4M6NL

Crystal structure of anti-il-23 antibody cnto1959 at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGSGYDVHWYQQLPGTAPKLLIYGNSKRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCASWTDGLSLVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO1959 light chain
publication title crystal structure of anti-IL-23 antibody CNTO1959 at pH 6.5
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nL01
3HPJA 1J8HB 3CNKA 5MENA 3FOLB 1TZIA 5ADOH 5GHWH 4NQSA 3KPLA 3V5DA 5LVEA 4MD4B 3TIEB 1CD1B 3RTQC 1BAFL 2Q6WA 1FG2B 4L1HA 4PJDA 4MQXC 3J7HA 4RFOL 4OCWH 2G2RB 1Q8MA 4NFDA 2J8UA 1KCRL 4S1DD 2AV1B 5D1QB 4F7TB 4ERSL 1H15B 5GGVL 3LV3A 1FNSH 3S36H 5ISZE 3NIGF 4K2UH 2J7LA 2YEZB 1IGIL 5HD8D 4J1UB 1RFDH 4GRWE 5HYJB 4HX1B 1OAZH 5GIRB 3KYMB 3O4LD 1F4YH 2ARJB 5FOJA 2NY2C 3QIBC 1LP9F 5IW3A 4TUOB 5J1AA 2Q1EA 2W0FB 1I1AB 1TVDA 4P5TD 2VXUL 5K59F 1KLUB 3MLXH 3RVVC 4BK5A 2F5BH 1QR1A 1ZWIB 5HDBE 5C0FB 1UKTA 3BEWA 1E6OH 4EVNA 1N3NB 4Y4KD 4G6ML 5KJRH 2RGSA 3RFZC 3ULSB 4UT9H 5E5RB 4DKDC 4LCWD 3FB7A 1VGEL 2H2SD 3QXDB 5DQ9B 3V7AG 1RVFH 1YMMB 4F8TA 4JCLA 4R90H 4FQHA 1OP3K 5HHPA 3PGCB 1HK6A 3SN6N 4MXWH 2DKSA 3OGCA 4PJEF 2D4DA 5C0DA 2HWZH 5ID1B 4I2XA 4PJFE 2MCG1 1R3LA 1RZ8B 4WVRA 4RZCA 5J89A 4NZRH 1TZGH 3F7PC 1E27A 3F6LA 1A21A 1Z0NA 1KIQB 3ZT5A 3MCKA 1K2DA 4G8IA 1INDL 4PV8B 2VWEC 4H26A 1Q72H 1DR9A 4NYLA 5EZLB 2APWA 3CFCH 3RA7L 3G5XA 1FJ1B 2A6KA 3FFCD 2CKNA 5J12B 4PB0L 4S11A 1WC7B 4LLDA 4F3FB 4LHJB 43C9A 3VRJB 4IRJB 1JUFB 3K4AA 2EH8L 3TP4A 4GKNA 3SGEI 4PJCA 3CU7A 1C7SA 1H0DB 2C9AA 3JZ7A 1XGQA 3D85A 1JL8A 1JNJA 1UH4A 3S7GA 2AQ1A 4IOFC 4PJ7A 1IEHA 2E7LC 3AFLA 3EOBA 4D0DA 3DSNA 4YHOH 1CDJA 5IVZA 3S8WA 1UWEH 4F15C 1R24A 4I4WA 4BQ9A 4YNYA 1XZ0B 1D5BA 3X12B 1EO8L 1CFSA 2H3NB 1XGYL 3NCCB 4R4FL 4YXHH 5F1NA 3IFOA 4X0KB 2R4SH 3N85H 3OJDA 5GGVY 1NAMH 4R2GB 4ENEC 3LKPB 3O3DB 2E9JA 4C59B 2R0LH 3RIAF 5T3ZD 5E0QA 4X4YB 3SKMA 2X4PB 4OZGA 1WITA 2EE2A 1P2CB 2Y4SA 2C3XA 3Q5TA 5FKAB 3QJHB 5D6DC 5DGRA 2FEEL 4YHPA 3FONB 3MUGB 1NFIA 1X7QA 1N6UA 3T2PA 4QRSA 3V0WL 5I8EB 4MSWA 2FO1A 4X9GA 2GTWA 2IALA 5JOFA 1T03L 1PDKA 4TVSa 1Q0XH 4E41B 2VDML 2OL3A 3UJJH 3CUPB 5T1LB 1UB5A 1GSMA 5HHXL 5DRZA 1R5VA 3B5TA 3JWOH 3X3FH 5CKGA 5MERA 4LCYB 4LLUB 2AI0H 1FV1A 3EYSH 4HIJB 2LFGA 2F53E 3MOAL 3FQUB 3WBDA 4TULH 4NRZA 4PFEA 3ZE1E 4NM8L 4JFPB 2R2EA 3OKLB 1TQBB 2BVQA 4Z76B 4JDTL 5I18L 3A67H 4NUGH 4YAQB 4WI9A 5DC4B 4HFWA 3BYYA 4U05A 5FYKU 5BMFH 1BIHA 5E00B 1IGTB 1E6JH 5A2LH 3S5LA 2EDQA 1Y0LB 4L4TA 1Z0MA 3PDDA 1CXEA 4ZTPH 1UZ6F 4LQFH 5EN2B 3WIIH 5IQ9A 2DTMH 1KIRA 3ARWA 3I50L 4JRYA 4I0CC 1JRHH 4IHOB 1IZJA 2KL6A 1V8HA 4QXUH 1P4IL 3GKWL 5GJTH 4OLZH 3G08A 3OF6A 3UTSD 5BS0B 1GZPB 4M1DH 1A6AB 2GJ6D 2EKSB 1A3RH 4JFFE 1YNTA 4L4VB 4KHTL 2UZXB 4WHCA 4Q6YA 4OIBA 4JM2C 2HG5B 4ZO8A 1PKQE 4L3ED 5HYFA 2C4FT 4QOKB 3RZCC 3DI2B 1S5HB 2FLRT 5F9OH 4HK0B 1H3TA 2HN7B 3BZ4B 3BSZH 3U1SH 1I8MA 5D2LF 5FYJH 4XHQA 1T22A 4DGIH 2NXYC 4XP6L 3TBWA 1UJ3B 4WFED 1L0XA 3QUMB 3R06B 3RVWC 1I3GH 1QHPA 3MROB 3MRFB 2H32A 2VRAA 3CC5B 4EQ3A 2GAZB 3REWB 5CFHA 1I3RB 3DX6B 3H0TB 3VXTB 3DX7B 3OWEA 1UB6A 3S35L 1NBZB 2WBJA 3HLAA 4U2ZA 3HI5L 5DUBA 1NH6A 3ZSSA 2P5WA 3Q5OA 1AC0A 4H1LB 3U0WL 3DVGB 1P4BL 4MJ6A 4Y1AB 3EOYG 3E6HA 4ZS6C 2DF3A 4HLZH 3WSQH 1YEHL 4FRWA 4P23A 1P5UA 3MRQB 4TRPL 3ESVF 1QO3B 5KW9L 3RDTC 5GGUB 5ANMA 1OWWA 2X10A 1U2HA 2FR4B 3LAFA 1RZKL 3P4MB 4MDIA 4BUGA 4WU7B 4JAMB 5CD3B 3MJ7A 3QEGH 5T1MB 1FRGL 5DT1L 4L1DA 2HRPL 5JOPE 4Y89A 2BOCA 5FYLD 3RY6C 3ZL4H 3GSVB 5E7BA 4PGDB 2R0WL 3QDJD 4BSWB 2GK0B 4NQDB 3ROOB 5J57B 4WI5A 5KZCB 3AREA 2DB8A 4M93C 1UWGL 4JO3H 5F7KC 1WIPA 1OCWL 2DIBA 5TPWL 5I17A 5KS9E 3P0VH 4H1LG 1JTOA 3PL6D 4KUCD 2FSEB 4NT6B 4FXGA 3FL7A 1B6DA 4PJ8C 4QGTA 2CDEB 5C2BL 2UUDK 4BFIA 4PJIF 4TUKL 2DRUA 4JDVB 3A6CL 2CK0L 4HXBL 3U46B 1NBVL 1HZHH 2QQKL 3GDBA 1SJHA 5EA0L 4XBPA 3GI8L 2VC2L 4XI5C 3L7EB 1M6OB 1AO7D 1NMBH 4M48H 4MDJB 5E6ID 3HE6D 1NUFA 1RJYA 4HH8A 2IAMD 5DJYA 1A5FL 3UXFA 2B4CH 5SWZD 4OSUL 1FCCA 4LL9A 1KC5L 1AQDA 4OGAD 4XNXH 2V5RA 3OB0H 5DJDB 1XGUB 2VDLH 3HUJF 2JE8A 4PR5A 2NW3A 3RKDC 5TDOA 5D7IF 6FABH 3BGFC 4GW1B 3QEQD 4G8GB 3SDXB 1UGNA 2HT2C 2FDBP 4JHAL 5F8QC 5ETUB 1AIFB 4HDIA 2JELL 5DJXB 1F4WL 4S1SH 5M7QA 4WEMB 5GPRA 1J12A 3OHXB 1IC5H 3TBYA 3K7UA 3JXAA 3KG5A 4Y19D 4HH9A 4FQIH 3I6KA 3U7WL 4XNZC 1BIIB 3C60C 4JN1H 5C08D 5JHDB 2VLRB 2VDQL 3MUZ1 3VG0H 1J0KA 5JPNA 4NDMA 4PY8J 3VXRB 4WHYH 3QFJD 1CDGA 5CD5D 4HMDA 1RIVL 3LKQB 4JZJA 43CAB 2Q76A 4XMPH 1SMAA 2VZTA 1BJ8A 1KXVC 4K8RH 3LDBB 4HS6A 3PIQB 4XP9L 3L5XL 1WBXA 2I5YH 2P8PA 1G7LA 4LMQE 1VACB 5JUEL 2OZ4L 1CXIA 4DZ8B 1MJUH 5AZEH 2G75A 5BRZD 4OLXL 3LPGA 2D7MA 2FEDC 4KMLB 4NZUH 2BC4B 2Z4QA 3OKDB 4BELD 2Z31D 1P7QA 2IPKA 3BZFA 1KACB 4EDWH 1KGCD 2AKRA 4P2RB 4Z77B 5J56B 2YPVL 3GBML 5IM7B 4DOHE 1NCAL 4N9GA 5F3HA 1LQSR 1DDHA 5JO5A 3U82B 4EI6A 3MRJA 2H26B 3C6LD 4PRPD 4CDHA 2VSDA 4Y4KB 2ZJSL 2Z9TA 1W8OA 5T1DH 4N90D 4DTGL 1EGJA 1IGFL 2E8ZA 5C70A 5F1OB 4QRQB 3T65B 4FN0A 3T1WA 3VWJC 4JRXD 3OAYH 4HC1H 4HUWA 5TDPA 3RTQB 5GGSA 2AVGA 4Y8AA 3ARDC 3G04B 1MSPA 3PWPB 4YLQT 2XY2A 1NGXA 3QDGD 