4M73A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
b'SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHAFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m73A01
4I01A 2DI3A 3OV8A 3KP2A 1YW8A 2YPRA 1KU3A 4WXCA 2HKOA 4GGGA 5BPIA 4HX7A 2KJBA 1T2KA 5CVUA 1TNSA 3LA7A 1KYWA 4M9ZA 3D0SA 5TJJA 1SD4A 3RKXA 4U0VA 3F8NA 1ZN2A 3JTGA 2ESNA 3LQQA 1PUEE 1O3QA 3WTVC 3JTHA 2D2WA 3F8FA 4HDVA 1PP8F 5HDGA 1JHHA 1LDDA 2P5LC 2FA5A 4NQWA 1YIOA 2Q0OA 1WRJA 4HF0A 5EEHA 4AWXB 1MD0A 1Z91A 4ON0A 3DPTA 3M8EA 4RS8A 5IT9K 1G4DA 1BIAA 2WC2A 4RGUA 2VBZA 4N9IA 2L3DA 2IP2A 1TTYA 2OZUA 1FWZA 1FLIA 1G3SA 1Y0UA 2RNJA 1FP1D 3IKVA 4I7HA 2EA2A 3HOTA 2MBFA 3R61A 3KFWX 5FFZA 1ZHFA 4IVNA 3EYIA 3ECHA 1TBXA 2QENA 3DKWA 3O2PE 4LG0A 1KGSA 1S7OA 2FNPA 1ON2A 2D1HA 1RZ4A 1P92A 3B73A 5E8GA 2ETHA 1DP7P 5HLGA 2EJRA 3RIRA 2YX7A 1YLFA 3GVAA 5F1RA 4G8XA 1XCVA 5D5VB 1E2XA 1S8NA 5HLHA 5ICCA 3J7AO 4LMYA 2W25A 1AOYA 2K4JA 1R5GA 1BIBA 3L2CA 4LFUA 5EEGA 3JW4A 2YR2A 5LLQA 1OYIA 2QQBA 4LGWA 3S2WA 2DPUA 4F7ZA 2FBIA 1O7LA 5K5RA 3ROUA 2V1UA 4UVBA 3M8FA 2HEOA 2HWVA 2O8XA 2Z3YA 3EDPA 4P9FA 1QPMA 4IPAA 4UHTA 2BYVE 5LRRA 2HTJA 4KDPA 1HKTA 3I54A 2AXLA 4JQFA 3TO9A 2F5CA 3BJOA 2ZFWA 3BPXA 4N0BA 1ZAOA 1J5YA 2BE5F 1JGSA 5D5UB 1ZYRF 3ZMVA 1J0RA 3RDIA 2HTSA 3CUQA 4KN4X 1U8RA 2OD5A 4U0WA 1FZPB 2HQRA 2NAZA 1YYVA 3FWEA 1P4XA 1TW3A 3F8MA 4PCQA 2BEOA 3J80Z 2M87A 2XVCA 1YW7A 3N4MA 2GIVA 1H9GA 5FFXA 2K86A 1FSHA 1FYLA 4OIPF 1OPCA 4CGZA 1MJBA 1OYYA 2P4WA 2VC1A 3GLXA 3F21A 5HS9A 3GFLA 4HQEA 1LB2A 5E1WA 4U7BA 3C18A 4G9YA 1ODDA 4L9VA 4HZFA 1QO0D 1K7AA 1KU7A 1QZZA 3O6BB 4RAZA 5HS7A 3J81Z 2XV4S 1G6NA 4P9UA 2W24A 2RV8A 2FBHA 4PGHA 1RI7A 1B1BA 3CO6C 4HDUA 4EJUA 4Q48A 4YFKF 3F8CA 3FXUA 3DQVC 2JRTA 4A0XA 2J5PA 2CG4A 5BMZA 4BHBA 2XRNA 5HOOA 4ENNA 4BNCA 1JHFA 2GA1A 3F22A 5LHIA 2MH2A 1TQMA 1YS7A 1T6SA 1ZG5A 2LSOA 1BJAA 1XN7A 3HRUA 4EM1A 2DK8A 1STZA 5HLIA 5LGNA 2XAGA 1BC7C 2Y75A 2GA2A 1OKRA 5AIPA 2Y48A 3TKYA 3SXYA 3H92A 5CVIA 3KZYA 1Z6RA 2RDPA 2BGCA 3VEPA 2L01A 3RKWA 1FP2A 2Z5UA 1P4WA 3I71A 4LB6B 2LNBA 4EMSA 5L3EA 2M30A 1FC3A 2Z99A 4KICA 5JHUA 2BBYA 2ZO4A 2PMUA 1SD5A 3ZMSA 1YFHA 2H6CA 4O3MA 2IVMA 4Y13A 4CZZA 5E1XA 4ENKA 3R0JA 3CUQC 2PEXA 3G3ZA 3IWFA 4M72A 3MEXA 5AONA 1YTYA 3U9GA 1ZGAA 2KIUA 3CLOA 3I4PA 4HBLA 4IHTA 1IXCA 2MA3A 2GAUA 5A2QK 3TGNA 2QBYB 2LF7A 4MGRA 4FT8A 4BYYA 4HF1A 4EQQA 2MLGA 2RC4A 2JPCA 2PG4A 3BDDA 1L0OC 4HX8A 1FBUA 5J8CA 3ML6A 4MTEA 4RB3C 2ISYA 2LF8A 1XGMA 1YQAA 3V8JA 3BROA 2A6EF 4G7OF 2YSRA 1BI2A 2FBKA 3GO5A 1H0MA 3ZMZA 5DUIA 4LG0B 3I5UA 4MQ9F 5JVTA 3REOA 4MQVA 5ICEA 3LFKA 3PQJA 5ED4A 5DUKA 3WU0A 5CYVA 4OINF 3KP3A 3I59B 3VOEA 2P6TA 2K02A 3FMQA 2IA0A 2NNYA 3K1PA 3R4KA 1LEBA 1VTNC 1KQ8A 3RKYA 1O57A 5D8LB 4ZZDA 5L3GA 1HSTA 1R00A 2QZ8A 4UV8A 4LB5A 3F6OA 5E1ZB 3RPQA 3K1MA 5ILSA 4ENJA 2OQRA 3IL2A 3FF5A 4XLPF 2CSOA 4UVCA 4UVAA 3QP5A 1IW7F 2PQ8A 2PLYA 3LAPA 3GF2A 1MJAA 2KJCA 1USTA 3TO7A 4ASNA 3KETA 2FE3A 2CGPA 2XAFA 3CUQB 3U1DA 2EFNA 3WTWC 2ZXJA 3KEOA 1S6LA 2L4AA 4U88A 3WGIA 2CQKA 2M1BA 2D45A 3CUOA 2A6HF 5BPDA 1NHAA 1RUNA 2EK5A 4HLXA 3LAJA 4CXFA 2STWA 3QAHA 1B59A 3ZN1A 5FD6A 4JBAA 4EV0A 3TOAA 3R6SA 2RN7A 1QBJA 4OIRF 1BN5A 3JAMK 1WWXA 1MZBA 4HAMA 4KMFA 1W7PD 5K5OA 4WF2A 2DW4A 3AAFA 1J75A 1I1SA 2UXNA 1ZH5A 1B9NA 1ULYA 3FXRA 4YIIA 2FMYA 1HSJA 1XGOA 2O6GE 3ISPA 1Z05A 3Q9SA 2DFIA 1B9MA 2P8TA 5E18F 3B02A 4Z2YA 5CJ9A 3MWMA 2F5EA 3VODA 3ZMTA 2QBYA 2VE8A 4FX0A 3HTSB 4EJOA 1WKMA 3BP8A 1TQIA 2W85A 3WGHA 2V9VA 3SQNA 4PGGA 4HOBA 1UFMA 2DU9A 2XUBA 2XKPA 4OIOF 2EV0A 1D8JA 4IRGA 4BHCA 1B4AA 3K2ZA 1IF1A 2PJPA 2EFOA 1LDKB 2VBYA 3BJAA 1QGPA 1IRFA 1MDMB 2STTA 1GXQA 2Z33A 3DPLC 2O0YA 3H3ZA 6PAXA 3BOQA 3C1DA 4IRHA 2FF4A 2L54A 2ZNYA 2P7CB 1SD7A 1TW2A 1BC8C 4OMYA 1HQCA 1K79A 1XGSA 5CVJA 3K0LA 2EFPA 1QZYA 1FYMA 1REPC 1R1VA 1Z6TA 2EA4A 1TNTA 3I59A 4GYIA 4L9NA 1JE8A 2HGCA 2EV5A 2KRFA 2COMA 2VOOA 3FM3A 3L00A 4OMZA 4ESFA 4IJAA 4G7HF 1DPUA 4G7ZF 2EFQA 5L3CA 1G3TA 1XDUA 4GCVA 4HLYA 4YFXF 4JK1X 4MHGA 3PQKA 3ZMDA 4LD5A 4L5IA 4WWCA 2P7VB 3SHFA 5DD4A 3RJPA 4L0YB 2F2EA 4ESBA 4HA8A 1U6GA 5DCMB 1LVAA 5JFRA 3L9FA 2F5FA 4RGSA 3GFMA 1J9IA 4FHTA 5LBQA 5JI6A 4L9TA 3P9IA 2G7UA 2OZ6A 3ABTA 2YX4A 3M9AA 3E5UA 1IRGA 4ZYGA 2FOKA 1F1ZA 4LLLA 3IRRA 4KMUX 4AIKA 3F23A 4I2OA 1LNWA 1U3EM 3GW2A 3ZQ7A 2O61A 5DYMA 1RNLA 2IW5A 1WQ2A 3T8RA 4LJZF 1B6AA 1GXPA 4WXHA 2A68F 3IWZA 4PZJA 1HBXG 1IAWA 4R79A 4KFCA 4A6DA 4ZYEA 5D5XB 2E1CA 2M45A 2LDUA 3HHHA 2R3SA 1V4RA 2NYXA 4RB1A 4KYWA 1IZ1A 1J7KA 4A12A 1BOAA 2DTRA 4WK8F 3WTUC 4RB0A 4B09A 3NRVA 3OOPA 1QNTA 3G73A 3WG9A 4P96A 4L5JA 5CVRA 5D8KB 2DO7A 3QOPA 1IN6A 3RYPA 1O3RA 3C3WA 3QU3A 3MZHA 2DAOA 3HSFA 2VC0A 3P9CA 3FMSA 1QQIA 2XAJA 2B0LA 2FNAA 4L18B 1FSEA 2QYOA 1HW1A 1O7FA 3IRQA 1MDMA 4E70A 1MKMA 2X0LA 4Q5SF 3BPVA 3W6KB 2P5VA 1IN5A 2VBXA 2QWWA 2HYFA 2WV0A 3T1BA 1F9NA 2VONA 4A2UA 2MC3A 4XRFA 1SFXA 5F6FA 3HRTA 1F5TA 1W5SA 4AVPA 2M8EA 5FB2A 2GXGA 2ZNZA 1O3SA 1EH7A 4IHSA 4AIJA 2VOPA 1ZLKA 3R60A 3VFZA 2OAZA 1DUXC 3N97A 3IKTA 1O3TA 5D5WB 3WTYC 4GXOA 2IJLA 1R36A 3E6DA 4HX4A 1OYWA 2QVOA 1Z9CA 1FT9A 5H6QA 3L7WA 4I0BA 3K9TA 4P5OA 4RGRA 4HV5A 4I02A 4YFNF 1R1UA 3HOSA 5DCMA 1SFEA 4RAYA 2EV6A 3KP4A 4BXUA 2RVCA 1BI0A 1L3LA 2QQAA 2O3FA 1WSUA 1YW9A 2F5DA 4YG2F 2FU4A 5IT9Z 1EV7A 4MTDA 5DCFA 4WX9A 4CYDA 4L9JA 3J80K 2G9WA 1OMIA 4RB2C 5LEJA 3M1EA 1GHCA 1P6RA 3DF8A 5JR3A 3WE2A 3F8BA 4R8HA 4EVIA 1XB4A 5E8IA 2JTVA 2IPQX 2ELHA 3FM5A 3LQRA 4S04A 2UXXA 4M6YA 1KQ9A 3MQ0A 3BJ6A 4G94A 4ENMA 3DP7A 1R7JA 4M73A 1R58A 2WWYA 2QLZA 2HOEA 2M5WA 1XSXA 3ZP5A 4FX4A 3E5XA 1TQPA 2DLLA 1T98A 3J81K 2MLKA 3GEZA 1FNNA 4XBFA 2VT3A 4EJVA 3JSPA 2XAHA 2R7DA 1Z7UA 4U7DA 5F64A 1HW2A 1ZLJA 3M7GA 3K69A 3QU6A 2J5OA 2EB7A 4AD9A 3MZYA 5DD8A 2G7HA 4EJWA 3LA2A 2HR3A 2IA2A 3LWFA 1W5TA 2JZYA 3P7NA 1BI1A 4LK0F 2KKOA 2XKOA 3E6CC 2HFHA 1CF7B 4KNYA 4KIBA 3IHUA 3ERED 1W7PB 4K2EA 1EH6A 3TDZC 3C7JA 1YS6A 1F4KA 5CLSA 1KU9A 1T0FA 2ZBKA 4EGYA 2DK5A 1C0WA 1XMKA 4DQ2A 5D4SA 1YG2A 3SZTA 4EM0B 3LA3A 3SZPA 1KQ0A 2V6CA 5LRSA 1JXSA 1Z1DA 2TDXA 2PBIA 3ZMUA 5DEQA 3DXJF 1ZRDA 3ULQB 1FBQA 1MGTA 1KU2A 1FYKA 2XAQA 2BV6A 3F72A 4G6DA 2L4MA 1XCBA 2HS5A 1S29A 2DBBA 2HYGD 2P5KA 4CDGA 1ZARA 4M6XA 1SFUA 4M9SA 1CGPA 4Q4ZF 1LDJA 5H6RA 1ZRFA 3EQLF 4MEXF 1K78A 1XMAA 1FBSA 2XASA 1J2XA 3V4GA 1LJ9A 3WGGA 3V7SA 1HKSA 5LGTA 1ZREA 3GXOA 4KA4A 4IXAA 3WTXC 1IXSB 2OA4A 4CHUA 1J59A 5E20A 3Q9VA 5BOXA 3KE2A 4KT5C 3WTTC 5K5QA 3HSRA 4HQMA 4I09A 2H09A 5BS6A 2W84A 1FOKA 2K27A 2FRHA 3DV8A 4RGXA 1SD6A 2ZMEB 3BZ6A 3U2RA 2A61A 3E6MA 3O3KA 5ICFA 2QM3A 1R23A 3HYIA 4BH9A 2WTEA 3T8TA 2IRFG 2VT2A 5D6FA 2ZKZA 3I58A 2IA1A 2NS0A 4OOIA 1FX7A 1W4MA 1HW5A 4LLGF 3IC7A 5DDGA 2K4BA 4Y17A 3CJNA 3QP6A 4LK1F 3HRSA 2PI0A 3ZPLA 3EYYA 1T38A 4R1HA 3WODF 2GZWA 1OR7A 4XSXF 3W6JB 4PDKA 2W57A 4O5VA 3FHZA 1T39A 1MJ9A 1IN7A 3KLNA 5KK1A 1XGNA 3V8KA 2Q8KA 1HXDA 3I53A 4GYGA 3FMRA 3GUDA 1ON1A 1G3YA 1HKQA 3KP7A 2VN2A 1S7AA 2XGXA 2A07F 4ZZLA 1FPQA 4O6JA 2VE9A 4NB5A 3ELKA 3NQOA 3RPUA 2Q2EA 1R5HA 2VBWA 1U5TA 1CF7A 2IT0A 1P4AA 4ZYDA 2OQGA 1W7PA 3BWGA 3F3XA 5A2QZ 2V1XA 1P2FA 4KIGA 2Z9OA 3F6VA 4HF2A 2UZKA 1IXRC 5KVRA 3PFIA 3HUGA 1UHMA 4ESJA 5FO5A 3KZZA 3KP6A 2FQ3A 3ECOA 1I27A 4BAYA 3QRFF 2D1VA 2OBPA 2KIMA 1K6OA 1X3UA 1Q1HA 4A0ZA 3HHGA 4S05A 4OIQF 2A69F 2ISZA 5ERIA 3KLOA 3CTAA 2QUFA 2DT5A 2OU2A 2UWMA 4QLCU 4BQAA 5J8FA 3BY6A 1PDNC 2L02A 2LKPA 4U0YA 2DQLA 4A0YA 5LHGA 3T0YA 3TQNA 1ZRCA 1KA8A 2A3SA 5DV5A 1EH8A 3GZ5A 3QPTA 4WCGA 3EETA 2XHKA 2V1DA 4EGZA 2E7WA 1LEAA 4UUVA 2E7XA 3VB2A 1USSA 5TRDA 1FY7A 5LHHA 2NNNA 4D0PA 3KEQA 2XIGA 4MEYF 3D5LA 3TO6A 4QWQA 5D4RA 3RYRA 2JPBA 2H27A 2YU3A 3NEUA 3KCCA 1ZGJA 4IRIA 1R1TA 5LGUA 3COAC 1IUYA 3GYHX 2ZMEA 4LLNA 2E1NA 2GXBA 2Y0MA 3E6BA 2RGVA 2DQRA 3T5XA 5BQTA 5ILVA 4P55A 5FLXZ 1UCRA 3TOBA 3CO7C 3H3UA 4AIHA 2ZJ2A 4TV7A 2JSCA 3E3VA 5HS8A 2FEZA 5L3FA 4L0ZB 4Q47A 5CVVA 1SMTA 3WE3A 1YO5C 3I64A 4NHJA 3MCZA 1G3WA 1XD7A 1RIOH 2HKXA 2H6BA 1D5VA 4ZH4F 3GX4X 4KIFA 1ZG3A 2PN6A 2CYYA 5ILUA 4ETSA 1I5ZA 1RUOA 1TLHB 1U5TC 3GFIA 1U78A 1ZG1A 3DFGA 3WTZA 3JAMZ 3E5QA 1LQ1A 5HDNA 2A5YB 3HRMA 3L09A 4HV6A 1K78B 4A5MA 4B8XA 4A5NA 2JT1A 3CDHA 3V7RA 2PFBA 3R0AA 1BBYA 2MH9A 2XROA 5K1YA 2QQ9A 2ESHA 1IN8A 2VXZA 4EM2A 3MFKA 3WU1B 1V3FA 1S3JA 2PMHA 5IT3A 2P6SA 5ICGA 4H0EA 2R7FA 2V79A 4OU0A 1I1GA 3JSOA 4G6QA 3Q5FA 5FD5A 1BI3A 3EUHA 1DDNA 4UNOA 2C6YA 2GQQA 1ONVA 2GWRA 3FX3A 3WTSC 3TDUC 1H9TA 3I0TA 2HDCA 4KN7X 4GO1A 3RTRA 4M9XA 2FXAA 3MAJA 2X4HA 3V7CA 3LSTA 4N9HA 1R22A 3FXQA 1KYZA 4WXDA 2CWEA 2O03A 2CO5A 1UHWA 2EFWA 4ZYHA 3GZ6A 1XDSA 3K1NA 3QPHA 2KIFA 3HSEA 5LEKA 1IN4A 3GFJA 4KUMA 2ADUA 4M71A 5J6XA 1UB9A 4MNUA 4DNCA 4BHPA 1AWCA 1BM9A 2MD5A 2HQNA 1SMYF 2RQPA 1DPRA 4CICA 1D8KA 5D6EA 2RKHA 2AS5F 5FGMA 3ABUA 2FSWA 2HZTA 4I0AA 4XLNF 3RI4A 2VODA 3HIFA 1WI9A 1PP7U 4EJTA 5HDKA 2CFXA 1XSVA 3HTUA 4M74A 1U5TB 4A6EA 2FMLA 3V8LA 1U2WA 4Y15A 4CO8A 4IF4A 4UXNA 3P9KA 5L3BA 2NRAC 4YIFA 2EWNA 4UV9A 1A04A 5HVQC 5L3DA 1D3YA 1XSDA 2DPDA 2K7LA 2H94A 3GWZA 4HW0A 4I98B 4XSZF 5FLXK 1GVJA 3ZN0A 4HYEA 1SAXA 3SFZA 2ACJA 2CW0F 3E97A 5AIQA 3FZVA 5E17F 2ZCWA 5H20A 3DEUA 1I6XA 3KP5A 1E17A
chains in the Genus database with same CATH superfamily
4I01A 3UKGA 2DI3A 3OV8A 1AHDP 3OYLA 1MSEC 2OTLI 1MNMC 1FMWA 3KP2A 1YW8A 1VNDA 2YPRA 4CCMA 1MMAA 2VB6A 1OCTC 4A93J 2VLAA 1MBFA 1KU3A 4WXCA 2E35A 4MFDA 3PL8A 2HKOA 4GGGA 5IP7J 5BPIA 4HX7A 3CF5F 1TT0A 4A3JJ 3I56I 3GTJJ 2KJBA 1TWGJ 1T2KA 2CUJA 5CVUA 5DTDA 3ABLH 1TNSA 3H0GJ 3LA7A 1KYWA 4DW6A 3PIPF 4FCYA 4XOTA 4M9ZA 3D0SA 4XN3A 5TJJA 2MGQA 1SD4A 4HNUA 3A01B 3RKXA 2R93J 4U0VA 2IGMA 2W82A 2PX9A 3F8NA 4A3CJ 1A6IA 1O4XA 3GTGJ 2VUMJ 1F43A 1ZN2A 3JTGA 2ESNA 3LQQA 1PUEE 3Q0WA 1O3QA 1EA3A 2DOFA 2XDVA 2JVHA 3WG7H 3WTVC 2WBMA 3JTHA 2D2WA 1OISA 1JTXA 3F8FA 4HDVA 1PP8F 5HDGA 2K3FA 1JHHA 1LDDA 2MYSA 2VJIA 2X6WA 2P5LC 3OYBA 3EUHC 3S2DJ 4XR6A 2FA5A 1S72I 4QTRA 4NQWA 1YIOA 2Q0OA 5IP6A 4QIWN 1WRJA 4KISA 4HF0A 2BHYA 3AKZA 2WB1N 5EEHA 4UB8C 4AWXB 3L2UA 1MD0A 4PJJA 4D7MA 1UG2A 2GIZA 4C9YA 1Z91A 4DOZA 4ON0A 5LD2C 2YUSA 3DPTA 2WB1A 3M8EA 4CCLA 4RS8A 3ABKH 5IT9K 2TRTA 4J01A 1BW6A 1G4DA 2EZKA 4HEA2 3W6VA 1BIAA 2VI6A 4M3BA 2UV1A 2KIQA 2LR8A 2WC2A 4RGUA 3W2VA 2VBZA 4N9IA 1WPKA 4IX7A 2L3DA 2IP2A 3OYHA 1TTYA 1OQYA 2OZUA 4NUBA 2E34A 1FWZA 3B6CA 1FLIA 2AXTC 1G3SA 4AUXA 1Y0UA 2RNJA 1W36D 1NK3P 1FP1D 2X1DA 3IKVA 4I7HA 3CCEI 2EA2A 3HOTA 1OCRH 2MBFA 1OLTA 3LSKA 3R61A 4XQFA 3KFWX 1MMSA 5FFZA 1ZHFA 2P81A 3MKWB 5FLVA 4IVNA 3RZDJ 3EYIA 3IP4B 3U1KA 4M3GA 2DN0A 3ECHA 4QSHA 4V19K 3I3LA 3K6GA 1BR1A 4X6AJ 4PSXA 1TBXA 2QENA 3DKWA 3O2PE 2CQNA 4LG0A 2HOAA 1KGSA 1S7OA 2MFZA 2Y30A 2FNPA 3K4LA 5CPRB 1ON2A 4RAGA 2LYCA 4ZC3A 2D1HA 3L2VA 3OWTA 1RZ4A 3MKZA 2R5YA 1P92A 3I9V2 3B73A 1K4TA 1BW5A 3CCYA 5E8GA 2ETHA 1DP7P 4RMNA 4D9JA 3DTKA 4NC8A 5HLGA 1YX3A 3H3VK 1SVLA 2EJRA 3BG3A 3AG3H 1POGA 3RIRA 2YX7A 1YLFA 4RLFA 3GVAA 1JKRC 2F4IA 5F1RA 4G8XA 4CCKA 3A4CA 3EUKL 1MW7A 1XCVA 5D5VB 4BJ6C 1S8NA 1E2XA 4FISA 2V26A 4DBRA 5HLHA 5ICCA 1T08B 3J7AO 4YELA 4LMYA 4IHVA 2DMUA 2W25A 1AOYA 2K4JA 1R5GA 1BIBA 3H9GA 1G59A 1OCPA 3L2CA 4XL9A 2KRCA 4LFUA 3JW4A 2YR2A 5EEGA 5LLQA 3MMYB 1OYIA 2QQBA 3DEWA 4LGWA 3S2WA 4AYBA 2DYRH 2DPUA 4F7ZA 3G71I 1VZ0A 2FBIA 3LSIA 1O7LA 5K5RA 1LE8A 2A6TA 3ROUA 2V1UA 3CC4I 4UVBA 5JLXA 2JVGA 3M8FA 2HEOA 2HWVA 3H9QA 3FIWA 4BKXA 2O8XA 2Z3YA 3EDPA 1U8BA 4P9FA 2NVQJ 1QPMA 4IPAA 4UHTA 2BYVE 5LRRA 4XLHA 1R6RA 2EH3A 2HTJA 4KDPA 2OCEA 1HKTA 2V7FA 4IKFA 3I54A 3SZGA 2AXLA 4JQFA 3TO9A 2F5CA 3BJOA 2ZFWA 4XN0A 3I4NJ 2ID6A 4MO7A 3G6EI 2NVTJ 3BPXA 3Q3SA 2E71A 4HNTA 2HU9A 2LRDA 3Q0UA 3RKQA 4PUSA 4N0BA 1ZAOA 1J5YA 1KZHA 2BE5F 1JGSA 5D5UB 3CESA 2R5ZA 4E7KA 