4M62L

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
b'EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVEIKRLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GEP2 FV light chain
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 113
sequence length 113
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m62L00
1HHGA 1J0IA 5DJ0B 4JDTL 3RZCB 4NQXB 4H25A 4GJTB 4Y89A 3DXAE 1WFOA 3TH2T 5E70A 3VWKD 4GKNB 1X5JA 3PWUB 1CXHA 4LCWA 2Y5TB 4KRMB 5C0FA 2DICA 5C92A 3EFDL 2LAGB 4I2XE 3PGFL 3BHBA 2WWKT 4Y4FC 1W72H 2BNRD 4GXUN 5KSVA 4F2MA 1UXSB 1A7OH 5T33H 5IWLA 3LS4H 1I4FB 4JZNA 1KULA 3QIBD 4Y4HA 2NY2C 4BSWA 3U6RA 5TQ2L 4U1JA 3Q5TA 1E4KA 1T2JA 1LO4H 2W07A 3O9WB 3OKYA 4N9GB 3IRPX 2H2PC 2FJFB 4YDVB 2BMKB 3MRJA 1S78C 1CU4H 1R6VA 1AGCB 3CNKA 1CXKA 4Z7VB 1CIUA 3KNBB 1K8DA 2VZ1A 3KDMB 5HVHB 4XCNB 5JOFA 1FZMB 4J3XA 2RGSA 4HT1H 5ISZE 2FJGA 4X9IA 2OCFD 3MLRL 3G6DL 4EI5D 1LDPL 1OL0A 2EDLA 2F8OA 2VDRH 3ARFD 3S7GA 4MD5A 2VDLH 1LGVA 4PJ5A 3CFEB 4MJ5B 1UQSA 4KKLD 4G6MH 5HHXH 1AGEA 2MFNA 5EC1B 4WUUD 1M05A 5D5MB 1WQVT 3T0EA 4W4OC 2CGRL 3SGKC 3ZSSA 2DTSA 1EO7A 5MENB 1MI5A 4KRPC 3NCJL 1PZUB 1PSKL 4XC1H 1IQWL 2LFGA 3REVA 4JE4B 4Y19B 5F7EL 4XC3H 5D1ZD 4CMHC 5BOZG 3CVHA 3TIDA 2ZCKH 5AD0A 3UJTH 1ZHNB 3V8CA 2FB4H 4JHWH 3HB3C 1DTUA 3PV6B 2A1WL 4JRYE 4G42A 9CGTA 3BKCL 3QNXB 3VFMB 3O11B 4LBEB 3F7RA 1F42A 3TO4D 4LSVL 1HHIB 3K4DA 4YK4C 4NFBA 3FJTA 2X70B 3Q6FA 4QEGA 2BK8A 5KBNC 4R0LC 5T5NG 3X11A 4YHPA 4MA1C 4ZG1A 1ZLWH 1DBJL 1SJHB 5FF6B 3HNTH 4LCYA 1VENA 5D1XD 5CBAA 2NW2B 4XB7A 4PD4J 1IGCL 4WENB 5CWSB 5GS1B 3VDCA 5JOEA 3UBXB 4AEHH 3FO0H 5H37G 1QFHA 3FONB 4M6NL 2VLJA 3FOMA 4OF8A 4YGVA 4QHNA 2DQJH 4NZTL 2Y36L 2P43B 2PYFB 3RVXC 1BGXL 2QQKL 4MA3B 4XCYB 5ESVB 3O3AB 1F3DJ 4I5BB 1AJ7L 2EDXA 4MCYB 4QTIL 1GC1L 1QFWM 1DZBA 3OJ2C 5T3ZE 4JRWA 1UACH 4AEIH 3ALPA 2HRPH 4HUXA 3MV7A 3UPAA 1CGYA 1MFAL 4Y16D 3TBSB 3FFCB 3TBVA 3BQUB 1KELH 1MWAL 4OKVB 4W70A 3JUYA 3IFOA 1XGYL 4LLUB 4P2RD 3BEWB 4GRWH 4NKMB 1HOCA 3IFNL 3DRQA 4NKDA 3KR3L 1QLRA 1UXWB 1NQBA 4MXWH 1TVBA 4HGWA 3AB0B 5A40E 3MOBL 1KLGB 5IROC 4OM0H 1A1MB 4XAWL 5DR5L 4K94H 1T5WB 3HC4L 4M1GL 3HZYB 1JE6A 1U92A 3KJ4B 4QXWA 5ERWA 3QJFA 4G5ZH 5IFAL 1QTYT 2UWEB 5L2KD 1L9MA 3V5KB 2KZWA 3I3BA 3QUZD 3PGDA 3JWDL 2J12B 4OB5L 2Y7QA 2VJXA 1XH3B 4LLMB 3OPZL 4C56D 2ZSVA 3F8UB 4JFFA 4S1QL 1LO2L 2K3TA 4R26L 3JVGC 2GY5A 2EDFA 1HN1A 4N68A 4XI5C 3FB7B 1MRFH 1YYLL 2OR9H 4Z7NF 5EOTB 4NJAL 2OL3A 1DQJB 4HIHB 3WFCH 3C6SA 3O3BA 1MIEL 1S7UA 4GMSH 3DXAA 4N0YL 5FIEA 4U1MA 2BDNH 3ARED 5J89A 3T2NH 3SOBH 3O41B 4H5SA 4DN4L 2O5ZL 3BVNB 4IOFD 3UZVB 1A02N 4XPAH 3ULSA 3UTPE 4LVNB 4PJFA 5LXGL 2FYYB 1AGFA 1NSNL 1MAML 4P2OD 4OJFL 3HC3L 4WEUD 3FRUA 4M6ML 4Q6IB 2Y4SA 1OLLA 4TQEH 4X6CA 3I6LE 5F1NA 2X10A 3S37L 2H8PA 5DRWA 1JMZA 4JGJA 2Z31D 4NQSB 1ZA6A 4E5XA 2EZ0C 4XXCA 5T3XE 4G6JL 4R2GC 4LK4A 1FV1B 4O02L 2XZAL 1RUKL 1A4KA 1R3HA 1YEHH 3HE6A 3FO9A 3CAFA 3LKSB 4QRSA 1NGQH 2ATKA 5ISZA 3U83A 2L7UA 4KAQH 2BSRA 2IPKB 1H9VA 1FFNA 2JCCB 3KPRE 1U58B 1NKRA 4F9LC 5DMYA 4XCEA 4ZXBC 1NCAH 3OB0H 4OQ1A 3VXSB 4Z77B 1AXSB 1UM5H 4G8GD 3ULUF 4JFOA 1NMAL 3VWJD 5C0BE 3VI4F 4I18A 1TQBB 5D7LE 3CH1A 1T1WB 5GRYA 5C0CD 3LCYA 4ODUA 2IBZY 1OARH 4QRUA 2YRZA 3QQNA 3TPKA 3MOAL 1QBBA 4HCRA 1N59A 4NWUL 3C5SA 4TYUA 4QXGL 5C0RH 4HF5L 4JRYA 4Z8FH 1SVCP 3G5XA 4BJLA 3QI9B 3ARUA 2DIJA 2FBJH 1NH6A 3K2MC 2XTJB 4QGTA 4JR9L 4I3GA 2ERJC 3GMQB 1FGNL 4FQQB 4OD1H 4RISH 3IDYB 3P0GB 4ZSOB 5FM8A 4P48A 4M7LH 1KIPA 1LO5A 1P4LB 1NDMA 2KQNA 4U6VL 1MSPA 2QL1A 5I75B 4L3EE 4YDKL 1OGTB 4UUJA 3UTSB 4ZOAA 1YEJL 3KPMA 4P5TC 4XP1L 4G7VH 3WBDA 3S4SG 1TVDA 3BO8A 1T21A 2FBOJ 2VLRE 3S3JA 5SWZB 3OKLA 2DQCH 2VMFA 4OCWL 5DHVH 2WUBL 4YE4H 3VGHA 3RWFA 3VXTB 3PJSB 5E94B 2HG5B 1OPGH 1MVUA 1KOAA 1MWAB 2C1OB 1GAFL 4NNXA 3B9DA 3LN5A 5GGRB 2XWJB 3P77B 4HUKB 3SDCA 3AU1B 1S9KC 1KT2A 4PJXB 3K81A 5JZ7D 3OAYH 5J9PB 3B2VH 4FFVD 4GKSA 4NM8L 5KG9A 1UH3A 4UQ3A 4K7PY 3E8UH 2P7TB 3MRPA 4JO3H 3D69B 4I48B 5IMOB 1Z3GL 4I3RL 3MRNB 4I0KA 2GT9A 3KYOA 2CRIA 1QOKA 1I3GH 4TN9A 1JZ7A 4GBXB 2DMCA 5H8DA 2UYLB 1H8SA 3T0WA 1W72A 5TDNA 4K7FB 2E7LC 3M1BA 5D8JH 5ICYA 2X4QB 2YRLA 3EZJB 3F5WA 2DJUA 1A6AA 5I1CL 2AXFB 3BIKB 3MLSL 3LKNB 2WWKO 1TTUA 1A2YB 4TVPD 4RGNC 4PJ9C 3BH9B 1HEZA 1F58L 3PHQB 4EN3C 5E9DB 1DUYA 3DROA 3C08L 1YPZE 4ZAKD 1CFQB 1MFNA 5F3BB 1CD1B 3SE9L 4W81A 5FECB 2QJDA 1YNKH 5IG7B 1CLOL 1GVIA 3JV5A 3BGFC 3T3MF 4PJ7F 2WSKA 1Q9WB 2DWEB 1DVFB 3SGEI 1MH5B 1U42A 3QXUA 1C1EL 3MNWB 1LO3H 1DQLL 2XZCH 4XRCA 5AYUH 5GRXG 5C9JA 5IB1B 3TZVC 2GSIB 4LEOA 3D2UB 1FPTH 4H26A 5L2JB 3ULVL 2IQAB 4P2CG 1LNUA 5MERB 4OIAA 4MAYA 2R2CA 1T89C 5JUEL 3BDYL 1KPRB 3PE9A 1QBML 4YXHL 3NN8B 1I3RB 4HV8A 2BRRH 1CE6A 1QBLH 3U48A 1G9NC 1WV7T 3O3DA 4M62L 2D0FA 4N0UA 1NGPL 1G9MH 4HXBL 1CICB 3KLSA 4OLZL 3CD4A 3NA9L 4K23H 1FNSL 5IVXA 5D9SB 4J3OC 2DLEA 5IVOA 1OTUC 4HPYL 3ES6A 3VG0L 2IMMA 1A0QH 2J8UE 2NZ9D 3H9SE 4FFWD 5D2NB 1RZKC 3HMWH 1ACZA 1O5DT 3KPRA 3I6GA 4NQCE 3H8NA 1DQTA 1TQCC 4GG8A 4HHAA 5GISL 1VEMA 4J1UB 1DBMH 1HCFX 5J06A 1CL7I 1HXMA 1DANU 1IKFH 4XNQA 1IQDA 