4M5ZL

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
SYVLTQPPSVSVAPGETARISCGGNNIGTKVLHWYQQTPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDISTDQAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 42
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL01
4JFZL 4NQDA 1DLHB 4GXUN 1RAMA 4OFDA 3DGGA 4YDIH 1A6TB 3RBSA 4XPAH 5E2WH 5BQ7A 5KOVC 4NZJA 4Q6IC 2DLFL 5DUML 1UJ3B 3IDGB 1AC6A 5TH2A 3ARPA 4NYLB 1HCFX 1X5FA 3TO4C 4M7JL 3MLVL 2E7MA 1NC4D 3O3UN 2Z93B 3S7GA 1AKJD 2A73B 2OI9C 1NEZB 2I26N 5BV7C 4UV4H 2HKFL 1J8HE 2VXVL 4OZGA 2A77L 4HW6A 3CFDB 5GXBB 4QRPE 3CGTA 3H8NA 5GS2H 4LPYA 3U79A 2XN9D 1XF3B 3OZ9L 5HD8D 1WAAF 3DX6B 1RJCA 1UWGL 2ZOKA 4K8RC 4JQIL 1EBPA 2FR4A 2J6EH 3DYPA 2I25N 5JW3L 2VOTA 3WE6B 4BYHA 3C8HA 4PJDE 3EYVB 4XPTL 2A1WH 4HIJB 3AY4C 3P4LA 2F5BH 4XNMA 3VXUA 2F53D 4Q6IB 1S9YB 5EFIB 3TO4B 4EUPH 1ZLUK 5CLTA 1KJ2B 2EEBA 4WTXA 4OZIE 2ADIB 4CU6A 2ICEB 1WEJL 2P8PB 2OI9B 2V7HB 3WDHA 4JPKL 5J1SC 1LQSR 3LD8C 3OX8A 5BV7B 5F9JA 5ADPL 4H88L 4ZNEA 1F4XH 3S5LA 1SEQL 4KZEL 1BFOA 4PJXF 4X4XB 4HJJL 5D5MF 5E8NA 3RZCD 2XYCA 4TNWK 1J11A 4GS7C 5HPOA 43C9A 5IKCB 3GJEA 5IQ7H 1WFUA 5DQ9A 2DQGL 1H8OA 4NOFA 5ID0B 2NY7H 5HD8C 1FNGB 4DN4H 1P7HL 3QQ4A 4OCNC 5A2FA 5F7WC 5EULV 5H37G 3I75B 1JHTA 3BZEB 1T21B 2P8MA 3DRTA 2BC4A 3LD8B 2QQKL 5F7NC 4QWWD 3LEVL 3S88L 4K3HA 3LKOB 1MHPH 4I2XB 3VCLA 1KTDA 3D18B 2NY1C 1D5ZA 3HE7D 3RJDA 2ZSWA 5LGJA 5EORL 4LF3B 2Y72A 1NC4B 5C7XH 1AKJB 4GS7B 1G9NC 5I1HL 1DBBH 1HQRB 3QEUB 43CAA 1TITA 4HF5L 3OGOE 5F96L 3EBAA 4UV7H 2XN9B 3O0RH 3X12B 4X6BB 4YO0B 1XR8A 4FQQA 5MP6L 4JB9L 3RZCC 1H3TA 4P5KB 3LDBC 4ODVL 2D7TL 4Q0XL 2KKQA 1T0MA 5F3HA 1UZ8B 3TO2B 3V6OC 4RWHA 1ND0A 5T3ZD 4MYWB 4XXCC 4WDIA 2NY1B 4PJIB 1KV3A 1A1NA 1T4KB 3PF2A 4YNYA 1CGUA 3QFJB 1DEDA 4HLZH 4LNRB 1U95A 1WGOA 5IB2A 4GW1B 3HMXL 4OLWL 3PQYE 1P4BL 4U1KB 5E9DD 3DO3A 2B1AH 3SKMB 1BX2A 3RBGA 4XXDA 1C5CH 3RDTD 3RZCB 3LDBB 4X6DE 1AQKH 3CXDH 1GVIA 1MFCH 4HIXL 4KGJA 3R8BB 3OAZK 1QSVA 3VRIB 1C7TA 4HUWA 4DKFH 1HINL 3FOMB 5J6HA 2NPLX 4M00A 2QV2A 1J88A 4BSWA 5MI0C 1RUML 3QIWD 3PWNA 5DUMH 1H3UA 4M7JH 3S36X 3SO5A 5E6ZA 2X1QA 4N0CC 3NCBB 2BJML 5FYKD 3QG7L 3T2OA 5ITFB 5I8OL 2NLJB 4MHHG 1FNHA 3AM8C 2QSTA 3MO1B 2NY2D 1RUAL 2HKFH 4KDTA 2VXVH 3ARGD 2A77H 3T08A 5L8LB 1WF5A 3WIFB 1SBSL 1U2CA 2P7TB 3OZ9H 5FHAL 2C3VB 4JQIH 3D25B 1P6AB 5JW3H 4HT1L 1DFBL 4OFPA 2X7LA 4XPTH 5HTSA 5I1AA 3VXSD 4P49A 4ZPTB 1XEDA 3FT4B 5LKNA 2GFBA 4OGZA 5CD5C 1NGXA 4TTDC 1IAKB 4NQTA 3HNTL 1P4LB 3RDTC 5JW5B 3PDOB 2OL3L 2ZNXA 1YMHA 4IMKC 3L3HA 4ZYKA 1JUFA 3QDGD 1CE1L 3INUL 1WEJH 1CLZL 4GAGL 4JPKH 1ZGLB 4C54A 4OT1L 4N8VG 1ADQL 2KBGA 4H88H 3L5WB 5ADPH 1SEQH 3MFFB 3QIWC 5EC1A 1G7JA 4H8WL 2ADFL 4HJJH 4BH8A 4NWTL 2WWKO 5SX4I 3RY6A 1LO3L 3QT2A 1U6AL 3KPMA 4PRHA 2Y5TB 4MHHI 5HHXL 4PJ7F 1PKOA 3DJ9A 4PTTB 2O93L 3ARGC 3O4LA 3D3VE 3AAZA 1N4XL 1KLUA 2VITA 3RDTB 3SY0B 3DVNA 3SPVB 1J5OL 1NDGA 4QHUB 4F37K 4UOW1 1MCWW 1JN6B 1T0PB 4PREA 2PYEA 4JFYB 3VD9A 1A2YA 2QQKH 1S9VA 3LEVH 4FG6D 3S88H 2QBWA 2HJLB 3GSOA 5F44A 3V8OA 4P2QD 2LTQC 3B2UD 4OIIL 1U8QA 3QIWB 1T7VA 4O00A 3MUY1 4WW2C 2HVKB 4UU9A 5EORH 4YFLF 4ZAKA 5DRWB 4OZ4B 5CCKL 2FZ3A 4OZIF 1TIUA 1U3HA 3AS3A 4HHAB 1K6QL 4HF5H 1VEOA 3ARGB 3P4MB 4KJPD 2EYTA 1WBXB 1T5WB 3PWLB 3BT2L 3NFSL 1MHHA 2WP3T 1R3LA 1AO7D 5MP6H 4JB9H 5IMOB 2AEWA 3F6LA 5F1IA 5F1NA 3ULVF 3B9DA 4ODVH 4WI3A 1FL5A 2D7TH 3MNWB 4Q0XH 4NJAL 3VXSB 3T65B 1W72L 4WHTA 1A9BB 2LTQB 2YRLA 1I1AD 3K8MA 1PY4A 4FQ1L 4S11A 2HVJA 4WW2B 4Z78B 1CD0A 5EN2B 4JPIA 4L8DA 3QDGB 1A0QL 3HMXH 1VENA 2VLLB 4OLWH 1A8JH 4FG6C 4JJHA 4HGMA 1P4BH 1Q9WB 4HUUB 1K4DB 3B2UC 1NC2D 2OZ4A 1LD9A 5DUPL 4CN6A 4FMFA 2D7OA 1BBJA 2GCYB 4OV5B 4JAMB 1Q72L 3L5IA 2A6KB 1XGPA 4HIXH 1I8KA 4JN2B 3DRQB 1P7QA 1HINH 4Z7VB 4RNRB 1UVQA 5BW7A 3K81A 4Y7MA 3KG5A 3RGVA 2E6QA 4KJPC 1FC2D 5D7JD 3SKNB 5I1IL 1LILA 1CDBA 2HAZA 1RUMH 3X3FL 1PZUB 1CGXA 4ZO7A 5DA4A 1QLRA 3P40A 4LLQA 2BJMH 5ELIA 3DV4B 3QG7H 3GB7B 5I8OH 5FGRA 2ORBL 2OX5A 5HXMA 1RUAH 1B0RB 3EO0B 3BGAA 3FQNA 4MJIB 5EU5A 2ZUTA 1SBSH 2YOCA 2EDLA 3F7RA 3UBXB 5HYEA 1NAMB 5FHAH 4PJAB 4HT1H 3EAKA 1A6AB 1DFBH 4O58L 2F8OA 3DXAE 1ONQB 1PQZB 2MCG1 2DM4A 5DK3A 3HNTH 1AO7B 2OL3H 2YPVL 4PY7B 1BOGB 2AGJL 4LL9A 3WNLA 4XPBL 1FJ1A 1CE1H 5I1CL 4NPYA 1CLZH 4GAGH 4D0CA 2VLRB 3JV6A 4L9LA 2W60A 3UXFA 4OT1H 5D7JC 1ADQH 1ZLWH 5IQ9B 1AFVL 1FVCB 2F8VA 4H8WH 2ADFH 5CHNA 4AENB 2AXHA 5ECJE 4NWTH 3QUMA 1GHFL 3LZFL 3V5DB 3UDWA 3HI1B 3QULA 1Z9OA 1U6AH 2VDKL 1EXUB 2VH5L 3BP4A 2ESVD 5HHXH 4Q9RL 1YMMA 2AQ1A 5F88B 4BFGA 3MRJA 4EOWL 3C87A 4P23C 1N4XH 1H3GA 3BJLA 4X80L 3VXRE 1J5OH 1QO3A 1P9MA 3MLWL 5F7YC 4MJ2A 4KGLA 1S5HA 3IAPA 1R3IL 3P77B 3MR9A 4NGHL 3TBVA 4CN1A 5D7JB 3GBNL 4XCEA 1JFQL 2HT2D 1NGZB 5INDB 2OR7A 4UQ2A 4MDJB 5AWNL 5CCKH 3OKYA 4X4ME 3K1DA 2OJEA 3R06A 4PJEA 5F3BA 1IRAY 1K6QH 3FB5A 1A6WL 3R1GL 3TFKD 3RKPA 1J10A 4LCWE 1FNSL 4OLZL 4PRPA 4JANB 1OW0A 4PJ9D 1KNOB 3BT2H 3NFSH 5CJ8A 5SX4H 1PEZA 1SYSB 3OAYH 1ES0B 2XA3A 2VDOL 3GMRA 2VWEC 4LK4A 2WV3A 5HGBB 2DIBA 2JCCB 3IJYB 3QDHA 1CXKA 4TNWF 1JE6A 3Q2CA 2IWGA 5HY9B 