2LC2A 1ZYRF 4GDFA 3FXKA 4JP0A 3ZMVA 1TWAJ 1J0RA 2AQFA 1DQUA 3RDIA 3ZQQA 2HTSA 3CUQA 5JLWA 3TP0A 3BC8A 4KN4X 1U8RA 3O8HA 2OD5A 4U0WA 1FZPB 2HQRA 2NAZA 3HL2A 1YRNB 1YYVA 4BS9A 3QYFA 3U21A 5K7ZA 3FWEA 1P4XA 1TW3A 3F8MA 5HODA 4PCQA 2BEOA 2M87A 2VJ4A 2XVCA 3J80Z 1YW7A 1RESA 3N4MA 2GIVA 1H9GA 3ERMA 5FFXA 2K86A 2DFHA 1GT0C 1FSHA 1FYLA 3JRHA 3GTOJ 2EIKH 4OIPF 4AVZA 3BR1A 1BR4A 3HKZN 4BE2A 2O9LA 1PUFB 1OPCA 4LOCA 3L2RA 2QCOA 4CGZA 1MJBA 1OYYA 2P4WA 2EBIA 1BJZA 2VC1A 2XGEA 3GLXA 3MD2A 1U9NA 2XPVA 3F21A 4CCJA 3K4NA 4RDUA 5HS9A 4IQJA 2CQQA 3WU2C 3GFLA 2AHQA 4HQEA 1LB2A 2ZC2A 3BTCA 3NAUA 3FBNB 1R71A 1XMXA 2BVMA 5E1WA 4U7BA 3GTMJ 3C18A 4UB6C 4PJLA 4G9YA 1ODDA 5IOZA 1IC8A 4L9VA 2L7MP 4HZFA 1QO0D 5M5WJ 1K7AA 2L7ZA 1KU7A 3M4OJ 1XX5A 1QZZA 3O6BB 4RAZA 5HS7A 5KAFC 3HOZJ 2R7ZJ 3J81Z 2XV4S 4Y52J 4EATA 1G6NA 1Z0XA 2LMDA 2M2EA 1WJAA 2W24A 4FE7A 4P9UA 2BHZA 2VL8A 2PJRB 1P7IA 2EIJH 2RV8A 2FBHA 3H5AA 1TL8A 1WI3A 4PGHA 5F0CA 2X1CA 1RI7A 5FKNA 1B1BA 2ZJQF 3CO6C 2KPMA 3GTPJ 2KT0A 2QSHX 1Z77A 4HDUA 1A35A 3SYTA 4LITA 4EJUA 5TGTA 4Q48A 4YFKF 3F8CA 3VDXA 3DPUA 3FXUA 2K9MA 3DQVC 3QQAA 2JRTA 4A0XA 2CUZA 2J5PA 2R7XA 3BQZA 2CQ7A 2KL4A 2CG4A 5BMZA 4A3LJ 4BHBA 4C3JJ 2XRNA 5HOOA 1VQOI 3LSGA 4ENNA 2VKEA 4BNCA 1JHFA 2BY2A 3K2AA 2R7VA 2GA1A 3F22A 1GLNA 1R4MB 4CCNA 5LHIA 3ZQFA 2MH2A 1TQMA 2NS7A 1YS7A 1T6SA 1ZG5A 2LSOA 3KPHA 4XKCA 1BJAA 1XN7A 1WJFA 3HRUA 4EM1A 2DK8A 2ECBA 4E7IA 1STZA 3CP2A 5HLIA 5LGNA 3JRIA 3E1SA 2XAGA 1BC7C 2Y75A 2GA2A 3F9KA 4FETA 1OKRA 1QRYA 2CRGA 3OS2A 5AIPA 3HOVJ 2Y48A 3TKYA 3SXYA 5J1YA 3H92A 2GXAA 5GPAA 3G2BA 5CVIA 4B44A 4DJAA 1D1AA 3KZYA 3L1PA 4M3EA 1Z6RA 1P7JA 1ETXA 2RDPA 2BGCA 2VKDA 3VEPA 1S7EA 2L01A 5F04A 3RKWA 5DM7F 1FP2A 2Z5UA 4II2A 1P4WA 3OYCA 3I71A 3CMEI 2RNGA 4LB6B 3HZJA 4KJZA 2LNBA 3S17J 4DYRA 4EMSA 2F4OB 2DA3A 1UZCA 4ZYAA 5L3EA 2M30A 2VIXA 1IDZA 5GAEJ 1FC3A 2Z99A 3MKYB 4KICA 5JHUA 1UAAA 3KZIC 2BBYA 3CP8A 4HG2A 4X1EA 2ZO4A 3JRCA 2PMUA 4XORA 1SD5A 3ZMSA 4C3HJ 1YFHA 3OR2C 4NQWB 4BQNA 2H6CA 1GUUA 4O3MA 2IVMA 1VFCA 3FXJA 4B4CA 3I4MJ 2LLKA 4Y13A 1AA7A 4CA0A 2XGDA 2DMNA 3PM1A 4CZZA 3JRBA 5E1XA 4ENKA 3R0JA 3CUQC 3RQ4A 3X2QH 1RPWA 5EF6A 2PEXA 3G3ZA 3IWFA 4M72A 1A31A 3MEXA 5AONA 1YTYA 1ZGAA 3U9GA 2KIUA 3CLOA 3I4PA 4HBLA 1IG7A 4IHTA 3NWTA 1IXCA 2MA3A 2V9KA 2GAUA 2LTPA 5A2QK 5HLTA 3TGNA 2QBYB 4Y33A 3ZQCA 2LF7A 4MGRA 4FT8A 4BYYA 3P5JA 4HF1A 4EQQA 2MLGA 2RC4A 4HNVA 2JPCA 2PG4A 3BDDA 1L0OC 2DXIA 4HX8A 1FBUA 3S32A 3TEDA 5J8CA 3DCFA 2NS8A 3ML6A 4MFEA 4MTEA 1FIAA 1OCCH 4RB3C 2ISYA 1FOWA 2LF8A 1XGMA 2KZGA 1YQAA 3AG4H 3G1OA 1YRNA 3V8JA 4PJNA 3BROA 1DU0A 2A6EF 2IGNA 3WHBA 1W5CC 4G7OF 2YSRA 1BI2A 5M3MJ 4XRSA 1AU7A 4E7LA 5CQGA 2FBKA 3GO5A 4NBQA 1H0MA 3ZMZA 5DUIA 4JX6A 4LG0B 2NVUB 3I5UA 4MQ9F 1JJ6C 1N25A 3OYMA 5JVTA 2DDBA 3REOA 3BQYA 1MBGA 1QVUA 5EG0B 4MQVA 3ZQIA 1RETA 1ZR2A 3J7ZI 4OAZA 5ICEA 3LFKA 2MSYA 3PQJA 5ED4A 1DGWY 5DUKA 1OCOH 3WU0A 4E6KG 2WY8Q 5CYVA 4OINF 3KP3A 3I59B 3VOEA 3SDBA 2IBDA 1ENHA 1SFKA 2P6TA 3BZCA 2K02A 2JK3A 3FMQA 2VKHA 2YS9A 2IA0A 2NNYA 3K1PA 1TWCJ 3R4KA 1G8XA 3HPGA 2IXSA 4J00A 1LEBA 3LSMA 3K70D 2HVQA 1VTNC 1KQ8A 3RKYA 1O57A 5D8LB 1QZEA 4ZZDA 4FASD 3OYDA 1BR2A 2LK2A 5L3GA 1HSTA 1R00A 2QZ8A 4UV8A 4LB5A 3F6OA 2Z2SB 5E1ZB 1NTCA 1Y1WJ 2DFFA 3RPQA 4A3BJ 3K1MA 2X1EA 5ILSA 3JRGA 4ABZA 1TZLA 3DEEA 2O7OA 2M4KA 1EKEA 4ENJA 1R9TJ 2OQRA 4IO9F 3IL2A 3VYTB 3A03A 3FF5A 4XLPF 2CSOA 2CV1A 4UVCA 4UVAA 2KHMA 3QP5A 1VQLI 1IW7F 1PJRA 4D5FA 1K61A 2PQ8A 2PLYA 3LAPA 5F27A 3GF2A 5J4VA 2IAIA 1MJAA 2KJCA 3I55I 2EQRA 3HJEA 1USTA 3TO7A 4ASNA 2IS4A 5J1RA 3KETA 5M3FJ 2FE3A 2CGPA 2XAFA 3DTIA 3FDYA 4DBQA 3CUQB 3U1DA 4PK4A 2EFNA 3WTWC 2ZXJA 3ZGKA 5E3LA 3H5RA 3KEOA 1S6LA 2L4AA 3QWLA 4U88A 3WGIA 3JRFA 2LKXA 2MC4A 1IRXA 2EPFA 1TWHJ 4I99C 2CQKA 2M1BA 2D45A 4NC7A 3JR9A 3CUOA 2A6HF 5BPDA 1X4OA 2DYSH 1NHAA 1YOVB 1RUNA 2EK5A 3PNTA 2GLOA 3H36A 3PNVA 1LKXA 1P9QC 2F48A 4HLXA 3LAJA 2XAUA 4IOCF 3OR1C 2ZXIA 4CXFA 2HPIA 1JT6A 2STWA 3QAHA 1B59A 1AKHB 4B47A 2M4GA 3ZN1A 5FD6A 2JMWA 2JN6A 4YEJA 4JBAA 3RPUD 3BT9A 4EV0A 1ITYA 2VJJA 1XC5A 3TOAA 1FOYA 3R6SA 2RN7A 1E3PA 4D5CA 4OIRF 1QBJA 1B8IB 1TC3C 2OV7A 1BN5A 1JTYA 3JAMK 1WWXA 4AC0A 1MZBA 4HAMA 4KMFA 3K7AJ 1W7PD 3H1CA 5K5OA 4WF2A 2DTZA 2DW4A 4F93B 3AAFA 5GAHJ 3G1MA 1J75A 1I1SA 1ETQA 2X48A 1TP4A 4PJMA 2UXNA 2CFOA 1ZH5A 1B9NA 1ULYA 4XICA 2JQ7A 2CJJA 4E7JA 1FMVA 3D5RC 3FXRA 4YIIA 1XPXA 3DU5A 4RM2A 2FMYA 3C2BA 1HSJA 3S8PA 1XGOA 1MH3A 2O6GE 3DKYA 3OYNA 3ISPA 1Z05A 2L7FP 3Q9SA 1DU6A 2DFIA 1B9MA 1Y8QB 2P8TA 5E18F 3A02A 3B02A 3NARA 4ZTFA 4RM3A 5EZHA 4HRIA 3IV5A 4Z2YA 1GV5A 3FHNA 5CJ9A 2V6EA 1QA6A 2F6CA 2LH9A 3MWMA 2F5EA 3VODA 2JA7J 3ZMTA 2QBYA 2LFBA 4Y4RA 2VE8A 4BDYA 4FX0A 2IS6A 2EINH 1XS9A 2Q1ZB 3HTSB 4EJOA 1WKMA 3BP8A 1TQIA 2W85A 2L5QA 3N05A 3WGHA 2V9VA 3JRDA 3SQNA 4RLQA 4PGGA 4HOBA 3D1NI 2HPMA 1XG1A 1UFMA 3CCRI 2DU9A 2XUBA 2XKPA 1JUPA 4OIOF 1ERDA 2EV0A 3OL4A 1D8JA 1MBHA 4IRGA 1K6YA 4XLFA 4BHCA 1B4AA 2EILH 3K2ZA 2E60A 1X1BA 1FTTA 4G12A 4PJ0C 1IF1A 2PJPA 2EFOA 1LDKB 2VBYA 3BJAA 1QGPA 4XKBA 3OSGA 1IRFA 1MDMB 2STTA 2E2IJ 2HXIA 4BEHA 1IV8A 1GXQA 3RCOA 1VI0A 2Z33A 5K7FA 3BR3A 3CCUI 3S1QJ 3KX2A 5E3NA 3DPLC 2O0YA 3H3ZA 6PAXA 3BOQA 3Q0VA 3C1DA 1ETVA 1ETYA 3H35A 5DS9A 1RR8C 4IRHA 3GTKJ 1UG0A 2FF4A 2L54A 3L2QA 2ZNYA 4BACA 2P7CB 5EG0A 4GFBA 1SD7A 1TW2A 4A3MJ 4IHWA 2HNHA 1BC8C 4OMYA 1HQCA 1K79A 1XGSA 5CVJA 5EJCA 3DKXA 3K0LA 2OUMA 4M3FA 1VF9A 1DGRM 2EFPA 1QZYA 2L9SA 1FYMA 2Y9ZA 1REPC 1R1VA 1Z6TA 1VQ7I 2EA4A 1TNTA 3I59A 1RKWA 4GYIA 4L9NA 1JE8A 2HGCA 2NOGA 2LY1A 1WGXA 2EV5A 2KRFA 2COMA 1HLVA 5HNHA 2M7BA 4BJ5C 2JUGA 1X1DA 2VOOA 3FM3A 1Y8RB 3OYFA 3LSRA 3L00A 2OPTA 4OMZA 1FOXA 4B43A 4ESFA 4IJAA 4G7HF 1DPUA 1TT5B 4G7ZF 3A1YA 2A05A 2EFQA 5L3CA 3OYGA 2DMQA 1G3TA 2DJIA 1XDUA 3OOUA 4GCVA 3KIOA 4YFXF 4XK4A 1MMGA 4HLYA 2E1OA 3FXOA 4JK1X 4MHGA 2KQRA 3PQKA 3ZMDA 3S1MJ 4LD5A 3TL4X 1YITI 4L5IA 2QKMB 2P7VB 3V42A 4WWCA 2QF7A 3SHFA 4BL0B 3PSIA 5KNLA 5DD4A 2ZJPF 1LUJB 3S16J 2Z1DA 3FBIB 3RJPA 3A0BC 1D5YA 3E0JB 4L0YB 2F2EA 5C4JJ 4ESBA 3HBLA 4HA8A 1U6GA 5DCMB 2M9HA 1LVAA 4CUGA 5IY5H 2Y9YA 5JFRA 4BQOA 3L9FA 2X9DA 1VQ9I 2F5FA 4LIUA 4RGSA 3GFMA 1J9IA 4FHTA 5FKOA 5LBQA 2KLOA 5JI6A 2N8GA 2NOJB 2XGCA 2A5WA 3CJTB 2R4GA 4L9TA 3P9IA 2G7UA 3HOWJ 2HVRA 1X1AA 3O8GA 1WH7A 2LG4A 3ASOH 2OZ6A 3ABTA 3FXMA 2YX4A 3M9AA 2BZTA 1IO2A 3E5UA 1IRGA 4ZYGA 2FOKA 1F1ZA 3ZQLA 3K4MA 1FEXA 2DT7B 1YIJI 2ZFUA 4LLLA 3IRRA 4KMUX 4RBOA 4AIKA 3HOUJ 3F23A 2R0QC 4I2OA 3C2GA 1H88C 2VQHA 1W0UA 1LNWA 5CKTA 4PFPA 2JWTA 1U3EM 4JYKA 1LPQA 3GW2A 2CW7A 3ZQ7A 3GLLA 1AKHA 1DP3A 2O61A 4IL6C 2LBFA 2FOWA 2M34A 5DYMA 1RNLA 1ACIA 2IW5A 2K85A 1WQ2A 3T8RA 3UR3C 4Y7NJ 2BOLA 4LJZF 3HKZA 3BTLA 1B6AA 1GXPA 2EZIA 2A68F 3IWZA 4WXHA 4PZJA 1B8IA 1HBXG 2HDDA 1YJNI 1IAWA 4R79A 1WVRA 4E4HA 5B3SH 5J40A 2LD5A 4KFCA 4A6DA 4OAYA 1D1CA 4ZYEA 5D5XB 4HSRA 2WADA 2E1CA 2M45A 2LDUA 3HHHA 2R3SA 1Q1VA 1V4RA 3KYLA 1JI8A 1MBJA 1OFCX 2NYXA 4RB1A 4DYCA 1K4SA 4KYWA 1IZ1A 1RR7A 1J7KA 4A12A 3RZOJ 1BOAA 2DTRA 4WK8F 4BY7J 2FUG2 5IYCJ 3WTUC 4RB0A 4XM3A 4B09A 1X3WB 4G6TB 3NRVA 3SEQA 4CCOA 3OOPA 1ORKA 4YRVA 1I50J 1QNTA 3G73A 2DDAA 3WG9A 4P96A 4L5JA 4DGWB 4UUTA 1YX5A 5CVRA 5D8KB 1H89C 5C3EJ 2DO7A 2E5ZA 3QOPA 3VYRB 2DJNA 4JOMA 3VYUB 1Z7LA 5F0FA 1IN6A 1V54H 4I76A 3VPRA 3RYPA 1Z3XA 1ZELA 3CCSI 1O3RA 2H1LA 3C3WA 3CQZJ 3QU3A 3JRAA 2IS2A 2COBA 3MZHA 3CD6I 2GOMA 2DAOA 4W1UA 3HSFA 2VC0A 5FKLA 5KAIC 3S15J 3P9CA 3FMSA 1HOMA 1LVKA 1QQIA 2XAJA 4CYCA 2B0LA 4BBSJ 2FNAA 4L18B 1FSEA 4LG3A 2QYOA 3S14J 1HW1A 1O7FA 3IRQA 1MDMA 3HPHA 4E70A 1I6HJ 1MKMA 2ME6A 1A36A 2X0LA 4Q5SF 3BPVA 2WY7Q 3W6KB 3M1CA 2P5VA 2OTJI 5K7HA 1VQ4I 3BCBA 3JCUC 2H8WA 3CMAI 2M7AA 1IN5A 2VBXA 2LREA 2EZHA 2QWWA 1HCRA 2HYFA 2WV0A 4QPOA 3T1BA 1F9NA 2VONA 2XC7A 4A2UA 2MC3A 4XRFA 3S2HJ 2DA4A 1SFXA 2B7EA 3A0HC 3HRTA 5F6FA 1F5TA 1HC8A 2M0MA 3HEFA 3S3MA 2R92J 1W5SA 4AVPA 2M8EA 5FB2A 4DZPA 2GXGA 2QSFX 2ZNZA 4A3IJ 1O3SA 5IP9J 1EH7A 4IHSA 4AIJA 1W1WE 2VOPA 5FKMA 1ZLKA 3R60A 3A2KA 3HC7A 5C44J 3VFZA 2OAZA 1DUXC 2L7KA 1J09A 1QVTA 3N97A 2VXDA 1ZGWA 1WZ2A 3IKTA 1O3TA 5D5WB 4B3AA 2ZSHB 4JX4A 3WTYC 1KONA 2EZLA 2ZJRF 3LL7A 4GXOA 2I5UA 2IJLA 1Y39A 1EJ9A 1NH3A 1R36A 3E6DA 4HX4A 3KEYA 3K4CA 1OYWA 1NG7A 2QVOA 3LFUA 1Z9CA 1FT9A 5H6QA 3L7WA 2BY3A 4I0BA 4XKVA 4BGDA 3QYBA 3K9TA 4OWRB 1N75A 2JSPA 4P5OA 4RGRA 2F4MB 4ZTJA 3TW7A 4HV5A 5KCMA 3OIOA 4I02A 4YFNF 4NNJA 4D1QA 1R1UA 3S3OA 3CDIA 4C2UA 1Y56A 3HOSA 5DCMA 1SFEA 4HSTA 4RAYA 3PSFA 2EV6A 3KP4A 2OF7A 4FTHA 4BXUA 2RVCA 1BI0A 1L3LA 1I3AA 1Z3YA 2QQAA 4C3IJ 3MN2A 2O3FA 1WSUA 1EF4A 1YW9A 2F5DA 4YG2F 4LIVA 2I10A 2FU4A 1YHQI 5E3OA 5IT9Z 4F52A 1EV7A 3BG9A 4MTDA 5DCFA 4WX9A 3BR2A 3G4SI 4IOAF 4IQ4A 4QPQA 1V5GA 2HI3A 1TWFJ 2KFDA 4CYDA 4L9JA 3BG5A 3J80K 2G9WA 4NDLA 1OMIA 3QPSA 3FK6A 4RB2C 3DLAA 3M1EA 2DCEA 5LEJA 1P6RA 3DF8A 4XNFA 5FJ8J 4BEHB 1GHCA 5JR3A 2VASA 3E7LA 2OC6A 3WE2A 3F8BA 4R8HA 4EVIA 1XB4A 5E8IA 1V5EA 1W36C 2JTVA 2K5CA 1E3HA 3HB9A 1X2MA 2IPQX 2KRHA 2ELHA 4BBRJ 1GVDA 2CU7A 2G0EA 2M3AA 3FM5A 4A3GJ 2B9SA 1WJBA 3CMYA 4C2MJ 3LQRA 2LVSA 2L9VA 1HF0A 4S04A 2UXXA 3SJMA 4M6YA 1SVMA 1KQ9A 1WJ5A 4F92B 3ZOBA 4A3EJ 2V1NA 4BUPA 3MQ0A 3BJ6A 4G94A 5GP9A 1T56A 4ENMA 2DA7A 3DP7A 1R7JA 4M73A 3CCLI 1R58A 2WWYA 2QLZA 2H1KA 2HOEA 2M5WA 1XSXA 3AL0B 3ZP5A 2ZXHA 4FX4A 1Z67A 3EUAA 3E5XA 1TQPA 2DLLA 1ETWA 4D7NA 3DBHB 1T98A 3J81K 2MLKA 1U9OA 3GEZA 1VQMI 1FNNA 2Y0SN 4XLCA 4XBFA 1SC7A 3W2AA 2VT3A 4EJVA 1MBEA 3JSPA 2XAHA 2R7DA 2Y0SA 3S3NA 1VQ5I 1Z7UA 4U7DA 3BLYA 5EGOA 5F64A 1HW2A 1ZLJA 3M7GA 4C2TA 2W4SA 3B6AA 3FK7A 3GZNB 3K69A 3K4BA 3MKLA 3QU6A 4IZZA 2J5OA 3ZXSA 2EB7A 1BOBA 4AD9A 3BG6A 3MZYA 5FROA 4XONA 5DD8A 5IYBJ 4A3DJ 1IGNA 1S5LC 1ETKA 2DA2A 2G7HA 3ABMH 4EJWA 2DT6A 2JA2A 3LA2A 2HR3A 2IA2A 2LOOA 3LWFA 3HGYA 1W5TA 2JZYA 3P7NA 2HOSA 3CCJI 1BI1A 4XIDA 4LK0F 2KKOA 2Q2EB 2XKOA 4BQQA 3E6CC 4BE1A 5H2FC 2HFHA 3BCAA 4I6ZA 1CF7B 1NG6A 2E5NA 4KNYA 3CZ6A 2ZXWH 1BL0A 4KIBA 3IH4A 3IHUA 3ERED 1W7PB 2VQCA 4K2EA 2P0WA 1WFXA 2Z16A 1EH6A 3TDZC 3C7JA 1R4NB 3HXLA 1YS6A 2L0KA 1F4KA 5CLSA 3RSNA 2HDWA 3S1NJ 1KU9A 2VJ5A 3FKIJ 1VQ6I 1T0FA 1YJ9I 4UY8I 4II3A 2ZBKA 3WHCA 4EGYA 2KDOA 2VPLA 2DK5A 1C0WA 1XMKA 4DQ2A 5D4SA 3VSLA 1YG2A 3OSFA 3SZTA 4EM0B 3LA3A 4N4OB 3SZPA 1KQ0A 2V6CA 2LBFB 5LRSA 1Z21A 1E3OC 3W3CA 1OJLA 3SDGA 1JXSA 1Z1DA 2TDXA 1B72A 3C2HA 3PIOF 1IJWC 2PBIA 3ZMUA 5DEQA 3DXJF 1ZRDA 3ULQB 1FBQA 1MGTA 1KU2A 3F0CA 2K9SA 2XAQA 1FYKA 3TMOA 4J19A 5FKKA 4XRSG 2BV6A 3F72A 1FIPA 3J7AY 4G6DA 2L4MA 1XCBA 3D5SC 2HS5A 1S29A 4ZDOA 3OMYA 2DBBA 2HYGD 2P5KA 2WAFA 4CDGA 2KZVA 3HGGA 2DFEA 5IOYA 2CMPA 1ZARA 4XKWA 4M6XA 5J4YA 4M3DA 1SFUA 2GOXB 4M9SA 1CGPA 2JUCA 4Q4ZF 1LDJA 5H6RA 2F5VA 1JUMA 5B1AH 1ZRFA 3EQLF 3AFHA 3IAS2 5FLMJ 4MEXF 1K78A 1XMAA 1FBSA 5GAGJ 2XASA 2DMTA 1J2XA 5F08A 4XRMA 5EZGA 3IUOA 3V4GA 5KHDA 1LJ9A 1JUSA 3WGGA 4BU2A 1ZTRA 1ETOA 2ZB9A 2X85A 2R7QA 3V7SA 1GDTA 1HKSA 2ICWG 2L9RA 3PO2J 5DM6F 5LGTA 2X51A 1ZREA 2CUFA 3GXOA 2MG4A 4KA4A 4IXAA 3WTXC 1IXSB 2OA4A 3K4KA 3DTEA 2LY2A 1J59A 4CHUA 2FQ4A 5E20A 3Q9VA 5BOXA 3KE2A 4KT5C 3WTTC 5K5QA 3HSRA 4B48A 1I3QJ 4HQMA 4I09A 1UMQA 2H09A 5BS6A 4CYCB 2HQAA 2W84A 4BXXJ 1FOKA 2JA6J 2K27A 1GV2A 3HOXJ 2XPUA 2IS1A 2FRHA 2L2OA 2H8RA 2PMZN 3DV8A 2HZDA 5HNFA 4RGXA 1SD6A 2ZMEB 3BZ6A 3U2RA 2A61A 3E6MA 1G2HA 4B1RA 3O3KA 2VPRA 5ICFA 2PMZA 1IV6A 4V2FA 2QM3A 2E1MB 1R23A 1I39A 2R7WA 1N77A 3HYIA 1R49A 1MBKA 4BH9A 2WTEA 4ZDLA 3FKJA 3T8TA 2IRFG 2VT2A 1X2NA 5D6FA 4CZCA 2ZKZA 3I58A 4H4KC 2IA1A 3CCQI 2NS0A 3OL3A 4OOIA 3S1RJ 1ZQ3P 1FX7A 1W4MA 1HW5A 4DZJA 4LLGF 2K3PA 1FTZA 5EYRA 3BTJA 3IC7A 5DDGA 5FRNA 4BDZA 2DOAA 5E3MA 2K4BA 2Y69H 4Y17A 2WA0A 3DBRB 3CJNA 2XSDC 4MLOA 