FQLH 1W0VA 1DUYB 2Y06H 4JVUA 1E4XH 2OR8A 1D5BB 4R4ND 5FB8B 1K9TA 3MCKB 2ADFL 1RPQA 3RJDA 3FO9A 5HVWA 2MQ3A 4DEPB 3O2VL 2FD6H 1IM9D 2CQVA 1C12A 4ODUA 5HY9A 5I76A 3TO2A 1T2QH 4MDJB 1IMHC 3RI5K 4IRZL 5JW4R 2YSSB 4HS6B 4JPVH 4F7PA 3HG1B 4WFFE 3SGKA 4MA8H 4JLRB 5EOQL 3OKOB 2Q76B 3T77A 4HULB 3T3PE 2WLYA 3LDBB 3C6LD 3OTTA 3RY5A 1PY4A 4X7SH 4PG9B 5D7IA 3WKML 4M6OH 5HPOA 5B4MD 4M61A 1E27B 4N90E 5F97E 3IVKA 3VXSE 3MJ9L 4NWTH 3WFBH 3UMTA 1FPTH 2Q20A 4WO4A 4QTIL 3VFOA 5KVDL 4FA8A 4OIIH 3OKEA 1DBAL 1A47A 1DFBH 2OYPA 1UACH 3NFPB 3UTTE 5F3BB 3UJIL 5KOVC 1KPUA 3DUUA 4U1HB 2K9UA 2OQJB 4MSWB 2EDTA 1RULH 3PQYD 3V4UL 4PJ5A 1TQBB 3GSUB 3FCTB 1VPOL 1TZHB 2N4IA 2YMXL 3BESR 1CFVH 2X4SB 3K4AA 4KGLA 1KBGL 2WSKA 1KTLB 3CGTA 4OV5A 1T4KB 1MLBB 2B8OT 5DWUL 4QLRA 2DQCH 3RWJA 4YDLC 2ZSWB 3STZA 1BF8A 2R2EA 5JR1L 2A38A 5CEZD 2ED7A 4EOWL 3O8XB 4HKJA 3MNWA 4JDVA 3MODH 4U6HB 1MCDA 2R4SH 1R3IH 3Q48A 1DEEB 1D6EA 2VXVH 1I8KB 4GKNB 4PJCA 3V7AE 1FYHB 1XAUA 2PO6D 5JIPA 3GSQB 3PWNB 1J8HD 3WJJC 3L3GB 5DJ6A 1IEBA 2I26N 3JUZA 4O2FA 2C4XA 3P73B 4Z8FL 4POYA 4OKVB 2RCSH 2JK5B 4DUWA 3P77B 4HEME 4P46A 5FYLE 2CRZA 4PRBA 4K9EH 1BZ7A 2Z35A 2DQFB 2HKFH 2HFFB 3W39A 3O4OC 2IAMC 3CU7A 2JJSA 5SWSA 1DQLH 3B5GA 1UGNA 2Y5TB 5C92A 2WWMC 1P69B 2Y36L 1HZHH 1IKFH 4YK4B 1LEKA 3SPVB 3GKWH 5ERWB 1OB1A 2OBGA 3B9EA 4X7TA 1NCBH 4HJ0C 1LK3L 2MHAA 3TFKC 3OKLA 2H2SD 2JE8A 4PGEA 4WUKL 3GNML 3VFWB 4UI2A 5HHOD 3V0VA 4OQTH 1FJ1A 4OI7A 3HB3D 5JMOC 3D0VB 1ZHBA 5FA3A 3G6AB 2ZCKL 2EIEA 3T2NH 3CZFA 2VLKE 5DQDH 1UM5H 5DJ0A 2OM5A 5I8KL 3P3YA 1NC4D 1LE9A 2CXGA 1EMTH 3RTQA 1KN4H 2IC2A 5EUOB 1TZIB 4P5KA 3G5ZB 5IBUB 3MRIB 3WNNA 2MKLC 