4M5ZL

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
SYVLTQPPSVSVAPGETARISCGGNNIGTKVLHWYQQTPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDISTDQAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1 chain
total genus 42
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL01
4AEEA 4N0CC 1RUKH 3VXTB 5IMLB 1YEEH 3S4SB 1H3PH 3MV9A 3T04D 4NJAH 1D3CA 4XPHL 4P9MH 1NGQL 4FQQA 4I9WD 4YGVA 4MD4A 1FVDA 3QAZB 3JV6B 1YNLL 4IRJA 2B2XH 1CG9B 5E95B 3O2VH 2BVUA 1IZJA 1GZQB 3MR9B 3KPTA 3MRLB 4IDLA 1NAMB 4HIJB 3LKNA 3GRWA 4I0KA 2J8UE 3LIZL 2RCSL 5GS1C 2SEBB 1SY6L 1CIUA 2DD8L 3HMXH 3MJ9H 4KXZI 2QKIB 5CCKL 3UZEA 3HE7D 4QHNB 2HLFC 3UTPE 4NWTL 2DM7A 4I48B 1LE9B 4O2CB 4ZNEA 1BOGA 1R3JA 5ACZA 1RZGB 3VI4F 1NBYA 1GPOL 2R23A 4ODXA 4U3CA 4KMQA 5IB4B 2ZUQC 1FBIL 4G42B 3PGDA 1E6OL 4QRTB 4PRNB 1K4DB 2R0LH 4M8QA 4PYHA 4HJGB 1IFHL 5F72S 4NQDD 3P9LA 4P46B 2LVEA 2BNRA 1RURH 4LVOC 1P2CA 4WUUD 5D7LD 4QXUH 5SWQA 4N0CD 4NNPH 2R1XB 1FGNH 4XNUL 5K59F 4RQQA 1C08B 1U91B 4M61B 5D1QC 3OZ9H 4NJ9L 2PXYD 3JWOC 1BFSA 4OZIF 3EDFA 2PCPB 1IJ9A 5JW3L 3I02B 5I6XB 2IGFL 3OXSA 2BNQA 3ARQA 3UMTA 2DBLH 4HHAB 2Z91B 1QPPA 2WWMD 2EEAA 5LWYL 4PRAA 2Q3AA 2DLGA 1RJYA 5AAWA 2A9ML 3B5GA 4O2EB 1BAFL 1INEH 5CJOH 2P7TB 4J3OC 1A47A 1YC7A 3K8LA 4G8IA 4P23B 1U8KB 3ARFB 4NGHL 2DLEA 3L3OB 4C4KT 3TNMB 3BZEB 3L7FA 1LNUA 2IMNA 5EOTB 2EO9A 2DYPD 2FL5B 3BYTA 3L3DA 3GUTB 3RVVD 5T1LD 4YE4L 2X70A 2Y5TA 3P0YH 1IQWL 1FDLH 5E6IC 5ESAA 2VAAB 3VFWB 1Q8MA 3UX9B 5I1KL 3LQMA 4Y19A 4YHIB 3QUXC 3D18A 4LVHB 4OBRA 1KJMB 4HUUA 4GH7B 1OAXL 2A9NL 4UIMB 5L8LB 1RFDH 4D9LH 1X5HA 3N06B 5GISH 1OARL 4Z7UF 2VZUA 4KI5E 3ROLA 4BH8A 4OF6A 2XXCB 1IGML 5H8DA 4WWKC 4GQ9H 4JFYB 1U92A 3GRWH 3W0WB 2FO4A 5JOPD 1NLDL 3I3EA 3T4AB 1P7KA 3F5WA 1A7NL 1V7NL 4H25A 4JFEB 5B38G 3QCTL 4PIRF 3E8UH 4NFCA 4PLNC 1H0DA 2VLRB 3EZJB 2IANB 4JY4A 2VABB 4I2XE 4U1SB 1RZ8A 3I9GL 3OAYH 1G7JB 3CH1A 5D2LA 1K5NB 4KJWC 4S1DD 3HZKA 3VD4A 4I3RL 4MJIA 3BOVA 1JMZA 4JPKH 2QL1A 1EXUA 2YPLA 4H20L 4MQTB 5I1GL 1CYGA 3HZYB 4HZAA 5IMKB 1AD0B 3BZFA 4Q0XL 4E41D 3QEUB 1T5WA 5L8JB 1CFNA 5M95B 3BRGC 1A6UL 3JWOL 5GZNC 5HVHC 4NQEA 2W0PA 4U49A 2BNUA 3AB0B 3K3QA 4NC2B 1OL0A 3AMKA 1G9EA 2YEZA 2J8UF 4MCYB 2O5XL 4MXWL 3MRBA 1B6DA 4BH7A 1QPXA 3VD5A 1A6AA 4IRZH 4QRUB 2I24N 1CL7H 5KSBE 2FWOB 5CP7B 2V6HA 3S35L 1NKRA 1MAKA 2B20A 4XAKD 5HY9B 1SJXA 5DQDH 4XHJD 2P46B 3GEWB 3PP3K 1OCWL 4APQA 2NX5B 5I2IA 5DD3H 2BNQB 2APXA 3L3HA 3QDGA 4N0UB 4J4PC 3ULSB 1AGEB 1OTSC 1OVZA 1KGCE 4IEFB 2WUBL 5KN5A 4JPIB 4MJIE 5DI8A 3U36A 1IMHC 1MHHB 1XIWA 2OP4L 3WMSA 4ODWB 1EO5A 3ARBA 2EDHA 4NZRH 5IVNA 4YXLL 2CJUH 4AZ8A 1I7RB 1UACH 2DKMA 3VGDA 2EEDA 2OL3L 5JUEH 3VWKA 1Y6NR 3OR6B 4OSUH 5ILTL 1U8IB 3BD4A 1FNLA 5BRZE 5I76A 4TQEL 5TDNB 5IJKA 3B2VL 2AJXH 2ZKHL 3EGSB 3GKWH 1CLYH 5IG7B 4OJFL 1JI2A 3RNQB 3ULVL 2YPVH 2V9RA 1H3WM 2ARJQ 4M03A 1X5FA 4Y19B 5I16B 3L3JA 3CFJA 4HW6A 1RK0B 4IMKC 3L6FA 4OGZA 5JXAH 1FORL 3C60C 4PTUA 4YPGB 5EPMB 2YSSB 43CAB 5JOEA 1N8ZA 2NR6C 4PGJA 4C83A 1MLCA 2UWEF 3QUYB 5MENA 2IPKA 1U92B 3RY5A 4HKBA 1EZVX 4UNUA 3TBSA 3T8XB 2JIXD 4AEHH 1Q9LA 1MCIA 1FL6A 2PW2B 4HK3J 1U8KA 3ARFA 3CVIH 3PWNA 2GY5A 4PJAB 3OJVC 3SKNB 1JPTH 4JHWH 4Z7WB 3PQYE 1I1YA 5FO9B 3BIKA 5GGSY 4FFVC 1ZLVH 3PIQB 1EO8H 5E08L 1V3LA 3M1BB 2AXJA 4G6AD 2N7BA 5I30H 3R8QA 1LE9A 1OGAA 3WFDH 2X89A 2WANA 4CN1A 5BRZA 4R9HA 4EDXA 4RGOL 4FQHB 3UBXG 1BQSA 1LP9A 2YKLH 3PDOA 3RVVC 4F3FB 3RGVA 3QNZA 3P77A 1F6AB 1MOEA 4MGXA 5L0QB 1QEWA 3MRNA 3JVGA 4TYUA 4S0SD 4U1MB 4N0FA 3FJTA 3GMMB 4XNMA 2I9LA 4X5WB 3K0WA 3M17B 5GS1A 4P46A 1T20B 1CQKA 4NHCH 4R90H 5C0RH 4WU7A 5IQ7H 3RKDC 1X5JA 4YEEA 1X7QA 3TWCH 2EYTB 4HUNB 1JYVA 3HS0A 3T2NH 4TVSa 2AEQL 4WO4C 2J12B 3QIUC 1IBGH 1NAKL 5DJ8B 5EU7C 3RIAK 3BH8A 2FEEL 2E7BA 3CFBB 2OZ4H 2GK0B 4WUKL 5EBMB 1YNKL 4X6EB 4U0RC 1AI1H 4EJ1C 3KPSB 4H1LB 1RAMA 2YPLB 5IUSA 1CGXA 5FYLE 3FFCD 2P48B 3FTGB 4YDVA 2ZCLL 4XP4L 3BZFB 5ITBH 1AFVH 1P9MC 2EE9A 5EG6C 1MHHA 1T5WB 3MOAL 4FFVD 5EDXA 3P11L 5HHOA 3V4PL 3WD5H 2GSGA 4JDVA 4DZ8A 1U8OA 3KYOA 3QPQD 5J8OA 1ZLWK 1MFCL 4WRLA 1JFQL 4KHXH 4GXUN 3G6DL 5CWSA 2FL5A 3L3DB 5CINL 1QG3A 1MFDL 3X14B 1MHCA 5ENWB 3NN8B 1N7MH 4L9LC 3QFJD 3BVNB 4E5XA 3CVHA 4G8FA 3OSKA 4L3CB 4G6JH 1HHHA 4HPYL 4F9LA 2ZJSH 4GAJH 5F97E 2GEEA 2F15A 4I8DA 1MIEH 2FNBA 1G7QA 1P4IH 4K9EH 1J8KA 4JFPA 3UPCA 5F1KC 1JGLH 1TENA 1IGYB 1FAIH 1D5ZB 2HN7B 5F7HA 3KVQA 5KN5B 3KXFA 5GGVY 3ZTNH 4UT6L 1E4WH 2HFEA 4X6BB 3ULUL 5I19H 3I6LE 4LU5L 4GAGL 1EERB 3UC0H 5AG9A 1ZEAH 3UPAA 2B0SL 3DO7A 1JTTA 1V8HA 2VZTA 3S9DB 5CD3B 5EBLA 2D4DA 3TIDA 4W6WB 1MI5E 3KNBB 2R0KL 4OLVH 5HDOA 3EJZD 3C6LC 5F7DA 4HBQA 3C2AH 2B4CC 2H2SC 2KUTA 1GGIH 1KIRB 1T2JA 2DS4A 5C3TA 5I15L 1NBZB 1PKOA 2BJMH 3CLEL 2YK1L 3QT2A 2ZCHH 3PNWB 2VXSH 1FNEB 2BMKB 4AIZB 4KU1A 1LQSR 3T3PF 3RZCA 4R7DB 3S7GA 1JWSA 5HHXH 1ROWA 4OLXH 3AS0A 2NLJA 4F33A 2FLRT 1IC4H 1CE1H 5LGHH 1OD7A 1FVEA 3U0WH 3QFDB 1QO3B 2PNDA 3LY6A 5F7FA 5C0CB 1JGEB 4XP1H 2F5AH 2UY7A 2JJSC 4MNHA 4YHOL 1I1AC 1YJDH 4LCCA 4PJDF 3MRIB 3U0WL 4TTGA 4QYOB 4ZFOB 5C71A 3IYLW 3H7BA 4WO4B 4TNWF 