4M73A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHAFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m73A01
2MLGA 3QU3A 3TDZC 3HRMA 4G94A 2L3DA 3T5XA 4YIIA 1KQ0A 4KFCA 5D5XB 1ZRFA 4RB1A 4I09A 5HDKA 5F1RA 2NAZA 5HS8A 2DQLA 2GXGA 2YU3A 1E2XA 2L02A 5H6RA 2JTVA 3B02A 1J0RA 5F64A 3LAPA 2VBZA 3T8RA 2A3SA 2CGPA 4WXDA 4HOBA 3KLNA 3LQQA 3WTYC 1LDJA 1J7KA 1FLIA 2X0LA 3HHHA 1DPUA 5JI6A 1SFUA 4CXFA 4HW0A 3WE3A 1F5TA 3KP5A 2XKPA 4ASNA 3GVAA 1YO5C 3FF5A 5ILSA 2P6SA 2H09A 3EQLF 3CDHA 2VC1A 2KKOA 3CTAA 4LB6B 5D8KB 4BYYA 5HOOA 2H6BA 1SD5A 1P4XA 1FBQA 1BI3A 1F4KA 2FOKA 3E5XA 3I4PA 2MC3A 4IHSA 4BHPA 3GFJA 3QPTA 1B59A 3V4GA 1FBUA 1B4AA 1DUXC 1HSJA 3CUQC 2HR3A 3C18A 3FXUA 2JZYA 2M87A 2EJRA 4I98B 2F5CA 5LBQA 3I54A 2VT2A 2B0LA 3F8MA 4ZYDA 1IRFA 3F72A 1K6OA 2C6YA 4HV6A 1G3SA 2IPQX 2L4MA 2PN6A 4JBAA 2V1DA 2V6CA 3P9CA 1O57A 3E3VA 1ZLKA 1W7PB 2M1BA 1U5TB 5LHGA 4RS8A 2D2WA 3SQNA 1S29A 4M71A 2PFBA 2P5VA 2M8EA 5KK1A 3G3ZA 2COMA 4K2EA 2O0YA 3F22A 1FT9A 2IT0A 1TQPA 3QRFF 4UXNA 3RDIA 2H6CA 4YFKF 2Z99A 3MEXA 1B6AA 3HSFA 3JAMZ 5HLGA 2DAOA 3V7SA 1FC3A 1R1VA 4N9HA 4RB3C 3L9FA 5DCFA 1WRJA 3BJ6A 4G7OF 4B09A 1LQ1A 4PZJA 3ULQB 3EDPA 3BOQA 3R61A 4PCQA 4LG0A 1UB9A 4M74A 4GYGA 2HKOA 2ELHA 3FZVA 1U2WA 3GUDA 3CJNA 3I58A 5J8FA 1QQIA 2EV6A 1RNLA 2PQ8A 2Q0OA 2M30A 3KP6A 3I59A 3KP7A 4I02A 1MDMA 4XSZF 1XMAA 2A61A 3K1MA 1O3RA 2JRTA 3IKVA 4G7ZF 1BJAA 1RIOH 2RVCA 3P9IA 5E17F 3H3ZA 2FMLA 5ERIA 1S7AA 4JQFA 3JAMK 4EJOA 5LGNA 5FD5A 1JXSA 1SMYF 3C3WA 2X4HA 2HGCA 2Y48A 5D5VB 4WXHA 4WX9A 1D8JA 2PEXA 1J59A 2EFWA 5J6XA 2GA1A 2VONA 2MD5A 2KRFA 3GFLA 4OIPF 4CGZA 1O3SA 2A5YB 1ZRCA 5LEJA 4ENKA 2DI3A 1G3TA 1O7LA 4A5MA 1FBSA 2QYOA 5LGTA 1DP7P 2D45A 1I6XA 4M6YA 3ABUA 1YIOA 2G7UA 2ESNA 1TTYA 2XAQA 1ZG1A 4ENNA 1J75A 3F8BA 4UHTA 4HZFA 3IC7A 4ESJA 3HTUA 4BXUA 3SXYA 1KYWA 1S7OA 1XSXA 1C0WA 5BQTA 5JVTA 2PJPA 2GAUA 2NNNA 4A5NA 1LB2A 2QWWA 3V8KA 1BI0A 3BROA 1FSEA 2YX4A 2AS5F 4U0YA 2IRFG 3FMSA 4MHGA 1LEBA 1U3EM 2FNPA 1ODDA 3W6JB 2VN2A 4P9FA 1JE8A 1D8KA 4Q47A 3FM5A 1S6LA 4OOIA 4WCGA 4P5OA 4HDUA 1IN4A 2NNYA 1MGTA 1IXCA 1R1UA 2ZNYA 4IF4A 1YLFA 5LEKA 2RNJA 4RGXA 5K5QA 1EH7A 1ULYA 2CO5A 3E6BA 3JSOA 4PGHA 5KVRA 3ISPA 4RB2C 2EK5A 1QZZA 1J2XA 2MA3A 3TQNA 2W25A 2K7LA 1IW7F 2DBBA 4HAMA 4OMZA 4Y13A 3OV8A 3MZHA 3K9TA 1RUOA 4R1HA 3LA3A 3L7WA 1RUNA 1BM9A 4U0WA 2KIMA 3COAC 2FU4A 4UVAA 1F1ZA 4KA4A 3SZTA 4ENMA 1H0MA 1QO0D 1D3YA 1XD7A 1PP7U 1XCVA 2GXBA 4DQ2A 2KIUA 2K4JA 5HLHA 2HFHA 2OU2A 3LFKA 1HW5A 4WF2A 4XLNF 3E5UA 1SMTA 2LNBA 5L3BA 4FX4A 1V4RA 4DNCA 1U5TC 2K86A 2A6EF 4G8XA 5FFZA 4QLCU 3HRUA 4F7ZA 5K5OA 2IJLA 1G4DA 2DFIA 3O6BB 4HLXA 4M9XA 1ZARA 2Z9OA 3WTZA 5DDGA 5L3FA 4BHCA 1OR7A 3GZ5A 4HF2A 3JW4A 1OYYA 4MEXF 1KU3A 4RAZA 2EFOA 1QPMA 4OIOF 4UV8A 3ZPLA 1IN7A 1SD4A 3HIFA 3VODA 1RI7A 4H0EA 1YQAA 4G9YA 2QUFA 2VXZA 1WSUA 2DQRA 3PFIA 2EA2A 1YS6A 1GXQA 3ZMDA 4FT8A 5CVUA 3O3KA 1T0FA 3I53A 4KIGA 2FNAA 2XGXA 5FO5A 4KICA 5DD8A 1MKMA 4AIJA 2EFQA 3F3XA 1R5HA 4U7BA 1Z7UA 1R1TA 3F21A 1MD0A 2ADUA 3N4MA 3BWGA 3JSPA 2EV0A 3HSEA 2HWVA 3VEPA 1STZA 2RN7A 2W57A 4YIFA 1BI2A 3HTSB 4KIBA 2GIVA 2JSCA 4LG0B 3ECOA 3SHFA 4GGGA 1Z05A 2HZTA 2ISZA 2EWNA 4M73A 2QBYB 2HYGD 4WK8F 2IA0A 5E1WA 2A07F 5DUKA 4AIHA 3L09A 2E7WA 3IKTA 2Z3YA 3I59B 2Y0MA 5IT9K 3E6DA 1MDMB 2HTJA 3FXQA 4P9UA 2E7XA 3WU1B 4I2OA 2P8TA 5HDNA 3FMRA 5CVJA 2BE5F 1ZGAA 3R6SA 2PMUA 3HRTA 1KU7A 4Q48A 4I0AA 1IN6A 4EJUA 4HA8A 4TV7A 3IWZA 4KDPA 1ZLJA 1W7PD 2ZMEA 5L3GA 2LF8A 1OPCA 2XKOA 4ON0A 1T38A 1Z1DA 1REPC 4MEYF 1O3TA 1MJ9A 1P92A 4KUMA 4O6JA 1FP1D 1QBJA 4A0YA 2IA1A 3V7RA 4ZH4F 1GHCA 1MJBA 3CLOA 1TLHB 1TNTA 4Q5SF 1KU2A 3ELKA 5BOXA 2VOOA 3MCZA 4KN7X 2XROA 1KU9A 3TKYA 4JK1X 2HYFA 3M7GA 2UZKA 3KLOA 1YS7A 1E17A 3M9AA 1Y0UA 2MBFA 3KE2A 5BPDA 1U78A 3K2ZA 1ZN2A 1IAWA 1T2KA 3EYIA 4I7HA 4RGRA 3KP2A 2DK8A 3F8NA 4M9SA 2IP2A 5HS9A 1H9GA 2V79A 2OZUA 2DPUA 1ZYRF 2STWA 3WTWC 5DUIA 5H6QA 5ILUA 5IT3A 2YX7A 1GVJA 2L54A 3T8TA 2KJBA 5LRSA 1T98A 1USTA 2WC2A 2FE3A 3F8CA 4MGRA 1XSDA 1QNTA 3DPTA 2MH2A 4EJVA 