3HNSL 5EOCL 2EDHA 4JFPB 3RVWD 3ECBA 5C86A 1W72H 1VFBA 4QF1A 4FQ1H 4NZTL 1MHCB 5GSRB 5L2KD 5IIEA 2E5EA 4HX1A 2YA0A 3RUGB 1X5LA 4RBPH 1VGEL 2EDWA 4NT6A 1CD9B 3GSUA 3TIEB 1A0QH 3QDME 4LRIA 3B9KD 3HTLX 2HJKB 4JQVC 4G42A 5I74C 2HT2C 1G0DA 2JKXA 1HXMB 1YDPB 3OXRA 5DUPH 2IANA 2X4OA 3TGXA 3OG4B 3OB0H 3U0WH 3M1BB 5D6DA 5FGCE 2A6IA 4Z76A 1Q72H 3VH8B 1TMCB 4JFHE 5JXAH 2ESVB 2NW2B 5IK3B 2VZ1A 3ZYIA 1G6RA 4DKEL 1U8OB 4OD3L 3SDDA 5I1IH 4PJ9C 1H15A 1U8PA 4NKMB 3ZMRA 3X3FH 2AK1L 4R0LC 2V5YA 5DFVD 5BZDB 4PRNA 1JGVL 4QT5A 1BVZA 4EDXB 3VFNB 5C9JA 3QO0B 2ORBH 5AZEL 3RVWC 3HB3D 1QR1B 1QEWB 4C57C 4YIQA 1TJHL 3OF6D 5I74B 1AGDA 3ARFA 1GJIA 4N9GA 3H7BB 5JW4N 4C56D 3T0EE 1I7UA 4M1CD 3HFML 2EDOA 5DQDL 4R90L 3UTPE 4L4VD 3ILQC 4HGKC 3IDNB 4RAUA 4XAKD 4YFLI 4IOIB 2ARJB 1CDIA 4H25B 4UIKL 2XKSA 3B9KC 4U1NB 4O58H 4LP5A 1XFPA 1T83C 1ZHLA 2VKXA 5C2BL 2DMBA 5ISZA 5GS2D 4PJ9B 3TLRA 5JOPD 1E4KC 2I24N 4LLDA 4O02L 4NRZB 2OJZL 4MJ6A 3MJ6A 1FZJB 3FB8A 2YPVH 2IH1B 2K1MA 2AGJH 5SWSD 1BQHG 4XPBH 3FFCE 5I1CH 2P49B 1KG0A 1L9MA 4DWHA 5HGHB 2ITCA 5TFSL 1S7VA 3TBYA 5L2KB 4D0BB 1AFVH 3ARVA 5E1AA 5DFVC 2HFGL 2ARWA 2BNQB 1WC7B 2EZ0C 3E1F1 3E3QE 1KJVB 1HXYA 4U6YA 4ESKA 5C0IA 2VDKH 3CC5B 2VH5H 1YJDL 1RUPL 3EJYC 3B9KB 2VXUH 3DETD 2GT9A 4Q9RH 3IJHA 5CJQL 3NGBC 3ZHKA 3WEXA 5D7LE 5E6IC 4EOWH 2W07A 4G43B 4H20L 2NXYD 4EI5D 4M1CC 2ZOLB 4X80H 2ICWB 3MLWH 5L0QC 5F6HI 5BRZE 1YZZA 1OP5K 1R3IH 1SHMA 4NGHH 4P4RA 3X14A 3LPGA 3L3DA 3HPJB 4KRPD 1JFQH 1UH4A 2NMSA 1N6UA 4YPGB 3TEUA 1BD2A 1S7UB 1VDGA 4R8WH 3O11A 5DF0A 4CKVX 3UTSA 1QBLL 4Y5VA 5AUMB 2V2WB 5DEGB 3ULVL 2JIXD 3BN9C 5JORB 3NGBB 3MQIA 3U36B 1A6WH 3R1GH 3HUJB 5E6IB 1Q8MA 5HVGB 4OLZH 1FNSH 4PV8B 4C56B 3GSRA 4S1RL 1O7SA 1WUNT 3CSYA 5DVNA 4X9FA 3ARBA 1U93B 1UB6B 3MZTA 1FE8L 2VDOH 5L0QB 4NFDA 4DGIL 2CRYA 4YPJA 2VERN 5AYQA 3HNSH 4I5BB 5EOCH 1UWXH 2YPLA 1ITCA 2UVEA 3GJFK 2NXYC 4NZTH 2C1PB 1EEQA 4AJ0A 3O3DA 4XMLL 1VGEH 2EIEA 4F37F 4WNQA 5SWSB 4P46C 1UFUA 4I48A 5HGDB 1CG9B 4L29A 5DVLA 4RGOL 3UYOD 5JOFA 4KRPC 3T0WA 2HFFB 3V5HA 5DZNA 1CXFA 3IFNL 4FMKA 2OTUB 3VD7A 2MHAB 2X9XA 3PWPA 4LSRL 5FA4A 4EUPB 4D9QD 1BQLL 1NCNA 4ONHB 1P1ZB 1N5AB 3VFTA 3G04A 3H3KA 2F54D 1KULA 2ZUSA 1RD6A 4ELMA 2YWZA 4DZ8B 3R0NA 4YXKL 4DKEH 1N0XL 4OD3H 1U8HB 2NXYB 4NO2A 1M7XA 3WFDL 4HS6A 5JHDE 2AK1H 2EH7L 3SDYL 5C07E 4P46B 1UM4L 4JJ5A 5IGXL 1T1YB 5KOMC 1AH1A 2J8UA 4YDJA 3ORJA 5AZEH 4K3JL 3QO1B 1WCBA 4EN3C 3NH7L 1TJHH 4JLRA 4KRPB 2VZOA 3HFMH 3IDXL 4IRJD 5D7IE 4GG6B 5DQDH 8CGTA 1CGWA 2PTTB 4FXLA 3HPLA 4R90H 3X13B 3UC0L 1IQWL 2JIXB 4ZQKA 2F19L 3NIDE 2WM0A 5HHMD 1I8MA 1CFTB 5C2BH 2YWYA 1G0XA 4OCRL 1X4YA 1F4WL 2HT4D 1WJ3A 5F89A 4D8PB 2E7LA 4PBWD 4ZODA 1IE5A 4O02H 3LRGA 2OJZH 4KJYA 2BHYA 2VJXA 4TYUA 4PJCB 1K5NA 4AT6A 1A1MA 1IAMA 3WXWL 1FP5A 3QNXA 3O8XA 3D0LB 1FN4A 3L7EB 3T1FB 4EN3B 3EYUL 4WUUE 1B6DA 5TFSH 4Y5YA 3MRDB 4ZFFB 5ID1B 5GHWL 3MRFA 2XACC 2BHZA 5C0CD 5FGBC 2HFGH 1I9RL 4DCQB 4Y4HA 4KU1A 4X4ZA 4OQTL 3CMOL 2DLHA 4ZG1A 1RUKL 1YJDH 1RUPH 4JR9L 1BLNA 3O3EB 4PRDB 3VFUB 3QDJD 5CJQH 1J0IA 3TA3D 3C5SB 4H20H 1J0KA 2QR0B 3LEXB 2CUIA 4G5ZL 4WVRA 1KXQE 3LN5B 4WW1A 3ZDZE 3DROB 1HHJB 4PTUB 5HVWA 5IB5A 2F54B 4J8RB 2W59A 5B4MD 5JPMA 3AVEA 4G6AD 4JFEA 4GKZA 5E8EA 2HT4C 1KCSL 4ZUWB 1Q0YL 1U8MA 4U7KA 4X7TB 3L3GA 3SEPA 4IS6B 2HFEA 4G8GD 2AV1B 1EHLL 1QBLH 1ZEAL 5FV2A 1DANT 3U0PB 1U8KB 5KZCD 1QZ1A 3ULVH 3GMNA 2PCPA 3VFVA 2B5IC 3WN5A 4C83A 3FO9B 3WMSA 2L4OA 4PJ8C 2Q86A 4XP6L 1G84A 4JZJC 5F7DB 1I3UA 4S1RH 1T0NA 2FBJL 4XPHL 1IKNA 3ZSSA 3IU4L 2XPGB 2XY1A 1FE8H 3DUHA 1GXEA 4N1HB 1U58B 3ARED 4DGIH 1TVBB 3BJ91 5HHMB 1J05A 4KAQL 2UUDK 5T3XL 1ZLVH 2WQ8A 5FGSA 5IFHL 5FYLE 1XGTA 2W0KA 2ADGA 4XMLH 1CWVA 3LQAL 4KQ4L 4ZPVA 5F97E 1Q9OA 1KGCE 1HHIA 3MMEB 3BVNB 1FL3B 3LKSB 4U0RC 3I6GB 2B5IB 4G6AC 4PLOB 4RGOH 1OAZL 1YEGH 3MV7A 1W0VB 1HH6A 4ZUTA 1EEZB 3MZGB 4PJ8B 4PJFE 3IFNH 4JZJB 4XVTL 4B0MM 3G5XB 4XHQA 4LSRH 4BJLA 2PO6A 32C2A 3RGHA 1BQLH 3I3BA 4QHLB 3UTTE 1YN6A 4OV6F 5SWQB 3QEQD 3FAXA 2BVOA 5SV3A 3KLHC 4B41A 4HUKB 2VUYA 4YXKH 1N0XH 1KCVL 2D9QB 2VC2L 4U1JA 1JWSB 1NCWL 5CIPA 3S98A 1ZHKA 3WFDH 4W4OC 1HQ4A 2RFXA 3D2UA 1BVLA 3ARDD 3QA3B 5MERA 4XMKL 2EH7H 1JGDA 1U8JA 5GS1C 3HZKA 4FXKB 4LCCC 4QXTA 3SDYH 5C9KA 5L9DL 1UM4H 2E8YA 5IGXH 3MRKA 5A2KH 4U0RB 1OGAD 3W0WD 1VFAB 4K3JH 5CGMA 3GMMB 3ESUF 3NH7H 5KSAA 1L7IL 4NRXA 5HDOA 3L95B 4KK6D 1NGWB 3IDXH 4MMXC 5H2BA 4NQXA 1LEGA 2EDQA 5IJVB 3MNVA 3BSZL 1BFSA 4N1CA 4X5XB 3UC0H 2M8XA 1IQWH 1JGEB 1MPAL 1R24A 4NUGL 3PNWA 2F19H 5IBTL 1QSED 3VFPA 1AI1L 3DIFB 1CN4A 2XTJD 4L8BB 1F3JB 4NQEA 4OCRH 1F4WH 2IBZY 4U1HB 2P44B 1DBJL 1EH9A 1YNTB 5I17B 5GS1B 1CLOL 4LCCB 4OZFG 5DJAA 5J8OA 4P57A 1PYWA 3WXWH 2Z0BA 3ZT7A 2ENSA 2AJZB 1KIPB 1RJLB 4PJBA 4B5EA 5E03A 5DVOA 3NCCB 3EYUH 3G6JF 4Y19A 5CWSB 3QIUD 2P47B 4KK8C 2DMKA 3CVIL 5GHWH 4YGVA 5I8EA 4GKSB 4TN9A 4P2RE 1I9RH 3HCVB 1KF9B 2O5ZL 4OQTH 1IC5L 3CMOH 5BXFB 5DQJB 1RUKH 2XZCL 1YPZA 2IGFL 4JR9H 3KHQA 1ZT1B 3BP7B 3G6AB 1EFXA 4GW4B 3BHBB 1FAKT 4JPVL 5DS8A 2OZ4L 4ODHL 4CVWA 4KK6C 5HYSB 3OJ2C 1JZ6A 1GGYA 3MV9E 3DX8A 4G5ZH 3WNMA 