3LH2H 3VCLA 5I76B 3HG1A 2DD8L 1N64L 3E2HB 3GSQB 1FVCB 5C0BA 2R1YB 5DTFA 4DOHB 4D0CA 2PTTB 4HIXH 3RKPA 2P8PA 4PJAE 5E5MB 2AJYL 3GEWB 5D7LA 4PJCE 1D9KB 4TSBH 4L8BA 3HC0A 1CD0A 3HNVL 2IALA 3SKNA 1BQHG 1EK3A 4QRPD 5D6CB 3KYMB 4CVZA 1M1SA 2E9IA 4TTDC 1CLCA 3QDJB 1J8KA 2X89D 1I7UA 4KGLA 3QSKB 1WC7B 4ONGL 1IKNC 5L88H 1N7ML 4HX1B 4LNRB 2QQNL 3RDTD 5EBLB 4EKXA 3QDGE 4HUWA 3MGTA 4LCCC 4PLNC 5I8OH 3SKMA 4TSAL 4X4XB 4UNUA 1CIDA 2W60A 3CMOH 3FT4B 5KSBB 5EN2A 2P5WE 3VJ6B 4WCYH 4ZS7L 3SDDB 3TN0A 4IIQC 4U31A 4D9QE 1I9JH 2VO5A 1OTSC 1B9ZA 3PL6B 4L5FH 1OSZA 3VGBA 1Q94A 1LO0L 3QUXA 1U91A 2CJUL 3MJ9L 2D9QB 3CDGB 4KQ3H 4RWHA 1S3KH 5JQ6H 4XPTH 3QDMB 4JRXE 5IBTL 2P49B 1DEEA 4QHUB 43C9B 5AZEL 3TT3H 2X4RB 3EYUL 4QT5A 1I1AB 2IPTH 5C0GB 1X4XA 2GTWB 5CJQH 3C09C 4Q2ZB 3GSUA 5HDQL 5KAQF 2ZNXA 2H3NA 1T0MB 5ENWA 3GSNL 1A6PA 4LPVA 3V52H 5L9DH 4LP5A 5DQJA 2DQGL 4FQHA 1OM3H 5FYKU 1P9MA 5GRJL 1U36A 1GGCH 2JELH 4OFPA 3TA3B 1AIFB 3LEYL 4JG1L 3QIWD 1BJ1J 1U3JA 5IOPA 2Z8SA 2FX7L 1R3IL 1JHTA 3DWTA 4MQ7A 3X12B 2EDBA 5MEQA 4HKBA 5GGSB 5IK3B 3OKEB 4P4KC 4K55A 1CGUA 4TUKL 1JNHB 4Z7UF 5CJXA 4LL9A 5C70A 4JFEB 2B1HH 4R4FL 7CGTA 4HMCA 1YN6A 5FCUH 4XZUA 3G9VA 3TIEB 3PABA 5FO9A 5TDPA 1CVSC 4MVBD 3QRFM 4CVUA 3DX9B 3ILPA 5ID1B 1R3JB 4ONOA 4V1DB 1KGCD 3BAEH 4KHXH 5CEYB 4IMLA 4EBQL 1TVHB 4MQXD 2RFXA 3GSXB 2OZ4H 3L5WB 4HLZG 4NJ9H 1EUTA 4X0KB 5IBLD 5JPNB 4XBPB 4WI5A 6FABH 3TFKD 2WK2A 2O5XH 1S7TA 3QCTL 1AP2B 4OV5B 4C59B 4NRXA 3QH3A 3TJEL 4X99B 4P9MH 5BCAA 1I8IA 3UTTD 5C3LD 2WLZA 3ZDZE 2XQYG 4NN7C 3VGEA 3BRFA 1MCSA 1UB5B 1F6LL 1U6AL 4Y1AB 1TFHA 1FL5A 2E3VA 5L7XH 1JL8A 1FFPB 5DC0A 4WEBH 1NGYA 1ZLWK 1KBGL 4WUUE 5D7SL 3KXFB 4J6RL 4FQ1H 1L0XA 1D6EA 3H42H 3HHRB 1FRGL 2MCPH 1R0AH 4KXZH 5EB9A 3S5LA 1Z9LA 1J0JA 3ARSA 4FNLL 2WINB 3RUGB 4U1LA 5CJOL 3H9SA 4JLRB 4K9EH 4Y4KA 4QXTB 2VYRE 1I7TA 5TPWL 1F2QA 4PRIE 1T04A 4NN6C 5JDSB 2F74B 3CK0H 3GKZA 1NAKL 3FQRB 4NQDE 4HKZA 5INDA 1MCHA 1YZZA 1RU9L 3C8DA 3V7MA 2GJ6D 4F3FA 2YD5A 3SO5A 3EFFA 3WFEL 1SYVA 5DHVA 4TUOA 1D5XA 2EE9A 4PJCA 5CHNB 5D7IB 4CUCA 2OLDA 2BOCA 1QFUH 2BVOA 4YPGA 4FQXC 3U36A 3P4NA 4K3DH 5IIEA 5E6IC 1BFSA 5FA4A 4PGZA 1YJDL 3C60D 2CUIA 4YNYB 4WO4C 5HVWA 2P4AB 2V7NB 1RMFH 1ZKAA 4PRHD 5I30H 1FVEB 1BD2B 1YNLL 4OCLC 4Y2DC 1I8KA 2P5WA 2W1NA 2H1PL 3NFSL 1ZV5A 1HYSC 3RAJL 4IRSD 5GS2D 1XGRB 2E7CA 2FH8A 1NDGB 4GRLC 1FG2B 2DBJA 4Q58C 3K4ZA 3BUYB 1JWUA 4MA8L 5GGVH 4Z7NE 1IL1A 3GSNB 4MJIB 4QOKA 4LCIH 4P2RE 4UT7L 4ELMF 3F6LA 3MLPA 3JV6B 1WF5A 1UM4L 3MLYH 3Q6GH 3MJ6A 4RWYL 4NO5B 1QHOA 3MLUL 2DQIH 4NZDA 2OJEB 1NFDE 3U0PB 1AY1L 1WICA 3TV3H 3FCTB 1JYNA 4L8DB 2EKJA 1EJOH 5HYJD 3S9DB 1T7XA 2VXVH 1RZKH 5FHAL 5ITFB 1MCDA 5F88B 3OGOE 2D31B 1OAKL 5L2KE 3BWUC 5JW3L 4UQ2B 4NGHH 2ZUWA 3WFBH 4KKCC 2IANE 2VDMH 5GRUL 1EO8H 5E8NA 1U8QA 4LHUA 4C56E 4JY6A 3EOBA 1FNGB 3LOWA 1J1PH 25C8L 4H1LH 4ZD3H 1KTDA 3D18B 5EO0B 4CN6A 3O9WD 1M4KA 1UT9A 5D71H 5L0QC 4LU5L 4ODVH 1HQ4A 2A6DA 1T20B 2AJZA 1JK8B 3NTCL 1FZJB 2D7QA 5FYJD 5I1IL 3OG4B 3D9AL 1Q8MA 3RIFK 1L9NA 2OTWA 2V5TA 5LGJA 2ORBH 2NXZB 5F7KC 1HSAA 1IGTA 2W38A 3CLEH 3VWKA 2EE3A 1MJ7L 1KJMB 5EU3A 4FA8A 1PGRB 5SX4I 2BNRA 3OKMA 3ULUE 3CZFB 3VFTA 1XZ0B 2FGWH 3T0XA 3ZKMD 1G7JB 3QIBA 3QQ3B 2NX5B 4WHTB 3V4VH 2FGZA 2VE6A 1GXEA 1KSRA 3CC5A 3FHAA 1JNLH 1R3LB 2W9DH 3V0WL 5MEND 3QPXL 1T03L 4O51A 4UT6H 4TVPH 1YQ2A 3OQ3B 3WKML 4Y19D 5DQDL 1FIGL 5E8OB 2R56L 1CFTB 2HKHL 1J1OL 4BZ2H 4QO1A 4FTVB 5JOPD 5AUMA 5J13C 4W68A 3BGMA 3KGRA 5HD8C 4Z7QF 2VDOL 3CSGA 4WV1B 4JZJC 2B7DT 4EI5A 2WLYA 3ZL4H 3ARFA 5C0AB 4RQQB 4QHKJ 1CDHA 3KWWB 4F15B 2Y06L 2FECL 1ZT4A 4G8GE 3P4OB 4PP1D 1MFDH 4WUUA 1QP1A 4EJ1C 2YXMA 3TCLB 2YMXL 3GMNA 4OI7A 4JM2B 1PLGH 3S36H 5CCKH 1I1YA 4EQ2A 2C7UB 5HHPA 2Z8RA 4RMQA 4XPFH 5DURB 3NCFB 5D1ZA 5C0CE 3OXRB 1AD9B 4M8VA 5DFVD 3V5DB 5HGDA 1T7VA 2XYCA 4XX1G 3WIHL 4LARH 5B8CA 3BDBA 3DVFA 5T5NF 1KPUA 3RZCC 2YC1A 4ENEC 1XCTB 3X3GL 4L3CB 2ZUQB 5EUKB 1OWWA 3TO4A 5HGHA 2NY0B 5CGYD 2AEQH 2A83B 5JMOC 4KMTL 5E0QA 3C6LB 4P4RA 1H5BB 5F89A 5C09D 4OCMC 1A8JH 4PIRF 5KS9B 3FTGB 4KRNA 3SGDI 1ZHKA 2UZIL 1MFEH 3BQUD 5D1XA 5FM5M 1KB9K 2W65A 1J1XL 1MHCB 4L8SA 5B39A 3C5ZB 1N0XL 4XVSH 1K3IA 3QEUB 3RIFF 4R4BB 4KY1H 1JWSB 2NY5H 4PRAB 1BFVL 2P8MA 3DMMB 1CDUA 3BUTA 5C0IA 1MIMH 5IW6B 1ZEAH 1TTGA 2BHZA 1A6ZB 1NGZA 1JHLL 4LOUC 1EAPB 4LGRB 5J6HA 5D2LB 4DVBB 1CTNA 4ODSL 4JQVA 3UTZA 4AK1A 1H8NA 1UWGH 3FQNA 4Y16A 4KI5C 3H3PH 3T3ME 3UCRA 2ZUUA 4PJ7E 5C0DA 5DMKB 2Z4QB 4P2RA 1R5IB 1OTTC 2VL5A 5F1IB 1BBDH 2XWBA 5EG6C 5AZ2H 2JTDA 4MD4B 5CJ8A 5L8KB 1NFDA 1NKOA 4QTHA 3WS6A 1NCTA 1CFSB 4L8CA 2WWMC 2MCG1 1NEZG 1JRHH 2OZ4A 2X42A 4EDWL 3WJJA 5KZCD 3ARDB 3X14B 1EZVX 3MO1B 5L2KA 1FL3B 1AFVH 3QUZA 5FUCE 2CRYA 4B41A 1BVKB 1RUAH 3MBEB 4RGOH 1MHPH 4C56A 1FZKB 4HPOH 5KTEH 3MCKB 5J11B 1DL7L 5C7XH 3MYZA 5EOQH 5T1MA 3M8OL 1H0DA 3MNZA 1R5VA 1A1OA 3KPQB 4G3YH 3U9UA 4S1DD 1VA9A 3RBGA 5GS1C 3GKWL 4C55A 4IRJB 5GGRY 3AREA 1N5AA 3V6BR 1JN6A 2QADC 4MJ2A 3LEXB 3VE0B 3G08B 1DE4A 3CUPA 3FQWA 4LAJH 5LAXB 3UYOD 4ODXA 4P2OA 5IMKB 4UB0L 4YQXH 4IMKC 1FNFA 4JHAH 4PGCB 2HFFA 2EH7L 4U1KA 