4JQXC 4PJBA 4XH2B 2OTPA 4WU7B 5EBGA 4OLXL 1BZ7A 2ZSVA 3MPCA 1NLBH 2DWDB 5BVJB 1SHMA 5EWIH 4PLKC 2IANA 2OZ4A 5DK3A 4DJMA 4D3CL 1YEIH 4QKXB 2QQLH 3NCEB 3TIEB 3HKFA 1CXLA 1CE6B 4MJ6B 3T2PA 5E56A 1WIPA 3DRQA 4U1HB 5F44A 5BRZB 4OGAC 3RWEB 4LLUB 1AY1L 4Y2DD 1SBBA 2AQ2A 3C2AL 4NQCE 3EHBD 3O3EA 4NM8L 3ULSA 1A14L 3WFHA 1KELH 4ZUVB 1RUAL 3PWUA 5E8EB 5F9OL 4H1LG 4JQVA 4U6YB 4LIQE 3U36B 5I1DB 5DK0B 4AYFA 1MCRA 1ZT7B 3P0VH 3VGFA 4PJGF 1DQMH 3T77A 3MGTA 2HT3D 5DMIH 5KW9L 3ZTNL 3QQ9C 2NR6D 3STZB 3VFGH 1CD9B 4Y5YB 3JZ7A 2XTJB 5I18L 2V5RA 3OJ2C 5GGRA 2VXTH 4ONHB 5F7EH 2A83A 2OSLB 4Z7UB 1MREH 1OLLA 1X7QB 4OF8A 1CDCA 5FYJE 3MRMA 2W65A 3EYFB 3L3JB 1HH9A 1NANH 2ZJSL 2VXQL 4NO0A 2IANE 4G7YL 4NKOA 5EU6E 5HYEA 2RBLA 3HNTL 1EEQA 2WBJB 1S7SB 3QDHA 4UDUA 1ZT4B 4L8SA 4NQCA 5IROC 2AXGA 2CKBA 2OR9H 1AIFA 1F11B 3U46B 4GG8A 5BV7H 3CAFA 1MJUH 3V4PH 3UJJL 4RMTA 1O7SA 5F7LB 5JXEC 2X4OA 3CFKB 4JM2F 3WIFB 1BD2A 4XPTH 5BRZD 5DJ2B 1T21B 2UWEE 4Y2DC 3U83A 1OSZA 4JJ5A 1FPTH 1YEKH 3BP7B 4RIRB 3O2DL 4WUKH 1NJ9B 4KDTC 1A1NB 3JV0A 2VNCA 2VISB 2E3VA 5ALBL 4LDLB 5AWNH 2FGWH 3BGMA 3HA0A 3QEGL 4OUUA 1GC1H 5I8KL 3ELAT 2EYSA 1KULA 1A3RL 2AJVH 2HJFB 4M1CC 5GGUB 1RHHA 2EIEA 4KZDL 1AHWB 2VB5A 3AU1B 4P4KC 1NCDH 3V0AC 2W9DL 1TLKA 4X5LA 1MAJA 3BH9B 3VDAA 2FLBT 1HXYA 2X1OA 1FJ1A 5HGAB 1QSEA 1RU9L 4GG6B 1AP2A 4HWZB 3ET9F 4JRWA 3DRQB 4GLRH 3ESVF 3GSXB 3OGCB 5DSCB 4HUKB 1AGCB 4TUJB 2NQCA 3OB8A 5D7SH 4GKSB 1EO8L 1XGPB 5B8CB 1QYGH 3CC5B 4DK6A 5DDHA 2Q20A 2ITCB 3BPCB 5ICXA 4X6DE 3GMMA 3CVIL 3KDMB 3PP4H 3OG6B 2AJUL 5KZCB 2NY1B 2A0LD 4AIXA 5SWSB 1N5AB 2IH3A 1EVUA 4L9DA 3A6BL 4L9LB 4PJFF 2WWKT 4MMXC 4P99A 1KCKA 5ID1B 4R4BB 5CMAA 4Y4HC 3LQAH 3TNNB 5B3NA 1I7ZB 1VESA 4KWUA 5T33L 2Y7QB 3L5HA 4UV4L 2YPKB 4ETQA 1R3KB 3MRQA 4NQVA 4PJ7E 4WTZG 5DQJB 4OAWB 4HMCA 3NA4A 2FZ3B 1IGYA 4FNLL 5D7JB 1I9JH 3MLSL 2QSVA 1C7TA 4PJHA 4Z0XB 1BLNB 1EJ6A 3B9KA 4JN1H 2FR4B 4K3EL 1AIFB 2H8PB 1A4JB 2CJUL 4E41A 4L8CA 1CFQA 4U6VL 4AT6B 1NCCH 4MAYB 1FYTB 1IEHA 2X9XA 3BSZL 4LARL 2OP4H 4WWKA 4NO3B 4CAGA 1QFWI 2XWBA 2GJ6B 4ZAKD 1LO5B 3JTSB 3BT2L 1YUHA 4K7PH 1FCGA 3MACL 4G6FB 3OKOA 5I6XC 4ELMF 1IT9H 1WLHA 5IKCA 1E28B 3ZLQC 3L1OL 4IS6B 5CBAA 3CSBA 4YQXH 3ZTJG 3WKNA 3CXHK 4KGLA 3LPWA 4UTAL 3NZHH 5ESQB 5JNYB 2NLJB 3VFTB 4Y5XA 1TTUA 1GZPA 4NNXA 5KVEL 1G7PA 5H37G 1CL7L 3HC4L 4XPGL 1MFBH 3DSFL 5EU4A 5E2WH 5CJBA 3I6GB 1RHFA 5CHNA 3UPRB 5CIPB 5GS2H 5ABDE 5KG9A 4PGEB 3ZO0A 1LEGB 2YA0A 4KUZL 4LPWA 1Y0LA 3H7BB 3MTRA 2V2WB 2VUYA 5TGBA 3BH9A 3DVNA 3IDGB 4LF3A 2R4RH 3DO7B 4BZ2H 4KV5F 5C8JA 5HGAA 1DCLA 1RUML 2FJFA 4X6CE 4DCQA 4U7MA 4L4TD 1OAUH 5F8RC 3KWWB 3RX5A 3DJ9A 4IOSD 3MFFB 1WZLA 1BOGB 4XCCH 1NJ9A 2K7QA 4Q9QL 3KPLA 2UZXB 4LPVA 2VISA 3G5VA 4NRXA 5DVNA 4R97C 1MFEH 5J4MA 1F6LL 5IFJB 2MJWA 3EYVA 4H0HB 1QA9B 3IDYB 4L29B 3VW3L 3D0LA 4PGDB 3VRLE 3WJLC 1SMOA 4U6YA 3VJ6A 4QNPE 3BEWB 1DLFL 3EYUH 1O7VA 4Z5RB 1ZWIB 5IF0A 1WEJL 4IRJB 3RTQC 4W4OA 4TUKH 4P23D 5D93C 2FJHA 2EXWC 5F9WB 4R6UA 1NCWH 4JFEA 3QXAA 4LLWA 5HJ3B 2DF3A 2VLJB 2PXYA 5KVEH 3DXAA 4XH2A 1F4AA 1G0XA 1C08A 3SKMA 2K1MA 4M61A 1YA5A 1SVCP 4ZUWA 3SE9L 3LN5B 2XA8L 5KANG 4HWZA 1HE7A 4LHJB 4NZTH 1QHOA 1IT9L 5I8EB 4S2SA 3G5ZA 2ZCKH 3RY4A 1IQWH 2FZ3A 1RIVL 2ATKA 4OZFG 5KVFL 2NY3B 2R2EB 4XVTH 4V2CB 3E6FB 4DKEH 4JB9H 4K7PL 4QRQA 3B9KB 3TA3D 3WXVL 3CC5A 3QUML 5HVFB 3O2DA 4EZMA 5CZXD 4BUGA 5I1DA 2ENSA 4JO4L 3GB7A 1SBSH 2VN7A 1HH6A 2PTVA 1WBXA 1CICD 5L7XH 4K9EC 3GSUB 1I1CA 4NGHH 2ZG2A 2D0GA 1GC1C 2YEZB 2ZUSA 4MCYA 2BRRH 3HI1A 1X5XA 2NNAB 3QUKB 4MNGE 3Q48A 4HUVA 5H37H 3MNVA 4UTBL 5IV2A 3FO0H 3QCUL 4MAUH 4ONHA 2YR3A 3OKDB 4GRMB 1I7ZA 4PJ7F 5CSGA 3C5SB 4X6FA 2BVPA 4L1DA 4K8RL 4C54A 3X12A 3OZ9L 4NRYB 3PV7A 3UJIH 2P43B 3O3DA 2Y07L 1JHTA 4JREC 1FRGL 1WF5A 4HX1A 3H9HB 4EDWL 2XNAA 3A6BH 1X4XA 5CHNB 3UPRA 3S4SG 4CMHC 1H8SA 3QDJD 5IQ9B 2P7TA 3U46A 1AR1C 2HT4D 3IDMA 3UTOA 2NX5E 1FBIH 2GJ6A 1QRNE 5I1JL 1E4XI 1Q0YL 4MA7H 5F3BB 5C7XH 5DVKA 2R1YB 1RIUH 4NIKB 3ILQC 1MRCL 3RVUC 1G0DA 4PRPE 4XNQB 4K3JH 5IMMB 5EULV 4TOYH 1QLRB 2QSCL 4TPRH 3CGTA 4XBEH 3DIFA 5I71B 4CU8A 2FRGP 2X4QA 1UFUA 1FV1A 2DD8H 3HMXL 3MJ9L 2ERJC 3WSQL 1CFNB 1ZSDA 3AFLA 4F7TB 2EDFA 1UEYA 3TH3T 1XF5A 4K94L 4JFYA 5GGUA 3OF6D 4FTVB 4W81A 3MRBB 2L7UA 2H41A 1OTTD 4ZS6D 3NZ8A 2PYEA 4FHBD 4L9LA 4Y4KA 2Z8WC 5T3XL 1JK8A 2Q8AH 3HI5H 4KI5C 5HI5C 1GC1L 5I8KH 4OZGA 4G43B 1YEEL 2Q8BL 3AY4C 2DJ4A 1A8JH 2W9EL 3GSXA 1W72H 4Y4HD 5MI0C 5D5MF 5KTEL 1MLBA 4HT1H 2ATKB 3NVQA 3BDYL 1AGCA 2O5YL 3O2DH 7FABL 4UB0L 2UUDK 4Q2ZA 5T1DH 1U6AH 3PWPB 4JPIA 5ICYA 2K9UA 4G8GD 1KB5A 3SGKA 4XCFL 4U4BA 1MCKA 1T4KA 4P4KB 1DUYB 4WWKB 5BV7L 5C0DA 1AO7E 2B1AH 3OR6A 1JWUA 1UA6L 2NNAA 3C60D 1NKOA 2NY1D 4WFFD 1XGUB 5HDBE 1JZ4A 2DRUA 1DQDL 3PJSA 3OKDA 2BVQA 2Y9RT 3OKLA 3TYFB 4DGIL 2DQFA 4DWHA 5T3XE 3I84A 4Y7MA 2VXQH 2XN9D 3P73A 1EEYA 1XFPA 5DO2C 3QZWB 4DN3L 5DJ8A 2P5WA 4J3SA 2BOBB 3IS0X 4OLYH 4NQVB 4XNZB 4KQ4L 5DQJA 5EPMA 43CAA 3L3HB 3W9DB 3VFTA 4XMPL 5IHUH 1GOFA 4C83B 3O9WD 2E5EA 1ADQL 4GKZB 1VFOA 5DEGB 5EO9A 4S1SH 5MP6H 3MJ8A 1YPZF 3FRUA 3KPSD 2X1XR 3MXWH 3ULVF 4H26A 