4M62L

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVEIKRLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GEP2 FV light chain
total genus 25
structure length 113
sequence length 113
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m62L00
3T2QA 1X5IA 3T3PF 5GJTH 5I17B 4IOSD 3O0RH 1WZMA 1ES0B 2YD8A 3K3QA 2UWEE 3G5YA 4YZFE 4IHOB 4Z8FH 3TV3L 3MUHL 2FJGB 1QLFA 3L3HB 1JZ8A 5E94A 4N0CD 2OR9L 2VL5A 3MBEA 1D5BB 2A1WL 4Y16B 1H3PH 4UU9B 1CL7I 2WLYA 3SDYH 1V5JA 1FL5A 5MI0B 4LSUL 5CJXA 5JTWA 1FNEB 4NOBA 3X11A 5JPMA 2VC2L 4I3GA 3A67H 1OP9A 4GQPH 4WTXA 2I26N 5ALCH 1C7SA 4LPYA 4KFZC 3EOAA 3W11D 5JPNB 4I18A 2ITDA 4QRSA 1KLUB 4XP6H 5DUPH 4WI3A 4PJAA 1NC2D 4F37F 1T5WB 4PRBB 3DV6A 4OLVH 4WWKA 3VRIA 1VESA 3FJTA 2A6KB 3VW3L 4KZDH 4W70A 3GNML 4HMCA 2MQCA 4Y2OA 3TFKC 5GGQH 3OF6A 1J5OL 3HZYA 4R4FL 1F11B 4QRPE 1A6AB 3H8NA 2ARWA 3VRIB 1G9EA 1ZSDA 5DC9B 3SDXF 2HMID 5E6YA 5DK2A 4M7LL 5HGAB 4LBEA 2Q86A 4JFHE 5DJZA 3WFCL 1YY8B 4LHUG 2Y7QB 3AXLB 1IBGL 3KR3L 4MA7L 2XWTA 5HHME 3VA2C 2VITA 4OFDA 4KK6C 5CSBA 3RNQA 3DO7B 4LMQI 1CDBA 5BZWA 1F6LL 2RHEA 4JY4A 3SOBL 4JHWH 1OGAE 4V1DB 3DIFB 1NFIA 1X4YA 2DI8A 3DUSA 1EMTH 4CMMA 3RNQB 5SX5H 1KXTB 3ARBC 3K4DA 5IQ9A 3VFSA 1FNGB 4GXUN 2IALA 4AIZB 4P4RA 5CUSL 1KJ3L 4XMKH 1NBZB 3LQZB 4MJ5B 1T04A 5HYFA 1MVUA 4OCRH 5J6GA 2HFFA 5DMIH 5HGAA 3N85H 5C70A 3JWOH 4UIMA 3FO2B 1DLHA 4N9OB 3E6FB 3LHPL 5TE6L 2BNQB 4LEOA 5HVFB 1VEMA 1YEFH 2BHUA 4LP4A 1U8NB 3PIQB 3T08A 5B8CC 3MCLL 1S8DA 4P3DA 4MQXD 4JN2A 5DK0A 3HLAB 5LGHH 1RV6X 2VXUL 3GM0A 1ZA6A 3NCYP 3LKSB 3QRFM 3PV6B 1HOCB 4OCYL 4YBHA 5EPMB 1YC8A 5DO2C 3O9WC 2NX5A 4D2NA 2YD7A 3LN9A 1ZSDB 5FOJA 4JZNB 4PJ9D 3N1PC 1MCLA 3UPAA 1WAAA 2K1MA 1VA9A 2IQAA 3L7EA 2EC9U 1MAML 1NJ9B 1XH3B 1IM9D 3OJDB 1FNEA 3X11B 3U9UB 3VMNA 3IXAA 3QQ9C 1O7SA 3RWFA 1JGLL 3RP1A 3MLYL 3VXUB 1FLRL 5DQ9B 1L6XA 1VEPA 3MLSH 3MMEB 2V2WB 1BF2A 1ES0A 3OKEA 3VD5A 2X2YA 1INEH 5HGBA 3N50A 3QT2A 3AREA 5IOPA 3G04B 4LSPL 4JZOB 2GY5A 3C5ZB 3E2HC 5KANG 5CIPH 4KQ3L 5JPMB 5ALBH 5C0FB 3WNPA 1OSPL 3VWJB 3RWHA 2ZUVA 5DDHB 1X7QA 5EBWB 2LVCA 5D7LD 1I8LA 3RBGA 3VD4A 1NANI 4QTIH 2A77L 1E4WH 4LSRH 3C5SB 1CR9L 1IL1A 3LMJH 3RVTD 1I1AC 5E9DE 5HJ3A 4C54A 3HE6A 1PX4A 3OXRA 2Z4QA 5E9DD 3VFGH 2J6EL 5B21A 3G5ZA 3OZ9L 5DVKA 4X7EC 4JRYA 4OBRA 5FV2A 2FB4H 5T1DL 5HHVL 3GI9L 3ALPA 4H88L 1G7PA 4Q6IB 1KJ2L 1KNOA 1U8MB 2DKMA 3MV11 1K6QL 3U46A 2WBWB 2AK4E 1KB9J 3BP5B 4UB0L 5IBLD 1J1OH 3EDKA 3VXRB 3LKOB 5EBLA 1AGBA 2E7HA 3JVGA 4ZS7H 2R1XA 3QHFH 4ZPVB 3RU8L 2BSTA 1VADA 3P0YL 4MB4A 3SKJL 3OR7B 3QNYA 3RJDA 1X9QA 4PRPE 1Q9LB 2AAVA 4Q6YA 2UZIL 1UJ3A 4D0CA 5H37G 3UJJH 3V0VA 1FJ1A 4AH2B 1K4CA 2QADB 2CSPA 2RFXB 4HJJH 4NIKB 2QQNL 4RIRA 2ZZUT 5ESQA 5C2UB 3SGEI 3P73A 2BVOA 5E2UH 3U7YH 1DQDL 2OXGA 3BKYH 1MHEA 5J6HB 4Y2DB 4D3CL 1PBYA 4LLMB 4MS8C 3L3DA 1ZHNB 4PRAA 3VXTB 3BD3A 4RAVA 3CSYA 3EFDH 5F1SA 3QNXB 5CJBA 1TQBC 2OZ4L 3TPUA 4CNIB 4RMTA 4A2LA 5HY9A 4AEIL 2CMRH 3VWKC 4X80L 3HE7B 5BVPH 3ZKMD 3OB8A 1P84J 1QPXA 2E7BA 3LQAH 4OF5A 5EC1B 3DNKA 3QFJA 3W5MA 1F5WA 4NZRH 2FHCA 4E0RA 1KN2H 5FYKU 2ADGB 2NY7L 5AYQA 4PGDB 1RURL 1U8KA 3EJYC 5BW7C 5GGTL 4L1DA 4U1GC 4MJIE 4P5TA 3AM8C 3C08H 1GZPB 4XNUH 4XNYH 1I1CA 3TV3H 1NAKH 4UT9H 1BJ1J 2ICWJ 1MIEH 4ZAKD 3TM6A 4MDIB 4QOKE 5MEND 2PXYB 1XCQA 2ADJA 2WQRA 1WT5A 1KTDB 3L3KA 1R3IL 3PHQA 1U8JB 4L5FH 4OCXL 5CD5D 5CHNB 3J8F7 3UTPD 4L3CB 4HD9A 5I1DA 1A6UH 2PO6A 1RIVH 1FG2A 2ICCA 3VXTA 3GSNL 1N26A 3W82A 1NL0L 1HNGA 5B4MC 1UACL 5J13C 3CXHJ 4XXCC 2AJSH 4XCEB 1B0GB 4JRWA 3OTTA 1T1ZA 3UEZA 3VGEA 4UNVA 1DANT 4K7PX 4UV7H 3RBSA 4JFED 3N9GL 3BAEH 1DQQA 1MAKA 5TPWL 1PVHA 4GW5B 5GGQL 3O8XB 4P4KB 2RAMA 5D6CB 5JO5A 5BW7A 1P4IH 3OR7A 3JTSA 1T1YB 3S98A 5I74C 2QHRH 4HPYL 3IDGB 2CRMA 1EJ6A 5IJVB 1GHFL 4PJGE 3WXWL 5ADPH 1CLOH 1CL7L 1IGMH 5F70A 1UT9A 1Q9WA 3TA3A 1V05A 3QJHB 3OAYH 5I0DA 1Z9MA 5HPMA 3OAZH 4AZ8A 4RAUA 2JJTC 4QXUL 2G5RA 3TWCH 1FC1A 3X3FL 1N6QH 4XRCA 4JHAH 5SWZA 5C9JB 5FYJD 1URLA 1XGRB 3BGFC 5KBNC 4BQ8A 1TJHH 3VDCA 4ZTOL 3CH1B 1CWVA 4GAJL 1C16A 3BT2L 3FB7B 4RMQA 2DD8L 3TIDB 5HYSA 5E6IA 4UOW0 5GS1B 1A7NL 5M94B 1HXMA 2R0ZL 4ZFFB 3DJ9A 5C0RL 1S9WA 2DMBA 3UTTE 4EBQH 2XZAH 3MBED 3DVNB 2J4WL 3NCEB 4OIBA 1EK3A 3MCLH 4I9WE 4OGXL 3WJJC 3ARFB 3CH8A 2H9GA 1KYOK 3KPNA 2EE6A 2VAAB 4IS6A 1BGXL 3QDJB 4NKMA 3ARGC 3C8KB 5GIRB 3VXUA 1I1AD 1OPGL 5JIPA 1KPVA 1FGVL 3U9UA 4K07A 2H2SC 3I6LD 1SY6L 4G7YL 4LCIH 2P5WE 4HKBB 1CFQB 3RWIB 5TF1L 3A6BH 2RCSL 5AYUL 2JJTA 2VERN 4P3WA 4N8CL 3V5KB 3V5DB 2Q20A 4HLZH 3W9EA 4LCCC 2BC4A 1RZJH 2BSED 1ADQL 2XKNA 5AZEL 3RUGF 5I1AA 3KPRA 2AJYL 1JGLH 3ESUF 3QPXL 5T3XE 4Q2ZB 2MPAL 3EOTL 1VENA 3QRGL 1INEL 3FN0L 1KENL 3PQYA 5KVDH 3LEVL 2PO6D 4L8SB 2BNQA 3DETD 2OL3B 1J11A 1GGTA 3FO2A 3O3UN 3HUJB 3MRKB 3GMPA 3STZB 3WL9B 4Y5VC 5TE4H 4PJBF 4XNMA 3BHBB 3DWTA 3PWPA 4U33A 2DBJA 4LPCA 1FRGH 2V2WA 4XI5C 3WLBB 4FQ2H 1BLNA 5DWUH 1A4KB 5IK3B 3SDAB 1JZ4A 5EU6E 2ZUQC 5CEXA 1VKXB 5CEYA 1XR9B 3VE0A 3KWWB 4OD2B 1DE4B 1FDLL 4Y1AB 2A6IA 1TCRB 1UKQA 3LD8C 1TNMA 4DVRH 5IHLB 1P84K 5DA4A 3MLZH 2YD2A 2DQGL 1QSEA 4OD1L 4YDIL 