4M5ZL

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
SYVLTQPPSVSVAPGETARISCGGNNIGTKVLHWYQQTPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDISTDQAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
molecule keywords Hemagglutinin HA1 chain
molecule tags Viral protein/immune system
source organism Influenza a virus
total genus 42
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zL01
3DBXA 2ZKHH 4PLNC 1A6TB 2RB8A 3IDJB 1CICA 4OM0H 5IOPB 5J1AB 1A3RL 3EFFA 3O3DA 4PRBA 5C86A 5IFJA 1MCOH 3FB6B 4XVUC 1FRGL 1T20A 1KSRA 1LO0L 1W0WB 4G6AD 4JREC 2R56L 3RVVD 5GZND 1HHHA 5IWLC 2H41A 4WFHD 3TJEH 4LHJB 4N8CH 1NPUA 2AJZB 5E1HB 4ZUVB 1TDQA 2EYTB 2X4OA 2YD9A 2IALA 2IPTL 4HQQH 3PL6B 3VA2C 4FTVA 4P9HH 3OV6A 5AYQA 3Q3GA 5GIRA 4YQXL 2DIBA 5HDBE 4NO3A 5D7SH 2P5WA 2WIIA 4Q97A 4Y1AB 5JHLL 4GO6B 3DSFL 5HGHB 2Q76A 3BSZH 4WEBL 3T4AB 5LJYH 3TVMD 4JGJA 3P9MA 2GCYB 4Y2DB 5FV1L 2UZYB 4UBDC 1G6VK 5C0CE 4RAVA 4HK3J 5E8PA 2F58H 1YJDL 3LHPH 1MPAL 2I60H 2Q8AH 5D1XD 3C08H 1UWEH 4R4FL 1H3WM 4X80L 2WP3O 4P2QA 4JFDE 3UTPE 1P4IH 2P44B 3CK0L 3AREC 4XT1C 3NPSC 3HE7D 4XRCA 1QFOA 2NXYD 3OHXA 1CDUA 4KUCD 1Q0XL 3KJ4B 2OR7A 2OX5A 3UO1L 4FZEL 3VWKB 2NLJB 1PG7L 3VFMB 5T3XL 1IM3A 1HXMB 1DLFL 5T33H 4UV7H 4Y4HB 5I30L 4PY8J 5B4MD 3QCVH 4JZJA 3M45A 1D6EA 1LEKB 3VFVA 1U8HB 3HNSL 5IKCA 3W5NA 3MV8D 1UXWA 4N0CD 4ODSH 3RNKA 3OAYK 5B3JF 3MFFB 5T1DL 5H8DA 5EU6D 1MF2L 4LP4A 3TA3D 1HZHH 1RZJL 1F4AA 3QISA 3ULVL 4EIZC 4XAWH 5FV2A 3MA7B 1KPUB 3C09B 4CADB 1YQVL 4F7EA 3ETBF 4YEFA 4L8DA 3TIDA 1A1NB 2VDNL 3MROB 3PXJA 4LSPH 3TZVA 4Y1AE 3GIVB 2A1WL 4GAGH 2ERJB 4QT5B 4PYHA 2XZAH 3KHQA 3RNQB 3ZYIA 3L5JA 1SEQH 4GLRH 5L2JA 1EFXB 1AR1D 4WW2A 1A7PH 1U8KB 4L3ED 4J3SA 3MJ8A 3FHAA 5AAMA 4YIQB 1U3ZA 2D7TL 1XGPB 5INCB 4Y7MA 5ITFA 2R1XA 3BKJH 5DJDA 4ZD3L 4D0BB 4WCYL 1MSPA 1QBML 4RDQF 5ESQB 3S36H 1OSZA 4Y4KB 4ZUWA 3DJ9A 4R4BB 3HMWL 4LLMA 4Y19B 2DDQL 5ACLA 1PQZA 1Z9MA 5DVLA 3BD5A 5ERWA 5LQBL 5L88H 2HJKA 1FNSH 3OKLA 1HOCB 4NNXA 3K4AA 3L3GA 3MUY1 3SGDH 1T89A 1MUJB 1U58A 1B0RA 4BM7A 1NL0L 3BHBA 3MOBH 5EZOL 1A6TA 1A6PA 4L4TE 5IOPA 5J1AA 3S4SB 1MJ8L 1VSCA 3ARXA 3PF2A 3L95B 5IJVB 4U49A 2UUDK 5TDPB 3U7AA 5D5MF 4XC3H 2RCSH 3K2UH 2YPLE 1UH4A 1F42A 1Y6KR 4P4KB 4L8CA 3MNWA 5IVXB 5HJ3B 2HJFB 2YUZA 4DKFH 3QQNA 4X7FC 1MCBA 1P4LB 5GRUH 2VDRL 4G8EB 5CD5D 2AJZA 4M7LL 1B2WH 1DQQB 1QD0A 5GGVY 2EYTA 4M6ML 1O7VA 3PL6A 2DD8H 1UM5L 4TTGA 3F7PC 4QO1A 4I48B 3FRUA 1YEFH 3S96A 5K9JH 1YN6A 1L6ZA 5D7IF 5J8OA 2OMNA 5CS7A 1QFHA 1YJDC 2EE6A 5E6IB 5A3ID 2PW2A 4BH8A 5EIIA 3OPZH 1PX3A 2EYSB 4Y19E 1EHLH 3BW9B 3CH8A 5B38A 2GCYA 4Y2DA 2BNQA 3D3VA 4PJ5E 4MXWH 1I4FB 3VXRB 4U1SB 2C1PB 4P4RB 4KQ4H 3OF6A 4KI5C 2VAJA 4W6XB 1BZ7B 5EC1B 5EIQA 2HTKD 3BD3A 4KRLB 3CFDB 1WZ1H 1KEML 1N0XH 1OAXH 1NC4B 2KQNA 3S97C 4GRLC 4LIQL 2WBKA 4HWUA 3LB6D 5TE4H 1KULA 3VWKA 4WWKD 2NLJA 2DQEH 4QCIB 3VFMA 2PYEB 1HXMA 2R4RL 1RZJC 4WUKL 1T0MB 1FC2D 1QFUH 3RY5A 4MMXC 1FBIL 1MFCH 4JFED 4TNWF 1LEKA 3V4PL 1YY9D 1X5YA 2E9BA 4BUHA 4Z77B 4M00A 3SKJH 4H8WL 4MWFA 4HMDA 3MFFA 1CR9H 4ZUUA 3BE1L 3WDHA 4G8IB 1FZJB 3RVUC 3V7AG 3RDTB 1H5BC 4KV5E 4X5XA 1Z2KA 2V2TB 4JG0L 1K6QL 3KPOB 3TYFA 4QRQA 1KPUA 3ZDZF 4CNIB 3NTCL 4OT1H 2YXFA 2BNUB 1AI1H 2FLBT 3MROA 3KLSA 1XF5A 3GIVA 2HTLC 3IF1B 1M7DB 4NQED 3RNQA 5TF0A 3G9AB 4HUKB 1EFXA 3GI9H 4D9RD 4M7JL 2XWTB 4UT9H 3QWRA 1INDL 2XXMB 4YIQA 4JQVA 5INCA 1XGPA 3VXRE 1AH1A 4D8PB 4OI9A 4HJ0D 4J3XA 1D9KC 4D0BA 3SE8H 1KTKE 1OHQA 4NFBA 1NSNH 4XVSL 5ESQA 1A3LH 1AXSB 1ZT1B 4LCCC 5IBTL 2Y36L 1W8NA 4R4BA 1XZ0B 1KLFA 3MFGB 3ARDC 5BRZB 4KROD 4Y19A 2HLFC 1NAKL 1LO4L 3I6LD 5HYJB 4OLUL 3SE3A 1MAKA 3V2AR 2MPAH 2WP3T 2OTWB 5HVHB 1HOCA 1EGJL 2ESVB 3O8XC 1BQLL 4QRUB 2J4WL 1LQSR 4F15C 1OD9A 3QUXB 2N1KA 2OCFD 2W60B 4Y8AA 2UVEA 1MUJA 1PSKL 2BHZA 2QTEA 2YD4A 3PP3K 3EZ8A 2CK0H 2YWYA 1N5AB 5AYUH 2HT3D 5CCKH 3W82A 4XMLH 1PGRB 3MUZ1 4KKBC 4HS8H 4QKXB 2NZIA 5JW4Q 3S4SA 4FQXC 2AJVL 1DUYB 1I85C 3L95A 5IJVA 4D94A 5TDPA 5CEYA 4PB9H 1JPSH 1U41A 4HAFA 4D9LH 4Z7WB 4JVPA 1CT8B 1WZKA 5DD6B 4E41B 1S5HB 5I1HH 4P4KA 4M93C 4TN9A 1CQKA 5IVXA 5HJ3A 4MDIA 2LU4A 4XNUL 1QFWL 5C1MB 1U3HA 4G8EA 3HI6L 1DQQA 1N59A 3HS0B 4F9LC 1IQWL 4G5ZH 1XR8A 4ODXB 2CGRH 1OQOA 2A74B 4JREB 4TUJB 5FEBA 3CFKB 2WINB 1MHCB 2ED7A 1K9TA 1RUAH 3B9EA 2GTZA 1TJGL 3BEVB 2BVOB 4RNRA 5GRWA 3T3MF 1X6NA 1CGVA 1RJYA 4ZFFB 5FCSH 1IGJB 1WZLA 3PQYD 4DGYH 5HYJE 3BW9A 4IRZL 2V5TA 2GI7A 2ZKHL 1RZ7H 4OM0L 5DJAA 3W0WB 3D85D 5E1AB 1I4FA 1T3FB 2ESVE 4NNYB 3VXRA 2BMKB 4U1SA 4DGIH 1CLZH 2C1PA 1MCOL 4YXHH 4HF5H 5C07B 3IDIB 2R0WH 2AP2A 4EN3D 1II4E 1BZ7A 5K9KB 1JNNL 3KLHD 1NFDF 4MAYC 5FFLA 1YA5A 3CFDA 1ODAA 2JF1A 2VERN 1NC4A 4N8CL 1LO2H 5T5NF 1V3MA 3NZ8A 4HQQL 4QCIA 2PYEA 4P5TB 1DJSA 4P9HL 5C6PB 1T0MA 2R1YB 4E41E 1J0YA 4WUUD 5A2KH 1VADB 4Y0GA 2H9GA 4PJXE 4Z77A 5JZ7D 1VFBB 4RSVA 1ORSB 5D7SL 4CN6A 3BSZL 4G8IA 1FZJA 4PJCF 5CAYB 3MCLH 3RDTA 1C5DA 3VMOA 2V2TA 3KPOA 1T66D 5DHVB 4W6WB 4QHLB 2ZCHH 3LHPL 2I60L 5BZWB 3MUHL 2Q8AL 4XXDB 1OW0C 1AFVH 3C08L 5EORH 1UWEL 4BSJA 3ARVA 3RIFK 4LKXB 1P4IL 2VLJB 4L8SA 1QSFD 2XWTA 5M95B 5IHUH 