4ZQKB 1BEYL 1XH3A 2ICCA 3E1F1 1S7WA 5CJ8A 4P3CH 1OAKL 1QFUH 4MJID 3QI9B 4ONGH 4QGTA 4OCSL 3AREA 1TJGH 1FNSH 1KCRH 3C6SB 3PHQB 1QSZA 1RUAH 3JTSA 3PGFH 2Y36L 1UWEL 1KELL 4MJ2A 5D96C 3C8KA 4E0RA 3TCXA 4NM8H 3ETBF 4YX2H 1HHHB 1RUQL 2VDKH 4KDVA 3HG1B 1H8OA 4ZFZB 3DRTB 3MSPA 2QQLL 5BZWB 2ED9A 4QWWC 3WHXA 3FHQA 5JW4Q 4PJ9A 1EIBA 1DUZA 5BO1L 4Y88A 2J7LA 4KQ3L 5T3ZD 4L8BA 2C4FU 2P42B 3IFPB 1A7QH 3H9HA 4K3HA 1AQDA 1D5BA 3BQUA 4BSJA 4X98B 5HD8D 2Y72A 4U1JB 2Q3ZA 4XHQA 2F9BT 4XWGL 1WK0A 2HFEB 3EJYC 2FHCA 3QHZH 2OR8A 4PR5A 4C56A 1W0WA 2X7LB 3Q6FA 3T4YB 4G80B 2MPAL 1FE8L 4Y8DC 4JDZB 4EQ2A 1AE6L 1AHWC 3PDGA 2AABL 2UVFA 3HS0B 5AEAA 4W6YB 5BO1H 1KENL 1M7IB 2ZNXA 3VDBA 3ZDYE 3B6SB 1DBMH 3F7YA 5K59E 1FC2D 2EIZA 4M6MH 2H6PB 3OXRA 1OF2B 2GI7A 5AD0B 2EDEA 2ZNWA 4U2YA 4HIIA 2ADGA 3WFBL 1P4LB 2F5BH 4V1DE 3SBWC 4M9PA 1CBVL 1K6QL 3X11A 5ID0B 3G5YA 1DBKH 2ATPB 4JO2H 3N50A 4ONGL 2NY4C 4JVPA 2BP3A 4JKPL 4OB5L 3BI9X 3N9GH 3Q6GH 1ZWIA 5I19L 2E7HA 1YYML 4S10A 1DFBL 3DUSB 4ZXBB 5DD5H 3T0EE 5CWSB 4FTVA 2D0HA 3MXWL 5DD0H 3MROA 3MRIA 4A6YB 5HGGS 2FEDD 3MQIA 2DQHL 4DW2H 4D0DA 2VLJA 2A6KB 3ULVC 4OLUL 2ICWI 3WS3B 5CKAA 1UXSB 1ACZA 4U1LB 2ED8A 5E6ID 2QJDA 5F6HI 4C56E 4JY6A 5KBNC 1UKSA 1V7MH 1HHJA 2XWJA 5L9DH 1HILA 2Q7YB 4Z76B 2F8VA 2VDLH 3P30L 5HI5D 2H26B 4YXKH 2JJTA 3EO9H 4FG6C 4LP5A 5CSZB 3O8XB 3CSGA 5IJVB 2JIXA 2KPNA 5E8OA 5IB3B 4LLVA 1DZBA 4A6YL 3EJZC 4OZHA 4APQD 5DFVD 2J3SA 2B1AL 1B0RB 4P2CG 1NMCC 3Q1SL 1V3KA 3GB7B 1CICA 4I2XB 5K9KA 3FFCB 4OCWL 1WBXB 1QRND 3U4EB 1T7ZA 3WD5L 3P11H 4K7FB 5I9QB 3RTQA 5C0DB 4RMRA 1U8JB 4XB7A 4MWFB 1A6ZA 4UB0H 4PJXA 5A16B 1WT5C 3P4OB 1EEZB 1VHPA 1HEZB 5KSVA 4ZOCA 2DQGH 5DA4A 4KY1H 4ODVL 1P7QA 3VRJA 2VLJE 1KLFA 1CD1B 1PAMA 5E8DH 2Q8BH 4CADA 1ZTXL 2HKHL 3GJFB 3BKCL 3T09A 2J88L 5SX5K 4RDQG 2R1WA 2XTJE 4YAQB 5HGDA 3KYKH 1KIPB 5EORH 3MV8E 3GO1L 5I8CA 1J8HA 1PKQB 3WV0A 4XCNB 3EOBB 4JZOB 2MQ3A 1WZKA 1CFBA 1CZ8L 4X9IA 4LSUL 3BRDA 2LU7A 1TMCB 5DUPH 1UWXH 3WSQH 2AV7B 1GHFL 5EBLB 5T1MA 3ARFD 2HFFA 4UNTA 5L2JB 3MCLH 5I1LA 1I7TA 1T1XB 1WWBX 5D8JH 5DMJB 4MD4B 4WW2B 4ZUSB 5BS0D 3WL9A 2EIBA 1CFVL 4RGOH 2D9CA 1JE6A 2DBJA 3SO5A 4K3JL 1OW0A 1U3HA 4WGVB 3WFDL 4L4TA 4F57L 3ORJA 3MRLA 3PWPA 2Y23A 3LKNB 4PRHD 2DTSA 1LEKA 3BQUC 2EDBA 1QFOA 5EN2B 1Q9KB 5C0AB 1MCPH 4HD9A 5FOBA 1HYRC 3QDJB 4QTHA 1CDYA 4HXAH 3V5HA 4R4NC 3SCMB 2H2PD 1NBVL 3FMGH 3GHBH 3GSNA 2D3VA 4KRPD 3AU1A 1BVLB 2AQ3A 2CR6A 2MHAA 4U1LA 1BZ7B 1QP1A 4K71B 2VLME 2BY3A 1QSEB 2E27H 2YC1B 3LZFH 3V5KB 1ORSB 4XP5H 1AP2B 1XF4A 1KSRA 1OT1A 1D5IL 5FOJA 2ZOLA 2CR3A 1QFWM 3F8UB 2YPVL 1Q1JH 4YWGL 4HXAL 3RWFA 4TUJA 4MAUL 5GGVH 5DJDA 4H0GA 4Y0GA 4YZFE 3SGJC 4GAYB 3ULUE 4NSKB 1V3JA 2BRRL 3G5YB 5KOVC 5SV4A 3KYNB 3ZKXB 4L4VA 1JGDB 1SYSA 4N5ED 2IFFH 4YXLH 5ITFA 4PBWD 4FFZH 1OTSD 3AREB 5KS9A 1XGRB 1REIA 4GQPH 1LMKA 4POZD 3ZHDA 2Z92A 4LCIL 4Y5YA 1B90A 1P2CB 4IOIA 5D8JL 1EEZA 3E2HB 2CQVA 3MRJA 5KVFH 2HAZA 5IB2B 1RIVH 4PB9L 5FM8A 4FQCH 5MI0B 4NQED 4PJCB 3QUZC 3L95B 1OCWH 5B3JF 2XA8H 3EFFA 3N1FC 4RAUA 3GO1H 4PRIB 3RGHA 5SWZB 3TVMD 4YAQA 1ORQB 4G9DA 5L8KB 1MCDA 4PP2A 5KSBB 3VXQB 1F4XH 1K8IB 4NQCB 2JK5A 2H3NB 1N6VA 2CKBB 4BQ8A 4G8IB 3SGEI 3MBXH 4G9FE 5L6YL 2Y6SC 3VGEA 3Q6FB 4R3SB 3O81A 1EH9A 3HC0B 1BD2B 5FA3A 3QBTB 3H9SD 4FQXB 5DJ2A 1A7OL 5GIRB 4WFGD 5EC1A 5IW3A 3C8KB 4PUBH 1MFEL 1ITBB 2APFA 2NZ9C 4YBQC 3VGAB 4NRZA 1U3HB 3U7WH 4FQLL 3F62A 1TXKA 1U8PA 2Q6WA 2DMBA 1OAUL 5FIEA 1P7KB 2BNRD 2IG2H 2HFGL 3WHXB 1RMFL 4H25B 4PJDE 3L3IB 4WEUD 2NY5L 1H0DB 4XXCC 2QADB 3LN4B 4Y19D 3CH8A 3E8UL 4A6YH 2NXYC 1J0ZA 3WXWH 2NY5C 2LABA 1YMHA 5JXEA 4Z0BL 3T08A 1LO2L 4UT9L 4YXKL 3KHQA 1QLFA 1F4XL 5SWSA 1PKQA 1BZ9B 4KGJA 4Y4FB 5TGBB 4ZYKB 3WEXA 4JFQA 3ZYOA 4G80A 3U7YH 2A6DA 3OJDA 1FJ1B 2NTFB 1ODAA 1YPZA 2F54D 5FKAB 4LDOB 3IDNB 4P5MA 1S7VB 3FQWA 4MDJB 4WW2A 1I3RB 3R06A 4XHJC 2PO6D 3OGCA 5EO1A 4PJCF 3RWFB 3P0YL 1MEXH 2EICA 4CVXA 1CD0A 1Z6JT 4POUB 1YYMH 3MACH 4YE4H 4LLVB 1CF8H 1IC1A 4IRJC 3W81A 4L4VD 2DMKA 2CGRL 3C6LA 1QKZH 4TNVK 1JGDA 2C4FT 5TDOB 5SV3A 3I3DA 4FTVD 2Z31D 3H0TB 2BNUB 5HPOA 5CS7A 1NCCL 1TPXC 1AH1A 1YUHB 2A9MH 2C1PB 1A9EB 1IAOB 1QVOB 5TQ0H 5HI3C 4QRUA 5IWLA 3MLSH 1G9MH 5HBBA 1MWAA 4NQDA 5HVWA 3PHOA 1VKXA 5KSVB 3B9DA 4FNLH 3CXDL 2EE2A 4BQCA 3MODH 1F58H 2A1WH 1IE5A 1QSFB 1DVFA 1PQZB 5HHME 4FABH 4M7KH 4B53A 4UV4H 4RAUB 1W2KT 4XXCA 5GPRA 4N0UA 4RAVB 2GSIB 2VQ1B 4P2OD 3BKYH 3PL6A 3E6FA 5FB8B 3GIVA 1F2QA 5E8PB 1UJTA 2X4RB 2UY6A 3EDEA 1NFKA 1Y0LB 1PZUB 4Q6IA 3BQUD 2V2WA 2ESVB 1R0AH 4JZOA 3QUXB 1KB9J 3O6KH 4ZUTA 5FA3B 5DVOA 5FKPA 3Q0HA 2R2BA 1ZGLP 5KSAB 1UB6B 5I74C 1SEQL 4ZPVA 3VMOA 5KANI 4JFFA 1S9XB 1JYNA 3ARXA 1UWEH 3IFNL 5A2JH 4E9LA 4CVZA 1QQDA 3JWDC 5CGYC 3IVKB 3KPPA 5I16A 3CMOH 1KF9B 5GGTA 1MAML 2IAND 1OP3K 4ZO8A 1Y18A 3IFOA 1P6AB 1T7XA 5DUPL 3ZE0E 2ICES 4HIHA 1IGTA 5FYJD 4Q7DA 3TJEH 2GTZB 4KZDH 4BA8A 4FZ8H 3KLAA 2MSPA 2ICEB 1BVLA 1YNLH 2VR5A 5HJ3A 2YWZA 2DQDL 4Z78A 4OKDA 4MNQD 4FMFA 3KPNB 1QTYT 4X7SL 2LFGA 2MQ0A 3DOSA 5DVMA 5HHNB 4CRPA 2J88H 1MI5D 1CDJA 3EDJA 2NMSA 5E8DL 1NSNH 4BSVA 3T0DA 4KY1L 4ODVH 