3IRRA 5A2QZ 3B73A 1DDNA 2RV8A 1JGSA 3L2CA 4R8HA 5CVVA 4G6DA 1BN5A 1KA8A 2Y75A 3WTXC 3GO5A 4M72A 3Q9VA 1AWCA 3I71A 2H27A 4OINF 1R23A 4LD5A 1CF7B 3U2RA 4ZZLA 3BPXA 2K02A 1YG2A 3TO9A 2LKPA 1FX7A 2R3SA 4EJWA 3J7AO 4G7HF 2JPBA 3CO6C 4L5JA 2HS5A 4L0ZB 2CW0F 3WTTC 5LHIA 1QGPA 1ZG5A 1XGMA 4BHBA 3DXJF 3J80Z 4UUVA 3K0LA 2PMHA 2DU9A 1S3JA 1WWXA 4A0XA 2HEOA 4L9TA 3BJAA 4EV0A 3R0AA 1GXPA 3U1DA 1LEAA 2FMYA 5E8GA 1TW3A 4A6DA 4HQEA 3KCCA 5A2QK 4EMSA 2ISYA 1UHWA 5BPIA 1AOYA 4IVNA 4KMUX 4EM0B 2CWEA 1ZH5A 4CHUA 3K1NA 4ZYEA 2RDPA 4LLGF 4A6EA 1ZAOA 3N97A 5DCMB 1HKTA 4BQAA 1IN8A 4Z2YA 1O7FA 5J8CA 4P96A 1LNWA 4EM2A 1HBXG 2D1VA 3R0JA 3R60A 2AXLA 3TO6A 3S2WA 1FYKA 4HYEA 6PAXA 4HBLA 1BIAA 1I5ZA 3RIRA 1FPQA 4HDVA 2UXNA 1XDSA 2QM3A 2DK5A 4XRFA 4MQVA 4KYWA 3J80K 4I0BA 3KEQA 3FMQA 2OD5A 1K79A 4HLYA 3MWMA 1PP8F 3GWZA 3DV8A 1BI1A 2TDXA 3FXRA 2FA5A 2DW4A 1TBXA 2FEZA 4HX4A 1WKMA 1FP2A 1IXSB 4WWCA 3L00A 3BPVA 3H92A 5EEGA 5HDGA 1ON2A 2H94A 4P55A 1Z6TA 1BC7C 2CQKA 5FLXZ 5JHUA 2HKXA 4M6XA 5ILVA 1YW7A 4U0VA 5JR3A 3BY6A 4HQMA 2OAZA 4A0ZA 2XRNA 4RB0A 3HSRA 3GYHX 3FM3A 3KP3A 1R7JA 3HOTA 2R7DA 1R00A 3LSTA 2ZJ2A 1W7PA 2P5KA 3C1DA 3LA2A 1YW8A 2KJCA 3EUHA 1XN7A 1F9NA 2GZWA 3RYRA 2HDCA 3MFKA 2MH9A 5CYVA 3MZYA 1A04A 2FBKA 2XAFA 2V1XA 5L3DA 1RZ4A 3GLXA 1HW2A 2P4WA 3V8JA 2M45A 4L5IA 4CZZA 2DTRA 2FQ3A 2W84A 4KIFA 3BDDA 2ZMEB 3Q9SA 2ZKZA 2BGCA 3F6VA 1EH6A 5ICGA 2ZFWA 2LSOA 3KZZA 2QVOA 2JT1A 3VFZA 4KT5C 3FHZA 2F5EA 3GF2A 2PLYA 4OIQF 2O8XA 1K78A 1LVAA 1XGNA 4LK0F 4RAYA 3R4KA 4BAYA 1B9MA 2XVCA 3QAHA 3FX3A 2PG4A 3OOPA 4CICA 3V7CA 3P7NA 2A68F 4S04A 3ZN0A 4D0PA 3RJPA 3M1EA 5HVQC 3IHUA 4ESBA 1HQCA 3QOPA 2ACJA 2YPRA 2P6TA 5LHHA 4CO8A 3G73A 2LF7A 3WE2A 4GCVA 3U9GA 1B1BA 2QQBA 1L3LA 4IRGA 3V8LA 1HW1A 1OKRA 3GFIA 1FZPB 3ROUA 2A69F 1R36A 4LGWA 2M5WA 5E1ZB 1O3QA 4EQQA 3I5UA 3QP5A 3TO7A 2G7HA 5FD6A 3F6OA 4PGGA 1W4MA 2XAHA 3TGNA 3I64A 4EM1A 4YFNF 4HF1A 3F23A 4M9ZA 1U8RA 3BZ6A 1TQIA 3MAJA 5CVIA 2O6GE 1SAXA 4L9VA 1S8NA 2ETHA 4MTDA 2OA4A 1HSTA 3DKWA 2V9VA 3DP7A 1R5GA 2KIFA 1LJ9A 1XMKA 1I1GA 3QU6A 2BV6A 4N0BA 5AIQA 3GXOA 4IPAA 2FF4A 4GYIA 5ICEA 4ENJA 1OYIA 3CUQA 3LA7A 3RTRA 3NRVA 2RQPA 3ABTA 2NRAC 1WQ2A 4XLPF 3ZMTA 1QZYA 4U7DA 1EH8A 3WGGA 2L01A 2OBPA 3T1BA 2VBXA 2NS0A 2BBYA 1SD6A 2Q8KA 1L0OC 3ZMUA 2VC0A 4E70A 2EB7A 1ZHFA 2QLZA 2VT3A 1J5YA 4L0YB 3ZN1A 2DPDA 3ERED 2VBWA 2XV4S 2DO7A 4UVBA 1H9TA 2VE8A 4KMFA 5LGUA 2GQQA 1G3YA 2ZO4A 4O5VA 2CFXA 4EGZA 3GX4X 1USSA 4NHJA 2ZBKA 1KQ9A 3H3UA 2RC4A 4MNUA 3WTSC 2V1UA 4OMYA 1WI9A 1SD7A 4S05A 2EFPA 2P7VB 3M8FA 1ON1A 1U6GA 1IN5A 3LWFA 2FBHA 2GA2A 1FWZA 3J81Z 2XHKA 5D8LB 4I01A 2F2EA 5D6FA 1VTNC 2FSWA 3QPHA 2K27A 2VODA 5HLIA 5D4SA 5E20A 4BH9A 3LAJA 1HKQA 4FX0A 4Q4ZF 1PDNC 3RKWA 4FHTA 4KNYA 2XAGA 3O2PE 2ESHA 4B8XA 4KN4X 3TOAA 1CGPA 1I1SA 3WGHA 1UFMA 2O03A 3RI4A 3KZYA 2FBIA 3IL2A 3SZPA 4XBFA 3ML6A 4ETSA 1XGSA 4LB5A 3IRQA 2YSRA 5FGMA 2Q2EA 3WGIA 4O3MA 3WODF 1ZREA 5D5WB 1SFXA 1Q1HA 3EYYA 3RKXA 2R7FA 1BOAA 4MTEA 4AIKA 5CLSA 1KGSA 3D0SA 4HV5A 3HYIA 1K7AA 3J81K 4BNCA 1BIBA 5DD4A 2Z5UA 2DT5A 1P4WA 1P2FA 2E1NA 2XUBA 1ZGJA 2CYYA 3E6CC 1HXDA 2QQ9A 3DQVC 1MZBA 5ICCA 2QQAA 3ZQ7A 3F8FA 2XIGA 4OIRF 2EV5A 3K1PA 1FOKA 1FYLA 3ECHA 5AIPA 3REOA 5JFRA 3QP6A 4LJZF 4A2UA 2A6HF 3JTHA 4L9NA 4IJAA 1EV7A 4AWXB 2FRHA 5BS6A 1K78B 1JHHA 3ZP5A 3KETA 2QBYA 2WV0A 1FSHA 3PQJA 3TDUC 2WWYA 1D5VA 1UHMA 2BEOA 5E8IA 5BMZA 5F6FA 4EJTA 3RKYA 1TW2A 4EGYA 4RGUA 1OMIA 2PI0A 2ZNZA 3K69A 5K5RA 2D1HA 2HQRA 3NQOA 3FWEA 3ZMVA 4GO1A 2J5PA 5DYMA 1G6NA 2ZCWA 2ZXJA 5ICFA 1YW9A 3ZMSA 4UV9A 1T39A 4LFUA 2OQGA 1ONVA 1W5SA 1KYZA 2RGVA 5LLQA 2P5LC 3EETA 2LDUA 3DF8A 5DV5A 3WG9A 4AD9A 5DEQA 5HS7A 1FY7A 2MLKA 3MQ0A 4WXCA 3T0YA 2G9WA 1IUYA 1YYVA 1BC8C 1XB4A 3JTGA 2XASA 5TRDA 4ZZDA 1ZRDA 5E18F 2CG4A 1TNSA 1FYMA 4HF0A 4IRIA 3WU0A 2W24A 3P9KA 3GEZA 5K1YA 2HTSA 5L3CA 3GW2A 2JPCA 4IRHA 4Y17A 5CVRA 3GZ6A 4RGSA 1R58A 1Z6RA 4AVPA 3I0TA 3RPQA 5ED4A 3CUQB 2EA4A 1P4AA 4N9IA 3IWFA 3WTUC 2K4BA 3HHGA 1U5TA 4LLNA 3WTVC 4HX8A 4NB5A 4OU0A 1XGOA 