5K9OB 1EO7A 3U7WH 5A40E 3BIBX 5EU4B 5JZ7C 4HK3N 5IJKA 2WP3O 2HMID 4RMSA 2XFXA 3PHOB 3QEQB 1ZLUH 1QA9A 1ZHNB 1X4XA 1NDMA 1N26A 2MNUA 2OK0L 2FWOB 3P9LA 4MNQB 2XG4A 5C0BE 1KCSH 1Q0YH 2P24B 5DD0L 1CD1B 2EEDA 2Y07L 4AH2A 5L8KB 1T20A 2IH3B 3MJ8A 3PL6A 4JZOB 1QFOA 1NANI 2D3VA 3IFPA 1ZSDA 1HSAA 4RRPG 3PDDA 1EHLH 1MLCA 1ZEAH 5D9SB 2EYRB 1T1ZA 2HTKC 1OGAB 3BWAB 4P5MA 3OAUL 1UEYA 2IPUK 4OB5L 2X4TB 1XZ0A 2KZWA 3QIUC 3MPCA 1QRNE 1X6LA 2UZYB 2V9RA 2ZG1A 3SGJC 4MSWB 4XP6H 5ADOL 4QXGL 5FOJA 2FBJH 2MKWA 4XPHH 3SOBL 4KROC 3IU4H 1RZ7L 4V1DD 4PY8J 1DN2A 5TQ0L 2J8UF 3MGAA 1UM6L 1U8IB 5FK9B 2NY6C 3MUZ1 3EO1A 5T3XH 1IM9A 1T6WA 2XTJB 3WXVL 2LU3A 4H8WC 5CKAA 5IFHH 1OM3L 1K3ZA 2XZZA 1OT2A 2XWTB 2ZP0T 3LQAH 4KQ4H 1NBQA 5D96C 4UB0L 4CW1A 3X11B 4YZFF 3T2NL 3SE8L 2CKBA 4OLUL 1RVFH 3BDXA 3QIUB 3MNZA 1OAZH 2DAVA 3T3MF 4XVTH 2OL3B 4HMEA 3F7QA 4KROB 2Q7NA 5FYJE 1S7TA 2C4XA 3O6ML 3BMWA 5FCSH 2NY6B 4LQFL 4DKDC 5I0DA 3GUTA 5KN5B 4M3KB 1KUMA 4Q2ZB 3PV7A 1T04B 1QFWM 1F6AB 4PGJA 2VLKB 1KCVH 2VC2H 3LMJL 3MXWH 4NN7C 1N64H 1NCWH 3QXAB 4AQ1B 1J0JA 3KYKL 2G2RB 3LH2L 4L8SA 1T66D 5ACMA 3JUYA 5EOTB 1V5JA 4F8QA 4XMKH 3UO1L 4GRLD 1OP9A 4PGDB 2H41A 3O45B 5L9DH 4HKZA 3GHEL 3U9PL 5KVGL 5BJTA 1NCDL 4ZSOE 3VI4E 3DBXB 2BVQB 3KPSE 3QDAA 1I7ZA 2VO5A 1L7IH 5FDYA 4XP9L 2EC9T 1L6ZA 3MV11 1EEYA 5I1DA 3BSZH 2VQUA 1LE5A 2D4DA 1AQDB 1MPAH 1EZVY 4NUGH 2ID5A 5IBTH 1KPUA 3QG6A 3MRGB 3OAZH 1AI1H 3VFMB 5BS0B 4N90E 4Z0XA 4NN7B 5DRNA 2OTWB 4UTBL 3WNKA 4EQ3A 3IRZA 3JTTA 5D1XD 1DBJH 4HEME 5IEHB 4V1DB 4M8QB 1IAOB 2DQHL 4M6MH 1OF2A 1CLOH 1X5HA 3RAJL 3WFZA 3MRHA 4OZHA 1UJTA 4XCYB 3FTGA 1H8NA 1SJXA 3CVIH 3HZVA 1XCQB 1T66C 1CLYL 1TPXC 1G7PB 5EBMA 1MOEA 5I75C 3FQXA 4JO3L 3TBWB 3OBAA 3U2SB 4GRLC 5I16B 4CGTA 2O5ZH 1IC5H 4G9DB 3DSFL 1BF2A 2DQEH 1K9TA 2XZCH 2IGFH 4Q6YA 2CLRB 3B3IA 3WJLA 4JDVA 1W72B 5E95B 3VI3E 3PGCB 3AU1A 3MJ7B 3U4BL 4QGTA 4JPVH 4Y16A 2W0LA 1M4KA 5DMGD 3T77A 4ODHH 3V52L 2VUOA 3JTSB 1GOFA 2DWDB 1T89C 4PGEB 1UB5B 1JNLL 3EGSB 3E6HB 3MUGB 4UIMA 2Y6SD 2FIKA 5FA3B 5GS3A 1YEDB 3VWKD 2BY2A 2EE6A 2OK0H 4RZCB 5JW4Q 3QRGL 4F2MA 2XG5A 1P7KB 4E41D 5DD0H 1TPXB 2Y07H 2EDRA 5K33A 2H3NB 5I75B 1IILE 3GHBL 4GRLB 5C0AA 4HS8L 3BXNB 2VXQL 4KKCD 1BZ9A 4N8VB 1S9WA 3RY4A 3VXTA 2BCKB 3OAUH 4OB5H 5JDSB 1W0WA 3MLRL 3MREA 2DS4A 3BPCB 4IHOB 1PJ9A 2UWEA 2NX5D 2V6HA 3Q5TA 4GBXA 2DWEA 5ADOH 4QXGH 3REWB 4O2CA 3I3EA 4RMQA 3SOBH 5KS9E 5DVMA 4U1IA 1RZ7H 4R3SA 12E8L 5TQ0H 1UM6H 1UXWB 1XF5B 4UDUB 1MCEA 1LE9B 1WBYB 2GHWB 2BVTA 2XWBA 3IETB 5DMGC 3WXVH 3QUXD 3OJMB 2HJFB 2Q1EA 4WV1A 1S7RA 5L8JB 2YEZA 1RJYA 4PRIE 4L4TD 1Q9KA 4MNHB 1Y0LA 3H3PL 3U6RA 4TQEL 5IOPA 2VDRL 5CBEA 1RU9L 4UB0H 2H8PA 4AYFA 4PJHE 4Z95L 2P48B 3T2NH 3SE8H 5ITBL 4OLUH 2X1XR 3MSPA 2JJVA 5IB4B 1DUZA 1D6VL 5HGAB 2LABA 1FFQA 3D69B 4PJXB 2YC1A 3CIQA 5D5MB 2G60L 3GIVB 4QRTA 1NANH 4PD4K 5JO5B 4OZFH 1G7HB 4FNLL 4KKCC 4PJBF 5KSVB 3O6MH 4LQFH 4YHNA 4Z77B 1XAUA 4HUVA 5CEYA 3KXFB 4POYA 1YNKL 3NFPA 1DVFA 5DJ8B 3LMJH 4KTYA 3KYKH 3KYAA 3LH2H 1SM3L 4MB5A 2OBGA 3L9RB 3PP4L 5FO7B 2WIIA 2QJDA 2OS7A 2ZSVA 1YPZF 3UO1H 1CFNA 4P59L 1CK0L 4QCIB 4Y1AD 5C09A 3GHEH 3VWKB 3U9PH 1RIVL 5KVGH 1NCDH 4X6CE 4XP5L 1A3RL 4E41B 3RWIB 2GIYA 3QUXC 2D7MA 1MJUL 3OPZL 3O9WC 4XP9H 2APBA 2P5EA 4GT7A 4WU5A 2XICA 3E6FA 1T80A 2FECI 3FCTA 3HC0A 5IW3A 4B7IA 2R15A 5FB8B 2MWCA 5MENA 3OSKA 1S8DB 4CVUA 5DDHB 4BUHA 4FOMA 2NX5B 4GRWF 3SDCA 1MRFL 2V7NA 4ZFGL 4UTBH 4OFYD 4O9HL 2XN9E 2DQHH 4LKCA 3CSPA 4YDKL 4W6XB 5CMAA 3RAJH 1FNEB 4EIZC 2VDLL 3FHQA 2J7LA 2YMXL 4UZGA 5EUKB 5KSBF 3LV3A 3S4SA 3QUXB 5TDPA 3FB6A 3O9WB 1CLYH 5FF6B 3N9GL 4L4TB 4PJIE 4WWKA 4JO3H 1G7MB 1WBZA 2VQ1B 3DSFH 1KCUL 3QFJE 3NZ8B 4HJGB 2VAAA 1KLGB 3U4BH 4D0DB 4JQXC 5AAMA 1N6VA 3QWQB 4P48A 4R26L 1J8HD 3V52H 4QRPD 3IDUA 3MRLB 3DX7B 1HWHB 1IC7L 4KMTL 3W5MA 4XC1L 1JNLH 2Z31A 4JGUA 2BXZA 1UCTA 1C5DB 1XF2B 2D7QA 2XKNB 4Z6AT 5F1SA 3FQUA 3V6OE 2GK0B 3F12A 5DTFB 2JB5L 3QRGH 3ILPB 3CVHA 3QPQD 2DYPD 1BQUA 4AG4L 4LPCA 3MLTB 5J56B 1CU4L 3GHBH 3DXAA 2H32A 6CGTA 3KPOB 4PR5B 2E27H 2N7AA 4QTHA 4HS8H 4K94L 5T1LD 1RULH 2VXQH 1IM3A 2C5DC 2R2BA 1JNHA 1RK0A 5ESAB 2X4NA 1IGYB 3PWJB 5FOBB 1HDMA 3MLRH 3UTZA 3VXQB 5JQ6L 5E7BA 1GZPA 2CIKA 1KT2B 3MRNA 12E8H 2APXA 3TBTB 4FQJL 3UAJD 3ULVD 3D1MC 5DD6B 1C1EL 1ZV5A 4O2EA 5IR1A 5EO1B 5IT2H 4PB9H 4O2FB 1AIFB 4E42B 2VN4A 4WRLA 3ZT6A 2P5WA 1V7ML 3SGKC 2RR3A 3KPPB 4JKMA 1UH2A 4QRUB 3H3PH 2F74A 1YJDC 1SEBA 2VDRH 1FNAA 3TWCL 1RU9H 4NZUL 5GZNC 3OR6B 4Z95H 4Y4KD 2O61B 2AQ2A 5T3ZE 1D6VH 3VMOA 1BREA 1DBKL 2UY6A 4HZAA 3AROA 2G60H 4G6KH 5EU3B 2FRGP 4FFVC 5FM8A 3QQ9C 3LQZB 3CD4A 4M6NL 4OZHF 4FNLH 3NCFB 2IC2A 4PJ7B 3ZE2E 1EV2E 2YA2A 1YNKH 1S9XA 2R39A 1J8HB 4X5WA 4G9FD 4QRPB 1SM3H 6FABH 3L5XL 4YE4L 3PP4H 3NOIA 4K07A 4EVNB 2BRRL 4UDTB 3F6IA 3TM6A 4P59H 4X99A 5C0GA 2W65A 3QWRA 3UAJC 4Y0GA 3ULVC 1CK0H 3EYOB 4TUKL 5A2LH 4KHXL 2BNRD 2VZSA 4HG4K 1RIVH 2H9GB 4BSJA 4XP5H 1A3RH 1MJUH 2DYPB 5BCAA 4BH7B 5IFAL 3OPZH 3STBA 5A2IH 5D2LF 2X4QB 3OMZA 3QYCA 5T1LB 1TCRA 2X4RB 4HZLA 1IL1A 4F58L 3DGGB 4OZIB 1NBZA 2BY0A 2O26U 3KYMA 4OFIA 4NNPL 