1YEGH 3P9WB 5BS0B 4Q9RL 3THMH 2V2TB 1HH6B 4JZNA 1UVQA 43CAB 2ATPB 1CLZL 3B9KB 3D0VB 2VISB 5D2LF 4HUWA 3ZDXF 4Y5VB 2BNRB 5ICZB 4NNPL 3MLUL 4EQ2A 2EE2A 5CJOL 2DM2A 5I15L 5IQ7L 3SE8L 4NT6B 3MRQB 5CCKH 1CI5A 5I8CB 1INDL 1OF2B 5I16B 3MRIA 5HBBA 5F7EL 2VWEE 3B3IA 5SV4A 4KI1A 4R9HA 1P7KB 3GIVB 3IAGC 1MJ7L 3IDMA 3PF2A 1XF1A 4IDJL 3B9EA 4FOMA 4EQ3A 5HHOD 3QDGB 5CIPB 2EYSB 5CBAA 2CIKB 4H1LA 4EN3D 3SDCB 2X4OA 5EU4A 3VFSB 1LE5A 4GSDL 4NZDA 5TGBB 4KHTL 4WI4A 3KPSE 1ERNA 4XTRC 5EO1A 3DUSB 4ETQB 2VLMD 4J4PC 4UZGA 5EO9B 3VXOB 4FQJL 4CVUA 2YMXL 3RZWA 3E6HA 1UA6H 3QUKA 3MRGA 2D0FA 2VLKE 4RRPG 5D1ZB 1EBAA 1VKXA 5L2KB 3BVNA 1T6VN 1BLNB 3G6AB 5BS0D 1JK8B 3CVHL 4XPAH 5D7JA 2Q87A 2ADFH 2H26A 3WSQL 4QRQB 2E9WA 3GRWA 3AS0A 4UT9L 2FIKA 5GGVH 1JHLH 3V6OC 3VJ6B 5DMKB 1MF2H 2XN9D 1MH5A 3IDMB 3GIVA 1VACB 4HKJA 4JFDB 1XF5B 4MMZC 5IB1B 3MV9E 3SDDC 2CO6B 4NM4H 1A64A 1YN7A 4DN3L 5C0JA 2BMKA 2MFNA 4JLRB 4PJCE 5DD6A 3FFCA 4ALAL 4M00A 3WFDH 2W9DL 4OM0H 2DQJL 5EOTA 3LKQA 1ED3B 4YR6A 4ODHH 2AJSL 3CGTA 1FZKB 1KJ2A 3IETB 4NQDA 4MJ6B 4CAGA 2VABB 2D3VA 3OGCA 3BDYL 3QIUD 4K9EC 4MA1C 4TOYL 4WWID 1KEGL 3NIFE 3QXDA 3ZE1F 4TUOA 4LU5L 2R2HA 3E0GA 2BJML 3U7WH 5L9DL 3QUMH 1OARH 3BN3B 4ZMAT 5I74B 3H3PL 3WE6A 3NCJL 3P30L 4W6WB 5DEGA 3W0WA 3WIHH 4RX4D 5JDSB 4LQFH 3ARBD 3ULVE 1A6WL 2OP4L 1FL6A 1X5JA 4QHLB 2DI9A 3EIFA 4HGMA 3FOLB 2YSSA 1WZ1L 3EOBB 5LWYL 1DUYB 3CFJA 5KAQF 3AGVA 3GJEA 4JQIL 2C4FT 3WL9A 2AKRB 4KY1H 2EDLA 5E5UB 1RAMA 2GSGA 3SJVD 4ERSL 3MROA 3IXTB 3VFTA 5IB2A 3UPCA 1LO4H 2YA2A 2PYFA 3O0RL 4F57H 1NCDH 4FG6C 2FDBP 4ORZC 1RK1A 4MJIB 1CGSH 2ZG3A 4OCWH 4PGEB 2R29H 5GGRY 1N6UA 4JHAL 1QKZL 4WO4A 3DHMA 2GJZA 2HKHH 4HWBA 2PXYC 2QQKH 1MVFA 1J8HB 2VC2H 1T7XA 5T3XH 3MRDB 4PJIB 3S4SG 4L3EE 3S35H 5C0ND 1U93B 3S88H 3QH3A 4DKFH 2FD6L 2N7AA 1OP5H 4YPJA 1EEZA 1AGCA 3LD8B 4OZIB 1JE6A 2YZ1A 1RHHA 5IFAL 4CGTA 1CFNA 1T2JA 3I6GA 4OFYD 3BZEA 4Y8AA 2J8HA 1WUNT 5CSZA 3UPRA 3MZTA 4WUUA 3T77A 5HDBE 4JO3H 5KN5B 3DGGB 3RPKA 2NY0B 3D0LB 4BH7A 1Y0LA 1TQBB 1U3HA 5EU6A 3ZYIA 2HWZL 3MUGA 4X8JB 3DSNA 1NLDH 5D8JL 5BZDA 4OI9A 1CBVH 5AZEH 2FECI 4DTGL 2ED7A 2LE9A 3OKOA 5J11C 1QSEE 1UH4A 4WHTA 4MA7H 4MLIA 3C6SA 3O41B 1WEJH 1B0RA 3EKCA 1D5MA 2ZPKL 1IAII 2ICEA 3L7FA 4MXWL 3HC0B 4ODSH 2MPAH 2Y5TA 4OFYA 5I6XB 4MNHB 1S9XB 4ZPTA 5DZNA 3VH8G 1VERA 3ULUF 1CK0H 1ORQB 4PJAF 3CLEL 4ZAKC 3FCTA 5A1AA 4MB5A 2EZ0D 4N1EA 4ZO8A 1A7PL 3W0WD 3IKCA 4ELMF 5J1TC 3GHEL 4PJCA 3VWJD 4R90H 3QCUH 3FFCE 1BM3H 4QYOA 1CG9B 4P9HH 3UROR 5KJRH 5EZIH 2DLGA 4NQEE 4XVUD 5F9AC 4IRZL 1Z5LA 4Q6IC 4HIXH 1MRFL 4LFHG 5D1XA 3O8XA 1YEFL 1WAAE 1PGRB 2CUMA 3T4AB 5HSFA 5K9QG 3ILQD 5AAMA 3ARTA 3DXAA 3KPQB 2VYRE 4KTEL 1P7QB 2R0LH 3IRZA 1GAFH 4KJPD 3V6BR 5AZ2L 1QA9B 4PRDB 3CSYB 1NANH 1QFWI 4M9OA 3BESR 4KK5D 1BMGA 2GAZB 5ISZD 2P4AB 1ZLVK 5F9OL 4G6AC 3VXSD 5BZDB 5HHXH 1J05B 3QCTL 4UQ3B 3MGTA 1NGWB 3MNVA 1HDMA 2AEQL 2BVOB 4PRDA 1RJZB 2Q8AL 3TN0A 5HHNA 5EU5A 4POUB 3DX7B 3HNSH 4ZFOA 2YN5A 3R1GL 4KRLB 1Q72H 3LV3B 5CGYC 2XPGB 5F89A 2RIKA 2JK5A 4YXHL 5EU3B 3VXPB 4YE4H 3DV4B 3HC3H 1V3KA 1QBBA 3NFSL 1BJ8A 5IHBA 2AJVH 3LN4B 1A9EB 3BKJH 2GK0B 4X7CC 2R9HC 2OL3H 3LKOA 5EBLB 3VWKA 4PB0L 4ETYA 3PL6D 5D2NC 3IAPA 4NFBA 3VXSE 3UJTH 2FEEI 1T7VA 4HX1B 1S7RB 1S7UA 5IVXE 4X4YA 5FYKH 3U1SL 4LSPH 4AEHL 1Y18B 1ZHKB 4JFPB 1WV7T 3WKMH 3BKCL 1GOHA 5FYKD 3TH2T 4Y19E 1DQLH 4HJ0C 4PGBB 4XT1C 5TDOB 1XCTA 4YWGH 4YGAB 5EUKB 4DW2H 1T1WA 5JOFB 4Y5YC 1CR9H 5LGJB 1IAIM 1U3YA 2P5WD 3MPCA 1ZHNA 4L8BA 5JHDE 3U0TB 3ZSSA 2JCCA 3VRJA 4P2OC 1FQ9C 2J6EH 2A83A 3MV7B 3ELAT 1IT9H 4N1CA 1ZA3A 2JELH 4LPUA 1MLBB 2CDEB 4FFVC 1G84A 1HQ4B 2YD3A 5C08E 3KDMA 2A0LC 1HIMH 1NSNH 2Z9TA 1S3KH 4TVPL 1Z0MA 4XXDB 3PWJA 4Z5RB 4JFYA 5J3HC 1XGQB 3B4NA 1NBVL 3HB3D 4WW1B 1Q9LA 4HBQA 3ARWA 4I0PB 5IEHA 5DJCA 3E8UH 5HYJD 3CK0L 4X5XB 4TSBL 1HXYA 3RWGB 1QSED 1M7XA 1BREA 2DQJH 2IC2A 2HT2D 1GC1L 5ILTL 1A5FL 5GGVY 1IKFL 4QF1B 3MCKA 2F53B 3UTSD 5D70H 1CGUA 1GOGA 3D2UB 2FECL 1YQVL 5JW3H 3LKQB 3HE7C 1NEZG 2NXZB 2X9XA 5IMLA 4HGKC 3H3PH 1QRNB 5AWNH 5DK0B 5SWSE 3WFBL 1MCOL 2CDGB 1J86A 4L4TE 1R3JA 2HMIC 3P4OA 2FCBA 3HG1B 4PJBA 4G5ZH 2NY6B 3O3DA 5FGCE 2CUIA 1H5BA 4F7PA 4JQIH 1BD2A 3TH3T 4LLYB 2LV4A 3UJIH 1EEYB 4LGRB 2VLKA 3GRWL 1KN2L 4X99A 3DSFH 1D9KC 3GSOA 4CVXB 5ANMA 2Y36H 5CWSB 5JNYA 3QDJD 3OKDA 2VDNL 1FL6B 4MJ5A 4YHMH 4OZ4B 3K46A 5MEPB 3VDAA 4APQC 3FT4A 2Z31A 5KVFL 2DLFH 5D7JC 4Z18A 5TQ2H 5DD3L 3T4YB 1M71B 4HH9A 4J8RB 4M8VA 4V1DA 4TULL 5I8OH 4U1HB 3PGCA 4DGIL 3DO7A 2DQIL 2E27H 4WO4D 1RIVL 1FZKA 1T03L 5D5ME 1QOKA 5INCA 3GSNH 3HAEA 4KK8D 1UG9A 1I8KB 5E8NA 1I8MA 5DJYB 5T1MA 5E24E 3RIAF 1X5XA 5DJZB 4QXGL 4G9FE 2F5AH 5H35A 5FXCH 1KYOJ 1IEAB 2DQHL 3GJFK 1KG0A 1I1AB 3T0BA 4JVPA 2R0WH 1BZ7B 1I4FB 3RY6C 3KHQA 3ULVH 3RHWF 2KPNA 5IR1B 1MHCB 3PWNB 3FZUC 1CGWA 5IGXH 4Y19A 4U1LA 2BDNL 1EFXA 2HVKB 4TRPH 3X12A 3QSKB 2VUYA 4NN7C 5I1GH 1NAMA 1LP9A 4HPYH 1AHWC 1HHIB 3QBTB 4U6XB 4HDIA 1NLBH 3CSBA 4X5WB 1CBVL 5IBUG 4NQCA 1OAYH 2W0PA 4M93C 5LQBL 5ANMB 2BK8A 5IQ9B 2GYSA 1R5VB 4EXPX 3TT1H 4UTBH 5SWSB 3PGCB 5E5MB 4PFEA 1E28B 