2L4AA 2UXXA 1YFHA 4A12A 2PBIA 5AONA 2F5FA 5H20A 4EVIA 5D4RA 1PUEE 5D5UB 1IZ1A 2O3FA 1OYWA 3SFZA 4UVCA 1P6RA 3BP8A 4QWQA 5E1XA 4GXOA 3HRSA 2GWRA 4L9JA 1YTYA 2IVMA 4XSXF 2HOEA 1SFEA 3TOBA 3RYPA 5D6EA 1IRGA 1CF7A 4ZYHA 2BYVE 2FXAA 3HOSA 5FLXK 3DPLC 1B9NA 3NEUA 1I27A 4NQWA 2IW5A 2E1CA 1R22A 3W6KB 3E6MA 5TJJA 1XSVA 3BJOA 2VE9A 1X3UA 1JHFA 4L18B 1FNNA 2VBYA 2EFNA 4HX7A 2QENA 2HQNA 5LRRA 4LK1F 2OQRA 3DFGA 2P7CB 3C7JA 1ZG3A 1LDDA 4YFXF 1IXRC 4IHTA 1BBYA 2J5OA 4PDKA 4CDGA 4LMYA 2OZ6A 5EEHA 3CO7C 4IXAA 1XCBA 3DEUA 3KEOA 3PQKA 4ESFA 3M8EA 2DLLA 4G6QA 1DPRA 4R79A 3KP4A 3ZMZA 2XAJA 2NYXA 4U88A 4LLLA 3AAFA 5DCMA 2W85A 2YR2A 1Z91A 2VOPA 3E97A 1LDKB 3VOEA 5FB2A 1J9IA 3VB2A 1UCRA 2CSOA 1T6SA 2STTA 3LQRA 1Z9CA 3D5LA 3CUOA 1NHAA 2O61A 4YG2F 2Z33A 4Y15A 4UNOA 5IT9Z 4MQ9F 3KFWX 3GFMA 1IF1A 5CJ9A 1TQMA 1XDUA 2WTEA 2UWMA 1V3FA 3Q5FA 1G3WA 3E5QA 4CYDA 1W5TA 2F5DA 2RKHA 5FFXA 2QZ8A 2IA2A 1MJAA 3HUGA 1KQ8A 3RPUA 1HKSA 5L3EA 4ZYGA
chains in the Genus database with same CATH superfamily
2UUZA 2MLGA 1ERDA 1D5YA 3QU3A 4CUGA 4II2A 4JOMA 3TDZC 3HRMA 4G94A 4ZC3A 1PUFA 2L3DA 3T5XA 2K5CA 3FXMA 1KQ0A 4YIIA 3VYUB 5FROA 3S14J 4KFCA 5D5XB 3RSNA 5C3EJ 1ZRFA 4RB1A 4I09A 4B4CA 5HDKA 2L5QA 3JRGA 1S72I 3GTQJ 3TP3A 5F1RA 2NAZA 5IY5H 1OCZH 5HS8A 5J1RA 2DQLA 2DYRH 2GXGA 4RBOA 4U87A 3CCLI 2YU3A 1E2XA 2L02A 5H6RA 2JTVA 3B02A 1J0RA 1YHQI 2QA4I 5F64A 4DZPA 2VBZA 3LAPA 2XSJC 4Y52J 3S32A 2JA6J 4PJ0C 3CP8A 1B72B 2KT0A 1FIAA 2ELJA 3T8RA 3PNVA 2A3SA 1FOXA 3H9JA 1RKWA 2Y0SA 2CGPA 4WXDA 4HOBA 3MD2A 3KLNA 3LQQA 3WTYC 3DLLF 3DTEA 1RETA 4XKWA 1LDJA 2K9NA 1J7KA 4HEA2 2DMQA 5EJCA 2LMDA 3F0CA 1YIJI 2BVMA 1FLIA 4DYRA 4LG3A 1YI2I 2X0LA 3HHHA 4JP0A 1DPUA 2WAFA 5JI6A 1SFUA 4CXFA 3VYRB 1WZ2A 4HW0A 3WE3A 3CCJI 1F5TA 2QQ8A 3KP5A 3G4SI 4CYCA 3J7ZI 3H1CA 2XKPA 4ASNA 3DTKA 3GVAA 1D1BA 3CZ6A 1D1CA 1YO5C 3A01A 3FF5A 2QKLB 2IEKA 5ILSA 2IGMA 2P6SA 2H09A 3EQLF 4MIMA 4A3KJ 3CDHA 1D1AA 2VC1A 2KKOA 3CTAA 3PNYA 4LB6B 2CRGA 4A3DJ 3BQYA 2VB6A 4BDYA 5IYDJ 2ZJPF 1AA7A 5D8KB 3D5SC 4BYYA 3LSHA 5HOOA 2H6BA 3GTMJ 1SD5A 1P4XA 1FBQA 4QIWN 1BI3A 2DMTA 2E60A 5TGTA 1F4KA 2OC6A 1A36A 2FOKA 3E5XA 5IP6A 3KYLA 3I4PA 2MC3A 2RQQA 2FJ1A 4IHSA 2VQCA 4BHPA 3GFJA 1JTXA 3QPTA 1B59A 3V4GA 1FBUA 2CS3A 1B4AA 1DUXC 3H5AA 1HSJA 3DEEA 2KRHA 3CUQC 1NG6A 3I3LA 2Q1ZB 4FTHA 1I3AA 5HNHA 2HR3A 2L9NA 1RPWA 2WY8Q 1NH3A 3BQZA 4XONA 3C18A 2CJJA 3GLLA 1YJ9I 1ENHA 3FXUA 4I76A 2JZYA 3ABMH 2M87A 4D9JA 2EJRA 3CC2I 3J7AY 4I98B 4PJMA 2F5CA 5LBQA 3I54A 3AKZA 2W1OA 4CA0A 2VT2A 5EG0A 2B0LA 2DFHA 3A0HC 3F8MA 4IEJA 1U0JA 4ZYDA 4BE1A 1IRFA 3WG7H 4IO9F 4BKXA 3F72A 1K6OA 4EATA 5K7HA 2KL4A 3B6AA 1WH7A 3O8GA 3HM5A 3BG5A 4DZJA 2OCEA 5J40A 1XS9A 2C6YA 4HV6A 1G3SA 5FLMJ 2IPQX 2L4MA 3SZGA 2BXYA 2PN6A 1VNDA 3UKGA 3ZRGA 3BZCA 2V1DA 2V6CA 3P9CA 4HNUA 1O57A 4J19A 3E3VA 1NTCA 1ZLKA 1W7PB 4IHWA 5C4XJ 2M1BA 1U5TB 5LHGA 3OIOA 4RS8A 2D2WA 2P0WA 1WPKA 3SQNA 3GTLJ 1S29A 4M71A 2DT7B 2PFBA 1AKHA 2P5VA 1BA5A 4DGWB 2M8EA 1OLTA 5KK1A 3EUKL 3G3ZA 5EZGA 2COMA 2MW8A 4K2EA 4RDUA 2L9RA 1YITI 2O0YA 3F22A 2L2OA 1FT9A 1ZR2A 2IT0A 2WAEA 3JRHA 3GTPJ 1TQPA 4G6TB 3QRFF 5B66C 5F08A 4IHXA 4UXNA 3RDIA 4Z6YA 2CQNA 2H6CA 2VJJA 2LBFA 1MSEC 4YFKF 2Z99A 2E19A 3MEXA 1B6AA 1MBKA 3HSFA 3JAMZ 4HPQA 4JX4A 5HLGA 2GIZA 2DAOA 3CQZJ 3V7SA 1MBHA 3SEQA 1FC3A 1R1VA 4N9HA 4RB3C 3L9FA 5DCFA 1R6RA 1WRJA 3BJ6A 4MO7A 2BY1A 4G7OF 3HB9A 4B09A 1LQ1A 2CUZA 4PZJA 2M8GX 3EDPA 3ULQB 5J1UA 3BOQA 3PFYA 4PJNA 3BTIA 1S7EA 1PYVA 2DA3A 3R61A 4HSRA 4X0GA 3ZOBA 3K4KA 4PCQA 1YRNB 1QHHD 4XLAA 4NQWB 4LG0A 1UB9A 3K7AJ 4M3DA 4M74A 3H0GJ 3TEDA 4B47A 4GYGA 2Z1DA 1ETQA 2ELHA 2HKOA 3FZVA 2DJIA 1U2WA 3GUDA 3CJNA 2ZC2A 3I58A 2E1OA 1BW6A 2N8GA 5J8FA 1QQIA 3A0BC 3LFUA 2EV6A 2D5VA 1RNLA 2BW3B 4DW6A 2PQ8A 2Q0OA 5DM7F 2EIJH 2M30A 3KP6A 3IAM2 3I59A 5KAFC 4CCNA 3IH2A 3KP7A 4I02A 3HEFA 1WJEA 3H3VK 1PJRA 1MDMA 2A05A 3BR5A 1VF9A 1XMAA 4XSZF 4HG2A 2A61A 3K1MA 1IV8A 3KZIC 1O3RA 2JRTA 2I10A 3IKVA 4G7ZF 2EH3A 1BJAA 2ZB9A 1RIOH 4MLOA 3I9V2 2RVCA 3P9IA 5E17F 3H3ZA 