3ZDYE 2DKUA 4I3SL 4JZOA 2XZAH 5GSVA 4S2SB 3P73B 4FTVB 1UXSB 3C5SA 5HGHA 4FFVC 3U79A 4U6HA 4KKNA 4AQ1B 2ZKHH 1S7QA 3DHJA 1UVQA 5JA9A 3ARBD 4WU5A 3OXSB 1T0NA 2B0SH 1EFQA 1I85A 5HYJE 3WNNA 1FGVL 1OTSC 4UTAH 1X5LA 5JNYB 3MBXH 2W9DH 4PJDF 4F57H 1AR2A 2NY2B 3QIBB 2DDQH 3V6OA 1BZ9B 2IMMA 1SEQH 5I1DA 3GSRB 5EWIL 2IWGA 2J8UF 3GSXB 3NPSC 4OD3L 2QEJA 2P8MB 4ODXA 2V6HA 5ADPL 3Q3GB 2IBZX 2R1YA 1CN4A 1XF4A 3FQNA 2D7PA 3STZA 4WEBL 3KPPA 1B0GB 5ERWB 1I3UA 4G3YH 4O4YH 1KUMA 1KTDA 2QQQA 3SCMD 3QUXA 2A77L 1LWRA 3HZMB 5E8EB 1FPTL 5H94B 1VFBB 4X6CB 5EOCH 1J05B 4WFGE 2JCCB 2GT9A 4LPCA 4DQOH 5BO1H 2X1QA 4RRPG 3V0AC 4HS8H 1M7XA 1SEBB 2Q3AA 2DD8H 2J4WH 3RX8A 1CCZA 1T7XA 1ZLWH 4IRSA 4LIQE 5I1HL 5IVXE 4HPOH 1G0DA 2N56A 1B90A 1OARH 3L6FB 1ZANH 4U1HA 2DAVA 2YUXA 2Z35B 4KQ3H 3QFDB 4X7SL 3T4YB 3ZE2E 3DSFH 1C5DA 2X1WL 2ICWI 3FQTA 3IVKA 4G8EB 3BIBX 1RJLA 3IDJA 3N0PB 4PP1C 3MFFA 5JOEA 4OGXH 4BUHA 3EHBC 4ONGH 3RWJB 4G5ZL 3ARVA 4UDTA 2QV2A 3A6OA 1D9KC 4LLQA 4XAWH 2ICEA 4PTTA 3FZUC 1GGTA 4BQCA 4HFUL 5C8JA 4XGZA 1AGDB 3MLTA 3H3BC 1QSEA 3KYAA 3MV9B 1MFAL 3HR6A 2Y36H 4F15B 4PRNB 1S5IL 5IHBA 4OF0A 4XPTL 3SE8L 3ME0A 4X80H 1K6QL 5EC2A 1B4JL 2IANA 3HI1B 4PJCF 2VISB 3U0TB 1AR1C 1M4KA 4QXTB 5K93A 3AY4A 4PJ7F 3RWGA 4A6YA 4HXAH 3VD7A 3WJJC 5IMLA 3MCG1 1YJDC 3F7YB 1NCCL 5BV7B 2ZOKA 4DK6A 3H9ZA 1U8IA 1FGNL 1FBIL 3FO9B 4PRIE 5TGBA 3ZDZF 1ZEAH 1WUNT 3MGOA 1P9MC 4JFXB 2YD8A 2H32H 3MXWH 4I0PD 4D0CB 3FCTA 3TZVA 4E41E 1NLBL 2MOVA 1IEBB 1I3VA 5A3ID 1KN2L 2ZUYA 3QJFB 1HXYB 4OZGF 3IAQA 3CCHB 5CWSB 3REVB 4HV8B 4X8JA 1K8IB 3NABL 2EDFA 1P4LA 3QG7L 1TQCC 4IIQC 5HHOE 3KJ4C 1XFPA 3D0VA 4U49A 5CIPA 3VDBA 2C1PB 4CKVX 1QSFA 3CK0L 1RK1B 3KXFD 3N9GL 1J1XL 5IB5B 1AD9A 1UC6A 4XP4H 2O26U 5TE4H 4G80B 3MRRB 3PHQA 4FZEL 4YK4C 1G7IA 2I07B 3BP7A 2PO6C 3L9RB 4UT6L 4PRAA 4U6YA 2RCSL 3RJQB 4J4PD 5F3BA 3GKZA 3L3JB 1CICD 2Z8WC 3OBAA 1T1YA 4XMLH 4MNQB 4XPAL 1BHGA 1WFUA 1T5XB 1AJ7L 2ADGB 5BS0E 2OS7A 1FO0H 5CHNB 2KDGA 3C09C 5TFSH 1F8TH 3PP3K 4JO4H 5JW4N 5C0EA 3HNTH 1V7MH 5DF0A 4OCRL 4L4VE 2PN5A 1OGAD 4QF1B 1A22B 1BX2A 4QOKE 3WCYA 3IETB 4KHXH 4KK9C 1QA9A 2VAJA 5EORL 4WTZG 3O3EB 1HHIA 1U3HA 1IC4H 5L7XL 3IKCB 2NCMA 3SDAD 5I1CH 2NXYB 4GQ9L 4HKJB 4YX2L 3MJ8B 2BDNL 1B9ZA 3D87B 4PG9A 3PL6B 2VLKA 4OZFG 2OQJB 3TLRA 3V4UL 5JQ6L 5BJTA 3OB8A 5F93C 5SWSD 3WJLA 1LE5A 2ORBL 2P5EA 2GQHA 3BN9D 5EPMB 4CNIB 1JPSH 1U8MB 4FNLL 4EI5C 3MV8A 4LVNB 3HFML 1KG0A 2EXWD 2JIXA 4ODHL 4Y1AE 5IV2A 4XC3L 4OD2A 3QNXA 3D69A 4DGVH 3BPCA 4FMFA 3GGWA 1NBYA 4KZDH 5DK2B 4Z7QE 2ESVB 4I9WD 4NNYB 4F9PA 4HUXA 1MEXH 3G5VA 4HQQH 2X5PA 4KTEL 1HQRA 1NFKA 3RDTB 5DMIH 4PRBA 1OY3B 5CS7A 2CUMA 2BRRL 4OQTL 3UJTH 1S3KH 2DQJL 3VJ6A 1XF3A 3T8XA 1UCBH 1FIEA 2FATH 1V3MA 1R0AH 5E2WL 4MMXC 3VXSD 1MREL 4G9FA 4NQDE 5HJ3B 4KGJA 2BNUA 4QNPF 5F1IB 1IQWL 1OP5H 3ISWA 3DIFB 4MXVF 4NPYB 3FAXA 1G7MA 4YQXH 4FQCH 3CVHA 4TPRH 3GJFK 2M26A 4ODSL 1F6FB 5DD6A 4JPWL 3GO1H 4AMKH 4F2MB 2RFXA 3CDFA 3MODL 4HWUA 4Y19B 5E4EC 5CCKL 1U3JA 5HGGS 3EFDL 3LN5B 2UY7A 1GOFA 2EYSA 5FK9B 4CJ0A 3HB3C 3L3DB 4PJ8B 2PXYD 4PJ5A 3WV0A 3AAZB 3GI9H 4KI5C 1JI1A 1MJ7H 1YMHA 4XZUA 4PRHB 4D8PA 4H25A 4PGZA 3O6KL 2FGWH 1RD6A 3TYGL 4PP2B 1YEIL 4KJPC 3DGGB 3DYOA 3QEHA 1OAKL 3QUYA 3RVTC 1SY6L 1SJXA 1BM3H 4NJ9H 5GZOC 3P3YA 5GISL 3UTQA 3MXVL 3CFKB 1JPFB 5E9DD 1EEZA 1D6VL 2ZSWA 1MRDL 5C0AB 3SY0A 1FNLA 4AL8H 1KN4L 1ZA6B 2VOTA 4ZO6A 4ZFFA 1O5DT 3BD5A 4G8GE 3SDXE 1T21A 3BGFB 1ND0A 1D5XA 3OG6B 4KK5C 1N6QL 3H42L 1ED3A 1CK0H 5DXWA 3S37X 2X41A 2ITCA 4BH8A 1LDSA 2V7NB 1MPAH 4OCYH 3TBTA 4PG2C 4KTDH 1EIBA 3EJYD 1DQML 5C0JA 1ULVA 2R0ZL 4KJQC 4UB0L 4LPWA 5JHDE 5KVEL 2VLRE 2HT4D 3C60B 3ARXA 5F7DB 4J3SA 1FYTD 4LSQL 4HULB 2X4NA 1FHGA 5TH2B 3VXRE 3DV4B 3E8UH 4YHYC 2DBLH 2VSCA 1I1YB 4IEFB 2IMNA 4HKXA 5F1KC 4X98B 2DMKA 5FGSA 1NGZA 2N7BA 3MMEA 4U0RC 3BE1L 3FB6A 4LBEB 4P2QB 4M1CD 2X1PA 2BVOB 5C1MB 4NQEA 1MI5A 2V2XA 1YNLL 5FYJD 3GMLB 2XXCB 5D93B 4OF6A 4R8WL 4CGTA 2YS4A 2ADFL 1R5WB 2ZUXA 1UH3A 1YN6A 2R2BB 4P2RE 2F5AL 1EHLL 4AT6B 4YGVA 5AWNL 2FBJL 4ZUVB 3HE7A 1J87A 2Q8AH 3O8XA 1GAFL 2HKFL 3TCXA 3VFPB 1S7WB 5IG7A 2L4OA 3IDXL 2YPKA 1UEMA 1FAIH 3FO0H 4ZXBA 5ENWB 4HAFA 2V5TA 1TJGH 5IFAH 2HMID 5TE7L 3VWJB 2APVA 4EN3C 1JGVL 5ISZA 1ETZA 1NGYA 3PWPE 4JVUA 4Q97A 1IL1B 3ARDB 1JK8B 1XMWA 3LEVL 3SBWC 5C92A 5D5MB 2EDLA 3ARGD 2E3VA 4FTVE 1OW0A 1JBJA 1CXHA 3OJVC 4JPIA 1W8NA 4PJ9A 1C1EL 3S96B 1FYHB 1A2YB 1LP9B 3BQUA 4IOIB 1MHCB 3QZWG 1UACH 1I9JH 3GSNB 4TSCH 2VE6A 5E8DL 2PTVA 4WDIA 2Q86A 3QXVA 5F7LB 3VWKD 4MB3A 4N5UA 1CDHA 4M8QA 5EOTB 2LU3A 1WSST 3U7YL 2YMXL 5HPMA 1HDMA 4I1NB 3IU3A 1MHHA 3NPSB 1AXIB 4MD5A 5DEZA 1NDMA 3QXAA 3SKNB 4XVTH 3FT2A 1F3JA 4YBHA 4NRYA 1U8OB 5JW5B 2EE6A 4PJEB 4CU7A 4PJFA 4M5YH 2R2HB 3LPFA 2WBWB 1QQDA 3GMNB 4A6YH 5DJ8A 5E2VL 3VI4E 1DUZB 2W1NA 1WWBX 2DQHL 2HYMA 4H5SA 4P5KB 4X6CE 3ZYIA 2X4SA 5DR5H 2AJVL 4DN4L 5MEND 1EVUA 4HHAA 4X99B 4YH6A 5EBWA 3V4PH 4LSVH 5DI8A 1DBMH 3JV6A 4O2EA 2JCCE 4HIEA 4PTUB 4RWYL 5DFVC 3VFOB 2BK8A 5LGKA 1MCEA 3NFSL 4U1JB 3DV6B 1UT9A 3UJIH 4O51A 1Q9WA 4B5EA 4AENB 3FT3A 4JJ5A 4P2CG 2VWEE 2NY3B 1MUJB 1GPOL 