4KTDL 4O2CA 4ZTPL 4YHOL 4XNXL 4J2XA 3RIFK 5KS9A 1FL5B 3Q6GL 3GSQB 1QFUH 3JV6B 4EI6A 3X3FH 1N6QL 5IK3A 1ZHLA 2VITB 4GKOA 1U8HB 3G5YB 3VXUE 4OCMC 5E2VL 2EKJA 1W0WB 3KPPB 3QISA 4PRPD 4MXQC 1PYWA 3IAQA 3MGAA 3V7AE 3RKDC 3MRMA 3QA3A 3ALXA 5JUEL 5TDNA 4DZBB 4U3CA 1TFHA 1IGYA 3NPSC 4MNGE 4EXKA 4R4NC 1MPAL 4NT6A 4GKZB 4URTB 3A6OA 4QXTB 5AZ2H 4KDTA 4Y4FB 1A6PA 2X41A 2PUQT 1NGQH 1A0QH 3PJSA 3EUUA 4Y4KC 1EV2E 1OAZH 5HHXL 3QCTH 3CPLB 3D2UA 4XCYA 3D39B 1P2CB 2AERT 1FZOA 1HINL 2D9QB 4UTAH 4LDEB 3EYUL 5D7LE 3BMVA 4JY5H 2H32B 1JUFA 1UM4L 3HR6A 4P2RA 2H8PB 3PUCA 1Q1JH 5L7XL 2DM7A 2VXVH 1BPVA 1HSAB 3HZMB 4I0CC 5FM5M 3SHSA 3SCMA 3TZVD 3QDJA 4X0KA 1GSMA 1JF1A 5HPOA 1IC5H 1A2YA 3QWRD 5IV2A 4IDLA 2MKLC 2FATH 1U8QA 2NY5C 4HK3J 3S96A 5EUKA 4GOSA 4OKVA 3FN0H 3G9VA 1G6RH 1IGFH 3QR2A 2VZTA 2ENYA 2VLRE 1GPOL 4N0FA 4HLJA 4B53A 2YS4A 5CBEA 3AVEA 4E9LA 3JSSA 4LLWA 5TE4L 4ODUB 3WS3A 4DAGH 1R3HB 4QRRD 3C87A 4GQ9L 2I25N 1QFWL 3TBSA 1ZS8A 5D2NE 2V9QA 5F6HJ 2R9HD 3QWQB 5LAXA 1UZ8A 1TENA 1AD0B 2ZSWA 2X4SA 5FHAH 3BQUC 5A16B 4EUPA 4GMSL 4XNZC 1I8LC 2F19H 1G6RB 1KTKE 4JRXE 2Q8BH 2AQ3A 4KZEH 1R24B 4GLRH 4FA8A 1S7WA 4XHQA 5JORA 5DRNB 3BH8A 5MEQB 4MD4A 2OJEA 1OWRM 4QF1A 3ZDZE 1A8JH 3HHRB 2WP3T 3LKRB 1RJZA 4TVSa 4FQXC 2IPUG 1QVOB 1RULL 3PL6C 1T66D 5BOPA 5E8DL 4HWZA 3WNMA 5C0CD 4YBLC 3CK0H 3ARFA 1N5AA 1JGUH 4MA1B 1I3GL 2XY2A 5JW4N 5D7IF 1I85C 4Y89A 1BQLL 2Q76A 3REWB 1U8LB 5GS1A 3ZTJH 5LVEA 1VDGA 5D70L 1YMHB 1X3DA 1AXSA 1JMZA 1QBML 2AS5M 5D5MF 1TLKA 1YPZE 4G6JL 5EUOE 3B9AA 5T1LB 2HFEB 3MACH 4XI5D 4LK4A 1LO2H 1SJXA 5C0GA 5HHMD 4EOWH 3R4DA 6CGTA 3DARA 3QULA 1MJ8L 3B2VH 4GXVH 5LG1A 4HKZA 4P5KB 2AJUH 3DUUB 4NKDB 1DFBL 1CE6B 1R0AH 4HC1A 4U2ZA 3RWEA 4MNHA 3DX6A 4G80B 4PJDE 2DQTH 2E9BA 4G3YH 3I2CL 3GRWH 1JPFA 3BRGC 3IF1B 5KG9B 1I3RB 2UVFA 4KUZL 3CJJA 5KZCB 1U8KB 4UDTA 4WNQA 2F74A 4Y7MA 4FN0A 2NY2B 3T8XB 3FB8B 4LHUB 3PWLB 3NTCL 3T2OA 3MRNA 4LASH 4BSJA 4F3FB 3ROOB 2NY2D 5JW4R 1RZKL 4JJ5A 1NDGB 1MELA 3IGAA 1ZT7A 4ZUVB 4BSWB 2CKNA 1IILE 1NMCC 4ZAKB 2EIEA 1AJ7L 3NZ8B 5D96C 3CFIC 4WUUB 1UWXK 3DMMB 4IMLB 2ZUUA 1CD0A 3KLAB 4C57C 4EUPH 4WFHE 1T21A 2E6JA 4K3EH 4XPTL 4EKXA 4LMQE 3GMLB 3DMMA 1QNZL 4IMLA 5ACMA 4M5ZL 1JZ2A 2EIZA 3GHBH 2DTML 3PHOA 1ZT4A 4W4OC 5KSUB 5I71C 2WINB 3DGGA 2WSKA 3SN6N 1ZXQA 3MLPA 3IGAB 2CK0H 1JV5A 4H5SB 4O2EB 3JBG7 3P4LA 4N0UA 4TRPL 1EAPA 3G6JE 2BSTB 1WBYB 2VDPH 1IC7H 4ZUWA 4JY6B 5EA0H 4CW1B 3HE6D 1I9JH 1A7OL 3QZWB 5FUZL 1E6JL 4LDLB 5IB3B 2X4RB 5DD5L 2ICWI 1Q0YL 3FFDA 5HD8D 4HQQL 4I1NB 4NDMA 4C58B 3DTXA 3HMWL 1T20B 5IB5B 4M7KH 3FOLA 3QUMB 1XAUA 4RGMB 3V7MA 1BAFH 4P5KA 3Q6GH 2C3WA 3OXRB 3T0ED 4LHUD 3KGRA 3U83A 4L4JA 3QUYA 1RUMH 3WN5C 2NW2B 1KCVH 4OQTL 1QRNE 1JGEB 1YYLL 5C09D 5GHWH 3P11L 3B43A 4OLWL 3EZ8A 5D1XD 1YJDH 3QIUC 4HK0B 1EA9C 3GBMH 4BH7B 2UVEA 4MJ6A 4OQ1A 2FSEA 5H37H 2W38A 3T65B 1BIIB 4XMLL 4XCNA 5BS0E 2FLBT 5IG7A 4NKOB 4PJ9B 1KLGB 5DC0A 2VLKD 5SWSD 3BP6A 1H3PL 4GMTH 1NGQL 1CDCA 3RVXD 3P0VH 5EFIB 1EZVX 5IFHH 4LNRB 4WFEE 3F7YB 2VLME 1IM9B 3PABB 2GW5A 3OKMA 4AEEA 1W0YT 4Z77A 4Z7VB 3RTQB 1HI6A 4ODVL 4JY5L 2HT2C 5L8LB 1F58L 2DYPB 2VDOL 3MO1B 2EDRA 5MEOB 1HH9A 2V17L 4LLQB 1CDGA 3EYOA 2OCFD 4WO4B 2MSPA 2HLAB 5I9QC 3L5XH 3TP4A 1CFBA 5F7WC 3C5SA 2BNRE 3S3JA 2QTEA 1N2RB 3S34L 4R2GB 4OM1H 1AY1L 5E6IC 4MLSA 3SJVA 2VDKL 3D6GA 5C2BL 3VWJA 1OY3B 4RWHA 3STLB 4U1MA 4GH7B 3SQOH 5SWQB 3L3OB 4LEOB 5T5FL 5DMYA 5F97E 1NUFA 2ZCKL 1BVLA 1ZWIA 2G60H 3LH2H 4EN3B 3VJ6A 2F8XC 5DJ6A 4HUXB 4RNRA 1O7VA 1NAMH 5CMAB 3GHEH 4TNWK 3C6LC 4OKVB 2X7LA 3QCUL 4P9HL 4DEPC 3ZTJG 2GI7A 1JF1B 4HEPG 3ULUE 5TE7H 1D9KA 3MMEA 3AAZB 2BHYA 1LK2A 4LL9A 5HI5C 5DTFA 3GMQB 1DQJB 5ETUB 1FNSL 3QUKB 5L88L 1BEYH 2VR4A 1BFSA 1QG3A 5EO9A 3OMZA 4YXKL 2JLLA 2X4UA 4WHYH 2DIJA 4J4PD 3RGVA 5K9JH 1S9KC 5IVOA 5EO1B 2R0LL 4QWWC 4S0TD 3GSXB 4XCYB 2X4OB 5EU4B 3EYSL 3MBXH 4NRYB 1C08B 3VCLB 1KELH 3LKPB 3D69B 3OV6A 3O6FA 3FOMB 3KLSA 1QYGH 1KCSH 3FB6B 1ZGLP 3BIAX 3GGWB 1YC7A 5FM5O 3F12B 1RIUL 2JIXB 3IFNL 1KFAH 4C55A 1G7JB 1II4E 3R1GH 4NRZA 5DD0L 2B4CH 2OYPA 5J13B 2YRPA 3E6FA 1TNNA 4JE4B 3VE0B 4NRXA 5DQJB 4JFFA 4R7NA 2F8VA 1S7XA 2YD6A 4GRMB 1NMAH 5DVNA 1CXLA 3HUJF 4GS7B 4O5LL 4AM0A 5K9QI 1FFPA 3GSOB 4CVXA 3ZHLA 4B5EA 1MJ8H 1MY7A 5IROA 3DETC 2NR6D 3SGKC 4ELKA 4LLDA 5J56B 3SO3B 2D2OA 2NLJB 2C1OA 4Z7QE 1FG9C 5TH2A 4F8QA 4KRMB 4I2XA 2VL5B 3HI6H 3MBEB 4KKAD 5CP3A 4YHNB 1BBDL 3B9DA 3TT3H 1DVFD 4H1LB 2EDTA 1FE8H 4PJ5D 2QL1A 4MCYA 2YPLA 1FYTB 4OLZL 5DQJA 5CKGA 1QFOA 5KVEL 4OF7A 2XNAB 3AMKA 4WUKH 2QR0A 1SVCP 3GMMB 2CKBL 1A6TB 4KI5C 3MCKB 4LCYB 5E8EB 5GJSH 1IM9A 3PABA 4QRRA 2NXYC 4M62L 2VKWA 2V5SA 15C8H 5HVGB 3MV7D 3QXAB 4XVJL 2BNRA 4LVOB 4P5MB 2V2XA 3ZTNL 1Q9OB 1KCKA 4DUVA 4RBPH 4WU7B 1KCRH 4FZ8H 3X14B 5ILTH 4ZUTB 3VG0L 1NMBH 1PZ5B 1AKJA 1BD2E 2DTMH 4ZFFA 5GGRA 4LEXL 1SMAA 3HZVB 2M1KA 2VLJE 5ISZB 5IUSA 1CD1A 5SX4I 4D8PA 1AGDB 4WEUD 4P23C 4KTYA 5DT1L 3I6KB 4DUXA 4NCC2 4DGVH 3BN9C 3WLWD 4Z7WE 1JYWA 1T20A 2EXWC 4YH6A 2P5EE 4IM8A 2X70A 4HZLA 3M1BA 2DQEL 3VFOB 4L4VA 4LQ1A 3KYKH 4XVTH 3C8HA 4A2MA 2GTZA 1DBBH 