4EZMA 4YX2H 3BEWB 5C2UB 3BMVA 3W0WE 3KJ6H 2GHWB 4D8PA 5KZCB 3TF7C 2QR0A 2DQDH 5C07E 4GQ9H 2F5BH 4UV7L 1AXSA 2ATKB 4OD2B 1ZT1A 3VXUD 3QCVL 3O9WC 1IZJA 1XZ0A 5BRZA 4MJIA 1ED3B 4ODSL 5I15L 3TT1H 1OTTD 4BFEA 2GQHA 2XRAH 2G75B 1HZHL 2OTWA 1BD2B 3H3PH 2ESVA 4POUB 1MCNA 4KUCF 2H2SC 1ZANH 3SCMC 3BESR 2W60A 3SQOH 1T80A 1IGTB 3B43A 2O61B 4LSPL 3A67H 3FZUC 5GSVA 1JBJA 1N5AA 4GAGL 5L2KB 3MUGB 2XZAL 1SEQL 5DHYB 2X41A 4KVCH 1CZ8H 1A7PL 4WY7H 2QSCH 4IDLA 4YDKH 1DUYA 2OM5A 4C56B 1T7ZA 3OKKB 3L3OA 4Z7WA 1CT8A 2FGZA 5DD6A 4E41A 3BKJL 3BFOA 4JDZB 1OSPL 4HKBB 3S36L 1S7RB 3DGCR 3C5SB 2VIRB 3PHSA 4QXUH 4ZNEE 3HS0A 2VLJE 2W07A 2LVCA 3STZB 5B38G 4MA3A 4Z0BL 5JXAH 4ODXA 4OQTH 2A74A 5L88L 4TUJA 2WINA 1YNTB 1FNSL 4M03A 5AD0B 3MLYH 1KB9K 3OX8B 1HCVA 1MEXH 2BVOA 4V1DB 2VC2H 2BSSB 1OGAB 4R97B 3GJFB 1IGJA 4NPYA 4PJAF 3SDAC 5CKAA 5ESAB 3MOBL 1AC6A 3F7VB 3HPLB 3TN0D 1X5IA 5E1AA 1T3FA 4X99B 4NNYA 4P46C 2BMKA 4Z7QE 2PF6A 2BCKB 3WEXB 2EXYD 4XC3L 3FQUB 5D7LB 5C07A 4FFVC 2RCSL 3IDIA 3K2UL 3ZE1F 5EFIB 5K9KA 4JFXB 1JWUB 4PGJA 2CIKB 2ZCLH 3MJ7B 4DKFL 5L2KE 2NX5A 3RY6A 1VKXB 2FNBA 2UYLB 5GRUL 1CD8A 1B2WL 4UIKH 5IMKB 1EEZB 3HTLX 2DD8L 3W11C 1RHFA 4P5TA 1GAFH 2R1YA 4NN6C 4YHMH 1YEFL 1VADA 3TC9A 1CDCA 3UTZB 5DJ0B 3ZT6A 3WYRA 3DUUB 3I02A 3F7RA 4LF3B 4O2EB 1ORSA 4GRLB 3MBEC 3T0ED 1FDLH 4ZXBB 3KPSD 1QBAA 1VHPA 4M3KB 3K81A 3OPZL 1UZ6E 3MCG1 1EHLL 4R0LB 4DOHB 3TO4D 2VZTA 3LY6A 2PXYB 1U36A 3OGCA 5C6WH 4YDVA 5DHVA 1MELA 4PRPB 4RA3A 4H0IA 3DTXB 4TSCH 4OLWH 4KQ4L 4V1DE 5BZWA 5IHLB 1OGAE 5GGUB 1AO7B 4P5MA 2EZ0C 3FRPA 1NLBH 4S1DD 4OLEA 3W9DA 1WZ1L 1P69B 3EFDH 4LKXA 5IM7B 2VLJA 1N0XL 4OSUH 1OAXL 1YNLH 3PDOB 3BEWA 1DSFH 4K7PH 5TE4L 3KR3H 1CGWA 3SEPA 4U3CA 4QRRD 2DQEL 2EE3A 2E9JA 5BV7C 1I8MB 5D7LE 2DM4A 1QFUL 2ATKA 1F2QA 2ATPB 3NAAH 4DZ8A 1MFCL 1ACYH 1WTGT 2O5YL 3K4ZA 3FQXB 1QZ1A 3BVNB 4I77H 3SKJL 4ETYA 4NN7B 1CR9L 4YHPB 3KYAA 1A64A 1BD2A 3S4SG 2NY4D 3ZYJA 4LCCB 4X6CB 4PV8B 4OT1L 2XA3A 3ARDB 1IGTA 5BQ7B 4ZQKA 3CVIH 5L2KA 3MUGA 4K23H 1EVTC 5CJQH 4LQ1A 5DHYA 5JA8B 5F1SA 3GI9L 1WC7A 5GRXG 3O8XB 4UT9L 4F15B 4C56A 2PUQT 3V6FB 3G6JB 3OKKA 4GBXD 4PRPE 1Z9LA 4HLJA 3G6AB 3UBXB 5EA0L 3SE8L 1LO3H 3EGSB 2JB6B 2ORBH 4JDZA 5INDB 1QFWI 2YD2A 1NSNL 4HKBA 3O4LE 1HYSC 1A3LL 1AO7E 1S7RA 1ZXQA 3ILPB 4NC2B 4P2OA 4C54A 4XXCA 2ADGB 1H3GA 2VIRA 2BY0A 2X05A 4FQXB 5DEZA 1QEWB 1NGXB 2XNAB 3STZA 2I9TA 3FHQA 4WTWA 1A6WH 1FYTB 2MPAL 2PR4H 3QIWC 1FGVH 1YNTA 2EDKA 4M93B 4PRDB 4JFFD 1ADQA 3EDJA 5AD0A 3GJFH 1ERNA 1N6QH 4V1DA 3ARWA 2BSSA 3GDBA 1OGAA 3GJFA 2FX8H 3QEGH 3DECA 5AYUL 5ESAA 5ANMB 4XMLL 3F7VA 1YQ2A 1Z3GH 3AS3A 5LVEA 2BVEA 2BNRD 3WEXA 4HDIB 4PB9L 4OLYH 3FQUA 4D9LL 4U7MA 5T3ZE 1JWSB 4G8GB 5I1HL 4KRPC 1TVBB 2OTUB 4JFXA 4MXQD 1JWUA 5DRZB 4ZTOH 2CIKA 3MJ7A 4LCWE 3TT3H 4L4JA 1VKXA 2UYLA 2Y7QA 3VRLE 4YHNA 4J7RA 2A6JB 1D5XB 4CJ0A 1FNFA 5IMKA 4IRSC 1EEZA 3BZDA 3G6JE 4G5ZL 2CGRL 2XIDA 3S35H 1NCUA 1T1XA 4LVEA 4BQBA 3C6LC 1SJVA 4MAYB 3UTZA 5DJ0A 2APVA 5FYLH 1RUAL 1E0OB 1U2HA 1RUKH 3DUUA 4LF3A 2I26N 3MMEA 4O2EA 4GRLA 5IMOB 4ZXBA 4MCYB 4PRID 4U1HB 1P1ZB 4DGYL 1KCLA 1MFDH 4R0LA 2EC8A 1FYTE 4OI8A 3BWAB 4KZDH 2PXYA 2QSQA 3PGCB 3FB8B 4JR9H 1RZ7L 5IB2A 4PRPA 4IMKC 1SYSB 1AJ7H 4YXHL 4HF5L 4G6AC 4LLVB 4PV9B 3RVVC 4KUZH 5GZNC 3BIBX 1CXIA 4YZFF 1T04A 5DRNB 3F6IA 2G60H 5C9KA 1FNGB 3CSPA 4F3FB 3CJJA 5CEZH 4NRXA 4X4ZA 3RX8A 2XKSA 2ATPA 3LD8B 1WFTA 4L1DA 4LVHC 1EBAA 1I1CA 3I84A 3D0LB 3FQXA 3BVNA 4LIQE 5DD3H 3TVMC 2X5PA 5AG8A 4PG9B 4OD1L 2OJEB 1BF8A 1F6FB 5IQ9B 4UNVA 5DR5H 4LCCA 4X6CA 2P1YA 4PV8A 4U1LB 4LHUD 2ZCHL 1X4YA 4UV4H 4JO2H 5BQ7A 5D1XC 4Z7UB 5D1QB 4MYWB 1F2XK 3N9GH 3QDJD 1HINH 2HMID 1AFVL 4NHUA 5EORL 4MJ4A 3VI3F 2EDWA 5JOPE 1OP5H 5CJBA 2ITCB 3WIIH 3HE7C 4OI7A 3O8XA 2NXYC 4YX2L 3U1SH 5IHUL 2BDNH 4I3RH 3U7WH 3V6FA 2ARJB 4ZS6D 3KJ6L 3G6AA 2DQDL 3KNBA 2JB6A 1A9EB 3MX0A 4G42B 5DQJA 5INDA 4GQ9L 1QSVA 2F5BL 5B4MC 3ILPA 1QR1B 3D39B 2R1WB 2EIBA 1I1AB 3MRNB 4N0CC 3G08A 1I85A 1N0LA 3EBAA 4M7ZC 1J5OH 4KWUA 2XNAA 3OGOE 3WNNA 1ACZA 3TA3C 2XRAL 4TULH 4GXUN 1S78D 3QCUH 1XF4A 4PRDA 3H3PL 3SGDI 1WJ3A 3JWOH 1S7WB 1MJUH 4RMWA 4KH2A 4QTIH 4YHLH 1ZANL 2MQCA 4JO1H 3SQOL 2PYFB 1J8HD 3B9KD 3IYLW 5JXEA 3QEQE 3QUZA 1TZHB 3DV4B 4IS6A 3A67L 1IGCH 4KMTH 5D5MB 5ANMA 5GGSB 1TTGA 3H6JA 4Y5XC 1AR1C 1SJEA 3QDMB 4LNVA 4KVCL 1HWGB 1CZ8L 2QSCL 4YDKL 1OP3K 4UNTA 1A0QH 3VDAA 1YY8B 1MQ8A 5J12C 4HDIA 1DVFD 3VFPB 3NIFF 4G8GA 2OTUA 1MCLA 4Z7UE 5DRZA 4ZAKB 3ZE2E 2FD6H 4FXGB 4U1MB 3LIZH 3NABH 1ONQB 4QXUL 1YYMH 3ZSSA 4JG1H 1Q9KB 4X7EC 2A6JA 1D5XA 4MNQD 4P46B 5D7IB 3NH7H 4EEEA 2JIXD 5JXAL 4XNQB 1EAPB 4OQTL 4AY0A 5EBMB 1A6VH 5HY9B 5I1CH 3MLYL 2W0FB 3D39E 3N1PC 1MEXL 2VC2L 2NY1D 5IMOA 4WRLA 1DBKH 1YEKH 4MCYA 2KQMA 4XHQA 4E5XB 3DROB 3FRPG 4TPRH 1P1ZA 2ZG2A 1S8DB 3UYOD 5D93C 3CFIC 3BWAA 3PGCA 3FB8A 2FSEB 3DO7B 1U8OB 1EFQA 1SYSA 2FCBA 3KXFE 4LLVA 5LG1A 4PV9A 2VZ3A 4W4OC 1A7NH 5KS9F 2ZCLL 3SPVB 4DQOH 5CD5C 4I18A 1I9EA 1FL5B 1OAYH 4RGMC 1CGUA 1FNGA 1SQ2N 1GAFL 2FHBA 2VZVA 2DJSA 4NQCA 3X3GH 4CDHA 4YHML 1IT9H 1ZLVH 3MJGX 5I71B 1KG0B 2Q7YB 3LS4H 4YH6A 5A3IC 3QXUA 3D0LA 