2Z31A 5HVFB 3CVHL 2F8XC 5EO9B 1T0NA 2H45A 2HLFC 2X44D 2EYTA 4OCRH 3PHOA 3JWOC 1TJHL 3DUUA 5FOJA 2OTUA 2R29H 4P59H 1IGFH 1EEUA 1WCBA 5CBEB 3MNVB 1S7RB 4XNMB 5EU4B 3T8XB 3WUWG 1UEYA 1VHPA 4XXDA 4PJBB 1IAIH 3O3EA 4AIZA 3QI9D 3IF1B 2NLJB 4P2YA 2XTJD 5T5FH 4X9BA 2Q8AH 1T6VN 1BJMA 2H9GB 3DIFB 4JANA 4PTUA 4NRYA 1EJ6A 2N1KA 4Q9CA 4G8GA 4YFLI 3EGSA 4YHZH 5F70A 1DLFL 3CX5J 3SE4C 3D39D 5GIRA 3VWJA 4G6FB 4U1SB 4PRPB 4BZYA 1DR9A 4HK3N 4U1HA 4XHQA 1H3PH 4PGJA 2R9HD 1RVFL 1YEKL 4WJ5B 1L7IH 2J7LA 3UTSD 3IDIB 1MCQA 4MAUH 5C0CA 1SM3L 1SYSA 2HT3C 1U3HC 2CH8A 2X4NA 3JV0A 3QRGL 5HYSB 1MCJA 3VXPB 3NCMA 4QRPE 1X5LA 4FQIH 5FO8A 4UBDC 5C2BH 2GCYB 5EDXA 2X4UA 3ECBB 4GUPB 3MX0A 3OV6A 1D5IL 3I02A 3LPFA 2CDEB 5ANMA 1Q9OB 1OSPH 4KWUA 3IETB 1CCZA 5DEZA 3MGOA 2G75B 3WS3B 3A6BH 2DDQH 3MJGX 3FAWA 5IHUH 1IC1A 2NY1B 2VTFA 4KROC 1XGQB 4FXGA 1S5IH 4HUUB 3U0WH 3U7YH 1MOEA 4G9FB 2F58H 1AE6H 3LQAH 5I2IB 4MNHA 1FE8L 1FDLL 1WT5C 3ZHLA 3E1F1 4ZUVA 4ZFOA 3M07A 3OHXA 4UOW0 4LGPB 1JPSH 3QEQD 4Z7UE 3RWHB 1N0LA 5DJYB 4CGTA 1JF6A 1Q0XH 3BE1L 2CKBH 1GGBL 4M5YL 3EJJX 4H88L 3BKJL 3QXAA 4PG9A 3V4PL 2B5IC 1YYMH 4H1LA 2WNGA 2FO4B 5JNYB 2F9BT 4UDTA 3C8HA 4GKZA 1ERNA 4XP4H 4ACPA 4BZ1H 4LGSB 2Y1VA 2FLBT 5FFLA 3BHBB 1IVLA 1OF2A 3DRTB 3B3IB 5LCVL 2V7HA 1AKJB 1PEZA 4BFIB 2XQBH 4M6OL 2OL3L 1H3VA 3O6MH 1QKZH 1F90L 3QO1A 3GBML 4GAJL 4LQFH 3H0TA 4LSRL 5FGCE 3ZE2F 3U6RB 3CFCL 1NLBH 5D7JB 1DVFD 2H26B 4ZNCD 4U1JB 1M71B 5ICZB 3ARGC 1TZIA 5IQ9A 1JP5A 2NY6C 1MFBL 3O0RL 5BQ7A 5CP7A 4NZRL 1MCWW 1WFTA 1KYOJ 3LD8B 3D2UD 4U3XA 1KNOB 3DURA 1SBSH 4OZHF 5T1DL 2P24A 2XI9A 4F33B 3NFNA 4ZAKA 2EYRA 3L95B 4RA0C 1CI5A 4ZS6D 4EOWL 2OQJB 2LTQB 3G9AB 4MD5B 1ND0A 3SDXA 2AEPH 2EH8H 3UBXG 1NMCC 2F54D 1CICD 1M05B 3R06B 5DD5H 3HTLX 4PJHA 1I9IH 4G7YH 2VRAA 1MJUL 3QB7C 4XNUL 2GQHA 1WJ3A 4EVNB 1N6QH 1GC1C 4P5MA 4PJIA 1I8MB 3SQOH 2NNAA 3LKPA 3L3KB 2VSDA 5I1JL 4OCYH 1QQDB 2QLVB 4AMKL 3UTTE 4UINL 5I9QB 5DRXA 2ADIA 5FYJH 3MACL 5FGRA 2I9LB 3HPJB 3SDAD 4GO6B 3W2DL 4KU1A 4JY5L 3GHBH 3F6IA 4HCRL 2F19L 2C1PB 3B5HA 5K9KB 1D9KD 2B4CC 5GGSY 4F8TA 4XVUC 1XR9A 3BPOB 4LCYB 5DEGA 5KVMC 5EZIL 2F5BH 1XF3B 2D7NA 3L5HA 4R7NB 4PY7A 3Q1SL 1KENL 3JWDC 4MD0A 4GW1A 1PKQB 2VLJB 3FOMB 1IBGL 5I1KL 3QEHA 4KVNH 1IGML 4V2CB 2CLVA 5DXWA 2O5YL 2Z9TA 5I1DA 2EDOA 3L5IA 2H2SC 2YPVL 3TNNB 3SDDD 5HHMB 3L5XH 3H9ZA 4OIIL 4F7CB 1ED3A 3ISWA 4OGAD 2ZKHH 4OZ4B 5DYOA 1V8HA 4HUXB 5KSUA 3PL6D 5IFJA 3VI3F 1DDHA 3FQUA 43CAB 4QRPA 4ELME 1QYGL 2XQYK 1ZHLA 1Z5LA 2HKFH 2R0WH 1A3RH 2UVEA 5DJ6B 3RFZC 2FX9H 1NCDL 2X89A 2BCKA 2MQ0A 3MLVL 3DETC 5T3ZL 4N8CL 4LDOB 1XAUA 5DA0B 1I1AD 1KCSH 1QLRB 4LPCA 3VMPA 3RDTA 1JUFA 2OR7A 4IM8A 1DANT 5B4MC 1XR8A 3HR5A 5DD1L 1G7HB 4OKDA 1JYXA 4R8WH 3UPRB 4JVPA 2CLZA 4OZGF 4L1HA 3HCVB 3DX6A 4N0FB 1W72L 4ZFFA 1A7OL 2FIKB 3QG6B 3LS4L 1S9WA 4GRMA 5BJTA 4MX7B 4Z7WF 3MSPA 2ZSVB 3L3HA 5EUOF 1LO4L 2EYSA 5E2VL 1LP9F 1L6XA 2H6PA 4KTEL 4M6AA 1XGPA 3OR7B 4JFED 4CAGA 1KN4L 1LEKA 2BRQA 2OL3B 3C6SB 5BRZD 5DJDB 4L4VB 3TZVD 2ADJB 1D5ZA 4K2UH 4U1MB 1A9BB 4MNGE 2OXHA 2X7LB 4CVXA 3MXVL 3BPLB 5HYJE 4HT1L 4I2XB 2Q86A 1M6OA 3E2HC 3L6FB 3GBNL 3UZQA 1U41A 2AI0L 4KRLB 2KUTA 4NIKB 1AGFB 2NY3C 2EIBA 3B9AA 3QIWA 4MJ4A 4HZLB 4AENA 2IAMA 1K6QL 4ZYKB 5KVDH 4DN3L 2G5RA 4E5XB 1IRAY 4JDTH 4HUVB 4WFED 4Z7VE 4CNIA 4WFHD 5JR1H 2JJWA 4LLAA 1NBQA 3ZLQC 3TBTB 2ZCKL 3ZO0A 2LVEA 1OVZA 2FB4L 4JHWL 5EU7C 5ISZB 5FOBA 1Z0NA 4YDJB 5T3XL 4LSUL 3QQ4B 4GW4B 5I0DA 1KB5B 4X4MA 4DCQB 4XP9H 1U8PA 3KXFD 3U30B 1JV5A 2VB5A 1BECA 2XWTA 2NY7L 4P23C 1KUMA 2ZUSA 2XIDA 4WI2A 3S96A 3DSNA 4JFYA 2VN4A 2LVCA 3OGCA 3GJFH 1XF5A 3U4EA 4Y19E 4OTXL 1URLA 3RX7A 1VFAA 4NC1E 4DQOL 3BXNB 3RTQA 5JOPE 3VH8G 5I6XB 4QRUB 3RWIA 3S6CA 3UTTA 3DV4B 1N59B 3FO0L 4RFNC 1IILE 2XPGB 4GW5A 4NO2A 4WU5B 3QHTC 4JRYB 5EFIA 1X5AA 2DQJL 4G6KH 4YZFE 4AM0A 3TC9A 3EDEA 1K5NA 1WIPA 2G60H 2Q20A 1IEHA 2B20A 2BERA 3QO0A 1CFNA 3FZUD 3KJ6L 2CSPA 2XKSA 5EOCJ 3T08A 3IKKA 4EDXA 5HHQA 2FECI 4EXPX 5E00A 2CKNA 1J5OH 1UACL 4AEIL 1AR1D 1LD9A 1RUPL 1LO5B 2HRPL 3OL2A 1GZQA 1GH7A 1NDMB 5INCB 1W8OA 1BVZA 2K7QA 5D96C 3KPSD 1OTSD 1QHPA 3DVNA 2JJSA 2EXWD 2JIXD 3BH8A 5DK0A 3KPMB 4PRNA 1IGYB 5SV3A 2A1WH 5AG8A 1P4IH 5LGHH 3GSWA 1MCNA 3G6AB 3BKCH 1CGTA 2GHWB 4MXWL 5J12B 1BD2D 2G5BA 2GJ6A 2ESVD 2NYYD 4I0PD 1FCGA 3O2VL 5E03A 4OM0L 3DGGA 2EDJA 3KPLA 3TYFA 2X1XR 3ALXA 4YHMH 2FHCA 1PD6A 3BP7A 1KT2B 3IAQA 5C09E 3STZB 2CKBA 3B9EA 4GKSB 1G6RL 1EXUA 3MZTA 4C4KT 1A7PL 4WW2C 5KN5A 1IGCH 5FV2A 4PLJC 3ULVC 4MJID 3VG9B 5L6YH 5BVJA 4MDJA 3HE7B 1AI1H 5DSCA 3TVMA 5BV7H 3MODH 4XPBL 1QEWA 4M6NH 4KKAC 3B9KA 3CFIC 2OR8A 4Y5YC 5TDNB 1MRFL 2Y36H 3M1BB 2OR9L 4APQC 1BGXH 3F5WB 4PRHA 3G6JE 4JKPH 1Z9SA 4XCCH 3VFGH 3WFCL 4EZMA 1A6AB 4GMSL 3MRCA 2W59A 1AJ7H 3O8XB 4QTIH 3T2NL 5C8JB 1RZ8B 4PV8A 5ICXB 2UWEE 4IRSA 3ZKXC 4R97C 3DOSA 4GFTB 3EO1A 3GBLA 5DVNA 4FXKB 1HEZB 3Q3GB 5EOCH 5IJKC 1MWAH 2ADFL 1EA9C 4XPAL 1ZLVH 5J1AB 3ETBF 3NCYS 5F6IB 3VFWB 4AQOA 4W6WB 4U1IB 1C12B 3VD5A 2Z8VC 2E9WA 4C83B 3L9RB 5GSVA 1T3FB 1BIIB 5DJ0A 4NQXA 2QKIB 2JB6A 2AS5M 4XAWH 3U9PH 4GKNA 5A3IC 