2FMLA 5ERIA 1S7AA 1IJWC 4JQFA 3JAMK 4KT6A 3BLYA 4EJOA 5LGNA 5FD5A 2ID3A 1JXSA 1SMYF 3BR1A 3C3WA 4II3A 2X4HA 2XRLA 2HGCA 2Y48A 3OSGA 3CC4I 1POGA 3IH3A 2K3PA 5D5VB 4WXHA 3M3YJ 4WX9A 1D8JA 2HYJA 2PEXA 1QHGA 1J59A 4PUSA 2EFWA 4GRIA 2CQ7A 5J6XA 2GA1A 2KLOA 1TT0A 2MD5A 2VONA 2KRFA 3DPUA 2LY2A 3PSFA 3FIWA 1T56A 9ANTA 3LL7A 2DMPA 1SAUA 3GFLA 4OIPF 4CGZA 2HPIA 1O3SA 2A5YB 1ZRCA 5LEJA 4ENKA 2DI3A 2F4MB 1G3TA 1OCPA 5FKOA 1O7LA 4A5MA 1FBSA 2M34A 2QYOA 2KZGA 4BBSJ 5LGTA 4RM3A 4AIDA 5DTDA 1DP7P 2V7FA 2XF5A 2D45A 2OPTA 1I6XA 4M6YA 3ABUA 2M0MA 1YIOA 2G7UA 1X58A 2DYSH 2ESNA 3FK7A 4XN0A 1TTYA 2XAQA 1ZG1A 4ENNA 1TWAJ 1J75A 3F8BA 4UHTA 2JVGA 1WJFA 4HZFA 5IYCJ 3IC7A 4ESJA 3HTUA 4BXUA 3SXYA 4NC6A 1KYWA 1QPIA 1S7OA 2GM4A 1XSXA 5M5WJ 5EDNA 1C0WA 1MBJA 3PIOF 5BQTA 5JVTA 2PJPA 2FD5A 4BS9A 2GAUA 1ZKGA 2NNNA 4UUSB 3FXLA 4A3LJ 1BR4A 3KYCB 4A5NA 4F3QA 1LB2A 2QWWA 3V8KA 1BW5A 1BI0A 2LLKA 3BROA 3HUGB 1FSEA 2YX4A 2XPWA 4HRIA 2AS5F 3JRBA 4U0YA 2W48A 2IRFG 3I56I 2KRCA 3FMSA 4ZDLA 2VL8A 4N4OB 5HLTA 4MHGA 1LEBA 2L9VA 1U3EM 2FNPA 4HSTA 2OTJI 1ODDA 2R7UA 3FK6A 3W6JB 2VN2A 1PUFB 1T33A 4P9FA 1JE8A 3HOXJ 1D8KA 4Q47A 3FM5A 2KIQA 1PVEA 2HPMA 1S6LA 4OOIA 5J3LA 1TC3C 4WCGA 4P5OA 4HDUA 1V5FA 1IN4A 2NNYA 1R9TJ 1MGTA 3L2VA 1E3OC 2QF7A 3K10A 1R4NB 3K70C 4V2FA 1Y1WJ 4RMNA 3W2WA 3N05A 1IXCA 1R1UA 2ZNYA 2DXIA 4IF4A 1V55H 4NBQA 1VQ9I 2KP6A 3LNQA 1P7JA 4YELA 2K40A 1YLFA 5LEKA 3BR0A 1CQTA 1IDYA 2RNJA 4RGXA 1MH4A 3BTJA 4M3GA 1EH7A 5K5QA 1ULYA 3NWSA 1IRZA 2F4OB 5M5YJ 2CO5A 3E6BA 3OL3A 4PGHA 3JSOA 3W2AA 3S93A 2DDAA 5KVRA 3ISPA 4RB2C 3MN2A 3PUBA 3IAS2 4XLCA 1P9QC 1LFBA 2EK5A 1QZZA 2NOJB 4M3BA 4CH7A 4D7NA 1J2XA 2MA3A 2HXOA 3TQNA 2W25A 3H35A 2K7LA 1IW7F 3ZQHA 2DBBA 3JRFA 4HAMA 1TWHJ 2EINH 2L9SA 5E3NA 5EGOA 2CUJA 1Z3XA 4OMZA 4CYCB 4YIRX 4Y13A 3OV8A 3G1LA 3MZHA 2M0CA 3LSRA 3K9TA 2K9LA 3A01B 4B3AA 1RUOA 4R1HA 1U9OA 4IX7A 3CESA 3LA3A 3L7WA 3KPHA 5GTHC 2XB0X 1RUNA 1BM9A 3QWLA 4U0WA 2KIMA 3COAC 1FTZA 1NG7A 2FU4A 3K4LA 4UVAA 1F1ZA 4UB8C 4KA4A 3SZTA 1SVMA 1VI0A 4ENMA 1QO0D 1H0MA 1JGGA 2JUCA 4DYCA 1D3YA 3VSLA 2NVTJ 1XD7A 3K4BA 1PP7U 2YU9J 1XCVA 2GXBA 4BACA 4DQ2A 2KIUA 2K4JA 4M6VA 4XKBA 2Y69H 1AU7A 5HLHA 1OJLA 2HFHA 2WA0A 2OU2A 3LFKA 1HW5A 4WF2A 4BJTA 4XLNF 3E5UA 1SMTA 2R7RA 5LFAA 2LNBA 5L3BA 4FX4A 2W7NA 1VQ8I 1V4RA 4DNCA 2YUSA 1VQKI 1JI8A 1U5TC 2K86A 2Y9YA 1GVDA 2A6EF 3MKZA 4G8XA 5FFZA 1JT6A 4QLCU 2W82A 3HRUA 4F7ZA 3QOEA 5K5OA 3DLAA 4NUBA 5EG0B 4CCKA 3S1MJ 2IJLA 2HOTA 1G4DA 2DFIA 2NXNB 1VQLI 3O6BB 4E7LA 4HLXA 2M7BA 3S1NJ 1K4SA 4M9XA 1ZARA 2Z9OA 3L2RA 3VDXA 3JREA 5DS9A 3WTZA 1D0YA 5DDGA 5L3FA 1DQUA 4BHCA 2GBYA 1OR7A 4JYKA 3ABKH 3GZ5A 4BQOA 4UY8I 2R5ZA 4HF2A 3JW4A 4E7IA 1OYYA 3K4NA 4I99C 4MEXF 1MMAA 1KU3A 3WU2C 4RAZA 3RQIA 3MVPA 2ZJQF 1QPMA 2EFOA 4DOZA 4OIOF 2LH9A 4UV8A 3ZPLA 1IN7A 1SD4A 3HIFA 3VODA 4XQFA 1RI7A 4H0EA 1YQAA 1HDDC 1QZEA 4G9YA 2QUFA 2VXZA 2A6TA 1WSUA 2DQRA 3PFIA 2EA2A 1JKRC 2PJRA 1YS6A 1GXQA 3ZMDA 4FT8A 5CVUA 3JCUC 4OAZA 4BXXJ 2LBFB 3O3KA 1T0FA 5F0HA 1MNEA 2HOAA 4IQ4A 3I53A 3K70D 2CW8A 4KIGA 2FNAA 2XGXA 5FO5A 3CJRB 4KICA 5DD8A 2NS7A 1MKMA 3ZGKA 4AIJA 2EFQA 3AG2H 2HOSA 2MYSA 3F3XA 1ETKA 4A3FJ 3HPHA 3WHCA 4FE4A 1A5JA 1R71A 3B6CA 2X1CA 3W2VA 1R5HA 2Y2ZA 4U7BA 1A6QA 3AG4H 1Z7UA 1R1TA 3F21A 2OF7A 5B5EC 3LSJA 5HNFA 4XORA 1MD0A 2ADUA 3ABLH 3N4MA 3BWGA 3JSPA 2WBMA 2COBA 2BHYA 4XLHA 2EV0A 5HODA 2GOXB 3HSEA 2HWVA 3VEPA 1STZA 2RN7A 2W57A 2HZDA 4YIFA 2O8KA 1BI2A 3HTSB 4KIBA 2GIVA 2JSCA 2VKEA 4LG0B 3ECOA 2LG4A 3G71I 3SHFA 1ZGWA 4GGGA 2NVUB 1Z05A 2HZTA 5FKNA 2ISZA 1TWGJ 3OMYA 2EWNA 3LOCA 4M73A 3BT9A 2DOFA 3M1CA 2KZVA 3CCUI 2QBYB 2HYGD 2WB1N 3Q0UA 4WK8F 2ICWG 4V19K 1W0TA 2IA0A 3F9KA 5E1WA 2A07F 5DUKA 2DFFA 4AIHA 3L09A 2F48A 2E7WA 3IKTA 2Z3YA 2OJED 2VASA 1VQ6I 5GAGJ 3I59B 2NVYJ 4C9YA 1WGXA 1ETXA 2Y0MA 5IT9K 2L7ZA 3E6DA 1MMSA 2QSHX 1MDMB 2HTJA 2IBDA 3OYDA 1D0XA 1WVRA 3FXQA 4P9UA 4QTRA 2CH0A 2E7XA 4FE7A 3WU1B 4I2OA 4IQJA 4UUTA 2P8TA 5HDNA 3FMRA 3W6VA 5CVJA 5J4YA 3SDGA 2BE5F 1ZGAA 2E71A 3JR9A 3R6SA 2K9SA 2PMUA 