1HI6B 5GS0H 4N8PA 4JFFE 2QSTA 3VD9A 1WQVT 2IADB 3IU3B 1A22B 3IDJA 4JKKA 2W60A 4IJ3C 1R3HA 3HE7C 5HGBA 3KPMB 3VXOA 4XNMB 3C2SA 3NCJL 7FABH 1TZHB 1X5IA 1MWAH 4HT1L 3HI1B 3DV6A 3BYYA 3FL7A 3RWGB 4YC2B 5FUCE 4P48A 3PHOB 1VKXB 2X4UA 1YEDB 2J5LB 3D69A 3HAEG 1CQYA 3EO9L 5EUOF 4R0LB 3DECA 5FKAA 3VH8G 4G43A 5DQ9B 3HI5L 4FN0A 1JNHB 4JM2C 1FNAA 3RGVC 2IAMA 2ZUUA 4XMKH 3GSOA 3M8OH 3SHSA 4S2SB 3B3IB 3EZ8A 2JJVA 4HGWA 3JTTB 2H32A 2D9QB 1MREL 4CVXB 1CN4A 4K94H 5DC4B 2VXTL 5DHYB 2XNAB 3X14A 4OLUH 4LMQE 3ECBB 3C08H 4ZS7H 1AR2A 2VLRE 3LDBC 5DEFA 3RL2A 2ZUVA 2LU4A 4HK0B 5DD5L 4JZJB 4MXVF 1BQHA 4RMSA 1U8OB 4HG4J 5C09A 5L88H 5T5FH 3IDXH 3GSNL 5DRNB 4XBEL 2AI0H 5JDSA 2QSCH 3UP1A 1UB6A 4IOIB 3D25A 5TDPB 4Y4FC 4NN6B 5IV2B 4N0RA 3WFBH 5GHWL 4MHHG 5IMMA 3EOAB 3G04A 5C7XL 1ZHBA 1QLRA 4MA7L 4ORGB 3MYZA 1SJHA 1DVFB 2W07A 3O6KL 4IDJH 1GL4B 4LGPB 4C56D 4M5YL 3GMPA 4HS8H 5B21A 3TN0D 3FB5A 4KZEH 3TJHD 3BD3A 1RY7B 4I0PD 5E00B 2GITB 2BDNL 3MX0A 1Q9WB 4F7TA 3GMQA 1N6UA 1F8TL 5DEGA 4HKZB 3WO4C 5FB8A 4NBXB 3NA9H 4HH9A 2VWEE 3BKYL 3T0ED 1YJDL 4KK5C 4OFKA 3AXLA 4LRNL 5IQ9A 4X9HA 4XP1L 2ORBH 2DIJA 4GRLC 1J88A 2WBJD 2YS4A 3VH8B 3LRSA 1CDGA 4PY7A 3MCKB 3HAEB 1BBDL 1CCZA 5DC0A 3SDYH 5GS2D 5JR1H 2BXZA 1WISA 3QI9D 1F58L 1N59B 1XAUA 3FO0L 3H9YA 3QCUH 3HC3H 3X17A 1XCQB 1KEGL 1QR1A 4I13B 4AG4H 4LLMB 2YK1H 5CEYB 4KHTL 4Z7WE 2BJML 1OGAD 4GUPB 5I15H 2BMKA 4JGJA 4CN6A 1T1YB 4R7DA 3B9KC 2P5EB 3MRCB 3V0WL 3KPMA 4R2GC 1I1AB 1QKZL 3CFEA 1T22A 2CGRH 3QUMH 4IIQC 4OV5A 1ZEAL 5DHVH 1AGFB 1CF8L 1FVEB 3ULUH 1N0LA 3MNWB 2JB5H 1OAZH 4UMGA 4QLRA 4UT6H 1JWUB 3CDGB 4ONOA 2IF7A 5MEND 5DRXA 4NDMB 4NZTL 3U4AA 3SE9H 4JG0L 4JFQB 1H9VA 5DGQA 1EBAA 3BXNB 4GFTB 1QSFA 3VGAC 4X99A 2ESVE 4HAGA 3U7YL 5EU3A 4OLYL 3QZWA 4I4WB 2VLKA 4ACPA 1S7QA 3ESUF 4LCWD 3JTTA 4DN4H 3F58H 4XP6L 4U1KB 1LO2H 4UT9H 1N5YL 4Z0BH 1DBJH 2BNRB 3O3EB 1B9ZA 3PL6B 1WEJH 1N7ML 4YFLF 3WXWL 1Z5LB 3SJVD 1G6RA 2B1HL 1MFDH 4YDKH 2VZVA 2EDJA 1KNOA 1DTUA 3VW3H 1MFCH 3MRMB 1T4KB 3TCLA 4XAWH 3WFCH 3TO4D 3H0TA 1KUMA 1HH9B 1IM9A 3VFRA 3C6SA 5FUOH 3DV6B 2D7PA 3I75A 5J13B 1T0PB 5DJXB 4PJEA 4JFFB 3QEHA 4RA0C 1S7SA 3HR6A 4PJ8A 4ELME 3FQNB 1RUMH 3BISA 1RJYB 2OZ4L 1ED3B 4PJFA 4ZFZA 2YXFA 1W72L 2W9EH 4RISH 2W65B 3EYFA 3ARUA 2XN9E 1IBGL 1NAKH 2N4IA 1P5UA 5L6YH 6FABL 5CJXC 5GSRB 3CU1A 4NC1C 4TTDC 5L0QC 5DD6A 1LNUB 5E6YA 4CVWA 1Z9SA 5T3ZH 5IQ7L 1ES0B 4UQ3A 3V7AE 1G7IA 4XVSL 5F9AC 4JPWH 5IB3A 2OI9C 2V7NB 4YR6B 1MFBL 4QXTB 2XT1B 3SCMD 2FATL 1BECA 1OQOA 2AJZB 5HYSA 5EIIA 3CD4A 1QZ1A 4KUCD 3HRPA 4P2OA 4H26B 3NZHL 5E9DE 4UTAH 1A1NA 5T1KD 2GUOA 4NO5B 4JLRA 3O9WC 3AC0A 3L1OH 4C59B 1JTPA 4HFWB 4P3WA 3TGXA 5CGMA 5AZ2L 3WIFA 4U3HA 1N59A 4XZUB 4KKAC 4NKDB 4CW1A 1G9NH 3O6LH 4GBXB 3TP4A 4FQ1H 2M2DA 2YKLL 3RDTC 2CO7B 4JFDA 4YHNA 5TFSL 4GUPA 3HMWL 2I07B 2D7MA 1KC5H 3GMNB 3KPPB 4JHAH 4N1HB 4FQXD 2AW2A 4LARH 1MRCH 5F71A 5CEZL 3IU3A 1HKFA 4U6VH 1UGNA 1ZLUK 2CLRA 5B4MD 2FH8A 2R1WB 1F2XK 3U82B 5BOZG 5GGVL 1I9JL 1KB9K 4XNXL 2I9TB 1TZHA 1RJZA 1UCTA 3O4OB 4YWGH 1XGQB 2W0LA 1Q1JL 3SKOB 4QEGA 1D5IH 1G7LA 4FG6D 3F6IA 4WIQA 3U7AA 1F97A 3T4YA 4EDWH 4XP5L 3G6JE 1JF5A 4LGSB 3BXNA 1JNNH 4W68A 1AD0A 4PJAF 3ZL4H 5DMYA 3QNXA 2Y6SD 4G42A 4RGNE 4WTXA 2IPTL 3BKML 1MUJA 4QRTA 4EKXA 3KLHC 3RX7A 2IEPA 3ZE1E 4BSVB 2AJUH 3BZ4A 2ZP0T 1CLYL 4I18A 4JHZA 1A6AB 1UH2A 1RK1B 4NKMA 2E8YA 1MCPL 2NX5D 4OF5A 2E7LC 5I9QC 3QQ3A 1K4CB 4WI7A 4BZ1L 4GBXD 1BFVH 1A21A 4F57H 1SBSL 3WO3B 3JBG7 1F4HA 1R3KA 3MRQB 4JO4H 2CDEA 3I02A 3CDGA 1LE5B 4JAMA 3OXSB 2VSCA 1C7SA 2VZOA 4JB9L 2UUDH 3EUUA 4LPTA 4DKEL 4UDTA 4KRPB 4PJ8B 1FNGB 2YD9A 1ZHKB 2IJ0C 4DUXA 3DETC 3O6LL 5J3HD 3KLSA 4OF3A 3H9SA 4ZPTB 3VRJB 1V05A 4X99B 1IAKB 2WINB 5BS0B 3OMZA 5EUOE 3FQTB 3VCLB 3DARA 3W5NA 3RVWD 4RRPA 4P23C 3DTXA 3MRKA 4OFIA 4FQIL 4UIKL 5HYSB 1A3RH 1NCWL 2VDMH 2X70B 4MXWH 4OZHB 4PJIA 2CLZA 5DC9B 1JN6A 3MYJA 3EKCA 3BPLC 3BDXA 3SDXF 3MLPA 1KG0A 3BKCH 3MMEB 2HKHH 1ZTXH 1CI5A 2C3WA 1ND0B 4YHYB 3RUGF 1FLTX 4UIMA 2DQGL 1U8JA 2EYRB 5FGCE 3VXMB 5I1LB 1KCLA 4BKLB 4ZDHA 1XCQA 3WL9B 1XF3B 3QUYA 5IB2A 5EU4B 4PLKD 1FFQA 2QR0A 4Q9QH 4XCCL 5DS8A 1NUGA 4FQ2H 3TFKC 4NQEE 4UNVA 5CBAB 4ETYA 1T1YA 4M9OA 4UILL 4CJ1A 4POZC 1ETZA 3UBXI 4R2GB 4LF3B 1L0YA 1CU4H 2BNQE 1TNNA 2VDNL 1PZ5B 3RVTC 2I9TA 3I6GA 3HNTH 1XGQA 2OLDA 5EC2A 4JQXA 2B7DT 3GSNB 3AVEA 1HWHB 1RIHH 1F02I 4GQ9L 5L9DL 3QIWA 3HLAA 3QXUA 5E2WL 3X3GL 4LSDA 4MZ2A 4OIAA 2YD2A 3VMNA 1TTGA 3O41B 4OIIH 3ARPA 4MA8H 5FYKD 1QEWB 3QP3A 4P49A 1ORSA 5FO7A 1OAQH 4JZNB 5F89A 4D9RE 4I0CC 2NXZD 5I1KH 3HZMB 4HZLA 1YYLH 2PTTB 3S36L 3CSPA 4NRXB 3E6HB 3O8XC 4JKWA 2NY1C 1DFBH 1OAZL 3EYVB 4LAJH 3L3IA 2FWOA 5CP7A 4PS4L 4JO2L 1FL3B 2FX9H 4K71C 2NW3A 3V0WH 2ZG1A 4WUUB 5D7LB 5I1HL 4NO2B 5F8QC 3D3VD 4OV5B 3DUUB 1AGFA 2F5BL 1A14H 4HIEA 1J9CT 3DSNA 3SKOA 4U1NA 3WN5A 2FIKB 4KHTH 1XR8B 1FQ9C 4D3CH 4N8CH 1I1FA 4HWBL 3TFKD 1DJSA 3DXAB 3HC3L 5C6WH 2DBLL 2MCG1 2YUVA 5J6GA 3NH7H 5C0EB 1AC0A 3U9UA 2VOTA 4A2LA 2MPAH 4JFHD 4XRCA 4NCDA 2EKSB 3BW9A 1DQLH 3VCLA 2DTMH 4Q6YA 4XWOC 1KN2L 3T65B 4YHOH 3I6LD 1HOCB 2B4CL 4LBEB 