3QP6A 4LK1F 1JT0A 2B63J 3HRSA 3M07A 2PI0A 3G1LA 3ZPLA 3EYYA 3UNGC 3CCVI 1T38A 5EDNA 2X6XA 2KMUA 4R1HA 5B1BH 3WODF 2GZWA 2X6OA 4FE4A 2E2HJ 1OR7A 2BW3A 4XSXF 3W6JB 3SFIA 2RREA 4PDKA 2W57A 3J7YJ 2EIMH 4O5VA 4JX5A 3M3YJ 3FHZA 2KISA 4ITVA 1T39A 2IGOA 3ZQHA 1MJ9A 1IN7A 3KLNA 4AYBN 5KK1A 1SANA 1XGNA 2ZSIB 3V8KA 2Q8KA 1HXDA 3I53A 4GYGA 3LMMA 3VSKA 3FMRA 3AG1H 3GUDA 4RAFA 3GBGA 1ON1A 1G3YA 1HKQA 3KP7A 3M8JA 2FJ1A 1UJ8A 2VN2A 1S7AA 2XGXA 4UUSB 3H0DA 2A07F 1OCZH 3W2WA 2GBYA 4ZZLA 1FPQA 4O6JA 1SAUA 2VE9A 2W7NA 4NB5A 1K83J 1T0FC 2OCCH 3CJQB 3ELKA 4ANJA 1IUFA 3NQOA 3RPUA 5FRMA 2L9NA 2Q2EA 1R5HA 2VBWA 1U5TA 2BXZA 1CF7A 5E79C 2IT0A 3BZKA 2XRLA 1WJCA 2R7TA 4A3KJ 3ONQA 1P4AA 3IAM2 2JA8J 4ZYDA 2OQGA 1W7PA 3BWGA 3F3XA 5A2QZ 2V1XA 1P2FA 4KIGA 4F91B 2Z9OA 1UHSA 2WAEA 2XPWA 3AG2H 3F6VA 4MIMA 5J3LA 3CLQA 1ZK8A 3QOEA 2GM4A 4HF2A 2UZKA 1IXRC 5KVRA 3PFIA 3HUGA 1UHMA 4ESJA 4AU7A 4IHXA 3GTLJ 5FO5A 3KZZA 3KP6A 2FQ3A 1WH5A 3OYIA 3ECOA 4V2GA 2IEKA 4XLEA 2KDZA 4BE0A 1I27A 3GTQJ 3MVPA 4BAYA 1WJDA 3QRFF 1JKOC 2QEXI 2D1VA 2OBPA 2KIMA 2MD0A 1K6OA 1X3UA 1Q1HA 4A0ZA 4F55A 1X1PA 3HHGA 3NWSA 4S05A 5JHFA 5IYDJ 2LKSA 2XB5A 4OIQF 2XB0X 2A69F 2ISZA 1FJLA 1PVEA 1E0EA 5ERIA 3OY9A 2CW8A 3KLOA 2XSJC 1H8AC 3CTAA 1X1CA 5IPAA 2QUFA 1X4PA 2ID3A 2DT5A 5EEAA 2OU2A 2UWMA 3TBIA 4QLCU 4BQAA 2BXYA 5J8FA 4IHYA 3BY6A 1PDNC 3PJRA 3A01A 2L02A 4X0GA 2HOTA 2LKPA 4U0YA 5CQEA 2D5VA 2DQLA 4A0YA 5LHGA 4E7SA 3T0YA 3TQNA 1ZRCA 2QQ8A 1KA8A 2YU9J 2A3SA 5DV5A 1EH8A 3GZ5A 3QPTA 4KT6A 1WCMJ 1A5JA 4WCGA 3DU6A 5J1UA 5C4XJ 4IEJA 3EETA 2VQGA 2XHKA 5GTIC 5F1JA 2V1DA 2MABA 2CV0A 5EGOB 4EGZA 2E7WA 1LEAA 2E36A 3HM5A 4UUVA 5GTHC 1W0TA 2E7XA 3CC7I 1X19A 2LY9A 3OYKA 3VB2A 3K70C 1USSA 3PNYA 2R7RA 5TRDA 1FY7A 3OS0A 5LHHA 1YI2I 2NNNA 4D0PA 2QGUA 2K9QA 3KEQA 2E2JJ 2XIGA 4MEYF 3BTIA 3D5LA 1QHGA 3CMMA 3TO6A 4QWQA 3CJRB 4E7ZA 5D4RA 3RYRA 2JPBA 2W48A 2VQLA 5JVGF 2H27A 3VWBA 3HG9A 1T95A 1V5FA 5GADJ 2YU3A 1WJEA 3NEUA 3KCCA 1ZGJA 3EPZA 4IRIA 2O5RA 2R7UA 3ZCOA 1R1TA 5LFAA 3OIPA 5LGUA 3COAC 1IUYA 2VKVA 3GYHX 2ZMEA 4LLNA 2E1NA 4GRIA 3AL0C 2GXBA 2CH0A 2Y0MA 1Y1VJ 3E6BA 2HQ5A 2QSGX 2RGVA 4ZDPA 2DQRA 3T5XA 2DODA 2QKLB 5BQTA 3QODA 5ILVA 4P55A 5FLXZ 4N4NB 2FD5A 1D0ZA 1UCRA 3TOBA 3CO7C 1QPIA 1OR7C 4C30A 5GPCA 2E19A 4XLAA 2JRMA 3H3UA 4AIHA 4NC6A 1U0JA 2R7OA 4FQGA 2CQXA 2ZJ2A 3OS1A 4XOPA 4TV7A 2JSCA 3E3VA 3PUFA 4HPQA 3TW6A 2V4JC 5B66C 2BY1A 5HS8A 2DMPA 2FEZA 5L3FA 4L0ZB 2TCTA 4Q47A 3MZ8A 1SMTA 5CVVA 2CS3A 1B72B 3WE3A 1YO5C 3I64A 1RRJA 1LFPA 4NHJA 3MCZA 1G3WA 2ELKA 1D1BA 3JREA 1XD7A 3ZR8X 1Y0NA 4S0HB 1RIOH 2HKXA 3CDLA 2H6BA 4P1WA 2NVXJ 1D5VA 4ZH4F 3L2WA 3GX4X 4KIFA 3LSJA 1ZG3A 4BJTA 2O8KA 2PN6A 2CYYA 3BR5A 5ILUA 2K9NA 4ETSA 2XF5A 2JA5J 2FX0A 3QYEA 4B3XA 2CV2A 1I5ZA 1N78A 1VQKI 1RUOA 1TLHB 2RQQA 1U5TC 3DBLB 3GFIA 9ANTA 1U78A 2WAQN 4A3FJ 1ZG1A 3BG7A 3DFGA 3LNQA 4PFOA 3WTZA 3JAMZ 3E5QA 1LQ1A 5HDNA 2A5YB 4PSWA 3HRMA 3L09A 4HV6A 4AM3A 3IH3A 1K78B 1SEUA 3KYDB 4A5MA 2WAQA 4B8XA 4A5NA 2JT1A 4L5EA 2K40A 3CDHA 3V7RA 2M8GX 3ZQGA 2PFBA 4UUSA 1YE9A 1BBYA 3R0AA 1MNEA 2MH9A 2NVYJ 2XROA 5M5YJ 5K1YA 1QHHD 2QQ9A 2ESHA 1IN8A 2VXZA 1IRZA 4EM2A 2M0CA 3K10A 3MFKA 2HYJA 3WU1B 3HOYJ 3PUBA 1V3FA 1S3JA 2PMHA 3DWLE 3PO3J 4CSWA 2OJED 5IT3A 3K4JA 2P6SA 5ICGA 2KP6A 4H0EA 2R7FA 1ZKGA 2V79A 4DYQA 2HXOA 1T8IA 2BY0A 4OU0A 1I1GA 2Y31A 3JSOA 2DOEA 2I8DA 3IH2A 3OYJA 1MNDA 1MMNA 4BXFA 4G6QA 3Q5FA 2ME0A 1JJ8C 3BR0A 5FD5A 5TISC 1BI3A 2IGKA 1CQTA 3EUHA 4A69C 1DDNA 1QU3A 4UNOA 2C6YA 2GQQA 3CF2A 4CH7A 1ONVA 3LOCA 1R5ID 2GWRA 3FX3A 4W97A 3S93A 3WTSC 3TDUC 1SFOJ 1H9TA 3PFYA 3I0TA 1MIJA 2HDCA 4KN7X 4GO1A 3RTRA 4F3QA 4M9XA 2XF7A 3FXLA 3SEZA 2FXAA 4KITB 2X6YA 1LFUP 1T33A 3MAJA 2X4HA 3V7CA 3LSTA 1JKQC 4N9HA 3LSPA 3CC2I 1R22A 2CUEA 1YJWI 3FXQA 1X58A 3RQIA 1KYZA 3TP3A 3CCMI 4WXDA 2CWEA 3ESWB 4YIRX 2O03A 1X3ZB 1VQNI 4XMYA 1A6QA 1APLC 2CO5A 2RAEA 4Y3OA 2UUZA 3VYSB 1UHWA 2NXNB 2ECCA 3GMEA 4M6VA 2EFWA 2JJ7A 4ZYHA 3GZ6A 1PUFA 1XDSA 3K1NA 2HVSA 3QPHA 1PYVA 3DLLF 3FISA 2KIFA 1Y6IA 2R5YB 1SVOA 3HSEA 2BVLA 5LEKA 1IN4A 3GFJA 5BNGA 4KUMA 1MH4A 2ADUA 2W00A 4M71A 5J6XA 1UB9A 4MNUA 4DNCA 1HDPA 1MMDA 3ZRGA 4BHPA 1JKPC 2BW3B 1F36A 1BM9A 1AWCA 1IDYA 5J47A 2QA4I 2MD5A 2WV1A 2HQNA 1SMYF 4RA2A 4Z6YA 2RQPA 1MSFC 1DPRA 3QPLA 2Y2ZA 4CICA 1D8KA 1ZR4A 2W1OA 2K9LA 2RKHA 5D6EA 1WHUA 2ZMEC 2AS5F 5FGMA 2PJRA 3ABUA 3GCMA 1RKTA 2FSWA 1S9HA 2R7SA 3H5NA 2V9PA 4ZJZA 1NK2P 1VQ8I 2E1MC 2AQEA 2HZTA 1LE8B 4I0AA 1V55H 4XLNF 3H9JA 3RI4A 3HDDA 2VODA 3HIFA 1HA8A 1WI9A 4AIDA 2XF6A 1D0YA 1PP7U 4EJTA 1JGGA 3OYAA 5HDKA 3LSHA 4E7HA 2CFXA 1XSVA 2MW8A 3HTUA 4M74A 4DIQA 1RC9A 1U5TB 4A6EA 2FMLA 3V8LA 1U2WA 2AO9A 1LFBA 1M1EB 4Y15A 5B5EC 4EEFG 4CO8A 4IF4A 4UXNA 3P9KA 5L3BA 2ELJA 2NRAC 4YIFA 2EWNA 4UV9A 1HDDC 1A04A 1BA5A 3BR6A 5HVQC 5L3DA 1D3YA 1XSDA 2DA6A 2DPDA 5M5XJ 1D0XA 3ASNH 2K7LA 3KYCB 2H94A 3GWZA 4HW0A 4I98B 4XSZF 1XTAA 2R5ZB 5FLXK 3HUGB 1GVJA 3ZN0A 4HYEA 4U87A 1SAXA 3SFZA 3OYEA 5F0HA 2ACJA 2CW0F 2DA1A 3E97A 3FZVA 3OIQA 5AIQA 4BY1J 5E17F 2ZCWA 5H20A 1VQPI 3DEUA 1I6XA 1UELB 2DA5A 3KP5A 1E17A 2LP0A
chains in the Genus database with same CATH topology
4I01A 2DI3A 3OV8A 3KP2A 1YW8A 2YPRA 1KU3A 4WXCA 2HKOA 4GGGA 5BPIA 4HX7A 2KJBA 1T2KA 5CVUA 1TNSA 3LA7A 1KYWA 4M9ZA 3D0SA 5TJJA 1SD4A 3RKXA 4U0VA 3F8NA 1ZN2A 3JTGA 2ESNA 3LQQA 1PUEE 1O3QA 3WTVC 3JTHA 2D2WA 3F8FA 4HDVA 1PP8F 5HDGA 1JHHA 1LDDA 2P5LC 2FA5A 4NQWA 1YIOA 2Q0OA 1WRJA 4HF0A 5EEHA 4AWXB 1MD0A 1Z91A 4ON0A 3DPTA 3M8EA 4RS8A 5IT9K 1G4DA 1BIAA 2WC2A 4RGUA 2VBZA 4N9IA 2L3DA 2IP2A 1TTYA 2OZUA 1FWZA 1FLIA 1G3SA 1Y0UA 2RNJA 1FP1D 3IKVA 4I7HA 2EA2A 3HOTA 2MBFA 3R61A 3KFWX 5FFZA 1ZHFA 4IVNA 3EYIA 3ECHA 1TBXA 2QENA 3DKWA 3O2PE 4LG0A 1KGSA 1S7OA 2FNPA 1ON2A 2D1HA 1RZ4A 1P92A 3B73A 5E8GA 2ETHA 1DP7P 5HLGA 2EJRA 3RIRA 2YX7A 1YLFA 3GVAA 5F1RA 4G8XA 1XCVA 5D5VB 1E2XA 1S8NA 5HLHA 5ICCA 3J7AO 4LMYA 2W25A 1AOYA 2K4JA 1R5GA 1BIBA 3L2CA 4LFUA 5EEGA 3JW4A 2YR2A 5LLQA 1OYIA 2QQBA 4LGWA 3S2WA 2DPUA 4F7ZA 2FBIA 1O7LA 5K5RA 3ROUA 2V1UA 4UVBA 3M8FA 2HEOA 2HWVA 2O8XA 2Z3YA 3EDPA 4P9FA 1QPMA 4IPAA 4UHTA 2BYVE 5LRRA 2HTJA 4KDPA 1HKTA 3I54A 2AXLA 4JQFA 3TO9A 2F5CA 3BJOA 2ZFWA 3BPXA 4N0BA 1ZAOA 1J5YA 2BE5F 1JGSA 5D5UB 1ZYRF 3ZMVA 1J0RA 3RDIA 2HTSA 3CUQA 4KN4X 1U8RA 2OD5A 4U0WA 1FZPB 2HQRA 2NAZA 1YYVA 3FWEA 1P4XA 1TW3A 3F8MA 4PCQA 2BEOA 3J80Z 2M87A 2XVCA 1YW7A 3N4MA 2GIVA 1H9GA 5FFXA 2K86A 1FSHA 1FYLA 4OIPF 1OPCA 4CGZA 1MJBA 1OYYA 2P4WA 2VC1A 3GLXA 3F21A 5HS9A 3GFLA 4HQEA 1LB2A 5E1WA 4U7BA 3C18A 4G9YA 1ODDA 4L9VA 4HZFA 1QO0D 1K7AA 1KU7A 1QZZA 3O6BB 4RAZA 5HS7A 3J81Z 2XV4S 1G6NA 4P9UA 2W24A 2RV8A 2FBHA 4PGHA 1RI7A 1B1BA 3CO6C 4HDUA 4EJUA 4Q48A 4YFKF 3F8CA 3FXUA 3DQVC 2JRTA 4A0XA 2J5PA 2CG4A 5BMZA 4BHBA 2XRNA 5HOOA 4ENNA 4BNCA 1JHFA 2GA1A 3F22A 5LHIA 2MH2A 1TQMA 1YS7A 1T6SA 1ZG5A 2LSOA 1BJAA 1XN7A 3HRUA 4EM1A 2DK8A 1STZA 5HLIA 5LGNA 2XAGA 1BC7C 2Y75A 2GA2A 1OKRA 5AIPA 2Y48A 3TKYA 3SXYA 3H92A 5CVIA 3KZYA 1Z6RA 2RDPA 2BGCA 3VEPA 2L01A 3RKWA 1FP2A 2Z5UA 1P4WA 3I71A 4LB6B 2LNBA 4EMSA 5L3EA 2M30A 1FC3A 2Z99A 4KICA 5JHUA 2BBYA 2ZO4A 2PMUA 1SD5A 3ZMSA 1YFHA 2H6CA 4O3MA 2IVMA 4Y13A 4CZZA 5E1XA 4ENKA 3R0JA 3CUQC 2PEXA 3G3ZA 3IWFA 4M72A 3MEXA 5AONA 1YTYA 3U9GA 1ZGAA 2KIUA 3CLOA 3I4PA 4HBLA 4IHTA 1IXCA 2MA3A 2GAUA 5A2QK 3TGNA 2QBYB 2LF7A 4MGRA 4FT8A 4BYYA 4HF1A 4EQQA 2MLGA 2RC4A 2JPCA 2PG4A 3BDDA 1L0OC 4HX8A 1FBUA 5J8CA 3ML6A 4MTEA 4RB3C 2ISYA 2LF8A 1XGMA 1YQAA 3V8JA 3BROA 2A6EF 4G7OF 2YSRA 1BI2A 2FBKA 3GO5A 1H0MA 3ZMZA 5DUIA 4LG0B 3I5UA 4MQ9F 5JVTA 3REOA 4MQVA 5ICEA 3LFKA 3PQJA 5ED4A 5DUKA 3WU0A 5CYVA 4OINF 3KP3A 3I59B 3VOEA 2P6TA 2K02A 3FMQA 2IA0A 2NNYA 3K1PA 3R4KA 1LEBA 1VTNC 1KQ8A 3RKYA 1O57A 5D8LB 4ZZDA 5L3GA 1HSTA 1R00A 2QZ8A 4UV8A 4LB5A 3F6OA 5E1ZB 3RPQA 3K1MA 5ILSA 4ENJA 2OQRA 3IL2A 3FF5A 4XLPF 2CSOA 4UVCA 4UVAA 3QP5A 1IW7F 2PQ8A 2PLYA 3LAPA 3GF2A 1MJAA 2KJCA 1USTA 3TO7A 4ASNA 3KETA 2FE3A 2CGPA 2XAFA 3CUQB 3U1DA 2EFNA 3WTWC 2ZXJA 3KEOA 1S6LA 2L4AA 4U88A 3WGIA 2CQKA 2M1BA 2D45A 3CUOA 2A6HF 5BPDA 1NHAA 1RUNA 2EK5A 4HLXA 3LAJA 4CXFA 2STWA 3QAHA 1B59A 3ZN1A 5FD6A 4JBAA 4EV0A 3TOAA 3R6SA 2RN7A 1QBJA 4OIRF 1BN5A 3JAMK 1WWXA 1MZBA 4HAMA 4KMFA 1W7PD 5K5OA 4WF2A 2DW4A 3AAFA 1J75A 1I1SA 2UXNA 1ZH5A 1B9NA 1ULYA 3FXRA 4YIIA 2FMYA 1HSJA 1XGOA 2O6GE 3ISPA 1Z05A 3Q9SA 2DFIA 1B9MA 2P8TA 5E18F 3B02A 4Z2YA 5CJ9A 3MWMA 2F5EA 3VODA 3ZMTA 2QBYA 2VE8A 4FX0A 3HTSB 4EJOA 1WKMA 3BP8A 1TQIA 2W85A 3WGHA 2V9VA 3SQNA 4PGGA 4HOBA 1UFMA 2DU9A 2XUBA 2XKPA 4OIOF 2EV0A 1D8JA 4IRGA 4BHCA 1B4AA 3K2ZA 1IF1A 2PJPA 2EFOA 1LDKB 2VBYA 3BJAA 1QGPA 1IRFA 1MDMB 2STTA 1GXQA 2Z33A 3DPLC 2O0YA 3H3ZA 6PAXA 3BOQA 3C1DA 4IRHA 2FF4A 2L54A 2ZNYA 2P7CB 1SD7A 1TW2A 1BC8C 4OMYA 1HQCA 1K79A 1XGSA 5CVJA 3K0LA 2EFPA 1QZYA 1FYMA 1REPC 1R1VA 1Z6TA 2EA4A 1TNTA 3I59A 4GYIA 4L9NA 1JE8A 2HGCA 2EV5A 2KRFA 2COMA 2VOOA 3FM3A 3L00A 4OMZA 4ESFA 4IJAA 4G7HF 1DPUA 4G7ZF 2EFQA 5L3CA 1G3TA 1XDUA 4GCVA 4HLYA 4YFXF 4JK1X 4MHGA 3PQKA 3ZMDA 4LD5A 4L5IA 4WWCA 2P7VB 3SHFA 5DD4A 3RJPA 4L0YB 2F2EA 4ESBA 4HA8A 1U6GA 5DCMB 1LVAA 5JFRA 3L9FA 2F5FA 4RGSA 3GFMA 1J9IA 4FHTA 5LBQA 5JI6A 4L9TA 3P9IA 2G7UA 2OZ6A 3ABTA 2YX4A 3M9AA 3E5UA 1IRGA 4ZYGA 2FOKA 1F1ZA 4LLLA 3IRRA 4KMUX 4AIKA 3F23A 4I2OA 1LNWA 1U3EM 3GW2A 3ZQ7A 2O61A 5DYMA 1RNLA 2IW5A 1WQ2A 3T8RA 4LJZF 1B6AA 1GXPA 4WXHA 2A68F 3IWZA 4PZJA 1HBXG 1IAWA 4R79A 4KFCA 4A6DA 4ZYEA 5D5XB 2E1CA 2M45A 2LDUA 3HHHA 2R3SA 1V4RA 2NYXA 4RB1A 4KYWA 1IZ1A 1J7KA 4A12A 1BOAA 2DTRA 4WK8F 3WTUC 4RB0A 4B09A 3NRVA 3OOPA 1QNTA 3G73A 3WG9A 4P96A 4L5JA 5CVRA 5D8KB 2DO7A 3QOPA 1IN6A 3RYPA 1O3RA 3C3WA 3QU3A 3MZHA 2DAOA 3HSFA 2VC0A 3P9CA 3FMSA 1QQIA 2XAJA 2B0LA 2FNAA 4L18B 1FSEA 2QYOA 1HW1A 1O7FA 3IRQA 1MDMA 4E70A 1MKMA 2X0LA 4Q5SF 3BPVA 3W6KB 2P5VA 1IN5A 2VBXA 2QWWA 2HYFA 2WV0A 3T1BA 1F9NA 2VONA 4A2UA 2MC3A 4XRFA 1SFXA 5F6FA 3HRTA 1F5TA 1W5SA 4AVPA 2M8EA 5FB2A 2GXGA 2ZNZA 1O3SA 1EH7A 4IHSA 4AIJA 2VOPA 1ZLKA 3R60A 3VFZA 2OAZA 1DUXC 3N97A 3IKTA 1O3TA 5D5WB 3WTYC 4GXOA 2IJLA 1R36A 3E6DA 4HX4A 1OYWA 2QVOA 1Z9CA 1FT9A 5H6QA 3L7WA 4I0BA 3K9TA 4P5OA 4RGRA 4HV5A 4I02A 4YFNF 1R1UA 3HOSA 5DCMA 1SFEA 4RAYA 2EV6A 3KP4A 4BXUA 2RVCA 1BI0A 1L3LA 2QQAA 2O3FA 1WSUA 1YW9A 2F5DA 4YG2F 2FU4A 5IT9Z 1EV7A 4MTDA 5DCFA 4WX9A 4CYDA 4L9JA 3J80K 2G9WA 1OMIA 4RB2C 5LEJA 3M1EA 1GHCA 1P6RA 3DF8A 5JR3A 3WE2A 3F8BA 4R8HA 4EVIA 1XB4A 5E8IA 2JTVA 2IPQX 2ELHA 3FM5A 3LQRA 4S04A 2UXXA 4M6YA 1KQ9A 3MQ0A 3BJ6A 4G94A 4ENMA 3DP7A 1R7JA 4M73A 1R58A 2WWYA 2QLZA 2HOEA 2M5WA 1XSXA 3ZP5A 4FX4A 3E5XA 1TQPA 2DLLA 1T98A 3J81K 2MLKA 3GEZA 1FNNA 4XBFA 2VT3A 4EJVA 3JSPA 2XAHA 2R7DA 1Z7UA 4U7DA 5F64A 1HW2A 1ZLJA 3M7GA 3K69A 3QU6A 2J5OA 2EB7A 4AD9A 3MZYA 5DD8A 2G7HA 4EJWA 3LA2A 2HR3A 2IA2A 3LWFA 1W5TA 2JZYA 3P7NA 1BI1A 4LK0F 2KKOA 2XKOA 3E6CC 2HFHA 1CF7B 4KNYA 4KIBA 3IHUA 3ERED 1W7PB 4K2EA 1EH6A 3TDZC 3C7JA 1YS6A 1F4KA 5CLSA 1KU9A 1T0FA 2ZBKA 4EGYA 2DK5A 1C0WA 1XMKA 4DQ2A 5D4SA 1YG2A 3SZTA 4EM0B 3LA3A 3SZPA 1KQ0A 2V6CA 5LRSA 1JXSA 1Z1DA 2TDXA 2PBIA 3ZMUA 5DEQA 3DXJF 1ZRDA 3ULQB 1FBQA 1MGTA 1KU2A 1FYKA 2XAQA 2BV6A 3F72A 4G6DA 2L4MA 1XCBA 2HS5A 1S29A 2DBBA 2HYGD 2P5KA 4CDGA 1ZARA 4M6XA 1SFUA 4M9SA 1CGPA 4Q4ZF 1LDJA 5H6RA 1ZRFA 3EQLF 4MEXF 1K78A 1XMAA 1FBSA 2XASA 1J2XA 3V4GA 1LJ9A 3WGGA 3V7SA 1HKSA 5LGTA 1ZREA 3GXOA 4KA4A 4IXAA 3WTXC 1IXSB 2OA4A 4CHUA 1J59A 5E20A 3Q9VA 5BOXA 3KE2A 4KT5C 3WTTC 5K5QA 3HSRA 4HQMA 4I09A 2H09A 5BS6A 2W84A 1FOKA 2K27A 2FRHA 3DV8A 4RGXA 1SD6A 2ZMEB 3BZ6A 3U2RA 2A61A 3E6MA 3O3KA 5ICFA 2QM3A 1R23A 3HYIA 4BH9A 2WTEA 3T8TA 2IRFG 2VT2A 5D6FA 2ZKZA 3I58A 2IA1A 2NS0A 4OOIA 1FX7A 1W4MA 1HW5A 4LLGF 3IC7A 5DDGA 2K4BA 4Y17A 3CJNA 