2LP0A 2VPRA 3HRTA 2CMPA 1KU7A 1TZLA 4Q48A 5B3SH 4I0AA 1IGNA 1IN6A 4EJUA 2MFZA 4HA8A 4TV7A 3IWZA 4KDPA 3LSPA 1I6HJ 2ZSHB 1ZLJA 1RR8C 1W7PD 4C2MJ 3V42A 5F04A 3IUOA 2DA4A 2ZMEA 5L3GA 2LF8A 5C44J 2NOGA 4BGDA 1OPCA 2DFEA 2XKOA 2DA2A 2BHZA 4ON0A 4BBRJ 1X4PA 2Y30A 1Z1DA 1T38A 1W36C 1REPC 4MEYF 1O3TA 2K9QA 1MJ9A 1P92A 2X48A 4AYBN 4E7SA 2FOWA 2R7SA 4HNTA 4KUMA 4O6JA 1FP1D 2R4GA 1U8BA 1QBJA 2LVSA 4A0YA 2IA1A 3V7RA 2OUMA 4ZH4F 2CV0A 1H8AC 3K4CA 3OYGA 2KQRA 1GHCA 1MJBA 2M7AA 3CLOA 4Y4RA 3A03A 1VZ0A 3CCSI 1TLHB 1F36A 4V2GA 2DMUA 1TNTA 4Q5SF 5H2FC 1KU2A 5C4JJ 3ELKA 5BOXA 2K85A 1DU6A 1XG1A 1YE9A 3FXKA 2VOOA 3MCZA 2X85A 1Y0NA 1QVTA 5GPAA 1HA8A 4BJ5C 1X1AA 4KN7X 5CPRB 2XROA 1R49A 2IXSA 4I6ZA 1KU9A 1MMGA 3TKYA 2KFDA 4JK1X 1VQPI 2HYFA 3M7GA 1WH5A 3KLOA 1YS7A 2UZKA 1E17A 3M9AA 1T95A 2E5ZA 1Y0UA 1SVLA 5EF6A 4BE2A 2MBFA 2XPUA 3KE2A 1FOYA 2ZFUA 5BPDA 3DKYA 1U78A 2EIKH 3K2ZA 3A02A 1YX5A 1ZN2A 4EEFG 1GDTA 1E3HA 1IAWA 1T2KA 3EYIA 4I7HA 2X9DA 1HF0A 5JVGF 3OYLA 1T8IA 2KMUA 3OYNA 4RGRA 3KP2A 1BOBA 4IL6C 2LY9A 2XGEA 2DK8A 3OYBA 3F8NA 4M9SA 5M3MJ 1XMXA 1SEUA 2IP2A 3NARA 5HS9A 1LUJB 4AUXA 1H9GA 2V79A 2OZUA 2DPUA 1ZYRF 2STWA 3WTWC 2ELKA 5DUIA 5H6QA 5ILUA 5IT3A 3ERMA 2YX7A 1GVJA 2L54A 3KX2A 3T8TA 2KJBA 2EZIA 5LRSA 2VJ5A 2WC2A 1T98A 1USTA 2FE3A 3F8CA 3RCOA 2K9MA 4MGRA 1XSDA 1G2HA 1QNTA 3DPTA 1MBFA 4A3EJ 1OQYA 2DT6A 2MH2A 4EJVA 1MSFC 3IRRA 5A2QZ 3B73A 4CCMA 1YX3A 1DDNA 2RV8A 3H9QA 1JGSA 4F55A 2DA6A 3L2CA 4R8HA 1RC9A 2IGKA 4G6DA 5CVVA 1BN5A 2ZXWH 3Q3SA 1KA8A 2Z2SB 2Y75A 2MC4A 3AG3H 3WTXC 3GO5A 4M72A 3HOZJ 3Q9VA 4XRMA 1XTAA 1Z7LA 1X2NA 3A1YA 2VJIA 4L5EA 1AWCA 3I71A 2H27A 2CW7A 1N77A 4OINF 1LFPA 2L7FP 1R23A 4BJ6C 1MMDA 1SC7A 4C30A 4JX5A 4LD5A 1CF7B 3U2RA 4ZZLA 3BPXA 4XN3A 1ZQ3P 2JA7J 2K02A 1X19A 1YG2A 3C2BA 3TO9A 2LKPA 1FX7A 3CMEI 2R3SA 2HNHA 3LMMA 3FKJA 3OOUA 4EJWA 3J7AO 2W00A 4G7HF 1QU3A 5L3EA 3QYFA 4BDZA 2V6EA 2JPBA 3CO6C 4BE0A 4L5JA 3FISA 2HS5A 4L0ZB 2CW0F 3WTTC 3CCVI 5LHIA 3QPSA 2LREA 3PO2J 5GPCA 1DGRM 1QGPA 1ZG5A 1XGMA 4BHBA 3HOUJ 3DXJF 3J80Z 4UUVA 1EA3A 1HC8A 3K0LA 3D5RC 2PMHA 5BNGA 2IS4A 2DU9A 1S3JA 4PJJA 1WWXA 1SFOJ 4A0XA 4F91B 2HEOA 3I4MJ 4L9TA 2KPMA 3BJAA 2WB1A 2QKMB 5F27A 4EV0A 1JT0A 1W36D 2B7EA 3BC8A 1WCMJ 3R0AA 4A3MJ 1GXPA 3U1DA 1LEAA 2FMYA 4E7JA 5E8GA 2YS9A 1TW3A 3UNGC 4FASD 3L2QA 4A6DA 4HQEA 3OS2A 3KCCA 3J7YJ 2EPFA 5A2QK 4EMSA 1IV6A 2DCEA 2PX9A 4LIUA 2ISYA 1UHWA 3RPUD 5BPIA 3HGGA 1AOYA 2LYCA 4IVNA 4KMUX 4XOTA 4EM0B 2CWEA 1ETOA 1ZH5A 3HJEA 2EIMH 2XF7A 4ZDPA 4CHUA 3K1NA 4AU7A 4XLEA 4C3JJ 4ZYEA 2RDPA 4LLGF 4A6EA 3HGYA 4P1WA 4CZCA 2F4IA 1ZAOA 5DCMB 3N97A 1HKTA 5JLXA 4E7HA 3DTIA 4BQAA 4XNFA 1IN8A 2GOMA 4Z2YA 1O7FA 2O7OA 2WY7Q 2B9SA 5J8CA 2R5YA 3EUAA 4P96A 1LNWA 4XL9A 3AL0B 2LR8A 4EM2A 1HBXG 2D1VA 3R0JA 4LITA 4PJLA 2ZXHA 3R60A 1S9HA 2R5ZB 1V54H 2AXLA 3TO6A 3S2WA 3CCQI 4HYEA 1FYKA 1ETWA 2E2IJ 6PAXA 4PSXA 4HBLA 1UAAA 1BIAA 1I5ZA 3RIRA 1FPQA 1HCRA 4HDVA 2UXNA 1XDSA 2M3AA 2QM3A 4AYBA 4MFEA 4FETA 1U9NA 2DK5A 4XRFA 3CDIA 4BQQA 4MQVA 4KYWA 3J80K 2PJRB 3JRCA 4I0BA 2I5UA 4Y7NJ 3KEQA 3FMQA 2OD5A 1K79A 4HLYA 3MWMA 2JRMA 3DBHB 3GWZA 1PP8F 1K4TA 3HKZA 3DV8A 2ME6A 1W1WE 3LSMA 1BI1A 2TDXA 3FXRA 2FA5A 2L0KA 2DW4A 1TBXA 2FEZA 4HX4A 1WKMA 1FP2A 1IXSB 3H0DA 4WWCA 2EZHA 4M3FA 4XICA 1E0EA 2LOOA 3AFHA 1A6IA 3BG3A 4OAYA 2JSPA 3L00A 3BPVA 3DU5A 3PSIA 4XKCA 1Y1VJ 3H92A 5EEGA 5FKMA 2VIXA 5HDGA 1ON2A 2H94A 3DBRB 1Z6TA 4P55A 4QPOA 3ZR8X 1BC7C 2CQKA 1RKTA 3VYTB 1HLVA 3OL4A 5FLXZ 1XPXA 4XK4A 5JHUA 2HKXA 3H36A 2VLAA 4M6XA 4ZTFA 5ILVA 1YW7A 1QVUA 4U0VA 5JR3A 2R7VA 3OYEA 3BY6A 3G2BA 2B63J 4HQMA 2OAZA 2DA7A 2DTZA 2XRNA 4A0ZA 4RB0A 3HSRA 3GYHX 1WJAA 3FM3A 3KP3A 1R7JA 3HOTA 3I4NJ 2R7DA 1R00A 3LSTA 2ZJ2A 1X3WB 1FMWA 1W7PA 2P5KA 1WJCA 3C1DA 2HQAA 5JHFA 3LA2A 4GDFA 1YW8A 2KJCA 3EUHA 1IO2A 1XN7A 5KCMA 2AO9A 3HXLA 3LSGA 1BR1A 2FQ4A 5KAIC 1F9NA 2GZWA 3RYRA 1UG0A 5EEAA 2LKSA 3ZCOA 4NC8A 3A4CA 2HDCA 2AXTC 3U21A 4DBQA 3MFKA 2MH9A 2VKDA 4PSWA 4YEJA 5CYVA 5CKTA 3MZYA 1X1BA 1A04A 2FBKA 2XAFA 1Q1VA 4J00A 