1A7BA 3PQYD 5F1KC 4ZFGH 3TVMA 1MRFH 5TH2B 2DM7A 2RHEA 4O9HH 3QDMA 4M9OA 3S3SA 5ENWB 5DJXB 4YDKH 1AD0A 4PBVC 5GGSB 5I30L 4KJWD 1AY1L 1EFQA 1INDL 2VDLH 4GKNA 3H2WA 1MFAL 4FFZL 2YMXH 2UWEF 1NSNL 2VDNH 3VXSE 4X0KB 4P4KA 3T4YA 2EDJA 5B21A 3N9GH 1IAIM 4LCYB 4A6YA 3C6SB 3QHZL 3MXVL 1KCUH 3LCYA 3BDYL 1OWRM 4OF8A 3QDGE 1FFPA 2EIZA 1MNUL 1KCRL 4FQHB 2APWA 3QBTB 4U6HB 4R26H 4GRMB 3TIDA 1XF1A 3T8XA 2ATPA 3BZFA 3I85A 4P2OD 1IC7H 4KMTH 3TCLA 1P6FA 2ED9A 3FRUA 3SO3B 1CDHA 3T0EA 1ZXQA 1NFDF 4Z7VE 1R0AL 1FZMA 4LVOC 2DJSA 2JB5H 1HI6B 4G9FB 3H0TA 4K3DL 4LKXA 1Z5LB 5DURD 4AG4H 4NZDA 3GMPA 4MA1C 2PW1B 1BQHB 4U6TA 5I6XB 4NM4H 5E5UB 4HH9A 3T0BA 5IHZA 4K94H 1SBBA 4KJWC 4XBPA 2BNRB 3ROLB 3U0TA 2AP2A 1G7LA 2IEPA 4N9OB 4MJIE 3MRMB 5JQ6H 1B4JL 4N5ED 3U83A 1J1OL 1EGJL 3VXMD 4PJAE 4FQJH 3FFDA 1C1EH 1KTDB 1ORQA 4LVOB 5E8PB 5LGJB 1OP5H 5JHLL 4O4YL 2NR6D 3D3VD 2GTWB 4LRNL 2GUOA 1V7MH 4W70A 5DWUL 4MA1B 4QXUL 1JP5A 3ZYJA 4P2OC 5IFJA 3QFDB 1AO7E 3WFHB 5JPNB 5B3JF 3C5ZA 4X6DB 3TWCH 4NZUH 3BUYA 2FSEB 2ZUWA 2VLRE 1D5MB 5CEZL 2NTFA 2HLAA 1IEBA 1MHEA 1XR8B 5BRZA 1XGQA 5GGVL 1DBKH 2Q7YA 4HDIB 3FO0L 1MJ7L 4KI5F 1ERNA 3T0XA 4M6NH 4JEGB 5D70L 5J9PB 4B7LA 5DMIL 1MY5A 5DJZB 2WBJA 4MNGE 3SE3C 3QZWA 1I8IB 5J3HD 2XA8L 3KYOA 5GRYA 2J4WL 4QOKD 4YNYB 1YEIL 3L5XH 4H5SB 4P2OB 3GJFH 4YE4H 1LNUA 2LQRA 4M43L 2BRRH 5CSZB 1NFIA 1BZ7A 3NZHL 2V2TA 2YD3A 3HI6L 4TUKH 3HG1E 1R3JB 4KHXH 5DK0B 4TOYL 2JK5A 3EYQD 1RURH 3HE6A 1BX2B 3FB7A 3PE9A 1S78D 4XXDB 2AVGA 2NR6C 5IFAH 1V3LA 4NKDB 3RVUD 4HWBL 3NIFE 4WGVB 4HUWB 3LIZL 4LGRB 1RZGB 4GAYA 1NFKA 3LS4L 4F58H 4XC3L 1RFDL 2CDEA 2NTSP 4UAOC 4W6YB 1MCBA 4NNPH 2BP3A 1OGTA 1BP3B 4E0RA 1FZKB 1QOKA 3W11D 2XQYK 3GKZA 4UBDD 3VXMB 5CJXA 5ICZB 4CMMB 5I30H 3B6SB 2JCCE 1AY1H 1INDH 3GSVB 3GMOA 1MFAH 4FFZH 4J7RA 1NSNH 1T1XA 5J3HC 3RY6C 4GUPB 3P4OA 3VG9C 4B50A 3N1GC 3F7PC 4M7KL 1FV1B 3RVTD 3RUGE 5EO9B 3QHZH 3MXVH 3PJSB 4BFEA 2BMKA 3EYQC 5I1AB 1MNUH 1KCRH 4ERSL 4UAOB 3LS5L 1NGXB 1Y18B 1OB1A 4TVPL 3K4AA 1YMHB 5C07A 3L3HB 3RVUC 1BJMA 4ZYKB 4GXVL 1JUFB 4LOUD 3NCJL 3RL1A 4JHAL 2VWEE 5LWYL 2CDFA 1FVDB 3JV0A 4MA3A 1DL7H 2ESVE 3QXDA 2DB8A 4ZO9A 4J3VA 1R0AH 2DOCA 4NO0D 1G7JB 1O5DT 1DN0A 2V5TA 5CIPH 4QOKB 4K3DH 5ICYA 1IGJB 4ZAKC 4NCDA 1ZS8A 3W11C 3QI9A 4X7FC 4MX7A 4ZD3H 4OSUL 3O4LB 1DQLL 2FYYA 2VITB 2A6DA 4WJ5A 5E94B 2B1HL 2WLZA 4PGCA 3C60A 1B4JH 1R5WA 5H8DA 1DUYA 4LHUA 1XGUA 5IWLA 3RVTC 1MUJB 1EGJH 4S1SH 2CQVA 1S9VB 3FO1A 1YEKL 4KKNA 3FN9A 4HPOL 3PWUA 4CADA 2CDGB 4NUJA 1V7NH 4UU9B 4BZYA 4FTVA 4O4YH 5JHLH 4PV9B 5DWUH 4QXUH 5DJDB 4OCLC 3KYNA 3WBDA 1J8KA 1MWAA 5GZOD 2ED7A 3VXRD 4GSDL 4YK4B 3MA7A 4KKBC 1UKQA 2IPKA 4ZFOA 1U91A 1LO5A 2ARJQ 5DR5L 5BO1L 5CEZH 2I9LB 3QXVA 5CJ5A 5GRXG 4NQSA 5GISL 1KXTB 4X7DC 3VGFA 1DQQA 3NFNA 1OAYL 3GKWL 1NPUA 5GGVH 5L2KE 5F1IB 3FO0H 1MJ7H 3QQ3A 1FL5B 4QTIH 1HEZA 4F33B 4BQ9A 2BNQE 4UUJA 5D70H 4Y8AA 5DMIH 4BK5A 3A6BL 2YRPA 2ZPKL 5BW7C 3BQUA 1QR4A 4IDJL 3P30L 2KQMA 4KFZC 2VSCA 2XA8H 2UUDH 2J4WH 3V6FB 4LCWD 5D71L 3LPWA 4L8DB 1UA6H 4M43H 3EYFB 3NZHH 2UY7A 3MC0A 3HI6H 5KSUA 4D9RD 2CLVB 4J4PD 4TOYH 4TPRL 1BGXL 1LD9B 1AHWA 3GSQB 4NO0B 5A1AA 3FQWB 5HHQB 3WKML 4GRWH 1HHKA 2KQNA 3R4DA 4HWBH 1P7QB 3LIZH 4H1LA 5EG6C 1CDUA 4JM2D 3LS4H 1FNFA 1UVQB 1H5BC 4P3WA 5IW6B 4XC3H 1RFDH 4M7LT 4YHPA 5DXWA 1JV5B 4I18A 1N5YL 5I1JH 1ZK9A 3AXLB 3HUJE 5FHBL 4M5YL 4LLQB 4KTDL 2NY0D 4NHUB 1CI5A 1I1FB 4ZFZA 4IMLA 1HCVA 1CIDA 1AP2A 2N7BA 1JYWA 1KJMA 1M7DA 4I3SH 4EXKA 5KAQG 4L9LC 1ZOXA 4JFHD 3DURB 5TPWH 2X1PA 2CIIA 2E9JA 3DGCR 5EZLA 3RY5A 5C0RL 2PTUA 1P84J 5KVDL 3W9EA 4BFIB 5JOPE 1OQOA 4ENED 4M7KH 3BH8A 2R1WA 4L3ED 4YAQB 1QFHA 5CFHA 5SWSE 3EZ8A 4TUJA 3BH9A 1H5BB 4J4PC 5HPMB 3A6CL 4X6EB 5J1AB 4ERSH 2AXJA 3LS5H 4OUOA 1ZT4B 4GAFB 4TVPH 4ZUVA 2X5PA 2E9IA 1P9MC 1T1WB 1ZA3A 5FUCC 3VRLE 3NCJH 3LN4B 1JRHI 4NSKB 4NPYB 4D0CB 2IF7A 3QUKB 4JHAH 4JM2C 3JV6B 5IB3A 5LWYH 3TPUA 3QUYA 1K2DA 3NTCL 4AL8L 4QRQA 3L3KB 3MRBB 1P5UA 3RWHA 5CHNB 4LCWB 2NY0C 4ZS6D 3PG2A 5DJYA 4OZFB 1L0XA 4J1UA 3SDAD 4OKDA 5GPRA 5IMKB 4OF7A 4FZ8L 3ZDYE 5F9WC 3RKDD 1U92A 4ZXBD 1KB5L 4OSUH 2DIAA 3BKJL 3GSXB 3MRJB 4XMPH 5I19L 1LK3L 3QUZA 3FFCD 1DQLH 1KIRB 2QTEA 4LBEB 2B1HH 4ODWB 5EA0L 1RZ8B 3CPLB 4PP2B 1WT5C 3PGFL 4ENEC 2LAGB 1I7TB 4JFDA 1DQML 5C0DB 4W4NA 5MEPB 4XCNA 4GG6E 1CFVL 4JM2B 1YEKH 4BA8A 4MDIA 2BDNL 3NMEA 1GZQA 3BEWA 4HKXA 1CTNA 1BJ1J 1U8NB 3VFOA 5DT1L 3TT3L 1IVLA 2PF6A 4FQPA 4R2GD 4UQ2B 5HYFA 3GI8L 3GSNA 2NY0B 5D7LD 4NKQB 4APQA 1V3MA 2SEBA 4IRSD 1JRHL 4YR6A 1LP9F 3GI9H 2OJEB 3R06B 2B4CL 1IGML 5F3BB 1FZOB 4LRIC 5F9WB 4NRYB 4PJCE 5IV2A 3DX9A 4K7FA 3BPOC 3MV9A 4PRPB 4HWNA 5DR5H 3EW3B 4JVPA 3NPSB 2WAHA 5GISH 2IADB 5GGUA 5D6DC 5ALCL 1OAYH 3GKWH 3GMRB 3O4OC 3SDAC 4PYGA 2C7UA 4JY4B 3DV6A 4L3EB 4R96A 3RWEB 3FOLA 5C0BA 3RKDC 1IGTB 1K8IA 1FBIL 3A6BH 3QSKB 2ZPKH 3ARQA 1QUNA 1VEMA 3IKCB 3SDDC 4IDJH 2Z8RA 3P30H 5IB1A 2DKUA 2FCBA 5IIEB 4ZMAT 4ZUSA 2PXYA 5D71H 5FEBA 1J18A 1S7WA 5C08D 2BY1A 2CRIA 3CFBA 3LAFA 3UZQA 3BPOB 4TPRH 1BGXH 2Z8SA 3OXRB 3CVHL 4R2GC 1A6ZB 3WKMH 1JPGB 3O4OB 2A6IB 3RWGB 3ETBF 3SDAB 