1C5CL 1RUQH 1T0MB 3E2HC 5CIPH 5HHQA 2C3VA 4NM4L 4PGCA 4Y5YC 5FA3A 2YA1A 1JPGA 2QHRH 3GUTA 4RDQF 1A4KA 4PD4K 4HUVA 1OT1A 4M3JA 4UUJB 5AEAA 1CGWA 4QHUB 5ICXA 3GZKA 2BNQB 4JDZA 4ZUWA 4HF5L 4R3SB 4QHKJ 2EDHA 1K4DA 2CR3A 3C8KA 4K8RD 2O5YL 3EYOA 1A7OL 4KRNA 1D9KB 3GSQA 2W0PA 3VXPB 3IDUA 4WV1A 3ZKMC 5KVDH 3MV9E 2AGJL 1WTGT 3ECBB 4K94L 3GIVB 3INUH 1XIWB 3RPIA 2PUQT 4J3XA 4MLSA 1CVSC 4YBQD 5DJAB 2V2TA 3V5HA 4X6FA 3O11B 5HVFB 5E03A 1FLRH 5T3ZL 1N26A 4JO2L 4CN6A 3UPRB 1IAKA 1WEJL 1CU4L 4HCRL 3JBG7 1S78C 2WUBH 2P24A 2YPLB 3DWTA 3AROA 1UM6L 1HQ4A 3OKNA 1RQ5A 3DMMA 1HH6A 2P8LA 5E08H 3HPLA 5I8KH 3HTLX 1TNMA 5I2IB 4KK6C 1J10A 2F53A 3AM8A 1HYRC 1ORQA 3ZTJG 3M1BA 3C08H 4G6FD 2MQ0A 3TPUB 1YYLH 2IPTL 1U95B 2JJVA 2AJYH 2QSTA 4W6WB 1RZFH 3RAJH 2PTUA 2HTLD 3L3IB 3QHZL 15C8L 4IIQB 4OB5H 4KV5F 3KJ4B 5DRXA 3D85D 2Y6SD 3LQAC 3MRKA 4MJIE 5L88H 3CFBA 1N2RB 3CH1A 3Q6FB 4FXLA 4IMLA 5DJCA 1IGCL 5D6CA 5BXFB 1IKFH 1AD0A 5C0RH 3GB7A 5B39B 4MZ3A 3UBXA 3L5WB 4UQ3A 4YK4B 4JB9H 2VJXA 5EUOE 1J18A 4G6JH 4Z0BH 4Z7WE 3MACH 3DO3A 5HI4D 4WIQA 3LEXB 3FFDA 1N4XH 3MRIB 4CMHC 3OKEB 4JFFA 3LZFH 2OI9C 5T5FH 3U6RB 3B2UD 3NGBC 4MNQE 4MVBD 1CFNA 5BV7L 3V6ZA 4LASH 4ONHA 4U7KA 4F7CA 2AK1H 1XR9B 5AUMA 5AYUH 1PKQA 2FJGB 2VLME 5EZJA 5F70A 2Z93A 1NC4A 3BYTA 3L3HB 3C09B 3CVHH 3LRSB 1CLZH 4LDLB 2VAAB 4YIQA 4AEHH 1IILE 1L7IL 4GRLA 5JZ7C 3LH2L 4K94C 5FKPB 2FEEI 4GG6B 3SGKC 3HCVB 2NR6C 1HINH 5I1AA 1F90H 5L8LB 3G5YA 4JG1H 1RZ7L 1CFTB 2R8SL 4ETQA 4E42A 5HBBA 2B2XL 4OIAA 1LO4H 5B39G 4QWWD 1LEGB 5C0GA 5C0IB 3U9PH 1ACZA 3T3PE 4G7YL 4Y5XC 1TETH 5EO9B 1T3FB 12E8L 1VPOH 2XZQL 3BH9B 3T08A 2AJSL 3DRQA 3K80A 3QPXL 1MQ8A 1E28B 3MLSL 4I8DA 4NQXA 1BLNB 4C83A 3VXQA 4NZTH 4WO4A 4H88L 3UDWC 3V95A 3QCVH 4PUBH 1RUML 2ZNWA 5AZ2H 1N5YL 4XCCH 4DVRL 4EI5B 3GJEB 3RL2A 4R7DB 4L4TD 2ESVE 5GGRB 3TN0A 3BO8B 4AM0B 4LKCB 4JRYD 4G43A 2R23A 3ZTNL 5CEXB 5T1KA 1EEQA 3OF6D 4ISVB 4I13B 4QRUB 2XIDA 2VZUA 2YN3A 3CDGB 5FYLL 3GMRA 4Z7VB 4RGNC 4ERSH 5KS9A 1OPGL 1ZHNB 4JREB 3E1F1 5A16B 1KPVA 1I8IA 3WHE0 3UC0L 5JIIA 3O2DA 3MRCB 1S9YA 4RMVA 5DZNA 4KMQA 1JZ4A 1AHWB 4PJIB 5HYSG 3N1FC 4ZFOB 1IC7H 5FOBA 4WHDA 3JV0A 1RHHB 5FO7B 4RBPH 5E4EB 4HBQA 2VXUH 3FO1B 4Y16C 1ADQA 3RBSA 2C1OB 3LKNA 4IJ3C 2A1WH 1KJVA 1W72B 4Q7DA 4N8CH 4PRHE 4FOMA 2WBJD 4P3DA 2FJHA 2P5WD 3P4NB 4N9OB 1F4XH 4FZ8H 5I8OL 5FGBC 2ZCKL 1KJMB 1MJJA 2HFEB 1N64L 4HG4K 4FP8H 4P23D 3QPQD 5DZLA 4OLYL 4KMTL 5C0AE 3IJYB 2IADA 4JY5L 1GL4B 3HS0A 5DFTA 5IJKC 1RUAL 1INDH 2BSSB 2P7TA 5BZDA 4AH2B 5ICYA 3RA7H 5ALBH 3PV6A 4JFYA 4KY1L 5C3LD 1HEZB 2R1WB 4K3HA 3PJSA 3KYOA 3C9NA 1KIPB 3WDHA 3ARED 4E9LA 2AEQL 1FNEB 1WCBB 1LEKB 1MFCH 3OZ9H 2X70A 1CWVA 4G9DB 2HJFA 4OJFL 5C9KA 4OV5A 3F58L 4YHYB 1LD9A 4MNHA 3IDNA 4NKOA 4XT1C 4JHZA 4ZS7L 5JIHA 1SYVA 4NSKA 4NOFA 3VXME 3D1MC 1BBJA 1DQQB 2VIRA 1G7PA 5JMOC 2AJXL 2BVTA 1JZ3A 3VWKB 3PXHA 1XGYH 1TCRA 3LIZH 1MCBA 2XFXB 1P69B 4XCEB 4FQJL 1XH3B 2XG5A 3FOLA 5IKCA 3T2QA 4PBVC 4YFLF 4MD4A 3TIEA 1E0OB 2CIIA 3E6FB 1CD1A 2VITB 1FG2A 3ALXA 1YY9D 8CGTA 3F62A 1JHTB 1OGTB 2G2RA 4U33A 1HWGB 4POYA 2KUTA 5D1QA 5DD0H 4F7TA 4KK8D 1H15A 1T03H 4GAFB 5K9QG 4Z7NE 2E7HA 2VDMH 2YEZA 4EN3B 1TJHL 2QSVA 5HYJA 2Q3ZA 4HX1A 3FTGB 5D5ME 5GIRA 3KYMA 2APFA 3VDCA 1WT5A 2ARJA 2F15A 3VI3E 2DYPA 5LAXB 3TH4T 3UPAA 1AY1L 3MOAH 2W0FA 4EXPX 1I1AA 3CSYA 4NM8H 3PHOB 2RIKA 2K7PA 5I1EL 2LAGB 1A6WH 1RI8A 2J8UB 3BKCL 5A43C 4GMTL 4WHTB 4RFNC 5C0FA 1N3NA 4PJBB 5I18H 1I4FB 5BOPA 2ERJC 2VQ1B 3ULSA 4M7JL 2XNAB 3TCLB 3O45A 2GCYA 2VXVL 4ZD3H 1HYSC 5DWUH 3R8BB 2ZUSA 3PWJA 3RU8L 4GRWF 1A9EB 1S9XB 1F6AB 2H41A 3LPWA 1P7QD 1YNKH 2OXHA 4NNPH 1QSVA 4S1QL 2A83B 3PGCA 2X89A 1MVUB 1P4IH 2Y7QB 3GKWH 5KSUA 5ID1A 1A9BB 5D1XA 1S7TB 4ODTH 3MLWL 5HDBF 3O6FA 3O81A 4EVNB 1AE6H 5I6XC 1KIQA 4M6NH 3MYZA 4PV8A 4KHTH 1BOYA 3F7RA 1MELA 1BFVL 3QISA 3TA3A 1J0YA 5IIEB 1BMGA 5F8RC 1SBBA 5EZLA 2BX5A 1DBKL 4DAGL 1PFCA 2YA2A 1FJ1A 4DKEL 5IVXA 2CR6A 8FABA 2ZOLB 1UG9A 2A6JB 1J11A 3C6LC 2OR7A 4PJFF 4FQQB 5JORB 5GGTA 4F3FA 3VRJA 4IRJA 2EECA 2EDNA 1G6RB 1CGVA 1E27B 1KXQE 1H0DA 3KS0J 3LSOB 3MCKB 3QQ9D 2BOBB 1FE8L 5I71C 1RUPH 2A6DB 4Y5YB 4H26B 4Y4FC 4NYLB 5F89B 2E8YA 3G5XB 4JQXA 1BP3B 4C55A 3U0WH 4ZAKC 1D7FA 1P4BH 3LMJL 4LCCC 2MJWA 1ZV5A 4OLEA 3WN5C 2BNQE 4G6FB 4P49A 3X12A 4D3CL 2H3NA 2Q7YA 4TRPH 2P48B 2YHGA 2D9QB 2BP3A 3TV3H 3CMGA 2HKHL 1RIHH 1JF1B 3CAFA 3LKPA 1RZKH 3O3DA 5CSBA 4X4YA 2X4PA 5CJOL 5F7EH 1FRGH 5DT1H 5TQ0L 1P2CA 5C6PB 1T66C 5FKAA 5F7FA 1QBLL 1JE6A 2HRPH 2CKBL 3QUXD 3FONA 3MUGA 3P4OB 3P77B 4MAUL 3DI3B 5DA0B 4R97C 4F58L 5IESH 5LCVL 5I8EA 4TN9A 1R24B 3GK8L 2EIDA 4XTRD 1D5BB 2G60H 1YC8A 4PRIA 1CFSB 5FHAL 2O61A 3GHEL 1UWGH 4I3RH 2ICES 2YPLE 1OCWH 2VXSH 4E41A 3TF7C 3CUPA 1NFDB 5ADOL 5GHWL 3SKMB 1A6TA 1G9MH 4KWUA 2FIRT 4HWBL 2WIIB 2FBOJ 4I48B 4IRSD 1GVIA 1NGPH 4YDJA 4RISL 3HAEB 4HIJA 5HHOA 5C2BH 1NANH 4TUKH 4OCWL 2NY1B 3A6CH 3S3PA 3OKLA 3FQWA 2GTWB 5CGTA 4Z76A 4QRPB 3EO1B 5EA0H 4PD4J 3GI8H 4YAQA 2D2OA 4K3GA 1KTLB 1HIMH 5E00A 1IGTA 3S36L 3KLHD 1Y0LA 3F8UB 5HDLA 1RFDL 4OSUH 1OAZL 3V0VB 1KC5H 3CFJB 2QTEA 3MOQA 3D2UB 2CLRB 3X13B 