1TJIH 3PWUA 2HT2D 2GW5A 4RAHA 4M1GH 5B21A 1NGQL 2EEBA 3OB8A 4KAQL 1UXSA 3NACH 1JPTH 1I4FA 1LNUB 4K3GA 3MUGB 1NCAL 3OPZH 1QA9B 5AYQA 4HS3B 4JVUA 4S1QH 1LO2H 1UM5L 5GPRA 5MI0C 4JAMB 4U4BA 4XWGH 1V7ML 3O9WA 4KJYB 4K3JL 5E1HB 4N9GA 4OAWB 1CE6B 3FB8B 4YDVA 2FJFA 2BMKA 3O3DB 1NUFA 3ARBB 3EUUA 3MUJA 4GAFB 3D48R 1AGCA 3WJLC 1MIEH 4ONHB 4Z7VA 4N0YH 4FTVD 1OY3B 1X5YA 2PO6B 4YIQB 3KDMA 4XCNA 1FZMA 1MQKL 2MOVA 2BY3A 2DJ4A 1ACYH 1OGAD 5A1AA 1X6NA 1Y6MR 2O5ZH 3UO1H 3KPRB 5C0AD 2BOBB 4LMQI 4UTAL 5LXGH 3CFEA 1MAMH 4HHAB 2FBJL 4JDVB 5EC1A 3HC3H 5D5MA 2WV3A 3QJHA 1BREA 1IQDB 3S37H 2DBLH 4JM2D 5MENA 1MHEB 4OD1L 5C0BB 5F6HI 3RPIA 3CDYA 1BQLH 4Y19A 2J5LB 5DURD 4O02H 4XNYH 5MEPB 2XZAH 3HZKB 2K9UA 5D7LB 3EJYD 5GRVL 2D7OA 1RZIB 4L8BB 4G7VL 2FIRT 1NC4B 1T2QH 3SKNB 3K8KA 4PV9A 2DQDH 3IKCB 3VFMA 3QNXA 4PR5B 2DQCL 4CW1A 3O11A 4LBEA 4WO4D 3PWLB 1OT2A 4FZ8L 2HMIC 4YE4L 5J3HC 3ESUF 2NY0D 1HHIA 3ROLB 2GTZB 3RVWD 1T0PB 2GITB 3C6LD 1EX0A 4Y2DD 4HBCL 2M8XA 1SJHA 3D39E 1X5KA 5FF6A 4IOSD 4ETYA 3SKMB 2W60B 4NDMA 4QNPF 4F37F 5KW9L 2NW2A 2OK0H 4JO3L 5EN2B 4OQTL 4ZUUA 4L3EB 5CWSA 1O7VA 4GRLD 5FV1L 3UBXA 1FLRL 4PP2B 3FONA 4QXGH 4HF5H 2VLRB 1EEQA 1U8OB 3R4DA 3WYRA 2ZG2A 1G6RB 2PYFA 3DMMD 1ZLUK 2NXZC 4JR9H 3O3AA 4L9LC 4NUGH 4MCYA 4JPIA 1C5CL 1CF8H 5IW3A 3QZWG 1RZGB 2ZG3A 3CX5K 5C09A 1NGWB 5JO5B 3V0AC 1QVOB 1BHGA 1CTOA 4CU6A 3BQUA 1E4XH 1VERA 1I1FA 4KQ4H 5HJ3B 5DQJB 2QQLH 3ZE2E 1RUMH 3P73B 4NKMA 1F6AB 1YNKL 4DW2L 3QUMH 1DN0B 1UXWA 1F02I 4OCWH 1VFBB 4CADB 1LK2B 2WUBH 4OFVA 3QEQE 5DDHA 5IOPB 2E6QA 1EH9A 3G6JA 4MQ7B 1KLGA 1A1MA 1I85C 1LO3L 1V5JA 3IT8D 4ELKA 4OZHE 4UMGA 3Q5YA 4YO0B 4N90E 4WFFE 3ARDD 4RX4D 12E8H 3WDHA 5K93A 4NM8H 2UWEA 3NZ8B 5DQ9B 3V5KA 3M45A 4POUB 2YD8A 4ZUSB 3BZFB 2VH5L 4C58B 3PABB 3MRGB 5FO9B 1NBVH 4I3RH 1XH3A 3MBED 4JN2B 4LLMA 3RY5A 2M26A 5D93B 1YPZB 5DHXB 1D7FA 1CLZL 2BRRL 2HFEA 2IBZX 1QBLL 2X5PA 1KCKA 3FB7A 4PGBB 2ICWJ 5EOTA 1FYTE 1DQJA 1CDCA 2RFXB 3DUSB 2PXYB 3EAKA 3MLSH 4IRJD 4K23L 3IS0X 1DBBL 3MRHA 3VFSB 3O41A 1A0QL 1S7TB 1XCQB 3W0WB 1FLTX 3BVNA 4O5LL 7FABL 1F58H 2NQCA 4PJEF 4N0CD 3GJFA 3C08H 2FYYA 3PIQB 1OB1B 4GAGH 3UJJL 1DBML 4R7DB 1YJDC 4Q6IA 3EDDA 3LH2L 2N7BA 1HHJA 4LIQH 3EJZD 3SEPA 2F54E 4JCLA 2PW2B 1FV1A 1F4XH 1HH9B 4KDTC 1C1EH 1D6EB 5D70L 5E2WL 4OLEA 3RHWK 3H6JA 3LKSA 3MTRA 1BOYA 4R90H 3K8MA 1TCRB 2O93L 2JJUA 2IPKA 2JCCA 2J8UB 3VFRB 3H9SB 5JA8B 2R1XA 2ARJQ 1U58A 1I7TB 4BUGA 5JW5A 4HWBH 4NQCB 4OZFG 4PJ8B 4XP6L 2IWGA 3VXSA 1B6DA 4Z77A 32C2B 4HS6B 4PJGF 3OKDB 1AXSA 4K7PX 5L88L 1QBMH 4YXHH 1IAOB 8CGTA 4F3FB 4PRPD 5I8OL 1ZOXA 4M62H 3RU8L 3VI3E 4HXBH 4OBSA 3EO9H 5DHVB 1T1WA 4G8IB 4PJAB 4WCYL 1Q1JH 3TNMA 4BSJA 3P4MA 2Q6WB 4XHJD 3ELAT 4MJ6B 4HPYH 3VG0H 2VZSA 4XGZB 2CRMA 3IJSA 4L5FL 3TBYA 1A5FL 1FBIH 3WXWH 4KQ3L 3QI9A 5JQ6L 5GISH 1P5UA 4QY8B 3GMQA 4KTDL 3TT3L 2W92A 2DD8H 4FQQA 4C4KO 5CJQL 4ZSOA 1PFCA 3QDGB 4OZGE 1U8MB 4JQXC 3V52L 2IG2H 1XT5A 1OGTA 4OSUL 2AJYH 5K9JH 1A1NB 3UTSA 5L9DL 3PXHA 4Z7WE 4G9FD 3MRBB 5CP3H 3BX7C 1HNFA 5SWZA 4PYGA 1GGCL 5EUOE 3QPQD 2JELL 1LP9E 4H0IA 5EPMB 3VXTA 3PJSA 2HG5A 4ODTH 3TGXA 1MWAA 3RX8A 4JRXB 5GGRA 4HFUL 5DJ8B 5IBUB 1N8ZA 1A64A 2HJFA 2XWJA 3P77A 2MHAB 3AU1A 4DUVA 4PJXA 2FX8H 1VSCA 5J9PA 2B1HL 2LU7A 3GGWA 3NCCB 1KTKE 2P7TA 3D69A 4I48A 5IMOA 5IM7B 2D03L 3MRNA 4ZS7H 5LGKA 3AROA 3S35X 1HHHA 1AKJD 1BLNB 2JB5L 4GBXA 2UYLA 1A6TB 3BAEL 4KHXL 15C8L 3JVGA 2Q3AA 5JTWA 5D7JD 3LN9A 3MJ9H 3RHWF 5C1MB 4JY6B 4KI5F 3VU2A 3JWNC 4WNQA 4YDLB 3ZTJG 2AXFA 3BIKA 3LKNA 5I15H 4OZHA 6FABL 2BSSB 1IE5A 4XP5L 1A2YA 2AK4E 5BRZE 1JPGB 2OTWB 1PEWA 5LGJB 3GSNH 4LIQE 3BH9A 5EU6D 3GK8H 1HSAB 3PHQA 4P9ML 5DLML 3Q5OA 1CFQA 5F3BA 1CD1A 3I50H 3DTXB 5EWIH 2ZSWA 3D85D 1HKLL 1AQKH 5IG7A 2NW3B 2YWYA 2DQTH 5L7XL 4JG1H 1T83C 3QIBB 1Q9WA 2FX7H 1R3IH 2DWEA 1DVFA 1MH5A 4FQ1L 3LQZA 5AAWA 2MCPL 1R0AL 1EEZB 3RGVD 2UVFA 2XICA 4TUKH 4URTB 5IB1A 4N8VB 3VGAC 2GSIA 3D2UA 1MNUL 1RHHA 4WFEE 1T1XB 4QHMB 4K9EL 3PNWB 3QDHA 4WFHE 5L2JA 2DL2A 2IQAA 2DQEH 5MERA 2EIZB 4HDIB 1DSFH 5DRZB 3BGMB 4NQEB 1KPRA 3CK0L 3NN8A 1I3RA 4OM1H 4EI5B 4Y8AA 2P8LB 5I16B 5JXED 1C7SA 4KGJA 5J7CC 4WUUB 1CICA 4Y5XC 1MCKA 5EO1B 3NABH 2NTSP 5D9SA 3GMNB 2EDDA 1QFUL 5EZOH 4LVEA 5FGBC 1UJ3B 5D2NA 1U3HD 3QCTH 4ISVB 1TDQA 5IT2H 4X4YB 4M5ZH 3NCBB 4UBDD 2DKMA 5HGDB 4PRIB 4X5WB 4J1UA 1FAIH 2IBBA 2DMKA 2HT4C 3K4AA 5B8CB 2FEDC 4OZIF 5CEZE 4ORGA 4OLYH 5I76A 2WMPA 3RIAK 4NQDB 2HVKB 2YC1B 3GSQA 1RMFL 1KF9B 4P5KB 3STLB 5I30L 2R1YA 3QXTA 4IJ3C 5TF0A 3SDAA 2PTTA 4J6RH 5E08L 2C26A 5HHMD 5E5MA 4KROD 1D9KA 1JNJA 5IWLC 4FNLH 4XMPL 2C3GA 4O4YL 4YWGH 5D6CA 3KYMA 5D1XB 1GGYA 4Y4HC 3IYLW 3KPSE 5TPWH 2NR6C 2BY2A 5GGVL 1E4KC 3S88L 3C2AH 4OBRA 4H8WL 1WC7A 4L8SB 4LCIL 5B39B 2X4SB 4QRQB 4NBZB 4HX1A 4LVOB 5FYKD 1NAKH 3MLYL 3Q6GL 1K85A 5EBLA 2Q1EA 1UC6A 1BD2E 3F7YA 2P8MB 2ESVE 3QUMA 4X4XA 1T6WA 5ID0B 3FT4A 2A6JB 5E8EA 4NHCL 3WFEH 3TV3L 3VJ6A 4HQQL 1NGZB 3HI1B 3SDDA 1BJ8A 2JJTA 4ZFOL 2VXVL 4NHUB 2R8SH 5J6HB 3BDXA 4NCC1 2WM0A 5CGTA 3PL6A 3RI5F 3VD9A 4UI2A 4NGHL 3D3VD 1CGWA 1WZMA 4MMXC 1KTLB 4LDEB 1HILB 5CZXC 4ZD3L 