2V1XA 5L3DA 1RZ4A 2OCCH 3GLXA 1HW2A 3JRAA 2VQLA 2P4WA 3OR2C 3V8JA 2M45A 4L5IA 3L2UA 4CZZA 4DJAA 2DTRA 3FKIJ 2FQ3A 2WADA 2W84A 2WAQN 4KIFA 2X6OA 1YOVB 3BDDA 4YRVA 3OR1C 2ZMEB 4PFPA 3Q9SA 2E2JJ 2ZKZA 2BGCA 3F6VA 3ZQCA 1EH6A 1VQ7I 5ICGA 1GLNA 2XDVA 2XSDC 1G59A 3TL4X 2L7KA 2CFOA 2ZFWA 2LSOA 2VKVA 5IOZA 2Y9ZA 3KZZA 1BL0A 3S17J 2HDDA 3MKYB 2QVOA 1OISA 2JT1A 3OYKA 3VFZA 4IHVA 4KT5C 3FHZA 4F93B 2X51A 2KISA 2F5EA 3GF2A 2PLYA 4OIQF 2O8XA 1K78A 1EKEA 1JUMA 1LVAA 1XGNA 4LK0F 4RAYA 3E0JB 3BG7A 2FUG2 1X4OA 3R4KA 4BAYA 3RKQA 2E1MB 2X1EA 4IOCF 2M4GA 1B9MA 1O4XA 2XVCA 1JJ8C 3QAHA 3FX3A 4CCOA 1EF4A 2PG4A 2CQQA 3OOPA 4CICA 3V7CA 1DP3A 1DGWY 3P7NA 2A68F 4E6KG 4D5FA 4S04A 3ZN0A 4D0PA 3RJPA 3M1EA 3IV5A 5GAEJ 5HVQC 3TMOA 3IHUA 5E3LA 4ESBA 1HQCA 1R5ID 1WJBA 1K83J 2AQFA 3QOPA 2ACJA 2XB5A 2YPRA 2P6TA 3H9GA 5LHHA 1DU0A 4CO8A 3G73A 2JK3A 2LF7A 1W5CC 3OYCA 2NVXJ 4AVZA 3WE2A 4ANJA 2VUMJ 4GCVA 2LD5A 3U9GA 1B1BA 2QQBA 1L3LA 2BOLA 4IRGA 2BY0A 3V8LA 1HW1A 1OKRA 3ZQQA 3GFIA 1X1DA 1Z77A 4W97A 1FZPB 4E4HA 2DDBA 1A35A 3GTKJ 2DMNA 1FIPA 2A69F 3ROUA 4DBRA 1R36A 1LVKA 2K3FA 1Y6IA 1AKHB 1QA6A 4LGWA 2M5WA 5E1ZB 1O3QA 4EQQA 3SFIA 3I5UA 3QP5A 3TO7A 2G7HA 5FD6A 3VWBA 3F6OA 4PGGA 1Z21A 4IKFA 1JKOC 3QYEA 1JKPC 3M07A 1ETYA 1W4MA 5GAHJ 2XAHA 2JVHA 3TGNA 3I64A 4PK4A 4EM1A 4YFNF 4HF1A 1Z3YA 3F23A 4M9ZA 1U8RA 3BZ6A 1JJ6C 4B1RA 1Y56A 1TQIA 2DJNA 3S1RJ 3MAJA 1VQ5I 5CVIA 3SEZA 2O6GE 1SAXA 2OTLI 4L9VA 4BUPA 2E35A 1S8NA 1V5GA 1FMVA 2ETHA 4MTDA 1ETVA 4B3XA 1ZK8A 3BR6A 1Y39A 3G1OA 3GMEA 1MW7A 3GTGJ 3S2HJ 2OA4A 2VI6A 3W3CA 2FX0A 2HXIA 2H8WA 2L7MP 1HSTA 3GTJJ 2V9PA 3DKWA 4B44A 2V9VA 5IP7J 2DA1A 3O8HA 3DP7A 5DM6F 4DIQA 1R5GA 5FKLA 1I39A 3HOVJ 2KIFA 2R7OA 4C2UA 1LJ9A 1XMKA 2V9KA 3BG6A 1I1GA 1H88C 1LE8A 3QU6A 1I3QJ 3WHBA 2BV6A 5K7FA 4UUSA 4N0BA 2P81A 3NAUA 3CMAI 5AIQA 3GXOA 2F6CA 3OYFA 4IPAA 4XKVA 1MNDA 2FF4A 2LK2A 1K61A 4AC0A 4GYIA 2KHMA 2EBIA 1GV5A 5ICEA 3CF5F 4ENJA 1OYIA 3CUQA 5E3OA 3LA7A 2IGOA 3RTRA 2JWTA 3NRVA 1APLC 2R93J 2RQPA 3ABTA 1B8IA 2NRAC 1WQ2A 3G1MA 4XLFA 1ZELA 2VKHA 2VXDA 3C2HA 4XLPF 3IP4B 4PFOA 3ZMTA 1QZYA 4U7DA 1EH8A 3WGGA 1EJ9A 2L01A 5LD2C 2OBPA 3T1BA 2VBXA 2NS0A 4KJZA 2BBYA 5FRMA 1SD6A 3MZ8A 2Q8KA 1L0OC 3BG9A 3OY9A 5B1BH 3ZMUA 1NK2P 2CUEA 1VQNI 1I50J 2VC0A 3IH4A 4E70A 1SFKA 1SVOA 2EB7A 1ZHFA 2QLZA 2VT3A 3AL0C 5E79C 1J5YA 1OR7C 3ZXSA 2LY1A 4L0YB 2VPLA 1W0UA 3ZN1A 2DPDA 3ERED 3SJMA 1R4MB 3Q0WA 3GTOJ 2VBWA 2XV4S 1WFXA 3ONQA 2DO7A 4N4NB 4UVBA 1H9TA 2VE8A 2CV2A 4KMFA 5LGUA 3S2DJ 2GQQA 1G3YA 4ITVA 1IRXA 2ZO4A 4O5VA 3GCMA 4D5CA 2QEXI 3MKWB 5IYBJ 2CFXA 4EGZA 4DYQA 3GX4X 1T0FC 4D1QA 1USSA 3DU6A 4BQNA 2R5YB 2WAQA 2RREA 4NHJA 4A3IJ 2ZBKA 3S3OA 2PMZA 3S3MA 1UG2A 1KQ9A 4HNVA 2JUGA 1N78A 3H3UA 2RC4A 4RAGA 4MNUA 3WTSC 2V1UA 4OMYA 3S15J 1WI9A 1SD7A 2X6YA 3TW6A 4Y3OA 4M3EA 1G8XA 5TISC 2BY2A 3HKZN 3HPGA 4S05A 2BXZA 2EFPA 2P7VB 3M8FA 1ON1A 1U6GA 5FKKA 1IN5A 3LWFA 3LSKA 1AHDP 2FBHA 2GA2A 1FWZA 3J81Z 2XHKA 5D8LB 4I01A 2F2EA 5D6FA 1VTNC 2FSWA 1GV2A 3FHNA 3QPHA 4KITB 2EZKA 2K27A 2VODA 1UHSA 2VQHA 5HLIA 5D4SA 5E20A 4BH9A 1K6YA 4ABZA 3LAJA 3UR3C 1HKQA 4E7KA 4FX0A 4Q4ZF 1PDNC 3RKWA 3HOWJ 4FHTA 2R0QC 1F43A 5FLVA 1MIJA 4ZTJA 2CQXA 4KNYA 3OYIA 1NK3P 2XAGA 3O2PE 3K4JA 1FJLA 2ESHA 4B8XA 4KN4X 2HVSA 3TOAA 1CGPA 1I1SA 3WGHA 1UFMA 3FDYA 2BZTA 2O03A 3RI4A 3KZYA 2FBIA 3IL2A 4E7ZA 1TWFJ 3SZPA 2TCTA 4XBFA 3ML6A 2R7WA 2R7XA 4ETSA 2VQGA 3A2KA 1IG7A 5FRNA 1XGSA 1M1EB 2XC7A 2QGUA 4LB5A 3JRDA 3IRQA 2OV7A 2YSRA 3RZOJ 5FGMA 4BEHA 2Q2EA 3WGIA 4O3MA 2GXAA 2M2EA 2X1DA 3WODF 4FISA 2DODA 3OYHA 3DKXA 1ZREA 1BJZA 5D5WB 1SFXA 4J01A 1Q1HA 3EYYA 3RKXA 2R7FA 1VQOI 1BOAA 2ZMEC 1Y8RB 4LIVA 4AM3A 1E3PA 4MTEA 4BU2A 4AIKA 1OCRH 5IOYA 5IP9J 3S16J 2HI3A 3FXJA 5CLSA 2ZSIB 1KGSA 2MABA 1V5EA 3D0SA 2WV1A 4HV5A 3HYIA 5F0FA 3J81K 1K7AA 3P5JA 4BNCA 2IAIA 1BIBA 1OCCH 2NS8A 5DD4A 2F5VA 3CP2A 5EGOB 2Z5UA 2DT5A 1P4WA 3CJTB 3OYMA 1P2FA 2E1NA 2XUBA 1ZGJA 2CYYA 3E6CC 1HXDA 2QQ9A 4XM3A 4BXFA 3DQVC 3CCRI 1MZBA 2R7TA 2E1MC 5ICCA 1UZCA 2QQAA 1OCOH 3ZQIA 