4PRIA 3DROA 5D2LE 4NNPL 5CJXA 5D5MA 2DI8A 3I50L 5LGHL 5EZLA 3STBA 4QGYA 5DMKA 2V7HA 1RZKH 2WLYA 4L4VB 5HHXL 4O5LH 3C5SA 4DK3A 2R0LL 2WM0A 1DBAH 4YDLB 2VXSL 4HS8L 5IVXE 4AM0A 4LFHD 5E4IA 1U8HB 1HHIB 4QTIH 2EYRA 1XT5A 2EKJA 1RUQH 1WBZB 3T3MF 3QUKA 1ONQA 3ULVD 3FAXA 5D7SL 4YHLL 4P2QA 1QOKA 2GFBA 2ED7A 4OLVL 2N1KA 3DI3B 1LHZA 2Y36H 2HA1A 3BDBA 2IQAB 1MJ8L 4ZPTA 1KCRL 3OTTA 4OCSH 3K74B 4K8RC 1IL1A 3FO2A 1HKLL 3GSNH 5T5FL 1QFUL 4LU5H 1L6XA 4KPHL 1VGKB 4DTGL 1MJJB 4X4ZA 1EAPB 1NAMH 4DUWA 1E4WL 2FSEB 1BEYH 3KAAA 4UOJA 1F4WH 5C07B 5KJRH 3CMGA 4ZS7L 1JPFA 2W9DH 5M94B 3QDGE 4XVUD 1G1CA 5DTFB 2VQTA 1EGJL 3JSSA 5I8OL 2A6JB 4XNZC 3O2VL 2G2RA 3DO3A 1I8IA 5BV7C 1DLHB 1NFDE 4H8WL 4KQ4H 1P4IL 3TO4B 1A6WL 1T1WA 1LP9B 4R96B 3QNZB 2VN4A 3VFSB 3QUXD 4PLJD 4DGIH 1YY9C 3MRPB 3DGGA 1FVDB 2YN5A 3MRRA 5J12B 4N0FB 1X9QA 1QRKA 5ALBH 3TN0B 1BD2D 2NCMA 4M1GH 1TFHA 4K55A 2EDNA 1XF2B 4MNGB 5GS0D 5D2NC 4KHXL 1MWAL 1U8PB 4AH2B 2DQJL 2X6MA 4JFZH 3BPNC 5F1OB 4HIJA 1FPTL 1RK1A 1Y18B 3IFOB 4LCWA 3ZHKA 3C6LB 1JK8B 3MOAH 4PJEF 2DWEA 1A4KB 2ZCLH 4WUUA 4XP4H 5D7LA 5TE6L 4J3TA 5E03A 4RFNB 1FHGA 1U6AL 5DZLA 3UJJH 5HTSA 1MJUL 3BX7C 1AI1L 3TO2A 1ULVA 1XEDA 4MJ6A 5KTEH 4HLJA 2BSTB 1NSNL 5DJ6A 4M1GL 3NZ8B 3IFLL 1UB5B 5KS9F 4LVNB 4X4XA 4ZUVA 5IB4A 1MY7A 5HHVH 5EZIL 1B4RA 3VFVA 5FO7B 3DBXA 4RRPG 2Q8AL 3RPIA 3Q2CA 4OD1L 4RFEB 2GSGB 2DQDH 3K2MC 4HV8A 4JDVB 4LHUA 4KROB 4HC1H 2R8SL 3V52H 1FNHA 4H8WH 1U95A 3LMJH 1FLRH 2L0DA 1ZVSA 2XKSA 5I8OH 4IIQA 1YMMD 3ARSA 4HQQH 3EJYD 4JPVH 2DMCA 4CL7A 3FAWA 5I18H 1LP9E 3OV6A 2Z31C 1KB5B 1AGBA 5CEXB 4S1QL 5CUSL 5CJQH 5JQHC 1NAML 1E4KA 1DQML 4M6AA 1T6VN 1HKLH 1HYSD 1NUFA 4TOYL 1MJ8H 3W39A 5F9OH 4GO6B 5GS0C 3RA7H 3U6RB 4B41A 2WBJA 3E3QC 4UDTB 5T3ZE 3RWHB 1RIUL 4WGWB 3CUPB 1YY8B 4R0LA 1Q0YH 32C2B 1JPTL 2BSSA 1YEIL 5ESVA 4KKBD 1ETZB 3KGRA 4O5LL 4AEHL 3CFKA 4N90E 1RZKL 3NCBB 1BIIB 3I50H 5H94B 1FRGH 2A6JA 5F7DB 1EJOH 3SJVE 1KGCD 2Y07H 4KDTA 5ESAB 3UJIL 1VEOA 3WLWC 1FZMB 2ZUYA 3IRZA 3C8DA 2DTML 4M7KL 3QDMA 1DQLL 1FNEA 4P2YA 5HHOE 5JIIA 3ARGC 3IGAB 3B5TA 4GRLA 2CXKA 1BX2A 3GBLA 4ZTOL 3MLZL 3NH7L 2A1WL 3MODL 4OJFH 3GKWL 1MFNA 4P2QB 3GI9L 3HZMA 3EOAA 4N8CL 5TQ0L 1BVKB 1GJIA 5JUEL 3VI4E 5C0IB 3W5MA 1X44A 1EEUA 1JJUA 1FL5A 4NZRL 4DFHA 4C56B 4GW4B 5H35B 5JA9A 4WFHE 3RRQA 3SDAC 5K9OB 3VXSE 2BSRA 4NQXA 4F8QA 2WUBH 4QHNA 3OR7A 5DUBA 2D7OA 3TBTA 1W8NA 3S88H 3GMRA 1GYAA 5D2LB 3F7YB 2GTZA 2NZ9D 2G2RB 2Z8RA 2ZCKL 1WFUA 5JHLH 3KHOA 3KXFE 3PWJA 5B39B 4UAOC 4NOBA 3SJVA 3SKJH 3WUWA 5EU6A 3U9UB 1OW0C 1U3HC 3UTZA 2OYPA 4F15C 5IP4A 5FCUH 4IRZL 3VA2C 3VFNA 2O5XH 5BQ7B 4HPYH 1U95B 1EHLL 3VGHA 3P9LB 5FGCB 4IIQB 2ADGB 3DYMA 1M05A 2Z4QB 3GK8H 5L2KD 5KVGH 2DLTA 2VDNH 2DICA 3OQ3B 1KPVB 5A2FA 3PDDA 2OSLA 2C26A 2Y7QA 4JY6B 5KVDH 1RD6A 2X1WL 1CGUA 3DUUA 2HFGH 2IG2L 4AM0B 1K9TA 2DLHA 5E2UL 1HHJB 3HMXA 3MJ9A 4FQ2L 5LBSH 1AFVL 4M1DH 3O6FA 2C4XA 5DJ6B 3ZDXF 1C16B 4PUBL 1J10A 3JWNC 2R2HB 4K8RD 4JVUA 3ZT7A 1A7OH 4ORGA 4Z0XA 4JDTL 3CZFA 4HG4K 1SJHB 3KPRD 2HT2C 4G8GA 2R4RL 1T89A 2J8OA 4TVPL 3RVUD 4F37K 4N5UA 4OQTL 3ARRA 5B3JE 2HJLA 2EKSA 3BW9B 1V7NH 2Q7YA 4Z76A 1F42A 3T2NL 5ADPH 3NABL 4LVEA 4NO3A 2MCPL 1NLDH 4Z7UE 5FXCH 4ONFL 3HNSL 1ZVSB 5I76B 4ODSL 3QIWD 2GT9A 4NHCL 5EZLB 3UDWA 2VLRD 1W8OA 2V7HB 2R39A 2E6QA 1EHXA 5HYJD 4IMLA 2KH2B 3HE6D 5D7JC 4YQXL 5KVMC 5C2UB 1ZS8A 5E7BA 3AS2A 3MNZA 3CDYA 1N8ZB 1NC2B 3HR5B 4KKNA 4U7SA 1A6ZB 1MLCB 4RGNC 5ISZA 2EXWD 1U3YA 2ARWA 4J3XA 3TN0A 4E42A 1M6OB 1P5VA 4Z77A 1D5XA 4KI5F 4FFZL 3FQRB 1FCCA 3V5DB 3IETB 1BQHG 4X6DA 1KTRL 4Y4KC 4OLWH 3IJSB 4LCWB 4HKXA 1EAPA 4X9GA 1P84K 4ZXBC 2B8OT 4K3EH 5C0NC 1C5DB 3U0TB 3KLDA 4OZFB 4FRWA 1PG7X 3VFUB 4QHMA 4FXGB 4P57A 4D2NA 3FO9A 5HGDB 1ZA3A 3NPSC 3TO2B 4ZMAT 1I85C 3FT3B 3O6FC 3KPLB 2BSTA 2OQJA 1FH5L 2X4TB 3FT2B 5EBWA 3HAEA 5EA0L 4PJ7A 5EUOB 3DMMD 3LZFL 2E27L 2P47B 1VGEL 2W9LA 3NGBB 1FGNL 2DJSA 1IAIM 3QIUD 5D1QD 3RPIB 4Z7NE 5HYQA 3WLBB 4YHNB 1QD0A 4V2BA 5LCVL 5CEYA 4MNQE 3GHBL 1MCJA 3ULVH 1QNZH 1YECH 2EO1A 1IFHH 2FJHB 4XNXH 4GW4A 4P2RB 5H35A 4TQEH 4QHUA 4Y16C 1TNMA 4OSUL 5ILTH 2BSRB 3GNMH 4NQXB 5DK2A 3QPXL 4HS6A 1VB9A 3PE9A 4KMLB 4I3GA 5JPMB 5FK9B 3WKML 2WMPA 1T2QH 2AK4D 3OHXA 5CEZH 1WWCA 4XPAH 2IPUG 2Q86B 1XF4B 3GJEA 5DURB 4WI4A 3P4NB 3VE0B 2PYFB 5TFSH 1JHKL 3BAEH 4HFUH 4FQ1L 5IGXL 3MCLL 5FDYA 3D3VB 5FCSH 3TT1L 4QRPA 4C57C 3AB0C 4QRQB 4XXDB 4HJ0D 5CCKH 3L5WA 4PV8A 1MY5A 4B50A 5AZ2H 4LSUH 4PRDB 1ZAGA 1YQ2A 3S5LA 4MD5B 1MUJB 4L8CB 4PY8J 2D31A 1NCDL 4PGBA 4NT6A 5JW4N 1NEZB 5JQ6L 5DQDL 4MSWB 5KS9B 2JKXA 5EORL 2B2XL 1G7IB 3CNKA 1M4KA 3RWCA 5TDNA 2ADJA 4GAYA 1L7IH 3KPOB 2ZUWA 2Z8SA 4P9ML 1DN0A 3ARDC 4F8TA 4JM2D 4RBPK 4MDIA 3PWVA 1RJLA 3GSWA 6FABH 1HHKB 5AWNL 2VIRA 4IS6A 2XRAL 1X4YA 1PBYA 4RISL 2FJGA 1KPUA 5LXGH 1ZLUH 4OD3L 1I9RL 1PDKA 4WENB 3HR5A 3P0GB 3PUCA 1JHTB 2VDQL 4PJBF 5F7UA 1T3FA 1YEKL 1ZHLB 4K94C 3AS3A 2IMMA 3KR3H 1ORQA 2DQUL 4KK6D 3LKSA 1GCFA 4XPTL 2NY6C 2AXFA 3X13B 4JANA 1MCBA 5A40E 3WFCL 4OCWH 4WTZA 3RJQB 2OR9L 4GKNA 3Q1SH 2A2QT 1KFAL 2CD0A 1KIUA 4FZEL 1VADA 3IDIB 4G9DB 1TZIA 4F2MA 1GH7A 