5C0DB 3T0EC 3QDMA 5FB8B 3AY4A 1S9YB 4GXVL 1INDL 1EHAA 2D7MA 3FRPG 1SHMA 1CK0L 4QHUA 1RK0A 43C9A 3HMXH 4ODVL 3ARGD 2X4RA 4LF3B 1I1AA 1ZSDB 2GTWA 4L4VD 4JJ5B 1S9VB 1YNLH 1JJUA 2ORBL 3CLEL 3IU3A 4FG6C 4G6AD 3WL9B 3RAJH 3THML 3MOQA 1ORQB 4NN5C 5L2KB 1P69B 3TA3A 1AIFA 2VUYA 2IANB 3BN9D 2DWDB 3V4VL 4C56B 4LASH 1A6UL 5IR1A 5DGRA 1HDMB 3PP3K 1BEYH 3H7BB 4UT7H 5GGSA 4ONFH 3A67H 4UT6L 5DS8B 2VL4A 3BPOC 4FQJH 1JNHA 4JHZA 5DMGC 3MNZB 2J8OA 1R5VB 4JFEA 3SPVB 4F57L 1ZVHA 1WUNT 1GCFA 3TIEA 1ZS8B 3K1DA 5ABDE 3RKDC 4LLYB 3DVGB 3CJJA 3ZKND 5JXAH 3DX9A 4WI3A 3T65B 1OAKH 1BBJA 1T7WA 5J1TC 5CEYA 3ZL4L 3QP3A 1DE4B 3CUPB 1ZMYA 2VXSH 4KK8D 4LSTH 4ZDHA 3L5WA 4HWBA 2X9XA 1ZANH 4X0KA 4LU5H 5JPNA 4XBPA 3BYYA 2HFFB 3NTCH 3TBWA 5I73C 4AH2B 3BPNC 3S36L 5I1IH 4KKBC 1FG9C 1GPOH 1P84K 1AP2A 4KUCF 4OV5A 2EYTB 1S7VA 1KFAH 4X99A 1EUUA 4QWWC 1B88A 4LARL 1OGAE 4OIBA 4Y1AA 3ARTA 3B5TA 4KTYA 5F7DB 1OP3H 1FFPA 4O9HL 3GI8H 4XX1E 5SWQB 4X9HA 1G1YA 3KXFA 4UNVA 2QSQA 4QNPE 1T03H 1DCLA 5C07D 5C0ND 5GIRB 3UPCA 5C08D 2BNQE 2B8OT 1G6VK 5DQDH 4AY0A 4RMVA 1MFEL 3TYGH 4ODHL 2R56H 4QXTA 1J1OH 4N5ED 5C0CB 3D0VA 2NY4B 5TFSL 1JZ3A 2YEZA 2F74A 5JDSA 1T1YB 2X4NB 5IUSA 4F7EB 3DHMA 3FQRA 4WWKD 4KY1L 5CP3A 2X4UB 4NO0D 3PWVB 1R3KB 2NY5L 1T1ZB 3I02B 5BW7C 1U8KB 3QXDB 1KXTB 1C08B 3SDYH 2YD7A 4PRBB 1VACB 2YMXH 5CHNA 3MGOB 5D7IA 3QXWA 2AVGA 3L3OB 4XBEH 4HWEH 1EIBA 3BD5A 3PHSA 1UWGL 4WI4A 1OP5H 1RY7B 3KPSA 3HE7D 3LDBB 3VD3A 3H3PL 5TJWK 2JIXA 1P4BH 2MQ3A 3F58H 4YNYA 4Y5VB 4YEFA 1RIVH 2EC8A 3OAUL 4XXCC 1WAAF 1BBDL 3ZYZA 1MFCH 1GGTA 4RMUA 3LVEA 1YDPB 1PX4A 1BD2A 5AZ2L 3INUH 4NYLB 4I0PA 4LSDA 3O8XD 3HE6C 1K4CB 3O81A 4MS8C 2AP2A 2R2HB 1EMTH 5D2LE 3NIGF 2UZIH 1A7NL 1MCBA 4DZ8B 5EA0L 3EHBD 3BUYA 2YKLH 5M95B 2RHEA 1RUAL 1J1XH 4U1GC 4RGOL 4ERSH 3GSNA 4MJIA 4DWHA 1MHPL 3BRDA 4PJ7B 4OLUL 5KTEL 1N0XH 4X9FA 5C7XL 5EOQL 2Z92B 3L3DB 1QSFB 2YPLB 5FM5O 2AERT 4NO5A 1WIOA 4I18C 4UDUB 4G3YL 2OJEA 5ACZB 2R4RH 3U0PA 3RWGB 5BQ7B 3FCTA 1CR9L 4PJEE 3F7VA 2VLKB 5ITFA 3O4OC 4U6YB 5F88A 3G04B 4DKEH 4X7CC 4UQ2A 1RULH 1YY9D 4XMKH 1MCCA 1X7QB 5GZOD 3LKOB 3SGJA 1FNGA 1LK3H 5J8OA 3D18A 1B6UA 5EO0A 3STBA 2LU4A 4YQXL 3AAZB 1G1CA 1S8DB 1T20A 2BHUA 1JK8A 1FZJA 1KIRA 3ARBD 3LRHA 2LAAA 2EDQA 1INEH 2PO6D 4HK0B 4OCRL 3ARQA 2BXZA 4JKKA 1TENA 2R29L 3IJYB 4P59L 1IGFL 2DRUA 5HHVH 4EDWH 4PJGE 2VR4A 3QEGH 3T0BA 1BZ9B 1IAIL 3CZFA 1XZ0A 2W0LA 1YEEH 3DSFH 4HD9A 3QQ3A 5DRXB 5T5FL 2NX5A 4WHTA 4M93B 3M17B 4XTRC 3SDCC 1CS6A 4YHZL 2Y07H 2CRZA 1UWEH 1H3PL 2PYEE 5E8OA 1CFTA 5KSBF 4TUJB 3GKWH 4K71C 4FTVA 1NC4D 5BOPA 1LDSA 1XR9B 5IF0B 4FQIL 4WV1A 2FD6L 5C2BL 4OUUA 3FAXA 5C0AA 1J12A 4JO1H 3KWWA 3L3IB 4Q9RH 1LE9B 2C3XA 1OSPL 2Y6SD 3P4OA 3C5JB 4LP4A 4EUPB 1F4YL 3TCLA 3QEHB 3AXLB 5JIHA 4ZNEA 4JM2A 2EH7H 5JHDD 2DDQL 4PLKD 4WGVB 1PW3A 5A2LH 2UZYB 4L3ED 4QYOB 3RJDA 1TJHH 1S5IL 1OQXA 1PQZB 3V5DA 3U0WL 2RBLA 5KSUB 1AE6L 35C8H 3LQAL 5FK9B 3QIUD 4JPWH 1A4JA 1BVLB 4J7RA 4QRPB 2NCMA 4U0RB 1BM3H 4KK6D 3SHSA 1XCTA 4L3CA 4JKLA 5EUKA 3L3GB 4X7TB 1D6VH 1RI8A 4APQD 5F8QC 2Q7YB 2UY6A 4HIJA 1ITCA 1JPFA 5SX5H 3C6LA 2C4FU 1YYML 1DLFH 1H5BA 1T66C 4BA8A 3CXHJ 5KSAB 3LQMA 4D8PB 5KS9A 3FTGA 1UH2A 3HMXA 1PG7H 2UY7A 4MAYC 3GMRB 4BZ1L 1F3JB 3VDBA 1MHCA 4KJQC 1P6AB 1BPVA 3QRGH 3C5ZA 4ZFFB 2OMBA 5CLTA 4POZC 3O6ML 4R4BA 2R2BA 4TULH 1QBAA 4FS0A 1S9WB 4GRMB 4LQFL 3T4YB 1JWSA 4WW2F 4PRAA 1NLBL 3DMMA 4Z7UB 3ULVF 5IW6A 1T5XA 3VXMD 4RGMC 1A6ZA 4TRPH 2XFXA 4G8EB 4N0RA 1EHNA 2FSEB 1EAPA 1OAZH 4J12A 2D4FA 5D2LA 3WO4C 2A74A 5DA4A 1GL4B 4DVBA 1D5ZB 3MUHL 3N1GC 1MHHB 4NOFA 5F9WC 2X1QA 4LLDB 5DMKA 2Z4QA 4HSQA 1FE8H 1FDLH 1M6OB 1KCVH 1R5IA 5IB4B 5A2JH 1FNEB 3FO2B 4P3WA 1RURH 2AEIT 1NBYB 1CDIA 2AEPL 1CFBA 5FGCB 2J5LC 4P99A 4MD4A 2NMSA 3BE1H 5DD5L 3NIDF 1GGBH 4YFLF 1B2WL 1I9IL 4OV6F 4G7YL 3BKJH 1U8HB 1CFSA 5DD0L 3LB6D 1CQKA 5FDYA 3ZKQD 1N6QL 3ARDA 3IFLL 1GIGH 3RUGF 1AHWA 3X14A 3W0WD 4CNIB 1FL3A 3OR6B 5EU6E 4OCYL 2A0LC 4GXUM 1BVKA 3MBEA 4HKJB 4FXLA 2DYPD 5GHWL 2EDTA 3EDFA 1FZKA 4OGXL 5FOBB 3MCKA 5FYJL 5GXBB 4M6OH 3EZ8A 2ZG1A 1QACA 4ZTOH 4I77H 5T1KD 3GBMH 4LSRH 1QRKA 3KPQA 3OAZH 3GHBL 3RVUC 3GI9H 1JV5B 3S37X 3HAEH 3S96B 3TN0C 4IRJA 4NZRH 2HTLD 3PF2A 3OGCB 3LEXA 2XT1B 3IVKB 3VE0A 2AQ2A 4KXZI 2VUOA 3QUXC 3UROR 3G08A 5T1DH 1IGJA 4M61B 4OZIE 4PJ8D 3CCHB 2VDPL 2BNUB 3W9EB 1RD6A 5IMKA 2V5YA 5IGXH 2EECA 5CMAA 4GW5B 4YBLB 1I7RB 4EOWH 5EFIB 4KVNL 5E2UL 5CZVH 2LE9A 4HLJA 2ZCHL 5IV2B 1K5NB 4A2MA 5EO9A 4YFEA 2EEDA 1IC7H 1JTPA 3QQ9C 2AABH 1I1CA 4RFEA 3L5XL 5HHQB 1P9MC 1X5HA 2ITCB 1I1RA 1S7RA 3MNVA 4XNMA 5EU4A 5CBEA 3T3PF 3T8XA 5KOVC 1HHKB 1F4HA 1GZQB 1KB5H 4PJBA 3GSVB 4RDQG 4ORZC 2R0WL 5I1JH 3PP4H 1A3RL 4PTTB 5F7UA 3IF1A 2NLJA 3BH8B 5DK0B 5TE4L 4AMKH 5DEFB 2H9GA 2XN9E 3O45A 2P47B 4UNTA 4LPUA 4GG6F 5CJXC 1KCSL 3MROA 3QDGD 1MAJA 2CK2A 4U1SA 4PRPA 5HI3D 2AW2A 4CJ1A 4NQVB 5FKPB 2HFGH 4OT1L 4WJ5A 5FUOL 5IMLB 3IDIA 1JZ2A 4R8WL 4D94A 2YOCA 3IGAA 4D9QD 5HYSA 1H8OA 2ZCLL 4M7JH 1EXUB 3VXPA 1OP9A 4KK5D 5FO7B 4ELMB 4UIMB 3T0AA 5H35B 3Q1SH 3ECBA 4DGIH 4GUPA 1HIML 1KJ3L 1Q9OA 1MRCL 3C60B 1QEWB 4O2CB 