4KMLB 3TZVD 1P5VA 4IRSC 1QBAA 4XNQA 4OF3A 4ZXBB 3MCKA 3JVGA 3WYRA 1ORSB 5ILTL 5A3ID 1TJGL 3SDDB 3FFCB 4KWUA 3DMMD 5GGTL 1N5YH 1HILA 3JSSA 4ODUA 5FHBH 4KKLD 4M5YH 4KTDH 4QT5B 4A2MA 1B0WA 3TYFB 5IBLD 4XBGA 4RMWA 4NQCA 1CFQA 3P4NA 1ZHBA 4L3CB 2D7NA 5JIHA 3MLPA 3D5OF 3VXNA 5HHME 5C0RH 4N9GB 1X7QA 1AGBA 4R2GB 1GYAA 2BHUA 2CUMA 5D7LB 3G5VB 3CCHB 5KVDH 2BNUA 1CGTA 2DQDL 3C9NB 3GGWA 4RAUB 3T4AB 4IRSB 3OKLA 5DJ6A 2W9EL 1VA9A 3MLUL 5JHDD 5J4MA 2ATKA 4ONFL 1ZA6B 1TNNA 5JR1L 2FEDD 1CR9L 5EBWB 3ZLQC 1JJUA 2X4UA 1XMWA 2VIRA 4XCCL 2Q76A 3ZDXE 2WIMA 4L9DA 4U2YA 3GSWA 4MJ6B 4QHKI 3FB8B 3TZVC 1B9ZA 3RIAK 3VXPB 2LE9A 1FG2B 4ZSOA 3P73A 4TNVK 3KPSA 5ANMA 3STLB 1AC0A 1I85A 4KH2A 5A3IC 5I66A 7FABL 1VACB 5D7SL 2VYRE 1S7VB 3TBYB 3NTCH 3DMMC 4AL8H 1LEIA 2C3WA 5K9JL 4KKLC 2DJ4A 1U2HA 5CSGA 2M2DA 1PSKL 4U6YB 2AABL 5C08B 5C0EB 2EE3A 4FZ8H 3CU1A 1LMKA 3C5JA 4J3WA 4LSSL 3WEXB 3DUSA 1KB5H 4PP1D 5I19H 1LK3H 3F62A 2ADJA 1IGIL 1JPST 1QQDA 1HOCA 4OM1L 2VN7A 4AZ8A 3EZJB 2RBLA 5EA0H 4WUUD 1Q9LA 4JY5L 3TZVB 1BHGA 3PGFH 4NZRL 1OQXA 3WHXB 4I9WE 4Z7UF 2R23B 3L3IB 3VWJA 3I84A 1M6OA 1CFVH 3L3JA 3SBWC 4JY6A 2MQ3A 5GGSY 2BDNH 4RSVA 2FEDC 1B90A 2G5BA 3PABA 4KRNA 5HYQB 3DMMB 1IZJA 5DT1H 5JUEL 1MVFA 3HRZA 3ZHDA 3D0VA 2RJMA 3MYJB 3TT3H 3BE1L 4L3AA 3GI8H 4OGXL 5FO9A 1FNLA 1WV7T 3O11B 3UTSB 1M71A 1JRHH 2B4CH 1HNGA 1RZIA 1NLDL 4RAHA 1V3JA 3Q6GL 3G6JB 3QZWG 4BSVB 3MROA 2WMPA 3BRGC 1X5GA 2ZUQC 3ZE1F 1CGVA 4XX1E 5ALCH 3D6GA 4YXHL 1I7RA 1C5BL 1PX4A 2YUZA 1DLHA 2O5XL 2VL5A 3LRSB 4N0YL 1A6TA 4PP1C 1TFHA 4MAYD 3V0WH 5HHNB 1UJ3A 2ITDA 3IDGA 2FBOJ 1CE6B 4NYLA 1HHGB 3W9DB 4R6UA 3O3DB 3T3PE 4NHCL 2Z93A 1EUUA 2A73A 4K94C 5D7IB 5EU6E 4XVSL 1NEZA 3DO7A 4Y2DD 4PYHA 2VKWA 3EDJA 3B5GA 3CFDA 1A7PL 1KEML 4KTEL 4LLYB 3QEQE 5JOFB 4HCRA 1XF3A 3VH8G 3CVHH 4MNQE 3DX6A 2ZUQB 4JFQA 5FDWB 2AW2A 3G04B 3WE6A 1IT9L 4NNXB 3EYVA 2AJVL 4HIJA 3NA9L 2YD8A 4POZD 5ILTH 5J89A 4YC2C 4Z7OF 4ONGL 1KGCD 1JYNA 1OGAE 4FQXD 4Q6IA 1NGYB 1QLFA 1AD9B 5GGTH 5EFIA 3TO4A 3QCTL 3QXTA 4HS6B 4WUUB 2E7LC 4Z8FL 3BAEH 4EDWL 2AK4A 1KJ2A 1M7IB 2ICEA 2P8PA 2V7HA 4G7YL 4JJ5B 1UG9A 3FT3B 1PLGL 5DC9B 5ERWA 3O8XC 4MAYC 3UTTD 3LRHA 2A0LD 4JLRB 1DQJB 1C7SA 4Y5YC 4Z7QE 4Z7NF 4HWZA 5DJCB 3TV3L 1DDHA 1EVTC 1ZWIB 3HPLB 4HFWB 1HWGB 2DQDH 4TSAL 2W9EH 4MD0B 4Y2DC 3MLUH 4Q9CA 4LQ1A 4GAJL 1I8MB 4ONFH 2JTDA 4WFFD 4YC2B 3N1MC 4PS4L 4PD4J 1CR9H 1EUTA 2WQRA 3WHE0 2VZVA 3BZEA 1YY9D 3B4NA 4K3EL 2VMFA 1K5NB 3U7AA 5J6GB 5B38A 1D3CA 4JG0L 2AJYL 4QY8A 5E4IA 3QNXB 2YXFA 4POZC 3O8XB 3LKOA 3BD3A 4MAYB 4I2XA 7FABH 1BIIB 5D7SH 4PJGA 4LASL 3ARTA 1MVUB 4HUXB 4LF3A 4M03A 2VLKE 3D85D 1T03L 5K9JH 1NC4A 2OTPA 1AKJA 3MRCA 3OKDA 2AABH 1HQRA 3QEUA 4Y2DB 4F15C 4C59B 5BVPL 1EHNA 4LSSH 4YJZL 2J12B 4GMTL 2HLFC 4K71C 3WN5C 3X12A 1IGIH 2YPKA 4OM1H 4X6BA 4I3RL 4YO0A 2VE6A 2V9QA 3GJFB 4P5KA 1IKNC 4JY5H 4R97C 4NZRH 1GPOL 1UM5L 3MV8D 1IGFL 3VA2C 2GJ6D 5IB5B 1UZ8A 5GRVK 3REVB 3TO2A 2X4SA 4OGAD 4WUKL 4P2RD 1HSBB 5C6TL 1GRWA 4MXWL 4F9PC 2BOCA 2F53A 3TNNA 4HUMB 1MRCL 5JUEH 3G5YB 1U8MB 1T4KA 4NKIL 3LEYL 3L3GB 3MRQB 3JWOL 5F71A 5BS0E 3BE1H 1OSZB 4OGXH 2BSTB 4LNRA 4GW1A 1A6VL 1Q0XL 3BO8B 4Y4FD 4DOHB 4HWUA 2ZNWA 2KZ1B 5TE6L 3GMNB 2PCPB 4U1KA 3UTTB 1ZVSB 1NLDH 2XQYG 4K71B 3WN5B 4X83A 4LP4A 3Q6GH 1CICD 3ULSA 4MWFB 1E6JL 1T0NB 3RZCA 3ALPA 4R97B 3TF7C 1N59A 3TPKA 1S7QA 3UYRL 4YXHH 4X98B 4NO5B 1C5BH 1TDQA 1J9CT 3V6OA 2O5XH 5HHOE 3T04D 4M7LL 3O81A 4N0FB 4N0YH 5EUOF 4XXCA 1XIWD 2GI7A 1WISA 2ILLA 5CEZD 2FGWL 2Q87A 1QRND 5DC4B 3CFKB 2Y4SA 4NHCH 3WLBB 1AGFB 1PY9A 3QXUA 4ZPVB 5ITFA 2NLJA 1A21A 4XVSH 3F7VB 4OGAC 1DP0A 1N8ZB 1VFMA 3WIFA 1KEMH 3HE7A 1VKXB 3OKNB 5KSAC 3UX9B 4ZUTB 3V7AE 3MRIB 2P7TA 3D85B 1P2CB 1B0GB 2C3VA 3D25A 4G3YL 4Y4FC 3H9HB 4CAGA 1N0LA 1IT9H 4PG9A 3NBNA 5SX5K 2AJVH 2BVOB 3NA9H 2V5RA 4V2BA 2ZKHL 4P5TD 4ZPTA 3ARSA 3W39A 2OR8A 4U1JB 3QJHB 4ONGH 1IAKA 1CICC 5CIPB 4UILL 2DQIL 1HQ4B 2RFXB 2YZ8A 3D2UB 3LVEA 1BVLB 3QCTH 4JFFE 1UYWL 4G80B 4Z8FH 5DFTA 3MV8B 4QXTB 3K4DA 2GJ6B 2BERA 4S1QL 4G7YH 2FHCA 3IDJA 1WAAE 4WO4D 5KG9B 3WKNA 3QPXL 4MD4B 3L5WA 4IIQC 2V2XB 5KSAB 1X5IA 4NRXB 3PIQB 1CDJA 3TV3H 5GRZA 4U05A 4K7PY 5H2BB 5FKPA 1LEGB 5T1KD 1IQDA 3AUVA 3RP1A 2I9TB 4Y4FB 4TSAH 1D9KD 1R24B 4PTTA 5E9DA 2X1WL 4GAJH 2YD6A 5T33L 2GITB 5L7XL 2XIDA 3GRWA 4PS4H 1CICB 3RDTA 3SY0A 1ZAGA 3SPVA 1H0DA 4IMKA 4QHUA 5CSBA 3IJSB 4K3EH 4PJXE 4QYOA 1I3RB 4D3CL 4JFYA 3LKPB 1T2JA 5D5ME 4DGYL 5IJKC 2VZTA 3O6KL 1G1CA 2AJYH 2CLZB 2HJLA 1OTUD 4IIQB 1XIWB 2F9BT 4Y19B 1HYSD 4LASH 3QIWA 3KXFE 1GCFA 5EPMB 2HVKA 1MAML 2DDQL 4M48L 4TVPD 1QRNB 2QHRL 4N90D 1T03H 4U6XA 5DRWA 4OZ4A 4HHAA 1YPZB 3MODL 2N56A 5BVPH 3P4MA 1DQDL 4ORZC 4GMTH 1WBXA 3T2QA 4XRCA 1LWRA 1T5WA 3PWLA 1NL0L 4JE4B 4I3RH 2LAAA 4Z7WF 2JJSA 3DX8B 4JKWA 5IMOA 4HIHA 1GPOH 1UM5H 2DD8H 1IGFH 4KKAD 4YBLC 4DN3L 1K4CB 2XFXB 4WUKH 4S1DD 3VXSA 4P5TB 2OM5A 1VADA 1A9BA 3KPTA 3P9LB 5C6TH 4MXWH 5F7FA 1NMAL 5FYJU 2Q6WA 5H94A 1MRCH 4WW2A 3LEYH 4RX4D 3JWOH 4Z78A 4GRWB 1WLHA 4LVHC 5EN2A 5CJBA 1ZSDB 3QDGA 3GO1L 3KPNB 1MLCB 1A6VH 1Q0XH 4OCWL 3RIAF 3ARRA 3ROOB 