5I73B 2BY2A 3DXAE 1IARB 1NBZA 4XNYL 4P2OB 3TV3H 4XP6H 3GRWL 2YD7A 3PNWA 1R3LB 4E41E 4XGZA 4DZBB 5I17B 4HF5L 3OAUL 3MLXL 3GFUA 3D87B 1LDSA 4YGVB 1L9NA 4XB8A 4ODBD 5F7EL 3SPVA 1OAXH 2A9NH 2QQQA 4TSCH 4ZDHB 5ELIA 3QIBB 2XOTA 2QHLA 3LEXA 1UKTA 2ARJB 1M6OA 5HD8C 5KAQF 2X42A 2I07A 3ZKQD 3ZDYF 4LCCB 5DMIL 2NY0C 2AK4A 3N9GL 3Q6GL 4PJBB 1N2RA 3OB0H 4JKPH 2PXYB 5J1TC 1WCBA 1CBVH 3BPNB 3SDCA 5LGJB 3OR7B 3QFJB 5F7KC 3KJ4C 3GMRB 1AY1H 4TNVF 4U1HA 1VFBB 2OJEB 1UYWL 1CLCA 1Q9OA 4WHTA 4CUCA 2X09A 4M6ML 4KK9D 5E1HB 3MUGA 1KEGH 3PWJB 3DWTA 1DBML 4EEEA 1SYVA 5LWYH 1CR9H 1B2WL 4Q97A 1JZ3A 5EWIL 1BREA 3SQOL 1E27B 2AABH 1NLBL 5D7JD 2IGFH 3O0RL 2H9GB 2BVOA 5TDOA 3SDYL 1BBDH 1XIWC 4QHKJ 4WI8A 5HYFA 4HMEA 5A43C 1I3RA 3R06B 1OP5H 1HH6B 3NFNB 4X6CA 5GGRY 3SDDB 5F1IA 3UTQB 4D0BA 1J0IA 3ZDXE 1QLEH 3J8F7 2F54A 4JKLA 4LRNH 3HB3D 2HLAB 3NA9L 3RTQD 1A7QL 1E4JA 5MHSD 4F9PA 1F8TH 1G9MC 2E6JA 1D9KB 3MLUL 2EDWA 2AK4E 2FX7H 4ZFOL 2WQ8A 3NIGF 3MMEA 2I26N 1IAMA 4HIEB 4ZXBD 4M5YH 2BVEA 1VFAA 3CLEH 2C1PA 4JG1H 2VDKL 1GGIL 4YX2L 1C16A 5BOPA 4NKQB 4XX1E 5IEKA 1F90H 4E42B 4JFEE 4O2EA 3RNKA 3OAZH 2AXFB 1FNSL 1U58B 2B0SH 2APVA 3IDXL 1F5WA 4GAGH 3UC0L 1OAKH 2EDDA 4L3EE 1NFIA 4WDIB 4AIOA 1JUFA 3QI9A 5IHZB 3D9AH 2EDXA 4IRJD 1SY6H 1M7XA 2G75A 5CLTA 5TH2A 2PYEE 5GGQH 5IESL 4S1SL 5ETUA 5MP6L 1FAIL 1IKNA 1JN6B 1P1ZB 2XQYG 1MH5A 1KXVC 3VFWA 5DD1H 3HLAB 4K9EL 3BE1L 1WC7B 1RJLB 3GSWB 2J1KA 3FN9A 1MIEL 5IBUB 3TVMA 1ND0A 3FO1A 3EFDH 1JWSB 3EJJX 1CGSH 3IDYC 4JY5H 1T83A 4G6JL 1KCSL 3SPVB 3W11C 4OZHF 5FA4A 5C0BA 1RUKL 4KH2A 3MRFA 5GRVL 5DJYB 3FB8A 3KPRB 4TN9A 5CINH 4Z77B 1YMMB 1JFQH 3IETA 2ICEA 3LPGA 25C8H 4Z78B 1KBGL 4BSWA 4O51B 4MS8C 1MCQA 3M07A 4AMKL 4EN3D 1J5OH 2BHUA 4ZFFA 4I48A 4X7EC 3FO9B 2O5YH 1YNKH 1G6VK 4Z95H 1VFUA 5GS0L 3TF7C 3BRFA 1NGXA 2PYFA 5FGSA 4RMUA 1NBYB 1SYVB 2CKNA 5EBWB 4WHCA 2P5WE 3WFHB 4AQOA 5B8CA 4L3AA 1A1MB 3B9EA 5HHNA 1OPGL 5C0EA 3VFPA 3X11B 5ID0A 1NC2D 3UXFA 3KYAA 1N0XL 2GJ6E 3QUZB 5SWZE 4WI3A 1HINL 4RBPH 2HP4A 2XPGB 5HYQB 4QRRB 4WFED 5BCAA 2RFXA 3DROB 4EI5B 2O61B 1B3JA 3ZHLA 3IKCA 3S34H 2VWEC 4MVBD 3TJEL 3MGAA 5IVZB 5GGRB 3DPBA 1PG7H 5DFWH 4HWBA 2W60B 4W70A 1D9KA 4MMZC 4DKDC 1GRWA 4XWOD 2DOCA 4WNQB 3TA3C 5DQ9A 3BUYB 4ETQB 1K85A 2IAMB 4B5EA 3DI2B 4HLZH 2YPLE 3CMOL 2APTA 4MYWB 4X6DF 3MGOB 3TH4T 4O02L 5F93C 3WN5B 1H3VA 4NKOB 3P4NA 3VE0A 3IFNH 2JIXB 4EIGB 3WJJA 1DBBH 1RI8A 1SEQH 4KKCD 4MLIA 1BFOA 2FR4A 2OR7A 1KJVB 1B88A 3IAPA 2AXGB 3DBXB 3P9MB 3P40A 1TVHB 5KOMC 3D39D 1S7TB 1T04B 1SY6A 5HYJE 1R0AL 1Z0NA 3CU7A 4K3DL 1WZ1L 3TYGH 1I7RA 2OK0L 4D0BB 5E94B 1G6RL 1IQDA 3GI8L 3IRPX 1AJ7H 4HBCL 2ZSWB 5F1SA 3ECBA 1IC5H 4Z7VB 1P1ZA 5DMKB 1R5VB 4X8JA 3MUHL 4RNRA 5JTWA 2YUXA 3BIBX 3TO4A 4EVNB 3UBXA 4C55A 1VACB 4ZSOE 1HHGB 4K8RH 4MX7A 4FABL 1KJMA 3ARED 4HUUB 4OBSA 1MQKH 2VH5H 3QO1B 4J3UA 5JW5B 3DMMC 1U8NB 4WJ5A 2ZPKL 4NN5B 4HLZG 3MZTA 1JZ6A 5GSVA 4K2UL 1MJ7L 1G7PB 1KCUL 1WAAE 3GMQB 4UTBH 2AJXL 2YD4A 2ZKHH 3O11B 3RWHA 1NC4D 3LS5H 4N1CA 1U42A 1A6VH 1YY8A 3LEXB 5FECB 3S6CA 4KAQL 1U8LB 2OL3H 1HNFA 4JJHA 1NGPH 4OCYL 4JFFD 3VH8A 3ILPB 1TIUA 4KROD 5L7XL 4ZNCD 5FO9A 5GRUH 4HMDA 3T2OA 1FG2B 1HXYB 3HG1E 3Q5OA 3WXVH 4OCNC 5DFTA 3CLFL 4AJ0A 4HH9B 4XVTL 1PFCA 3IAGC 4ZUSA 3O3UN 4MXQD 4CKVX 1UM6H 4NHUB 3L3KB 4LHUD 1BQUA 1R3LA 1YY9D 3O8XD 3LV3B 5FAAA 2C5DC 4GS7C 1S8DB 4DZBA 5I17A 3FFCE 5DRWB 1E27A 2B39A 5HYSG 3VFVB 3MRCA 4ZSOA 1Q9KA 3HE6C 3S35H 5IR1A 5FA4B 5C0BB 3O9WB 1UXWA 5DGRA 3TA3A 1DR9A 3GMOA 1BJ1J 2FECL 2NY4B 1K3ZA 4AH2A 3SGKC 1FFNB 4JRXB 3VD7A 2KBGA 1MCFA 2H2PC 3QHFL 2VJXA 2J5LC 5E6IB 3VFOB 3D2UD 3ULUF 2NY5H 3SDCB 3VXRD 3QFJA 4HCRA 2EIDA 1KTLA 4FQLH 3U7WL 1NGXB 4QCIB 1JL8A 1ZVHA 4NDMA 5FGBA 1DVFC 3S37H 3L5XH 2ICWA 2I60L 4R8WL 3I9GH 5HI3D 3S97C 3OF6A 5A1AA 1J05A 3RNKB 4F7MB 3NCYP 3QWQB 1G7HA 4GG6F 5D6DC 3VI3E 4E41B 4OCMC 3QCTH 1S7QB 3WO4B 3FFCA 3TESA 2K7PA 4I5BA 4KUZH 1A7NH 3MBXL 2BZDA 3U4EA 3SE3A 3MV8A 2V17H 4NKIH 2V2XB 4FQJH 1KPVA 4KK5D 3AAZA 3P4OA 1DEEA 3C5ZB 5GISL 1S5IL 4PJHF 4R4FH 4XVUC 1FZMA 4RFNC 1UEMA 2V5TA 1WC7A 3GIZL 3BUYA 4PJCA 3UROR 3HPLA 4FA8A 3CFJB 3S3SA 4HWUA 5JW5A 3MGOA 3O4LE 2Z93A 4FQCL 2Q7NA 1PYWB 2YSSA 4M4RA 3UJTL 1HK6A 4PJEB 1I8KB 4FTVE 1F3RB 5T3XD 3TBYB 3PWPE 4YR6A 3VU2A 2DL2A 3LCYA 1MSPA 1BFOB 4J6RH 4LCIH 4WVRA 4U1IB 1IEAA 1NCTA 4TRPH 3U9PL 4YFDB 2RIKA 2CMRL 3D1MC 2MTPA 3MA7B 5GSRA 2NXYD 1NFIB 4WDIA 4JLRB 1M71A 4KK9C 1KB5L 4R3SA 1TJIH 5C08E 4I3SL 4GXVL 5F88B 1INEL 1BAFH 5CJOL 2GK2A 5CSBA 2OTUB 1KYOJ 1NGYB 4OGXL 4QXTA 4UQ2A 2NY7H 5ETUB 3QG7L 3TVMC 2R9HD 3CX2A 5MEOA 4NRZB 1PY9A 3QDGD 1VACA 4U1GC 3R0MA 5EIVA 2IALB 3RVXC 1WAAF 5DRWA 1TTFA 3IGAA 3ULUC 3D0LB 5CKGA 1BBJA 5KSBF 2PO6C 4JQIL 2E9WA 1ZSDB 3UTZB 3LQAL 2X2YA 1MELA 4H88L 3RAJH 3PF2A 3HRZA 3QAZC 5DRZB 3O4LA 3PHSA 3UTTD 4ZFGH 4Z7VE 3NIDE 4YHYC 3FMGL 3V5HB 5C0IA 3REVB 3RUGB 4KI5D 3LEYL 5DJCA 3PP4L 1CTNA 1RZIB 3IJSA 1MI5A 4ISVA 1CS6A 4Y4FA 3WEXB 1OP5K 1INQB 4HCRH 4QHLB 4MA1C 1AGDB 3SKMB 3C60A 4NNYA 5JLZA 1IAII 4LCCC 2VXVL 4WNQA 2DLIA 3QNXB 4PRBA 1CE6A 4Y4HB 1KIQB 4AEIH 3RWEA 4DKAA 4HJ0C 