2CDGB 1FDLL 5D7IE 4PG9A 3QQ4B 2OJEA 1MFNA 5BV7B 4PGCB 4U1LA 1QFWM 4M62H 3PGFH 4TSCL 4OLWL 5D1QA 1ITBB 5MEND 2HTKC 2DLEA 1NLBL 4CRPA 3EFDL 2ITCA 4LQFL 4MA1C 4OSUL 1YNLL 1CF8H 3LB6C 1DSFL 1KB9J 2NTSP 4K7PL 3B83A 1MREH 3DWTA 3PWJB 2OP4H 4NRYA 4WWKC 1YECH 2DKUA 4UI2A 5DF0A 2FBJH 3D1MC 3DHJA 4YPJA 3KLAB 4Z18A 1QR1A 3NAAL 1YY9C 2EKJA 1ACYL 5GGTH 3C8DA 1I1AA 2GK0A 4JHWH 35C8H 4I77L 5GGTA 2CLRB 4Z5RB 3BP7B 5D1ZB 4JN2A 5EU7C 5FYJH 1AIFB 5L8KB 1BFSA 1S7WA 4Y5VB 1K5NB 5I2IB 2PYFA 1B0WA 4PS4H 1T83A 1TZHA 4BELD 3DV4A 1F8TH 3CVIL 5D5MA 5GGSA 2CUIA 5ETUB 4K23L 5CJQL 3QEHB 3QDMA 4P59H 2ZOKB 1ZVSB 1YY8A 1KCUH 1NMAH 1X6LA 2FX7H 3HZKB 4O4YH 4K94C 2BHUA 4P49A 5F7FA 4TSAH 1WK0A 1J18A 3SDCA 1Q0YH 1UEYA 1LO3L 4ZAKA 5D6CA 2ORBL 4JVWA 4QXGH 2AI0H 5LGHH 4X4YB 5KTEH 1IKNC 3DIFB 4U1MA 1ONQA 3JXAA 4KROC 1PVHA 1DEEA 4EDXB 1Q9KA 1U91A 1WBYA 2YD5A 4P46A 1V8HA 5D7IA 4M7KL 3QUKB 3C5ZD 3DVFA 1FSKC 4XNQA 1H3PH 1EAPA 2AERT 5EBMA 1FGVL 4Q58C 3VWJA 2DN7A 3MV9D 4JFPB 5HY9A 2W0FA 5E8EB 3IU3B 3NCJH 1N6QL 2GY7B 4M43L 3SDXF 3WUWB 4E5XA 1WT5C 1AQDB 3DROA 4IRSB 5I17A 2FX8L 2HT3C 1QPPA 3QEGL 5GRJH 1LE5B 2CRZA 3BWUC 5I18H 3MRDB 3C6LB 1Z3GL 3DO7A 2V9RA 1YDPB 4O00A 4X8XA 1U8OA 2EDBA 1LE9B 2ZZUT 1IVLA 4OLYL 1DE4A 2AKRB 1XGQB 3JVGC 4WHDA 5JIIA 1AE6H 1OAZL 2WUBH 4OTXH 3QDGD 3SGJC 4ZTOL 3TT3L 3SPVA 5EZLB 1G7PA 3DUHA 1TFHA 4DW2H 1VFMA 4X83A 3VGAC 1FL5A 2AV7B 5FYKH 4NZDA 3NCEB 1U6AH 1CXEA 4L3CA 3T1WA 3S35L 4L5FH 1GVIA 3EJJX 4GT7A 5HGGS 1MY7A 4PJCB 3E0GA 2Q7YA 3X11A 3HZVA 1RUKL 2EE9A 5CEXB 5CZKA 4FP8H 2CDGA 5F7MC 2P8LB 3QQ4A 3QUYA 3MRBB 4JRXD 4J12A 4KZDL 4NRZA 2EIEA 1QR4A 1GGBH 4LVHB 1GGCH 4PGCA 4YUEH 4P2RE 3RZCD 4EN3C 2BFVL 3KLHC 4JHAH 4UQ3A 4EI5D 4Y16A 2XQBH 3K1DA 3RJQB 1KXQE 4HMCA 5I1GH 4HWBH 4D9QD 2AABH 3NFPB 4HPYH 2G60L 3AB0B 4OLXH 3DOSA 3ESVF 4I9WD 3PWJA 4HWBA 4M9PA 4M6AA 2NW2B 4YDLC 5D1XB 5C0ND 5CEZL 3BOVA 3WL9B 5JZ7C 5D72H 3EYOB 1KIUA 3FOMA 5ENWB 3GHEH 3GSQA 2CLRA 5DD3L 5E8NB 1A22B 4H1LH 3BP7A 5GGSY 5D1ZA 3RL2B 1I7UB 1T66C 4Y5VA 1K5NA 4AIZA 5DUML 4WFHE 4PJCE 5I2IA 1MRFH 2J8HA 3PUCA 2X70B 4UOJA 4UV4L 4JO2L 3V0VB 5JMOC 3DPBA 2X4RB 5EU6B 1KJMA 3TA3B 3N9GL 1DZBA 1HINL 2O5ZH 5ETUA 3QEHA 3QWQB 2A2QT 4M61B 1JPFB 5IK3B 2OJZH 3WIIL 1ZVSA 2EDHA 3U1SL 2BDNL 4I3RL 3U7WL 7FABH 1KIRA 2V2WB 3HZKA 3D69B 3ARGD 4KAQH 4MA8H 4X4YA 4F80A 2B0SH 3DIFA 3EOBB 1ULVA 1MIEL 5MEPB 1KB5B 1U8NB 4U6HB 5IGXL 3BXNA 4N0RA 4EDXA 5HPMB 4JZOB 1OTTC 1J5OL 3QUKA 5F1NB 4Y4FB 4PP2A 3QRGH 2ICCA 3HZYA 4NZTH 3GMOB 4TULL 3QCUL 4BQ9A 3JWOL 4PJAB 1A4KB 1MJUL 4QTIL 4YHLL 2HFEB 3IU3A 4JO1L 1JNLH 5D2LF 2CH8A 3LV3B 3WUWA 5CKGA 1AQDA 4IRSA 1IGCL 4KMTL 1LE5A 1P5VA 2AJSH 4DWHA 4HAGA 1K2DB 1NFDA 1YDPA 4IJ3B 1LE9A 2D0HA 1A0QL 4YPGB 3VW3L 5F9DC 3MV8E 5FM8A 2ADFH 2AKRA 4ZO6A 3VXOB 4PLKD 4TNVK 2YC1B 5EU6E 2FD6L 4QHKI 4CMHC 2HT2D 3ILQD 1X5AA 3LIZL 3NABL 4AEIH 3HRPA 1YYML 2MHAA 4LPTA 3VE0B 4IOFD 2AV7A 4JG1L 4O2CB 4XHJD 5C09D 3NH7L 5GQBA 3QIBD 5TGBB 1OOAA 2APWA 3LN4B 2I27N 1P6FA 5EZJB 4R8WL 3BMWA 4M5ZH 3HFMH 1A6VL 3VCLA 4PJCA 4N0FB 4QRPD 4XB8A 5I1CL 1WEJH 5FGBA 1Y6NR 4L3EE 5CEXA 4JAMA 1U8LB 1DBKL 2VMFA 1YEKL 2RIKA 2EDLA 4TPRL 1T7YA 3MRBA 5K93A 3TN0C 3O41A 4J3UA 3GM8A 4RDQG 3RWIB 1MOEA 4HULB 3R06B 2CDEB 2V5RA 2EXYC 5SWSD 4ODVH 4KJPD 5IMLB 1KPRB 4IIQB 1A7NL 5I0ZA 1KCRH 3IDMB 4DQOL 1QG3A 3A6CH 4LCYB 1OAYL 4MHHG 3ZTJH 1XF1A 1INQA 3TBTA 3WL9A 5KSAA 2VDMH 3X3GL 1IT9L 5KSVA 1X5JA 2OSLB 3LS4L 3EYOA 4MA1B 3T0EC 3QBTB 1A6ZA 5ENWA 3CU7A 4PJEF 5E8NA 2OMBA 3TO4C 3AS0A 2OQJB 2NMSA 1JPGB 4BZ2H 3RL2A 2F8XC 4IMLB 3IDGB 1I7UA 1C5BL 3GMPA 4GRWF 1EA9C 2LQRA 2HWZH 3R4DA 2X70A 4M62L 3PGFL 5E2UH 3GMQB 2EC9U 1P7HL 3V0VA 2B2XH 1X5GA 3HI1B 5D96C 5TFSH 3WFDH 3QHTC 5IW1A 4S1DC 2E5EA 2H3NB 3C60B 1VESA 3RQ3A 5IK3A 2IBZX 1KLUB 3U0WH 1CF8L 4CDGC 5JOFB 4FS0A 2V2WA 2ENYA 2WWMD 1MREL 2OP4L 1EMTL 3D69A 4PJGF 3GB7B 1YECL 3QG7H 1SJXA 1P7QB 43C9A 3NFSH 3FN0H 5DGQA 1KB5H 1KIPB 4NQEB 4AEFA 4HKJB 3EOBA 5H37G 1TZIB 1SMOA 1KB5A 4OIIH 5MEPA 5GGTL 5J6GB 1V5JA 5FHAH 4U6HA 5AG9A 3LVEA 5HPMA 3GSXA 1Y18B 5IHZB 1JYVA 1C7TA 4JZOA 35C8L 2ZNXA 4Y4FA 5F1NA 1CFSB 2XG5A 2J6EA 3GMOA 1YEGH 4MB3A 3V6ZB 2NY4C 4R96B 4XBGB 5FYJL 4NCC2 1CXFA 4PJAA 2Y25A 1V3JA 2HFEA 3QUMH 1WAAF 1RK0B 4Q0XH 1F11B 3LV3A 4PS4L 1JHTB 5MHSD 4XCCH 3E2HB 1FSKB 1JGLH 1YN7A 2DWEB 1CVRA 1FV1B 1OWWA 4P59L 2P24B 1PAMA 4JFEE 1JGDB 3K1KC 4BUGA 2DI8A 4GBXC 4OF7A 2HFFB 2HG5B 1KCUL 1NMAL 2FX7L 3MV7B 4OBRA 4YPGA 5DFTA 2X4PB 4O4YL 5CHNA 5D8JH 5HHNA 1N3NB 5IBUB 3VXOA 4TSAL 2ZP0T 1MI5B 1Q0YL 2YC1A 4QXGL 5KTEL 2AI0L 4O2FA 5LGHL 3EYFB 4BKLB 1YEEH 5EU7E 4WDIB 3VE0A 5A1AA 2CRIA 2YMXH 2X1WL 3WDIA 4NT6B 5TGBA 1LEGB 5EZJA 1H3PL 5IB1A 5IBLD 2VSCA 1JI2A 4MCZB 4NQEE 2YXMA 1IGYB 3NCJL 3RIAF 4D9RE 1CBVL 3DX8B 1U8LA 3MGAA 5DMIH 2FL5B 1FH5H 5GRJL 4Z7NE 1FG9C 2VYRE 3RWIA 5I18L 2IAMB 1GCFA 3O3EB 3R06A 5L7XH 2CDEA 1VEOA 3RVTD 1KYOK 3THML 5KSUB 1QTYT 4MXQC 3I6LE 5IMLA 4IIQA 1AE6L 3DRQB 2WUBL 4OTXL 1N4XL 3ZKXC 5BW7C 3L5HA 4P5KB 4DW2L 1R5VA 1XGYH 3D85B 4LCYA 5GJTH 4OAWB 1T22B 5FYKL 5J89A 1U6AL 3MV7E 5HHOD 3U46A 4N8VB 5T1MB 4MAUH 5FCUH 