3IETA 5I1KH 5FYKE 4QKXB 3WS3A 2VQ1A 3TESA 1HI6A 1JIBA 3CFBB 3KLAA 3WNLA 4K2UL 2A6KA 5K9QI 1XGQA 3LPGA 2YPVH 4OIIH 3V6OA 2FWOB 4G9FA 4IRSB 4BH8B 5I2IA 4E0RB 3EO1B 1QYGH 3D3VE 1BQSA 4LLQB 2CO7B 3MFFA 5C71A 5CLWA 5DJYA 1VADB 4RRPA 1A21A 2PTVA 5HHOE 3U7WH 2WW8A 4UAOC 3PWPD 4X6DF 3UP1A 4Y4KC 4L4VE 5JNYA 2I60L 2IFGA 2JB6B 5DD1H 3WSQL 5JR1L 3MV8E 2WP3O 3OKKB 4JFXB 4K8RD 3AM8A 4MNGB 1WWCA 4OLVL 3JTTB 3DRTA 5HYJB 2IH3B 3B3IA 1AKJA 2GFBB 5K9OB 4BFIA 1AQDB 2G9HB 1NAMB 2XKNB 2ENYA 4L3AA 5FA3B 5D7JA 4HS8H 4XP9L 3DV6A 2H26A 5ICZA 1M71A 4OF0A 3JTSB 5E2VH 3ZZ1A 2YD9A 3KLHC 3K46A 3NGBB 5C2UB 4KTEH 3OG6B 4N1CA 1KN4H 2ZJSL 5DUBA 1KNOA 2EE6A 2VDKL 4UTBH 3BW9B 3D25A 4Z0BL 5I71C 1FFOB 5EU6A 4NQED 3MXVH 4F33A 2AV7A 3L95A 5DVOA 5B38A 4YC2C 4EIGB 5I1EL 3WHXB 1RZ7L 1K2DB 5C0EB 3ILQD 4XCFH 2OQJA 4W6XB 2QR0B 4G6KL 3GBNH 4GOSA 1ZAGA 2AI0H 4WDIA 1B4JH 2HTKD 2PNDA 3R06A 2G60L 3MUY1 2R0KL 3QJHB 3QUYD 3RWDB 1DUZB 1K6QH 4DN3H 1J5OL 3RGVA 2A9MH 4EVNA 4AG4H 3RPIB 1I8MA 2ZOKB 3CLFL 3O2DH 4NM4L 4LFHG 2BY1A 3L3KA 4DGYH 4HAFA 1C5DA 3TJHC 1QQDA 4PRID 4DAGH 4KK9C 4NSKB 2W0KA 1P4IL 5LGHL 4HC1L 4PV9B 4NQDD 5T3XH 4IHOB 4LSUH 4CW1B 2I9LA 3HPJA 2DN7A 1A3LH 5JXEA 5HVGB 4XWOC 3VXQB 2NY7H 2C1PA 1MELA 2D7PA 3QA3A 4AIOA 2CUMA 5K9KA 1MLCB 4YHML 4JZOB 5C07E 3LS5H 3OSKA 3U0TB 1WBZB 2J88H 5C08E 3RZWA 1XF3A 4OTXH 2A73B 4NDMB 4R7NA 1XGTA 4ZUUB 5A16B 4DQOH 1IZKA 5CUSH 5L6YL 5HGBB 4YDLC 1D5BB 1X5GA 3HS0B 1AI1L 5BV7L 2AJUH 3MODL 3EYQD 3HUJE 1ZT7A 1PKQA 1NMBH 4XNZC 1JGUL 2EKSA 4LLVB 5BS0E 4K07A 1BWWA 3IDXH 3PUCA 1NPUA 1OW0A 3BISA 4JKPL 3VFGL 4XCCL 3FQXB 2IFFH 3NIGE 3MCLH 3VWKC 4X98B 5A2IH 3KJ6H 3TNNA 1G9MC 4KVCH 4JPIB 4RFOL 4F7CA 1Z0MA 5C09B 1WSST 4OZ4A 4P46B 1RUPH 1EEYA 3FO1A 5E6YA 43CAA 1KXVC 5EOCL 1I1FB 4KUZH 1UWXH 3QIBC 4W6YB 1N3NB 1FC2D 5DJ6A 1FQ9C 4YH6A 2MKLC 5CZKA 2PUQT 1HQRB 1A7QH 1FSKC 1G7QB 5DDHB 3G6JB 1AC0A 1G7HA 3O2VH 1QSEB 4NNPL 4U3CA 3U9PL 1IM9B 2X1WL 1TJIL 1U93B 4E42B 5EZLB 4ELKB 3UPRA 4DUWA 3HCVA 2OMNA 4N0FA 5E4EC 3RA7L 5FAAA 5LQBL 1G6RH 4IRZH 3NACL 2FIKA 1J0ZA 1J88A 3QG6A 4PPTA 1JPTL 3VFVB 4EI5C 1YN7B 1A7PH 3ARFC 1JRHI 2IAND 5I8CA 4JGMA 3D3VA 4KKLC 4MX7A 1XGUB 3S5LG 4U2YA 3WNOA 4XPBH 3B5GA 1GYAA 2NY2B 4XWGL 4U6HA 4DK3A 4TSCL 2HFEB 4PG2A 1U2HA 1MJJB 3OR7A 2M1KA 3KG5A 3IDNB 5DJDA 4L4VA 2D3VA 2ADJA 5D1ZC 1QLFB 2BVUA 1A9BA 3BIBX 3WXVL 2X7LA 5GGVY 3MRHB 5B8CC 2I27N 4I2XA 1H15A 3HAEA 4DKAA 4YDIL 1ACYL 1U8NA 5KZCB 3ULUD 3UO1L 1F3DH 5GGTL 4LKCB 5EU7E 1NCWL 2EDKA 2GI7A 3L6FA 4M7ZC 2ADFH 3GJFB 1XIWD 3TO4C 4JGUA 3BWAB 4HZLA 4KV5F 3WMSA 4MZ2A 2VNCA 1FVDA 1CT8B 1PY4A 1I9RH 1X5FA 2P5EE 3I2CL 3MREA 1F4WH 3GRWL 2DBLL 4TNVK 4ZYKA 5CJBA 1HHJB 2FZ3A 4NPYB 3MA7B 2ZUYA 4HUVA 3B4NA 5D1XC 2EIEA 1BQLL 2AXGA 4KRPB 1BX2B 4XNYL 4GAYB 2VR5A 5ALCL 3TBTA 5GS0D 4BFGA 4L8SC 4LVOC 1T2QL 3JBG7 4A6YB 4YDJA 4PB0H 2DQDL 2R1XB 2VIRB 4PYHA 1YEIL 3QQ4A 4GW4A 5F7HA 5CKGA 5J0BA 5JW5B 2FEDD 4WHCA 1KB5A 1J9CT 4KKNA 2HJLB 3DYOA 4DCQA 1IAII 1K8IB 3EYFA 4LNVA 2APFA 2YPKB 4NC0B 3BP4B 4WU7A 1V7MH 4K3JH 4CMMB 1ZWIB 2L0DA 3QWOB 1TJGL 4JQVC 4M7LT 2HAZA 4Y16C 3VRJB 4MA1B 3PWJA 2OK0L 1U3YA 2DLTA 2NY4D 5MHSD 3BXNA 2GJJA 3TNMB 1MQKH 3P4MB 4Y4HD 3WFZA 4R6UA 3BZEB 3OBAA 2EO1A 3DV4A 1U0QA 2XPGA 3IJSB 4WU5A 4R4ND 5MEOA 4P3DB 3TBYB 3RL1B 1RZFL 3RNQB 3SE3A 5IB2B 4UTAH 5SX5K 3UEZA 3ARYA 3WS6C 3S4SB 4KZDL 4D0BB 2FJHB 3FFDB 4NUGL 4FHBD 4ODBD 1CF8L 3WJJC 4CBPA 5BV7B 5JHDE 3D39B 2AJXL 4LHUG 1MEXH 5INCA 5C08A 3QUZC 3E6FB 1E4XL 4KQ4L 3SN6N 2VXUH 3GMMB 3NOIA 4PJ5D 4PJDE 3TT1H 2QQLL 1IGYA 1RUML 3TPUB 1E6JH 3HUJA 3T0ED 3G6AA 3QUML 4RZCB 4FZ8H 4WWKA 4ZO6A 3W5MA 3IDJB 1NJ9B 1SMOA 4U6TA 4X8JB 3AREC 1N8ZB 3EYSL 2HJFB 2PW1B 4HBCH 1HK6A 3STZA 4FG6D 12E8L 4OD3L 3IDMB 3GGWB 4JREC 1QNZL 4IOFC 2HWZH 5KW9H 1CG9B 3IDGA 4OQTH 4K9EC 1NBVL 3QNYB 1VPOH 4P2OC 3VFPB 3HE7A 1FLRH 2V6HA 4HH9B 1HHHB 4N8VG 2VWEC 4FOMA 4YBQD 1MCOH 1QSFD 4NBYB 5LKNA 2IBGA 1E27B 2YPLD 2Z31C 3MYJB 4NUJB 1I8LA 1MUJB 3QEQB 3SCMD 1K4DA 4WNQB 5DMGD 3VXME 5HI5D 1QRNE 1T22B 3ABZA 3O8XA 1C5CH 2VLKD 4OZHB 5C8JA 4QRTA 1RZ8A 5ICXA 3L7EB 3CXHK 4JEGB 1YECH 2P48B 5CSZA 4FXKA 3O2WL 3MRFB 3Q3GA 2R23A 3O6KH 5J1AA 2GUOB 5IP4A 3DHJA 1EFQA 4GAGL 4MQSB 2BFVH 4M48H 3VFWA 5E99L 4U1IA 4RAUB 1C12A 2AV1B 2ZSWB 3OAZK 4DW2H 1ETZB 3VWJC 4C83A 1T80A 3L9RA 1T3FA 2ZUXA 4LKXB 1BIIA 4LIQL 2WBKA 5BO1L 4JPVL 2L4OA 1FYTB 3MV9D 2QKIA 3UYPA 3O6FD 4CN1A 1B4RA 4KKBD 1F4XL 3N1PC 4X6EB 3LQZB 2YZ1A 3AGVA 4R2GB 3BJ91 4R90L 3VGDA 4RMSA 3S8WA 1RHHB 4AQ1B 3W0WE 5L8LB 1M7DB 2VH5H 5DUML 2HYMA 1WBXA 3B2UD 4HWBL 4MMZC 3MUGA 3VFUB 1JF1B 1QA9A 3O2DA 4X83A 5I1GL 4HS3A 1M7IB 4JAMA 4ZXBB 1CLZH 3W81A 1Y6NR 4KJYA 4WIQA 1FYHB 4OAWA 3FB8A 3I3DA 4F58L 3R8BB 1Y6KR 2WANA 3JV4B 3ARBA 1F4AA 4K8RH 3T3PE 4S11A 3DYMA 4ONHA 5B39G 4Z95H 2F54B 3EO9L 4P0DA 1UZ6F 2PO6A 4TVSa 4YIQA 4ZPVA 3AMKA 1Q1JL 1I3UA 2ID5A 1DBBH 3SBWA 2E6PA 2XNAB 1RSFA 2KKQA 2OSLB 3BIAX 1WWAX 4GG6E 1VKXA 4O5LH 3X13B 7FABH 5JMRA 3VXRE 2BOBA 4HWNA 5HDBF 1FBIL 3K74B 3WXWL 4JDVA 3UJJH 4TNWK 3WEXB 1J05A 1BQHB 4XH2A 1KCUL 1YEDB 4ORGB 1WZ1L 1FHGA 1MHEA 3KPPA 