5A2IH 2G9HB 5JPNB 3BHBA 4IHOA 1CFVH 3O2WH 1CIDA 2I5YH 3K8MA 4Q2ZB 4NWTH 1RU9H 3B2UD 2NY6D 5ICYB 1T7YA 3ES6A 4WU5A 4S1RH 1GHFH 4G8GB 4ZSOB 5DK0A 3TM6A 3GSQB 3RU8H 4UBDD 2WBWB 3ARBC 4PBVC 3A0OA 1OD9A 2EZ0D 2V9QA 3FZUC 4NZDA 5HHQA 3C5ZC 3VWKC 3KYKL 2AV1B 5E99H 4F37F 1A9EA 1IAOA 1QVOA 4PP1D 4G9FA 1RJCA 4Z7VA 1AR1D 3MNVB 5E8NB 3LD8B 4L3CA 1PX3A 1A6TA 4G6KL 3K4DA 4PJDB 3RX8A 2A38A 3VD3A 2C7UA 4M3JA 2ILLA 1ZGLM 3L95A 4ENED 2BOBA 2COQA 2Z93B 3EFFB 4U0QB 1D6EB 4DOHE 1HZHL 1NGWA 1CFTB 4GKZA 5EO9B 2MNUA 4S11A 3D3VA 1GOGA 4X8XA 4NM4H 5TPWL 3DVGB 3FRUB 4LASL 1VFMA 3UTSB 1QFWL 4HPOH 2HT3C 1II4E 4M48H 5BS0A 5A3IC 4LSVH 1DVFD 1KG0B 2UZIH 5C70A 3ZKNC 43C9A 3V6ZA 3U0TA 4YDIH 5SWSE 4OFYD 1UENA 4PJGB 2X4SA 1F6FB 3DGCR 12E8L 1LDPH 3MRKB 1CXEA 4QRRE 2CLZB 1C8PA 1XGTA 3KJ6H 4CVZB 4QHKI 1YPZE 3UTPD 3PWVB 1BQLH 2ENYA 1V7ML 4ZD3H 4W4NA 4GAFB 1KCVL 1QBLH 2SEBA 4WJ5B 1FO0A 1EUTA 1CLOH 3HE6B 1I8KA 1IGTB 4ZS6C 1ZHLA 5IR1B 5D2NA 2YN3A 3L7EA 3QEQD 4PRHE 1XF5B 4Y1AD 1S3KL 3VFGL 5C0CA 3REVA 1M7DB 3FQRA 3D3VE 3GBML 1X5GA 3PL6C 5KW9H 2JJUA 4I9WE 1W0WB 1P84J 1RZFL 4OB5H 3P0VL 3IJYB 5DJZA 1A02N 4G3YH 1JRHI 1DBKL 4BK4A 5BS0E 5DYOA 4FQXC 2AGJL 5F6IB 1VEMA 4IBLT 3VFUA 1PZ5A 3RVTD 5EZOL 3PGDB 3B6SA 5I71C 4JZNA 5F89B 1ZA3B 4NQDE 1KTLB 8CGTA 1UZ8A 5J13C 2YA2A 1T03H 4LLUA 2ERJB 3W11D 4DUVA 3MV8D 1I4FA 2P4AB 2D7TH 3L5WB 1BBJB 1DSFL 1YEJL 1ADQA 5C86A 2UVEA 1X6LA 3HE7A 1AE6H 1T0MB 1R3HB 1IVLA 2ITCA 3BPCA 5TF1L 1HDMB 2R29H 1FE8H 4EQ3A 4ORZC 5I0ZA 3QHZL 4P4KA 1J7VR 2RR3A 4ZTPH 4XWGH 2F5AL 5D2NE 2W92A 3AREC 4Y5VA 1N5AA 1NFDB 2IH3B 3RWGA 4Y2DA 3D0VB 3QJFA 3BPOC 3ZKND 3LKOA 5E0QA 1CE1L 1TJHL 1KLGA 3NCFB 4RQQB 2E7CA 4PJDA 4YXHL 4Q9RL 1IM3A 3QIWC 3WNNA 4RSVA 1JNHA 4F7EA 3SDCD 3VXRB 4K07A 4NO0B 4JKMA 4DKFH 3RP1A 3D85D 2WUCH 2ICWB 1LO3H 5E8OB 2IAMC 3TBYA 3BWAA 3O45A 4TUOB 5DHXB 1OP9A 1BLNA 4JN2B 4WU5B 3PGFL 1IEAB 4AK1A 1I3GH 1YDPB 4QRRD 1TJGL 2IH1A 3TPUA 2FHFA 4P3CL 4P9HL 4Q6IB 1DL7L 1NCAL 1EDQA 2VL5B 4YHIA 4K7FA 4GKNB 4TVPD 1NEZA 2XWBB 4Y16A 4GG6E 3HAEH 2XXMB 2QQKH 3IKKA 3SDAD 2HLAA 1FGVL 3ARDD 5KSAA 4ZPVB 1W0VB 4RIRA 4HEPG 1HCVA 3AAZB 3SCMC 5IHUL 2QBWA 2HH0H 3VFMA 5IKCB 1S9YB 3MLYH 1FO0H 4LSSL 1PG7W 1NGZA 3G6AB 4K23H 5C9KA 4TTDD 4PJHE 2FJGB 5ACMA 4GAJL 1HHIA 4YHZL 2HFTA 1EAJA 3GM8A 5K9QI 2OJZL 3QUMB 1JPFB 3MUZ1 2NY0B 3KYMA 4CMHB 2WV3A 5KAQG 4X98A 1KJ3L 2FO4B 2YUWA 4EI6A 1FNFA 3K2UL 4HUWB 3KLAB 3OAYK 5T5NG 2DQTH 4JANB 2C9AA 3UDWC 4S0TD 4PY7B 3TH2T 3QDAA 4M6OH 2E8ZA 4XCFH 1JHLL 5KSUA 5E70A 4GRWB 5ITBL 4DQOL 4JY4B 3ISWA 5C6TH 1UH4A 4GG6A 4HGMA 4X7DC 3LRHA 1LWRA 1VFBA 2OJEA 3S96B 1RULH 4RMVA 3SY0B 2H6PA 3OXRB 4LLQB 1T1WB 5JIKA 1P4LA 4BH7B 4BELD 5JA8B 2HMIC 1GSMA 3OG4B 3TWCL 1G1YA 4P2RD 4PPTA 3BEWA 1NMCB 1LD9A 1T22B 4R90L 5C0RL 3RDTD 5IHLB 1FIGH 5T3XH 4OM0H 4TSAH 3CK0H 4X4ME 3VXUD 5H2BB 1X5ZA 7CGTA 2BY1A 4HWEL 1U3ZA 5SX5H 2GCYB 4YH6A 5IFHH 3NBNA 5D6CA 3NIDF 1SJEB 2A6KA 4BSWB 1IKFH 3PP3H 3R1GH 2DWEB 3TNNA 5J6HA 2CK2A 5DI8B 1DDHB 2GTWB 3FRPA 4N9GA 3IB4A 8FABA 1KN4H 2BVYA 4DVRL 3OPZH 4NPYA 5I8EA 1PW3A 4KKCC 3IF1B 4TPRL 5E1AA 3QDGB 1HIMH 1UCBH 1MNUH 1YEGH 3B3IA 2H26A 1CVRA 3VGGA 4UU9A 1U8IA 4IHOB 1XGYH 4IRSA 5J89A 3LPFA 3DVGA 1A1MA 4MQSB 1G6RB 3VFPB 1U58A 3HE7B 5I1JH 3FQXA 2H8PA 2A77L 2HLFD 5I66A 4LPXA 1CFQB 2DQCH 3RFZC 3LOWA 4RFEA 3SQBA 5EFIB 4YDLC 1QBAA 3EO0B 2FIRT 1U36A 4Y5VB 3ARTA 2G75B 3W39B 4CGTA 2VLKD 1UZ6F 5I1IL 1NMBL 3CVHH 3GM0A 1N4XH 4QXGH 4PJXB 1EK3A 4GRMA 1HEZA 2IPKB 3QRGH 5K33A 4PJFB 2CIKB 3HFMH 5JXAL 3W2DH 3SEPA 2BVPB 2BCKB 4WFFE 1Z9OA 1U3HD 1K2DA 4NN6C 3V7AG 2F19H 3J7HA 4WI9A 2JELL 4F9LC 4Z7WA 1JNLH 5BVPH 1NGWB 3QXDA 5AZEL 4UQ3B 5D2NB 2EXYD 1EHNA 4I1NB 5T1KB 5DJYA 3HNVH 2X1PA 3RWIB 1KJVA 4QO1A 1ZOXA 5DUML 4HUWA 3T8XA 1KIPA 4U33A 1UACL 3S98A 4EDXB 1W72B 2Z35B 4M7JH 3S5LG 1AD9A 5EU5B 2PUQT 5DJZB 5HYIA 3RKPA 4AL8H 2RGSA 3H7LA 2AV7A 1MFAH 3PIQA 2HFFB 5H94A 2E7MA 3MXVH 4LDEB 3VG9B 5I1EL 4WEBH 1ZE3C 1GIGH 3D2UA 2HWZL 2FO1A 2D03L 4F3FA 2IAMD 4QRSB 2V5YA 1XZ0B 5DD3L 5IFJA 3HCVB 3Q3GB 1A7BA 1B0GB 3W9EB 1QA9A 3OKYA 4L29A 3GHEL 2AP2A 1PY4A 1JV5A 2YD8A 4OFDA 5C0GB 3QUZA 5FUZL 5CFHA 3VXRE 3MO1B 3O11A 4Z5RA 3QNYB 1YEFL 2X89D 1TVDA 3VXPA 3MC0A 4PG2A 5H2BA 1A9BA 1T1ZA 4QTHB 5J56B 1YMMA 4GMTL 3LH2L 2GCYA 4TUKL 3WS6A 4JE4B 2DKSA 3EOTH 3QB7C 3IXTB 1NL0L 1HSBB 1DLFH 1A6UH 1T5XA 3EYUL 3JWOH 4UT7H 3FOMB 4JO3L 2MHAB 4OI8A 2L7JA 4N9GB 1VPOL 4J23A 5E4EB 5I1GH 3LVEA 2FB4H 5C0FA 4IMKA 2EDYA 1JNJA 3GBNL 3SDDD 4GLRI 3CFBA 4I3RH 1D6VH 3I2CH 3WFEL 5EBMA 3D39E 5B39A 2XN9A 5AUMA 5E6ZA 5I74B 4ERSL 3SJVB 3PABB 1HXMB 3WUWB 3DHMA 1HQRB 1A5FL 4XPBL 1LD9B 1BJMA 4P0DA 4BZ2L 1ACYL 3WIHH 1T7WA 1SYSB 1KNOB 2UZYB 5LAXB 2EH7H 3TCLB 3SKUD 5ITFB 1FSKB 2YPLD 3QH3A 2CDEB 4N8VG 4JAMB 1IGMH 1G7MA 1C5CH 1JPGB 2EDRA 4LNVA 3DSFH 3HC4H 4XPGH 4G8FB 3RBSA 3MLTB 3ARBD 1EV2E 4JFDD 3WE6A 5EZJA 2AK1L 5ADOL 1S9YA 3P73B 4D9LL 4UV7L 1XIWD 2IQ9H 2DI7A 1I7UA 1Q94B 4DGVL 2OM5A 1X6NA 2VLLB 3B2UC 3IF1A 4XX1G 1C12B 1NQBA 4DEPB 3DYOA 3RUGE 5CD3A 3KG5A 4OKVA 5IK3A 3VGBA 5MEQB 2KZWA 2QADD 3BT2H 1P7HL 1C5BL 2H3NA 