1T1ZB 2VLLA 5JW4R 4TNVF 5TE6H 3MBED 2M26A 4HUUA 1K4DA 4HC1A 1HYSC 1I8LA 2DLTA 2V17L 5KSBB 4RQQB 3TYGL 2GCYA 4OV5A 1E6JH 1YN7B 4JAMA 5HI3D 5T1KB 2A6KA 3UYRH 4YBLB 4L4TE 4Z7VA 4M7LH 4QRRD 5F9OL 4DAGL 3MLSL 2LVEA 3SKNA 5DEFB 4EJ1C 3IB4A 2FGWH 4LVHB 5T1DL 3DV4A 1QHPA 4XP4L 4KKAC 3HI5L 1IAII 4YEEA 2DQCL 1IEAB 4OBRA 3TH4T 4P2QA 5CEXB 1OTSD 4ZUUB 3UBXA 3EKCA 3GMQB 1NAMA 3AMKA 3ZKMD 2Y7QA 4RAVB 5DVKA 3J8F7 4PJAA 4HAGA 1TCMA 4TUOB 4CDGC 4M3JA 3C8KA 4G3YH 3V9FA 3QEHA 4LLUB 1A6AA 4PRID 1EEUA 3MBEC 4PJGF 1ONQA 1N2RB 2ZKHH 1PQZA 4WTZG 4JRXE 3BMVA 3CDGB 4UILH 2DQIH 1OAQL 1AO7A 1PG7L 1UYWH 5DUBA 4PY7A 2KL6A 1BOGA 1PKQA 4HBQA 1W0YT 4S1QH 4Q74A 1Z9MA 3RVVD 4J3OC 4K8RD 1I1AA 2Y06L 3QPXH 4WFED 1FGVL 5IQ9A 1I7ZB 1FVCA 1REIA 4NP4L 1UT9A 4NOBA 1HHHB 4AENA 2NNAB 1EEYB 1FVEA 1IAIL 1EXUA 3K2UL 4ODTL 5DO2D 1T2QL 4KXZI 3MBEB 3BKYL 5F88A 1JPSL 4KI1A 5T33H 1NC2A 1OTSC 3QIBD 4JHZA 5L7XH 2B7DT 1F97A 3ZKMC 3RA7L 5IROC 1MFEL 4G6FD 4XWOC 3LPFA 4PRAA 4OCYL 3PGDB 4JN1L 1UZ6F 4FFYL 4D3CH 1RIHL 4DGYH 3O6KH 4OZHB 5CP3H 3EDFA 3P77A 4QRRB 2VISA 4XX1G 3V8CA 3FTGB 5D7JA 3V95A 3P0YL 3Q3GA 4FQIL 3HZVB 5F9DC 4PJ7E 4HIEB 2DDQH 1JF1B 2QHRH 5I76B 4QNPF 1JGLL 1D5BB 1F4YL 5DEZA 3IYLW 3VXOA 5KS9B 2HH0L 3MODH 3TCXA 3B3IB 1IFHL 3RVVC 3SHSA 1N3NB 1DQDH 2YN3A 5AZ2L 5HYSG 5E5MB 4JANA 2K7QA 4XH2B 1NL0H 4C55A 1SYSA 4OTXL 1FYTE 2X10A 1ES0A 2X4PA 4IM8A 5HGBA 2JCCA 3IJYA 4E9LA 1L4IA 5D2LB 5DO2C 2K3TA 4DN3H 2L7UA 4PRIB 2NY1D 4H1LH 5HY9A 5I1EH 4AEEA 1C08A 4JFPA 3MRPB 3QIBC 4NQDE 3QFJD 1NMAH 3V4VH 4F2MB 4PJHB 3FL7A 1MHCA 5GSRA 3U4EB 3IDMB 3HZYA 4WV1C 2Z35B 3RUGA 4I4WB 1FQ9C 3S96B 5ACZB 1A64A 2Q8BL 3TIEA 4QEGA 3GO1H 2XZQH 4OCWH 2QLVB 1S9WB 1MQ8A 1UKTA 2HJKA 3BZDA 4GMSL 3LKNB 4RGND 3ULVE 2YXMA 2V17H 1HXMA 1YDPA 5D6CB 2UWEB 5LAXA 1PVHA 3TYGH 5CGTA 3O3AB 1NCCL 1SYVB 1FHGA 3BP6A 2X05A 1T7XA 2VLMD 2ESVA 2NW2A 4FZEL 1F4HA 1FFOA 2WLYA 1TZIB 3QIBB 5F9OH 4DAGH 3MLSH 5E8DL 5J0BA 2W0FB 3GM8A 4NKMA 4G6FB 5E00B 4X6CB 4WV1B 3CH1B 5T5FL 2YEZB 4EIGB 3RTQD 4WWKD 5T1DH 3U6RB 3HRPA 4EDXA 4R4ND 3VFNA 4XP4H 5HI4C 3HI5H 4AEHL 2WWMD 4U1GC 5CBEB 2DQCH 3VMPA 1QR1A 1QEWA 2A83B 5LGHL 4L8CA 3JXAA 2ZWLT 5DFWH 1Z3GL 1GGCL 1NFDB 5DGQA 1I3VA 1IEHA 2YC1B 4NWUH 4G9FE 2AEIT 3IDNA 5E2JA 1DTUA 4IOIA 2ARJA 4H25A 3P9MA 1D7FA 4U1NA 2W1NA 5CEYB 4RGNC 5BVJB 3NFPB 5DHYA 2BNRE 4N0CD 4PJ9A 3SDCC 3RVXC 1OAQH 1PG7H 4NRZA 3VFSB 2WIIB 2ZSVB 5FECB 2ZUVA 2B4CC 3NA4A 2QKIA 1X5YA 2WK2A 1T7YA 4N8PA 1KB5B 2EECA 1MQKL 1U0QA 1EPFA 1CXLA 3K0WA 2Y06H 4CMHC 3SKJH 1FGVH 5L2KA 4D0BA 4NP4H 1JBJA 4HFUL 5IVZA 4MVBD 3RTQC 4WWKC 3H6JA 1WC7A 5B8CC 1UQSA 2P5EB 1KJVA 1BZQK 2E3VA 3QWOA 4R4NC 1IAIH 3CC5A 3E6FB 2WWMC 3K2UH 4OIAA 5CD5D 3B9KA 5KBNC 4ODTH 4TTDD 4UT9L 5T5NG 1T2QH 5MENB 3S34L 5B38G 3BKYH 5DMYA 4LLVA 3OKEB 4RGNB 1JPSH 3LY6A 1J0YA 4IRZL 3IAGC 4ZTPL 4D94A 4I0PD 1NKOA 4IJ3C 1FO0L 1E4KA 3RA7H 1CGYA 4JFZH 1MFEH 1MCNA 3QAZC 1G7IB 2ICWA 1NEUA 3OJDB 1K3IA 4OCYH 2D03L 5IM7B 3SDXF 2ZG2A 4FFYH 3S37X 1RIHH 3ZTNL 4AQOA 2HP4A 2DLFH 3BKML 1FDLL 1XCTB 2MQCA 1AGCB 3EOBB 5DD3L 4CMHB 3MLVH 3P0YH 4HJ0D 4NN5C 3LV3B 1KPRB 3HPJA 4FQIH 1QPPA 3DVIA 2IPTL 4YPGA 3WIHA 4MCYA 3RTQB 4WWKB 5B8CB 1JGLH 5AUMA 2V2WA 2HA1A 1F4YH 2JE8A 4R7NB 5DHXB 2HH0H 5JORA 2UYLA 4OFKA 3ZHLA 1IFHH 3U36A 1UWGH 5FM5O 3OF6A 3HUJA 5AZ2H 3FRPG 2BSRB 1UEMA 5C0FB 4IJ3B 4PV8A 4LEOA 4C56A 5L6YL 3WUWG 3RRQA 4OTXH 3QAZB 4MVBC 3B43A 4OKVB 5ICXA 1UB6A 4L4VA 3S37L 3QCVL 3RX8A 3WNNA 1KLFA 3V7AG 1EAPA 4Y88A 1MCIA 5KANG 5MI0B 3S36L 4KXZH 5JA9A 2W92A 4I5BA 3FQUB 4NDMB 4I0PC 4NN5B 3CVHB 2C1PA 4OFVA 3N0PB 3KLSA 1CL7I 3BDBA 4LIQL 5SWSA 3VW3L 2Q8BH 4J6RL 3PV6B 4FQCL 4KZEH 5CLWA 5HGDA 1CG9A 3MLZL 4KZDL 1PBYA 3VXME 2X4NB 5DHVH 1X5ZA 4GMSH 4HJ0C 4UT6L 1HDMB 4NNYA 3UP1A 3UTZB 2O5YL 2JELL 4EUPA 2YD1A 1NCCH 4ONHA 2GSIA 4G8FB 1N5AA 3QCUL 2DQGH 4AY0A 3W81A 4FZEH 4JZNB 4O2EB 5IR1B 3QJFA 4I0PB 1U8HA 5E8DH 3BESR 4EI5A 5T3XE 5FYKU 3H9YA 1IC4L 3ZYOA 2P5WB 1KTLB 1LDSA 3HLAA 3ZO0A 5T5FH 1WIUA 3ARXA 1J0ZA 1MSPA 1NBYA 3WS6C 2GAZA 4MZ3A 1FH5L 4MJID 5J11C 5KANI 4AEHH 5B39G 1T1YA 2AQ3A 4N0UB 3S8WA 3QO1A 1MCSA 4KV5F 4MQSB 1INQB 1Z3GH 1V05A 2Y9RT 5I1HH 3ZKND 4LPUA 5HVHC 1CL7L 2LVCA 2PTTA 3X13A 4OCMC 1T5XB 5F96H 4QOKE 3TBSB 2JIXA 1GGTA 4NC2B 3ARYA 3WFCL 1W2KT 3WLWC 3O4LE 3G08B 4ODBD 4D8PA 4OZGF 2VLRD 1YY8A 4MXVF 4PJCA 2P8LA 5J11B 1OHQA 3D0LA 3T1FA 3UPRA 1G0YR 2GJZB 1MQKH 4D9LL 1I9JL 2R9HC 1ZVHA 3MRDA 5ID1A 2FX8L 4P4KC 5TDNB 2GY7B 3PDGA 5HVHB 1I1CA 4HFUH 2AV7A 2ENYA 3VJ6B 1A4KA 2FGZA 4DCQA 4UTAL 2R2EA 4LLWB 5ACLA 2FJHB 1SMAA 3O3EA 4PRDA 4WEMB 5DSCA 3VFUA 3S34H 1NBZB 2MSPA 4IRZH 4ZTPH 5I8CA 3HG1D 1FO0H 4OIBA 1UH3A 3ZKNC 2QR0A 4LLMB 3LEXA 4UOW0 3LN5A 2D03H 3DROA 1HHJA 2F54A 1TTGA 2X70A 4AIZA 3BKMH 2AEQL 1FDLH 4MS8D 5DD3H 1T22B 2VLJD 3IXTA 4ZUWA 3L6FB 4P4KB 4U0QB 4QRSA 3OTTA 2YRZA 2IPTH 1D6EB 1KCKA 5IVOA 3FN0L 4R4BB 4P23D 1PD6A 3U0PA 1ZVYA 5IESL 4X9IA 1FFPB 4JKKA 4X6FB 3JV4A 5FUZL 4KC3B 3FO9A 5INCA 1KBGL 4IRJA 5F7DA 3BZFB 3SCMD 3CUPB 1GGIL 2XPGA 3S37H 3QCVH 1FIEA 2VR4A 3BFOA 4DVBB 1FSKC 4GLRI 1U58A 3S36H 4LPWA 4F80A 