1CWVA 5JZ7C 4WTZA 2ERJB 4FFVC 3SDAB 4I1NB 1X6LA 5MEPA 2IG2L 5D70H 3HZKA 2ICCA 5E2WH 5K9JL 5J1SC 3D5OF 1P6FA 1RZIA 4IDJH 4KDVA 1NC4A 4RIRB 3IKCA 4P5TB 4PR5A 3ZYJA 3PWLA 4LRNH 4NQTA 3N9GH 5JW4M 4MB5A 3KS0J 4X7DC 3RGHA 4XP6H 3ROLA 4OFYD 4ODTL 4J3VA 3ZT6A 3HRZB 3NIFF 2GTZA 4L4TD 1YC7A 2GITA 1KACB 4U7KA 4FP8L 4LSSL 5KSAD 2FX8L 3GMOA 3CX2A 3F7YB 3RU8H 5SWSD 2I07B 1DFBH 3QUMB 4OZGB 2C4XA 3VD7A 1RJCA 4I8DA 4XVJL 5D6DA 5E8EB 5I1AA 1WFUA 3QISA 4L3EA 4S0TD 4ZAKC 4PJDA 3UBXI 4Z7WB 4JJHA 4MCZA 4PP2A 3VXNB 1FH5L 4ZUTA 2VLRA 2MMXA 3QIUA 5EUOB 1LP9B 1A5FH 1U8OA 2JK5A 4WHYH 4PJFF 1G6RA 4X6DE 1IM3A 5HYEA 1REIA 3MBXH 3WKNA 4HIEB 1KIQB 5HY9B 4HEPG 1KJ2A 1A14H 4X6CF 3RJQB 1RK0B 4KTDH 5BZDB 5I15L 1RZGA 2CDFB 2X2YA 2YSSB 1NGWA 5JO5A 1QVOA 3GK8L 3V2AR 3IU3B 4LRIA 3WNPA 4OSUH 1P2CA 2FEEL 5HJ3A 4XPGL 4RGNB 4PJ9B 4PS4L 3I50L 3TP4A 3P73A 4EN3B 5EWIL 1F6AA 1AQKL 1P7KB 5K33A 2DQTL 1DN0A 1SEQH 1VFBA 4CADA 3KHQA 4M3JA 1G0DA 1LK2A 1R5WB 3G5YB 5BVPH 5IR1B 4QRRE 1AXIB 3BGFB 4HFUH 3CIQA 1UZ8B 1MPAH 5DFWH 2VAAB 3KPNB 2XY1A 4YO0A 3PWPE 4ZUWB 3PXJA 2WIIB 2NZ9C 3NZ8A 5DQ9A 2AK4B 4ZUSA 1PY9A 3BZFA 5BRZB 3TZVB 2C4FT 2DQEL 1V05A 3CXDL 3MRGA 4POYA 1DSFL 2F5AL 2D03H 4JN2A 1YPZA 3VA6A 5C0JB 2JB5H 1BBJB 3W39B 4OM1L 2FCBA 2D9CA 3RY6A 5TQ0L 1YUHB 15C8H 4PGBA 5I8KL 3DUSA 2NY5C 4ZDHB 4OD2A 2PXYA 4U1NB 3NABL 1WTLA 2YA1A 4J4PA 3WJLA 4LLWB 1NCBH 3PG2A 1ZA3B 3TBWB 3QHFL 1CXLA 3VFSA 5EZOL 4XP5H 1ZLSH 1XF1A 1XCQA 3CSYB 3W0WA 4GS7C 5IT2L 1S7VB 4M5ZL 1TTFA 2V17L 5DLMH 2BVTA 3PIQA 5ETUB 4NQEE 1OB1A 4LQ1A 1FAIL 4R7DA 5BXFA 2Q76A 4W4NA 4DVRH 1TQCB 5DWUL 1HKLH 2YUWA 5K9QG 3RDTC 2ICWB 1YQVL 4OLYL 3TCXA 2NXYD 3GMPB 4Z9KB 5ITBH 5T1KA 1KCLA 5F1KC 2PW2A 1TETL 1HH9A 3WHE1 4LVHC 2IF7A 1YC8A 4HEME 2VOTA 1BJ1H 5E56A 3ULUH 3NZHH 1TCRA 3RL2B 1MNUH 2J8UA 4YWGL 3LRGA 3VFRA 5GRZA 3OKNB 4NQCA 4JFDE 3D0VB 4H1LG 4PJ8A 5HI4D 2YEZB 3C2AL 32C2A 5EBGA 5DO2D 5JW4N 4HS6A 3OKDA 3HI6L 2EDHA 1IAOA 4JPKL 3HRPA 2RIKA 1T66D 5GS0H 2RAMA 4RDQF 4HJJH 4LCCB 4G8IA 2DI9A 4PJAA 1IJ9A 2Q6WA 4Z78B 1UB6B 1CXEA 1UWXK 4MJ6A 2R8SL 1JYVA 4QLRA 4XGZA 2JF1A 2B39A 1UM6L 3WLWD 1MCRA 4NZUL 2XA8L 2J3SA 3KPSB 3QIWC 3BD3A 3UTQB 2JIXB 2IAMC 1S7QB 4OQTA 5FGSA 4QY8A 1FN4A 3FKUS 2CDGA 1CDYA 3HMXL 3ZMRA 5TH2B 1HYRC 4WWID 4NNYB 3QDGA 2ESVB 5D72L 4I0PB 1U8MA 1PJ9A 3PWNB 4X7SH 5E08H 3U1SH 3V79C 3C09B 3F7QA 4JVWA 2AXHA 1A1NA 4MVBC 4YHYC 5DI8B 1OHQA 3QAZC 3MRBA 4XMPH 1RZJH 4JCMA 4O4YH 1MF2H 8FABB 1ZGLM 2DS4A 3HG1D 2WIMA 2YRPA 4UV4H 5EPMA 4PD4K 3V95A 3S3SA 3S88H 1U8JB 1ORSB 2P1YA 4HJ0D 4H8WH 4LASL 3SE8H 1BEYL 1ZVYA 4JRXA 2VQUA 3N06B 5DJ8A 2WBJD 1BOGB 4QF1B 1U95A 5IBLC 5HPOA 4ONFL 1RAMA 3A67L 2MHAA 4FQJL 4JFZH 3TFKC 1IC5L 3AS1A 3WN5A 3L1OL 1E4JA 3LKQB 4NC2B 1PYWB 2B1AH 3DBXA 3RTQC 1F13A 1H3XA 4NHCH 2EDRA 4M00A 1FNLA 5IVXF 5ALBH 4HQQH 5IM7A 5I74C 4CRPA 3F7VB 2R0ZL 5IQ7L 3U46A 4YBLC 5JXAL 5DJ2B 1TPXC 1BLNA 4RNRA 4KV5E 5M94B 1CQYA 1A6TA 2AJ3B 4Z18A 4S1RH 4D0DB 3X17A 3DARA 2VXSL 5TE6L 2BJMH 4LSTL 1JMXA 4KPHL 4GXVH 1INDH 3REWB 4HJGA 3RVUD 1CK0H 1ZANL 3HFMH 4AEFA 4BSVB 2BSSA 1KIRB 1FO0H 3ET9F 4F80A 3QFDA 3PWPA 1GPOL 2VLME 1GHFH 1JPGA 2YS4A 1IZJA 4X5XA 2JJSC 4NZJA 1II4E 1KFAL 3WV0A 1N6VA 4G43B 3O4LE 2JLLA 3THMH 3DTXA 3OB0K 1F3RB 3LQAC 4NN7B 2NW3A 4BK4A 1OAQL 3JSSA 3LKRB 4P3CH 3ZDYF 3LZFH 1NUNB 3GI8L 4RBPH 1L7TL 1A6UH 2FL5B 1JGEB 4IS6A 4JFQB 5GZND 3VI4E 4O2FB 1EEZA 3DX7B 2V5SA 3QDAA 1YEGH 2I24N 1CD8A 4GRWF 4N8VA 4E41D 1T1XA 1PG7W 4QHMA 4YXKH 4F57H 3PNWA 3TYGL 4QGYA 3X3FH 2EIZA 4HDIA 3TVMC 4TOYL 5DRZA 2AJVL 4NQEA 4MNQB 3B9KC 3LMJL 3MLTB 4NT6B 4NN6B 1OGAB 3C9NA 1IGIH 4ZFZB 4OUUB 2P8LA 5DD6B 3UC0L 5I16A 3BSZH 4UOJA 1XFPA 3EIFA 3H2WA 2YUXA 1MCFA 3VXUD 2V5MA 1N5YL 3SDYL 4S2SB 5EO1A 2ARWA 3AVEA 3QUYA 4IRSC 4LCWE 3KVQA 5I18L 4EEEA 1JZ5A 4XBEL 5GRVK 4HWEL 3UZEA 1UJ3A 2BNQB 3P0VH 4FMKA 4ISVA 3I6KB 4JO2H 4JDZB 4X4YA 1YNTB 3FN0H 4FQXB 5MHSE 4FABH 4PRIA 3FB6B 4X5WA 3ZT7A 1P4BL 3F58L 5E6IB 5D1QD 1KEML 5F1OB 1RIVL 4ODWB 1A4JB 2PF6A 1YMHB 2W0PA 3WD5L 3ARZA 4NQDA 1QFWL 2HVKA 4WO4B 1MFCL 4P5KA 3STLA 2IEPA 4O9HH 1X44A 3INUL 3TF7C 3OAYK 3KYAA 4YEEA 3NCYP 4HIJB 1JPFB 3UDWA 3C8KB 4Y2DB 5DVMA 4P46D 1RQ5A 1EMTL 5EIVA 2F8VA 2FHBA 4LPYA 4K3HA 4ODHH 1T2XA 2CLRB 2YKLL 4EUPH 4XB8A 5TFSH 4PJ5E 5GJSL 4ERSL 4GRLB 4M4PA 3NGBC 3O9WC 1E4XI 2MJWA 2X4SA 4R96B 4Q6YA 4QRQA 3T0EE 4GT7A 2R2BB 2V2XA 1X5ZA 1MI5E 3EOTH 5TE7H 2R4RL 1QSED 2IMNA 4JFHD 5ID0A 1IM9D 4M8QA 5HVHC 1T5XB 2OXGA 2A6JA 3P9LB 4X80L 2XFXB 3HI1A 3SY0A 2DB8A 4NHUA 5A2KH 4N8PA 2VABB 2A74B 4DKEL 4Y4FD 1G7LB 1RULL 4XMKL 1KTLA 3A6CL 3ZKMC 1A3QA 1WITA 3GDBA 1HILA 1UA6H 5FB8A 1LK3L 1S9YA 2NY2D 3DPBA 6CGTA 5DVKA 3RX5A 1QSFE 3OAUH 2YD6A 2YPLE 4LF3A 5EC2B 1KC5H 3KLHD 1ZSDA 4BFBD 3GB7B 1W0WB 4JJ5A 2H2PD 1S9VA 1INEL 2DJSA 4PGDB 1S78D 3GJEB 3TO2B 4PJEB 2VLKE 5HHVL 3WL9A 3NCEB 1ORQA 1AHWB 5F44A 3QEGL 1Z9MA 3FT2A 2VC2H 1A7NH 4OLWH 5EBMB 1VEOA 5EA0H 2IANA 4JY4A 2DWDA 1YEEL 2PCPB 3B6SB 3DSFL 1P7QB 3PQYD 2DQUL 1HDMA 4OLUH 3H7BA 4X6FA 4U2ZA 2Y07L 5DS8A 3VFNB 3WLBB 3V6ZB 5HXMA 1UWEL 4KRPD 3ROOA 1JNNH 4DJMA 3MV9E 3SPVA 4OFKA 