5I1CL 2IH1B 3TPUB 3P9MA 2HJLB 1KEML 3BSZH 1XF1A 4P4RA 2ESVA 1MCWM 4KJYA 2VL5A 5K9QG 3BGFC 2H1PH 4LLYA 3T1FB 5AYUL 1TCMA 4RFOH 5GGSB 5F3BA 4JN1L 3OKKB 3HHRB 2I25N 4Q9CA 1WFNA 4QNPF 3KNBA 1WJ3A 1OB1B 2OXHA 1JPST 4XP9H 3G6JA 3JV6A 4XBPA 1PLGL 3N1MC 3LSOB 2XZQH 2FX8L 4OZIB 3HCVA 2DYPA 1JCKA 4OM1L 3WDHA 1ZS8B 2X4QB 2X1QA 3ARFC 4NJ9H 1DQQB 2ITDB 4PLOB 5HSFA 2P44B 5T33H 4G6FD 1JV5B 2DQIL 4KJPC 4L8BB 2DQIH 4XNUH 5IROA 3IFPA 3O3AA 5MERB 1OSPH 4YO0A 5JW4R 4Q6IC 1F13A 3RPKA 4CNIB 2HMID 3PV6A 4PJ5A 4H1LH 3T0EC 4EBQH 3HPJB 4PJFE 1I9IH 3MA7A 2RAMA 1MRFH 5F88A 3OJDB 4R26H 2BOCB 4OZGB 3GSRB 1QYGL 2ICWJ 3ZE0F 4F15B 3X3FL 1GPOH 3QO0A 1V5JA 1OF2A 3SE8L 2P5WD 3D6GA 4EN3A 4NUJB 1AKJA 5AUMB 3BZ4B 3EHBC 3TBWB 5ANMB 4KUCF 3WIHA 3QUYC 2IADA 3WIIH 4YGAB 1BJ8A 3THMH 4P2RA 1MIML 4F7MA 4F9PC 2VR9A 4HWNA 2ATPA 4TULL 1ZT7A 3U1SL 3ZZ1A 3T77B 1T0NA 3O4LB 3MGTB 2OTWA 3MREA 3RBGA 3MV8B 3GJEB 3PXHA 4U1NB 4A6YA 1AC6A 3GJFK 4NQUA 3QWRA 1XGUA 2AJVL 4R97B 1YEHH 4PJ5E 1HSBA 3C9NA 5FYKU 1MWAB 5DK2B 1ZT4A 5JDJA 4XPHH 5INDA 3QUZD 2CSPA 5IMOA 3OHXB 3QEGH 2OL3A 4NJAL 4LP4A 2ZWLT 2VQUA 2FGWL 2NY3C 4Y4HA 1P6FA 4V1DA 3FQTA 3EW3B 2CK0L 5D7KD 4QCIA 4ZODA 2R0WH 2P8MB 4UU9B 2J2ZA 5D5MB 1MCCA 1A0QL 1BF2A 1HQRA 3RJDA 3T0EA 2X4RA 1TPXB 4D9QD 1CICC 3S5LB 1U93A 2ZOKA 5EOQH 3BMVA 2FB4L 4NT6B 4MZ3A 2J4WL 4JRYB 4KV5E 2EEBA 5LKNA 4P4KD 2AJSL 3JWDH 2X4NB 4LEXL 2D7QA 4GBXC 1JGUH 1ZVYA 3B5HA 2YOCA 3G6JB 4XBPB 4BKLA 3UAJD 5FEBA 2GW5A 1DEEB 2VL4A 2BSED 4JRXE 2IQAA 4G7YH 1RHHB 5JZ7D 1UM4L 3MBEA 5C07D 2YMXL 2PKDA 1YEFH 3BGMB 1FZKB 3D5OF 2JCCE 1RPQA 2YZ1A 1VENA 1PYWA 4LGRB 3KLHD 2BNRE 2EDQA 3QJHB 2R56H 5DRZA 1H3XA 3VXNB 1D5BB 3FT4B 2FH6A 1BF8A 4M62H 3UTSA 1LILA 2L4OA 3PV6B 2EC9U 4PJ5B 2Y06L 1I1RA 4XBGA 4WEBL 1INDH 3CZJA 2J6EH 3LRSB 3NIFE 3H9SE 2KKQA 3GGWB 4Q74A 4K7PX 4MAYD 2HVJA 3B8SA 2NY0D 4LLYB 2PW1B 3DXAD 3T1FA 4KVCH 5HI4D 3GSRA 4HH8A 4MD0B 2M26A 4AL8L 3IDIA 5DDHB 1UKQA 1A7RL 3DGGB 4ELKB 5ICXB 4OTXH 3ARWA 1XGTB 2R69L 3DLQR 2EE3A 5DSCA 4KFZC 1QUNA 4OLZL 2LU3A 4NWUL 3IDUA 5J11B 2AK4B 1N2RB 5EN2A 5FGRA 4PRIE 5C0AA 4FP8L 4URTB 5MERA 1J8HE 1QBMH 2YRZA 3QHTC 4ZAKA 3VXOB 4ZUUB 2F19L 3TZVD 4MJ5A 4ZXBA 1RV6X 3STLA 3OL2A 2VDRH 3K46A 5DJCB 4PP1C 4Z7WF 2X4PA 4WI5A 3UTTB 3O6FD 1XR8A 4KKLC 4Y19E 2XA3A 1VDGA 3BMWA 5IVXA 3IJYA 1UQSA 5I1IH 4PJ9C 1IC4L 3TN0C 5FV2A 1JGVL 2QHRL 1Q72L 4CU6A 2G60H 1TQBC 3VDCA 4I4WA 2MOVA 4P2QE 2HT2D 2CKBH 1Q94A 5BW7C 2RQ8A 3MLVH 3L3OA 3QQ4A 3R4DA 1D6EA 2ZCHL 3DETD 4PJGE 5HDBF 5C0CD 2A77H 3TNMA 4FMKA 2HTKC 4EN3B 3V4UH 3L7FB 1U2CA 3VWKB 4LQFH 4XTRD 5D7JA 4XC1L 5IJVA 4HDIA 2FEEI 2R0KH 5MEQA 3SDDC 4XCEA 4NSKA 4DVBB 1BHGA 4XPFH 5DEFB 3RL2B 2F58L 4I2XA 5K9KB 4DVRH 3QEQB 2DI9A 2NTSP 3B9VA 3NFNA 4X6CB 2X9YA 2JJWA 1XGRA 5JHDE 1T6WA 2Z92B 1NFDA 2JF1A 4KTEL 1JRHH 3D0VA 1IKFL 4PBXA 1IGFL 1P4BH 3UZQA 1NDMB 4YNYA 5CEZD 4F58H 3MLRH 1EMTH 2CLVA 3DX8A 1BGXH 2VSDA 1JGLL 1KXQE 1LEIB 5KSAC 2OL3B 4Z8FL 4F7EB 1CD1A 4KRLB 2WWMC 2BC4B 4CADB 3GMPB 1RVFL 3V6OE 2D2OA 3WJJC 4EOWH 4NQSB 1XMWA 1FIGL 1MJJA 2EDTA 3A6CH 2GITA 3H42L 3BIKB 3OBAA 5EU7E 3QJHA 1CFTA 1CDBA 4UBDC 1B4JL 1BIIA 3BWAB 3O45B 4TUOA 3DVIA 1DQJB 4YO0B 4PP2B 5KSBA 5DTFA 2AJZA 1LK2A 1S9VA 2KQNA 2XWTA 3CSYB 2XV6B 4Y4FD 3F7PC 1IGIL 3MFFA 3G6DH 4WUUE 5D7LE 3VXMD 2FECI 5KG9B 1I8IB 3TBVB 3G5VB 4P4RB 5GRJH 4QXWA 4Y16B 4OF7A 4X80L 4PD4K 5C8JB 4GMSL 4PV9A 4D9RD 4PGZA 1ZA6A 5JHDA 4JFDB 3LN9A 3QO0B 3U4BL 5GXBB 4I77H 3V8OA 5CAYB 4GW1B 3MLWH 3AM8C 1H5BC 2YHGA 4PTTA 4PJ8C 2AEQH 4POYA 1AO7B 1FO0B 5DJ0B 2NY3D 1L4IA 4JO1L 1JF1B 6CGTA 3KYMB 1IRAY 1WITA 2VDOL 4K23L 1F4YH 2JE8A 5DT1H 4LSSH 1OWWA 1A64A 3DX6B 2HH0L 2HG5A 1H8NA 4UINH 1BGXL 5F1NB 5HHMB 1BM3L 3LKOB 4LNRA 3NACH 4X4XB 1IKNC 3ZMRA 1ZANL 5DYOB 4Z7VF 4EN3C 1LO0L 3MOBL 3JVGC 3QSKB 2XI9A 4P5MB 3DX9B 5A2LH 3DUHA 1DL7H 3L9RB 4G7VH 5IB1A 4GRWH 4NBZB 3SDXA 1BPVA 2WP3T 4U1KA 3ZYJA 1U8MA 4HDIB 3BJ91 3L3GB 5ANMA 4I18B 5I30L 5FYJH 5SWSD 3S8WA 3P4LA 5E08H 5IVZA 1ZHNA 3UO1H 3QQ3B 3RNQA 3C5JA 3U79A 4JHWL 3QCVL 3RL1A 2XPGA 5C0AD 2QV2A 2VZSA 5IB5A 5ISZD 4X4YB 1Q72H 2OX5A 3QA3B 4GS7B 4MQXD 4O4YL 4YXHH 1JGVH 4YC2C 1OAYH 5D6CB 4YNYB 5ICZA 1N6QL 2P1YA 4QOKD 5F96H 3MJ6A 1FVCA 5T5NF 4M6NL 1QR4A 5IBUG 1FORH 5L2KE 1MVUA 2XZAL 3V2AR 1IM3B 4ZTPL 8FABB 2VLJD 4GXUM 4GOSA 4WO4D 1A7PL 1H3UA 4NRYA 5HPMB 5ESVB 1AXSB 4XMLH 4EXKA 2HJKA 4V1DD 5F21B 1RZ7L 5MEPB 2OMBA 2P8MA 3RGVD 1FYTE 3QIBC 3B2VH 3SDXE 3LQZA 5FM4A 4CN4A 2GT9B 4NO0D 1WIOA 1OGAB 3CCHA 1K8IA 4N0YL 3VXSA 3B4NA 5ANME 3TBVA 3GZKA 4LEOB 2R69H 2JCCF 4KVNH 4OTXL 3QUXA 4OQTA 3H3KA 1HHGA 2GJZB 5EZOH 2GAZB 4AIZA 4ZUTB 2ADFL 4LHQB 5FV1L 5FKPB 4B7LA 4GRLB 4U6XB 2ZSWA 2IWGA 2VC2H 4CDGC 5I75B 3LQAC 5GZOD 1XF3A 1GGBL 1W0VA 4NUGH 4OQ1A 1ZLSH 3SY0A 2UYLB 2BCKA 5IBLC 5DS8B 3DIFB 1K2DB 4LKCA 3MBEB 1CLZH 2YBRB 3F7VA 5L2KA 1CXIA 3ARYA 1CLOL 2QSQA 1C5DA 2QQNH 4M7LH 4IJ3B 3UYPA 1NDGB 4P5TD 4ZUUA 3TBTB 1C1EL 4W4OC 2DN7A 3MUY1 4M02A 1GAFL 3V4VH 1QRNB 2YWYA 4O2CA 4EI6B 4PJ9D 3EYQC 3KJ6L 1PSKH 4OGYH 1QHPA 4KRPC 3I6KB 4JRYD 2A73B 1KT2B 4MQXC 4KMTH 5KSUB 4YDIL 4Q0XH 4ODUA 4NZUL