3QP6A 4LK1F 3HRSA 2PI0A 3ZPLA 3EYYA 1T38A 4R1HA 3WODF 2GZWA 1OR7A 4XSXF 3W6JB 4PDKA 2W57A 4O5VA 3FHZA 1T39A 1MJ9A 1IN7A 3KLNA 5KK1A 1XGNA 3V8KA 2Q8KA 1HXDA 3I53A 4GYGA 3FMRA 3GUDA 1ON1A 1G3YA 1HKQA 3KP7A 2VN2A 1S7AA 2XGXA 2A07F 4ZZLA 1FPQA 4O6JA 2VE9A 4NB5A 3ELKA 3NQOA 3RPUA 2Q2EA 1R5HA 2VBWA 1U5TA 1CF7A 2IT0A 1P4AA 4ZYDA 2OQGA 1W7PA 3BWGA 3F3XA 5A2QZ 2V1XA 1P2FA 4KIGA 2Z9OA 3F6VA 4HF2A 2UZKA 1IXRC 5KVRA 3PFIA 3HUGA 1UHMA 4ESJA 5FO5A 3KZZA 3KP6A 2FQ3A 3ECOA 1I27A 4BAYA 3QRFF 2D1VA 2OBPA 2KIMA 1K6OA 1X3UA 1Q1HA 4A0ZA 3HHGA 4S05A 4OIQF 2A69F 2ISZA 5ERIA 3KLOA 3CTAA 2QUFA 2DT5A 2OU2A 2UWMA 4QLCU 4BQAA 5J8FA 3BY6A 1PDNC 2L02A 2LKPA 4U0YA 2DQLA 4A0YA 5LHGA 3T0YA 3TQNA 1ZRCA 1KA8A 2A3SA 5DV5A 1EH8A 3GZ5A 3QPTA 4WCGA 3EETA 2XHKA 2V1DA 4EGZA 2E7WA 1LEAA 4UUVA 2E7XA 3VB2A 1USSA 5TRDA 1FY7A 5LHHA 2NNNA 4D0PA 3KEQA 2XIGA 4MEYF 3D5LA 3TO6A 4QWQA 5D4RA 3RYRA 2JPBA 2H27A 2YU3A 3NEUA 3KCCA 1ZGJA 4IRIA 1R1TA 5LGUA 3COAC 1IUYA 3GYHX 2ZMEA 4LLNA 2E1NA 2GXBA 2Y0MA 3E6BA 2RGVA 2DQRA 3T5XA 5BQTA 5ILVA 4P55A 5FLXZ 1UCRA 3TOBA 3CO7C 3H3UA 4AIHA 2ZJ2A 4TV7A 2JSCA 3E3VA 5HS8A 2FEZA 5L3FA 4L0ZB 4Q47A 5CVVA 1SMTA 3WE3A 1YO5C 3I64A 4NHJA 3MCZA 1G3WA 1XD7A 1RIOH 2HKXA 2H6BA 1D5VA 4ZH4F 3GX4X 4KIFA 1ZG3A 2PN6A 2CYYA 5ILUA 4ETSA 1I5ZA 1RUOA 1TLHB 1U5TC 3GFIA 1U78A 1ZG1A 3DFGA 3WTZA 3JAMZ 3E5QA 1LQ1A 5HDNA 2A5YB 3HRMA 3L09A 4HV6A 1K78B 4A5MA 4B8XA 4A5NA 2JT1A 3CDHA 3V7RA 2PFBA 3R0AA 1BBYA 2MH9A 2XROA 5K1YA 2QQ9A 2ESHA 1IN8A 2VXZA 4EM2A 3MFKA 3WU1B 1V3FA 1S3JA 2PMHA 5IT3A 2P6SA 5ICGA 4H0EA 2R7FA 2V79A 4OU0A 1I1GA 3JSOA 4G6QA 3Q5FA 5FD5A 1BI3A 3EUHA 1DDNA 4UNOA 2C6YA 2GQQA 1ONVA 2GWRA 3FX3A 3WTSC 3TDUC 1H9TA 3I0TA 2HDCA 4KN7X 4GO1A 3RTRA 4M9XA 2FXAA 3MAJA 2X4HA 3V7CA 3LSTA 4N9HA 1R22A 3FXQA 1KYZA 4WXDA 2CWEA 2O03A 2CO5A 1UHWA 2EFWA 4ZYHA 3GZ6A 1XDSA 3K1NA 3QPHA 2KIFA 3HSEA 5LEKA 1IN4A 3GFJA 4KUMA 2ADUA 4M71A 5J6XA 1UB9A 4MNUA 4DNCA 4BHPA 1AWCA 1BM9A 2MD5A 2HQNA 1SMYF 2RQPA 1DPRA 4CICA 1D8KA 5D6EA 2RKHA 2AS5F 5FGMA 3ABUA 2FSWA 2HZTA 4I0AA 4XLNF 3RI4A 2VODA 3HIFA 1WI9A 1PP7U 4EJTA 5HDKA 2CFXA 1XSVA 3HTUA 4M74A 1U5TB 4A6EA 2FMLA 3V8LA 1U2WA 4Y15A 4CO8A 4IF4A 4UXNA 3P9KA 5L3BA 2NRAC 4YIFA 2EWNA 4UV9A 1A04A 5HVQC 5L3DA 1D3YA 1XSDA 2DPDA 2K7LA 2H94A 3GWZA 4HW0A 4I98B 4XSZF 5FLXK 1GVJA 3ZN0A 4HYEA 1SAXA 3SFZA 2ACJA 2CW0F 3E97A 5AIQA 3FZVA 5E17F 2ZCWA 5H20A 3DEUA 1I6XA 3KP5A 1E17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I01 A;  2DI3 A;  3OV8 A;  3KP2 A;  1YW8 A;  2YPR A;  1KU3 A;  4WXC A;  2HKO A;  4GGG A;  5BPI A;  4HX7 A;  2KJB A;  1T2K A;  5CVU A;  1TNS A;  3LA7 A;  1KYW A;  4M9Z A;  3D0S A;  5TJJ A;  1SD4 A;  3RKX A;  4U0V A;  3F8N A;  1ZN2 A;  3JTG A;  2ESN A;  3LQQ A;  1PUE E;  1O3Q A;  3WTV C;  3JTH A;  2D2W A;  3F8F A;  4HDV A;  1PP8 F;  5HDG A;  1JHH A;  1LDD A;  2P5L C;  2FA5 A;  4NQW A;  1YIO A;  2Q0O A;  1WRJ A;  4HF0 A;  5EEH A;  4AWX B;  1MD0 A;  1Z91 A;  4ON0 A;  3DPT A;  3M8E A;  4RS8 A;  5IT9 K;  1G4D A;  1BIA A;  2WC2 A;  4RGU A;  2VBZ A;  4N9I A;  2L3D A;  2IP2 A;  1TTY A;  2OZU A;  1FWZ A;  1FLI A;  1G3S A;  1Y0U A;  2RNJ A;  1FP1 D;  3IKV A;  4I7H A;  2EA2 A;  3HOT A;  2MBF A;  3R61 A;  3KFW X;  5FFZ A;  1ZHF A;  4IVN A;  3EYI A;  3ECH A;  1TBX A;  2QEN A;  3DKW A;  3O2P E;  4LG0 A;  1KGS A;  1S7O A;  2FNP A;  1ON2 A;  2D1H A;  1RZ4 A;  1P92 A;  3B73 A;  5E8G A;  2ETH A;  1DP7 P;  5HLG A;  2EJR A;  3RIR A;  2YX7 A;  1YLF A;  3GVA A;  5F1R A;  4G8X A;  1XCV A;  5D5V B;  1E2X A;  1S8N A;  5HLH A;  5ICC A;  3J7A O;  4LMY A;  2W25 A;  1AOY A;  2K4J A;  1R5G A;  1BIB A;  3L2C A;  4LFU A;  5EEG A;  3JW4 A;  2YR2 A;  5LLQ A;  1OYI A;  2QQB A;  4LGW A;  3S2W A;  2DPU A;  4F7Z A;  2FBI A;  1O7L A;  5K5R A;  3ROU A;  2V1U A;  4UVB A;  3M8F A;  2HEO A;  2HWV A;  2O8X A;  2Z3Y A;  3EDP A;  4P9F A;  1QPM A;  4IPA A;  4UHT A;  2BYV E;  5LRR A;  2HTJ A;  4KDP A;  1HKT A;  3I54 A;  2AXL A;  4JQF A;  3TO9 A;  2F5C A;  3BJO A;  2ZFW A;  3BPX A;  4N0B A;  1ZAO A;  1J5Y A;  2BE5 F;  1JGS A;  5D5U B;  1ZYR F;  3ZMV A;  1J0R A;  3RDI A;  2HTS A;  3CUQ A;  4KN4 X;  1U8R A;  2OD5 A;  4U0W A;  1FZP B;  2HQR A;  2NAZ A;  1YYV A;  3FWE A;  1P4X A;  1TW3 A;  3F8M A;  4PCQ A;  2BEO A;  3J80 Z;  2M87 A;  2XVC A;  1YW7 A;  3N4M A;  2GIV A;  1H9G A;  5FFX A;  2K86 A;  1FSH A;  1FYL A;  4OIP F;  1OPC A;  4CGZ A;  1MJB A;  1OYY A;  2P4W A;  2VC1 A;  3GLX A;  3F21 A;  5HS9 A;  3GFL A;  4HQE A;  1LB2 A;  5E1W A;  4U7B A;  3C18 A;  4G9Y A;  1ODD A;  4L9V A;  4HZF A;  1QO0 D;  1K7A A;  1KU7 A;  1QZZ A;  3O6B B;  4RAZ A;  5HS7 A;  3J81 Z;  2XV4 S;  1G6N A;  4P9U A;  2W24 A;  2RV8 A;  2FBH A;  4PGH A;  1RI7 A;  1B1B A;  3CO6 C;  4HDU A;  4EJU A;  4Q48 A;  4YFK F;  3F8C A;  3FXU A;  3DQV C;  2JRT A;  4A0X A;  2J5P A;  2CG4 A;  5BMZ A;  4BHB A;  2XRN A;  5HOO A;  4ENN A;  4BNC A;  1JHF A;  2GA1 A;  3F22 A;  5LHI A;  2MH2 A;  1TQM A;  1YS7 A;  1T6S A;  1ZG5 A;  2LSO A;  1BJA A;  1XN7 A;  3HRU A;  4EM1 A;  2DK8 A;  1STZ A;  5HLI A;  5LGN A;  2XAG A;  1BC7 C;  2Y75 A;  2GA2 A;  1OKR A;  5AIP A;  2Y48 A;  3TKY A;  3SXY A;  3H92 A;  5CVI A;  3KZY A;  1Z6R A;  2RDP A;  2BGC A;  3VEP A;  2L01 A;  3RKW A;  1FP2 A;  2Z5U A;  1P4W A;  3I71 A;  4LB6 B;  2LNB A;  4EMS A;  5L3E A;  2M30 A;  1FC3 A;  2Z99 A;  4KIC A;  5JHU A;  2BBY A;  2ZO4 A;  2PMU A;  1SD5 A;  3ZMS A;  1YFH A;  2H6C A;  4O3M A;  2IVM A;  4Y13 A;  4CZZ A;  5E1X A;  4ENK A;  3R0J A;  3CUQ C;  2PEX A;  3G3Z A;  3IWF A;  4M72 A;  3MEX A;  5AON A;  1YTY A;  3U9G A;  1ZGA A;  2KIU A;  3CLO A;  3I4P A;  4HBL A;  4IHT A;  1IXC A;  2MA3 A;  2GAU A;  5A2Q K;  3TGN A;  2QBY B;  2LF7 A;  4MGR A;  4FT8 A;  4BYY A;  4HF1 A;  4EQQ A;  2MLG A;  2RC4 A;  2JPC A;  2PG4 A;  3BDD A;  1L0O C;  4HX8 A;  1FBU A;  5J8C A;  3ML6 A;  4MTE A;  4RB3 C;  2ISY A;  2LF8 A;  1XGM A;  1YQA A;  3V8J A;  3BRO A;  2A6E F;  4G7O F;  2YSR A;  1BI2 A;  2FBK A;  3GO5 A;  1H0M A;  3ZMZ A;  5DUI A;  4LG0 B;  3I5U A;  4MQ9 F;  5JVT A;  3REO A;  4MQV A;  5ICE A;  3LFK A;  3PQJ A;  5ED4 A;  5DUK A;  3WU0 A;  5CYV A;  4OIN F;  3KP3 A;  3I59 B;  3VOE A;  2P6T A;  2K02 A;  3FMQ A;  2IA0 A;  2NNY A;  3K1P A;  3R4K A;  1LEB A;  1VTN C;  1KQ8 A;  3RKY A;  1O57 A;  5D8L B;  4ZZD A;  5L3G A;  1HST A;  1R00 A;  2QZ8 A;  4UV8 A;  4LB5 A;  3F6O A;  5E1Z B;  3RPQ A;  3K1M A;  5ILS A;  4ENJ A;  2OQR A;  3IL2 A;  3FF5 A;  4XLP F;  2CSO A;  4UVC A;  4UVA A;  3QP5 A;  1IW7 F;  2PQ8 A;  2PLY A;  3LAP A;  3GF2 A;  1MJA A;  2KJC A;  1UST A;  3TO7 A;  4ASN A;  3KET A;  2FE3 A;  2CGP A;  2XAF A;  3CUQ B;  3U1D A;  2EFN A;  3WTW C;  2ZXJ A;  3KEO A;  1S6L A;  2L4A A;  4U88 A;  3WGI A;  2CQK A;  2M1B A;  2D45 A;  3CUO A;  2A6H F;  5BPD A;  1NHA A;  1RUN A;  2EK5 A;  4HLX A;  3LAJ A;  4CXF A;  2STW A;  3QAH A;  1B59 A;  3ZN1 A;  5FD6 A;  4JBA A;  4EV0 A;  3TOA A;  3R6S A;  2RN7 A;  1QBJ A;  4OIR F;  1BN5 A;  3JAM K;  1WWX A;  1MZB A;  4HAM A;  4KMF A;  1W7P D;  5K5O A;  4WF2 A;  2DW4 A;  3AAF A;  1J75 A;  1I1S A;  2UXN A;  1ZH5 A;  1B9N A;  1ULY A;  3FXR A;  4YII A;  2FMY A;  1HSJ A;  1XGO A;  2O6G E;  3ISP A;  1Z05 A;  3Q9S A;  2DFI A;  1B9M A;  2P8T A;  5E18 F;  3B02 A;  4Z2Y A;  5CJ9 A;  3MWM A;  2F5E A;  3VOD A;  3ZMT A;  2QBY A;  2VE8 A;  4FX0 A;  3HTS B;  4EJO A;  1WKM A;  3BP8 A;  1TQI A;  2W85 A;  3WGH A;  2V9V A;  3SQN A;  4PGG A;  4HOB A;  1UFM A;  2DU9 A;  2XUB A;  2XKP A;  4OIO F;  2EV0 A;  1D8J A;  4IRG A;  4BHC A;  1B4A A;  3K2Z A;  1IF1 A;  2PJP A;  2EFO A;  1LDK B;  2VBY A;  3BJA A;  1QGP A;  1IRF A;  1MDM B;  2STT A;  1GXQ A;  2Z33 A;  3DPL C;  2O0Y A;  3H3Z A;  6PAX A;  3BOQ A;  3C1D A;  4IRH A;  2FF4 A;  2L54 A;  2ZNY A;  2P7C B;  1SD7 A;  1TW2 A;  1BC8 C;  4OMY A;  1HQC A;  1K79 A;  1XGS A;  5CVJ A;  3K0L A;  2EFP A;  1QZY A;  1FYM A;  1REP C;  1R1V A;  1Z6T A;  2EA4 A;  1TNT A;  3I59 A;  4GYI A;  4L9N A;  1JE8 A;  2HGC A;  2EV5 A;  2KRF A;  2COM A;  2VOO A;  3FM3 A;  3L00 A;  4OMZ A;  4ESF A;  4IJA A;  4G7H F;  1DPU A;  4G7Z F;  2EFQ A;  5L3C A;  1G3T A;  1XDU A;  4GCV A;  4HLY A;  4YFX F;  4JK1 X;  4MHG A;  3PQK A;  3ZMD A;  4LD5 A;  4L5I A;  4WWC A;  2P7V B;  3SHF A;  5DD4 A;  3RJP A;  4L0Y B;  2F2E A;  4ESB A;  4HA8 A;  1U6G A;  5DCM B;  1LVA A;  5JFR A;  3L9F A;  2F5F A;  4RGS A;  3GFM A;  1J9I A;  4FHT A;  5LBQ A;  5JI6 A;  4L9T A;  3P9I A;  2G7U A;  2OZ6 A;  3ABT A;  2YX4 A;  3M9A A;  3E5U A;  1IRG A;  4ZYG A;  2FOK A;  1F1Z A;  4LLL A;  3IRR A;  4KMU X;  4AIK A;  3F23 A;  4I2O A;  1LNW A;  1U3E M;  3GW2 A;  3ZQ7 A;  2O61 A;  5DYM A;  1RNL A;  2IW5 A;  1WQ2 A;  3T8R A;  4LJZ F;  1B6A A;  1GXP A;  4WXH A;  2A68 F;  3IWZ A;  4PZJ A;  1HBX G;  1IAW A;  4R79 A;  4KFC A;  4A6D A;  4ZYE A;  5D5X B;  2E1C A;  2M45 A;  2LDU A;  3HHH A;  2R3S A;  1V4R A;  2NYX A;  4RB1 A;  4KYW A;  1IZ1 A;  1J7K A;  4A12 A;  1BOA A;  2DTR A;  4WK8 F;  3WTU C;  4RB0 A;  4B09 A;  3NRV A;  3OOP A;  1QNT A;  3G73 A;  3WG9 A;  4P96 A;  4L5J A;  5CVR A;  5D8K B;  2DO7 A;  3QOP A;  1IN6 A;  3RYP A;  1O3R A;  3C3W A;  3QU3 A;  3MZH A;  2DAO A;  3HSF A;  2VC0 A;  3P9C A;  3FMS A;  1QQI A;  2XAJ A;  2B0L A;  2FNA A;  4L18 B;  1FSE A;  2QYO A;  1HW1 A;  1O7F A;  3IRQ A;  1MDM A;  4E70 A;  1MKM A;  2X0L A;  4Q5S F;  3BPV A;  3W6K B;  2P5V A;  1IN5 A;  2VBX A;  2QWW A;  2HYF A;  2WV0 A;  3T1B A;  1F9N A;  2VON A;  4A2U A;  2MC3 A;  4XRF A;  1SFX A;  5F6F A;  3HRT A;  1F5T A;  1W5S A;  4AVP A;  2M8E A;  5FB2 A;  2GXG A;  2ZNZ A;  1O3S A;  1EH7 A;  4IHS A;  4AIJ A;  2VOP A;  1ZLK A;  3R60 A;  3VFZ A;  2OAZ A;  1DUX C;  3N97 A;  3IKT A;  1O3T A;  5D5W B;  3WTY C;  4GXO A;  2IJL A;  1R36 A;  3E6D A;  4HX4 A;  1OYW A;  2QVO A;  1Z9C A;  1FT9 A;  5H6Q A;  3L7W A;  4I0B A;  3K9T A;  4P5O A;  4RGR A;  4HV5 A;  4I02 A;  4YFN F;  1R1U A;  3HOS A;  5DCM A;  1SFE A;  4RAY A;  2EV6 A;  3KP4 A;  4BXU A;  2RVC A;  1BI0 A;  1L3L A;  2QQA A;  2O3F A;  1WSU A;  1YW9 A;  2F5D A;  4YG2 F;  2FU4 A;  5IT9 Z;  1EV7 A;  4MTD A;  5DCF A;  4WX9 A;  4CYD A;  4L9J A;  3J80 K;  2G9W A;  1OMI A;  4RB2 C;  5LEJ A;  3M1E A;  1GHC A;  1P6R A;  3DF8 A;  5JR3 A;  3WE2 A;  3F8B A;  4R8H A;  4EVI A;  1XB4 A;  5E8I A;  2JTV A;  2IPQ X;  2ELH A;  3FM5 A;  3LQR A;  4S04 A;  2UXX A;  4M6Y A;  1KQ9 A;  3MQ0 A;  3BJ6 A;  4G94 A;  4ENM A;  3DP7 A;  1R7J A;  4M73 A;  1R58 A;  2WWY A;  2QLZ A;  2HOE A;  2M5W A;  1XSX A;  3ZP5 A;  4FX4 A;  3E5X A;  1TQP A;  2DLL A;  1T98 A;  3J81 K;  2MLK A;  3GEZ A;  1FNN A;  4XBF A;  2VT3 A;  4EJV A;  3JSP A;  2XAH A;  2R7D A;  1Z7U A;  4U7D A;  5F64 A;  1HW2 A;  1ZLJ A;  3M7G A;  3K69 A;  3QU6 A;  2J5O A;  2EB7 A;  4AD9 A;  3MZY A;  5DD8 A;  2G7H A;  4EJW A;  3LA2 A;  2HR3 A;  2IA2 A;  3LWF A;  1W5T A;  2JZY A;  3P7N A;  1BI1 A;  4LK0 F;  2KKO A;  2XKO A;  3E6C C;  2HFH A;  1CF7 B;  4KNY A;  4KIB A;  3IHU A;  3ERE D;  1W7P B;  4K2E A;  1EH6 A;  3TDZ C;  3C7J A;  1YS6 A;  1F4K A;  5CLS A;  1KU9 A;  1T0F A;  2ZBK A;  4EGY A;  2DK5 A;  1C0W A;  1XMK A;  4DQ2 A;  5D4S A;  1YG2 A;  3SZT A;  4EM0 B;  3LA3 A;  3SZP A;  1KQ0 A;  2V6C A;  5LRS A;  1JXS A;  1Z1D A;  2TDX A;  2PBI A;  3ZMU A;  5DEQ A;  3DXJ F;  1ZRD A;  3ULQ B;  1FBQ A;  1MGT A;  1KU2 A;  1FYK A;  2XAQ A;  2BV6 A;  3F72 A;  4G6D A;  2L4M A;  1XCB A;  2HS5 A;  1S29 A;  2DBB A;  2HYG D;  2P5K A;  4CDG A;  1ZAR A;  4M6X A;  1SFU A;  4M9S A;  1CGP A;  4Q4Z F;  1LDJ A;  5H6R A;  1ZRF A;  3EQL F;  4MEX F;  1K78 A;  1XMA A;  1FBS A;  2XAS A;  1J2X A;  3V4G A;  1LJ9 A;  3WGG A;  