3ZQ7A 3F8FA 2XIGA 4OIRF 2EV5A 2TRTA 3K1PA 2R7ZJ 1FOKA 5FJ8J 4JX6A 3H5RA 1FYLA 1ZTRA 2JQ7A 3ECHA 3VPRA 5AIPA 3REOA 1TWCJ 3QPLA 5JFRA 3QP6A 3CD6I 2R92J 4RM2A 4LJZF 2E2HJ 2DOAA 4A2UA 2A6HF 3JTHA 1XC5A 4L9NA 5E3MA 3K6GA 3CDLA 4IJAA 3S3NA 1FEXA 1EV7A 1S5LC 1MMNA 4AWXB 3S8PA 5GTIC 2FRHA 5BS6A 1K78B 2XPVA 1JHHA 3ZP5A 1TP4A 2KDOA 3KETA 2QBYA 2WV0A 1FSHA 3BCBA 3PQJA 3TDUC 1JKQC 2WWYA 1D5VA 1UHMA 2BEOA 5E8IA 5BMZA 5F6FA 4EJTA 2UV1A 3RKYA 1TW2A 1B72A 5KHDA 4EGYA 1IC8A 4RGUA 5M5XJ 1OMIA 1IDZA 4BY7J 1Y8QB 2PI0A 2ZNZA 3K69A 5K5RA 5J4VA 2D1HA 4F52A 1VFCA 1A31A 2HQ5A 2HQRA 3G6EI 1TT5B 3NQOA 2MD0A 3FWEA 3ZMVA 4GO1A 2J5PA 3BTLA 4W1UA 5DYMA 1G6NA 2IGNA 3HOYJ 3X2QH 1WJDA 3OIQA 2ZCWA 4XOPA 2ZXJA 4FCYA 5ICFA 5CQGA 2LTPA 1YW9A 3ZMSA 2VJ4A 4UV9A 1T39A 2IS2A 3L1PA 4LFUA 3SDBA 1RRJA 2CU7A 2OQGA 1ONVA 1T08B 2V26A 1X1CA 1W5SA 4Y33A 1YJNI 3TP0A 2HVRA 1KYZA 2RGVA 3BZKA 5LLQA 1MBEA 3S1QJ 4A3GJ 2P5LC 2ECBA 5J1YA 5F0CA 2H8RA 3RQ4A 3EETA 2LDUA 3DF8A 2JN6A 4F92B 5KNLA 1TL8A 5DV5A 3WG9A 4S0HB 1UMQA 2EQRA 4AD9A 5DEQA 1QRYA 5HS7A 1FY7A 1ZR4A 4QPQA 2MLKA 2A5WA 2JA5J 4XR6A 3MQ0A 4WXCA 1SANA 2GLOA 3T0YA 2EZLA 2G9WA 2DN0A 3LSIA 1IUYA 1YYVA 1BC8C 1Z67A 1XB4A 4ZYAA 4NC7A 3JTGA 2RNGA 2XASA 1KZHA 3QQAA 4BY1J 5TRDA 4A93J 4CSWA 3KYDB 4ZZDA 4X1EA 1ZRDA 5E18F 1X2MA 3BR3A 2CG4A 2LKXA 1TNSA 3OSFA 1FYMA 4HF0A 5CQEA 5EZHA 4IRIA 3WU0A 1OFCX 5GADJ 1MBGA 4A3JJ 2V4JC 2W24A 2ECCA 3VYSB 4A3BJ 3P9KA 3GEZA 3RZDJ 4C3HJ 5K1YA 2HTSA 5L3CA 4OWRB 3GW2A 3OS1A 2JPCA 4IRHA 2MG4A 3CF2A 1LE8B 1VQMI 4Y17A 3C2GA 4D7MA 3OYAA 5CVRA 3GZ6A 5JLWA 4RGSA 1R58A 1Z6RA 4AVPA 1WHUA 3I0TA 4ZJZA 3CC7I 3RPQA 3CJQB 5ED4A 1UJ8A 3CUQB 2EA4A 2E5NA 1P4AA 3K2AA 4N9IA 4XMYA 4C2TA 1N75A 2CUFA 3BR2A 3IWFA 3WTUC 2K4BA 3OS0A 1B8IB 2Y31A 3M4OJ 1HDPA 4RAFA 3HHGA 1U5TA 3QYBA 5J47A 2QSFX 4XRSA 4LLNA 3WTVC 2BY3A 3CCYA 4HX8A 4NB5A 4OU0A 1XGOA 3PL8A 2L4AA 2UXXA 3U1KA 3TBIA 1YFHA 4A12A 3CCMI 2PBIA 2M4KA 5AONA 3ASOH 5EYRA 3KIOA 2F5FA 3HBLA 5H20A 4RA2A 4EVIA 4ZDOA 3ASNH 2XGCA 5K7ZA 5D4RA 2Y0SN 1PUEE 4G12A 5D5UB 3HC7A 1IZ1A 2O3FA 1OYWA 2JJ7A 3SFZA 4UVCA 1JUSA 1P6RA 2EILH 3CCEI 3BP8A 1JTYA 4QWQA 1HOMA 2I8DA 2BVLA 5E1XA 4GXOA 3E7LA 3HRSA 2GWRA 3PJRA 4L9JA 3BCAA 4RLQA 1YTYA 2IVMA 2PMZN 1RR7A 2H1LA 4XSXF 3HL2A 5M3FJ 4LOCA 2JA8J 1GT0C 2HOEA 1SFEA 3TOBA 2LC2A 3RYPA 4XRSG 3E1SA 5D6EA 1IRGA 2LRDA 1CF7A 2G0EA 4NNJA 4ZYHA 4B48A 3PO3J 2V1NA 3MMYB 2BYVE 4C3IJ 2FXAA 3HOSA 3HDDA 5FLXK 2LFBA 1YJWI 1YRNA 1D0ZA 1N25A 3DPLC 1B9NA 3EPZA 4IZZA 3NEUA 1I27A 4NQWA 2AHQA 2IW5A 2E1CA 2H1KA 1R22A 3PIPF 2R7QA 3W6KB 3E6MA 2DOEA 1BR2A 3JRIA 1KONA 5TJJA 2O9LA 1XSVA 1X1PA 1MH3A 2E34A 3DWLE 2ME0A 4XIDA 4A3CJ 2HDWA 3BJOA 3HZJA 4IHYA 2VE9A 4IOAF 1X3UA 1JHFA 4L18B 3QODA 1FNNA 2W4SA 2VBYA 4FQGA 1WI3A 2BW3A 4BL0B 2EFNA 2O5RA 2QSGX 4HX7A 2QENA 2MGQA 3OWTA 2HQNA 5LRRA 4LK1F 2OQRA 3DFGA 2P7CB 3C7JA 3ZQFA 1ZG3A 1LDDA 1XX5A 3OYJA 1H89C 2MSYA 2ID6A 4YFXF 1JUPA 5B1AH 1MNMC 3VSKA 1IXRC 1ACIA 4IHTA 1BBYA 2J5OA 4PDKA 4CDGA 4LMYA 3NWTA 2OZ6A 5EEHA 3CO7C 3PM1A 1Z0XA 4IXAA 2X6WA 1XCBA 3EUHC 3DEUA 3DEWA 3KEOA 3PQKA 4ESFA 3TW7A 3ZQGA 2NVQJ 5F1JA 3OIPA 2IS1A 3M8EA 2DLLA 2XF6A 4G6QA 4GFBA 1DPRA 2KDZA 3PNTA 4R79A 3CMMA 3KP4A 3ZMZA 4H4KC 2XAJA 2NYXA 4U88A 1IUFA 2QCOA 3Q0VA 2E36A 4LLLA 5DCMA 3AAFA 2W85A 2YR2A 1FTTA 1GUUA 1FOWA 1X3ZB 1Z91A 2X6XA 2Z16A 2VOPA 1LPQA 3FBNB 2HVQA 4NDLA 3D1NI 3CLQA 2AQEA 4MFDA 2IS6A 3E97A 2ZJRF 1LDKB 3H5NA 3VOEA 5FB2A 3M8JA 1J9IA 3FBIB 4QSHA 3VB2A 3ESWB 1VQ4I 1ORKA 3L2WA 4BEHB 1UELB 2Q2EB 3AG1H 1UCRA 2CSOA 1T6SA 2STTA 3ZQLA 1LKXA 5IPAA 4CCJA 3LQRA 2RAEA 1Z9CA 2XGDA 3D5LA 3PUFA 3CUOA 1NHAA 3GZNB 2O61A 4YG2F 3KEYA 2Z33A 4RLFA 3BTCA 2JMWA 4B43A 4Y15A 4UNOA 5IT9Z 4MQ9F 1OCTC 1P7IA 1LFUP 3HG9A 4X6AJ 3KFWX 3GFMA 4CCLA 2CV1A 1IF1A 5CJ9A 1J09A 1TQMA 1XDUA 2ZXIA 2WTEA 1RESA 2XAUA 2UWMA 1V3FA 3Q5FA 3SYTA 1G3WA 3E5QA 4CYDA 1W5TA 2F5DA 2RKHA 4KISA 5GP9A 3DCFA 3K4MA 3CMYA 2JA2A 4UB6C 2HU9A 1ITYA 5FFXA 3GBGA 2M9HA 2QZ8A 2IA2A 3MKLA 4ZYGA 1MJAA 3HUGA 2DA5A 1KQ8A 3I55I 4A69C 1WJ5A 3RPUA 3FXOA 1HKSA 4JBAA 3DBLB