1Q9OB 4L29A 2Y1VA 5DXWA 2VXQL 2E7CA 2ZSVA 4NQXB 5T3XD 1QSED 3QJHB 1ZEAH 1P6FA 1OAZH 5D6CB 4PRNB 4WTWA 5IKCB 1QFWH 1Z6JT 4BM7A 1TFHA 4ELMA 4UB0L 1L7IL 1HI6A 3QEUA 4JY4A 5KN5B 3FOMA 3C60D 5HSFA 2AJXH 4MJ6A 1BGXH 2HTLC 4KQ4L 3N50A 5LCVH 5FCSH 4GAJH 5HGBB 1QBLH 5BS0E 1CT8A 3QNZA 2IPTH 1VFAB 3O41B 1I7RA 3DSFL 2C3HA 2YD1A 4HPYH 4I0CC 3CUPA 4PRIE 1FAKT 1W0WB 3IJSA 4XCFL 1UQSB 5C0RH 4AM0B 3CH1B 1QR1B 1SY6A 3PWLB 2NR6D 1J5OH 2NMSA 5K9JH 2R9HD 4OI8A 1G7PB 3MRMA 3HAEG 3KPOB 4U1MA 1JK8B 2W92A 3SE8L 4Y2DB 4YGAB 4NO5A 1KPRB 1P9MC 1H3WM 1HH9B 1JWUB 1T1WA 2DB8A 4P9MH 4U2YA 5ECJE 5EWIH 2YPLD 3RL1B 2CH8A 4DN4H 1NCDH 4L5FH 1A02N 1C7TA 4GSDL 2GFBA 2Q86B 3ARGB 1S7TA 1Q9KA 2DI9A 4PJDA 1IILE 5DRXB 5JXEA 4L8CA 4AG4H 4O51B 2DRUA 3DV6B 3L6FB 1A3RL 1OW0A 5DEGB 4GT7A 3ULUH 4LMQE 2Z8RA 5D1ZC 3LKOA 1F13A 3R06A 2AJUL 3DRQB 5GJTL 5E00A 3MRGB 5DDHB 1S5HB 4CVWA 1Q9LB 3BPOB 2RBLA 2B5IB 4CAGA 3DI2B 2D7PA 4JFYA 6CGTA 3WSQH 1BFSA 1I1YA 3MLSL 4I0KA 2YZ8A 3D2UD 4X5XA 1A9EB 4JG1L 3WL9B 3VXTB 4YEFA 3UTZB 4YHIB 5LWYH 5D71L 4NZJA 3RBSA 3FT2B 1CYGA 5ITBH 4XH2B 3IFLH 5I6XC 4O9HH 1RUQH 3BP6B 2V17H 2AJZB 3IU3B 3NABH 4I0PC 5F96H 5E2VH 4POZD 3FQRA 4ONFL 5J4MA 5IROC 1DANU 3N85H 1BD2A 2GJZA 3RWEB 3HFMH 3B5TA 3DTXA 3HRZA 1VHPA 4ORGB 4OZIA 5DEFA 2ICWA 4WWKD 4BH7B 3BW9B 1PFCA 3NIFE 4XCYA 3QFJA 1KB5H 2XPGB 3MGOB 3OWEA 5ACZB 3D2UB 6FABL 2NY0C 4MZ2A 3FKUS 5SWQB 1P53A 1QSFB 2HVKB 3TV3L 3BKML 3PF2A 3L1OL 5BJTB 4OFKA 1ADQA 3MRPA 2DBJA 4LSPL 2NY3B 2K7PA 3NZ8A 4M62H 2VC2L 4RIRB 3C87A 1M7DA 2FX7H 4Z7NE 1MAMH 5CIPB 2AS5M 4U6VL 2EYTB 2OR9L 4R97C 3KLAA 3DVNB 4GRLC 4GKSA 3IFOA 1X5GA 1MEXL 1N5AA 2P44B 4QXGL 5DS8A 