3V7S A;  1HKS A;  5LGT A;  1ZRE A;  3GXO A;  4KA4 A;  4IXA A;  3WTX C;  1IXS B;  2OA4 A;  4CHU A;  1J59 A;  5E20 A;  3Q9V A;  5BOX A;  3KE2 A;  4KT5 C;  3WTT C;  5K5Q A;  3HSR A;  4HQM A;  4I09 A;  2H09 A;  5BS6 A;  2W84 A;  1FOK A;  2K27 A;  2FRH A;  3DV8 A;  4RGX A;  1SD6 A;  2ZME B;  3BZ6 A;  3U2R A;  2A61 A;  3E6M A;  3O3K A;  5ICF A;  2QM3 A;  1R23 A;  3HYI A;  4BH9 A;  2WTE A;  3T8T A;  2IRF G;  2VT2 A;  5D6F A;  2ZKZ A;  3I58 A;  2IA1 A;  2NS0 A;  4OOI A;  1FX7 A;  1W4M A;  1HW5 A;  4LLG F;  3IC7 A;  5DDG A;  2K4B A;  4Y17 A;  3CJN A;  3QP6 A;  4LK1 F;  3HRS A;  2PI0 A;  3ZPL A;  3EYY A;  1T38 A;  4R1H A;  3WOD F;  2GZW A;  1OR7 A;  4XSX F;  3W6J B;  4PDK A;  2W57 A;  4O5V A;  3FHZ A;  1T39 A;  1MJ9 A;  1IN7 A;  3KLN A;  5KK1 A;  1XGN A;  3V8K A;  2Q8K A;  1HXD A;  3I53 A;  4GYG A;  3FMR A;  3GUD A;  1ON1 A;  1G3Y A;  1HKQ A;  3KP7 A;  2VN2 A;  1S7A A;  2XGX A;  2A07 F;  4ZZL A;  1FPQ A;  4O6J A;  2VE9 A;  4NB5 A;  3ELK A;  3NQO A;  3RPU A;  2Q2E A;  1R5H A;  2VBW A;  1U5T A;  1CF7 A;  2IT0 A;  1P4A A;  4ZYD A;  2OQG A;  1W7P A;  3BWG A;  3F3X A;  5A2Q Z;  2V1X A;  1P2F A;  4KIG A;  2Z9O A;  3F6V A;  4HF2 A;  2UZK A;  1IXR C;  5KVR A;  3PFI A;  3HUG A;  1UHM A;  4ESJ A;  5FO5 A;  3KZZ A;  3KP6 A;  2FQ3 A;  3ECO A;  1I27 A;  4BAY A;  3QRF F;  2D1V A;  2OBP A;  2KIM A;  1K6O A;  1X3U A;  1Q1H A;  4A0Z A;  3HHG A;  4S05 A;  4OIQ F;  2A69 F;  2ISZ A;  5ERI A;  3KLO A;  3CTA A;  2QUF A;  2DT5 A;  2OU2 A;  2UWM A;  4QLC U;  4BQA A;  5J8F A;  3BY6 A;  1PDN C;  2L02 A;  2LKP A;  4U0Y A;  2DQL A;  4A0Y A;  5LHG A;  3T0Y A;  3TQN A;  1ZRC A;  1KA8 A;  2A3S A;  5DV5 A;  1EH8 A;  3GZ5 A;  3QPT A;  4WCG A;  3EET A;  2XHK A;  2V1D A;  4EGZ A;  2E7W A;  1LEA A;  4UUV A;  2E7X A;  3VB2 A;  1USS A;  5TRD A;  1FY7 A;  5LHH A;  2NNN A;  4D0P A;  3KEQ A;  2XIG A;  4MEY F;  3D5L A;  3TO6 A;  4QWQ A;  5D4R A;  3RYR A;  2JPB A;  2H27 A;  2YU3 A;  3NEU A;  3KCC A;  1ZGJ A;  4IRI A;  1R1T A;  5LGU A;  3COA C;  1IUY A;  3GYH X;  2ZME A;  4LLN A;  2E1N A;  2GXB A;  2Y0M A;  3E6B A;  2RGV A;  2DQR A;  3T5X A;  5BQT A;  5ILV A;  4P55 A;  5FLX Z;  1UCR A;  3TOB A;  3CO7 C;  3H3U A;  4AIH A;  2ZJ2 A;  4TV7 A;  2JSC A;  3E3V A;  5HS8 A;  2FEZ A;  5L3F A;  4L0Z B;  4Q47 A;  5CVV A;  1SMT A;  3WE3 A;  1YO5 C;  3I64 A;  4NHJ A;  3MCZ A;  1G3W A;  1XD7 A;  1RIO H;  2HKX A;  2H6B A;  1D5V A;  4ZH4 F;  3GX4 X;  4KIF A;  1ZG3 A;  2PN6 A;  2CYY A;  5ILU A;  4ETS A;  1I5Z A;  1RUO A;  1TLH B;  1U5T C;  3GFI A;  1U78 A;  1ZG1 A;  3DFG A;  3WTZ A;  3JAM Z;  3E5Q A;  1LQ1 A;  5HDN A;  2A5Y B;  3HRM A;  3L09 A;  4HV6 A;  1K78 B;  4A5M A;  4B8X A;  4A5N A;  2JT1 A;  3CDH A;  3V7R A;  2PFB A;  3R0A A;  1BBY A;  2MH9 A;  2XRO A;  5K1Y A;  2QQ9 A;  2ESH A;  1IN8 A;  2VXZ A;  4EM2 A;  3MFK A;  3WU1 B;  1V3F A;  1S3J A;  2PMH A;  5IT3 A;  2P6S A;  5ICG A;  4H0E A;  2R7F A;  2V79 A;  4OU0 A;  1I1G A;  3JSO A;  4G6Q A;  3Q5F A;  5FD5 A;  1BI3 A;  3EUH A;  1DDN A;  4UNO A;  2C6Y A;  2GQQ A;  1ONV A;  2GWR A;  3FX3 A;  3WTS C;  3TDU C;  1H9T A;  3I0T A;  2HDC A;  4KN7 X;  4GO1 A;  3RTR A;  4M9X A;  2FXA A;  3MAJ A;  2X4H A;  3V7C A;  3LST A;  4N9H A;  1R22 A;  3FXQ A;  1KYZ A;  4WXD A;  2CWE A;  2O03 A;  2CO5 A;  1UHW A;  2EFW A;  4ZYH A;  3GZ6 A;  1XDS A;  3K1N A;  3QPH A;  2KIF A;  3HSE A;  5LEK A;  1IN4 A;  3GFJ A;  4KUM A;  2ADU A;  4M71 A;  5J6X A;  1UB9 A;  4MNU A;  4DNC A;  4BHP A;  1AWC A;  1BM9 A;  2MD5 A;  2HQN A;  1SMY F;  2RQP A;  1DPR A;  4CIC A;  1D8K A;  5D6E A;  2RKH A;  2AS5 F;  5FGM A;  3ABU A;  2FSW A;  2HZT A;  4I0A A;  4XLN F;  3RI4 A;  2VOD A;  3HIF A;  1WI9 A;  1PP7 U;  4EJT A;  5HDK A;  2CFX A;  1XSV A;  3HTU A;  4M74 A;  1U5T B;  4A6E A;  2FML A;  3V8L A;  1U2W A;  4Y15 A;  4CO8 A;  4IF4 A;  4UXN A;  3P9K A;  5L3B A;  2NRA C;  4YIF A;  2EWN A;  4UV9 A;  1A04 A;  5HVQ C;  5L3D A;  1D3Y A;  1XSD A;  2DPD A;  2K7L A;  2H94 A;  3GWZ A;  4HW0 A;  4I98 B;  4XSZ F;  5FLX K;  1GVJ A;  3ZN0 A;  4HYE A;  1SAX A;  3SFZ A;  2ACJ A;  2CW0 F;  3E97 A;  5AIQ A;  3FZV A;  5E17 F;  2ZCW A;  5H20 A;  3DEU A;  1I6X A;  3KP5 A;  1E17 A; 
#chains in the Genus database with same CATH topology
 4I01 A;  3UKG A;  2DI3 A;  3OV8 A;  1AHD P;  3OYL A;  1MSE C;  2OTL I;  1MNM C;  1FMW A;  3KP2 A;  1YW8 A;  1VND A;  2YPR A;  4CCM A;  1MMA A;  2VB6 A;  1OCT C;  4A93 J;  2VLA A;  1MBF A;  1KU3 A;  4WXC A;  2E35 A;  4MFD A;  3PL8 A;  2HKO A;  4GGG A;  5IP7 J;  5BPI A;  4HX7 A;  3CF5 F;  1TT0 A;  4A3J J;  3I56 I;  3GTJ J;  2KJB A;  1TWG J;  1T2K A;  2CUJ A;  5CVU A;  5DTD A;  3ABL H;  1TNS A;  3H0G J;  3LA7 A;  1KYW A;  4DW6 A;  3PIP F;  4FCY A;  4XOT A;  4M9Z A;  3D0S A;  4XN3 A;  5TJJ A;  2MGQ A;  1SD4 A;  4HNU A;  3A01 B;  3RKX A;  2R93 J;  4U0V A;  2IGM A;  2W82 A;  2PX9 A;  3F8N A;  4A3C J;  1A6I A;  1O4X A;  3GTG J;  2VUM J;  1F43 A;  1ZN2 A;  3JTG A;  2ESN A;  3LQQ A;  1PUE E;  3Q0W A;  1O3Q A;  1EA3 A;  2DOF A;  2XDV A;  2JVH A;  3WG7 H;  3WTV C;  2WBM A;  3JTH A;  2D2W A;  1OIS A;  1JTX A;  3F8F A;  4HDV A;  1PP8 F;  5HDG A;  2K3F A;  1JHH A;  1LDD A;  2MYS A;  2VJI A;  2X6W A;  2P5L C;  3OYB A;  3EUH C;  3S2D J;  4XR6 A;  2FA5 A;  1S72 I;  4QTR A;  4NQW A;  1YIO A;  2Q0O A;  5IP6 A;  4QIW N;  1WRJ A;  4KIS A;  4HF0 A;  2BHY A;  3AKZ A;  2WB1 N;  5EEH A;  4UB8 C;  4AWX B;  3L2U A;  1MD0 A;  4PJJ A;  4D7M A;  1UG2 A;  2GIZ A;  4C9Y A;  1Z91 A;  4DOZ A;  4ON0 A;  5LD2 C;  2YUS A;  3DPT A;  2WB1 A;  3M8E A;  4CCL A;  4RS8 A;  3ABK H;  5IT9 K;  2TRT A;  4J01 A;  1BW6 A;  1G4D A;  2EZK A;  4HEA 2;  3W6V A;  1BIA A;  2VI6 A;  4M3B A;  2UV1 A;  2KIQ A;  2LR8 A;  2WC2 A;  4RGU A;  3W2V A;  2VBZ A;  4N9I A;  1WPK A;  4IX7 A;  2L3D A;  2IP2 A;  3OYH A;  1TTY A;  1OQY A;  2OZU A;  4NUB A;  2E34 A;  1FWZ A;  3B6C A;  1FLI A;  2AXT C;  1G3S A;  4AUX A;  1Y0U A;  2RNJ A;  1W36 D;  1NK3 P;  1FP1 D;  2X1D A;  3IKV A;  4I7H A;  3CCE I;  2EA2 A;  3HOT A;  1OCR H;  2MBF A;  1OLT A;  3LSK A;  3R61 A;  4XQF A;  3KFW X;  1MMS A;  5FFZ A;  1ZHF A;  2P81 A;  3MKW B;  5FLV A;  4IVN A;  3RZD J;  3EYI A;  3IP4 B;  3U1K A;  4M3G A;  2DN0 A;  3ECH A;  4QSH A;  4V19 K;  3I3L A;  3K6G A;  1BR1 A;  4X6A J;  4PSX A;  1TBX A;  2QEN A;  3DKW A;  3O2P E;  2CQN A;  4LG0 A;  2HOA A;  1KGS A;  1S7O A;  2MFZ A;  2Y30 A;  2FNP A;  3K4L A;  5CPR B;  1ON2 A;  4RAG A;  2LYC A;  4ZC3 A;  2D1H A;  3L2V A;  3OWT A;  1RZ4 A;  3MKZ A;  2R5Y A;  1P92 A;  3I9V 2;  3B73 A;  1K4T A;  1BW5 A;  3CCY A;  5E8G A;  2ETH A;  1DP7 P;  4RMN A;  4D9J A;  3DTK A;  4NC8 A;  5HLG A;  1YX3 A;  3H3V K;  1SVL A;  2EJR A;  3BG3 A;  3AG3 H;  1POG A;  3RIR A;  2YX7 A;  1YLF A;  4RLF A;  3GVA A;  1JKR C;  2F4I A;  5F1R A;  4G8X A;  4CCK A;  3A4C A;  3EUK L;  1MW7 A;  1XCV A;  5D5V B;  4BJ6 C;  1S8N A;  1E2X A;  4FIS A;  2V26 A;  4DBR A;  5HLH A;  5ICC A;  1T08 B;  3J7A O;  4YEL A;  4LMY A;  4IHV A;  2DMU A;  2W25 A;  1AOY A;  2K4J A;  1R5G A;  1BIB A;  3H9G A;  1G59 A;  1OCP A;  3L2C A;  4XL9 A;  2KRC A;  4LFU A;  3JW4 A;  2YR2 A;  5EEG A;  5LLQ A;  3MMY B;  1OYI A;  2QQB A;  3DEW A;  4LGW A;  3S2W A;  4AYB A;  2DYR H;  2DPU A;  4F7Z A;  3G71 I;  1VZ0 A;  2FBI A;  3LSI A;  1O7L A;  5K5R A;  1LE8 A;  2A6T A;  3ROU A;  2V1U A;  3CC4 I;  4UVB A;  5JLX A;  2JVG A;  3M8F A;  2HEO A;  2HWV A;  3H9Q A;  3FIW A;  4BKX A;  2O8X A;  2Z3Y A;  3EDP A;  1U8B A;  4P9F A;  2NVQ J;  1QPM A;  4IPA A;  4UHT A;  2BYV E;  5LRR A;  4XLH A;  1R6R A;  2EH3 A;  2HTJ A;  4KDP A;  2OCE A;  1HKT A;  2V7F A;  4IKF A;  3I54 A;  3SZG A;  2AXL A;  4JQF A;  3TO9 A;  2F5C A;  3BJO A;  2ZFW A;  4XN0 A;  3I4N J;  2ID6 A;  4MO7 A;  3G6E I;  2NVT J;  3BPX A;  3Q3S A;  2E71 A;  4HNT A;  2HU9 A;  2LRD A;  3Q0U A;  3RKQ A;  4PUS A;  4N0B A;  1ZAO A;  1J5Y A;  1KZH A;  2BE5 F;  1JGS A;  5D5U B;  3CES A;  2R5Z A;  4E7K A;  2LC2 A;  1ZYR F;  4GDF A;  3FXK A;  4JP0 A;  3ZMV A;  1TWA J;  1J0R A;  2AQF A;  1DQU A;  3RDI A;  3ZQQ A;  2HTS A;  3CUQ A;  5JLW A;  3TP0 A;  3BC8 A;  4KN4 X;  1U8R A;  3O8H A;  2OD5 A;  4U0W A;  1FZP B;  2HQR A;  2NAZ A;  3HL2 A;  1YRN B;  1YYV A;  4BS9 A;  3QYF A;  3U21 A;  5K7Z A;  3FWE A;  1P4X A;  1TW3 A;  3F8M A;  5HOD A;  4PCQ A;  2BEO A;  2M87 A;  2VJ4 A;  2XVC A;  3J80 Z;  1YW7 A;  1RES A;  3N4M A;  2GIV A;  1H9G A;  3ERM A;  5FFX A;  2K86 A;  2DFH A;  1GT0 C;  1FSH A;  1FYL A;  3JRH A;  3GTO J;  2EIK H;  4OIP F;  4AVZ A;  3BR1 A;  1BR4 A;  3HKZ N;  4BE2 A;  2O9L A;  1PUF B;  1OPC A;  4LOC A;  3L2R A;  2QCO A;  4CGZ A;  1MJB A;  1OYY A;  2P4W A;  2EBI A;  1BJZ A;  2VC1 A;  2XGE A;  3GLX A;  3MD2 A;  1U9N A;  2XPV A;  3F21 A;  4CCJ A;  3K4N A;  4RDU A;  5HS9 A;  4IQJ A;  2CQQ A;  3WU2 C;  3GFL A;  2AHQ A;  4HQE A;  1LB2 A;  2ZC2 A;  3BTC A;  3NAU A;  3FBN B;  1R71 A;  1XMX A;  2BVM A;  5E1W A;  4U7B A;  3GTM J;  3C18 A;  4UB6 C;  4PJL A;  4G9Y A;  1ODD A;  5IOZ A;  1IC8 A;  4L9V A;  2L7M P;  4HZF A;  1QO0 D;  5M5W J;  1K7A A;  2L7Z A;  1KU7 A;  3M4O J;  1XX5 A;  1QZZ A;  3O6B B;  4RAZ A;  5HS7 A;  5KAF C;  3HOZ J;  2R7Z J;  3J81 Z;  2XV4 S;  4Y52 J;  4EAT A;  1G6N A;  1Z0X A;  2LMD A;  2M2E A;  1WJA A;  2W24 A;  4FE7 A;  4P9U A;  2BHZ A;  2VL8 A;  2PJR B;  1P7I A;  2EIJ H;  2RV8 A;  2FBH A;  3H5A A;  1TL8 A;  1WI3 A;  4PGH A;  5F0C A;  2X1C A;  1RI7 A;  5FKN A;  1B1B A;  2ZJQ F;  3CO6 C;  2KPM A;  3GTP J;  2KT0 A;  2QSH X;  1Z77 A;  4HDU A;  1A35 A;  3SYT A;  4LIT A;  4EJU A;  5TGT A;  4Q48 A;  4YFK F;  3F8C A;  3VDX A;  3DPU A;  3FXU A;  2K9M A;  3DQV C;  3QQA A;  2JRT A;  4A0X A;  2CUZ A;  2J5P A;  2R7X A;  3BQZ A;  2CQ7 A;  2KL4 A;  2CG4 A;  5BMZ A;  4A3L J;  4BHB A;  4C3J J;  2XRN A;  5HOO A;  1VQO I;  3LSG A;  4ENN A;  2VKE A;  4BNC A;  1JHF A;  2BY2 A;  3K2A A;  2R7V A;  2GA1 A;  3F22 A;  1GLN A;  1R4M B;  4CCN A;  5LHI A;  3ZQF A;  2MH2 A;  1TQM A;  2NS7 A;  1YS7 A;  1T6S A;  1ZG5 A;  2LSO A;  3KPH A;  4XKC A;  1BJA A;  1XN7 A;  1WJF A;  3HRU A;  4EM1 A;  2DK8 A;  2ECB A;  4E7I A;  1STZ A;  3CP2 A;  5HLI A;  5LGN A;  3JRI A;  3E1S A;  2XAG A;  1BC7 C;  2Y75 A;  2GA2 A;  3F9K A;  4FET A;  1OKR A;  1QRY A;  2CRG A;  3OS2 A;  5AIP A;  3HOV J;  2Y48 A;  3TKY A;  3SXY A;  5J1Y A;  3H92 A;  2GXA A;  5GPA A;  3G2B A;  5CVI A;  4B44 A;  4DJA A;  1D1A A;  3KZY A;  3L1P A;  4M3E A;  1Z6R A;  1P7J A;  1ETX A;  2RDP A;  2BGC A;  2VKD A;  3VEP A;  1S7E A;  2L01 A;  5F04 A;  3RKW A;  5DM7 F;  1FP2 A;  2Z5U A;  4II2 A;  1P4W A;  3OYC A;  3I71 A;  3CME I;  2RNG A;  4LB6 B;  3HZJ A;  4KJZ A;  2LNB A;  3S17 J;  4DYR A;  4EMS A;  2F4O B;  2DA3 A;  1UZC A;  4ZYA A;  5L3E A;  2M30 A;  2VIX A;  1IDZ A;  5GAE J;  1FC3 A;  2Z99 A;  3MKY B;  4KIC A;  5JHU A;  1UAA A;  3KZI C;  2BBY A;  3CP8 A;  4HG2 A;  4X1E A;  2ZO4 A;  3JRC A;  2PMU A;  4XOR A;  1SD5 A;  3ZMS A;  4C3H J;  1YFH A;  3OR2 C;  4NQW B;  4BQN A;  2H6C A;  1GUU A;  4O3M A;  2IVM A;  1VFC A;  3FXJ A;  4B4C A;  3I4M J;  2LLK A;  4Y13 A;  1AA7 A;  4CA0 A;  2XGD A;  2DMN A;  3PM1 A;  4CZZ A;  3JRB A;  5E1X A;  4ENK A;  3R0J A;  3CUQ C;  3RQ4 A;  3X2Q H;  1RPW A;  5EF6 A;  2PEX A;  3G3Z A;  3IWF A;  4M72 A;  1A31 A;  3MEX A;  5AON A;  1YTY A;  1ZGA A;  3U9G A;  2KIU A;  3CLO A;  3I4P A;  4HBL A;  1IG7 A;  4IHT A;  3NWT A;  1IXC A;  2MA3 A;  2V9K A;  2GAU A;  2LTP A;  5A2Q K;  5HLT A;  3TGN A;  2QBY B;  4Y33 A;  3ZQC A;  2LF7 A;  4MGR A;  4FT8 A;  4BYY A;  3P5J A;  4HF1 A;  4EQQ A;  2MLG A;  2RC4 A;  4HNV A;  2JPC A;  2PG4 A;  3BDD