4H1LG 3MXVH 4L5FL 4I0KA 4MQXD 4XPTH 8FABB 5I1IH 4NC1E 2OSLA 2IQ9H 3GI8H 2P8PB 1RUMH 4FP8L 1RV6X 3P30L 1FO0H 2C26A 1T4KB 2OQJA 3DO3A 2YPVH 4YDLB 1JPGA 3L5IA 2B1AH 3IDGA 1A7RH 3LKQB 3V5KB 1GGBL 3ZDXF 1GGCL 4WI2A 1LWRA 3VFRA 3S6CA 1OPGH 2BXZA 5JW4M 1R3KB 3ZL4H 3HI1A 2WMPA 3P9LB 4JHAL 1MIMH 2NY3D 4ODTL 2XQBL 5T1LB 2H3NA 2I5YL 1I8LA 3C60A 5I1GL 2Y23A 3BX7C 2AABL 5KVEH 3QPXL 4HPYL 5JOFA 1ZGLB 1KBGL 2Z8VC 1WWAX 1P7QA 4YZFE 4RIRB 1KIPA 4LDOB 3LN9A 4M4PA 1TZIA 2ZOLB 5D72L 1MLBB 3WUWG 1Y18A 5IHZA 3GHEL 4Q9CA 5FDYA 1CFSA 5AZ2H 5ID0B 3V6ZA 4FQJH 1T6VN 3GKZA 2EDRA 3VXUB 5DC0A 1WWCA 1RK0A 4KHTH 5C0IB 1MRFL 4K8RD 3DMMB 5T5NG 1F11A 4UDUA 5FO8B 5F7HA 2HMIC 1MFBL 5KAQF 2XN9B 2O5ZL 2DWEA 3PABB 1DUZA 1G7IB 3BPCA 2V5SA 1FV1A 4WUUE 2P24A 2OJZL 1QLRB 1JGDA 4ZS6C 4DN4H 4X6FB 3GGWB 2HFFA 2HG5A 3MV7A 7FABL 2KDGA 3WNLA 2X4PA 4KAQL 4HGWB 4MA8L 4OCWH 1MI5A 3BISA 5F88A 1XGUB 3BP5B 4H5SB 2B0SL 5I6XC 3D5OF 1WWBX 3L5WA 3KPRB 1BOGA 3DXAB 1YYLH 4GUPB 5IESH 1CDYA 1EJOH 1UT9A 4OM1H 2W0PA 1HN1A 3SJVD 4NT6A 1D7FA 2LVEA 1LEGA 3QRGL 1S78C 4NZTL 5C92A 1H3VA 3GSRB 3UJTH 3ZDYF 4WTZA 2RQ8A 1IGYA 3B9KC 4NQDD 1RURH 1WFUA 3TBVB 3DX8A 1JNLL 1QSFE 1VPOH 5JIHA 1UWXH 5CSGA 5CP7B 1PG7W 2FL5A 1MCRA 2D7MA 3CVHB 2AJSL 2VSDA 5EDXA 2IAMA 3C5JB 3O3EA 3VXUE 4D0CA 5KS9B 3K2MC 1JYXA 4WGWB 2D31B 3RVWD 1DVFC 3C8KB 5KSUA 3QO0B 3ZTJG 4D0DA 2ADFL 1G9MH 3DRQA 2VXQH 1OL0A 1Z9SA 2X7LB 5GISH 4P5KA 3PDDA 1KTLB 3CSBA 3L3KA 1Y6MR 1RAMA 1T22A 1XCQB 5I8EA 3LPGA 5T1MA 3LAFA 1I1FB 1HHKA 5I66B 4M5ZL 3HFML 1Q8MA 8FABA 3K8KA 1WEJL 1PG7X 4ZO8A 2P8PA 2IAND 2NY1C 3NGBB 3WNKA 1FFPB 4FMFA 4KJWD 4ZG1A 1IRAY 2YUVA 1T4KA 2XWJB 2JKXA 2V9QA 1JGEB 2MTPA 1O7SA 4NGHH 3V5KA 4JKMA 2L4OA 1UZ8B 3KPSB 4ODVL 1R3KA 4C57C 3P9LA 5GRZA 5L8LB 5HHPB 3V52H 5T1LA 4AL8H 3VU2A 2DQHH 2IH3B 1KCRL 4RZCB 5DS8B 1UYWH 4YDIH 3A6CL 1ZGLA 1ZOXA 1QSEB 1NUNB 5A16B 1OLZA 4RIRA 5E8DH 4ONFH 5D96B 1NAMH 1LEIB 1CGSL 2HRPH 4E42A 2FEEL 3QIUB 4MHHI 4XPGL 4FFYH 1MLBA 4XNYH 2VDPH 5IR1B 2X1PA 1U8JA 5ADPH 5ID0A 3GMLB 4BZ2L 4C83A 2JTDA 3GHBH 5IQ7H 5HYFA 2B20A 1FCCA 2HWZL 4OGAD 5C0IA 4WHYH 4X4MA 3DMMA 5E2UL 5FO8A 2IMNA 2BRRH 2B2XL 3SDDD 3BO8A 3MRFB 4YFLF 3WFDL 2XN9A 1I1YB 4OV5B 1A1MB 1G7IA 1ZHKA 3HN3A 4XP1H 4YNYB 4X6DE 3U0WL 4JANB 3GGWA 4C58B 2AXHA 4NNPH 3B5GA 3QG7L 1OCWH 3NFSL 3FN0L 3T0EE 3C8HA 1XGUA 3KPSE 3WO4B 5FB8B 3BP5A 1AKJD 2AJUH 2BSTB 3QWOA 1WIPA 3KPRA 5IFHH 3DXAA 3N1MC 4GUPA 5FHAL 4GBXB 1KV3A 4UIMB 5C0DB 5KVMC 2H2PD 4HSQA 4JPKH 4R7NB 1PZ5B 1ZHLA 1YEGL 3SDXB 4F7TB 2R9HD 3H3KA 3GSRA 5BZDB 4PUBH 5EH1A 1JTTA 2DBLH 3P40A 3QUML 3O3BA 4CVUA 3MNZB 3CVHH 4ZDHB 4F58H 5CP7A 4XCCL 5LKNA 1KN2H 2CXKA 1PLGH 1F3JB 1ZSDB 1JGLL 3CVHA 4QRRE 2ZUQC 1F6AA 3VG0H 1C16A 5KS9A 3O2DA 3DHMA 4K8RH 2D31A 1RZIB 3BPNC 3C8KA 4DAGH 2EEDA 3QO0A 5D8JL 1SVZA 3Q5TA 3X14B 5AWNH 3G9VA 4I8DA 1S9YB 1SBBA 2X7LA 1WVZA 5FGRA 4K3EH 3IFOB 1YEEL 3TH4T 3F5WB 1KTLA 3BDXA 2BP3A 2YMXL 1U8IB 2K7PA 3C5ZC 3W81A 1F4WH 3ULSB 3G5VB 5DGRA 4K55A 3UTSD 1B4RA 2DOCA 4XCFH 3UTTB 5CLTA 4N9GB 3IKKA 2YD7A 1MCQA 2OL3B 3TESA 1CG9B 4TYUA 5DMIL 3IJSB 2NQCA 1FH5L 1ZHBB 4JGMA 4F9PC 1W0YT 1JYNA 5JO5B 4FHBD 3SDXE 3U79A 1QRND 4MS8C 5L7XL 4U7SA 1UZ8A 2AQ1A 4NHCH 3NA9H 3RIFF 3LS5H 5HHPA 4QF1A 5EC2B 3EHBD 5DQ9A 3VXMB 2GKIA 5CGTA 1K4CB 1NCAH 2A73B 2IH3A 4WVRA 4RZCA 5DS8A 5F3BA 1XGYL 5GJTL 5GJSL 5IVZB 1QSEA 4N5ED 2JJTC 5E4EC 5BS0D 4MAUL 5FCUL 2ZJSH 1LEIA 3MXVL 2ICES 3QIUA 2VLRD 2X4SB 5I1IL 4HCRH 3BP6B 3GBMH 4U6XB 5K9OA 2IQ9L 3GI8L 5IR1A 3QR2A 1RUML 2BZDA 4HCRA 2XTLA 1FO0L 2BNRE 1IAMA 2I24N 4K2UH 1GYAA 2YPVL 2B1AL 3HUJF 1WBZB 4MD4B 3WN5A 2EDJA 4NQUA 3RZCC 5M94B 5IBUG 3UC0H 1HHJA 3ZL4L 4EI5C 4Z8FL 3MRFA 1I1YA 1A1MA 5FA3A 4YNYA 3N06B 4X6BB 5KVEL 4KTEH 3UPCA 4WU7A 2WIMA 4JANA 6FABH 4MA7H 1SM3H 4EUPH 1NCNA 5C0NC 1UJ3C 4G9FB 4LDEB 2IGFL 5FB8A 4HIXH 1IILE 3QDJB 4WTZG 3QRFM 4DUVA 4RAHA 2BSTA 1NCCH 3OAUH 3DURA 4YO0B 5LBSH 2E8YA 1AD0A 3CUPB 3ZTNL 4H0HB 4UIMA 3V8CA 4B7LA 2F54D 5D2LB 5AZ2L 4R7NA 4L29B 1PZ5A 4F7TA 4FQJL 2A83A 5BZDA 3WBDA 1LO5A 1VA9A 3U9UB 4KHTL 1A5FH 2HJLB 3MNZA 3OKOB 4GW5B 4JRWA 4APQD 1NGYB 4PJHB 5JPNB 5ILTH 1F3JA 1ZSDA 2NY0B 1KF9B 3EO9L 1W72H 2GSGB 4RGND 3ULUD 4HS6B 1LGVA 3AMKA 4NKIH 1W72A 1F3RB 3HRZA 1RZIA 3ARGC 5DJZB 3HR6A 3X14A 4HWNA 1T1YB 3QI9D 4OCWL 4ELMF 4IEFB 4J6RH 2ADJB 4HUUB 2Y1VA 1U9KA 1S9YA 5TH2B 4LAQH 2FECI 3IFOA 3HCVB 1PEWA 3F5WA 1YYLL 5BO1H 3PNWA 5IESL 1EJOL 1CCZA 4OM1L 5EUKB 3ISWA 1U8IA 5E70A 3WXWH 4XMKH 4LHQB 1DVFB 2X2YA 5E94B 5EWIL 5GGQH 3UJTL 3QDJE 3MLUH 3UTTA 1OARH 4X6EB 1BFTA 3L7EB 4N9GA 1KCVL 1UJTA 5CINH 1RURL 1VPOL 4Q9BA 2ZUTA 1JTOA 4L4VD 4EI6B 3GMMB 2CR6A 4JM2F 4L9LC 5LCVH 4XCNA 1XGTB 4UT6H 5D2LE 5CFHA 5HYIA 5JO5A 5F72S 2VL5B 1E4JA 4R2GD 2AK4D 2DIAA 3GMRA 1BREA 4Q7DA 4LPUA 1URLA 2E6JA 4EKXA 2C3XA 1KNOB 3MREB 3T0BA 1EK3A 1MCPH 4PLKC 5EC2A 5SWZA 1MVUB 3G04A 4YGVB 3VXMA 1G9ML 4PJHE 4LSUH 2VXQL 1K4CA 2A73A 5DURD 2HT2C 2AS5M 3ILQC 3W5MA 5GISL 4CVWA 4IOFC 4XHJC 5IVZA 1ES0B 3QIBC 4ZUSA 5IT2H 1JPST 1J8HE 3LPFA 3RGVD 5LWYH 2DYPB 2I9LA 4LPWA 1L4IA 3HE6B 4LVNC 4J1UB 5J1TC 3IDXH 2X4SA 5EBGA 2BRQA 