4IHOA 3ZE1F 1ZGLP 4OZHE 3P9WB 4RAVB 2EZ0C 5BS0A 4AZ8A 1NEZB 1QSED 4XWGL 1GZPA 3U30C 2EKSA 5DD1L 3CLFH 2JELH 3FO2B 1F4WH 4CMHB 3HAEG 4L4VA 4UT9L 5F1SA 4CUCA 2D0HA 2OI9B 2IAND 4EJ1C 2GJZB 3NGBB 2HG5A 2CO7B 3O2VH 3U7WH 5CAYB 4QOKA 5J3HC 1QYGH 4XB8A 4GSDH 5J06A 4HK0A 2CSPA 2HN7A 2BHYA 1CT8A 5GRXG 3SKJL 4GG6E 4LQ1A 1UJ3A 3QUMA 1ADQH 3IFLH 3MROA 3IDYC 4NZRL 3MRFA 5L2KE 3CC5A 1ZLVK 2GAZA 3REWA 1GGBL 1I3RA 2EXYC 4NJAH 5GS1C 3H0TA 3DX7A 3TZVD 3MREB 1NBZA 2GTZB 1GOHA 5E2JA 1MWAB 1Q72L 1NEZG 4Y5XB 3KWWA 1Q9LB 2V2WB 5DVKA 3H2WA 4H1LA 1DQJA 4V2CB 1OQXA 3DVGA 4BYHA 1CQYA 4Y1AA 1PYWA 3MUJA 2Z92B 1QSFD 3GBMH 1F11B 3Q1SL 1NCAH 3O4OC 1QO3A 3EYQC 2XI9A 5GGUA 2DWDB 4Q74A 4X7CC 3P4MA 3Q5YA 2CLVB 3F7QA 4WU7A 4JAMA 2E27H 3WNKA 4OI7A 5T1MA 4QY8B 2ICWJ 4YHNB 1VFAB 1WF5A 1IGFH 3ARSA 3EDJA 1PX4A 1DTUA 2CRZA 4YHOL 1J88A 1UH2A 2R9HD 3GSVA 4PGDA 4BSWA 2GK0A 4NQDA 1UWEL 3ROOA 4FFWD 1KEGL 2VUYA 3E6HB 5JHLL 2Y06L 1DEEB 4E0RB 2FYYB 5ANMB 4YXHL 2R4SL 4Z7VE 3N85L 1EFXB 4RGNB 2R0LL 5IBUB 4HSQA 3CDYA 5FV2A 4DFIA 2FSEA 3JWDH 4FMKA 2CDEA 1TLKA 2WK2A 1GC1C 1LO0H 2GY7B 2JF1A 4JDVA 5JLZA 3U46A 1ZLUH 2P49B 3VFUB 1U3HD 4NQCE 4U7SA 4M6AA 2UZIH 3L7EA 1M6OA 1Q0XL 2OK0L 5KS9F 5I17B 3UJJL 5ADPH 2LVCA 2FX8H 4KI5E 2VLKD 1GJIA 2XWTB 1PEWA 3MLRH 2VTFA 5DJDA 4FXGB 3JWOL 1XGUA 1WVZA 2P5ED 5DMGC 1XGRB 3EYSL 2A77H 3W5NA 4TULL 3MV8D 1FPTH 4GAGL 2JIXD 1CIDA 4GW1A 4G8GA 5EFIB 1A3QA 5IBUG 5DJ0A 5FF6A 1JZ7A 2ARJQ 1AIFA 5DJXA 3RJDA 4XBPB 3EJZD 3AU1A 2G9HB 1TENA 4HJ0C 1NCTA 1RY7B 3GEWB 1T89A 1ZVYA 4J6RL 1ACYH 3WFEL 4GKZB 4D0BA 1BIIA 5JHDA 4LQFL 2VLRA 1G9EA 3WIIL 2EXWC 2WQRA 2DTML 1JRHL 5E1AB 5DEGB 2NW3B 3VXRA 1OSZB 4G9FD 3LKQA 4OLZL 4R96B 2LTQC 5FIEA 4MNGB 4M1DL 2WWKT 3PIQA 3QB7C 1A3RL 1TCMA 1VACA 3WUWB 4HDIB 1FVCA 4DZ8A 2EC8A 4J12A 2VZVA 3WFBL 2Z91B 1I7RB 5EULV 1AXTH 3BN3B 5D71H 3OKDA 4HH9B 5LGHL 2EIZB 5IB3B 1Z3GH 1Z9OA 5F9OL 3BSZL 4PJ5D 4P2RA 1FAKT 2XT1B 4MA7L 4HFUH 5FYJL 5IM7A 4GXUM 1MFAH 1I8LC 2H26A 1CGSH 1S5IH 1WBXB 3QCTL 4XPTH 3U2SB 3SE8H 4GAJL 1II4E 4XWOD 1B4JH 3T04D 2RBLA 3QUYD 2B39A 3QAZC 2Z4QB 4HG4J 2ZNXA 1U0QA 3WUWG 3BW9A 3RTQA 4XBGB 2AKRB 3G04A 2F54D 3PWPA 1QOKA 2ATPB 4O58H 2B1AH 3WSQL 4G7VH 4N9GB 5F3HB 4S2SA 2O5XL 1FGNH 1DDHB 3P73A 4FTVA 1UXSA 4O02H 4KVNL 3HMXA 3LQZB 5IK3A 2VMFA 3I75A 4GG8B 4PLKD 3OXSA 5JDJA 7CGTA 5CLTA 1OAXL 2W65B 3DVFA 4XH2B 3U0PA 5JNYA 3NABH 1WZLA 4RRPA 3QG7H 4HUWB 5TDPB 3QIBA 4KKCD 5ESVB 1BZ9A 2NY5H 2X2YA 3ZDYF 1FL6A 3ARYA 1NGXB 1Q1JH 3GSRA 2E6PA 2ED8A 4YHIB 4JO3L 2Y72A 1FSKC 5HGHB 4PJBE 3MNWB 2DI8A 4RFNB 3O41B 4MGXA 4FZEH 4NQED 1BVKB 1MI5D 1C12A 4WFFE 1B0GA 4UT6H 1LDPL 1SMOA 3GSUB 4RMRA 2RCSH 3B2VL 5E8EA 2BSED 5H94A 1VFBA 4M4RA 4HUMB 4X6CA 1NSNH 2C26A 1J05A 1EHNA 2P45B 3MA9H 3KPRB 1X4YA 5KN5B 1U8HB 1HZHL 4P57B 2VB5A 2JCCA 3HE7D 4YBLC 4OCSH 3O8XD 3QP3A 1EA9C 4ODXB 4Q0XH 4YGAB 5I6XB 2B4CL 1SEBA 2R1YB 5A2IH 4KROC 4HIXL 3KPPB 4XVUD 4XNXL 3RGVC 4NKIH 3QUXB 4MMZC 5I8CB 2H9GB 5HI3C 4ZXBD 5CJXC 6FABL 2OBGA 3L6FA 4O2CB 2CRMA 5EORH 5ISZD 2Z35A 5SX5H 3T4YA 1PGRB 1KCLA 4YE4L 4ZPTA 3WFDL 4PJHB 1QVOB 3IXTB 5IVOA 3PGDB 4OFYD 1IC5L 1ONQB 1N7MH 3BT2L 3BQUD 4FQIL 3K1DA 2XY1A 3RWJA 1UWXH 5JQ6H 4JN1L 5I71B 3VG0L 5D9SA 4R26L 5DRWB 4Y4FB 3VGGA 5H8DA 2V9QA 3KR3L 5BOZG 2E7LA 1SBSL 4FNLH 5IVXF 4P46D 1AGDA 4ODHH 1KCSH 4ZAKB 1T2QH 5IFHH 3MV9A 4U1HB 4XMPL 3ZE2F 4LCCB 2FECL 4GFTB 3RWFB 4K8RL 3WN5B 2DQIL 3CSPA 2I5YL 2W38A 4KTEH 3IVKB 4YHZH 1MJUL 3ZDXE 5AZEL 1MIML 4RMUA 3HR5A 3IDJB 4ZODA 4UV7L 2VISA 4NZUL 5L6YH 4QXTA 1WCQA 4OQTH 3FOMA 2DQJH 2VR4A 3IF1B 5EBLB 4EDWL 5D6DA 3W2DH 4P0DA 4Y2OA 5EG6C 3F7YA 4XGZB 4WW2C 3SQBA 5IMMA 1HWHB 4R97B 1L0YA 4LAQH 2NXZC 3FO9A 1MIEL 3QUMH 1CXFA 4ZUSB 3TVMD 1XGTB 4D0CA 3PP4H 2VERN 4JPWH 4LCWE 5T1DL 4P9MH 1NFDE 1IEBA 4XNMB 3MODH 3BMWA 5CCKH 3EFDH 1JGUH 1B3JA 5CWSA 4OI9A 5DS8A 5F71A 4HV8A 4ZNEE 1K8IA 3AB0C 4YDKL 4K9EC 4H1LH 1K8DB 3RIFK 3IYLW 2FX7L 4KKAD 4KDVA 1RK1A 4B41A 5IW1A 4MJIA 5IB5A 4NCC1 4QRPE 5TGBB 5K33A 4G80A 3TYGH 2EDTA 2W60A 4WTZA 2ZKHL 5E24E 1SY6H 3L9RA 5EUOA 4X5WB 2B0SL 3MXVH 2NY0C 4Z7WA 3ULUC 4U6XB 4UTAL 1AI1L 1BVLB 1D6VH 3L3JA 5D1ZC 1MRDH 4F57L 4KQ4L 5B38B 2DDQL 4MNQA 3S4SB 3TO4A 4OZFA 1PQZB 1T5XA 1KN4H 2ADGA 1SEQL 3F5WB 5CHNA 4QHMA 3U30B 5C0BB 2OR9H 1A14H 2DICA 1G7IB 2EEBA 1G6VK 1CYGA 1MCNA 4JM2A 4BFBD 4G3YL 2IPUG 3MJ9A 1KNOB 5IOPB 3RKPA 5KVEH 4EQ2A 3IETA 3RZCA 3SE3C 5EOCL 5D70L 1EV2E 3O3EA 4LSRH 1G7JB 3IKCA 3BRDA 4QRTB 4D9LH 3DMMD 4KRLB 2W0LA 2QR0B 4HKJA 2MNUA 3MJ8A 4DQOL 3BE1H 1X9QA 5C0EB 1NPUA 1UM4L 4HS8L 2F53D 2OL3L 2ZCHH 4PYGA 5B38G 5T3ZE 3EDKA 2J4WL 3QXUA 3QO1B 2ATKB 4XNQB 1JGEB 2I60H 4ONFL 4M9PA 5DQDH 1BFOB 5EPMA 4CNIA 1U8MA 4Y4HC 3CFIC 4UMGA 1E4WH 1ZLSH 4LVEA 1R3IL 4WI4A 3FQRB 1OARL 4UINL 5EU7C 5AYQA 1ZANL 1EHLH 3JVGC 3FN0H 4KQ3L 1OWRM 5AWNH 1HHIB 3DSFL 5DK2A 2ESVA 4NNYA 1TJIH 2PW2B 1KCUH 3O4OB 3BRGC 3RDTA 1GAFH 4OGXL 2HT3C 3B43A 2HKFH 3NMEA 2VLKB 4LSSH 3I3EA 4ONGL 1P7KB 2AJUL 3B9AA 5BJTB 1BEYL 2HTLC 4U1LB 3RVUD 4JFFD 2I9TB 3RY6A 2JIXB 1QACA 5HJ3A 5TE7H 3ZHDA 1IGJB 5GRVL 1JGVH 2AV7A 2DWEA 5F1IA 2W07A 2Y36L 4YHKH 1NBYB 