3V5DA 4RX4A 4CKVX 5TE7H 3CIQA 5KZCD 1KFAH 4PJAE 4RAVA 4EZMA 3F7YB 2Y7QB 4FXGA 2NW3A 1Q1JH 2IQ9H 3VI3F 3WFDH 1TTFA 1T6VN 4NQTA 4UNTA 3GHBH 4JO1H 4G42A 4NKDB 1S9VA 4XP9L 4F2MB 1A3QA 4PP2A 1JPTH 4CN1A 2H9GA 3J8F7 4BFIB 4HWEL 1QG3A 1NMAH 4JFEB 5HGAA 4U2ZA 3WLBA 3KG5A 4KZEH 2YWZA 5MEND 4WEUD 1FDLL 3C6SA 4PGBB 1G84A 2VE6B 3EYQD 4PGCB 4QOKD 4YH6A 3MGTA 4ZNCD 3AU1B 4LSQL 2DJ4A 1A7QH 4OCRL 1HSBB 1DSFH 3K3QA 1HOCA 3BEVA 4L4JA 3VXUA 3O6ML 1DBML 2J5LB 1VFOA 5DT1L 43C9B 1QQDA 2K3TA 4K7FB 4DCQA 1YEFL 4U6XB 3MLTA 4U1JB 1F3JA 1RV6X 5D5MA 4LPYA 4Q6YA 4HXAH 5MENB 3MBED 1IAIM 3H9SD 1T89A 4GKZB 3GZKA 2XICA 1NUNB 3SE4C 4OZHA 4QOKB 1DBKL 1GOGA 1G6RH 3QSKB 3SJVD 1XIWB 5D2NC 3FB5A 3JWDC 3VFTB 3QDGA 1YC7A 3EJZD 1MHHA 1GGIH 3IKCB 4P0DA 4ZFOB 5DMJB 1G9MH 1GIGH 1BBDH 2WIIA 5L2KE 2QKIB 3KPLA 5ANMB 1XF5A 3TT3L 5C0BB 1JPSL 3L5WB 3TBYB 1MJJA 1FL3A 3KYNA 2KZWA 5JOPE 5IMMB 3NN8B 4GO6B 4POUB 3GFUA 4LVHB 4XB8A 1Z9OA 2ED9A 4WW2B 3V5KB 2EKJA 3BRGC 4ODBD 3QUKB 5I1HH 4ETQA 1GGYA 3FFCD 1GGBH 1HQ4A 1U8QB 2VO5A 1NMCB 3SJVB 1ZLUK 2VZTA 4X9FA 4JN1H 3L3OA 2PYEA 2E7HA 5TQ0H 3WXWH 2AKRB 1ZGLB 4MAUL 2C1PA 4I3RL 4OD3H 4YDIL 5GGRY 5EC1B 2GSIA 1EGJA 2O5XH 5F1NB 3MRLA 3EUUA 5D70L 4HS8L 4LNRB 1ORSA 3KPRD 1Z3GL 3KHQA 2VSDA 4HMCA 4PY8J 4CJ0A 4G9FA 4L8BB 3MRBB 5EO9B 3F7VB 3UEZA 3PHSA 5EU6A 2M1KA 1JN6B 3BEWA 2AERT 1J0KA 3U4BL 5E95B 4HKBB 3DLQR 3MSPA 1MWAA 1T0PB 4P59L 3U48A 3F5WA 1QNZL 2APVA 1MJUH 1YMMD 4Z7UA 3WFCL 5KSUA 4NCDA 1PJ9A 2R4RH 2ZKHH 3D85D 4X0KB 5EB9A 4BELD 5FYKE 3GSVA 5HPMA 1FO0A 3H9ZA 3MRNB 3PDOA 3HR6A 1S7UB 1EFXB 1NFKA 1L7TH 1EEQA 2H26A 1FFOB 4PBVC 3EFDL 3LAFA 3I02B 3CMOH 4HXBH 3RY4A 4JRYE 