3BP6A 5E6YA 4U6XA 1HQRB 2D0GA 3IAQA 4EVNB 3B3IB 4GRWB 4X9HA 1FVDB 3DETD 5CZVH 4BA8A 4B50A 4KDWA 1NC2A 2QKIA 2WK2A 2FO4B 4NGHL 4ENED 4QRSB 2BSRB 4KJPC 3OMZA 1J0KA 4GG8A 3PHOB 5FF6B 5JR1H 3V52L 4UINH 4AL8L 4UNUA 2DQHL 4LU5H 3SGKC 2AXGB 1UYWL 1KELH 4LSRH 2MWCA 4YDIL 4ODUB 4X6BA 1HWHB 4PG2A 4OCMC 4UAOC 1EHAA 4G9FA 1TENA 5E8DL 3VFWB 4ONFL 5T3XD 5JORB 5I8CB 4JRYD 1NAML 3NCFB 5C0AD 4YO0A 4FFYL 2AJ3B 3IJYB 2YD8A 4QNPF 4XNYL 5F6IC 3TO2B 4LLAA 3CUPA 3CH1B 3S36X 5D2LA 5ADPL 5KG9A 4L29A 5D2NC 2YSSB 3ZHKA 1A1OB 1QLEH 2WWKT 1TCRB 3GHBL 5IQ7L 5IP4A 3ULVD 1J0IA 1FZOA 3BKMH 1R0AH 2HJLA 4GRMA 4GW5A 1X7QB 1HQ4B 5B39B 1KTDB 2BRRL 5ISZD 1GRWA 4LL9A 5F9WC 5JPNA 3N85H 2GSGA 4Q6IB 4WO4A 5DTFB 3BDBA 4NOBA 3V5DB 4KVNH 2EECA 2NTFA 4HS6A 4XP1L 4LLQB 1ZLWH 2DTMH 2WWMC 2AVGA 1QLFB 5FA4A 5DJZA 2FJFB 5F7EH 4LKCA 4NNPL 1OCWL 1XH3B 1SY6H 2ADJA 4Y88A 5C0EB 5TH2A 3MRRB 1V3KA 2AJUL 2VDOH 3AXLA 2ZUQB 3HCVA 3MLPA 3D2UB 1WFNA 4JFQA 1G0DA 4FG6D 4C4KO 5GS1C 3SDYH 1JFQH 5MENE 1S7TB 4KFZC 4PUBL 5D6DA 4MZ2A 3BQUB 3L7EA 3OJDB 2EE2A 2DBLL 1YMMA 3E6HB 3U7YH 1UADC 2PN5A 3B5HA 3RVXD 4EI6A 3CVHL 1NBVH 3GMMA 4LMQE 4F58L 1KN2L 4CGTA 1PLGL 2EICA 1XGTA 2G9HB 3MV9B 1J1XH 2VL5A 2KZ1B 4OCRH 5EOQH 4POYA 4CJ1A 4PGEA 3VG0L 4M1GL 4NUGH 4QOKD 2NNAA 2GW5A 4K8RL 3SO3B 3MLVH 1NCBH 1W0VB 3MREA 4UB0H 4DAGL 1HXYB 1AP2B 2E9WA 5AWNL 2F19H 4IRJB 3WLWD 4YGVA 2DJUA 4NDMB 5ALCH 4V2CB 1E6OL 2Y5TB 3ULUH 2ICEB 4K3EL 1VENA 3MV11 2FEDD 2EYRB 3WO3B 1OF2B 3O45A 1ES0A 1F4WL 2DYPA 3SN6N 5IBLC 1TTUA 4JVUA 3HE6A 3Q5OA 4PJEA 2FR4B 1BBDH 4GRWH 1HQRA 2ICWB 5HTSA 3OJVC 4ETQA 4H25B 4EVNA 5C9JB 3B3IA 5EOTA 1FVDA 3H7BB 3IXAB 4UOW0 3AS2A 2ED8A 4OFIA 4FQHB 1B9ZA 3FT4A 3K8LA 1S9XA 2NY5L 4HFUH 2BK8A 2BSRA 5CSBA 3RVTC 2GJJA 2E7LA 1IM9D 4NHCL 3NA9L 3PHOA 3LS5L 5HHMD 4PJGA 3CDCA 1NCAL 2AXGA 3BZEB 2FWOB 4ODUA 3MV9E 4ZO9A 1E27B 1JGVL 4NC0B 3KG5A 3T2PA 4W81A 3ZT5A 1RZ8A 3TH3T 5JQ6H 2AW2A 3QB7C 3GEWB 3VFWA 4EI5B 5JORA 3PJSB 5I8CA 2ZJSL 4MQXC 5H94B 1R24B 5E9DD 1DANT 3GJEB 2JJSC 5HHVH 1NKOA 2AJ3A 2BVYA 2YPKB 5IROC 5CIPB 3PWNB 5EN2B 3TO2A 1A7QH 3CH1A 5T1KA 1WAAA 3O0RH 1UJ3B 4K2UL 2YSSA 4PJXF 4PJFE 1NANH 1A1OA 3UX9B 3MODH 4YC2B 3BH8A 1TCRA 2B7DT 1YC7A 3QDGE 1PZUB 1TIUA 4M5YH 3TWCL 2HFTA 5DA0B 5EBLB 3UC0L 1DL7H 1HKLH 1HQ4A 2NY3C 3ZDXE 4Q6IA 1JZ7A 3SQBA 3EYVB 3V5DA 3QHFH 4XH2B 4LLQA 4KTEL 5CBAB 3I2CL 1FN4B 1QLFA 2DKSA 3L7FB 4MA7L 5D70H 1SM3L 2FJFA 2OR8A 1H15A 2CKBH 1NLDH 1XH3A 2L7JA 1JV5B 4AMKH 5C0EA 2CKBA 4ZPVB 4M02A 4WFGE 3OAUL 1NCCL 2V7NA 5EO0B 5LBSL 3D2UA 4AEEA 2YZ8A 3UZQA 2YRPA 2DQTH 1TVDA 3B4NA 4DKEH 3ARGB 2FB4H 3RZWA 1PKQB 3TNNB 4HUVB 2WBJD 5SWQB 3BQUA 3QXAA 2VLKD 4K8RC 1GH7A 1FL3A 1UXSB 3E6HA 5F6HJ 4D9QE 3HR5B 4J4PA 1DTUA 3TFKD 5ILTL 4I0PD 1D5BB 1W72L 2NY2B 1ZLVK 2B4CC 2AJYH 4NKIL 1HH6B 1XIWB 5DVMA 4RX4D 1W0VA 4Z7VF 1HXYA 4IRJA 4J6RL 4U3HA 1E4KA 2Y5TA 2BY2A 4LAQL 3OAYH 2AEQH 2EYRA 2HA1A 5BO1L 5CBEB 3Q5YA 3WXWL 4XMKL 2Y5EA 3BGFC 2XY2A 1OD7A 3QG6B 2EDEA 4PIRF 4MJ6B 3AS1A 2FR4A 4AQ1B 5GGQL 5C0BD 2AK1H 5F96H 3MLUL 2NY5C 4YFEA 1LILA 1OARL 2IFFL 32C2B 4HEPG 1S9KC 1U8PB 2ICWA 4WW1B 5CINL 1L6XA 4H25A 5C9JA 1Q38A 2VXSL 2P5ED 1TNMA 4X5WB 3QIBB 4XNZB 3IXAA 4GAYB 1CICD 5LCVL 1VERA 3O2VH 4UT6L 2X4UB 4MQSB 2EH7H 1PKQE 4LVNB 1QHPA 4FQHA 4QRPB 1JHKH 4OFVA 1BWWA 4WV1B 3RVWC 1CYGA 4NYLB 1MCPL 3WS6A 2XYCA 5E7BA 4HFWB 3O4OB 4PJ7A 5GZOD 5KSBF 4LSUL 4Z7QF 3BZEA 2FWOA 1E27A 4U1GC 1MCJA 1BECA 4FTVD 1DANU 1I7ZA 5SWSB 5L0QC 5IT2L 1OWRM 1C1EH 5LWYL 1BAFH 3PJSA 3EOYG 5BJTB 5H94A 5J11C 2BHYA 1BIIB 3GJEA 2PKDA 3L9RB 3IDXL 2P5WD 4I2XA 3KWWB 1T5XB 5CIPA 1IL1A 1P9MA 3PWNA 5EN2A 1I9JH 2P45B 4FXLA 4KJWC 5D71H 3FO0H 1JZ6A 5CZVL 4ZFOB 3RX5A 4P23B 5FAAA 3ZT7A 5A2FA 1P6AB 2UUDH 4MLSA 4G9DA 2V6HA 1UZ6F 4YGAB 1CLYH 5EBLA 5ACZB 1KGCD 1N8ZB 5F6IB 4KRNA 5GSRA 2WM0A 12E8H 3QHZH 3Q48A 2FHFA 1A3QA 2PCPA 5C09E 4WGVB 4P2QD 5IVNA 5JR1L 4UINL 4LU5L 2IG2H 4XH2A 4LSRL 1KELL 4FFZH 4U0RB 1HCFX 4UU9B 3OXSB 4OFYA 5KN5B 1FN4A 4QRPE 4Q9RH 3L7FA 4XAKD 5DUPH 4Z0XB 1H0DB 5ESVB 5JIPA 2MQ0A 1JV5A 4XP4H 1FGNH 2GTWB 2VWEC 5F9WB 4O58H 4ZPVA 3U9PH 4NZRH 3O6ML 4KGLA 4OZGF 5EO0A 3UZVB 1A9BB 3OKEB 2AXFA 3V6OA 3FFCA 1T2JA 2QEJA 3Q1SH 4FN0A 5SWSE 3T3PF 1P53A 1PKQA 4WIQA 3TNNA 4HUVA 4WEMB 1QLEL 4AH2B 5SWQA 4OGAC 4F2MB 1ZA3B 1EERB 1IGMH 1UXSA 3BKML 3HR5A 1R0AL 3TZVD 5F93C 3IGAB 4KI5F 3SDDC 4PD4J 5DRXB 1Y0LB 4ZOBA 3OG6B 2EH8H 5JW5B 3N85L 1D5BA 3D6GA 4GXVH 4R3SA 3LKSA 2XPGB 3CX5K 1R3LA 2DTML 1HH6A 1N64H 1XIWA 4XBPB 5F9JA 5DI8B 2NY7H 1EO8H 1SY6L 4WI6A 3ULVF 2CRMA 3NCBB 5GS3A 1YEDB 5D2NE 1MQKH 5EO9A 5CBEA 2K9UA 3ZSTA 4K3HA 4G6MH 2H2PC 3BT2H 4XVJH 3SBWA 2DLFH 3SDYL 2R9HC 2BVTA 1JFQL 1Z5LA 4MJ6A 5HGAB 2NXZB 4NFCA 4ZODA 1BVZA 1CDGA 1ETZA 2B39A 3BN9D 1U8PA 2HKHH 4WW1A 4UTAH 1QVOB 4I13B 4P3DA 4NKMB 3U7YL 3VFTB 2Q20A 4X5WA 3IDYC 1NBVL 2UWEF 3L6FB 4GAYA 3CLFH 2X4UA 4WI3A 5J13B 1J1XL 5EOQL 4OCRL 1V3LA 1IJ9A 4NUGL 4NKDB 4WV1A 1Q9OB 1UCTA 3MLVL 1NCBL 4JEGB 4NYLA 4UB0L 3NN8B 1AXTL 2F19L 4AQOA 3BPLC 1FP5A 4QRTB 3IRPX 3FONB 3ULUL 1S7XB 3ARYA 5J4MA 1BBJB 2MQ3A 2R0ZH 3PL6D 3NPZB 4U3XA 2XWBB 3QYCA 2CLZB 