A;  1L0O C;  2DXI A;  4HX8 A;  1FBU A;  3S32 A;  3TED A;  5J8C A;  3DCF A;  2NS8 A;  3ML6 A;  4MFE A;  4MTE A;  1FIA A;  1OCC H;  4RB3 C;  2ISY A;  1FOW A;  2LF8 A;  1XGM A;  2KZG A;  1YQA A;  3AG4 H;  3G1O A;  1YRN A;  3V8J A;  4PJN A;  3BRO A;  1DU0 A;  2A6E F;  2IGN A;  3WHB A;  1W5C C;  4G7O F;  2YSR A;  1BI2 A;  5M3M J;  4XRS A;  1AU7 A;  4E7L A;  5CQG A;  2FBK A;  3GO5 A;  4NBQ A;  1H0M A;  3ZMZ A;  5DUI A;  4JX6 A;  4LG0 B;  2NVU B;  3I5U A;  4MQ9 F;  1JJ6 C;  1N25 A;  3OYM A;  5JVT A;  2DDB A;  3REO A;  3BQY A;  1MBG A;  1QVU A;  5EG0 B;  4MQV A;  3ZQI A;  1RET A;  1ZR2 A;  3J7Z I;  4OAZ A;  5ICE A;  3LFK A;  2MSY A;  3PQJ A;  5ED4 A;  1DGW Y;  5DUK A;  1OCO H;  3WU0 A;  4E6K G;  2WY8 Q;  5CYV A;  4OIN F;  3KP3 A;  3I59 B;  3VOE A;  3SDB A;  2IBD A;  1ENH A;  1SFK A;  2P6T A;  3BZC A;  2K02 A;  2JK3 A;  3FMQ A;  2VKH A;  2YS9 A;  2IA0 A;  2NNY A;  3K1P A;  1TWC J;  3R4K A;  1G8X A;  3HPG A;  2IXS A;  4J00 A;  1LEB A;  3LSM A;  3K70 D;  2HVQ A;  1VTN C;  1KQ8 A;  3RKY A;  1O57 A;  5D8L B;  1QZE A;  4ZZD A;  4FAS D;  3OYD A;  1BR2 A;  2LK2 A;  5L3G A;  1HST A;  1R00 A;  2QZ8 A;  4UV8 A;  4LB5 A;  3F6O A;  2Z2S B;  5E1Z B;  1NTC A;  1Y1W J;  2DFF A;  3RPQ A;  4A3B J;  3K1M A;  2X1E A;  5ILS A;  3JRG A;  4ABZ A;  1TZL A;  3DEE A;  2O7O A;  2M4K A;  1EKE A;  4ENJ A;  1R9T J;  2OQR A;  4IO9 F;  3IL2 A;  3VYT B;  3A03 A;  3FF5 A;  4XLP F;  2CSO A;  2CV1 A;  4UVC A;  4UVA A;  2KHM A;  3QP5 A;  1VQL I;  1IW7 F;  1PJR A;  4D5F A;  1K61 A;  2PQ8 A;  2PLY A;  3LAP A;  5F27 A;  3GF2 A;  5J4V A;  2IAI A;  1MJA A;  2KJC A;  3I55 I;  2EQR A;  3HJE A;  1UST A;  3TO7 A;  4ASN A;  2IS4 A;  5J1R A;  3KET A;  5M3F J;  2FE3 A;  2CGP A;  2XAF A;  3DTI A;  3FDY A;  4DBQ A;  3CUQ B;  3U1D A;  4PK4 A;  2EFN A;  3WTW C;  2ZXJ A;  3ZGK A;  5E3L A;  3H5R A;  3KEO A;  1S6L A;  2L4A A;  3QWL A;  4U88 A;  3WGI A;  3JRF A;  2LKX A;  2MC4 A;  1IRX A;  2EPF A;  1TWH J;  4I99 C;  2CQK A;  2M1B A;  2D45 A;  4NC7 A;  3JR9 A;  3CUO A;  2A6H F;  5BPD A;  1X4O A;  2DYS H;  1NHA A;  1YOV B;  1RUN A;  2EK5 A;  3PNT A;  2GLO A;  3H36 A;  3PNV A;  1LKX A;  1P9Q C;  2F48 A;  4HLX A;  3LAJ A;  2XAU A;  4IOC F;  3OR1 C;  2ZXI A;  4CXF A;  2HPI A;  1JT6 A;  2STW A;  3QAH A;  1B59 A;  1AKH B;  4B47 A;  2M4G A;  3ZN1 A;  5FD6 A;  2JMW A;  2JN6 A;  4YEJ A;  4JBA A;  3RPU D;  3BT9 A;  4EV0 A;  1ITY A;  2VJJ A;  1XC5 A;  3TOA A;  1FOY A;  3R6S A;  2RN7 A;  1E3P A;  4D5C A;  4OIR F;  1QBJ A;  1B8I B;  1TC3 C;  2OV7 A;  1BN5 A;  1JTY A;  3JAM K;  1WWX A;  4AC0 A;  1MZB A;  4HAM A;  4KMF A;  3K7A J;  1W7P D;  3H1C A;  5K5O A;  4WF2 A;  2DTZ A;  2DW4 A;  4F93 B;  3AAF A;  5GAH J;  3G1M A;  1J75 A;  1I1S A;  1ETQ A;  2X48 A;  1TP4 A;  4PJM A;  2UXN A;  2CFO A;  1ZH5 A;  1B9N A;  1ULY A;  4XIC A;  2JQ7 A;  2CJJ A;  4E7J A;  1FMV A;  3D5R C;  3FXR A;  4YII A;  1XPX A;  3DU5 A;  4RM2 A;  2FMY A;  3C2B A;  1HSJ A;  3S8P A;  1XGO A;  1MH3 A;  2O6G E;  3DKY A;  3OYN A;  3ISP A;  1Z05 A;  2L7F P;  3Q9S A;  1DU6 A;  2DFI A;  1B9M A;  1Y8Q B;  2P8T A;  5E18 F;  3A02 A;  3B02 A;  3NAR A;  4ZTF A;  4RM3 A;  5EZH A;  4HRI A;  3IV5 A;  4Z2Y A;  1GV5 A;  3FHN A;  5CJ9 A;  2V6E A;  1QA6 A;  2F6C A;  2LH9 A;  3MWM A;  2F5E A;  3VOD A;  2JA7 J;  3ZMT A;  2QBY A;  2LFB A;  4Y4R A;  2VE8 A;  4BDY A;  4FX0 A;  2IS6 A;  2EIN H;  1XS9 A;  2Q1Z B;  3HTS B;  4EJO A;  1WKM A;  3BP8 A;  1TQI A;  2W85 A;  2L5Q A;  3N05 A;  3WGH A;  2V9V A;  3JRD A;  3SQN A;  4RLQ A;  4PGG A;  4HOB A;  3D1N I;  2HPM A;  1XG1 A;  1UFM A;  3CCR I;  2DU9 A;  2XUB A;  2XKP A;  1JUP A;  4OIO F;  1ERD A;  2EV0 A;  3OL4 A;  1D8J A;  1MBH A;  4IRG A;  1K6Y A;  4XLF A;  4BHC A;  1B4A A;  2EIL H;  3K2Z A;  2E60 A;  1X1B A;  1FTT A;  4G12 A;  4PJ0 C;  1IF1 A;  2PJP A;  2EFO A;  1LDK B;  2VBY A;  3BJA A;  1QGP A;  4XKB A;  3OSG A;  1IRF A;  1MDM B;  2STT A;  2E2I J;  2HXI A;  4BEH A;  1IV8 A;  1GXQ A;  3RCO A;  1VI0 A;  2Z33 A;  5K7F A;  3BR3 A;  3CCU I;  3S1Q J;  3KX2 A;  5E3N A;  3DPL C;  2O0Y A;  3H3Z A;  6PAX A;  3BOQ A;  3Q0V A;  3C1D A;  1ETV A;  1ETY A;  3H35 A;  5DS9 A;  1RR8 C;  4IRH A;  3GTK J;  1UG0 A;  2FF4 A;  2L54 A;  3L2Q A;  2ZNY A;  4BAC A;  2P7C B;  5EG0 A;  4GFB A;  1SD7 A;  1TW2 A;  4A3M J;  4IHW A;  2HNH A;  1BC8 C;  4OMY A;  1HQC A;  1K79 A;  1XGS A;  5CVJ A;  5EJC A;  3DKX A;  3K0L A;  2OUM A;  4M3F A;  1VF9 A;  1DGR M;  2EFP A;  1QZY A;  2L9S A;  1FYM A;  2Y9Z A;  1REP C;  1R1V A;  1Z6T A;  1VQ7 I;  2EA4 A;  1TNT A;  3I59 A;  1RKW A;  4GYI A;  4L9N A;  1JE8 A;  2HGC A;  2NOG A;  2LY1 A;  1WGX A;  2EV5 A;  2KRF A;  2COM A;  1HLV A;  5HNH A;  2M7B A;  4BJ5 C;  2JUG A;  1X1D A;  2VOO A;  3FM3 A;  1Y8R B;  3OYF A;  3LSR A;  3L00 A;  2OPT A;  4OMZ A;  1FOX A;  4B43 A;  4ESF A;  4IJA A;  4G7H F;  1DPU A;  1TT5 B;  4G7Z F;  3A1Y A;  2A05 A;  2EFQ A;  5L3C A;  3OYG A;  2DMQ A;  1G3T A;  2DJI A;  1XDU A;  3OOU A;  4GCV A;  3KIO A;  4YFX F;  4XK4 A;  1MMG A;  4HLY A;  2E1O A;  3FXO A;  4JK1 X;  4MHG A;  2KQR A;  3PQK A;  3ZMD A;  3S1M J;  4LD5 A;  3TL4 X;  1YIT I;  4L5I A;  2QKM B;  2P7V B;  3V42 A;  4WWC A;  2QF7 A;  3SHF A;  4BL0 B;  3PSI A;  5KNL A;  5DD4 A;  2ZJP F;  1LUJ B;  3S16 J;  2Z1D A;  3FBI B;  3RJP A;  3A0B C;  1D5Y A;  3E0J B;  4L0Y B;  2F2E A;  5C4J J;  4ESB A;  3HBL A;  4HA8 A;  1U6G A;  5DCM B;  2M9H A;  1LVA A;  4CUG A;  5IY5 H;  2Y9Y A;  5JFR A;  4BQO A;  3L9F A;  2X9D A;  1VQ9 I;  2F5F A;  4LIU A;  4RGS A;  3GFM A;  1J9I A;  4FHT A;  5FKO A;  5LBQ A;  2KLO A;  5JI6 A;  2N8G A;  2NOJ B;  2XGC A;  2A5W A;  3CJT B;  2R4G A;  4L9T A;  3P9I A;  2G7U A;  3HOW J;  2HVR A;  1X1A A;  3O8G A;  1WH7 A;  2LG4 A;  3ASO H;  2OZ6 A;  3ABT A;  3FXM A;  2YX4 A;  3M9A A;  2BZT A;  1IO2 A;  3E5U A;  1IRG A;  4ZYG A;  2FOK A;  1F1Z A;  3ZQL A;  3K4M A;  1FEX A;  2DT7 B;  1YIJ I;  2ZFU A;  4LLL A;  3IRR A;  4KMU X;  4RBO A;  4AIK A;  3HOU J;  3F23 A;  2R0Q C;  4I2O A;  3C2G A;  1H88 C;  2VQH A;  1W0U A;  1LNW A;  5CKT A;  4PFP A;  2JWT A;  1U3E M;  4JYK A;  1LPQ A;  3GW2 A;  2CW7 A;  3ZQ7 A;  3GLL A;  1AKH A;  1DP3 A;  2O61 A;  4IL6 C;  2LBF A;  2FOW A;  2M34 A;  5DYM A;  1RNL A;  1ACI A;  2IW5 A;  2K85 A;  1WQ2 A;  3T8R A;  3UR3 C;  4Y7N J;  2BOL A;  4LJZ F;  3HKZ A;  3BTL A;  1B6A A;  1GXP A;  2EZI A;  2A68 F;  3IWZ A;  4WXH A;  4PZJ A;  1B8I A;  1HBX G;  2HDD A;  1YJN I;  1IAW A;  4R79 A;  1WVR A;  4E4H A;  5B3S H;  5J40 A;  2LD5 A;  4KFC A;  4A6D A;  4OAY A;  1D1C A;  4ZYE A;  5D5X B;  4HSR A;  2WAD A;  2E1C A;  2M45 A;  2LDU A;  3HHH A;  2R3S A;  1Q1V A;  1V4R A;  3KYL A;  1JI8 A;  1MBJ A;  1OFC X;  2NYX A;  4RB1 A;  4DYC A;  1K4S A;  4KYW A;  1IZ1 A;  1RR7 A;  1J7K A;  4A12 A;  3RZO J;  1BOA A;  2DTR A;  4WK8 F;  4BY7 J;  2FUG 2;  5IYC J;  3WTU C;  4RB0 A;  4XM3 A;  4B09 A;  1X3W B;  4G6T B;  3NRV A;  3SEQ A;  4CCO A;  3OOP A;  1ORK A;  4YRV A;  1I50 J;  1QNT A;  3G73 A;  2DDA A;  3WG9 A;  4P96 A;  4L5J A;  4DGW B;  4UUT A;  1YX5 A;  5CVR A;  5D8K B;  1H89 C;  5C3E J;  2DO7 A;  2E5Z A;  3QOP A;  3VYR B;  2DJN A;  4JOM A;  3VYU B;  1Z7L A;  5F0F A;  1IN6 A;  1V54 H;  4I76 A;  3VPR A;  3RYP A;  1Z3X A;  1ZEL A;  3CCS I;  1O3R A;  2H1L A;  3C3W A;  3CQZ J;  3QU3 A;  3JRA A;  2IS2 A;  2COB A;  3MZH A;  3CD6 I;  2GOM A;  2DAO A;  4W1U A;  3HSF A;  2VC0 A;  5FKL A;  5KAI C;  3S15 J;  3P9C A;  3FMS A;  1HOM A;  1LVK A;  1QQI A;  2XAJ A;  4CYC A;  2B0L A;  4BBS J;  2FNA A;  4L18 B;  1FSE A;  4LG3 A;  2QYO A;  3S14 J;  1HW1 A;  1O7F A;  3IRQ A;  1MDM A;  3HPH A;  4E70 A;  1I6H J;  1MKM A;  2ME6 A;  1A36 A;  2X0L A;  4Q5S F;  3BPV A;  2WY7 Q;  3W6K B;  3M1C A;  2P5V A;  2OTJ I;  5K7H A;  1VQ4 I;  3BCB A;  3JCU C;  2H8W A;  3CMA I;  2M7A A;  1IN5 A;  2VBX A;  2LRE A;  2EZH A;  2QWW A;  1HCR A;  2HYF A;  2WV0 A;  4QPO A;  3T1B A;  1F9N A;  2VON A;  2XC7 A;  4A2U A;  2MC3 A;  4XRF A;  3S2H J;  2DA4 A;  1SFX A;  2B7E A;  3A0H C;  3HRT A;  5F6F A;  1F5T A;  1HC8 A;  2M0M A;  3HEF A;  3S3M A;  2R92 J;  1W5S A;  4AVP A;  2M8E A;  5FB2 A;  4DZP A;  2GXG A;  2QSF X;  2ZNZ A;  4A3I J;  1O3S A;  5IP9 J;  1EH7 A;  4IHS A;  4AIJ A;  1W1W E;  2VOP A;  5FKM A;  1ZLK A;  3R60 A;  3A2K A;  3HC7 A;  5C44 J;  3VFZ A;  2OAZ A;  1DUX C;  2L7K A;  1J09 A;  1QVT A;  3N97 A;  2VXD A;  1ZGW A;  1WZ2 A;  3IKT A;  1O3T A;  5D5W B;  4B3A A;  2ZSH B;  4JX4 A;  3WTY C;  1KON A;  2EZL A;  2ZJR F;  3LL7 A;  4GXO A;  2I5U A;  2IJL A;  1Y39 A;  1EJ9 A;  1NH3 A;  1R36 A;  3E6D A;  4HX4 A;  3KEY A;  3K4C A;  1OYW A;  1NG7 A;  2QVO A;  3LFU A;  1Z9C A;  1FT9 A;  5H6Q A;  3L7W A;  2BY3 A;  4I0B A;  4XKV A;  4BGD A;  3QYB A;  3K9T A;  4OWR B;  1N75 A;  2JSP A;  4P5O A;  4RGR A;  2F4M B;  4ZTJ A;  3TW7 A;  4HV5 A;  5KCM A;  3OIO A;  4I02 A;  4YFN F;  4NNJ A;  4D1Q A;  1R1U A;  3S3O A;  3CDI A;  4C2U A;  1Y56 A;  3HOS A;  5DCM A;  1SFE A;  4HST A;  4RAY A;  3PSF A;  2EV6 A;  3KP4 A;  2OF7 A;  4FTH A;  4BXU A;  2RVC A;  1BI0 A;  1L3L A;  1I3A A;  1Z3Y A;  2QQA A;  4C3I J;  3MN2 A;  2O3F A;  1WSU A;  1EF4 A;  1YW9 A;  2F5D A;  4YG2 F;  4LIV A;  2I10 A;  2FU4 A;  1YHQ I;  5E3O A;  5IT9 Z;  4F52 A;  1EV7 A;  3BG9 A;  4MTD A;  5DCF A;  4WX9 A;  3BR2 A;  3G4S I;  4IOA F;  4IQ4 A;  4QPQ A;  1V5G A;  2HI3 A;  1TWF J;  2KFD A;  4CYD A;  4L9J A;  3BG5 A;  3J80 K;  2G9W A;  4NDL A;  1OMI A;  3QPS A;  3FK6 A;  4RB2 C;  3DLA A;  3M1E A;  2DCE A;  5LEJ A;  1P6R A;  3DF8 A;  4XNF A;  5FJ8 J;  4BEH B;  1GHC A;  5JR3 A;  2VAS A;  3E7L A;  2OC6 A;  3WE2 A;  3F8B A;  4R8H A;  4EVI A;  1XB4 A;  5E8I A;  1V5E A;  1W36 C;  2JTV A;  2K5C A;  1E3H A;  3HB9 A;  1X2M A;  2IPQ X;  2KRH A;  2ELH A;  4BBR J;  1GVD A;  2CU7 A;  2G0E A;  2M3A A;  3FM5 A;  4A3G J;  2B9S A;  1WJB A;  3CMY A;  4C2M J;  3LQR A;  2LVS A;  2L9V A;  1HF0 A;  4S04 A;  2UXX A;  3SJM A;  4M6Y A;  1SVM A;  1KQ9 A;  1WJ5 A;  4F92 B;  3ZOB A;  4A3E J;  2V1N A;  4BUP A;  3MQ0 A;  3BJ6 A;  4G94 A;  5GP9 A;  1T56 A;  4ENM A;  2DA7 A;  3DP7 A;  1R7J A;  4M73 A;  3CCL I;  1R58 A;  2WWY A;  2QLZ A;  2H1K A;  2HOE A;  2M5W A;  1XSX A;  3AL0 B;  3ZP5 A;  2ZXH A;  4FX4 A;  1Z67 A;  3EUA A;  3E5X A;  1TQP A;  2DLL A;  1ETW A;  4D7N A;  3DBH B;  1T98 A;  3J81 K;  2MLK A;  1U9O A;  3GEZ A;  1VQM I;  1FNN A;  2Y0S N;  4XLC A;  4XBF A;  1SC7 A;  3W2A A;  2VT3 A;  4EJV A;  1MBE A;  3JSP A;  2XAH A;  2R7D A;  2Y0S A;  3S3N A;  1VQ5 I;  1Z7U A;  4U7D A;  3BLY A;  5EGO A;  5F64 A;  1HW2 A;  1ZLJ A;  3M7G A;  4C2T A;  2W4S A;  3B6A A;  3FK7 A;  3GZN B;  3K69 A;  3K4B A;  3MKL A;  3QU6 A;  4IZZ A;  2J5O A;  3ZXS A;  2EB7 A;  1BOB A;  4AD9 A;  3BG6 A;  3MZY A;  5FRO A;  4XON A;  5DD8 A;  5IYB J;  4A3D J;  1IGN A;  1S5L C;  1ETK A;  2DA2 A;  2G7H A;  3ABM H;  4EJW A;  2DT6 A;  2JA2 A;  3LA2 A;  2HR3 A;  2IA2 A;  2LOO A;  3LWF A;  3HGY A;  1W5T A;  2JZY A;  3P7N A;  2HOS A;  3CCJ I;  1BI1 A;  4XID A;  4LK0 F;  2KKO A;  2Q2E B;  2XKO A;  4BQQ A;  3E6C C;  4BE1 A;  5H2F C;  2HFH A;  3BCA A;  4I6Z A;  1CF7 B;  1NG6 A;  2E5N A;  4KNY A;  3CZ6 A;  2ZXW H;  1BL0 A;  4KIB A;  3IH4 A;  3IHU A;  3ERE D;  1W7P B;  2VQC A;  4K2E A;  2P0W A;  1WFX A;  2Z16 A;  1EH6 A;  3TDZ C;  3C7J A;  1R4N B;  3HXL A;  1YS6 A;  2L0K A;  1F4K A;  5CLS A;  3RSN A;  2HDW A;  3S1N J;  1KU9 A;  2VJ5 A;  3FKI J;  1VQ6 I;  1T0F A;  1YJ9 I;  4UY8 I;  4II3 A;  2ZBK A;  3WHC A;  4EGY A;  2KDO A;  2VPL A;  2DK5 A;  1C0W A;  1XMK A;  4DQ2 A;  5D4S A;  3VSL A;  1YG2 A;  3OSF A;  3SZT A;  4EM0 B;  3LA3 