4NJ9L 4MDIB 1IM3B 3HI5H 3VFGL 1JNHA 3ZE0F 1MCPH 2OSLA 2CDFA 2N7BA 25C8L 4NRYA 4S2SB 1N6UA 2IALB 3X3GH 3IXTB 1YECL 3MV9D 2FL5B 3G6JE 3L95B 3RNKB 4WEBH 4NHCL 4BZ2H 1J1PH 3CU1A 1HN1A 2WWKO 2RHEA 4M4PA 1CK0H 3LS4L 5KVEH 3VFRB 1XF2A 1HXYA 1XF3B 4OD2A 1VDGA 1KLGB 4MD0A 4XNMB 1WFUA 4PS4L 4K8RH 4RMWA 1KIQA 3QH3A 1NJ9B 1IAII 3IT8D 1W72L 4TN9A 3VH8A 2R56L 1U9KA 4Z0BH 1CBVL 4KDTC 1RIVL 1UVQB 3MV01 4IDJL 5FUOL 1Z0MA 3HPLB 4ODSL 4A6YB 2DBLH 1M71B 2OJEA 3CXDL 2JCCE 1XGPB 5I8EB 3JV0A 3MV9B 1ES0A 4XCEB 4YE4L 1SM3H 4AYFA 1NC2A 4WJ5A 5ILTL 5KSAC 4OZGA 1CE6B 5CP7B 1U8OA 5KS9F 3TIEA 3LCYA 5GRWA 1T83A 3FO0L 2WP3O 1S7SA 1TDQA 3QFDA 1RIUH 4HWZA 4NO0B 2RQ8A 2HH0L 4LCCA 1HXMA 1K4DB 1A3LL 1ND0B 5HI3D 2V5SA 5DK2B 4OT1L 1UG9A 1GHFL 4QXUH 4CVXA 1PVHA 2DQGL 3FL7A 3QIBD 1EJ6A 4RFOH 5MP6L 5TQ2H 1DLFH 3MFGB 2CLZA 3NACL 4YR6B 3CFJB 4OFYA 5JW3L 2GTWA 3BSZL 3JXAA 1INEH 1INQA 1BVZA 1UJ3C 2EC9U 5HHNA 4M6NH 2FEEL 3RL2A 3T3MF 2IG2L 2XKSA 3WO3B 4XMPH 3DXAB 2D7TL 4G8FA 4ZAKD 2G75B 5D7LA 4RAUA 1C08A 4Z77A 1JUFB 4LEXH 3Q3GB 1CVRA 5I9QC 2A9ML 4DW2H 1AD0B 3QNXB 3BJLA 4LLVA 4M00A 2AV1B 1FZMA 4RAHA 1I8IA 1P4BH 3IDIA 4HHAB 1O5DT 3BP5B 1ZTXH 3ESVF 4G8IB 1MJ7H 5L2JA 2QSQA 4FFYH 2GITB 4NBYB 2R15A 4MA3B 3TO4C 3UC0L 1D5ZB 3AREA 4D3CH 4P5TA 2QEJA 4WHYG 1KIPB 5F7LB 2GJ6E 3HR5B 5F1OB 3BI9X 4GRWB 1A6ZA 4I2XA 3QJFB 4MLSA 2CGRL 1GZPB 4YFLF 4RGMC 4ZAKB 4UIMB 4OGXH 5CBEA 3VG9C 3MFFA 5FF6B 3MLWL 1P2CA 5BRZD 5J1SC 4ZG1A 1NUGA 1LO2L 4QRSB 4UT6L 3MV7D 12E8L 1HWHB 3OR6B 1UT9A 3LH2L 4NQED 5CAYB 3KPSE 1X9QA 3QHZH 1FVCB 5IJKC 5D9SB 3DVGA 2COQA 2E27L 5C0JA 5C0AE 3ARBC 1MFAL 4UBDD 4JZNB 1EEZB 5GRVK 5BOZG 3JWNC 