4Y5YA 2HP4A 1JF5A 4MQ7B 1LDPL 3QO1B 4G7YH 3MACH 1T1WB 3U4AA 5MHSE 1G9NL 3VRLF 4NO0A 3FO1B 1BIIA 3L9RA 4K7PX 5KBNC 3G6JF 1T5XA 3HUJB 4PY8I 5I1JL 2F53B 1ZMYA 3KGRA 4ZFOA 4P23A 3C9NB 3CFEB 4Y2DD 2IPUK 2UZIH 2BNQD 3D3VD 4HV8B 1RZKH 3ROOB 3KYKH 4FXKB 4UQ2B 1WQVT 3FO9B 4HFUL 3OF6D 3QT2A 1N8ZA 3TPUB 4ONGH 5TQ2H 4BFBD 3OKMB 4GKSA 3EHBC 4U1KB 4N1EA 4OF3A 1OP9A 4JFDB 4DZBB 5DRWB 4RFNC 4UU9A 3OXSA 3V5HB 5KN5A 4NIKB 3VWKD 1J0JA 1NMCC 4N5EC 3P0YH 5ESVA 5JQ6L 4JE4B 4PJIF 2KPNA 4JDVB 2GTWA 3EOAB 1AHWC 3NVQA 2XOTA 5JIKA 3PP4H 5HHVL 3S3SA 2VZOA 4EQ3A 3GNMH 3ZKND 1A9BA 3OKEA 1RIUH 1LP9F 4LRIC 1A7QL 1WITA 3RWEB 4OKDA 3O0RL 3T4YB 2ZSVA 4JJ5B 4HH9B 5CJ5A 4AH2A 3MODL 4DN3H 5C0RH 1JNJA 1MWAB 5GGVH 3SGEH 3BI9X 1KOAA 4F2MA 2RHEA 1ZA3A 4M5YL 3O6FB 2HH0H 4ZTPH 5I19H 4XWOD 4ORGA 3HUJE 3IGAA 1DL7L 1HKLL 5DRXA 1JTPA 1Y0LA 3PIQB 3RIAK 2F53E 5DYOB 4X7SH 5JW5A 1EFXD 5HHOE 2FX9H 5MI0C 2XPGA 3QWRD 4ELMB 3QHFL 5B8CC 5F89A 3MLWH 4Y8DC 5D70L 1RULL 4TNVF 5EUOE 1FLRH 2HVJB 2CKBL 4F37F 5DI8A 1NLDL 2M8XA 5HI4D 2X1QA 4AMKL 5FM5M 1UKQA 2R8SH 4LSVH 1YEDA 4N90D 4NWTH 2FHCA 3AC0A 1OTUC 4NKOB 2M2DA 3AY4A 2VKXA 2DQTL 4OF5A 3FQTA 4RISH 3T2NH 3MRCB 2MMXA 1MCKA 2PTVA 1PDKA 2PTTB 3BH9A 3BZ4B 3P2TA 4JM2B 4TVPH 1QVOA 3QFJB 2C5DC 2JELH 2N4IA 4NKMA 1TZGH 3VFTA 3K3QA 3S35X 4XNMB 4APQC 2ITDB 3CSGA 4KK5D 2V9TA 3I9GH 3IFNH 3L6FA 2X4TA 4L4TB 4RGNC 3ULUC 2FH8A 1Q94B 2AJYL 3FN9A 5DFVD 4NKDA 2FDBP 4NQDB 5F7KC 3S3PA 1IEAB 2YPLB 1MHPH 3QI9C 3NN8A 4NSKA 3IJHB 1G9NC 4QRTA 1FFRA 1U3HD 3BJLA 3FONA 2QQQA 1F4YH 5HDQH 2AEQL 3ARRA 4ELME 1BBJA 2PO6B 4Z7UF 3ZE2F 1KJ3H 2XWBA 5HDLA 3FT3B 4MQ7A 5CJXA 1T1WA 4JQXA 2E7BA 3EJZD 5KAQG 5MEOB 3P4NB 1BEYH 2AK1L 2ZG3A 5F96L 5F1OB 1NMBH 1XMWA 3ALWA 1QRKA 4MMZC 4U1GB 2P43B 2F53A 1S9VB 3SY0B 1C7SA 3C9NA 3CFEA 2W9EH 3JTSB 1GPOH 2C4FU 3O2VL 4R2GC 2EH7L 5C0CA 4HV8A 1BIHA 3VXRD 5DUBB 4PJ5B 1Q9WB 2HVKB 4UQ2A 5HHQB 1S7QB 1JHKL 3FO9A 3ALPA 2RBLA 2ZUUA 1CDIA 3H9SB 3TPUA 5JDJA 3QFJE 1QQDB 2GEEA 3SJVE 4U1KA 4JFDA 1NC4D 4ZMAT 5F7LB 3IDJA 1WISA 5IMMB 5I1LB 3V5HA 4RFOH 1WLHA 4MD5B 3RGVC 4BH7B 2W9DL 2PYED 4NQDE 5E8OB 2XACC 4DUXA 1C1EL 3FB6A 1EZVX 1BAFL 3QQ3B 1W0WA 1E4WH 4GMTH 8CGTA 1RU9H 3EOAA 1FVEB 2LAGB 3S5LB 1I9JL 4ZUVA 5D71L 3DETC 2LU7A 3FO0L 5I74B 3RDTD 1IEHA 1ZTXH 3T4YA 4JJ5A 1P4BH 2ZUXA 3MO1B 5FIEA 2C3HA 3WCYA 1MWAA 4ENEC 4PLOB 4ALAH 5TE6L 2W0LA 3O6FA 2DQUL 3WV0A 4Y1AA 3QHZL 12E8L 1BFVH 5HGHA 3IVKB 2WZPD 2P46B 5ICYB 3T4AA 3QNZB 3MOQA 5DYOA 2DLTA 4HLZH 3T2QA 1OAQH 4U6YB 3P0GB 2EDQA 2IG2L 4ELMA 4QYOB 4WTXA 4FFZL 3RP1A 3ZYZA 2KKQA 4Q9RL 4B41A 5DUPL 1MFAH 2IANE 3FTGB 2HVJA 1MCDA 1RD6A 3SDDB 3H9SE 5C6TH 3LEVH 4XP4L 1FGNL 4O58L 3NCYS 1UB5B 4NZRL 3U9PL 4AT6B 5EOCH 3QZWB 5BRZD 4MJID 5I0DA 1F4XH 3UDWA 4BSVB 3ZLQC 3VXTB 3MRCA 3Q1SL 5HYQB 4QWWD 3U83A 4QNPE 3WJLC 1IC5L 5JHDB 3WIHL 4Y4HA 1PX4A 3ULVC 3BZ4A 4JM2A 4Q2ZB 1KUMA 3RFZC 1IGML 1U8HA 3QFJA 3Q6GH 4XNMA 5FYJU 2EH8L 5I8OH 1EHXA 2H26B 4L4TA 2WQ8A 5BXFB 4HWEH 3P0VH 1SHMA 3W9EB 5EU5B 3WJJA 3MA7A 3CFJB 4CADA 5IJKC 1IEAA 1GZQB 5KVDH 5CUSH 2YPLA 4GW1B 1A1NA 2WBWB 3B2UD 2EO1A 1WWWX 1WGOA 3IDYB 4GG6F 2NY7L 2Z9TA 1EO8L 4QT5A 4S10A 1G7MB 3FCTB 1U8KA 2CQVA 1MQKL 3OXRB 1U8MB 2PO6A 3CLEH 3PWUB 3HI5H 4FG6C 2N56A 4AJ0A 4WW2F 1CXKA 3EKCA 4G6ML 5HYEA 1XEDA 3BT2L 3M17B 4XVJL 2DLFL 5MEOA 2X89A 4MX7B 1R5IB 4OGZA 4Y4KA 3V9FA 3F62A 3K74B 2R0LH 3FAWA 3RVXC 2ZUWA 1LK2B 2QQLH 5M7QA 3VXSB 5HSFA 3B2VH 1S9VA 1HI6B 3SY0A 3CLFL 3ZZ1A 5I76B 1IC4H 1F00I 1CE1H 5DUBA 4PJ5A 1Q9WA 2HVKA 3ALXA 4JDTH 5JHDE 4JM4H 1S7QA 4OZ4B 4MB4A 4OZIF 2F5AH 2W91A 3H9SA 4LPYA 3WLWC 4KDTA 1IAIH 3LDBB 2BVQB 4F8TA 2NX5D 2Q3ZA 4YWGL 1HILB 1V7NH 1FL6B 2FEDC 4OKVB 5IMMA 5I1LA 2G5BB 1KJ2B 2R0ZL 3BP4B 3P4LA 4P5TD 1DQDH 5DJ2B 1FC1A 4G7YL 3QQ3A 4TUKH 3MACL 2H1PH 5DMYA 5FYKU 5I75C 2HJFA 4TUOB 1XAUA 1FVEA 1P4LA 4PJXB 3CX5J 3NCCB 3S5LA 4RFNB 4YHOH 3VGHA 2R4SH 4TSBH 1MNUH 3H9HB 5BS0B 2AJXH 1NANI 5C0FB 3MYZA 1KXVC 2UZIL 1RMFH 3MO1A 1JHLH 4I48A 3IU4H 1RZKL 1JF6A 5LAXB 1LD9B 3KYKL 4Z9KB 3MLTB 3QXWA 4LDLB 4U4BA 5E6IA 4N8PA 5TDOB 4WI9A 4ONGL 5TQ2L 3JWDH 3IVKA 3VXSE 1JRHH 3HMXH 4CU7A 3QNZA 2J5LC 1OB1B 2EYSA 4JFHD 3D25B 1H3XA 25C8H 5IB5B 4JZNB 3UTSE 3HMXA 4QYOA 5TPWH 4XP6H 4XTRD 5DD0H 3RWJB 2ZUVA 4NBZB 1T0NB 3W2DH 5KZCD 5C71A 3P0YL 1UWXK 4P4RA 3L3IB 5EC1A 4MJ5B 4TVSa 1UB5A 1FLTX 4AT6A 3QZWA 3MV01 1P5UA 3PP4L 3QDAA 5MI0B 3TJEL 3GNML 2P8MB 1ZWIB 2A6IB 2D0FA 2ZG1A 4H8WC 4JKWA 4BSVA 2C3VB 3VXTA 5HYQA 2HFGH 1BD2D 4HUMB 4POZD 5JHDA 3N1GC 2IQAB 4DN3L 2A0LD 4Q2ZA 5I19L 1DR9A 2HH0L 4ZTPL 5AAWA 4JCMA 3AREB 3NPSB 5L2KD 3H2WA 4Z7VB 4X7SL 1I3UA 2H26A 5BS0E 5ICZB 4XX1E 2FX9L 5BXFA 4C56D 3RA7H 3W9EA 2VLRE 5EU5A 2H32B 4CNIA 1GZQA 1NDGB 5C0GB 4BYHA 3MLWL 2F58L 4GW1A 2BNUA 4LARH 3I50H 3HAEB 3PWPD 4P2OD 3IF1A 1M7DA 3GO1H 2R8SL 2IBBA 3O2WH 4LSVL 3RTQD 4NWTL 1FAKT 2LTQC 4U33A 3OXRA 3I6KB 1U8MA 3PWUA 1JF1B 4RISL 3T2NL 1JCKA 2ICWI 3M17A 2W9LA 2WBJC 4HGKC 3FB5B 2LV4A 3HC3H 4OCLC 5T33L 4KKAD 1R5IA 1GXEA 4V1DD 1LK2A 4NZUH 1QHOA 3VXSA 2BC4B 2JELL 1BOYA 1TZGL 3TFKC 5HYJA 4I0PC 3I9GL 5BVJB 3IFNL 3VDCA 4RAUB 3H9YA 