A;  4N4O B;  3SZP A;  1KQ0 A;  2V6C A;  2LBF B;  5LRS A;  1Z21 A;  1E3O C;  3W3C A;  1OJL A;  3SDG A;  1JXS A;  1Z1D A;  2TDX A;  1B72 A;  3C2H A;  3PIO F;  1IJW C;  2PBI A;  3ZMU A;  5DEQ A;  3DXJ F;  1ZRD A;  3ULQ B;  1FBQ A;  1MGT A;  1KU2 A;  3F0C A;  2K9S A;  2XAQ A;  1FYK A;  3TMO A;  4J19 A;  5FKK A;  4XRS G;  2BV6 A;  3F72 A;  1FIP A;  3J7A Y;  4G6D A;  2L4M A;  1XCB A;  3D5S C;  2HS5 A;  1S29 A;  4ZDO A;  3OMY A;  2DBB A;  2HYG D;  2P5K A;  2WAF A;  4CDG A;  2KZV A;  3HGG A;  2DFE A;  5IOY A;  2CMP A;  1ZAR A;  4XKW A;  4M6X A;  5J4Y A;  4M3D A;  1SFU A;  2GOX B;  4M9S A;  1CGP A;  2JUC A;  4Q4Z F;  1LDJ A;  5H6R A;  2F5V A;  1JUM A;  5B1A H;  1ZRF A;  3EQL F;  3AFH A;  3IAS 2;  5FLM J;  4MEX F;  1K78 A;  1XMA A;  1FBS A;  5GAG J;  2XAS A;  2DMT A;  1J2X A;  5F08 A;  4XRM A;  5EZG A;  3IUO A;  3V4G A;  5KHD A;  1LJ9 A;  1JUS A;  3WGG A;  4BU2 A;  1ZTR A;  1ETO A;  2ZB9 A;  2X85 A;  2R7Q A;  3V7S A;  1GDT A;  1HKS A;  2ICW G;  2L9R A;  3PO2 J;  5DM6 F;  5LGT A;  2X51 A;  1ZRE A;  2CUF A;  3GXO A;  2MG4 A;  4KA4 A;  4IXA A;  3WTX C;  1IXS B;  2OA4 A;  3K4K A;  3DTE A;  2LY2 A;  1J59 A;  4CHU A;  2FQ4 A;  5E20 A;  3Q9V A;  5BOX A;  3KE2 A;  4KT5 C;  3WTT C;  5K5Q A;  3HSR A;  4B48 A;  1I3Q J;  4HQM A;  4I09 A;  1UMQ A;  2H09 A;  5BS6 A;  4CYC B;  2HQA A;  2W84 A;  4BXX J;  1FOK A;  2JA6 J;  2K27 A;  1GV2 A;  3HOX J;  2XPU A;  2IS1 A;  2FRH A;  2L2O A;  2H8R A;  2PMZ N;  3DV8 A;  2HZD A;  5HNF A;  4RGX A;  1SD6 A;  2ZME B;  3BZ6 A;  3U2R A;  2A61 A;  3E6M A;  1G2H A;  4B1R A;  3O3K A;  2VPR A;  5ICF A;  2PMZ A;  1IV6 A;  4V2F A;  2QM3 A;  2E1M B;  1R23 A;  1I39 A;  2R7W A;  1N77 A;  3HYI A;  1R49 A;  1MBK A;  4BH9 A;  2WTE A;  4ZDL A;  3FKJ A;  3T8T A;  2IRF G;  2VT2 A;  1X2N A;  5D6F A;  4CZC A;  2ZKZ A;  3I58 A;  4H4K C;  2IA1 A;  3CCQ I;  2NS0 A;  3OL3 A;  4OOI A;  3S1R J;  1ZQ3 P;  1FX7 A;  1W4M A;  1HW5 A;  4DZJ A;  4LLG F;  2K3P A;  1FTZ A;  5EYR A;  3BTJ A;  3IC7 A;  5DDG A;  5FRN A;  4BDZ A;  2DOA A;  5E3M A;  2K4B A;  2Y69 H;  4Y17 A;  2WA0 A;  3DBR B;  3CJN A;  2XSD C;  4MLO A;  3QP6 A;  4LK1 F;  1JT0 A;  2B63 J;  3HRS A;  3M07 A;  2PI0 A;  3G1L A;  3ZPL A;  3EYY A;  3UNG C;  3CCV I;  1T38 A;  5EDN A;  2X6X A;  2KMU A;  4R1H A;  5B1B H;  3WOD F;  2GZW A;  2X6O A;  4FE4 A;  2E2H J;  1OR7 A;  2BW3 A;  4XSX F;  3W6J B;  3SFI A;  2RRE A;  4PDK A;  2W57 A;  3J7Y J;  2EIM H;  4O5V A;  4JX5 A;  3M3Y J;  3FHZ A;  2KIS A;  4ITV A;  1T39 A;  2IGO A;  3ZQH A;  1MJ9 A;  1IN7 A;  3KLN A;  4AYB N;  5KK1 A;  1SAN A;  1XGN A;  2ZSI B;  3V8K A;  2Q8K A;  1HXD A;  3I53 A;  4GYG A;  3LMM A;  3VSK A;  3FMR A;  3AG1 H;  3GUD A;  4RAF A;  3GBG A;  1ON1 A;  1G3Y A;  1HKQ A;  3KP7 A;  3M8J A;  2FJ1 A;  1UJ8 A;  2VN2 A;  1S7A A;  2XGX A;  4UUS B;  3H0D A;  2A07 F;  1OCZ H;  3W2W A;  2GBY A;  4ZZL A;  1FPQ A;  4O6J A;  1SAU A;  2VE9 A;  2W7N A;  4NB5 A;  1K83 J;  1T0F C;  2OCC H;  3CJQ B;  3ELK A;  4ANJ A;  1IUF A;  3NQO A;  3RPU A;  5FRM A;  2L9N A;  2Q2E A;  1R5H A;  2VBW A;  1U5T A;  2BXZ A;  1CF7 A;  5E79 C;  2IT0 A;  3BZK A;  2XRL A;  1WJC A;  2R7T A;  4A3K J;  3ONQ A;  1P4A A;  3IAM 2;  2JA8 J;  4ZYD A;  2OQG A;  1W7P A;  3BWG A;  3F3X A;  5A2Q Z;  2V1X A;  1P2F A;  4KIG A;  4F91 B;  2Z9O A;  1UHS A;  2WAE A;  2XPW A;  3AG2 H;  3F6V A;  4MIM A;  5J3L A;  3CLQ A;  1ZK8 A;  3QOE A;  2GM4 A;  4HF2 A;  2UZK A;  1IXR C;  5KVR A;  3PFI A;  3HUG A;  1UHM A;  4ESJ A;  4AU7 A;  4IHX A;  3GTL J;  5FO5 A;  3KZZ A;  3KP6 A;  2FQ3 A;  1WH5 A;  3OYI A;  3ECO A;  4V2G A;  2IEK A;  4XLE A;  2KDZ A;  4BE0 A;  1I27 A;  3GTQ J;  3MVP A;  4BAY A;  1WJD A;  3QRF F;  1JKO C;  2QEX I;  2D1V A;  2OBP A;  2KIM A;  2MD0 A;  1K6O A;  1X3U A;  1Q1H A;  4A0Z A;  4F55 A;  1X1P A;  3HHG A;  3NWS A;  4S05 A;  5JHF A;  5IYD J;  2LKS A;  2XB5 A;  4OIQ F;  2XB0 X;  2A69 F;  2ISZ A;  1FJL A;  1PVE A;  1E0E A;  5ERI A;  3OY9 A;  2CW8 A;  3KLO A;  2XSJ C;  1H8A C;  3CTA A;  1X1C A;  5IPA A;  2QUF A;  1X4P A;  2ID3 A;  2DT5 A;  5EEA A;  2OU2 A;  2UWM A;  3TBI A;  4QLC U;  4BQA A;  2BXY A;  5J8F A;  4IHY A;  3BY6 A;  1PDN C;  3PJR A;  3A01 A;  2L02 A;  4X0G A;  2HOT A;  2LKP A;  4U0Y A;  5CQE A;  2D5V A;  2DQL A;  4A0Y A;  5LHG A;  4E7S A;  3T0Y A;  3TQN A;  1ZRC A;  2QQ8 A;  1KA8 A;  2YU9 J;  2A3S A;  5DV5 A;  1EH8 A;  3GZ5 A;  3QPT A;  4KT6 A;  1WCM J;  1A5J A;  4WCG A;  3DU6 A;  5J1U A;  5C4X J;  4IEJ A;  3EET A;  2VQG A;  2XHK A;  5GTI C;  5F1J A;  2V1D A;  2MAB A;  2CV0 A;  5EGO B;  4EGZ A;  2E7W A;  1LEA A;  2E36 A;  3HM5 A;  4UUV A;  5GTH C;  1W0T A;  2E7X A;  3CC7 I;  1X19 A;  2LY9 A;  3OYK A;  3VB2 A;  3K70 C;  1USS A;  3PNY A;  2R7R A;  5TRD A;  1FY7 A;  3OS0 A;  5LHH A;  1YI2 I;  2NNN A;  4D0P A;  2QGU A;  2K9Q A;  3KEQ A;  2E2J J;  2XIG A;  4MEY F;  3BTI A;  3D5L A;  1QHG A;  3CMM A;  3TO6 A;  4QWQ A;  3CJR B;  4E7Z A;  5D4R A;  3RYR A;  2JPB A;  2W48 A;  2VQL A;  5JVG F;  2H27 A;  3VWB A;  3HG9 A;  1T95 A;  1V5F A;  5GAD J;  2YU3 A;  1WJE A;  3NEU A;  3KCC A;  1ZGJ A;  3EPZ A;  4IRI A;  2O5R A;  2R7U A;  3ZCO A;  1R1T A;  5LFA A;  3OIP A;  5LGU A;  3COA C;  1IUY A;  2VKV A;  3GYH X;  2ZME A;  4LLN A;  2E1N A;  4GRI A;  3AL0 C;  2GXB A;  2CH0 A;  2Y0M A;  1Y1V J;  3E6B A;  2HQ5 A;  2QSG X;  2RGV A;  4ZDP A;  2DQR A;  3T5X A;  2DOD A;  2QKL B;  5BQT A;  3QOD A;  5ILV A;  4P55 A;  5FLX Z;  4N4N B;  2FD5 A;  1D0Z A;  1UCR A;  3TOB A;  3CO7 C;  1QPI A;  1OR7 C;  4C30 A;  5GPC A;  2E19 A;  4XLA A;  2JRM A;  3H3U A;  4AIH A;  4NC6 A;  1U0J A;  2R7O A;  4FQG A;  2CQX A;  2ZJ2 A;  3OS1 A;  4XOP A;  4TV7 A;  2JSC A;  3E3V A;  3PUF A;  4HPQ A;  3TW6 A;  2V4J C;  5B66 C;  2BY1 A;  5HS8 A;  2DMP A;  2FEZ A;  5L3F A;  4L0Z B;  2TCT A;  4Q47 A;  3MZ8 A;  1SMT A;  5CVV A;  2CS3 A;  1B72 B;  3WE3 A;  1YO5 C;  3I64 A;  1RRJ A;  1LFP A;  4NHJ A;  3MCZ A;  1G3W A;  2ELK A;  1D1B A;  3JRE A;  1XD7 A;  3ZR8 X;  1Y0N A;  4S0H B;  1RIO H;  2HKX A;  3CDL A;  2H6B A;  4P1W A;  2NVX J;  1D5V A;  4ZH4 F;  3L2W A;  3GX4 X;  4KIF A;  3LSJ A;  1ZG3 A;  4BJT A;  2O8K A;  2PN6 A;  2CYY A;  3BR5 A;  5ILU A;  2K9N A;  4ETS A;  2XF5 A;  2JA5 J;  2FX0 A;  3QYE A;  4B3X A;  2CV2 A;  1I5Z A;  1N78 A;  1VQK I;  1RUO A;  1TLH B;  2RQQ A;  1U5T C;  3DBL B;  3GFI A;  9ANT A;  1U78 A;  2WAQ N;  4A3F J;  1ZG1 A;  3BG7 A;  3DFG A;  3LNQ A;  4PFO A;  3WTZ A;  3JAM Z;  3E5Q A;  1LQ1 A;  5HDN A;  2A5Y B;  4PSW A;  3HRM A;  3L09 A;  4HV6 A;  4AM3 A;  3IH3 A;  1K78 B;  1SEU A;  3KYD B;  4A5M A;  2WAQ A;  4B8X A;  4A5N A;  2JT1 A;  4L5E A;  2K40 A;  3CDH A;  3V7R A;  2M8G X;  3ZQG A;  2PFB A;  4UUS A;  1YE9 A;  1BBY A;  3R0A A;  1MNE A;  2MH9 A;  2NVY J;  2XRO A;  5M5Y J;  5K1Y A;  1QHH D;  2QQ9 A;  2ESH A;  1IN8 A;  2VXZ A;  1IRZ A;  4EM2 A;  2M0C A;  3K10 A;  3MFK A;  2HYJ A;  3WU1 B;  3HOY J;  3PUB A;  1V3F A;  1S3J A;  2PMH A;  3DWL E;  3PO3 J;  4CSW A;  2OJE D;  5IT3 A;  3K4J A;  2P6S A;  5ICG A;  2KP6 A;  4H0E A;  2R7F A;  1ZKG A;  2V79 A;  4DYQ A;  2HXO A;  1T8I A;  2BY0 A;  4OU0 A;  1I1G A;  2Y31 A;  3JSO A;  2DOE A;  2I8D A;  3IH2 A;  3OYJ A;  1MND A;  1MMN A;  4BXF A;  4G6Q A;  3Q5F A;  2ME0 A;  1JJ8 C;  3BR0 A;  5FD5 A;  5TIS C;  1BI3 A;  2IGK A;  1CQT A;  3EUH A;  4A69 C;  1DDN A;  1QU3 A;  4UNO A;  2C6Y A;  2GQQ A;  3CF2 A;  4CH7 A;  1ONV A;  3LOC A;  1R5I D;  2GWR A;  3FX3 A;  4W97 A;  3S93 A;  3WTS C;  3TDU C;  1SFO J;  1H9T A;  3PFY A;  3I0T A;  1MIJ A;  2HDC A;  4KN7 X;  4GO1 A;  3RTR A;  4F3Q A;  4M9X A;  2XF7 A;  3FXL A;  3SEZ A;  2FXA A;  4KIT B;  2X6Y A;  1LFU P;  1T33 A;  3MAJ A;  2X4H A;  3V7C A;  3LST A;  1JKQ C;  4N9H A;  3LSP A;  3CC2 I;  1R22 A;  2CUE A;  1YJW I;  3FXQ A;  1X58 A;  3RQI A;  1KYZ A;  3TP3 A;  3CCM I;  4WXD A;  2CWE A;  3ESW B;  4YIR X;  2O03 A;  1X3Z B;  1VQN I;  4XMY A;  1A6Q A;  1APL C;  2CO5 A;  2RAE A;  4Y3O A;  2UUZ A;  3VYS B;  1UHW A;  2NXN B;  2ECC A;  3GME A;  4M6V A;  2EFW A;  2JJ7 A;  4ZYH A;  3GZ6 A;  1PUF A;  1XDS A;  3K1N A;  2HVS A;  3QPH A;  1PYV A;  3DLL F;  3FIS A;  2KIF A;  1Y6I A;  2R5Y B;  1SVO A;  3HSE A;  2BVL A;  5LEK A;  1IN4 A;  3GFJ A;  5BNG A;  4KUM A;  1MH4 A;  2ADU A;  2W00 A;  4M71 A;  5J6X A;  1UB9 A;  4MNU A;  4DNC A;  1HDP A;  1MMD A;  3ZRG A;  4BHP A;  1JKP C;  2BW3 B;  1F36 A;  1BM9 A;  1AWC A;  1IDY A;  5J47 A;  2QA4 I;  2MD5 A;  2WV1 A;  2HQN A;  1SMY F;  4RA2 A;  4Z6Y A;  2RQP A;  1MSF C;  1DPR A;  3QPL A;  2Y2Z A;  4CIC A;  1D8K A;  1ZR4 A;  2W1O A;  2K9L A;  2RKH A;  5D6E A;  1WHU A;  2ZME C;  2AS5 F;  5FGM A;  2PJR A;  3ABU A;  3GCM A;  1RKT A;  2FSW A;  1S9H A;  2R7S A;  3H5N A;  2V9P A;  4ZJZ A;  1NK2 P;  1VQ8 I;  2E1M C;  2AQE A;  2HZT A;  1LE8 B;  4I0A A;  1V55 H;  4XLN F;  3H9J A;  3RI4 A;  3HDD A;  2VOD A;  3HIF A;  1HA8 A;  1WI9 A;  4AID A;  2XF6 A;  1D0Y A;  1PP7 U;  4EJT A;  1JGG A;  3OYA A;  5HDK A;  3LSH A;  4E7H A;  2CFX A;  1XSV A;  2MW8 A;  3HTU A;  4M74 A;  4DIQ A;  1RC9 A;  1U5T B;  4A6E A;  2FML A;  3V8L A;  1U2W A;  2AO9 A;  1LFB A;  1M1E B;  4Y15 A;  5B5E C;  4EEF G;  4CO8 A;  4IF4 A;  4UXN A;  3P9K A;  5L3B A;  2ELJ A;  2NRA C;  4YIF A;  2EWN A;  4UV9 A;  1HDD C;  1A04 A;  1BA5 A;  3BR6 A;  5HVQ C;  5L3D A;  1D3Y A;  1XSD A;  2DA6 A;  2DPD A;  5M5X J;  1D0X A;  3ASN H;  2K7L A;  3KYC B;  2H94 A;  3GWZ A;  4HW0 A;  4I98 B;  4XSZ F;  1XTA A;  2R5Z B;  5FLX K;  3HUG B;  1GVJ A;  3ZN0 A;  4HYE A;  4U87 A;  1SAX A;  3SFZ A;  3OYE A;  5F0H A;  2ACJ A;  2CW0 F;  2DA1 A;  3E97 A;  3FZV A;  3OIQ A;  5AIQ A;  4BY1 J;  5E17 F;  2ZCW A;  5H20 A;  1VQP I;  3DEU A;  1I6X A;  1UEL B;  2DA5 A;  3KP5 A;  1E17 A;  2LP0 A; 
#chains in the Genus database with same CATH homology
 4I01 A;  2DI3 A;  3OV8 A;  3KP2 A;  1YW8 A;  2YPR A;  1KU3 A;  4WXC A;  2HKO A;  4GGG A;  5BPI A;  4HX7 A;  2KJB A;  1T2K A;  5CVU A;  1TNS A;  3LA7 A;  1KYW A;  4M9Z A;  3D0S A;  5TJJ A;  1SD4 A;  3RKX A;  4U0V A;  3F8N A;  1ZN2 A;  3JTG A;  2ESN A;  3LQQ A;  1PUE E;  1O3Q A;  3WTV C;  3JTH A;  2D2W A;  3F8F A;  4HDV A;  1PP8 F;  5HDG A;  1JHH A;  1LDD A;  2P5L C;  2FA5 A;  4NQW A;  1YIO A;  2Q0O A;  1WRJ A;  4HF0 A;  5EEH A;  4AWX B;  1MD0 A;  1Z91 A;  4ON0 A;  3DPT A;  3M8E A;  4RS8 A;  5IT9 K;  1G4D A;  1BIA A;  2WC2 A;  4RGU A;  2VBZ A;  4N9I A;  2L3D A;  2IP2 A;  1TTY A;  2OZU A;  1FWZ A;  1FLI A;  1G3S A;  1Y0U A;  2RNJ A;  1FP1 D;  3IKV A;  4I7H A;  2EA2 A;  3HOT A;  2MBF A;  3R61 A;  3KFW X;  5FFZ A;  1ZHF A;  4IVN A;  3EYI A;  3ECH A;  1TBX A;  2QEN A;  3DKW A;  3O2P E;  4LG0 A;  1KGS A;  1S7O A;  2FNP A;  1ON2 A;  2D1H A;  1RZ4 A;  1P92 A;  3B73 A;  5E8G A;  2ETH A;  1DP7 P;  5HLG A;  2EJR A;  3RIR A;  2YX7 A;  1YLF A;  3GVA A;  5F1R A;  4G8X A;  1XCV A;  5D5V B;  1E2X A;  1S8N A;  5HLH A;  5ICC A;  3J7A O;  4LMY A;  2W25 A;  1AOY A;  2K4J A;  1R5G A;  1BIB A;  3L2C A;  4LFU A;  5EEG A;  3JW4 A;  2YR2 A;  5LLQ A;  1OYI A;  2QQB A;  4LGW A;  3S2W A;  2DPU A;  4F7Z A;  2FBI A;  1O7L A;  5K5R A;  3ROU A;  2V1U A;  4UVB A;  3M8F A;  2HEO A;  2HWV A;  2O8X A;  2Z3Y A;  3EDP A;  4P9F A;  1QPM A;  4IPA A;  4UHT A;  2BYV E;  5LRR A;  2HTJ A;  4KDP A;  1HKT A;  3I54 A;  2AXL A;  4JQF A;  3TO9 A;  2F5C A;  3BJO A;  2ZFW A;  3BPX A;  4N0B A;  1ZAO A;  1J5Y A;  2BE5 F;  1JGS A;  5D5U B;  1ZYR F;  3ZMV A;  1J0R A;  3RDI A;  2HTS A;  3CUQ A;  4KN4 X;  1U8R A;  2OD5 A;  4U0W A;  1FZP B;  2HQR A;  2NAZ A;  1YYV A;  3FWE A;  1P4X A;  1TW3 A;  3F8M A;  4PCQ A;  2BEO A;  