3W2DH 1V7MH 4KTDH 4PG2A 4JFDA 3F62A 2HJFB 4QRQA 1NCUA 3W0WD 1JYWA 1H5BB 2EDQA 4DVBB 2LVCA 3I6GA 1WLHA 5EA0L 1E4KA 1FLRH 2YA1A 3LRSA 1XR8B 3O2DA 1JZ7A 3CFEB 5BRZB 4YIQA 3HMWH 4NKQB 5ISZA 1T1XB 4JHAH 4OGAC 1OSZB 4HJJL 4K94C 4RQQB 1FFQA 4JGUA 2WANA 1FGVH 3VXSB 4D0DB 5JDSA 1EUUA 3GGWB 4KKBC 1T5XA 4PJFE 5C0DA 3VWJD 1ZHKB 3VXMA 2C26A 2X1WL 4AL8L 4OBSA 4WI5A 2IGFH 5IR1A 3VWKC 1YY9C 2Z4QA 2CR3A 1G7JB 5KJRL 3W0WB 5I1EL 3UTTB 2IH3A 2ITCB 3MROB 3OB8A 3GBML 4XVSL 3FHQA 4NIKB 3NTCH 5JZ7D 3LIZH 1T80A 1ED3B 1OF2B 1BJ1H 4KK8D 5ABDE 1IC4H 3MJGX 3QG7L 1RUAL 3BVNA 4FQXD 3LRHA 1BZQK 1U8HB 4AEIL 3DRTA 1RVFL 1T6WA 5ACMA 1XCQA 1JI1A 4I0PB 4HFUL 3W9DA 5JQHC 3LN4A 3VWJB 2QV2A 4MA1B 1JF6A 4IRJC 2X89A 1BVKA 4S1DC 2UVFA 5BQ7B 4J3SA 1CS6A 3KJ4C 1ZT4A 2Q6WA 1MCNA 2CDGB 3SKOA 1NGWA 1I7ZA 4OUUA 2UZYB 4HKXB 3O6LL 3T2PA 3V95A 2NY0B 1QOKA 3QZWG 2R29H 2P8PA 1MF2H 4U1IA 4KXZI 3BYTA 4AZ8A 3ZT6A 2YN3A 4FP8H 3CVHL 3TYGL 2JB5H 5JXAH 2R8SH 2EH8H 2NYYC 3ELAT 4OM1L 5MI0C 3AS3A 3FQTA 4U1KB 1IZJA 3LZFL 1LK2A 5ALBL 1LEGA 2I07A 1HIML 4PRDB 1EBPA 3ZTNH 4D2NA 2C4FT 4JEGB 2BY1A 4TOYH 4R97B 5J6HB 5C08A 1PYWA 4YPGB 3WXVL 4M9PA 3DX7B 4WWID 4GRLB 1MQKH 4LF3A 2UYLA 3FO1B 5FYJE 3QULA 3CCHB 5DJZA 5TDOB 5EBLB 35C8H 2OLDA 4JFFE 3EYUH 4JREC 3DURA 4MJ5B 4MVBD 4ZUTA 3UBXI 1K8DB 4MQ7B 2GT9A 1K5NB 1UXSB 1GH7A 2A74B 4IRSD 1EIBA 4ZUSB 4NRXA 5CBAA 4R7DA 1AFVH 1NAMB 4X6FA 2EKSB 1QO3B 4FTVD 2MPAH 4X4XB 4I4WA 2EIZA 5DEZA 5FKAB 2VLKB 3HS0A 4TUJB 4UU9A 4G8GA 2X7LB 3QO1A 1RZKL 2NY5L 5CMAB 3EZ8A 1T7XA 3IDNB 4J1UB 3VE0B 3GSOA 4C83A 1Q0XH 3SEPA 2E6PA 5JMRA 4APQA 1B0RB 3KNBB 3QQ4A 4PGZA 4NN6C 5A43C 2W0FA 5IEKB 2RGSA 3UO1H 