3B8SA 3Q5OA 4BUGA 5EU7C 1G9ML 2YKLL 3H0TB 3INUH 1YEFL 4WENB 3U7YL 4M8VA 4LIQH 4HH9B 4KJQD 5ESVB 3VW3H 3C5ZC 4J6RH 5IHZB 4FQCH 3MMEA 2YSSA 1EA9C 3BVNA 4W81A 3LKSA 3FZUD 3MLZH 4PRBA 4MS8C 3F65A 3S35X 3S3PA 1QVOA 1LO3H 1NMCC 1W0VA 1F11B 5DMKB 4UT6H 2PUQT 2O5YH 2DQFB 3I02A 4JZJA 2JELH 4LMQI 4MNGB 5C0CA 4BELD 4O5LL 4QHMB 5IVXA 1MEXL 4QHLA 5EIIB 5F7UA 3QCUH 4CRPA 4XI5C 5SWQA 5L2JA 3FFDB 3QDJA 4KDVA 3TA3A 4RCAA 5TGBB 2AXGB 2NY5L 2VL4A 5GRVL 1JWSA 3HG1B 4F9LC 4WFHD 1IC4H 3OV6A 3QA3A 2V9TA 1BVKB 5IG7B 3SCMC 2R4SL 4D2NA 5IFJB 3B8YA 2RAMA 4FXKA 3IFOA 5GGVY 3OR7B 3C5ZB 1FH5H 4OIIH 2CH8A 4E5XB 1VFAA 3GMMA 2VLJB 3HE6C 1Q38A 4WI5A 2W91A 2HLAB 3L95A 4NC0B 1NGWA 4ORGB 1MHEB 2PETA 3BZ4B 1CL7H 4G8GA 4P0DA 5FYKL 3L5HA 5IJVA 3FJTA 5JOEA 2DLGA 4X5XA 4KJQC 4P23B 4GOSA 1JGEA 2RCSL 2D7PA 3FZUC 4OGYL 1CFBA 3DIFA 3K7UA 1TVHB 3WFCH 4D9RE 3QZWB 1F3JA 4L8BA 1NCBL 3Q1SL 1KIQB 4U1HA 3JWOC 3LQMA 4NJAH 3MBXL 3SCMB 4HK0B 3HAEG 4ETYA 2CO7B 1YNTA 4UNTA 5GS1A 3AREA 1XGRB 2X89D 2IAMD 5CJXC 2V2TB 1BZ7B 1PAMA 1ZLWK 1D5XA 2AJZA 1KIPA 1RJLA 5FUCE 2V5MA 2JK5B 5J57B 4D9LH 5CWSA 1I9JH 2CRZA 2H1PL 2BNQD 3K80A 3B5TA 3ILQD 4DQOL 2FX8H 2CUHA 4FFWD 3PHQB 2D0GA 5I0ZA 4G8EA 3GMLB 3HCVA 3M8OL 4OCSL 4UTAH 1EO5A 1JPFB 5DQJA 5BXFA 4RMRA 3U9UB 2HKHL 3C08L 3BP7A 4UNUA 3L7FB 1LP9B 3B9EA 4LSTL 4GW4A 3K3QA 3BHBA 3UEZA 1CQKA 4QHNB 2D0HA 4U1LB 1E28B 3A67L 2Z91B 4ZO8A 4PRPE 4F7EB 2I27N 1GL4B 2DN7A 1NMBL 1KYOJ 1MCCA 5EU4A 3PHOA 2AKRA 3QEQA 5MEOB 1ZHNA 5EZIL 2NY4D 2AEQH 1P69B 3GMOB 4L3EE 4GG8B 3SJVD 2EZ0D 2CD0A 3ZKSD 3ARDA 1CD1A 3EJYD 2C4FT 3ZE0F 4W68A 4JZOA 4XWGL 3OKOB 2IAMC 3FN0H 4BQ6A 5E6ID 1UKSA 2GY5A 5D9SA 2EYRA 5F6IC 3U46B 4RDQF 1OGAA 3BWAA 4LEXL 3W0WA 5IESH 2BMKB 5JXED 2X4TA 4MCZB 5FUZH 5BOPA 4FFWC 1FL6B 1KBGH 2PYFB 4MSWA 5E24E 1A4JA 3EJZC 1R3HB 2A9NL 2YUWA 1GGIH 5IWLC 3FHAA 4X9BA 1U8IA 3PWVB 5FK9A 1LO0L 3S5LG 3PP3K 3PUCA 5EWIL 1QSEA 2CDFB 2WWKT 4XCFL 4R0LB 3QXDB 1JK8B 1G9MH 2YKLH 3OL2A 1RIUL 4JRWA 4AEFA 1WVZA 1IGCL 1VCAA 1YEFH 2FB4L 3BN9D 3RQ3A 2A74B 4RMTA 2XWTA 3UPCA 3U7YH 4ONOA 2IAMB 4F7TA 5F6IB 3X11A 2NY4C 3WS3B 5JQHC 3OB0K 1GHFH 4CU8A 3LZFH 3QIUA 2FYYB 2A6DB 4XHJC 2J8OA 4CU7A 1MCRA 1FLTX 1MCPL 1QTYT 3IFLL 2OL3A 3IDIB 1DUYB 4O5LH 1OD7A 3K1KC 5CAYB 1MEXH 35C8L 1CD8A 5KN5A 5JXEC 4Q2ZA 1T04A 1ADQA 1A14L 2AJXL 4N5UA 1F6AA 2NY5H 2HG5A 1TVDA 4POUB 3QXAA 1HE7A 2G2RA 4FTVB 4JHBA 4P46D 2A6JB 5EOTA 4EKXA 2R4SH 4PGDA 3MA9L 1R5VA 4GLRH 5LBSL 3GBNH 2XI9A 2XY2A 4URTB 1EZVX 2NY4B 5AAWA 2OR9L 1DSFL 2DKSA 2IPKB 3DBXA 3SJVB 3LHPL 2FO4A 3WFBL 4EBQL 2BVQA 3IRPX 3CFIC 1BM3L 2YUXA 4MQTB 5AWNH 3KAAA 4HGWB 4NQSB 4OAWB 3WL9A 3RWFA 3NFNB 5FYKH 3QQ3B 1NUGA 1J12A 1WWAX 2DI9A 2UZXB 4DFHA 1AQDA 3KPRD 4UUJB 3DYMA 2DTSA 2R2HB 2RCSH 4OGYH 5C08E 3L1OL 5KVEL 1K8DB 3VFMA 1TTUA 4GW5B 3O41B 1NCBH 2OTWA 3Q1SH 4I18C 3SE4C 5IEHA 3RU8L 1QFUL 5IP4A 4V1DA 4M8QA 2D31B 4EN3D 4CNIB 3KLAB 1E6OL 5KTEL 1EIBA 4Z7UB 4XCYA 3RWDB 1GOGA 2H1PH 1LK2B 2OXGA 1XCQA 2BVEA 4K9EL 5JTWA 3P3YA 1G7PA 3EOTL 4UQ3B 4ODXB 3U2SA 4OCSH 3M8OH 1H8SA 4H1LB 1BD2E 5DYOA 2HKHH 2CLRA 3C08H 3UZEA 1U3ZA 3UTSE 2DKMA 1W72A 1TZHB 3PGCA 4LSTH 1MCHA 4YHPB 2D4FA 3F58L 5SX5H 4I18B 1DBML 3JTSA 1UXSB 2P43B 3V6BR 3G6JE 4PGEA 1UB5A 2Y1VA 4ZFZB 1NMBH 1MCJA 3EGSA 3E6HA 3MUGA 1WQVT 1KJMB 3DYOA 4JKPL 2R0LL 4X9GA 5EZIH 5I1GL 1X9QA 1JGVH 2CIIB 3QUYC 3AC0A 3T0AA 4HLJA 4LPVA 5IVXF 3ISWA 4XWGH 4CDHA 4GRLA 1CT8B 3BXNA 2R1WB 3AS0A 3FQRB 1HH9B 4N8VA 3H42L 3MCLL 4LEXH 5EBGA 3RHWK 4WHCA 4PY8I 3VD4A 3V0VB 2XWJA 2HT3C 2H2PD 3BPCA 1CDCA 3H9SD 4LAJH 5JLZA 2KUTA 4UIKH 3K8LA 1BBDL 4ZUVB 4KPHL 3REWA 1LHZA 2J88L 5DRXB 3L5JA 2QHLA 2NXZD 1T89A 1WAAA 1KELL 1ZA3B 4CVXA 3PWPE 5E08L 1UXWA 2HTLD 3KPRB 1LO0H 5C1MB 2GW5A 1XF5A 4UDUA 5EWIH 5IB3B 4XCFH 3MJ9A 5FO8B 2HRPL 1LE9A 4PJEF 3QUYB 4GQPH 1ACZA 4ZOAA 5F8QC 2HJFA 1A47A 5D1XA 3UYPA 4NQVB 1RIUH 1IGCH 5DJYB 2FB4H 4G6ML 4APQC 2IQAA 4MNHA 1AR1C 3MGTB 5JMOC 5E8OB 3V6ZB 5IMLB 4JRYD 5IW1A 3EJJX 4PJ8D 1UACL 2IG2L 1OPGL 2R0ZL 2J8UE 5E7FA 1MCPH 5HGAA 3D69A 1WZMA 3IFLH 3HAEH 4HKBA 3VGEA 5D5MA 3GIVA 4KRLB 3NN8B 5JO5A 4ELKA 1G7HA 1ED3A 3EO9L 4HKJB 5IF0B 4Z77A 4M61B 35C8H 4AM0B 1XH3A 4MDIB 5DD5L 2FO1A 2AJXH 2WUBL 1A14H 4HAFA 4FP8L 4HKXB 3TT1L 2H2PC 2J5LC 2G9HB 4WI9A 2PXYC 4YZFE 1GOHA 2NXZC 1E4XI 2RIKA 3L9RA 5FO7A 4APQB 4KRMB 1I75A 5F9AC 1HK6A 5JNYB 4MXQC 2HTLC 3MA9H 4LSUL 3T3ME 5LBSH 4QCIA 1B6UA 3VWKA 1W8OA 4X4YB 5CZKA 5IV2B 2GTZB 2OR9H 3DX9B 4I9WD 4PPTA 3NIGF 4E41A 3LHPH 3RWIA 3WFBH 4EBQH 5A43C 1DE4B 1BM3H 4RISL 3VE0A 4BQBA 5DK2B 1Q94A 1XR9B 3RNQB 3KLHD 5J12C 5FB8A 5D1ZD 2XT1B 1S8DA 1F2QA 1WFTA 2C4FU 3L1OH 5KVEH 3TESA 2I07B 2MKLC 5DDHA 2J5LB 3H9SB 2NX5A 5IB1B 3TNMB 4G8IA 3O6FD 3TN0D 1ZT7B 2PXYB 3I6KB 1YEJL 2NXZB 3RU8H 1QFUH 5J7CC 4V2CB 4YHIB 3PXHA 4CVZA 3EOYG 4OD2B 3RL2B 2K9UA 1E6OH 4F7PB 5KTEH 1S7WB 4NCC2 1CTOA 4LGPB 1CFSA 5EUKA 3QUXA 2EICA 3VRJB 3IGAB 5GIRA 4EZMA 2Y36L 4K9EH 4JFEE 1P84K 5FF6A 2EIDA 1T2XA 1E4XL 1I4FB 4L4TA 4UT7L 3EOTH 1CCZA 5J12B 1G7MA 5FCUL 4C58B 1MIML 2VQ1A 4JRYB 5EIQA 1R5IB 3NZ8A 3MCKB 4HJGA 5AD0A 2WW8A 2FL5B 