5FO9B 4M7KL 3HG1A 5EUOB 3ECBB 1KC5H 5GS1C 4QNPF 4LSVH 1TJIH 3SBWA 3ZL4H 3QO1A 3D1MC 4EIZC 5IF0B 4L9DA 2XY1A 3E3QC 4GAGL 2APFA 3AUVA 2BXZA 5TQ2L 4JM2F 1G9MC 4OB5L 3SDDD 2HVJA 5ICYB 3DROA 2FZ3B 4C83B 1ZGLA 3ZZ1A 4FMKA 3IDJB 2MHAA 3PNWB 3EYFA 3SJVE 4M3JA 2R15A 3V6FB 3ARDB 3OF6D 2FR4B 1QHPA 2XOTA 2QSTA 4Y8DC 1HXYB 2FGZA 3HCVA 2DQHH 4PJGA 4OIIH 1JPGA 3GSUA 2R0WL 3GBNL 32C2B 4R97C 3W11C 2P8LA 3KPQA 4OZGE 2IANB 3BJLA 5IGXL 3KPMA 4Z5RA 4C56E 1YEEH 4Q74A 3HS0B 5F8QC 3G6JB 2CGRH 4PJCF 4M43H 3TCLB 3GSWB 4Y19D 1NLBL 1INQB 3CLFH 4HS6A 4P5TB 5HDLA 3BEVB 2V17H 3OB0H 3UDWA 4XCCH 1XGRA 1MCCA 4PRIB 2W0LA 5KVMC 3IKCB 4UTBL 3PWVB 3T0WA 1AY1H 3W39B 1F2XK 3DX6B 4G80A 2J6EA 5TDOA 4HG4K 4PJFB 2K7PA 2A9MH 4NDMB 4L3EA 3BDXA 5T5FH 4YHPA 1HKLL 3TNMA 3DUUA 4R26L 8FABA 2I60H 3LDBC 3VMOA 5IWLA 1E0OB 4TUJB 4QHNA 1S78C 4KI5E 2FX8H 1OAQH 2EDQA 3LEYH 4PREA 1NCWH 5TE7L 1MHEB 1TXKA 5DJ2A 1T1YA 5IEKB 5K59F 1DQTA 3QFJB 3PWPE 4M61A 1J0HA 1YNTB 2XQYG 3TN0D 4YBQC 4AH2A 4JDTL 2W07A 3CU1A 3B8YA 4KQ4L 2O5YL 1MLCA 3PXJA 1JPST 3EYSH 1TETH 2YC1B 1T2XA 2EIDA 3OKLB 1U6AH 1U9KA 3ZE2E 5J6HA 4U6YB 4BZ1L 2R0KH 4EEEA 2I5YL 3A67L 5CZKA 5DQDL 3ARDA 2PW1A 1UENA 2AEIT 3IDYC 1W8NA 4NFCA 2C1PA 2YBRB 3J7HA 3QH3B 5E95B 1YEKL 2W59A 2ZOKB 3A0OA 8FABB 1FFNA 1S7TA 3RFZC 5DHVH 3V4VL 5I18H 2FH8A 4QGTA 1J8HA 3HC4L 3O6MH 4D94A 4KKCD 4OUOA 2IGFH 4P5TC 1BGXH 4X9HA 1SVZA 1N0XL 5DRXA 3TO4A 5GISH 3LKNA 4YHIB 1RK1B 2VSDA 1NMAL 2PNDA 1IFHH 4MJIA 5ITFB 3V5HA 1IZJA 4RQQA 4PJXF 5HYJA 4JKPH 5JHLL 1S78D 3OKYA 4TUJA 4N8VG 1M7DB 4WTZA 4PTTB 5DJ0A 5F7FA 4W68A 5TF1H 1T5XA 2W60B 3WS6C 1HHKA 4QOKA 3UX9B 3O3BA 3BZDA 5HYQA 3F58H 1OL0A 1CE6A 1EJOL 1RZJL 3GJEB 2ZG1A 4XBEL 4OF3A 2BY3A 3TVMD 3MLWH 4UDUA 1QEWB 1IMHC 1IBGH 3KR3H 4EI5B 2IBBA 3C6SB 2EDHA 2BOCA 3H9SE 3FQRA 2BXYA 1REIA 2E7LA 4FQLH 2GFBA 1UQSA 2D7TH 5DHYA 1FE8L 4YUEH 4XAWL 4JPVH 4DZ8B 5FUOH 3PNWA 1U3HB 2H32A 4WUKL 5EU6B 5F21B 4WEMB 4RIRB 1PZ5A 1LD9B 3EDEA 3GSRA 25C8H 5GJSL 5GS3A 3VXRE 4HUVB 5C09E 5CGMA 1RULH 1NC2A 1VCAA 4Z7WA 3T77B 1XMWA 2W65B 1OTUC 1T22A 4LSSH 1YUHB 1KN4L 3NACL 4UOJA 1FAKT 3IXAB 1D5IH 4JN2B 1QP1A 2Y6SD 3MRLA 4ZS6C 3VGFA 1QVOA 1BFOB 1YN6B 3CFEB 2IF7A 1OGAD 2Q7YB 4UIKL 1QLRB 1HSBB 1U8NA 2VQTA 3LRSA 4KK9D 4MSWA 5LBSH 4F80A 5I73C 2VXTL 1KIPA 1XGUA 1J0YA 5K9KB 2AK4B 1OT2A 3DRTB 2IH3B 1AI1L 1JI2A 3MACL 5GRJH 3T0DA 5HGDA 4JFHD 5JZ7C 2IQ9L 5D7JB 2LABA 4EOWL 2IALB 4AIZA 5AD0A 3KNBA 2YRLA 4APQB 3QIWC 4X6CA 4CVWA 5FK9B 2GTZB 4XGZA 2BOBA 3IS1X 3RDTC 2B20A 5BZWB 4RISL 3UTTA 3O3EB 3TO2B 5CEZL 3IT8D 2DQDH 1FBIL 4WV1A 2YSSB 2HFFB 2OJZL 2YRZA 3QZWG 2X89A 4LPWA 2ZUSA 4NP4L 4KC3B 4GSDH 3SE4C 1E27A 5EC2B 4NQCD 2QSQA 1RZKH 2PF6A 2NXZC 1U2HA 3V4UL 3WIHA 3UCRA 4XP4L 1G7HB 1D5ZB 3CDGB 4M7LT 5T3ZL 4OF0A 1YNLH 3BN9D 1MCJA 4ISVB 3SQBA 3C9NA 5MP6L 1CZ8H 2EECA 4WTWA 3E3QE 1T5WA 1YEDB 3MLVH 4P5MA 4KK8C 3VXQA 3MJGX 3WDJA 3GBNH 5GGVL 4XZUB 2D31B 4N5UA 2VE6B 4M4RA 4OAWB 4I0PC 1BIHA 1RZ7L 4Z6AT 2APTA 1F8TH 4U1HA 4LRIC 1HHGB 2AXFA 2VDRH 4OI8A 4AEFA 4GS7C 1JCKA 4QTHB 2A6KA 3RY5A 3K7UA 4DN3H 3V8OA 4ZFGH 2VZOA 3SKJH 4M03A 4WW2C 3QDME 4NSKB 2R1YB 2H26B 3CLFL 3WFDL 3RWCB 1U58B 2XQYK 5JLZB 1YZZA 3GI8H 5CWSA 4PYGA 1EEQA 2DMCA 1L7IL 3JWDH 3RY4A 5KW9H 4O00A 5LXGH 2MKWA 1G9NC 1BD2B 1MFNA 4NN6C 4D9QD 2V7NB 1F00I 4I13B 3DIFA 3BD4A 2VXSL 1MQKH 1TVBA 3LCYA 4IOFC 1EGJH 1RUML 4JHZA 3L3IA 4OQTH 2FJGA 4N0CC 1SYSA 1T2QH 1EHNA 4HXAH 3VXQB 4AEIH 2OSLB 4YDVB 3LEYL 1F3RB 4X80H 4WI7A 4BFIB 1T66C 5D2NB 3O6FB 4JFQB 3L3JB 1UZ6E 5FYLD 5EN2A 1LP9B 4F7CB 5IBLC 5CLWA 4G7VH 3CX5J 3ULSA 3RPIB 4Z77B 4XWGH 2Z8RA 1A1MA 1FIGL 3MODL 4UOW1 3RWIA 5L0QB 2YPLD 5C7XL 1JHKH 1GGUA 2X4UB 3WD5L 3WJLC 3BISA 4N8PA 1CGSL 4XNUL 1RZGB 3VXME 4HFUL 2JIXA 1PW3A 1CT8B 3M8OL 5EC2A 3RWDA 4PJ9A 4DOHB 3CUPA 1F6FB 1IQDB 4KRNA 1UCTA 3AAZA 2P1YA 2ZUWA 1T0NB 1G0YR 1EXUA 2R0KL 3R06B 3WIIL 1OTSD 3GSRB 1KJMA 4HXBH 3AFLA 3BZ4A 1GGIL 2DLTA 4NNYB 4XPFL 4JFZL 4JM4H 4PG9B 1KJVA 3CFKB 4HH9B 4J8RA 4U6HB 3FMGL 2I27N 1C16B 4ODXB 4XP5H 4Z7UF 3ROLB 2CQVA 5B39B 3KWWA 1GRWA 4FQIH 3L1OH 2NNAB 5C0DA 2Z31B 1KIRB 3D2UD 4NUJA 1ZLVH 3O4LB 4KWUA 1N2RA 3VU2A 4H0HB 3WLBA 1T4KA 5GGSA 2FYYB 3V6OA 1MWAH 3HN3A 1UZ6F 1HH9B 3DTXB 2ZCKH 3HUJE 1ZHBB 3CFBB 2ILLA 3QJHA 3WEXA 1IE5A 3O2VL 2W0FB 2JTDA 2XTJE 4JRYE 3VGBA 3MV8D 2E9JA 2CDGA 3OR6A 4H8WL 3TBVB 5F72S 1E4JA 3EBAA 3BUYA 3O81A 4U0QB 3UTQA 2ESVA 4KPHL 1JGDB 4JPWL 4D0DB 4F15B 2IFGA 1XF3A 2R56H 2DL2A 5F71A 4DCQB 3PDOB 3TWCL 1TTGA 2F53A 3PHOB 1YNKH 4LOUC 1I9RL 3EDJA 1B0GA 4FQ1H 3SDXB 3MRFB 1P6AB 4MXQD 3B9KC 1KCSL 1JRHL 1K4DA 4FHBD 4HS3B 1F4WL 4BQCA 2HKFL 1FG2B 3ALWA 4DOHE 2R0ZH 5C0RH 3H0TA 1XIWC 4TQEL 5F1NB 4U1KB 4XCFL 1J1PL 1K9TA 5E8PA 3MBEC 1PKQB 3O3BB 4UV4H 3K81A 5GS0C 3G5XA 2VXTH 1JF5A 4CN1A 1OPGH 1T5XB 2W60A 3QDGE 4X4ME 5DJ0B 1C5BH 3O8XD 1FZMA 3BRDA 1G6VK 1WWAX 3Q1SH 3SKNA 1RU9H 3QIBB 4QHKJ 2JCCE 4XC3H 2YPLE 1T83A 2B7DT 2RCSH 4POYA 3HNSL 4Y4HC 4JO1H 3DYOA 3WV0A 3FCTB 4X6EB 4C56D 3VXSB 4O2EA 5IB5A 1D5XA 4S2SB 3WHXA 1UYWH 3HE7A 2EDWA 3QUZB 2FEDD 1ZVSA 5B3JE 4G8GA 3HI6L 1BECA 3BIKA 