4CMMB 1M05B 2DIAA 1KGCD 3EOAB 5KVGH 2DN7A 2APTA 1BM3L 4IRSB 1VKXA 1AGDA 1A1OA 1IGJA 2XFXB 3MXWL 4XC3H 1A7RH 3ARDC 3TBSA 5CEXA 1Y0LB 2E9BA 2DLTA 4G6MH 3QEHB 2GY5A 1A0QL 1IT9L 4O58H 3TA3A 5CIPH 4GG6A 5GISH 2C3VA 1BQHA 5E99H 3QWOA 4I18B 1RZ7H 1F4YH 3P30H 5JOFB 1I4FA 5BS0B 1FORH 1TJIH 3VJ6A 5JHDA 3D39E 1P4LB 4Y4FA 1MLCB 4UNUA 1EO8L 2CMRH 4MJIE 1CLOL 4GAYA 4OCWL 2B4CH 5BV7L 2JELL 4PRIB 3MRDA 4XNQA 4U0RB 3HC0B 1ZANH 3VRJB 1BFOA 4ODHH 4XXDA 3WHXA 5DI8B 2FHBA 4BQBA 2Z0BA 3OAUH 4KTEH 2UWEE 4KJWD 3LN9A 4HUXA 4U3XA 5I1LB 3RY6C 4YXKH 1UA6H 1T0MA 4JHBA 3U82B 4WU5A 32C2B 3BZFA 5ICXA 3ROLB 3U0TA 5INCB 4Z7WF 5GS2D 3ROOA 1ZS8A 3LQZB 3RIAF 2J6EH 4X4ME 1OP3K 2FIKB 4QRRD 1ONQB 3RVXC 2VLRE 4E5XB 4F9PA 3ZKMD 3T09A 1TVDA 2XKUA 4FQHB 5MEOB 1WWBX 2DS4A 3MRRB 1EXUA 3GJFB 4JRXA 1RZFH 1BZ9B 4ODXA 5GZND 1QKZH 2FBOJ 3GO1H 3S36L 4NKMB 1JZ2A 4BFGA 1DVFC 5E2JA 4K7PX 4Y1AD 3V8OA 5IWLC 4C56D 5I1AA 5L6YH 1WITA 1I7TA 3QXDA 2BNQA 3H3PH 3RGVC 5IMKB 3S7GA 3I75A 3SQOH 1G9NH 1MI5D 4AT6A 1WAAE 2GTZA 1PSKL 4HWUA 4AH2B 4K7PY 1U3HA 2IMNA 5T5FL 4E41E 4H5SB 4ZS7L 1NGZA 3MBXL 4O2CB 4P4KD 3QUMH 4PJ9D 4PTTB 2AXFB 3MJ8A 3WN5C 4RMTA 3UYRL 5E94B 3FQXA 3JUYA 5D6DA 1CFTB 4HLJA 5DUPH 3BIKB 5BOPA 1IEAA 3GIZH 4ALAH 1H15B 4HWBL 5L7XL 3BUTA 5IEHB 4RMQA 3L3KB 3BZ4A 1BLNB 3LY6A 1U93A 5GQBA 3ARUA 2P45B 1MFDH 1FZKB 1RU9L 5GHWH 3WIHH 5T1MA 3HZKA 5EC2A 3P9LA 2EE3A 2V2XB 4HGKC 4KY1L 2PTTA 1DJSA 2BVQB 5ENWA 2EYSA 5IFJB 5KAQG 1U91A 1DUZB 4F7CA 2QHLA 5E7BA 1J05A 1B90A 4WHYH 4HX1B 3PGCB 5LQBH 2D0HA 4Q6IC 2DMCA 3GMOA 1FBIL 3U0PB 3WHE1 2FB4H 1I1AD 2WIMA 4HG4J 1BP3B 3T1FA 2L4OA 2UVEA 2NTFB 4K3DL 4CVZB 2NXZC 2Z92B 3QDMA 