2XV6B 5I8KH 3ARTA 5KSBB 4M6OH 4QRUA 4XAWL 5B22A 3WSQH 1FNEB 3QUXA 3FQWB 4MZ3A 4L4VB 1MHPL 5F7NC 1CFNB 4EQ2A 2BVQA 2KH2B 4KK6D 3ARSA 2F54E 3UJJH 1HILA 1WCQA 4Z7VE 1FL6A 3TYGH 2J8UE 2UZXB 4OKVA 5F8RC 1F4YL 5HDQL 2AK4B 1KJ2A 3OKNB 3BP4A 9CGTA 1KJ3L 4G43B 5DJ2A 1OM3H 4ELKB 5FM5O 2DM2A 1S5HA 2AAVA 2VL4A 5DURB 1BEYL 1XR9B 1NMBL 4PJXA 3KPLB 3QULB 3ME0A 5FYLD 4ZXBD 2VDQH 4RGNE 3ULUE 1HKFA 3ET9F 3RGVB 1N7MH 5AEAA 5BS0A 5FKAB 5IB3B 1CICC 2KZWA 4ONHB 5C70A 2PXYD 2W9EL 1GPOL 1JUFB 4NZJA 4HLZG 3V8OA 3CFKA 1MHCA 2N7AA 4PRPD 1EUUA 1QNZH 5HD8D 5LAXA 1LD9A 4F7CB 5IWLA 1I1RA 3MLTA 4L9DA 3BEVA 5TDOA 4LRIA 4ZFFA 5GZOC 1MCWM 5SX5K 1OB1A 1GJIA 1CLOH 3D25A 4NFDA 3MJ6A 5E7FA 1FQ9C 3AM8C 5IB5A 4JZNA 1DBMH 5D7JD 3OR7B 3RWJA 3W0WA 1V7MH 1J0HA 3PWLB 1T0NA 4RFOL 5KSBE 4OZGB 2DI9A 3BUYB 5IW3A 4L4VE 5F7YC 3L3IA 4P9HC 4WENB 1E4WL 4GMTL 3I3BA 4MJ5A 5CEZD 1RU9L 1Z0NA 1NUFA 2P8MA 1ZWIA 2A6IA 3OB0H 3FL7A 2AK4E 3CSYB 4YJZL 3CXHK 3GFUA 2C3VA 1ZTXL 2MSPA 5MEQB 4HZLB 1HSBB 3O81A 4CW1B 1P4BL 4CAGA 2KBGA 1XF2B 5KW9H 3NA4A 2QBWA 4YDJB 5K9JL 2E7MA 4ALAL 1TVHB 4LLWB 1VFBA 4S0SD 3AREA 3RKDD 1BFVL 2IBZY 3VMPA 5ICZA 2L7UA 2HRLA 5DHVH 1OAQL 3SE4C 2ED9A 2H32A 4UOW1 1NDGA 4MXWL 4QHLA 5JA9A 1L9NA 4OFPA 3CPLB 3HAEA 4PRNB 4JZJC 5ISZB 5C6TL 4TRPH 1G1CA 3LEVL 3O4LB 4XXDA 3I75B 3L5XH 4BK4A 5EOCL 1HNFA 4ZNEA 1H5BB 2P4AB 3F58H 1JF1A 1F4XL 2IFGA 4N1CA 1CTOA 1ORQB 1UH3A 2HAZA 1I8IB 4OZGE 2Q6WB 3EJYD 3FB5A 2UWEB 4AM0B 4H20H 1PYWB 2YD6A 4OD2A 3FO2B 5JXED 1ZT7B 1CI5A 1NQBA 3T3PE 3QUZD 3TZVC 3EDKA 2BC4A 5TQ0H 1J88A 3Q6GL 4RMQA 1ED3A 1OVZA 1ZLUH 1IARB 4WEUD 4WW2C 5MERB 1NFIB 2Z31D 1D9KB 4RAUA 1AGDB 2G75A 5T3XE 4KI5E 4JRYE 5KSBA 2SEBB 3OR6B 4HWEL 3P0VL 5K59E 1FNEA 1D5MB 5KVDL 4G8GD 5CGMA 1AI1L 2O61A 1HHIB 4LCWB 4HUWB 1BP3B 4PP1D 4XZUB 4WFED 4LSQH 3S5LG 2K3TA 2WSKA 1EEUA 3DVGB 1DQLH 5HPOA 3OKNA 3PWVB 3CLEL 5F8QC 3ULVE 5LXGH 2PETA 3HI5L 5C0JB 1KTRL 1EPFA 2VLLB 2APFA 1KEGH 1NUDA 1UVQB 5FUZH 4OZFB 1T89C 3MLXH 5ISZE 3BN9C 1TCMA 2NW3B 3RWFB 1XR9A 4BSWB 3V0WH 3C5SA 3BGMB 3GSUB 3QULA 4X7DC 4C55A 2R0LL 5CMAB 2C1OB 2QQLL 2VOTA 1IQDB 5TF1H 3RGVA 3Q0HA 1M05B 3EDEA 3LRHA 2VQ1B 5FKAA 5IB3A 1U8QB 4ONHA 1ADQH 2IJ0C 4YQXH 4QTHB 1JUFA 1IC4L 4KI1A 1B90A 3TPKA 4JO4H 2JK5B 4F7CA 2UWEE 4JM4L 4OV6F 4FABH 3OX8A 4KKNA 4WEBH 4Z7NF 1CIUA 2A9MH 2F5AL 1UGNA 4KJQD 1NCWH 1IAIL 2CK0L 3QZWG 3DSNA 3IDNB 5CCKL 1V7NL 4PJIB 3HPLA 3OR7A 3LKOB 4HS8L 3PL6C 1A21A 3PWLA 4X99A 1IM9B 1TETH 2EEAA 1DQDL 3BUYA 2BCKA 1JPSL 4OFKA 5D7LA 4NQCD 1LP9B 3Q6FB 4TUKL 2H1PL 5EFIA 3CIQA 5H35B 1YEJH 5J6HB 1FJ1B 1L0XA 1G7JB 4YHOL 3CSYA 1HH9B 2R4SL 2Y72A 2YWZA 1MNUL 1LK3H 3KPTA 4LFHG 4TSBL 4Y2DC 3D87B 1IC7H 2AJXL 5MEQA 4CW1A 4LAJH 1XF2A 3SGEI 1BJMA 2BY3A 1RMFL 5GHWH 3IU4L 3MRHB 5JNYB 4ZUTB 1TVHA 1GGIH 5T1DH 1NEUA 3UTQB 5D1QD 5EO1B 1IZKA 1D3CA 1IAKB 3I85A 3HMXL 4OQ1A 1AXIB 1Z6JT 25C8L 4WWID 5TPWL 4AZ8A 3VWKC 4XP6L 5DD0L 3ZHLA 3DI3B 3W2DL 4DGIL 3DTXA 2XKNB 4LNRB 1CLZL 4PTUB 3CPLA 4PRNA 5ISZA 2R0WL 3O4LA 1KT2B 5GGUA 1AO7A 1I1AD 2OS7A 3ZKNC 1EEYB 2OI9C 1H5BA 5IM7A 4NP4H 1GOGA 2J88H 4PJIE 3PDOA 1LO2L 4ZD3H 5IJKA 1J1OH 2IMMA 3B9VA 1ORQA 4KHXH 1I8IA 2A6DB 2R2HB 4H0GA 5IF0B 2Q6WA 2V7HB 2HFGL 5DK0B 5EPMB 3C09C 5DDHB 1I8MA 3LEYH 1LP9E 4HX1B 1PY4A 2UWEA 4YHIB 5HHME 4AM0A 1JZ3A 1PYWA 5FYJD 3FO2A 4XWOC 2DDQH 3QEQB 4NM4H 4RMVA 3SKOB 3E3QC 1WV7T 2DTSA 4YHPA 1KCSH 1J86A 3HLAB 5MERA 3QDMD 1NFIA 1D9KA 3PDGA 1AGDA 1U92B 3MCLL 4GJTB 4JQVC 2SEBA 3OR6A 5E9DE 2VLKB 5IG7B 5T3ZH 3RPIB 4CN1A 3O9WB 1D5MA 3SDCD 4N68A 3ARDA 4LARL 1A4JB 3I50L 4ZAKD 5HI4C 1HHIA 4LCWA 3GSOB 1F02I 4K71C 3GO1L 4XZUA 3O2WL 3DVGA 1XGRB 2Q1EA 3SE3C 1G9EA 4U7KA 3PWVA 5HI3D 1MRCH 4OZFH 3SCMB 4B53A 3G6JA 4F57H 3VD9A 2VLLA 5KJRH 1UVQA 2CKNA 4UDTB 3VWJD 4OZFA 3UBXA 3EGSA 3UZEA 3RWFA 3HC3L 3R0MA 4BSWA 3BGMA 2D9CA 2ADGA 1JZ8A 1XF3B 4NZUL 1IQDA 2D9QB 3H3BC 4FQXA 3M07A 2HLAB 1QEWA 4KK5C 1M05A 1NGXA 2VQ1A 1J87A 3CD4A 3F8UB 3TT1L 3VI4E 1U8QA 4QTHA 1FYTA 5C0BB 5BCAA 5I8KL 5DFVC 2JK5A 2EO9A 4M6OL 3WSQL 5DZNA 5DC9B 1MH5B 4BQ8A 3KXFB 2Y07H 3QXVA 3DBXB 3MC0A 4F9LA 4ZSOE 1U3HC 3UJJL 4X8JB 5DMJB 4PJIA 3TYGL 4J2XA 5IFJB 4WY7L 2VLKE 4B5EA 3X12B 1D6VH 5FYKD 1OM3L 1LP9A 3Q6FA 1JWSA 2CD0A 3EJZC 1TVBA 3SDAB 4LIQH 5J6HA 1FJ1A 3KPPB 2X4OB 4MXVE 2VDQL 1ZLWK 4G6KH 4FTVB 1HH9A 4WUKH 1I3GH 1N7ML 3JUYA 3QUYD 1ZA6B 2YRZA 3ARBD 2X09A 3CC5B 4LRNH 1MHHB 4MAYA 5JNYA 2P5WB 2WIIB 1QNZL 4ZUTA 3VG9C 2WW8A 3BE1H 3HAEG 5EO1A 4Y16D 1IAKA 3K80A 4U1HA 1CLOL 4RAVB 1KACB 5E8PB 4NN6B 5C0BE 1V7ML 3EYUH 5AZEH 4FQCH 5DJXB 4QY8B 2XKNA 2AXJA 1WUNT 4LNRA 4PTUA 3ZKMD 1SVCP 4YHKH 2P5EE 3MBEB 3PXHA 4J23A 4P2QB 1RIVH 1UACH 5DJ8B 5BOZG 1JK8B 1KT2A 3NFNB 3MQIA 1MCSA 4RBPH 1EEYA 5GRVL 5DRNA 3HNVH 2JLLA 2X4QB 2XQYK 2Z8RA 3RDTC 4LBEB 4UIKL 3MA9H 2A6DA 5D1ZD 5IF0A 2V7HA 5DXWA 4F3FA 4JZJB 5EPMA 1HYSD 5DDHA 5IBTH 5KW9L 4YHIA 4HX1A 3VFVB 1OW0A 5IKCB 2R23B 2QL1A 1UXWB 4HIHB 3RNKB 3QEQA 1T2QH 3SKOA 4ZOAA 3QA3B 5TDNB 2QLVB 4FTVE 2OR9H 3UTOA 4L8SC 3WDJA 4GG6B 3IS1X 5IQ9A 3OKDB 1EGJA 5IG7A 3R0NA 3RPIA 1YC8A 4LCIH 3O9WA 4DVRH 2P5WE 2UV3A 4U31A 1A4JA 4Q6YA 4NCDA 