1ZS8A 1CR9H 2X1PA 1F11B 4LLYA 3DVGA 4PJCF 5HDBE 3KPOB 2FLRT 4YFDB 3TJHD 1Q9KB 3VGFA 3T65A 3C87A 5HHNB 5J13B 4PJGB 5IHZB 3BD4A 3HB3D 4G80A 1IGJB 1T7ZA 4JO1L 1XIWA 1GZPB 2DQHL 5CGYC 4Q9RL 4JZJB 3WUWB 4KMLB 3I9GL 5CMAB 3JWOL 5GJTH 1SJEB 1ZHBA 5FYLE 5DK2A 4AH2A 3FHQA 4JO4L 5BMFH 3BQUC 2PYEB 4FQCL 5IB5B 5I66B 3VMOA 4RFEB 1QR1A 3GM8A 2RB8A 35C8L 4JFFE 4JPWL 4WI8A 2C5DC 5LBSH 3EYOA 1J8HD 3HI5L 1BM3L 2ZWLT 1XF4A 5F7DA 3MRQB 3AB0C 2HH0L 2V2TA 3BGAA 4O58L 1D6VL 5SWQA 3O45B 3RVXD 2GKIA 4FQPA 3GHEL 4WW1B 3ZE1F 3KJ4C 3ARPA 2DM4A 3MROB 5DJCB 1N26A 1UFUA 5DK3A 1S5HA 4YJZL 1BFOB 1PG7L 1JGVH 1PKOA 1AO7B 2APWA 2RR3A 4JKMA 4PJFE 1T1YA 5JW4Q 4LCUA 3IGAB 4UOW1 4F7EA 4PLOB 4WHDA 2ED8A 2FD6H 1GRWA 4TULL 1V3KA 2ADGA 4X6CE 4BQ8A 3PWVA 1R3KA 2P45B 1A22B 1JPST 1T1ZA 1KEGL 5CD3B 1U8KA 1H3WM 3QXDA 3IXAB 3HPLB 1C08A 3L3JB 4L4TE 4AEEA 3DX8B 4TRPL 1F4YH 4PRBA 1VACA 5JLZB 3EDJA 3NBNA 2VQ1B 1OAZL 1TLKA 1HI6B 1QPPA 3L3OA 1IEAB 5SWSE 3KLAB 2NPLX 4LVNC 2A6KB 3MA9L 1H3GA 4LPWA 3SKOB 2CIKB 2CO6B 4Q6IC 2X41A 2V9QA 5FYKL 3RNKA 4Y5VA 4JN1H 4S0SD 3CFKB 1KCVL 4ZO8A 1G7PB 5C6WH 1W0VB 2HN7B 1RURL 1WZKA 1VEPA 2UV3A 2BX5A 1YDPA 3MFFB 4JB9L 4XI5D 5DC9B 4NYLA 4S1DC 4NFDA 2HP4A 4KJWC 1K4CA 3CFJB 2R2HA 4N90D 4WFFD 1LEGA 3QBTB 1GIGL 4L4JA 4NKIH 4WI7A 3K2UH 1DBAH 1FO0A 2V9TA 4DZ8A 3P9MB 4QHLB 1NFIB 1CBVH 5FKAB 4HIIB 2X09A 3ZDZF 2E9JA 4PJ7A 4CVWA 3LAFA 4ZTOL 2FEEI 4I77L 2Z92A 3L3DA 1QSFA 2YPLA 3CFDB 4OF3A 1FYTD 4UDUA 1KCRH 1TQBC 3GMLB 1I7ZB 5ACZA 3WFHA 3DV6B 5E2TH 3GI9L 2EZ0D 5IVNA 3RWGA 3SCMA 1X4YA 4OI9A 4R2GD 5GS2H 4I9WE 4F9PA 2VLKA 3HNSH 3IAPA 4U6YA 4XPHH 5DUBB 5FDWB 3G04A 2E6JA 2QADB 2ATPB 2A77L 3D25B 3MR9A 5ADOL 5IMMB 1X7QA 2GAZB 2X1OA 3QI9C 2EDYA 5EU6B 1WWWX 2XTJC 4YR6B 1J11A 3LKOA 4I4WB 2E5EA 2AV7B 3DVIA 2FATH 3IU4L 4ZXBD 2X9YA 4JM4L 5B38B 5IGXL 2BVPB 1A6WH 1LEIA 4DFIA 3AAZA 5BV7C 3D85B 1S8DA 3IDYC 5I1HH 4H20H 2C3HA 2OYPA 5CZVL 5I8EB 3IB4A 4LEXH 4WDIB 4BFEA 2Z91B 5I75C 2R9HC 1IC7L 3VD4A 4HK0A 3MV9A 5TGBB 2AABL 3O6FA 3QCVL 1B2WH 5AEAA 3T0VA 5DD0H 4HG4J 3IJYA 1KLUA 3RGVB 1NAMH 3QR2A 5D7KE 3IFLH 1KB5L 2KZ1B 1BZ9A 4WI6A 4OF5A 1C5DB 3PP4L 5EORH 4OZIB 2C9AA 5DJAB 1OLZA 3V6FA 5GHWH 4OGXH 1BMGA 2J6EH 3M17A 1F5WA 2B4CL 1ZVSB 5HDLA 2X4PB 4QCIA 2Z93B 1EV2E 2XG5A 2HFGL 4OF6A 4TUJA 4DKFH 3B8SA 3QA3B 1JBJA 5GS3A 5ILTL 3ZHKA 5DJZA 4NKOB 1MY7A 2AKRA 3KLDA 4GBXC 4M7JL 4PBWD 5IF0A 4P5TD 4G8FB 1U3HB 1XGTB 3MV11 4DGIL 2VDPH 1QLEL 3L3IA 3MRIA 4OFDA 1IARB 1LE9A 2R0LL 1BAFH 2XN9B 1ZT7B 3C5JA 4EUPA 5BW7A 2EKSB 5E2UH 3AXLA 1IT9H 2E27H 1RJLB 2ZCHH 5DC4B 4R3SA 3K3QA 1NFDF 4HFWB 4QYOA 2IPUK 1INQA 3PDOA 1PQZA 3NMEA 4KROB 5F96H 1W8NA 3P9WB 5FK9A 4F7PA 1EEYB 3FO1B 2AJSL 2NZIA 1BVLA 4MZ3A 5H37H 3MRRB 1FORL 3AS3A 1QSVA 1AC6A 5TE4H 1DVFC 3L3GA 4X7TA 4OFYA 1MRDH 2Q7YA 3BT2H 4N0UE 5ADPL 3U7WL 4L4TA 1A47A 3TWCL 5IVXE 4EXKA 5KSAA 4X7EC 5JHLL 4D8PA 1UADC 4BH7B 2YD1A 2B5IB 2VZVA 5SWSA 5E8PA 2NTFB 4OT1H 3F12B 3FB5B 5FUOH 3GMRA 2FHFA 4YHOH 4RGND 1F3JA 1PDKA 4PJ9D 3ZT5A 2ZNWA 4EN3D 3F65A 2C3WA 2C3VA 4RMRA 1KPVA 4O2EB 2VDNH 2ZCLH 2F53D 4ZS6C 3T4YA 3BPCB 5I8CB 3D3VB 3HG1E 1HIMH 4MDIB 5IFHH 1CICC 4HS8L 1KJ3H 1BF2A 1MRCH 4Z7UA 2XA3A 2GSGB 5ACLA 4CDHA 1KB9J 5HHOB 4U6HB 4G8EA 1AD0A 4DZBB 2FSEA 3ARGB 4EQ3A 2NY6B 5D2NC 5EU5B 2AK4D 3K0WA 3G5VB 4Z5RA 5AWNL 4UTBL 1FZOA 3MV8B 5DT1L 4RAVA 3EO0B 1MHHA 3DO7B 1HKFA 4FQ2L 3ZDYE 4LLDA 2EDEA 1H15B 1VFOA 3HAEB 1U8NB 4RBPK 5IB4A 4XCFL 2ICEB 1FNEA 3FO2A 2VLLB 3J8F7 5F7FA 3WFDH 3SDAC 1NBYA 2VDQH 1B4JL 4GRWE 3KAAA 3QWRD 5LWYL 1FVDB 1JVKA 3MREB 1D9KC 1U8HA 1NMCB 2FZ3B 3DI3B 2A9ML 1NGXB 2DI7A 4AG4L 2ZOLB 4Z7QE 2I60H 3WSQH 3O2DL 1OTUD 2AXGB 3U2SA 5E2JA 3OR6A 4DGYL 1FNHA 4DAGL 4HKJA 4OLVH 3T04D 4Y88A 1CVRA 4WI9A 4PY8J 2VZUA 1A3LL 3VH8B 3KYNA 3NFPA 3EYFB 4HZAA 1DEDA 3F62A 4WU7B 5DD3H 3SDDC 2JJTC 1SY6H 1Z2KA 5K59F 4YBHA 4Q9QH 3WIFB 3LS5L 4OGAC 2LQRA 3BKYL 2ZJSH 2J88L 3PL6C 4E41E 3R0NA 1DQQB 3IVKA 2VDKH 3PWJB 4OLXL 4Z0BH 4M61A 5CUSL 3AY4C 3CCHA 3VXOB 2BNUA 3W9EA 4TTDD 2AJUL 3MPCA 3T4AB 5I1EH 1K3ZA 1RZ7H 1I7RA 5MEOB 1NMBL 2O61B 5CEZD 1I1AC 2FR4A 3T2PA 3IDXL 1NLDH 4JG0L 5IV2A 2XXMB 2IFFL 3VXUE 3MCLL 2R0KH 2QSVA 4KVCL 4A6YH 3NAAL 1KXQE 5C07B 4HGKC 2ITCA 1HHKA 5C08B 3MJ8B 3CLFH 3GSVA 4NM4H 3TA3C 3CPLA 4KUZL 2DF3A 2ED9A 1UKQA 4PTTA 5F97E 5DEFA 1GOFA 4QXUH 2N56A 5ESQA 3HUJB 4HC1H 2R2EB 3IJHA 1A7QL 1NC2D 3QUKB 4WFGD 5DJXB 4WWKB 5BS0B 3QCUL 4TPRL 1D5MB 4OCXL 4F7MA 2M2DA 5KVFH 4NO0B 3OJDB 2MPAL 1EFXB 4NQVA 3QNZB 5FKPA 1QFWI 5IMLA 2OI9B 5MP6H 2E8YA 1I75A 4FMFA 3S98A 4IRZL 3P0YL 4H0HB 3A6OA 4DUXA 5FO7A 2VZOA 3IDGB 4ELMA 1O0VA 3MXWH 4UIMA 3BESR 5H35A 4M02A 5ECJE 1KJ2L 1M7XA 2EC9U 5GQBA 3C60A 2CR6A 4O2CA 3VRIB 2YD4A 1JGUH 4P4KD 5GGUB 4HMEA 1HINH 3SDXF 1J18A 3CFBA 1QSEE 1K4DB 4JFHE 2I9TB 4PREA 3RWCB 4B5EA 2R39A 3FQTB 4PJHF 5IHLB 3VW3L 3P30H 4RFOH 3EOAB 4QRTB 1X5XA 2N7AA 4D9LH 3F7PC 4BK5A 2FWOA 4BH8A 4E0RA 5J4MA 1EVTC 4PJIF 2X40A 2EICA 5CSZB 3MRMB 2R23B 4LLQA 4LAQL 1RJZB 2G2RB 2YXFA 1A9EB 1VADA 1ZTXH 1I9RL 3FMGL 2NY3B 3HKFA 1F4WL 2DTMH 2WBJA 2RCSL 3V9FA 4U6XB 5C9KA 2I26N 3GSRB 4JHBA