3TJEH 5C09A 4LFHG 3VRIA 4GRMB 3EJZC 3MOQA 4Q9BA 2W59A 3SDAA 5E70A 1FFPA 4HT1L 4PJAB 3OBAA 1NUDA 1GZQB 4WW1B 5KTEH 2H41A 4XMLL 3UTPE 3QXVA 1PD6A 4QGTA 3FHAA 5DMGC 4Y2OA 1S9XA 2CIIA 2R1YB 3Q6FB 3IDJA 5I1KL 1ZLVK 4P99A 3RWGA 2D3VA 3EOTH 2DLIA 4NUGH 4ZO6A 3FT4A 4PYHA 2HMID 3L5XH 1C16B 4ZFZA 1SY6L 3T2OA 1UCBH 2YD4A 3VCLA 2HVJB 4NJAL 3S3SA 1MJ8L 4DTGH 1CD0A 4FABL 4R96A 4P23D 3THMH 2NY2D 1R5VA 4LHUG 2H2PC 1OTTD 4TNWF 5EULV 1PQZB 5DRWA 1H8SA 2DD8H 3OKYA 5L8JB 5K9QI 2AJ3B 3B3IB 3LHPL 2I25N 3QDJE 1UJ3B 1IL1A 4X9IA 2HT2C 2PXYA 2FH6A 3GMRA 4OCSH 1WZLA 2F53A 3CD4A 3HKFA 3IJYA 3EDDA 1EHXA 2AQ2A 4OQTA 5GGRB 4JVPA 5C9JA 1ZXQA 3RKPA 5IG7A 5IQ7H 3MUJA 1AJ7H 3MLXH 2XTJE 5ID1B 3HMXA 5C0CE 4KK6C 4JFOB 1I8LC 3T4YA 3DROB 1UEYA 4PJEE 2W65B 2G2RA 2X4RA 3Q5OA 3TO4B 1KELL 3F7QA 3MUGA 2W9DH 3ETBF 4WO4D 2ESVA 1W8NA 4M6ML 4Y0GA 3FRPG 2F15A 5DHVB 4ACPA 4Y4KC 5HDLA 5LGKA 3HE7C 4LPWA 3PDDA 3EYFB 1QLRB 5FDYA 1OP5H 1H3XA 2GQHA 1WC7A 3VG9B 3C08H 3QXWA 5L2KB 5KW9L 1F6FB 2ARWA 2A77H 2XZAH 3NFSH 5EU4A 4QT5B 2P4AB 1KJ3H 3G08A 4PJ5D 4YHYC 4YAQB 4LLQA 1G7QA 4NQDE 4KI1A 2QSTA 2BXYA 4YBQD 3CC5B 3GMLA 3WNOA 5DUBA 5T1DH 3ARFA 4JKKA 3ARBB 1KT2A 5IJVB 1F02I 2UZIH 3PWJA 3W11D 5IBTL 4M8QB 1AI1L 3OR7A 2VDKL 5I1IL 4Q2ZA 1WIUA 3LEVL 2H8PB 3QCUL 1IGIL 2KDGA 5KANI 5F88A 1MCLA 2OCFD 2BSSB 2R69L 3PP4L 4WV1C 4GMTL 4XI5D 4Z7OF 5ITFA 4X4YB 5F6IB 3GSNB 4HQQH 4HZLB 4N8CL 2G60H 1MFEH 1ZHNB 2VITA 2YUWA 4EN3A 2DWEB 2X9YA 3BQUC 5FUCE 1XH3B 4JRYD 1FIGH 1F4HA 2C1OA 1IQDA 1XGYL 5FO8A 3QIUA 4P46D 2YKLH 1GJIA 4U6TA 5T3ZD 5AZEL 3CJJA 3QAZC 5J1AB 3UTSE 5JQ6H 3O0RL 2EEDA 3MR9B 3TZVA 2BFVH 1ETZB 3VWKB 3DETC 3G04A 5SWSD<