4Z7QF 3GMPB 4NN6C 1A1NB 1PG7H 3DIFA 3LEVH 4NPYA 1C8PA 1S7SA 3DXAB 1NC4D 3G5VB 4AJ0A 3I84A 3G6JE 4V2BA 1XGPB 2ADIB 1PLGH 5DD3H 4RGNE 4F2MA 1AKJB 3V2AR 4GRLD 2GI7A 5B4MD 4ZYKB 2CH8A 5FK9A 2PYFA 3VJ6B 1Z6JT 4TNWK 3L3DA 3T8XB 4PJ8A 5HPOA 4EKXA 3AAZA 4LHUB 1A6UL 4MAYC 3WDJA 2PF6A 4LF3A 1SJVA 3EW3B 1BECA 3HN3A 4PRHA 3U7YH 2YMXH 3MXWL 1QZ1A 3DGGA 5DHVB 3TFKC 4C4KO 4GLRH 1WZ1L 3EYUH 3CFKA 4LOUD 2YN5A 1JPFA 3EYFA 4RGMC 2P47B 4WO4D 3VFWA 2EYSB 3MBEA 3KPSD 5C0AA 3A0OA 4WWKC 5D7SH 5E2VH 1ZA6A 2DQHH 1T1WB 3BZDA 4KUZH 1YUHB 5E8NA 4XP4L 4BKLA 3T09A 2IQAB 2CIKA 3TN0D 2NY7H 2V7NA 2D3VA 5JOPD 3QEHB 4POZD 4LHUG 5J1SC 2VKXA 4CJ1A 1PEZA 3NFSH 3PABA 1L9NA 1GYAA 1DVFC 1EEZB 4OCNC 1JHLL 3C60A 1UADC 4PPTA 5F7DA 5EU4B 4N5ED 3WMSA 4HS3B 5TH2A 4UZGA 3DV4A 1ZHKA 3BKJL 1I1YA 5DA4A 1KB5B 4PLJC 3HI6L 4I77H 4X98A 1RZGA 1T21B 4MNGE 3WIFB 2CUIA 1YA5A 1F8TL 4JO4L 3DGCR 3JUZA 3ZKNC 3FQXA 4LBEA 3HNTL 4TTDD 1VFUA 2VZSA 2BVOA 4FXKB 4LLAA 4Y2DC 3UEZA 3GMLA 3QIWC 3VXMA 1I7ZB 5GRUH 5JW3L 2DL2A 3C5ZD 5FYLE 1H8OA 1A7OH 1R5WA 4KHXL 5D7JC 3UYRH 1T6WA 3QDJE 1NAMB 2R2BA 3ARRA 2CRYA 2X4NB 4AT6A 3QQ3B 4HKXB 3WLBA 2AGJH 3BUYA 4ZUVA 3MRPB 4RFEB 1NGZB 1ZE3C 3I85A 4LSTL 1MHEA 5IJVB 2DLFL 3WLWC 3BP5B 3PWVA 5JIKA 3BFOA 1NUGA 1KYOK 4NP4H 3VFPA 2F9BT 1V5JA 1JYWA 2V2XB 1S7WA 1VGKB 1Z5LB 3QAZB 2FH8A 4JO2H 4BA8A 1CU4H 1JPSL 4HCRH 5ENWA 5IHLB 5FGRA 3VWJA 3D48R 1YN6B 1JGDB 3WS3B 4F7EB 3WXVH 5E56A 4F8QA 4K7PH 3BGAA 4KZDL 1IL1A 3ARDA 4W68A 1JK8A 4MA1C 1K3ZA 1MEXL 5D5MA 4UT7H 2YKLL 4QYOA 4PLOB 5ILTH 3S96A 3V9FA 4YHML 1OLLA 1A2YA 5T33H 4IOIA 1MHCA 5DUMH 3GSNA 3ILQC 1S3KL 3UJTL 5IG7B 5GJSL 3W0WB 5HVHC 3ETBF 5GZND 1UCBL 2IPTH 3D39E 1M7IB 1R0AL 3RWEA 5EOTA 1IAOB 4KDTC 2EDKA 2AEWA 3VFTA 4ELMB 4GRWB 4YQXL 4FQCL 4ZDHA 4TPRL 4PJ9B 1FSKB 1CS6A 3GO1L 3SKNA 3B8YA 4AMKL 3QSKB 4P48A 2BRQA 4ZOBA 1U8OA 1Q94B 1A6VH 3K3QA 5JW5A 2R2HA 2VE6B 5INCB 2Q86B 3GMNA 1FFPB 3GI9L 4KI1A 4RQQB 1MJ7L 3ULVC 4ZUUA 1DUZA 4P5KA 1J8HD 3NCYS 2UWEE 5BV7H 4X99A 3KPRE 1KLFA 1CTOA 2QKIB 3NACL 2FGWL 4KFZC 3I6GB 1KB9K 3VD4A 1HDMB 3BRFA 4PTUA 5D8JH 4YXLH 4XPBL 4MD5B 3VFOA 5HY9A 2YC1A 4YBLB 4NJ9L 1BM3L 1INQB 4U1JA 3MA7B 1L7IH 4NRYB 1EGJL 4HLJA 1OTTD 4NWUL 4KROB 4AENA 4PGBB 5L8JB 1MUJA 3RGVB 1QQDB 1TMCB 3H3PH 5D1QD 4DGYH 3VI4F 4AL8L 4X6CF 5E6YA 2X4SB 1M1SA 2B2XH 2BHZA 4V1DE 5E2TH 3MOBH 5CSZA 1OOAA 5HYJD 2JCCF 2FL5B 4PJHE 1A6ZB 4BFGA 4UUJA 3OR6B 3RVXD 4KRMB 4N90E 1S7RB 1G9NC 3QPXH 2OP4L 4KKLC 4QHUA 2B1HL 3MLSH 3OL2A 3I02B 1I1AD 2BNQA 2ITDB 4R3SA 1Q9WB 4NCC2 3MCLH 4ZPVB 4N0RA 3MRNB 4FABL 4JRXE 1A7BA 1D9KA 4JR9L 3S35X 3AS3A 3IFNL 3VXPA 4HK3J 1GGIH 1QHOA 4M43L 5HHQB 2C3VB 3GIVA 1AGCB 3MLZL 1JPGB 1NGQL 1YMMD 4N1CA 4M6MH 3Q48A 5DJAA 3CFEB 3O11A 2XQYG 2X40A 5DJ6B 1BGXL 3N06B 4HUVB 4ELKB 4R4NC 3B6SB 5FXCH 7FABH 2X89D 4UQ2B 4MWFB 4ZUWB 3UPRA 3C8KB 3MJ9H 5FYKE 4WFGD 4OM1H 1RMFL 1U8KB 3BKMH 2YPLA 3ZHKA 3WJJA 3STLB 4AY0A 4NBZB 1CI5A 2R4RL 4WW2B 1TTGA 4HLZG 3SE4C 1XF1A 4JG0L 1LO2H 3UC0H 4M5ZL 1T4KB 5SV3A 5I2IA 4XNUH 3MLYL 1P9MA 3ILPA 3WNPA 1K4CB 3TPUA 5IMKA 1U95A 3FO0L 1IAKB 5CEZE 4CU8A 5I30H 4IRJD 2F58L 3AB0B 3L3IA 1S7UB 2LQRA 4KJWC 4IIQA 5IFAL 1HI6B 2ZCLL 1HHGB 2ADJB 1HQ4B 1ROWA 1DQLL 2CO6B 1UXWB 3OKNB 5GRWA 4AEEA 3IJSB 2QBWA 3TH2T 1ORQB 3CSGA 5B39A 4OZHA 2H2PD 3X14B 5I8OH 2M1KA 3S97C 2GITB 1A7PH 4CL7A 3LRGA 3SHSA 3S88H 4TSCL 2PO6A 5JMRA 1HNGA 4NQUA 4X7FC 3MRIA 5L9DH 1V7NH 4GJTB 3X3GH 4KMTH 2FLBT 5J9PB 3U6RA 1BZQK 3H9SB 5D1ZB 5GGSY 4TOYL 4PYHA 5DRXB 3MGAA 1XR9A 1OSPL 1C5BH 1RUAH 2FJGA 3DNKA 3IFPA 4AIZB 3BAEL 3L3HA 4NKQB 2DIAA 3P9LA 5DVLA 5C0BE 3LRSA 4XVTL 4OLWH 1AD0B 2VAAA 1UA6H 4KY1H 3OGOE 1B0WA 5EUOF 3EBAA 2AJZA 5FKPA 4GG6A 4Z7WF 4M5YL 3HCVA 2UVEA 4FA8A 2AEQH 4FG6C 4A6YL 1EJOL 4PRID 5L2KA 4JRWA 4E41D 3F6IA 1CFNB 5C0IA 3CDCA 4F7CB 4L4JA 1PKQB 3L3KB 3V4PL 3WFCH 5EO9A 3GJFB 1T3FA 4LSVL 2Z93B 2FRGP 4HUUB 3BH9A 1NC4B 4FQ1H 2YXMA 4MA3B 4ZS7H 3RWHA 2AXFA 5HHOD 1E28A 1MJ8H 4GRLB 5HI5C 3UJIL 4S1RL 1OB1A 5CBEA 4JM2F 1A7NL 3EO0B 2IG2L 4XRCB 5I1AB 2WSKA 3G5YB 2AJXH 4Y4HB 4EI5A 2HFFB 3GJEA 4WHYG 2NMSA 1T04B 4MHHI 4EIGB 1OTUD 5DJ2B 4FQJH 3MNVB 3BKYH 1TVHA 4R7DA 3T3PF 1NLDL 1YECL 4BSJA 4KKBC 3FRUB 5GGRA 3W11C 1VFMA 2H1PL 5F9DC 3BO8A 1XR8B 2VYRE 2OM5A 4AM0A 4LKCA 1VESA 1BREA 4CDGC 4NQXB 3I2CH 5CINH 1U8LB 3S3SA 2YUZA 5E1HB 5BS0D 1LGVA 4QRUA 3S3JA 3CDGA 5C9JB 4Z7VA 3UAJD 4JFDB 1ZHNA 3KPNB 4L4VD 5A16A 1FZKA 5DZOA 1DUYA 5DSCB 1E4KC 1GCFA 3MRCA 3DXAE 4PJAB 4QOKD 4WGWB 1WQVT 5IT2H 1HXMA 2X4QB 1ZHLB 4ZFOA 5KSBB 1AY1H 1RHHA 5FO7A 1LHZA 5T1KB 2ARWA 1BQUA 3FO1A 3QWOA 4NQCA 5I1EH 2IGFL 1H3PH 1F3DJ 2C1OA 4U1GC 5CMAB 3Q2CA 1W72A 4M03A 1I8IB 5E08L 1AQKL 5I8KL 2O93L 3D3VB 1YDPB 3P4NA 4S1QH 4DJMA 3RPKA 4Y1AD 4GH7B 4CMMB 2APBA 4OLUH 1CD0A 5IWLC 5L2JB 3MZGB 1FZJB 4RGMB 2AJYL 3MLWH 5F44A 3IJYA 3BUTA 1AGEB 3NA4A 4XNYH 2IQ9H 4WWKB 2XKUA 2DQCH 4RGOL 1N6VA 3RNKB 5L88L 2BSSA 4YDIL 4AH2A 4P3DB 4DAGH 5C0RL 3TH3T 4NO3B 3FHQA 1HEZA 2NYYD 2R1WA 4NQDD 4JB9L 1KIUA 4G6JL 4PG2A 4Z0BL 1MJJB 3GBNH 3MACL 5KZCD 1KIPA 1T83A 3GSNH 4PREB 1N4XL 3NCEB 3OKMB 4N0UE 4OKVB 1LEKA 3LZFL 2ED9A 