3MOBH 4KHXH 5F7KC 1J0IA 3TO4D 3BXNB 4YDJA 4MZ2A 5MHSD 1CDJA 4R7DB 2NY4B 4S1QH 3PXHA 4HCRA 2YC1A 4P2RD 3T0EC 4NP4H 4NC1E 4XPGL 3KLAA 4PJXB 3CIQA 2WLZA 1KIQA 4NYLB 3EJZC 4IMKA 5DJXA 2FGWH 2RFXA 3OAZK 4JREC 1PKQA 5C09B 3LB6D 3BD5A 2A74A 4LRNH 2WWMC 1MNUH 4TPRL 3OXSA 4X6BB 2AXJA 2NY2C 5D93B 1FVDB 3O3AA 2HH0L 2WUBL 2G5BB 4P59H 1H3UA 5ACZA 1AD9A 3ARFC 5FUCC 4UQ3A 3T2NL 4KVCL 5DJ2B 3FB8A 4LHUA 1RUQL 3MLVL 1KCRL 3DLQR 2ZSVA 2JB6A 4U1JA 3B8SA 4XWOD 1WBXA 2NPLX 1EEUA 1NCNA 3LOWA 2YR3A 2VH5H 3IF1A 4L3CA 3FQNA 5DMGC 2P24B 1LNUB 4MD4B 5F6HI 5JORB 1Q8MA 2BNQE 1ZVSB 4TVPH 1IZKA 1XCQB 3BW9A 1U8OA 4R8WH 3BGFB 1QBLH 3ROOA 3MLUH 1Z5LB 5DUML 3PWVA 3WCYA 3BUTA 4BA8A 2K7QA 3SE8H 1MHHB 2AGJH 4ZSOE 4JHBA 4KMTL 3MRJB 4JGJA 4TSBH 1OQOA 2VKXA 2VLJD 1N7MH 3QFJD 3HPJB 5ID1B 5H8DA 2AJXL 3HE7D 4LAJH 5I9QB 4GKSB 3VA6A 2Y06L 4ZO9A 3QHTC 5L2JB 4WFHD 3MXWH 5DVLA 1WLHA 1VFAB 2EC9T 4R96B 4YBLB 5D1ZC 1Q94B 4N0YH 3AREB 3BGMB 1MFEL 3OKEB 3AM8A 3VGAB 3ILPB 4LVEA 4MD0A 4YFLF 1OD7A 3OKNA 4K3GA 5E70A 3SDCC 1AGDA 3QI9A 4HKXB 4OIAA 5T1LA 2WIMA 1M6OA 3VFUB 1RMFH 3V6FA 1OLZA 2OR7A 3CDYA 4TUOB 2DWEA 1U8LA 5IKCB 3L5IA 2AV1B 4OLVL 3QI9C 2B39A 1KJ2B 3OJMB 1ULVA 4JPKL 3EYQD 1T7YA 4Y4HD 1I7UA 2MJWA 4YR6B 5EOTB 3TJEH 5TF0A 2ESVB 1B9ZA 2V2XB 3HTLX 5C6TL 2JJWA 1IGTA 2OR8A 2OR9H 1D7FA 2ZSWB 3MRCA 1UZ8B 1S8DB 5EU7C 4CDGC 1IGJA 2YWZA 1DSFL 4YK4C 4QRRB 4HKJB 3SKMB 5B38A 1GOFA 1MH5B 2CGRL 4M43L 5CBEB 1MCWM 3QDMB 2LAGB 3ZT5A 4B7IA 2Z35B 5AG9A 3BPOB 3QUZD 4XVSH 3V52L 3G5ZB 1JWMB 3VFNB 2A6JA 5DLML 2RQ8A 5MERA 1XIWB 4YHNA 5BRZA 3SDAC 4IJ3B 2ZNXA 3VW3H 4YC2B 4EI6B 2XN9E 3B9VA 3LRHA 5FA3B 4LU5H 3MRGB 3LQMA 1UFUA 1IKNA 5D1ZA 5D72L 3O6KL 1VPOL 2PYED 4ETQA 3JWOC 2F54E 3FB5A 3NCJH 4TYUA 2OBGA 4ODBD 2XT1B 5C1MB 5I1GL 2DTSA 4S1SL 3SDCA 4LQFL 1Y6KR 4AM0B 4PGJA 3FQXB 2NY0D 2EYTB 4HGWB 2ADIB 1LVEA 3TBWB 4JRXD 2AEPL 4G8EB 2YXMA 5CIPA 1AQKH 4X0KB 4OFVA 4U6XA 1AP2A 5DHVB 4BZ2L 4Y4FD 2R23A 3FO9B 4M1GL 1CT8A 1NPUA 4RGNE 4FXLA 4X7DC 3H3KA 4ZTPH 1IGYB 3TYGL 1A3QA 1FVEA 3QIWB 5GRVK 1SM3L 2EH8L 3ULUH 3SGKA 1EMTL 3UAJD 2P8MA 3K8MA 5C0EA 1J0KA 3ULUD 2HKHL 2VLRD 4NKIL 2UY7A 4YAQB 1ITBB 4Y5VA 1S9VA 3EW3B 3GMNA 4BFIA 4BZ1H 3K2UL 3GO1L 1HOCA 3W0WE 4P2QB 2XG4A 4DJMA 5C0CA 1L0XA 3KS0H 4E41A 5I1EH 2P8MB 1U8HA 4K3JH 2V2TA 4GKZA 4UI2A 4I2XB 3EFFB 2N56A 3BIBX 3RGVB 1XF4A 4XCFH 4PJGF 1CU4H 3OPZL 5IMKA 2VIRA 1M71A 5SX5K 5E5MA 1X5ZA 1MPAH 2B4CC 4MXVF 4BZYA 4OZGA 5BV7L 4F7TA 2I07B 4JDZB 1LO3L 2VXUH 5F9JA 4XBPA 4QRQA 2FBOJ 1A22B 5J6GB 2L7UA 3NIGF 4G8EA 1XGYH 2SEBA 4OZ4A 5FYJL 4XNQA 2EYTA 4BSVB 5JHLH 1X5KA 3FONA 1YPZA 4WV1B 5F9JB 3MUY1 1YECL 4NRXB 1HINH 3HUJA 1LE9A 3PWPD 4IRJA 5E5RB 1ZWIB 5D8JH 3F58L 4MA8H 1PLGL 4FABH 5JXAH 4WU5A 3MJ6A 2XTLA 4XX1E 4X4XB 4ZDHA 1K85A 3MRHA 3OZ9H 5FA3A 4MAYA 3MC0A 5HXMA 4APQA 3JV5A 3QQ4B 1F45A 5IJKC 2DS4A 4KHXL 4NHCL 2NYYC 4EVNA 5DJ8B 4MXWH 1KB5B 5I1AB 1JWMA 2X5PA 3VFNA 1J1OL 4YAQA 4Q9BA 3D25A 1R6VA 5FUOL 8CGTA 4JPIA 3RTQA 4FP8L 5C3TA 1A7PH 5F1IA 2Y4SA 5D2LB 4FQXB 1CFQA 4K9EL 1F2QA 4P4KC 5EWIL 2Y25A 3C60A 5KJRL 3EJJX 3FT2B 3WYRA 2CJUL 2CUHA 3MRCB 5J7CC 4P59L 1KG0B 1K5NA 1YUHA 1ZVYA 3HR5B 2LTQC 1QR4A 4XCNB 3VFGL 4KJQC 1KLUA 2DJSA 5HVHC 3BKYL 3B9KA 3D0VA 2X7LB 1ORSB 4P2QE 3ARQA 3CD4A 5DRWA 4LVNB 4RNRB 3B2UC 3K4ZA 1YMMA 1UJTA 4B7LA 5GSRB 3V7AG 1TVDA 4Y1AA 4KMLB 4Z7NF 1DQMH 4Z7UE 1P4BL 2Y1VA 3O3DB 1J1XH 4PGCB 5T3ZD 2JCCB 4AL8L 4GKNB 4QEGA 5DUMH 2XZQL 5C9JA 3BGAA 2WIIB 1MUJB 4I77H 4FTVD 5JZ7D 1W72H 2B1HL 4LGSB 2VLLA 5E2WL 2QQLH 5IVNA 5F9WC 4HLZG 5JNYB 1EO8L 2CKBA 3RI5K 3UBXB 4YHLL 1ADQA 4Z0XA 5L6YL 2Y06H 5EBMA 1RZJC 4R2GD 5EOCH 2NTSP 1ZAGA 5F9WB 1M7DA 3U7YL 4G6JH 2OL3L 5IW6A 3LRSB 1FFRA 1AE6L 3GBLA 2Z92B 5CS7A 5EFIA 3VWKB 5EIIA 3MRJA 3H7BB 4OCXH 3MV9D 4GXVL 2D0GA 2W65A 1DBKH 2H1PL 3VI3E 3TF7C 5HDBF 1RIHH 1Z3GL 5D6CA 5JO5B 2X05A 4F7MB 3V4UH 1UACH 1A1OB 2J8UF 3L5WA 4ZXBB 2APBA 4H20H 3RDTD 3QFJE 1K2DA 1T7ZA 4EI5D 4HJGA 2J8UA 4JQVA 2CDEA 4HG4J 1CZ8L 2HG5A 1RURH 1EUUA 1JNNH 1MEXL 5EH1A 2JELL 3RVVD 2PO6B 1JFQH 1BD2D 1F4YL 1RZ7H 3VFRA 2WBJC 3KLHC 4KJYA 2ADJB 3BYTA 5ADOL 4XXDA 5ICXB 3DUHA 4D0BA 5F7UA 1CL7H 1DTUA 1AXIB 1TVHA 4NQVA 5FECB 5M95B 3RX7A 3HFMH 2GCYA 4XWOC 2Y6SC 3I50L 3FB7A 1D6EA 4JO2L 1ZTXH 2B5IC 2EDOA 2VJXA 4M6OL 5A2JH 2EYRA 5FGBC 5ITFA 4WHYG 2CLZB 4QYOB 3S35X 2NY3B 4HBCH 5DLMH 3ARFD 3CXDL 3LKNB 2XZCL 5BO1L 2XYCA 4PS4H 3AB0C 3HB3C 4KJWC 4QOKD 5E4EC 1QFHA 2QSCL 3UDWC 2FHFA 2VAJA 1A6VH 1JP5A 2R1WA 3NIGE 4MAUH 1S7QB 2CK0L 4NO0B 1MQKL 3LV3A 3KPSB 3OSKA 5FEBA 5C0CE 3PGDA 1KOAA 2BFVH 2XWBB 1D5MB 1KT2A 1A7NH 4HX1A 1H3TA 4PY8I 3QIBA 1JI1A 1CLOL 3AS1A 5DR5L 2H32H 2AEPH 2L0DA 3FRUA 4FFZL 5JHDD 1JNJA 4WVRA 1I85A 3GB7B 5F88A 3MOAH 3TVMC 1YMHA 4XP9L 4PY7B 2NY3C 1I1FB 1W8OA 1Q0YH 1EHAA 3O3AB 2OX5A 2B5IB 4UT7L 2Q3ZA 4MNGB 2VDNH 5KSBA 2ED9A 4ZODA 3TYGH 3TPKA 3CX5K 2M26A 5C09A 4M6AA 4F7MA 3ULUL 5LJYH 1N5AB 5HHPB 3TN0B 1OTSC 4OZIE 4ONHA 2OI9C 2RBLA 4GUPA 1OCWL 1P4LA 2X40A 2F5BH 5T1KB 4LIQH 3FQWA 2A73B 2Z92A 2K9UA 4NGHH 4PJCB 4KKCC 4KVNL 4ZO6A 3MV01 5DUBB 1SJHA 4GLRI 4XPFH 1KTDA 