4Z7UA 4TRPL 4X6DF 4KK9D 4WW2B 3L5XL 2V2XB 2RJMA 4K3JH 4J3TA 1XGRA 3QAZC 2R1XB 3F58L 3SCMA 4WJ5B 2ARJA 1FIGH 2N7BA 3KR3L 4QWWC 5HVHC 4NJAH 4UDTA 4XGZB 1L9MA 5HVFB 1A9EA 4G42A 3VFSB 5C08B 4P2QE 4X98B 2MKLC 3BRGC 4R9HA 2D4DA 3D39A 3MGTB 2R1WA 3MRNA 3U2SB 5HBBA 5TQ0L 4G6FB 2HLAA 4GSDH 4P2CG 4XAKE 3G6DH 5EZIH 4PRHB 4OZIB 3OKLB 2FYYB 2F8OA 5C0BA 4JLRB 1J9CT 1QYGH 2JCCF 2UY7A 2R69H 3B2UC 4BQCA 1IAII 3KXFA 3BHBB 3CXHJ 1BFOB 2G2RB 1L0YA 3DX6B 2D4FA 4X8JA 4LSQL 2K7QA 3QIWB 1GC1H 4GG6E 3VGFA 1DQLL 3LRSB 4LPCA 5LXGL 5E95B 4R6UA 4YBQD 1JNNH 3X12A 4L8CB 2WLZA 4HJ0C 3MNWB 3X3FH 2EDXA 1KEGL 3VFPA 5FUZL 3MLXL 3MZTA 3SDAA 2ZSWB 3AM8A 5FECB 3KPPA 4FXGA 3V0WL 2YUXA 5TF1L 4HPOH 3FRUB 4N0UB 3S96B 1ZA6A 1Q72H 1YN6B 1R5WB 1ADQL 1A6WL 5H37H 2V17H 2PR4L 3CC5A 4KRPB 2WAHA 1MHHA 5C08E 4JO4L 1UWGH 4P2RB 3LZFH 2PW2B 4FABL 4BH8B 1EUTA 5EIIB 4G8FB 1TLKA 2A9ML 1JRHI 4P3WA 4XPAH 1JPTH 1JVKA 4PR5B 5B38B 4E9LA 3RY6C 5LGJB 1NCWL 3U6RB 1S8DA 2BNQB 3D3VB 5JQHC 5BMFH 4PRHE 2XY1A 4OZIE 4GQPH 3ABZA 2FSEA 3BN3B 4P5TC 1CXHA 3NCMA 1TETL 4QY8A 4XP5H 5DJXA 5KSAD 3MBEA 4ZNCD 5DJ8A 1JK8A 3NFNA 3GMNB 4N1HB 1YEJL 3SE4A 2X4QA 3LQMA 4Z76B 4LBEA 3S37H 1LK3L 4LLUB 1IC7L 1A8JH 1I7RB 5FXCH 3S9DB 5GHWL 3QFDB 2R23A 3MUJA 2Z93B 4HIHA 3QJHB 5I15H 1KG0A 2OI9B 4MWFB 5FYLL 1GGIL 4WI4A 4ZUUB 3QA3A 5TDNA 2QV2A 3N0PB 1JI1A 5BV7H 4IDJH 1DBBH 1BJ1H 2EDOA 1MVFA 1REIA 4X5XB 4BFGA 1MFDL 3TYFB 1NBQA 4N0UE 4QRQB 4GG6A 3OKDA 4XTRC 5HDOA 3OZ9H 4FQIH 4HWZB 4JR9L 3LEXB 4GMSH 3RHWK 1XF5B 5DVKA 1LDSA 2J1KA 4OZFG 3UBXG 1AJ7L 3EO0B 1GL4B 5IFAH 1UKTA 3TVMB 2V2XA 3JV4B 4KUZL 2BNQE 3D3VE 4LGSB 3UROR 1BX2B 1GZPB 4NP4L 1M71B 2J88L 1R3HB 4WJ5A 3EYSH 4Y4FD 1J1OL 4OCYH 1OSPH 3ES6B 4KHXL 5E56A 4XGZA 3EO1B 4POZC 4JFZH 3VFSA 4BFIB 5C08A 4X98A 4DKDC 3LEYL 2A0LC 3KLAA 4LSSH 4K71B 2ENSA 3MGTA 4KJYB 3U2SA 4NM4L 3HE7B 4Z0BH 2NXYB 2X42A 1EX0A 3MBXH 1KCSL 4PRHA 4OZIA 4Z5RA 2FYYA 3DLQR 4JLRA 1AIFA 5T3ZL 5DR5L 4K3GA 5I73C 3WHE0 3BKCH 3MV8B 4WNQB 1I3VA 3GSWB 1BFOA 2G2RA 3TCLB 4P2OC 2YA1A 5E24E 2VJXA 4M7ZB 4XXCC 1WIOA 3DX6A 1NH6A 3RTQC 3KS0H 3QIWA 5DK2B 4I0CC 1H8OA 2BVPB 4G7VH 5CEYB 2ZOKA 3LRSA 4R7DB 1MRCL 4F57L 3PV6B 1WBXB 3ZKSD 3FKUS 2APXA 5F9AC 5KJRL 4MDIB 2CJUH 3E3QE 2VR9A 3IRZA 4KKAC 1U3HB 2ZSWA 3K8MA 1N59B 5E2TH 5FECA 4Y5XB 1LVEA 4R97C 2X1OA 4L3EB 3RRQA 2JE8A 1RQ5A 1XR8B 3IDUA 3EDFA 3I3EA 4N0UA 5DD5H 2RR3A 5J12B 5GRYA 1R5WA 3KVQA 3HPJB 1YUHB 1JP5A 2GTZB 4PRAB 5ID1B 4JFPA 4RNRB 4P2RA 3MXWH 1RJYB 4N90E 2DQFB 4G8FA 5E8EA 3CZFB 4ZOCA 4F7MB 4PR5A 2Y07L 4KK6C 4X7TB 5LGJA 3H42H 3U6RA 5I9QC 4I5BB 5DJAB 4LPXA 4G3YH 2AQ2A 2QSTA 3MRDA 3C6LA 3K4DA 3VG9B 2NR6D 4OJFH 1MCHA 4PJHF 1X4ZA 4L1HA 4X9BA 1FZMB 2Y06H 1D6VL 5B21A 3UXFA 1XGQA 3GMNA 4PFEA 3X17A 4F37K 5EZLA 5D93B 4ZXBC 1G7LB 4HUNB 2XTJD 3NZ8B 5DJCB 2GT9B 4G6KL 2YRLA 4Z76A 4R0LC 5J7CC 3VJ6B 3WS3B 2DKMA 1I3GL 4IMKA 4LLUA 2PXYC 4HJGB 4P2YA 5IVOA 1I7RA 2O5YH 2YS4A 5IVXE 2H9GB 4NO2B 4LRNL 5HD8C 3QFDA 2Z93A 4M6NH 3QJHA 2Q86B 5FDWB 4P3CH 4TVPE 5CGYD 5BOPA 3MRGB 4HBCH 4RGMB 1F3DH 1C5DB 2P8LA 3C60D 5D7JC 3UYRH 3HC4H 4HWZA 3RWDB 3LEXA 4OCNC 3WNMA 3EYUL 5AZEL 1P7QD 4FQCL 4OF8A 2DLIA 4HGMA 3T2OA 3EO0A 4YHKL 2OK0H 1RIVL 1UACL 3TVMA 3R1GH 5E2WH 3JV4A 4L8SB 4NN7C 1BX2A 1TPXC 1GZPA 3HNVL 1M71A 3NFPA 1TJIH 1R3HA 1U95B 5EA0H 3UJIH 4AIXA 2QR0B 3ES6A 4ONOA 3MA9L 3EO1A 4UZGA 2NW2A 5D1XA 4BFIA 4KC3B 3VD7A 1IAIM 1G0YR 1B4JH 4UMGA 4MJIB 3RWHB 2VZUA 3QAZB 4KJYA 4LVOC 3HE7A 3RKDC 1T2QL 3SOBH 1E4XH 4DGVH 4WWKB 3P77B 2PYEE 2COQA 5KVGH 2OR9L 3MNVB 2ZPKH 1NGQH 2BSED 2MJWA 4TTDD 1A2YB 4JPIB 3KDMB 4JFEB 3MV7D 3HKFA 3V95A 3OBAA 4LCIL 2JB5H 4DVRL 1RK1B 3MV8A 3U82B 4WNQA 5GSVB 2D7OA 1MI5D 3E8UH 3GSWA 2BOCB 3WLBB 3FB7B 2CUMA 3TCLA 3VFOB 2X4RA 5EU6A 4RFEB 3TA3A 1C5CH 4K3JL 1IE5A 5DK2A 3HC0B 3ZO0A 4M61A 4RCAA 1JPFA 4HJJH 1CD1B 2BVPA 4X7CC 1MAMH 3S88H 3L3OB 1UA6H 3DI2B 4R7DA 4NCC1 3PV6A 1WBXA 3VGDA 1FORH 3U4EB 1FIGL 3EJYC 1P84K 2DQCH 2FRGP 4NJAL 4CMMB 2FBJL 4XPFH 1MJ7H 1MCEA 5JXEC 3C87A 4R90H 3CFBB 3JWOC 3QUZC 4Y5XA 4L3EA 2YA2A 1U8NA 2FATH 1NGWB 1IFHH 4JKPH 1BVKB 4MA3B 1JIBA 3EYQD 4GSDL 4JHWL 2J6EH 3OTTA 1UFUA 2A9NH 3G6DL 5EZIL 2Z31C 2IAMD 3HPJA 1YUHA 1E6JH 4PRAA 1RFDH 5ID1A 4GFTB 4QGTA 1A4KA 1QYGL 2DQFA 3CZFA 2R69L 5BRZE 4MJIE 4W68A 3T1FB 4KROB 4NPYB 4F7MA 4X7TA 2J7LA 5I1EH 1F8TL 4I5BA 3HZMB 4PP1C 4PPTA 4JPVH 3WD5H 1K2DA 4O02H 1GC1L 2DICA 4RMSA 1G7QB 2XZCH 1FZMA 4O5LH 2M1KA 3X3FL 1X5ZA 2NX5B 4AENB 4U1JB 1G7LA 1DN0B 1EIBA 1AY1H 3R8BB 1TTFA 5DJCA 2GT9A 4AG4H 1V05A 3VJ6A 3WS3A 4O2CA 4HPOL 4Z7WE 4WFFD 4HJGA 2D03H 1Q72L 2XXCB 1VGKB 3LN4A 1FPTH 2V17L 3L3DB 4NO2A 4W4OA 4PGBB 3I02B 3MLRH 2Q86A 4I4WB 4X5LA 4N0FA 1UWGL 5FDWA 3LZFL 3K0WA 1MCWW 4OD1H 3VGAB 1CGYA 4XPAL 4KJQC 1JPTL 1TQBC 3MRGA 5T1LD 4I18C 3H7LA 3OGCB 2PNDA 4YDVB 5F70A 4B0MM 5BMFL 2IF7A 2D7PA 3F6LA 5DEFB 3OJ2C 3RWDA 3EW3B 1CD9B 1FNLA 4XP5L 4KMQA 4P5MB 3LD8C 5JW4N 4J3VA 3PQYB 3W9DB 1KPRA 2EDNA 4LPVA 3VD5A 4LSTH 4ZO7A 3IDMA 2FH6A 2Y9RT 4YE4H 3ARZA 1U95A 1NCDH 3FQNB 3DUSB 4J8RB 5J57B 3S37L 3O6KH 1F45A 4EN3B 4DZ8B 2FJGB 4Y2OA 2LABA 2NX5E 3BYYA 2D3VA 4LCU