5KTEL 4G9DA 3LRHA 4YHLH 4IM8A 3DARA 3T4AB 1B2WL 3P0GB 4LASL 3IDGB 1M71A 2AK1L 5AYUL 5T5NG 3SKOB 1S7XB 3CPLB 1FE8H 4DZBB 4RX4A 2R9HC 4LLVB 3MRBB 2QJDA 4IRZL 5BZDB 3CVHL 1QKZH 5ICYB 1QLFB 1CLZL 3PV6B 4AEHL 1P1ZA 3HNSH 2APXA 4Y2DB 3PJSB 1HINL 1DQQA 1F90L 3BI9X 1IARB 5JIPA 4JG1L 3BXNB 2PCPA 3LKSB 3BD4A 5GS2H 4HKZB 3WEXB 2HKHH 4XCEA 5D7JB 1LO4L 1XH3A 3U9PL 1I8KA 2W0KA 3LEYH 4AYFA 4XVSH 5CJOH 1VPOL 1LD9B 3E6FA 5TQ0H 3X11A 4RCAA 1QBLH 2VITA 1YZZA 3PF2A 4MXQD 3OR7A 3QYCA 4LEXL 5DC0A 2XN9B 1JHTA 2JK5B 5HHME 1OGTA 1A64A 4GXVH 4NZTL 1L6XA 4G8GD 1DN0B 2XTJC 3OAZK 3QCVL 5HYQB 2R56H 1JWUB 4NN7C 5J6GB 4JQIH 1UKSA 4XCCL 3K8LA 5DYOA 1HOCB 2AEIT 1R5IB 1DFBL 4EN3A 5IKCB 5I15H 5IBLD 3FTGA 5JHDD 2CIIB 2GK2A 2VLRD 4HWBH 3SBWA 4OZ4A 5GS0D 5A40E 5HGDB 1JWMB 4RISH 5LAXA 2UY6A 3LHPH 3VXRD 1E4XL 3OG4B 1YC7A 3PHOA 4UOW1 1JRHI 3W0WE 2AABH 5CGYD 4XX1E 4WHTA 5HVHB 3PE9A 4PJBA 4LRIC 1DBAH 1I4FA 2ID5A 3SEPA 1GRWA 3MRGB 2B5IC 2VQ1A 3ZTJH 2XNAA 3TCLA 4HIHB 4Z7NF 5C86A 5DTFB 1QLRB 1HCFX 1Z9SA 3LKOA 3QXWA 3T77A 1A9EA 3C5JB 4ELME 1S9XA 1F6AA 5D5MF 2MHAB 4X7EC 3MLPA 3GM8A 3VI3F 1BBDH 2A83A 2DYPB 5LJYH 1IC7L 4P2RD 1DL7H 1IT9H 1MVUA 2Y7QA 3CSYB 2Z8RA 3RHWK 1A9BA 5EO1A 1S7TA 1PW3A 4GT7A 4XWGH 3IJHB 1CGXA 2XZCL 3GHBL 4W4NA 1T2XA 4GW4A 5DD1H 3S9DB 1OQOA 3K2MC 2A1WL 2AEPL 3O45B 1KYOJ 2GCYB 2FHFA 4OUOA 2ICCA 3V79C 1F3DH 3PWJB 2DQTL 4N8CL 4QRRE 5IIEA 3WIHA 3QWQB 5E94B 2CLZB 3N1MC 1F4XL 4FZ8L 1KEMH 1N5AA 3RTQD 1HN1A 2ZOLA 2A6JA 4N0CC 4MQXD 3SKJH 3PWPD 4X9FA 1MQKH 5KSUB 2VXQL 4FP8L 4FQQA 5D1XB 5JORA 5MEPB 3BZEA 1CDCA 4XAKE 1JTPA 2HVKA 3O6FB 4FTVD 3PDGA 1G6RA 5C0NC 2MFNA 2HTKC 1GGBH 3LSOA 4HKBA 2BOBA 4AIXA 3TA3B 2A6DA 1YEFH 4Y5YA 5LG1A 4ZNCD 5F89A 4P2OC 5ALBL 1C08B 1WWCA 5IVXB 2NY2D 3QIBD 8FABB 4JFZL 1EEYA 4HD9A 3Q1SH 3RIFF 3T0VA 2AS5M 2R69H 4HMCA 1MFCL 3OZ9L 3RVVD 5C7XL 1U3ZA 1JF1A 2MMXA 3TC9A 1MCJA 4OGYL 3VE0B 4LSUH 3CD4A 2MQCA 3DO7A 1Q9KB 1FLTX 5GSRB 3P4OA 2ICWB 3P77A 2YWYA 1KEGH 5ITFB 5JHLH 1ZSDB 2Y06H 2WM0A 2Q7YB 1KB9J 4IOSD 2FJFB 3LIZL 1FDLH 2W59A 4CRPA 4LCWA 1NFDA 4X6BB 4U3HA 3B9KC 1CDUA 5EC1B 3BPLC 4F37F 4OBRA 1FN4B 2J3SA 3ORJA 2HLAA 2YA0A 4ZFZA 2WIIA 4I48A 4ZNEA 4WJ5A 5IROC 1KPRB 3HAEA 4L5FL 4YJZL 5F9JA 2XQBH 2A0LC 2OR8A 4QRPA 5DD0L 3EO1A 2C5DC 4PRIB 1PG7W 4BQ6A 2O61B 5HHNB 2OK0H 1KTLA 3O6MH 3NCFB 2I9LB 1WZMA 4FHBD 4NQTA 4U1IB 2OTWA 5I0ZA 5TE6H 1FFQA 4OTXH 1A6TB 3QIUC 4B0MM 4W81A 3V0VA 4YDJB 3CFJA 3D2UA 4ZSOE 3MTRA 4IOFD 2CLRA 3X13A 4OCMC 5HHOB 2WWKO 2Q8BH 3VFRB 4RAVA 3DUHA 4GAGH 2VLJB 4WI7A 4H0GA 4QLRA 1NEZA 3MV9D 5ESAB 1A6WL 3ES6B 3FQWB 3ULUE 3SKUD 1F42A 4LPVA 4X4XB 3VFVB 4UBDC 1MFDL 3T2NH 3FO2A 2FECI 3H9SE 2NZ9C 4ZD3L 3B3IB 5DWUL 2GJZA 5CLWA 4ENED 4J6RH 4YDLB 3WFEH 4APQC 1YNKL 4P46C 4NNPL 4JGJA 3VD9A 3KGRA 3TO4C 1NJ9B 4MCYB 4XP5H 4OZHF 2WWMC 1X3DA 4IS6B 3L95B 2BY3A 4ODTL 1FORH 2JJTC 4HT1H 3SGKA 4HGMA 3K2UH 4YC2B 1AE6L 2XPGA 4M6NL 1GGYA 3WFBH 3L3OB 4AQOA 3MREA 4Z7UB 2D03H 2GTZA 1W72H 1KJ3H 2NX5B 3MYJA 4ETYA 5GXBB 2EEAA 1MWAA 1D5MB 5LGHH 1BFTA 4Y5XA 3RI5F 3VGDA 1NMAH 2XA3A 1Q9LA 2V2WA 3HZYA 3U83A 3OAUL 1FFOB 1CT8B 2Z92A 4MA7H 1RU9H 4GG6F 4CVXB 4TNWF 5BVPH 1F11A 4I18C 4C57C 3TVMC 3UTTB 4MJID 5KBNC 3OX8B 3UDWA 2IPUK 2DWDA 1CLYH 3L3GB 3QCTH 4DN3L 3IDIB 4GAJH 1JI2A 4LKXB 2CLVA 2DLGA 3WHXB 5GRYA 4QY8A 5EU7E 4YHNA 4XCYB 1RUPL 1VFAA 4RAUB 3VGAC 1AGFB 2RAMA 3KWWB 5F7NC 1DQJB 4XHJC 2UVFA 4NFBA 4MNQD 1PYWB 2UYLA 1GZQB 1K9TA 1U58B 2VLMD 5L0QB 1DEEA 4E0RA 2O5XH 2FYYA 5ALCH 2YOCA 3G6JA 3TV3L 4KVNH 1RIHL 4JFDE 1EFXA 1MY7A 2FX9H 1RSFA 5INDB 4TNVK 4LHQB 5F7EL 5LBSH 4JM2D 1XCTB 3SDDC 4O2FA 1OAXH 4PJAE 1Y6NR 3LS4H 2NLJB 2EICA 3QUZC 5IESL 5KSBE 1NQBA 3VFUA 5H37H 2G60L 5D2NC 1NCBL 3ARFC 3BHBA 4Y16A 5MI0C 2NXYD 5F7YC 4I3RL 3DUSA 4Z7VF 5E99L 2VXSL 3RVWD 5CUSL 3RNQB 1DLHA 2XWTA 3W9DA 1G9ML 5IHZB 1JNLL 1WLHA 3EGSB 1LDPH 1NGPL 1MHPL 3SOBH 1XGRA 3D3VE 2VDRH 3JWNC 3B2VH 3TJHC 3T0EC 2WW8A 5JLZB 4YR6B 5EFIA 5FGBA 4HJJL 4KZEL 4U3XA 2NZIA 2ESVD 3K4DA 4ZS6D 2JB5H 3BH8B 4UV4L 4G42B 2AXHA 2G9HA 1HIML 3RDTD 4KI5F 4YPGB 1MCRA 4JFQB 1EPFA 5IJKA 1FZMB 1KJ2A 4GKZA 3MBEC 2N7AA 4KRPC 4HIXH 1F58L 4K7FB 4OFIA 4NRXB 2ZUVA 4U1KA 5E1AA 2DKMA 5DEGA 3PXJA 1AH1A 1OSZA 2V7HB 4R96A 4XCNB 1U8PB 2F8VA 4MNGA 4XPGH 2WINB 5DJ0B 5FF6B 4YE4H 3RIAK 4LRNL 4M3KB 3CLFL 3WUWA 3NH7H 3WFDH 3AU1B 1A02N 2Z91A 1I7RA 4PY8I 4EEEA 1KFAL 1KSRA 4TVPE 3BT2H 3O2VL 4WGVB 5FAAA 4JFEB 2EIZA 2EYTB 5IB3A 4D0BB 3VD3A 4DFHA 3O2DL 1QYGL 4GSDL 4NWTH 1NDGA 1RZKC 4R26H 3QDJA 5KG9B 4PJ8D 4LNVA 3KR3H 1SBSH 2E5EA 4B53A 5LXGH 4JE4B 1X4XA 4QCIB 2BSRB 5EDXA 4PRHD 1ADQL 2DQIH 3IFLL 5SWQB 2J88H 3WDIA 3U2SA 4F7PB 1FVCB 2J2ZA 4NJAL 1MIMH 4XI5D 4EXKA 4UV7H 3H6JA 1EO7A 4OAWB 4Z0XB 3WIHH 3DVNB 4XB7A 3P2TA 5C0AD 1QBMH 4YDVA 4XBGA 3MRLB 5F96L 2XN9E 2NY6C 5DRNB 5FEBA 2ATPA 3RKDD 1UQSB 4N8VB 3OSKA 1X5AA 2W92A 2VZOA 5DVNA 2HT2D 1F2XK 2XTJB 4NN7B 1MIEH 3LQZA 1JF6A 1G6RH 4GKOA 3VFSB 4ZQKB 1EXUB 2E27L 4GG8A 1L4IA 4WTXA 4ESKA 5DK0B 3U4BL 1YEGH 3D39A 3VG9C 4NO0B 2W65A 4XH2A 1DANU 3C60D 4QTIH 4YDKH 3NFNB 3BW9B 5IF0A 3PHSA 5ESVA 4K23H 2FX7H 3V7AE 5T3XE 1L6ZA 4K3JL 