1T7WA 2X4NB 2VLJB 4UQ2A 5CGYD 4AMKH 3KPSA 4QT5A 4DCQA 5I6XC 4YDKH 5JW4Q 4W6YB 4XP5L 1CU4L 3OPZH 4HC1L 4MHHG 3UTSB 4OGXH 1IC1A 3LEVH 3MSPA 2KQMA 4NO2B 4L3AA 3TBVA 2YOCA 2AK4D 4PR5A 2JJSC 1FSKB 3GMOB 1CYGA 2IPKA 2BDNH 3N1GC 3BWAA 3K80A 2GTWB 3MROB 3A6BL 2XRAL 2F54B 2EZ0C 3ARBB 3H42L 2YK1H 1FFQA 1AR1D 3EOBA 1HHJB 1JL8A 4O51B 1JNHA 2IANA 2BVQB 3DO3A 2OXHA 2VLLB 3RJQB 2XN9A 3MV8E 3Q5TA 5F96H 4I9WD 3QPXH 3WHE1 1UB5B 4KPHH 4RWYL 1CFNB 3I6GB 1SEBB 3D18A 1CGXA 2VXQL 2XA8H 3BE1L 1KENH 1NUGA 5KVDL 4P2RB 1P69B 5GQBA 3HRZB 3TYFA 3GSVA 4NQDE 1XEDA 5MEQA 1OD9A 1OVZA 1EH9A 5DS8B 1FL3B 1JPTH 4K9EH 5ESAB 1RZIB 4ZYKB 2E7CA 4D0DA 1P7HL 1S7SB 5DJAB 1IC4H 4G43B 4LVNC 2FO4A 5FKPA 4FQ2L 3BZFA 1I1YB 3ZDYF 2HTKD 5I75B 1DUZB 4OD3L 1J88A 1U2CA 1ITCA 3CZFB 5IF0A 1MFCH 2PTUA 4QCIA 4MQXC 1RZGA 1FNSH 4C56B 5JUEH 1UWEL 4YXKH 5K9JL 4JO4H 4P57A 3SDDA 1R3HA 5I1HL 1QZ1A 3WEXB 1TZIA 1LDPH 1SY6A 3VFOA 4Q9RH 3D39D 3NIDF 3THML 3ZHDA 3KXFA 3EJZD 4OTXH 1CLZH 4E41E 4JFDD 3RIFF 1U8IA 5TDPA 1W0WA 3KPPA 3VXMD 2X4PA 1T04B 1XGPB 4NHUA 3KYMB 4DKDC 1A2YB 3BH9B 1UA6L 2IMNA 1O0VA 2IFFH 2WIIA 2ZCLL 1KTLA 3LN5A 4HAFA 5DEGB 5CJOH 4Y16C 5JDSA 3W0WB 3D87B 4M6NL 3ARPA 4JO1L 1W0VA 2B1HH 4MYWB 3GSQA 2BNQD 3PWUA 2EDXA 5F7EH 3D3VE 2BSRA 4JFEE 5IBTH 3KPRE 3MFGB 5FYLE 5C0NC 3QUYC 3HZVA 1YEHL 5GGRB 4IDJH 1P5VA 3ARYA 3BDBA 1FLRH 5M7QA 3WNNA 1T6WA 4PJHE 1MI5A 3O4OC 2GUOB 3KJ4B 2CIKA 4CKVX 3V0AC 4S1QL 4DFHA 4I5BA 2HP4A 1QO3B 3UTPE 4J6RL 1L4IA 2VNCA 4YXLH 4NUGL 5EZOL 3RWFB 1K5NB 3VFMB 3X3GL 4NBYB 3K8LA 2FGWL 1OTTC 4FQJH 4JFOB 1MCKA 4TPRH 2W9DH 2J5LB 5GS0D 4ZD3L 4P2RE 3QNZA 4GG6E 4LSRL 3IETA 4KK9C 4NQDB 3QEUA 1I1AA 2FIKB 2IAMA 3RGVC 2CDFA 3L3JA 1AP2B 3RWJA 3EO1B 3IDIA 3QDJE 4OSUH 5DGRA 1JNNL 1MEXH 3FFCB 3R0NA 5IESH 4Y0GA 5I1LA 2EDKA 2NW3A 1JHTA 5E1AA 4H88H 1MI5B 4MDJA 2CRYA 3VG9B 1LP9E 3NFNA 1U8PB 4G8IA 4QHUB 1UB6B 3OAUH 3FB5B 4JFDA 1B4JL 2A6IB 4L4TD 4WHCA 5J06A 3T4YA 4JN1L 4ZS7L 2EH7H 1JTOA 5EOQH 4TSAH 3HFML 1MFDH 3IU4H 1VFBB 4WI2A 1X4ZA 3WJLA 1OSZB 1P53A 1RUPH 3QXUA 4JVUA 4O4YH 1S5IH 1OTUD 1NBZA 4Q0XH 5DFWH 1IJ9A 4WCYL 2AJXH 4YX2H 1NCDL 5JW5A 3QDGA 4NQEA 1RFDH 2YWYA 2D9CA 4PY8J 3O4LD 1HWGB 5A2KH 1EEYA 4HFWA 4XH2A 4LEXH 1X5FA 1DQDH 4KMQA 1N4XL 3SKMA 1JJUA 2BJMH 3BO8B 1OARL 5T3XL 3PWNA 2H6PB 1J18A 4O58L 4P2CG 3TEUA 2PCPB 6FABH 4G6KL 1Q0XL 5DEFB 3U0PB 2D7NA 4JKMA 5DR5H 4AENB 1NGYA 4FFWC 1S9VB 3GMNB 1FGNL 1MSPA 3MLRH 5D6DC 1UM6H 2JJVA 4HV8A 4JFXA 3W9EB 5E99L 2IAMB 3P3YA 4NRYA 2DM4A 2N1KA 5DS8A 4XP9H 1F11A 3QNZB 4LLVB 4XVTL 3HZYB 2XWJB 2IPTH 5ESVA 2Q7YA 5J4MA 2ENSA 4YJZL 1KACB 4LSVL 2HJLA 4N8VB 3QDHA 1SEBA 1NAKL 3D18B 5EUOF 1KEML 2R29L 5C6TH 3O2WH 4GAGH 5J8OA 2YPKB 1EZVY 2F5BL 4HHAA 4DQOL 1CFVL 3AU1A 4EUPG 4L8SC 2VB5A 4KJPC 1I9IL 3EOAB 2AV1A 2AW2A 1P9MC 3OHXB 1OW0A 4AMKL 2F54A 3B5GA 4KKBC 3GKWH 5ERWA 4RFOH 1ZA3B 5KOVC 1C8PA 2OK0L 5EZLA 4QHMB 1M05B 1OHQA 4UNUA 1FVCA 5D96B 4MD0B 3PP3K 3UYPA 3V6ZB 5GRYA 1ZEAL 4P9HC 3UC0L 2A9NH 1JZ7A 4IOFD 1VB9A 4I4WB 4XHJC 4HIHA 3VGAC 4ZQKB 3V9FA 1AH1A 3G08B 4GAFB 5C08A 1PG7X 1UWGL 4PJFE 1GHFH 4KKLD 2Q6WB 4EDXB 4LNRA 4J4PA 5EA0L 3GMRA 1BFOA 5FKAB 3VXMA 1DN0B 2IAMD 4Z7NE 5F96L 3MRPA 1C5CL 3BZFB 1H8OA 1UM5L 3ULVF 1S7SA 1NC2B 2EKSB 5CGTA 3OXSB 4CBPA 3DVNA 5F9OH 1AR1C 4JAMA 5I1JL 1H3WM 3CLEH 4RGOL 5DD1L 4DK6A 4I18C 2H41A 1BWWA 4GW1A 3W5NA 4L9LA 4I0PD 3NIFF 1VGKA 2H2SD 3ZE1E 5C07E 4WJ5A 1Q72L 3K2UH 2E9IA 4HKXA 4I3SH 1IC4L 3MJ7A 4G8FA 4XXCA 3QHZH 3U0TA 2GFBB 4L9LC 3QCVL 1ZOXA 2FWOB 4K3JL 5SWZB 4UDUB 3NZ8A 5GZND 1NCBL 3L3KB 2ZCHL 1EPFA 5EZJB 4GG8B 3P9LA 5T33H 3ZT6A 4XB7A 3MV9A 1LDPL 5HYSB 2VSCA 2LQRA 2GT9B 1QPPA 4NC2B 1GGCL 1KPRA 1GGBH 1VSCA 4IEFB 1FGVH 2PXYD 4DKAA 2F58H 4PREB 4F33B 3PL6B 3GK8H 3CH1A 5F7NC 1B3JA 3IYLW 3O11A 1JPSH 2UUDH 2E6PA 2IFFL 1WBYA 2X4QB 3S36X 2DWDA 4DN4L 4B50A 2GK2A 4YDLB 2QKIB 1IEHA 4XPBL 4FABL 1F58H 2VDOH 3H7LA 4FZEH 4J3TA 4XMPL 1IGCL 3BX7C 3VGDA 5ICXA 3I02A 2VRAA 5IHZB 2EXYD 3FQNB 1A4JA 2YD5A 1K3IA 2DN7A 3SKNB 1QACA 4YHKL 4K3DL 1H15A 3FQTB 3D9AL 4F2MA 4WJ5B 5ID0A 2G60L 3LH2L 3EOYG 4ONHB 4AEHH 4FP8H 5I1DB 1BFTA 3V4PH 2JJSA 4N1HB 1LWRA 3X3GH 4PJIE 1NAML 3QYCA 4NQXA 4JGUA 4MA3B 2YPVL 2HJKB 3GJFB 3IFOA 2A74B 3L5WB 3KPMB 4ZXBA 1ZT7B 5DC4B 4PRPA 1BZ9A 1DVFA 4M7JL 1IKFH 2P46B 1J9CT 3CCHA 3GSNB 5CD3A 1H9VA 5L88H 2BCKA 1BQUA 3KPLA 1I8IB 3H7BA 1C7TA 3L6FA 4RMRA 1BHGA 4QKXB 1S9YB 4XC1L 2MOVA 2R2CA 1AGCB 3U0WH 5CHNA 1AGFB 1MJJB 4YDIH 2W0FA 4NN5C 2NMSA 5EOCJ 3I02B 3NAAL 2WBJD 3KLHD 4Y4KB 1JGDA 4G5ZL 2W92A 1YMMD 4NWUL 4JB9L 2QKIA 3HMXH 5I71B 2ICEB 3L7FB 1IEBA 1KV3A 4TSAL 3QULB 5I15H 3IFNH 1MUJA 5IQ7H 1C12B 4PD4K 4M48L 2QQLL 1ZS8B 4TUKH 4YFEA 4KU1A 2CXKA 2AABL 4Y2DD 5FO9A 4G6MH 2ADGA 2HT4D 5DURD 5I1CH 2G9HA 2B4CL 5C0FA 2PTTB 1AFVL 4U0RB 2OS7A 4K7PY 4NNYA 5H94A 1Q9KA 2YZ8A 3TA3C 3G04A 3OAYK 4I48A 2DOCA 3GM8A 4QHLA 4XHJD 4L29B 5BRZD 1CICD 3D85B 3NCCB 1CDYA 4O58H 2KL6A 2NY5H 1MCQA 3BSZL 5C0DB 1Q0XH 3P9MB 1QR1B 4HIJA 1QFPA 5IVXF 1AC0A 4U1SB 1DEEB 1UM6L 1X5HA 2OMNA 1WZLA 4QXGH 4NNXA 5I1KL 1A1NA 3JUZA 4GRWF 4UAOB 2IBZY 5D7IB 1CDHA 