1BWMA 4DOHE 5EU6D 3BW9A 3IS0X 4D0DA 2D9CA 3F58H 4AIOA 1DBMH 3KWWA 3MRLA 5HJ3A 1JNJA 3CLEL 4MNQD 3FONB 4WI4A 5D72L 4KK8D 5D1ZC 1C5DA 4NQCB 5C71A 2G75B 1I85C 2XKNA 1MI5D 4JKPH 5DHVB 4JFOB 2R0LH 5I1GH 4P3DA 1WWCA 5EUOB 3ILPA 4WGWB 3WNPA 3O6FC 3TN0C 4WFFE 1PZ5B 1LEKB 3MLTA 5D1QD 1RZKC 3KPOA 4PR5A 1JZ5A 5DJ6B 2XXCB 4Y1AA 3H42H 4JFXB 5ESAA 3MCLH 1VGKA 1GGUA 1NQBA 1YUHA 4JQXA 2X4UB 5JZ7D 1BBDH 2RGSA 4KPHH 3WJJC 2J88H 1KT2A 2Z4QA 3O2WL 1KELH 1ZLVK 1YYML 1JWUB 5CBAB 5E08H 2GSGB 2L7JA 1E0OB 5D1ZB 3C6LD 5ANMB 4MQXC 2EDTA 5EO1A 4O2FA 2WNGA 3JBG7 3DPBA 5HHVL 4E42A 3O6FB 5TF1L 3TN0B 4OFYA 1IKFL 1A1OB 2HTKD 3KPPA 4QRUA 4G6MH 1WZLA 1P4IL 2ZCKL 5SWZD 3MV8E 3OR6A 2GJ6E 5A16A 3BISA 2O61A 3DUSB 1UACH 2ZUYA 4MA8L 4FN0A 5GGRA 2IG2H 1OPGH 2R0ZH 5AG8A 4KROD 2FJGB 5HYIA 1QQDB 5D1QC 2NY6D 4J3UA 2VAJA 1JWMB 4LCUB 5I8KL 3EO9H 3LQZA 4U7SA 3HR6A 4HV8B 2VLKD 2DICA 1YEEL 3L3JB 3X3GL 5DD5H 5EU6B 2WUBH 2G5BB 4FP8H 3TT1H 1Z9LA 2BY3A 3CU7A 1J8HA 4CJ1A 3D39D 3GK8L 4QRPA 3BIKB 3SGKA 3SQBA 3J7HA 4EVNA 1JF6A 4A2LA 4UDTA 1F6FB 4LSUH 3VFWB 3C6LC 3EYOA 1MI5B 2JJUA 3Q48A 2H9GA 4ETQB 4PJDA 5D2NC 3B9AA 4PJBE 1FO0B 3S3JA 1WSST 2DYPA 4XAWL 5C0JB 1BFVL 4ELMF 4RISH 4MZ2A 5D1QB 3KNBB 4Y19E 5CEZE 1QYGL 5IEKB 1SJEB 2X4QA 5T1LA 2EYSB 3UJIL 2X4RA 5BS0D 2VL5B 3ESVF 3MJGX 4DKAA 1SY6A 4OZIA 3OGCB 3ALWA 1S7XB 1YPZE 4YBQD 5KVMC 1EJOL 3KDMB 1CYGA 2ITDB 4FS0A 4HMDA 1YEJH 2GJJA 4OLXL 3ARUA 4KAQH 4Z7WB 5ENWA 3G9AB 5DJXA 1B2WL 2ICWJ 5GGSA 3C6LB 4GH7B 5CD3B 3DO7B 2YD5A 4YWGL 1BWWA 2DQJL 1BQSA 5D2NB 3WDJA 5HHOD 4X0KA 3GBLA 1KIUA 2Y36H 2K7PA 5F72S 1BAFL 3FAWA 4JFQB 1E4XH 1PG7W 1QSFD 4UT7H 4LCYA 2DQUL 4GRWE 3C6SA 5SWZB 5FCUH 1MIMH 1T6VN 5DRZB 1KTRL 4Y4KA 3QUML 4FQHA 2QL1A 1QLFB 4U6HA 4GRMA 2AK4B 5KSBE 3CLEH 2HWZL 2OSLA 5DJ0B 1IBGL 5D72H 2OLDA 1F2XK 2PW2B 5ERWB 1SQ2N 1CVSC 4YBQC 2BOBB 5JA8B 2VR9A 1HI6A 3D39B 4G9FA 4M4PA 4HWZB 5D96B 1DDHB 1Z5LA 1MCFA 2HRLA 1X6NA 1MLBB 2PW1A 1BQHA 3VDAA 1ZANL 3BEVA 4JFFD 2XXMB 1C16A 4LPXA 2BNRA 3BYTA 3ROLA 1CZ8L 1BPVA 2JJTA 1RV6X 5IUSA 5FXCH 1MCDA 3VGBA 3MRMA 3IU3B 4XNYL 2YBRA 1NJ9B 3O2WH 4TVPE 1S9KC 1YYMH 25C8L 4GXUM 4O51B 4JREC 1NUDA 5B38B 4QY8B 1MH5B 4XVUD 4PJ5D 4PJGB 8FABB 1ETZB 3PQYA 4P9ML 5E8PA 5HHVH 4OUUA 5TF1H 2GTWA 1IKFH 1J1PL 3MRCB 3QFDA 3OKDB 3WFHA 5JPNA 1P4IH 2ZCKH 4OM0L 5LJYH 4X6DA 4F7MA 5HDBF 2BSSB 1JHLL 3V5KB 5F93C 3ZT5A 2FSEA 4MA8H 5HHOB 1D5MA 2Y23A 2YPKB 1FFNB 3NPZB 2VE6B 1QSFB 4X8JA 4HDIA 2UZIL 3KXFD 5I8KH 1QHOA 3BGMA 1Y6NR 2OZ4H 4JREB 1MFBL 5J9PA 2X4SB 3DVGB 1YEEH 3X3GH 4YDVA 5DJZA 4NC1C 2MMXA 2BOCB 2F53B 3RHWF 2ED8A 3TNNB 3SN6N 1I8IA 3WUWB 1S5IL 5F70A 1U8LB 1AE6L 2Y25A 3GK8H 5T1MA 2EKSA 4H5SA 4P2OA 4OQTA 1G6RL 1RHHB 2DQTL 4S0TD 5CSZA 2COQA 2FEEI 4QWWC 1R3JA 5DK0A 4NQUA 4XVUC 2AJ3A 2CR3A 1BIHA 3HE7C 4OZHE 4QRRE 4XAWH 1BFVH 3ULSB 1QPXA 1F00I 1N59B 4NKDA 3SKOB 1QYGH 1QG3A 1S7QB 4JFFB 2P4AB 1RZGA 3UJIH 3D9AL 3F5WB 3N85L 2QADD 4OI7A 3SE3A 5L88L 1G9MC 5DD1L 1EJOH 3QXWA 1MJJB 4BZ1L 1FZKA 4OLXH 4MQ7B 4EI6B 4R7DA 3VXMA 1OVZA 3LKQA 1T3FA 1YYLL 4PGBA 5ICZA 4CMMA 1B2WH 3KPLA 3B6SA 2DM2A 2VABB 3T09A 3HS0B 4YWGH 1OM3H 3GSVA 3O9WD 4PJ5B 5D2LE 2DQJH 3HE7B 3D3VA 1I3GL 4HBCL 1O0VA 5LXGL 2EDXA 4GUPA 1BAFH 2R8SL 4Q9QL 5ABDE 1FV1A 3FO2B 5B39B 2DQUH 2FEEL 5I1LB 5EO9A 4PG9B 3PJSA 5DC0A 1R3KA 2MTPA 5C0AE 2WBKA 2NW3A 3ZZ1A 2NY5C 3QUMH 2FX7L 3W39B 1F3DH 3MOBL 5B3NA 5BZWB 4JDZB 2AXFB 1Y18A 4BKLA 4JO4L 3BPLC 5TJWK 4WFEE 1FLRL 3CJJA 5K59F 4N8CL 1P53A 2UWEE 3UTQB 1EERB 3VDBA 5FKAA 1G9EA 2HWZH 1IBGH 2CSPA 3IDJB 1FVDA 1UADC 2JF1A 2QADC 3T2PA 1CXIA 4NIKB 2P45B 3OHXB 4Z5RA 4WU7B 2X2YA 3N1PC 3TH2T 2VTFA 4ISVB 4QOKA 4DK3A 5HHPA 1IGJA 5FKPB 4ZOCA 1IQDB 4JRXD 5M95B 1ZANH 1WIPA 3VGHA 2NY2C 5E9DB 1RJZB 1CZ8H 1JL8A 3KPQA 5E94A 3BPLB 5EZJA 3VMNA 1F3DJ 3DARA 1H0DB 1OL0A 1ZE3C 3ELAT 4F3FB 3RWJB 2FHBA 2IALB 1E27B 2JJSC 5FAAA 4XNYH 1NFDE 2ERJC 3MRRB 1MUJA 4QYOB 4ACPA 25C8H 4PJDF 2QADB 3M07A 3AB0C 1S7SB 3QISA 3O3BA 4P9MH 2CDGA 3A0OA 3F7YA 2YHGA 3VDCA 1J1PH 4PV9A 2C1OB 4U6XB 3IXAA 2Z92A 5DJDA 4OM0H 5IMMB 2NY2B 1JHLH 4RIRA 3BYYA 1I1YA 3T1WA 1I8LC 3B83A 4U33A 4XRCB 5C09E 2I9LA 1MCQA 3BP5B 4FXGB 4HIHB 2ERJB 2UZIH 3CZFB 3ES6B 4F33A 3EOAB 1MFBH 3NCYP 2P5EE 5H35B 3DTXB 4XP1L 3AB0B 1VADB 3HNVL 4MMZC 2ZUUA 2Q6WB 3L3OB 5B3JE 2PR4L 5MENE 3DLQR 5H94B 3IVKA 4RGNE 1S5IH 1AE6H 3M17A 3V6FA 2R0WL 5HYJD 3MGOB 5GZND 1CGSL 1RY7B 1G6RH 2DQTH 3QH3A 4U2ZA 1FYTD 2CK0L 3EYFA 5EC2B 1KPVB 3UROR 1YQ2A 2VLME 3SDXB 2CLVA 5E99L 4KI5E 3MLXL 2MOVA 4EEEA 4NO0A 2DL2A 3GSQA 3RPIA 3BGFC 4FFVD 3QQ9D 4U1MA 3U0WL 3FQWA 5HHQA 4NQDD 1DEEA 4Q97A 5HDQL 4JRXB 1A7NL 5JXAL 4P99A 3CDFA 3RZWA 3D9AH 3N85H 5IW6A 2AERT 4TTGA 5L88H 5DD1H 4BZ2L 4Z0BL 1JV5A 3VU2A 4UMGA 3AXLA 2DI7A 4NHUA 4UI2A 4BZ1H 4DZBA 1I1FA 2IQ9L 2YS4A 5FFLA 3TP4A 1YYLH 4MJ5A 5DJ2B 2XZAL 4FHBD 3MOQA 5HSFA 4P2QB 3MJ9L 3DURA 1I1AC 1F90L 2MJWA 3BGFB 4TQEH 2CO6B 1I3GH 5ETUB 2Y7QB 5H37H 3RJQB 1M05A 2HN7B 4HBCH 5LXGH 4BFIA 1JVKA 2R8SH 4Y5XA 4Q9QH 5GRWA 5ITBH 3C8KB 4I13B 3VXRA 3QEHB 3VXUD 4YAQA 2X40A 4U1SB 3OKKB 1H5BA 5HPMA 4X6EA 5TE7L 2Z8WC 3NACL