1MCHA 4GQPH 4MQ7A 5EUKB 4FQXC 4YHIA 3DETD 3MNWA 4AEIH 4BK4A 3BJ91 4P2QD 3U9UA 3O41A 4CU6A 5IK3B 1JJUA 2B5IB 1LILA 1BVKA 3I75B 2XRAL 3VMPA 2ZUQC 3JWDL 2FEDD 4FQPA 4HWNA 3GSUA 5CP7B 4LCIH 4N8VG 3VXMD 5KAQG 3NTCL 3GSOB 2R29H 1AI1H 3U0PB 1RK0B 1LO0L 3DRTA 4KQ4H 1WZKA 4HUNB 2UWEA 3KPRA 5KN5A 1FL6B 1U8HA 4P57A 2UZIL 4PJBF 2J8OA 5CP3A 3TO2B 4XCFL 2FX8L 4U31A 4WUKH 3ULVE 4WENB 2X4RA 3TESA 1ORSB 1QPXA 3MLRL 1C12B 3AS1A 3C5ZC 1Q0YL 4X6EA 1I7TA 1T2JA 2AQ2A 3ZE0E 4PGEB 4C56B 4I0KA 3BMVA 5I8CA 2H9GA 2QADC 3VWJD 4O2CA 5D70H 1DBBL 1VEPA 3ARDD 4V1DA 3C6LA 4YXKL 4PJHA 1QVOA 1MVFA 2Y23A 3IXTA 1ZVHA 3PGDA 3THML 2C3WA 1ONQA 2OSLB 3KLSA 1UM4H 4FFVD 1REIA 5DVOA 2OL3H 1X5GA 1W0VB 1ACYL 4XXDB 1HH9B 3LQAH 3MO1B 4JRXA 4QKXB 4ONFH 5DRWA 4Y4FA 5D7LB 4DKFL 1OTSD 4P2OB 3MQIA 2HFGL 5EZOH 4M6OH 1R3IH 3H8NA 4UINH 4ZAKA 1MCPL 5IB2A 1HSAB 4LCCA 3RWFA 3WN5A 3GMQA 4ZPTB 1DCLA 4MJ5B 2DM4A 3T3MF 4Q9RH 2LU7A 5HDQH 5C09E 1AXTL 5D71L 3VD5A 1ODAA 2AJUH 1Z3GL 2EDWA 4WW1B 1BEYH 4AG4H 1JNNL 3IF1A 3SDYH 5FO9B 3KNBB 5D9SB 5EBLA 5I9QC 4UTBL 3FHAA 5KANI 5GS2D 1JCKA 1ZT7B 4ORZC 2H8PA 4XPHL 2VDKH 4E5XB 3PWUB 2MCPH 4MS8C 5FYJU 1B6UA 1JP5A 1I75A 1YN7B 1UFUA 3EKCA 1CGSL 1LNUB 4ZUSA 3AS2A 3ZDXF 4WUUB 1XGTA 1BD2B 3HR5B 1ZK9A 4XNMA 3P40A 2BVEA 1R3JB 4BZ1L 1N8ZA 3B9KB 3FOMB 1J1PL 3BPLB 5JXEC 2DQUL 4OV6F 4LIQL 1UCTA 3FMGL 3KPOB 2NY3D 1PX3A 1KCVH 3V8OA 1K8DA 1JHKH 4JPVL 2XQYK 1NMCC 4ZO7A 4HWEL 1A6UH 4O58L 5KVFH 2B1AL 4G7VL 3FT4B 5IMMB 5GGTL 3WNLA 4O02L 4HPYH 1S7VB 3IS0X 1NFDF 4OFKA 4PP1D 4LU5H 4X5WA 3ZHLA 4BH7A 1WZ1H 1EAPA 2BNQD 4U6XA 2VH5H 3EHBD 5DS8B 3WXWL 1BVLA 3QIUB 3H9YA 4JKWA 1D9KD 5B38A 3S4SA 1PQZA 2V9RA 2NY5L 1EZVY 3QDMB 3FZUD 2HH0L 2VLJE 4KH2A 4KVCH 3F5WA 1Q1JL 5I1GH 5IW1B 4XPFL 4MJIB 3SO3C 1R3HB 5EIIB 1XIWD 5IGXL 4NBXB 3HMWH 5CZVL 2I24N 3DX8B 5C0BA 3HKFA 2W60B 1OAYL 4NUJB 3WD5L 4N1HB 3UTPE 5EUOB 2YD1A 4Z7WB 3QBTB 1AR1D 2WUCH 1KNOA 5IOPA 2HAZA 4JFOB 1JHLH 3AMKA 4APQB 1JV5B 1LEIB 5I74C 1NSNL 1R3KB 3MSPA 2YPLD 5EO0B 4WY7L 4OZFB 3TO4B 4UIMA 3VA2C 1RZJL 3MA9L 1G7JA 2YD6A 3BKJH 4P4KC 4QRTA 3HI6H 2QR0A 2CDGA 4N0FA 4QHMB 2YXFA 4OCSL 1ZT4B 4Q0XL 2HVJB 4CVWA 5GS1A 2IEPA 4Z7UE 4U1MA 3MRDB 4UNVA 3QO1A 2ATKA 4XNQA 1JGEA 2NX5E 3CZJA 3OKOA 4JM2B 5JW3H 4HW6A 4Z18A 4DKAA 3F65A 4NKIL 1BFOA 3RZCB 3R1GL 4B50A 5IB4A 3FQRA 5ACMA 1U91B 5ECJE 1E4JA 2YWZA 4MCZA 3RGHA 3TBSA 1CG9B 4GOSA 3UTTE 4I18B 2PW2A 4LSTH 3ALWA 3BDYH 3OB0K 2DLFH 4WNQA 1N7ML 3EAKA 2YBRB 1P7KA 2PO6D 3VGAB 1YEDA 4U1LA 1MCOL 3PQYE 5DDHA 4RWHA 2I9TA 1JPTH 5JTWA 1KCSL 1IGJA 4LFHG 1T2QL 4XMKL 5IFHL 1NCUA 3VXOB 3GMPA 3VGHA 1A1NA 4IMKC 2J5LC 4X7TA 3DXAA 3QI9C 4YHZL 1IJ9A 3N1PC 2YKLH 5LQBL 1XGPA 2ADIA 4YHMH 1H3UA 2AJ3A 1ZGLB 1AKJA 3W39B 5L6YL 5M94B 1U2CA 5CBAB 2XWJA 4ZYKA 3VFNA 2WP3T 5GJSH 5BQ7B 1D5ZB 3SDDB 4R2GC 3W2DL 4X4ME 4LHUA 5L2KD 1H3WM 2F8OA 5D72H 2VLLB 1EMTH 3UZVB 4KK9D 2E6JA 3QUZB 3HC3H 5HDOA 2AV7B 2CJUL 2DWEB 1S8DA 3DTXA 5HGAB 1OD9A 4LAQL 3BJLA 4XXCC 3QUML 1S7SB 5EBMB 5D2NB 2PR4H 3DECA 3G6JF 5DHVA 1ES0B 3WNOA 4M93B 1UJTA 3PP4L 3S98A 1K5NA 4P9ML 4C54A 1CTNA 3VFMB 4OD1H 1DJSA 1JGUL 1OP3H 2PYFB 3WNMA 4LGSB 3I6LE 1FL3B 2GUOB 3T0EB 1Q9OB 4EI5D 1RPQA 4AK1A 3BIKB 2QSCL 1T1WA 3JV4B 4LF3B 3MRMB 1YUHA 3AGVA 4ONOA 5FECB 1IE5A 3NACH 2IQAA 5FHBH 3MV11 4L9LC 1H3XA 3DX9B 1L9MA 4XPBH 3NIDE 1TQBC 3OAYK 2VN7A 3EO9L 2BCKB 3QNYB 3VDAA 3EYFB 2DL9A 1EGJH 1H5BC 4N0UA 2YD5A 4NWUH 1JMXA 3VFWB 3MBEB 4JGMA 5CZXC 5EU4A 2ZUUA 1OM3L 4HS3A 5IEKB 2KKQA 1B0RA 1KB5A 1J8KA 2DQDH 5IB1B 3WIFA 5E8NB 1PKOA 2QQLL 2DJ4A 1A0QH 4BKLB 5ITBH 1QFUH 2CIKB 2OR9L 1A14L 3R4DA 4FXKA 3IXAA 3MGTB 3HC4L 3WHE1 2OP4H 1T83C 2B1HH 3PABB 3K4ZA 4JFEE 1I7ZA 4LVHC 4NQCD 4FABH 4XNZB 5TF0A 4JHWL 3QWRA 4JR9H 1NAMA 1RHFA 1X6LA 5GRJL 3EFFB 5DURB 3HB3D 3IFNH 3SE9L 4EUPB 5HHVH 4LSRL 2M2DA 4KI5D 1ZHKB 3QQ3A 5F97E 4M43H 3SJVB 4D9LL 3MRPA 1RZGB 4RFEA 3KPQB 1EHAA 4GBXC 1ZXQA 3AVEA 3MLZH 5IJVA 1NGQH 2EC9T 4H8WL 1I8LA 1MNUL 3BP5A 3FQXB 5CP3H 1BGXH 2ZCHL 4KJPD 5FUOH 2DBJA 2AQ3A 1VSCA 1IMHC 1T1XB 1VGKA 1Z5LA 2I60L 3RVTD 5GZOD 4P3WA 3VXMB 5CZKA 5DQDL 4OCXL 4LLWA 3HRZA 1E4WL 1ZLSL 1RMFH 3RHWF 2E7CA 1JGDA 3WS3A 4F7EA 3WE6B 3FN0L 1HNFA 3QZWB 3UBXG 2NY6B 2R4RH 2KPNA 3PWNB 1TJIL 1QFOA 3DVIA 3WLBB 3BUYB 1KCUL 2W9EH 4JG0H 1ZLWK 1MHEB 2XTJE 4KK5D 4M5ZH 3IRPX 5DD5L 3PWVB 4UILH 2JJSC 3MLYH 1WFNA 2CMRL 5DHXB 2ZSVB 4EUPG 5KOMC 2FO4B 3F7VB 4JKKA 4LSSL 1SVZA 3LY6A 4ODUB 3RL1B 3W0WA 3QG6B 2GSIB 5GS0L 1T5WA 4KJQD 1M7IA 4Y5VC 2AERT 2EKJA 4MA8L 1CE1H 2F58H 3KDMB 4JFHE 2N4IA 1OL0A 2ZCLH 5CJ5A 3KPMB 4YHKL 5I1IL 3U36B 1IAOA 4ELMA 1DQLH 1PG7L 2NY4C 4LPYA 3SDCC 4RX4D 1X6NA 3B9EA 4FQXB 1QRNB 4QYOB 5EIQA 1PLGL 5DD3L 4P4RB 1Q94A 1TITA 2K1MA 2SEBB 4I5BB 5BW7C 4P5MB 4P9HL 1S9WB 1YPZB 2ZUQB 3LB6C 3S36X 5INCA 5KSAC 1RZIB 4GAYB 3MJ6A 1FFPA 4LDOB 4RQQA 1KELH 3RWEB 4NQVB 4PJGB 3G5ZB 2BERA 4TOYH 1V3LA 3ZYOA 4QRRA 1OSPH 2GJJA 2QKIA 3L1OL 5GQBA 3VFTB 5EOQL 3I6GA 4ZDHB 4X83A 3BAEH 2BHUA 1INQA 1QFWH 1A4JA 4OFDA 3MA7A 4OF3A 3EYUL 5MEQA 5IMOB 3LS5H 3O9WC 3ARUA 4PGBA 3I3BA 5CEZH 2YRPA 4C56E 3NCJH 1G84A 3RGVA 1EJOH 1P7HL 5CSGA 5D7SL 