1E4XH 3G9AB 1FZOB 4WUUD 4MAYD 4WWKD 2FBJH 5FF6A 4WY7H 4F7CA 3R06A 2J5LC 5GZOC 2OJZH 4PJHB 4CU6A 4P0DA 2AXHA 1JWSA 3O2WL 1JFQL 1F3DH 1YN7B 5EIIB 4M7LH 4AQ1B 1JWUA 2Z8WC 4PGEA 4P3DB 3HMXA 5IB1A 4PG2A 4M1DL 5I8OL 1OAYL 2V7NA 4HPOL 1FPTL 2DQIH 2GJ6D 1I9IH 1A6TA 3QWOA 15C8L 5DI8A 1G7PB 2N4IA 4IRJB 4RDQG 2ZJSH 4ZQKA 2WZPD 2YUWA 3SGJC 4HIHB 2CR6A 5IW3A 4TNVK 3BWUC 4U7KA 4JHWL 4YNYB 1QSFE 4XNQB 5F8RC 2OSLA 4YDVA 1UKTA 2HTKC 4XP1L 5I30H 1IL1B 1FVCB 5BO1H 3EZJB 3G6AA 4N9GA 1DBAH 4D9RE 1OGTB 5T1KD 4AK1A 1A6VL 1KJ3H 1MRDL 2WWKT 4NPYB 4MVBC 4GFTB 3EYVB 3S36L 3C5ZA 1A7RL 5SWSA 3JWOL 4OZFA 1WTLA 5GGTA 1RUAH 4OF6A 1KJMB 4X4ZA 1ZLSH 2WQ8A 2Y7QA 4DGVL 2NW3B 4WU7A 4DWHA 3QPQD 4I3RH 3GI8L 4CRPA 5DK2B 4KY1L 3TT1L 4XX1G 3KYKL 5E2TL 1UM5H 2HVKA 5DRZA 1TZGH 3PP4L 4OZHE 1UH3A 2FL5B 5J1AA 4JR9L 3EGSA 4WW2B 1FVEB 4BM7A 5BJTB 1SYVB 3MRIB 4LCYA 1QKZH 4PP1D 1C1EL 1DLHB 3MJ8A 4ZFOL 5CJ5A 4KI5F 3D25B 4AENA 1BBJA 1A3LL 2RJMA 4Z7VF 4EIGB 3BEWA 3QHZL 1WWWX 5DZLA 5C9KA 1TMCB 2D7MA 3VFVA 5JOPD 4DKFL 3CDGA 3MJ9A 4ZUUB 3JV6A 4YDKL 2KDGA 3BO8A 5C7XH 1WZKA 5E7FA 3T3MF 1CXIA 4WI5A 2IAND 3WD5H 3KYOB 1RJCA 3UYRL 4Z8FL 1UXWB 5CEYB 3QO0A 4X6CB 1LE9B 1XR8A 4LRIA 4JGMA 2V7HB 4OT1L 1P9MA 2E5EA 4YFLI 2DF3A 3HI1B 1EDQA 3JV4A 4DAGL 1JRHI 3MA9H 2X10A 3BHBA 1VGEL 2Q86B 1U41A 2AK4A 4JDZA 5A2LH 4Z7OF 3X12B 1UM4H 3OBAA 4NM8H 4XGZB 3I6LE 3C6LA 2YKLL 2VIRB 3WDIA 2O61A 3NPSB 4NQED 3ABZA 3WFEH 2Q8BL 3QQ3A 4HUUA 4KZEL 3QG7L 2FB4L 3GEWB 3LZFL 1YN6A 4FQIL 4Z7UB 2C3GA 4MDJB 4KZDL 5IMLB 3IDUA 3GNMH 1WJ3A 1MWAL 4PJAB 1YEDA 3LPGA 3IDIB 4NQSA 3PE9A 1CK0L 4BH8B 4R4FH 4R26H 1I3VA 3LEXB 3M45A 1MY5A 3V4PL 3GSXA 3P0YH 4NBXB 3SE9H 2ZNWA 4I0KA 4GQ9H 2DWEB 2HRPL 1MRCL 4YO0A 4L4VD 4NFDA 3IVKB 2E8YA 1KPVB 4TTDC 5FYJE 4UU9A 2QQNH 2IH1A 5LCVL 5SV3A 1A4KA 5E94B 4GMSH 1F4AA 1R3LA 1U3ZA 5FUCE 1GIGH 1KUMA 2HA1A 4WW1A 1J12A 4D3CH 4U2YA 4BQ9A 1LO2L 5I17A 2FRGP 1IM3A 4OCSH 1MFAL 5DJ6B 1YNKL 3TGXA 4QRPD 2DQUL 3EYVA 4YGVB 2CMRL 3JUYA 1OTTD 3GUTB 3S3PA 3HZKA 4PJBB 1DN2A 1N59A 4OCRL 3LS4H 5DQDH 5GGUA 3HMXL 4PR5B 1F4WH 1T0PB 2NW2A 1KIUA 4IHOA 4K8RD 4PRHD 4XAKD 2R69H 1JGUL 3EJYD 4JZJA 4PRHE 4XAKE 1FZJB 4L3ED 2W9EL 4J1UB 5KSAD 5GGTH 3U79A 2XKNB 5CJQL 2DYPA 5MEOA 3VI3F 3UBXI 4XNYL 4ZUSA 5K9KA 3FFDB 2B8OT 1N0XH 5B38B 4PTTA 3ZKMC 1IAOA 1ACYL 2IEPA 4OCYH 1WBXB 5BMFH 4S1DC 4PIRF 5FGSA 2VLRA 2HAZA 4K94L 1S7VA 1RU9L 3ESVF 5GRXG 1YEIL 1FYTE 1DL7L 2B2XL 1NGZB 1EJOH 3HKFA 3P4NA 4Q97A 5C0IB 2X1QA 4XBEH 1XZ0B 2WV3A 3MLWL 1YNTA 4Y5YA 1S9WB 3JTTB 2DQTL 4FTVE 1F4HA 4KROD 5B8CB 4M5ZH 1ZT1A 4NCDA 2FBJL 1CIUA 3N9GH 1T80A 4P3CL 4U1SA 2XQBL 4X7TA 3FQTA 5IESL 1NFDF 2UUDK 5J57B 3KYNB 2R4SH 3NTCH 1BOYA 5FB8B 4P46A 2A38A 5LGJA 1N64L 4WFFD 1KT2B 1IEBB 4KQ3H 4OGZA 4OLXH 2VDPL 4P2QD 4NN5B 3SKOB 4L3EB 5KSAB 4R96A 2R1WB 1Q9KB 1CQKA 4YZFF 4IRSB 2FHBA 4X6EA 3ARBA 4E42A 2WUBH 2A77H 2P49B 1VFUA 3P77A 4Z7QF 2RR3A 4KUCF 3QEGL 1CLYL 5E08L 5IT2H 2J2ZA 1RJYB 4KJQD 3UMTA 5HYJB 4R3SB 3H9SA 1BQHA 1UXSB 4R0LA 5I30L 4M5YL 4PJEB 1KB9K 3VRLE 4Z7WF 5KSVB 1DBAL 2B0SH 1PKOA 5E00B 3DV4A 1YQVH 4N5ED 4UB0H 2PR4H 5KSAA 4KV5E 4GRLD 5D7SH 5IFJA 3S8WA 2VLJA 1JZ5A 2DD8H 2MMXA 4GJTB 1V7NL 3UO1H 3PQYD 3QNXA 3T3ME 5D4QA 1FO0A 3B6SA 2FJHB 4LVHC 2JB6B 1DBML 3MYZA 4U6YA 2NYYD 1OAKH 1RVFL 1P4LB 1CXEA 2NY6D 4P2OB 5CZXC 5E99H 4QRPA 2AV7B 1T21B 4WFGD 5FUZH 3CCHB 5CD3B 5TFSH 1AO7B 4PLNC 2XXMB 2FEDC 3REWA 5CEZH 3BPCA 4Y5YB 2CLRB 2WWKO 5E2UL 1WIUA 3BPLB 3GFUA 4GMTL 3PDOA 5FO7B 5KSBB 3T4AA 1WFTA 5IFHL 1NGZA 5IROC 1H3VA 3S9DB 3UTQB 3T09A 1TDQA 3EFDL 3RL2A 3O6FD 4WDIB 3GIZH 4H1LG 3FRUB 1QRKA 2UWEA 1AGBB 3I3BA 1YYLH 1ND0B 1LO5B 5FYLH 1H15B 1DJSA 1ADQH 4UDTB 1WISA 4HWNA 4DGIH 4V2BA 2AJYH 2H3NA 2Y23A 2P5WB 2E27L 5F1KC 4Q6IA 1S7WB 3Q5OA 3CFBA 4U6VH 4OUUA 5MP6H 3EOTH 4OCLC 4RRPA 4RFOL 2VDKH 4DGYL 3T0XA 1D5XB 5J12B 4ZPTB 3SQOL 2UYLA 1S9XA 1OP3K 2OK0H 2DWDB 4LLUB 5LAXB 4WHTB 3O4LA 1NCAH 2EDFA 3MA9L 3O45B 1ZEAH 4Z95L 3RWHB 2EYRB 2X42A 4FQXD 4PP1C 1DSFH 2VQUA 1GZQA 4M3KB 4X6DA 4C4KT 5FFLA 3CVHA 3U9PL 3ZDYE 1D6VH 1TVHB 5FECA 4LLAA 4GW1B 1GGYA 1DUYA 3CFJB 4R2GC 4JFEB 4PJDB 2NQCA 2NX5E 1NL0H 1EVTC 4BK4A 3L5HA 2EKSA 3QJFB 3RVUC 4UAOC 3Q3GA 4CJ1A 3SGDH 3QQNA 4K8RC 3S34H 3CX2A 4OZHB 2HRLA 4OQTA 5TPWH 4RA0C 3SDXA 1VPOH 3BOVA 1JZ3A 4Z9KB 3IDJA 3PDGA 3ZKSD 2VABA 3OGCB 1OGAA 4NC1C 3ZE2F 3QG6B 5T3XD 1B0WA 1A1OA 3DXAE 3DROB 3O2DL 2DRUA 4WUUE 1MRCH 3WXWH 5ADPL 3NCYS 1J0ZA 5DMGD 4AT6B 1TPXC 4J1UA 1BVKA 3V6ZA 5LCVH 5K9OB 3SCMC 2WANA 4JG0H 4Y5XB 5EZLB 5FKAA 3QUZC 1W72B 3TBSB 5EUOA 1N59B 2R4RL 2IG2L 1SM3H 3CFCH 1MI5D 2Z93A 2AK1H 3VFPB 3I85A 4I4WA 3FT3B 4KHTH 4L4VE 5IOPB 1P1ZA 1FYTA 2F58L 2CKBB 5TJWK 2VDQL 3WIIH 3LS4L 1S7XB 5GGSB 2WM0A 5C71A 4NSKA 4MX7B 4JFFB 1KIRA 4NUJB 3UTTD 1VHPA 1BBDH 2C9AA 4PGCA 2XZAL 4D8PB 3MNZB 3TNNA 1FORL 3FMGH 3OJDA 4M1CC 1NJ9A 1E28A 1XH3A 3C09B 4KRPD 3WSQH 5GSRA 3BPOC 4HS8H 1P2CA 1LE5B 4NZTL 3VXUD 2CKBH 3SO3C 3FN3A 12E8L 4UT6H 1UADC 1KCUH 3L3GB 2FATL 3BEWB 3GGWA 1EXUB 1MJUH 2NX5B 2V5YA 2VDML 1WAAF 3L95B 1P7QD 1GPOH 3PGFH 4LP5A 1NCCL 3RZCB 3QUXB 1A6AA 