3J80 Z;  2M87 A;  2XVC A;  1YW7 A;  3N4M A;  2GIV A;  1H9G A;  5FFX A;  2K86 A;  1FSH A;  1FYL A;  4OIP F;  1OPC A;  4CGZ A;  1MJB A;  1OYY A;  2P4W A;  2VC1 A;  3GLX A;  3F21 A;  5HS9 A;  3GFL A;  4HQE A;  1LB2 A;  5E1W A;  4U7B A;  3C18 A;  4G9Y A;  1ODD A;  4L9V A;  4HZF A;  1QO0 D;  1K7A A;  1KU7 A;  1QZZ A;  3O6B B;  4RAZ A;  5HS7 A;  3J81 Z;  2XV4 S;  1G6N A;  4P9U A;  2W24 A;  2RV8 A;  2FBH A;  4PGH A;  1RI7 A;  1B1B A;  3CO6 C;  4HDU A;  4EJU A;  4Q48 A;  4YFK F;  3F8C A;  3FXU A;  3DQV C;  2JRT A;  4A0X A;  2J5P A;  2CG4 A;  5BMZ A;  4BHB A;  2XRN A;  5HOO A;  4ENN A;  4BNC A;  1JHF A;  2GA1 A;  3F22 A;  5LHI A;  2MH2 A;  1TQM A;  1YS7 A;  1T6S A;  1ZG5 A;  2LSO A;  1BJA A;  1XN7 A;  3HRU A;  4EM1 A;  2DK8 A;  1STZ A;  5HLI A;  5LGN A;  2XAG A;  1BC7 C;  2Y75 A;  2GA2 A;  1OKR A;  5AIP A;  2Y48 A;  3TKY A;  3SXY A;  3H92 A;  5CVI A;  3KZY A;  1Z6R A;  2RDP A;  2BGC A;  3VEP A;  2L01 A;  3RKW A;  1FP2 A;  2Z5U A;  1P4W A;  3I71 A;  4LB6 B;  2LNB A;  4EMS A;  5L3E A;  2M30 A;  1FC3 A;  2Z99 A;  4KIC A;  5JHU A;  2BBY A;  2ZO4 A;  2PMU A;  1SD5 A;  3ZMS A;  1YFH A;  2H6C A;  4O3M A;  2IVM A;  4Y13 A;  4CZZ A;  5E1X A;  4ENK A;  3R0J A;  3CUQ C;  2PEX A;  3G3Z A;  3IWF A;  4M72 A;  3MEX A;  5AON A;  1YTY A;  3U9G A;  1ZGA A;  2KIU A;  3CLO A;  3I4P A;  4HBL A;  4IHT A;  1IXC A;  2MA3 A;  2GAU A;  5A2Q K;  3TGN A;  2QBY B;  2LF7 A;  4MGR A;  4FT8 A;  4BYY A;  4HF1 A;  4EQQ A;  2MLG A;  2RC4 A;  2JPC A;  2PG4 A;  3BDD A;  1L0O C;  4HX8 A;  1FBU A;  5J8C A;  3ML6 A;  4MTE A;  4RB3 C;  2ISY A;  2LF8 A;  1XGM A;  1YQA A;  3V8J A;  3BRO A;  2A6E F;  4G7O F;  2YSR A;  1BI2 A;  2FBK A;  3GO5 A;  1H0M A;  3ZMZ A;  5DUI A;  4LG0 B;  3I5U A;  4MQ9 F;  5JVT A;  3REO A;  4MQV A;  5ICE A;  3LFK A;  3PQJ A;  5ED4 A;  5DUK A;  3WU0 A;  5CYV A;  4OIN F;  3KP3 A;  3I59 B;  3VOE A;  2P6T A;  2K02 A;  3FMQ A;  2IA0 A;  2NNY A;  3K1P A;  3R4K A;  1LEB A;  1VTN C;  1KQ8 A;  3RKY A;  1O57 A;  5D8L B;  4ZZD A;  5L3G A;  1HST A;  1R00 A;  2QZ8 A;  4UV8 A;  4LB5 A;  3F6O A;  5E1Z B;  3RPQ A;  3K1M A;  5ILS A;  4ENJ A;  2OQR A;  3IL2 A;  3FF5 A;  4XLP F;  2CSO A;  4UVC A;  4UVA A;  3QP5 A;  1IW7 F;  2PQ8 A;  2PLY A;  3LAP A;  3GF2 A;  1MJA A;  2KJC A;  1UST A;  3TO7 A;  4ASN A;  3KET A;  2FE3 A;  2CGP A;  2XAF A;  3CUQ B;  3U1D A;  2EFN A;  3WTW C;  2ZXJ A;  3KEO A;  1S6L A;  2L4A A;  4U88 A;  3WGI A;  2CQK A;  2M1B A;  2D45 A;  3CUO A;  2A6H F;  5BPD A;  1NHA A;  1RUN A;  2EK5 A;  4HLX A;  3LAJ A;  4CXF A;  2STW A;  3QAH A;  1B59 A;  3ZN1 A;  5FD6 A;  4JBA A;  4EV0 A;  3TOA A;  3R6S A;  2RN7 A;  1QBJ A;  4OIR F;  1BN5 A;  3JAM K;  1WWX A;  1MZB A;  4HAM A;  4KMF A;  1W7P D;  5K5O A;  4WF2 A;  2DW4 A;  3AAF A;  1J75 A;  1I1S A;  2UXN A;  1ZH5 A;  1B9N A;  1ULY A;  3FXR A;  4YII A;  2FMY A;  1HSJ A;  1XGO A;  2O6G E;  3ISP A;  1Z05 A;  3Q9S A;  2DFI A;  1B9M A;  2P8T A;  5E18 F;  3B02 A;  4Z2Y A;  5CJ9 A;  3MWM A;  2F5E A;  3VOD A;  3ZMT A;  2QBY A;  2VE8 A;  4FX0 A;  3HTS B;  4EJO A;  1WKM A;  3BP8 A;  1TQI A;  2W85 A;  3WGH A;  2V9V A;  3SQN A;  4PGG A;  4HOB A;  1UFM A;  2DU9 A;  2XUB A;  2XKP A;  4OIO F;  2EV0 A;  1D8J A;  4IRG A;  4BHC A;  1B4A A;  3K2Z A;  1IF1 A;  2PJP A;  2EFO A;  1LDK B;  2VBY A;  3BJA A;  1QGP A;  1IRF A;  1MDM B;  2STT A;  1GXQ A;  2Z33 A;  3DPL C;  2O0Y A;  3H3Z A;  6PAX A;  3BOQ A;  3C1D A;  4IRH A;  2FF4 A;  2L54 A;  2ZNY A;  2P7C B;  1SD7 A;  1TW2 A;  1BC8 C;  4OMY A;  1HQC A;  1K79 A;  1XGS A;  5CVJ A;  3K0L A;  2EFP A;  1QZY A;  1FYM A;  1REP C;  1R1V A;  1Z6T A;  2EA4 A;  1TNT A;  3I59 A;  4GYI A;  4L9N A;  1JE8 A;  2HGC A;  2EV5 A;  2KRF A;  2COM A;  2VOO A;  3FM3 A;  3L00 A;  4OMZ A;  4ESF A;  4IJA A;  4G7H F;  1DPU A;  4G7Z F;  2EFQ A;  5L3C A;  1G3T A;  1XDU A;  4GCV A;  4HLY A;  4YFX F;  4JK1 X;  4MHG A;  3PQK A;  3ZMD A;  4LD5 A;  4L5I A;  4WWC A;  2P7V B;  3SHF A;  5DD4 A;  3RJP A;  4L0Y B;  2F2E A;  4ESB A;  4HA8 A;  1U6G A;  5DCM B;  1LVA A;  5JFR A;  3L9F A;  2F5F A;  4RGS A;  3GFM A;  1J9I A;  4FHT A;  5LBQ A;  5JI6 A;  4L9T A;  3P9I A;  2G7U A;  2OZ6 A;  3ABT A;  2YX4 A;  3M9A A;  3E5U A;  1IRG A;  4ZYG A;  2FOK A;  1F1Z A;  4LLL A;  3IRR A;  4KMU X;  4AIK A;  3F23 A;  4I2O A;  1LNW A;  1U3E M;  3GW2 A;  3ZQ7 A;  2O61 A;  5DYM A;  1RNL A;  2IW5 A;  1WQ2 A;  3T8R A;  4LJZ F;  1B6A A;  1GXP A;  4WXH A;  2A68 F;  3IWZ A;  4PZJ A;  1HBX G;  1IAW A;  4R79 A;  4KFC A;  4A6D A;  4ZYE A;  5D5X B;  2E1C A;  2M45 A;  2LDU A;  3HHH A;  2R3S A;  1V4R A;  2NYX A;  4RB1 A;  4KYW A;  1IZ1 A;  1J7K A;  4A12 A;  1BOA A;  2DTR A;  4WK8 F;  3WTU C;  4RB0 A;  4B09 A;  3NRV A;  3OOP A;  1QNT A;  3G73 A;  3WG9 A;  4P96 A;  4L5J A;  5CVR A;  5D8K B;  2DO7 A;  3QOP A;  1IN6 A;  3RYP A;  1O3R A;  3C3W A;  3QU3 A;  3MZH A;  2DAO A;  3HSF A;  2VC0 A;  3P9C A;  3FMS A;  1QQI A;  2XAJ A;  2B0L A;  2FNA A;  4L18 B;  1FSE A;  2QYO A;  1HW1 A;  1O7F A;  3IRQ A;  1MDM A;  4E70 A;  1MKM A;  2X0L A;  4Q5S F;  3BPV A;  3W6K B;  2P5V A;  1IN5 A;  2VBX A;  2QWW A;  2HYF A;  2WV0 A;  3T1B A;  1F9N A;  2VON A;  4A2U A;  2MC3 A;  4XRF A;  1SFX A;  5F6F A;  3HRT A;  1F5T A;  1W5S A;  4AVP A;  2M8E A;  5FB2 A;  2GXG A;  2ZNZ A;  1O3S A;  1EH7 A;  4IHS A;  4AIJ A;  2VOP A;  1ZLK A;  3R60 A;  3VFZ A;  2OAZ A;  1DUX C;  3N97 A;  3IKT A;  1O3T A;  5D5W B;  3WTY C;  4GXO A;  2IJL A;  1R36 A;  3E6D A;  4HX4 A;  1OYW A;  2QVO A;  1Z9C A;  1FT9 A;  5H6Q A;  3L7W A;  4I0B A;  3K9T A;  4P5O A;  4RGR A;  4HV5 A;  4I02 A;  4YFN F;  1R1U A;  3HOS A;  5DCM A;  1SFE A;  4RAY A;  2EV6 A;  3KP4 A;  4BXU A;  2RVC A;  1BI0 A;  1L3L A;  2QQA A;  2O3F A;  1WSU A;  1YW9 A;  2F5D A;  4YG2 F;  2FU4 A;  5IT9 Z;  1EV7 A;  4MTD A;  5DCF A;  4WX9 A;  4CYD A;  4L9J A;  3J80 K;  2G9W A;  1OMI A;  4RB2 C;  5LEJ A;  3M1E A;  1GHC A;  1P6R A;  3DF8 A;  5JR3 A;  3WE2 A;  3F8B A;  4R8H A;  4EVI A;  1XB4 A;  5E8I A;  2JTV A;  2IPQ X;  2ELH A;  3FM5 A;  3LQR A;  4S04 A;  2UXX A;  4M6Y A;  1KQ9 A;  3MQ0 A;  3BJ6 A;  4G94 A;  4ENM A;  3DP7 A;  1R7J A;  4M73 A;  1R58 A;  2WWY A;  2QLZ A;  2HOE A;  2M5W A;  1XSX A;  3ZP5 A;  4FX4 A;  3E5X A;  1TQP A;  2DLL A;  1T98 A;  3J81 K;  2MLK A;  3GEZ A;  1FNN A;  4XBF A;  2VT3 A;  4EJV A;  3JSP A;  2XAH A;  2R7D A;  1Z7U A;  4U7D A;  5F64 A;  1HW2 A;  1ZLJ A;  3M7G A;  3K69 A;  3QU6 A;  2J5O A;  2EB7 A;  4AD9 A;  3MZY A;  5DD8 A;  2G7H A;  4EJW A;  3LA2 A;  2HR3 A;  2IA2 A;  3LWF A;  1W5T A;  2JZY A;  3P7N A;  1BI1 A;  4LK0 F;  2KKO A;  2XKO A;  3E6C C;  2HFH A;  1CF7 B;  4KNY A;  4KIB A;  3IHU A;  3ERE D;  1W7P B;  4K2E A;  1EH6 A;  3TDZ C;  3C7J A;  1YS6 A;  1F4K A;  5CLS A;  1KU9 A;  1T0F A;  2ZBK A;  4EGY A;  2DK5 A;  1C0W A;  1XMK A;  4DQ2 A;  5D4S A;  1YG2 A;  3SZT A;  4EM0 B;  3LA3 A;  3SZP A;  1KQ0 A;  2V6C A;  5LRS A;  1JXS A;  1Z1D A;  2TDX A;  2PBI A;  3ZMU A;  5DEQ A;  3DXJ F;  1ZRD A;  3ULQ B;  1FBQ A;  1MGT A;  1KU2 A;  1FYK A;  2XAQ A;  2BV6 A;  3F72 A;  4G6D A;  2L4M A;  1XCB A;  2HS5 A;  1S29 A;  2DBB A;  2HYG D;  2P5K A;  4CDG A;  1ZAR A;  4M6X A;  1SFU A;  4M9S A;  1CGP A;  4Q4Z F;  1LDJ A;  5H6R A;  1ZRF A;  3EQL F;  4MEX F;  1K78 A;  1XMA A;  1FBS A;  2XAS A;  1J2X A;  3V4G A;  1LJ9 A;  3WGG A;  3V7S A;  1HKS A;  5LGT A;  1ZRE A;  3GXO A;  4KA4 A;  4IXA A;  3WTX C;  1IXS B;  2OA4 A;  4CHU A;  1J59 A;  5E20 A;  3Q9V A;  5BOX A;  3KE2 A;  4KT5 C;  3WTT C;  5K5Q A;  3HSR A;  4HQM A;  4I09 A;  2H09 A;  5BS6 A;  2W84 A;  1FOK A;  2K27 A;  2FRH A;  3DV8 A;  4RGX A;  1SD6 A;  2ZME B;  3BZ6 A;  3U2R A;  2A61 A;  3E6M A;  3O3K A;  5ICF A;  2QM3 A;  1R23 A;  3HYI A;  4BH9 A;  2WTE A;  3T8T A;  2IRF G;  2VT2 A;  5D6F A;  2ZKZ A;  3I58 A;  2IA1 A;  2NS0 A;  4OOI A;  1FX7 A;  1W4M A;  1HW5 A;  4LLG F;  3IC7 A;  5DDG A;  2K4B A;  4Y17 A;  3CJN A;  3QP6 A;  4LK1 F;  3HRS A;  2PI0 A;  3ZPL A;  3EYY A;  1T38 A;  4R1H A;  3WOD F;  2GZW A;  1OR7 A;  4XSX F;  3W6J B;  4PDK A;  2W57 A;  4O5V A;  3FHZ A;  1T39 A;  1MJ9 A;  1IN7 A;  3KLN A;  5KK1 A;  1XGN A;  3V8K A;  2Q8K A;  1HXD A;  3I53 A;  4GYG A;  3FMR A;  3GUD A;  1ON1 A;  1G3Y A;  1HKQ A;  3KP7 A;  2VN2 A;  1S7A A;  2XGX A;  2A07 F;  4ZZL A;  1FPQ A;  4O6J A;  2VE9 A;  4NB5 A;  3ELK A;  3NQO A;  3RPU A;  2Q2E A;  1R5H A;  2VBW A;  1U5T A;  1CF7 A;  2IT0 A;  1P4A A;  4ZYD A;  2OQG A;  1W7P A;  3BWG A;  3F3X A;  5A2Q Z;  2V1X A;  1P2F A;  4KIG A;  2Z9O A;  3F6V A;  4HF2 A;  2UZK A;  1IXR C;  5KVR A;  3PFI A;  3HUG A;  1UHM A;  4ESJ A;  5FO5 A;  3KZZ A;  3KP6 A;  2FQ3 A;  3ECO A;  1I27 A;  4BAY A;  3QRF F;  2D1V A;  2OBP A;  2KIM A;  1K6O A;  1X3U A;  1Q1H A;  4A0Z A;  3HHG A;  4S05 A;  4OIQ F;  2A69 F;  2ISZ A;  5ERI A;  3KLO A;  3CTA A;  2QUF A;  2DT5 A;  2OU2 A;  2UWM A;  4QLC U;  4BQA A;  5J8F A;  3BY6 A;  1PDN C;  2L02 A;  2LKP A;  4U0Y A;  2DQL A;  4A0Y A;  5LHG A;  3T0Y A;  3TQN A;  1ZRC A;  1KA8 A;  2A3S A;  5DV5 A;  1EH8 A;  3GZ5 A;  3QPT A;  4WCG A;  3EET A;  2XHK A;  2V1D A;  4EGZ A;  2E7W A;  1LEA A;  4UUV A;  2E7X A;  3VB2 A;  1USS A;  5TRD A;  1FY7 A;  5LHH A;  2NNN A;  4D0P A;  3KEQ A;  2XIG A;  4MEY F;  3D5L A;  3TO6 A;  4QWQ A;  5D4R A;  3RYR A;  2JPB A;  2H27 A;  2YU3 A;  3NEU A;  3KCC A;  1ZGJ A;  4IRI A;  1R1T A;  5LGU A;  3COA C;  1IUY A;  3GYH X;  2ZME A;  4LLN A;  2E1N A;  2GXB A;  2Y0M A;  3E6B A;  2RGV A;  2DQR A;  3T5X A;  5BQT A;  5ILV A;  4P55 A;  5FLX Z;  1UCR A;  3TOB A;  3CO7 C;  3H3U A;  4AIH A;  2ZJ2 A;  4TV7 A;  2JSC A;  3E3V A;  5HS8 A;  2FEZ A;  5L3F A;  4L0Z B;  4Q47 A;  5CVV A;  1SMT A;  3WE3 A;  1YO5 C;  3I64 A;  4NHJ A;  3MCZ A;  1G3W A;  1XD7 A;  1RIO H;  2HKX A;  2H6B A;  1D5V A;  4ZH4 F;  3GX4 X;  4KIF A;  1ZG3 A;  2PN6 A;  2CYY A;  5ILU A;  4ETS A;  1I5Z A;  1RUO A;  1TLH B;  1U5T C;  3GFI A;  1U78 A;  1ZG1 A;  3DFG A;  3WTZ A;  3JAM Z;  3E5Q A;  1LQ1 A;  5HDN A;  2A5Y B;  3HRM A;  3L09 A;  4HV6 A;  1K78 B;  4A5M A;  4B8X A;  4A5N A;  2JT1 A;  3CDH A;  3V7R A;  2PFB A;  3R0A A;  1BBY A;  2MH9 A;  2XRO A;  5K1Y A;  2QQ9 A;  2ESH A;  1IN8 A;  2VXZ A;  4EM2 A;  3MFK A;  3WU1 B;  1V3F A;  1S3J A;  2PMH A;  5IT3 A;  2P6S A;  5ICG A;  4H0E A;  2R7F A;  2V79 A;  4OU0 A;  1I1G A;  3JSO A;  4G6Q A;  3Q5F A;  5FD5 A;  1BI3 A;  3EUH A;  1DDN A;  4UNO A;  2C6Y A;  2GQQ A;  1ONV A;  2GWR A;  3FX3 A;  3WTS C;  3TDU C;  1H9T A;  3I0T A;  2HDC A;  4KN7 X;  4GO1 A;  3RTR A;  4M9X A;  2FXA A;  3MAJ A;  2X4H A;  3V7C A;  3LST A;  4N9H A;  1R22 A;  3FXQ A;  1KYZ A;  4WXD A;  2CWE A;  2O03 A;  2CO5 A;  1UHW A;  2EFW A;  4ZYH A;  3GZ6 A;  1XDS A;  3K1N A;  3QPH A;  2KIF A;  3HSE A;  5LEK A;  1IN4 A;  3GFJ A;  4KUM A;  2ADU A;  4M71 A;  5J6X A;  1UB9 A;  4MNU A;  4DNC A;  4BHP A;  1AWC A;  1BM9 A;  2MD5 A;  2HQN A;  1SMY F;  2RQP A;  1DPR A;  4CIC A;  1D8K A;  5D6E A;  2RKH A;  2AS5 F;  5FGM A;  3ABU A;  2FSW A;  2HZT A;  4I0A A;  4XLN F;  3RI4 A;  2VOD A;  3HIF A;  1WI9 A;  1PP7 U;  4EJT A;  5HDK A;  2CFX A;  1XSV A;  3HTU A;  4M74 A;  1U5T B;  4A6E A;  2FML A;  3V8L A;  1U2W A;  4Y15 A;  4CO8 A;  4IF4 A;  4UXN A;  3P9K A;  5L3B A;  2NRA C;  4YIF A;  2EWN A;  4UV9 A;  1A04 A;  5HVQ C;  5L3D A;  1D3Y A;  1XSD A;  2DPD A;  2K7L A;  2H94 A;  3GWZ A;  4HW0 A;  4I98 B;  4XSZ F;  5FLX K;  1GVJ A;  3ZN0 A;  4HYE A;  1SAX A;  3SFZ A;  2ACJ A;  2CW0 F;  3E97 A;  5AIQ A;  3FZV A;  5E17 F;  2ZCW A;  5H20 A;  3DEU A;  1I6X A;  3KP5 A;  1E17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...