4UIKH 3WYRA 4U1SB 4K55A 4ZUUB 5DMYA 1JFQH 2QADB 2UWEF 5E2UH 5CJXA 4KUZL 2YD2A 4EN3D 3R0NA 5I76B 4XBEH 1C7TA 25C8H 4YEFA 2FL5A 2NY7L 3HMXL 1A6ZA 4M1GH 5A1AA 3OR6A 5HY9B 2YC1B 1S7RA 3S37H 2DLEA 3I02A 2ITDA 3BWAB 4S1RH 4ZPVA 3GRWA 1NCNA 3MRNA 4C4KT 1TIUA 1A7NH 4OFVA 1E4XI 2IG2H 2YRLA 4FQ2L 3RWCA 1IAIM 5D7LE 1OF2A 2F54E 4TQEH 4I77L 2CGRH 2QQNH 2X05A 1HKFA 2K7QA 4WFFD 1AGCA 1NLDH 1YECH 4QHKI 4W6XB 5C71A 5CSZB 1TVBB 4PJHF 4TSAH 2ZZUT 2H1PH 1FZOA 2DM7A 3CFEA 5DJ6A 5FM5M 4ELKA 1EK3A 3B6SA 4YFLI 5I19L 1IM9A 2X1OA 5HYEA 2YD7A 4UQ2A 5J11C 5ACLA 4MWFA 4S1DC 5GRUL 4RA0C 1FNGB 3UYRL 3PV7A 1U8KA 2X44D 2E9WA 1MFEL 2EDOA 4M9OA 3STLA 5HD8C 2A9NH 3NIFE 4WW2A 4OF8A 3LKRA 3FB8B 1T4KA 2HP4A 1RJCA 4L29B 4WUUE 1BD2E 3F12B 4P5TC 4NP4L 2E9BA 4UU9B 5DFVD 1K4CA 1KBGH 5KSVB 4MJ2A 2WAHA 1T1ZB 4Y4KC 4JY4A 2UUDH 2IGFH 1S7UA 2EO1A 2XG4A 1HI6A 1OVZA 3WXVL 1HHGA 2H2SC 2ADJA 2KQMA 1MCQA 4K7PL 3VFGH 1NMCB 1UXWA 3D25B 2HRLA 3FRPG 4K3EH 2C3GA 4UT7L 5I1JL 1OHQA 1AQKH 5ILTL 4ZSOA 3GNML 3IJSA 2YRZA 3BP4B 2R15A 5T33L 1RJZB 3X14A 2FD6L 3ILPB 2GITA 5DUML 1HILB 3U4AA 4Z78B 2IBBA 5IMKB 1IFHH 5J9PA 1ZVSB 4OFPA 3H9SA 5EU6B 1G1YA 1IRAY 1TQCB 5D1ZA 3RUGE 1WTLA 3ZLQC 5MEOB 3QDME 4GKSB 3VGBA 4RGOH 3ZKMD 2AK4B 4KXZH 5B3JE 1BQHB 4AIZA 4YDIH 3SO3B 3CGTA 4IDJL 1CE6B 2XA8L 5DLML 1WJ3A 1KCKA 3DYPA 4OZHB 1A6VL 2CQVA 4ZFGL 4KTYA 2ZG2A 4RNRB 1ZHBB 2PO6B 3UPCA 2QHLA 1OP5K 3SGJC 2FIKB 2IFFL 3O3BA 3VCLB 4F7MA 5KTEH 1S78D 1C16B 2Z0BA 1GC1H 5I74B 1B2WH 3N50A 1PY9A 1MFNA 3SE3A 5DK3A 1BQSA 2F19L 3L3KA 3GJFA 1A1MA 4P4KB 3IFPB 4HUUA 4N0YL 4MA3A 3D0LB 3KAAA 5D8JL 3OKYA 1ZTXL 4IRZH 4YXLL 2ZUTA 4TNVF 5DHVH 1FIGH 5ID0A 3P9LB 4KK6D 3MV01 2NY1D 2AJZB 4G8FB 1UENA 3EO0A 4XRCA 5JW4Q 4QRPD 1BQHG 2VL4A 3H3PL 3A6BH 4DGYL 5L2KB 1L7TL 5I1LB 4Y4HA 3ET9F 2HFFA 1NL0H 4DW2H 5FM8A 1T04A 4GXUN 5DJ2A 3MNVA 3JVGA 2EYRA 5E2TL 3MOBL 3FRUA 3WKML 1XR8A 2KZWA 4HC1A 3H7BB 3STBA 3D2UD 5F9AC 4UI2A 3RWHB 2AXFB 5AAWA 4LEXH 1WBZB 4X9HA 1U8LA 4J7RA 1OB1B 5CBEB 3MCLL 5C9JA 1OAQH 4JFDA 4Q6IC 5HYSB 4NN5C 2CRIA 3KPNA 1BWWA 1GGIL 3PUCA 4R4BB 1B4RA 4K7PY 2DQGL 1KB5H 1DFBH 1TVHB 5DSCA 4M6ML 4PJAA 2J5LB 4OIIH 2YSSB 3QI9B 3GIZL 3BESR 1U3YA 2X4QA 1ZHLA 5KSBA 7FABL 4YFEA 5EU5B 1E4XH 4FQLL 4GO6B 2A2QT 5JZ7D 2GYSA 4BQ8A 3MJ9L 4OM1L 4A2MA 2NR6D 3BKML 3VMOA 4LGPB 3QUKB 3UP1A 1BJMA 1IM3B 5ELIA 5CMAA 4MAYA 3EOAB 1FZKB 1LO2L 4P3CL 4HBCH 1DUYB 5D2NE 3LQMA 3D3VA 1YDPA 4XNUL 5LWYH 5JQHC 5BV7C 4RIRB 4CMMA 1HXMB 1WISA 3EDFA 1I9IH 3TT1L 1G0XA 1G0YR 5L2JA 4NQCB 1FZJA 3CZFB 3QWOB 4ZMAT 5I30L 2BNRE 2DOCA 2XZCH 1AGEA 3GHBH 3BP6B 1QEWB 4HGKC 4WWKA 3T0EE 4JPKH 2AEPH 3CVIH 1I9EA 1F97A 2FHCA 4GW5A 3RNKA 4K3DL 2DQTH 3BVNA 4CVZA 4NO3A 2J8HA 3LN9A 4L9LB 3QR2A 4CW1B 1A7PL 3S88L 1JWSB 1T20B 4KJYB 4PREA 5E4IA 3K81A 2VXQH 3OKMA 5L9DL 4OKVA 1DVFA 1GIGL 1V7NL 3UBXI 1H5BB 3X3GL 5FUZH 1QPPA 2A6IB 3T0AA 5JW4R 3T4AA 4FFYH 1EFXD 3HG1B 3IDGA 4RGND 2XXMB 3SKOA 1C5BL 1NC2B 1S7XA 3CPLA 5DHYA 3K8MA 4DZBA 4GRWH 4CADB 4LLVA 3MRBA 1RAMA 3MV7B 1QLFA 4R7NB 3EYVB 4OLWL 2PYEB 1UA6L 1KV3A 4Y2DA 5IQ7H 4JFZH 5FCSH 3QIWA 3MZTA 3BXNA 3LKSA 4LVHB 4Y16D 1VA9A 3AUVA 5AG9A 4HKZA 3WEXA 5D7JA 5C7XH 1Z9LA 3P0YH 1M71B 4OGYH 5HXMA 4LSPH 3SJVE 3WFCL 3HC0A 1VHPA 4FQ1L 4GBXB 1IAIL 5J0BA 4U0RB 1INEH 1MJ8L 5J8OA 2XN9A 2JK5A 1P1ZB 1LE9B 1DN0A 1NANI 4PS4L 5HYQA 1JWUA 4J3TA 1DQDL 5J6GA 4OM0L 1U92B 4OF7A 1KXTB 3PL6C 2PCPB 3M45A 3UZEA 3N1QC 5TQ2H 2OJZL 3R0MA 3VXUB 1HOCA 1R5IA 3HNVH 3BKYL 1NKRA 1I8KB 1WIUA 4GS7C 2DLTA 1CD9B 4LVNC 5MP6H 3X11B 5HGDA 2K9UA 3WS6C 1J1OL 1JWMA 1U8QB 4C58B 4L5FH 3OR7B 2OJEB 2VDNL 2FWOB 1CDIA 1QFPA 4RMQA 3I2CL 5CINL 3PGFL 2X4UB 3GRWH 4J2XA 3KPSE 5E6IC 3HE6C 2IAMC 3MRGA 4Y5VB 4HIHA 5DYOB 5DTFA 1QLRA 4OGAC 2DQFA 3C5JA 3ESUF 2MHAA 4KDTA 2NY4B 2VR5A 3SDCB 1QRNE 4OZ4B 2I25N 5IT2L 1M05A 3P30L 1FO0A 1U6AL 1AFVL 4J3UA 1YPZE 3ZT6A 1H3PL 3SGEH 3IJHA 4BZ2L 3L7FB 5KSAB 1MFDH 4YWGL 2HJLB 4PJGE 4PBXA 1JNHB 2APTA 5F88B 2MTPA 4ELMF 3LKOB 5EOCJ 3T77B 3PP3H 1LK3L 5C0CB 2MSPA 3T1FB 5E94A 2CLZA 3ZT7A 2O5ZL 2ENSA 3O3UN 5CD5C 3CFDB 1BQLL 5JXAL 2ZUWA 3P9MB 5JR1H 1D5IL 1F4AA 1ZS8B 4JQVC 4OLUL 5EO1B 5MEPA 3CX5K 5AD0B 3O9WB 2VKWA 5C07B 3TEUA 3K46A 1NBQA 1VB9A 4PJXE 2IQ9L 4GW4B 4XNYL 3C2AH 4K9EH 5DMKB 5D96C 3ALPA 4OT1H 1AC6A 3TWCH 1IBGL 1MH5B 2DQCL 2Z31C 3M8OL 3V6FB 1NGWB 3VRLE 3UCRA 5JPMB 1JN6B 3D39D 2F74A 1C08A 3QXTA 3O0RH 5IP4A 1EDQA 3OAUH 1N5AB 5DJZB 2OMNA 3TJEL 3TYFB 3GBNL 3WL9B 3GSNL 1CIUA 2AXGA 2YUVA 1Y18B 1U8NB 2VXTL 3ULUH 3BZEB 2HVKB 4O00A 1QUNA 2VL5A 4YHLL 1CFVH 1VKXA 4DN3H 5C09A 2IF7A 3OJ2C 4HKBB 4LMQI 3E2HB 3VE0A 4L8SC 1HYSD 4UOW0 4ZOEA 5E5MA 1Q9KA 1QKZL 2P46B 5IUSA 5GSRA 1JF5A 4W4OC 2ICWA 3HNSL 4XP1H 1V3KA 3IGAB 4D2NA 4LP4A 2BSTA 3DETC 5ITFA 1EEYB 3KPRD 1ZSDA 1DE4B 5J11B 1U8JA 3JSSA 4M02A 2FJFA 4CBPA 2Z8VC 1TTUA 3ARBC 3MX0A 4X6BA 3QHFH 5D93C 4Z6AT 5EC1A 3LEYL 4XVSL 3NCMA 1FN4A 1CGYA 3GJFH 3DO7B 1YY8B 3O4LB 3SE4A 1KPRA 1A3LH 3W82A 2A73B 4Y8DC 5IBTL 3V8CA 1JZ8A 4GXVL 4QXGL 4P5TB 2ENYA 2KQNA 1J86A 1PVHA 1YQVH 3UTZA 5B8CC 2R56L 5H2BA 4V1DD 2EH7L 1NCBH 3HZVA 1MCDA 4JQIL 3CXHK 5HHNA 2DN7A