4N8CH 2YPVH 3M07A 5GGSY 4LARL 3QIBD 5KVGH 2H6PA 3QQ3B 2OZ4A 3CC5A 1WCBA 2QEJA 1FFOB 5DMJB 1NMBL 1N5YH 1ZLWK 3VFMA 1MCPL 2ZP0T 2G75B 4PRID 4NBZB 1RZFL 2PETA 2P47B 5I66A 1QO3A 3L95A 1CICB 2HFGL 4MCYB 5DJYA 4OLZH 3VD7A 4O02L 1QLEL 1YYML 4YFDB 2ZKHH 2GY7B 4D9LL 1X5AA 3KJ6L 3QO0B 3ARED 4G42B 1A6WH 4DKEL 1NFIB 4JQXC 2AI0H 3DURB 3F7VB 4JCMA 4O2CB 4U1IA 3PWUB 1QBAA 1T3FB 2P43B 4JB9H 2CJUH 2HKFH 4HAGA 3SGDI 3KNBB 4MX7A 3F7RA 1QLFB 3L3HA 4M48H 3H9HA 5IT2L 5MEPA 3BH9A 1JHTB 5E1AB 2AABH 3DBXB 4RCAA 1FDLH 3H9ZA 2Z31D 4PLOB 1BQLH 5I1CL 4F9PC 1AR2A 1MREL 5MENE 1AFVH 3ES6B 3S5LB 4JFFE 4G9DA 2N7BA 1A7QL 2PKDA 1EFXB 4L8SA 2XKSA 4GBXA 4P57B 1G9MH 3SDDB 3C60D 4MJID 5D7SL 3T0VA 1P4BH 2ORBL 3DX9A 1OW0C 3S35L 3WHE0 2XZQH 1CE1H 1KLGA 5DURB 5A3IC 2FD6H 2UZXB 1IGTB 4ONGH 4F9LA 5H35B 1BFVL 4JG1L 1N8ZB 5D5MA 2BC4B 3L3GA 5I1KH 1E4XI 3LIZL 1I75A 5FHBH 4FTVB 1LD9A 1F90H 2P7TB 4OIIL 3V8CA 2BRQA 2M8XA 3ARDD 3M17A 3DVGB 5D93C 4BQ6A 4P46D 3SKUD 1NFDE 3RTQC 4X6DE 4YHZL 3ZKNC 4JM2A 5CEXB 4LCCA 1QR1A 2EEBA 5GIRA 4K3HA 4I0PA 1CDUA 2HWZH 2BVEA 3VI4E 4DVBA 4QRRE 2FEEL 2NY4C 1XGPA 4JFYB 4LCWE 4U05A 4M1DH 4GRLB 3ULUC 4XP6L 3BPLC 1Q94A 2D03H 1J8KA 4X83A 4ACPA 2AQ1A 3CVHB 4MWFB 3QEHA 4XNZB 4MD5A 4FXKB 2BSRB 3BQUB 4PBVC 4L4TA 3O45A 3RA7H 1L0QA 5FM8A 4KGJA 3B9KD 1HEZB 1BJMA 3SDCD 4NHUB 1KBGH 4FXGA 1F4YH 2DJUA 3KPRB 2VZVA 5C08D 4ZNEA 2FX8L 4UBDD 3WFCH 5ENWA 2IH3A 4R8WL 3KXFB 2A0LD 4NM4L 4FQHB 4ODWA 2AEWA 3LS5H 5D7IA 3F62A 3S7GA 35C8L 1ZTXL 1IGJB 3DI3B 1DP0A 4OM0L 4U1JB 5CAYB 5H2BA 1AIFA 3BP6B 3NZHH 2IAMC 3MUJA 1T22B 1AD9B 1MOEA 4GAYA 4F7EB 1CFTB 4X98A 2H9GB 3RHWK 5HHPA 3CFDA 4H5SA 1FLTX 4PJEF 2APXA 5E8OB 2XN9B 4N0YL 3ZYJA 5ESAA 4XMKL 2ARJQ 1BAFL 2APVA 3OX8A 4GG6B 1H3XA 5L9DH 3KDMB 2BFVL 1KIQB 5INDA 3VH8B 2NY1B 4PY7A 2O93L 1YEKH 2DQCH 1KXQE 3O2DH 5DGQA 4JKKA 1NC4A 4HMEA 3IJHA 5DEZA 4TNWF 3FKUS 5LWYH 3SBWC 5C0BE 4BFGA 5BVJA 4KKBD 2LFGA 4YHPB 5A40E 4F57L 1TPXB 1KB5L 4NJ9H 1Z6JT 4KROC 3U6RA 4I8DA 2MCPH 1JZ6A 3K0WA 4P9MH 4HIEB 3E1F1 4OLYH 3KXFD 5E00A 5ISZE 2HLFD 4MNQB 2NXZD 3FTGB 3UTZB 2IPKB 1EFQA 5C3LD 1MAJA 1LO0H 1DQLL 3EO9L 3O4LE 3L6FB 5JXED 4PGZA 4QRUB 4YPGB 2BCKB 4GUPB 2XKUA 1JBJA 4IRSD 2GT9A 3U82B 2XFXA 4ZXBD 3S88L 2I9LA 4I2XE 2ATKA 4NM8L 1A47A 4N0UB 3WUWG 5CJ8A 2EXYC 2Q76B 1F3JA 4MHHI 4O9HL 4XAWH 2AJZA 3TVMB 1DQQB 4KJYB 5IFAH 2X4NA 1MFBL 3B83A 3FFCD 5HY9B 1YDPB 2C1PB 3BPCB 2IGFL 4G9FD 32C2A 3ME0A 5I8EA 1T1ZB 2ITCB 1N0LA 5C0GB 1S3KL 1U95B 3DYMA 4LLMA 3ARSA 1OSPH 3MLXH 3PGFL 3INUL 4QTIL 5IB4B 2YD9A 5SWZD 1TTFA 3DXAB 5DRNA 3H9YA 2DI7A 2AJZB 5E4EB 3AB0B 4ZUVA 3DRQA 2VO5A 5E8OA 5T5NF 1GC1H 2IADA 3REVB 3UZVB 4WEBH 3WDHA 2HYMA 4X9GA 5CZVL 2C7UB 3SDXE 3GB7A 4R0LC 4LHJB 2YN3A 4TTGA 3F7QA 1FHGA 1JN6A 5C0AD 1GIGL 5DF0A 3VXMB 5H2BB 1RK0B 1AI1H 5EIQA 2NZIA 4LSDA 4OZHF 4F33A 1EEZB 1JPFB 4KAQH 3LQAC 5TQ0L 2GSIA 4L4VB 2A2QT 3Q5YA 3QUZA 5FYJU 1KELL 3IDNA 3WKNA 1ZHBA 1S7QA 1DEDA 1DBJH 2UZIH 3O9WB 4DKEH 4NQUA 4GG8A 1TQCC 4HWBL 1HZHH 4NKDA 1P5UA 4IRZH 5HJ3B 4LSSL 4HJJL 2WBKA 4OD3H 4MJ4A 3U4EB 5B3NA 4H26B 5IBUB 1MFCL 5I1IL 3MFFA 4G9FA 2KZ1B 3OKOB 4J7RA 2P48B 2W9EH 3HZKB 4UIKH 2ARJA 4YHML 1HSAA 3HG1E 3MGOB 2GCYB 5IW1A 4ODTH 3MX0A 5BV7H 2BRRH 2QJDA 2XI9A 3IRPX 5DA0B 4HIIB 4PUBH 1Y0LB 5IHUH 5I2IA 1A7QH 3BZ4B 4ZUTA 3OX8B 4GW4B 5DD3H 1G9ML 2BP3A 3VFRB 1WFUA 5BVPL 3T3PE 3H6JA 2AEQH 1V7MH 2ZCLH 1JPGB 3GSUB 4K94C 4K23L 3QWRA 1T03H 5BCAA 2XXCB 2LU7A 2VTFA 5D1QD 1U91A 4PJXE 5HYSG 1PAMA 2FR4A 2F5AL 3QXDB 5D9SB 1T89C 3LIZH 5FHBL 2AJVL 3OQ3B 2EXWD 2HJFB 3NH7H 1RUKH 4PJ8C 3RL1A 4IRSC 1G7IB 5D5MB 3ARVA 4K71B 1JTTA 2R4SL 3LRGA 2O5ZL 2GJZB 3RVTC 1ZA6B 3OGOE 4YXLL 4HUKB 3U36B 1AD0A 3LDBB 4ZFGL 1XF2B 1P6FA 3BKCH 4N68A 1L6ZA 4AG4L 3CVIL 2C1OB 2A6DA 2X89D 2Z91A 3VMPA 1VACA 3BQUA 4GXUM 4DW2L 4YGVA 2D03L 3CAFA 4U49A 4MWFA 5DMKA 4YBQD 4NO5A 4FQQA 4XVJH 4HZLB 1PEZA 4UV7L 2FJFA 2QADC 3FONB 4K8RH 4XNXH 1NBYA 4FZ8L 3N0PB 1BOGB 3RA7L 4ZSOB 1QFUL 5DFVC 3QPQC 3C5ZD 3UZEA 4AJ0A 2NXYD 5K59E 2WNGA 1SBSH 1UXWA 3HZMA 3Q6FB 2PR4L 1CD1B 2QBWA 3Q0HA 1BWMA 2R2HB 5ESVB 1KJVB 4KI5D 3U2SA 1JUFB 4JN1H 4ZOBA 2FX7H 1YMMB 4YIQB 1MHCA 2V5RA 3KHOA 3E8UL 2VE6A 4OAWA 2P7TA 2R2EA 4X6CE 5MENA 4PB9H 1MWAA 2VZUA 3X14A 4OZIF 5HTSA 1KGCD 4JPIB 5I1LB 1ED3A 1S5IL 1OAKL 1JHKL 1RVFH 5IM7B 4GRWB 4YX2L 5DFVD 5L6YH 1HHIA 4N0RA 4QXUH 1L7IH 1QSZA 3TLRA 2BMKB 5DJ8A 3MJ8B 5C0EB 5MENB 4FQCH 3HLAA 2X6MA 1FFOA 3KPSD 1PSKL 2DLHA 1P7KA 3QIWA 4LSUH 3B3IB 5J0BA 3U2SB 3PIQA 5E8EA 4XTRD 3BT2H 4PLJC 1Q38A 4XH2B 5ABDE 4PPTA 3C5ZC 4KXZI 3GIZL 4G6KH 3KG5A 2DQCL 1MCOH 2FX9H 4PV9B 5D2NA 1RIHL 1Z3GH 4UUJA 2IWGA 5JW5B 5BXFB 1S5HB 4QRSB 2ITDB 2W0KA 2NTFB 2NZ9D 4PJAE 4OLEA 1OSZA 4J3SA 5ECJE 3S37X 3L3IB 1JTPA 3NN8B 3ZKXB 4KRPB 1WWCA 3LY6A 2I07A 1TVBB 1UEYA 1FH5H 4LAQL 2Y36L 4WU5B 1KB5H 3TNNB 3STLA 2P8PB 4OLYL 4LCIL 4G42A 3L9RB 4HCRL 2NY4D 3EFFA 5HI3D 4V1DD 2DBLL 1D5BA 3IFPA 2XWTB 4P23B 4JQXA 1K3ZA 4ELMB 2I9TB 4BYHA 3FO1A 1R3KB 3OB0K 3TH4T 3U4BH 3DYPA 3NVQA 1M4KA 3EO9H 2SEBB 2Q7NA 5ADOH 3FRPG 1YEEL 1AHWA 4LLQA 4XBPB 4FQQB 3QDMA 1HI6B 3WXVL