chains in the Genus database with same CATH topology
2MLGA 3QU3A 3TDZC 3HRMA 4G94A 2L3DA 3T5XA 4YIIA 1KQ0A 4KFCA 5D5XB 1ZRFA 4RB1A 4I09A 5HDKA 5F1RA 2NAZA 5HS8A 2DQLA 2GXGA 2YU3A 1E2XA 2L02A 5H6RA 2JTVA 3B02A 1J0RA 5F64A 3LAPA 2VBZA 3T8RA 2A3SA 2CGPA 4WXDA 4HOBA 3KLNA 3LQQA 3WTYC 1LDJA 1J7KA 1FLIA 2X0LA 3HHHA 1DPUA 5JI6A 1SFUA 4CXFA 4HW0A 3WE3A 1F5TA 3KP5A 2XKPA 4ASNA 3GVAA 1YO5C 3FF5A 5ILSA 2P6SA 2H09A 3EQLF 3CDHA 2VC1A 2KKOA 3CTAA 4LB6B 5D8KB 4BYYA 5HOOA 2H6BA 1SD5A 1P4XA 1FBQA 1BI3A 1F4KA 2FOKA 3E5XA 3I4PA 2MC3A 4IHSA 4BHPA 3GFJA 3QPTA 1B59A 3V4GA 1FBUA 1B4AA 1DUXC 1HSJA 3CUQC 2HR3A 3C18A 3FXUA 2JZYA 2M87A 2EJRA 4I98B 2F5CA 5LBQA 3I54A 2VT2A 2B0LA 3F8MA 4ZYDA 1IRFA 3F72A 1K6OA 2C6YA 4HV6A 1G3SA 2IPQX 2L4MA 2PN6A 4JBAA 2V1DA 2V6CA 3P9CA 1O57A 3E3VA 1ZLKA 1W7PB 2M1BA 1U5TB 5LHGA 4RS8A 2D2WA 3SQNA 1S29A 4M71A 2PFBA 2P5VA 2M8EA 5KK1A 3G3ZA 2COMA 4K2EA 2O0YA 3F22A 1FT9A 2IT0A 1TQPA 3QRFF 4UXNA 3RDIA 2H6CA 4YFKF 2Z99A 3MEXA 1B6AA 3HSFA 3JAMZ 5HLGA 2DAOA 3V7SA 1FC3A 1R1VA 4N9HA 4RB3C 3L9FA 5DCFA 1WRJA 3BJ6A 4G7OF 4B09A 1LQ1A 4PZJA 3ULQB 3EDPA 3BOQA 3R61A 4PCQA 4LG0A 1UB9A 4M74A 4GYGA 2HKOA 2ELHA 3FZVA 1U2WA 3GUDA 3CJNA 3I58A 5J8FA 1QQIA 2EV6A 1RNLA 2PQ8A 2Q0OA 2M30A 3KP6A 3I59A 3KP7A 4I02A 1MDMA 4XSZF 1XMAA 2A61A 3K1MA 1O3RA 2JRTA 3IKVA 4G7ZF 1BJAA 1RIOH 2RVCA 3P9IA 5E17F 3H3ZA 2FMLA 5ERIA 1S7AA 4JQFA 3JAMK 4EJOA 5LGNA 5FD5A 1JXSA 1SMYF 3C3WA 2X4HA 2HGCA 2Y48A 5D5VB 4WXHA 4WX9A 1D8JA 2PEXA 1J59A 2EFWA 5J6XA 2GA1A 2VONA 2MD5A 2KRFA 3GFLA 4OIPF 4CGZA 1O3SA 2A5YB 1ZRCA 5LEJA 4ENKA 2DI3A 1G3TA 1O7LA 4A5MA 1FBSA 2QYOA 5LGTA 1DP7P 2D45A 1I6XA 4M6YA 3ABUA 1YIOA 2G7UA 2ESNA 1TTYA 2XAQA 1ZG1A 4ENNA 1J75A 3F8BA 4UHTA 4HZFA 3IC7A 4ESJA 3HTUA 4BXUA 3SXYA 1KYWA 1S7OA 1XSXA 1C0WA 5BQTA 5JVTA 2PJPA 2GAUA 2NNNA 4A5NA 1LB2A 2QWWA 3V8KA 1BI0A 3BROA 1FSEA 2YX4A 2AS5F 4U0YA 2IRFG 3FMSA 4MHGA 1LEBA 1U3EM 2FNPA 1ODDA 3W6JB 2VN2A 4P9FA 1JE8A 1D8KA 4Q47A 3FM5A 1S6LA 4OOIA 4WCGA 4P5OA 4HDUA 1IN4A 2NNYA 1MGTA 1IXCA 1R1UA 2ZNYA 4IF4A 1YLFA 5LEKA 2RNJA 4RGXA 5K5QA 1EH7A 1ULYA 2CO5A 3E6BA 3JSOA 4PGHA 5KVRA 3ISPA 4RB2C 2EK5A 1QZZA 1J2XA 2MA3A 3TQNA 2W25A 2K7LA 1IW7F 2DBBA 4HAMA 4OMZA 4Y13A 3OV8A 3MZHA 3K9TA 1RUOA 4R1HA 3LA3A 3L7WA 1RUNA 1BM9A 4U0WA 2KIMA 3COAC 2FU4A 4UVAA 1F1ZA 4KA4A 3SZTA 4ENMA 1H0MA 1QO0D 1D3YA 1XD7A 1PP7U 1XCVA 2GXBA 4DQ2A 2KIUA 2K4JA 5HLHA 2HFHA 2OU2A 3LFKA 1HW5A 4WF2A 4XLNF 3E5UA 1SMTA 2LNBA 5L3BA 4FX4A 1V4RA 4DNCA 1U5TC 2K86A 2A6EF 4G8XA 5FFZA 4QLCU 3HRUA 4F7ZA 5K5OA 2IJLA 1G4DA 2DFIA 3O6BB 4HLXA 4M9XA 1ZARA 2Z9OA 3WTZA 5DDGA 5L3FA 4BHCA 1OR7A 3GZ5A 4HF2A 3JW4A 1OYYA 4MEXF 1KU3A 4RAZA 2EFOA 1QPMA 4OIOF 4UV8A 3ZPLA 1IN7A 1SD4A 3HIFA 3VODA 1RI7A 4H0EA 1YQAA 4G9YA 2QUFA 2VXZA 1WSUA 2DQRA 3PFIA 2EA2A 1YS6A 1GXQA 3ZMDA 4FT8A 5CVUA 3O3KA 1T0FA 3I53A 4KIGA 2FNAA 2XGXA 5FO5A 4KICA 5DD8A 1MKMA 4AIJA 2EFQA 3F3XA 1R5HA 4U7BA 1Z7UA 1R1TA 3F21A 1MD0A 2ADUA 3N4MA 3BWGA 3JSPA 2EV0A 3HSEA 2HWVA 3VEPA 1STZA 2RN7A 2W57A 4YIFA 1BI2A 3HTSB 4KIBA 2GIVA 2JSCA 4LG0B 3ECOA 3SHFA 4GGGA 1Z05A 2HZTA 2ISZA 2EWNA 4M73A 2QBYB 2HYGD 4WK8F 2IA0A 5E1WA 2A07F 5DUKA 4AIHA 3L09A 2E7WA 3IKTA 2Z3YA 3I59B 2Y0MA 5IT9K 3E6DA 1MDMB 2HTJA 3FXQA 4P9UA 2E7XA 3WU1B 4I2OA 2P8TA 5HDNA 3FMRA 5CVJA 2BE5F 1ZGAA 3R6SA 2PMUA 3HRTA 1KU7A 4Q48A 4I0AA 1IN6A 4EJUA 4HA8A 4TV7A 3IWZA 4KDPA 1ZLJA 1W7PD 2ZMEA 5L3GA 2LF8A 1OPCA 2XKOA 4ON0A 1T38A 1Z1DA 1REPC 4MEYF 1O3TA 1MJ9A 1P92A 4KUMA 4O6JA 1FP1D 1QBJA 4A0YA 2IA1A 3V7RA 4ZH4F 1GHCA 1MJBA 3CLOA 1TLHB 1TNTA 4Q5SF 1KU2A 3ELKA 5BOXA 2VOOA 3MCZA 4KN7X 2XROA 1KU9A 3TKYA 4JK1X 2HYFA 3M7GA 2UZKA 3KLOA 1YS7A 1E17A 3M9AA 1Y0UA 2MBFA 3KE2A 5BPDA 1U78A 3K2ZA 1ZN2A 1IAWA 1T2KA 3EYIA 4I7HA 4RGRA 3KP2A 2DK8A 3F8NA 4M9SA 2IP2A 5HS9A 1H9GA 2V79A 2OZUA 2DPUA 1ZYRF 2STWA 3WTWC 5DUIA 5H6QA 5ILUA 5IT3A 2YX7A 1GVJA 2L54A 3T8TA 2KJBA 5LRSA 1T98A 1USTA 2WC2A 2FE3A 3F8CA 4MGRA 1XSDA 1QNTA 3DPTA 2MH2A 4EJVA 3IRRA 5A2QZ 3B73A 1DDNA 2RV8A 1JGSA 3L2CA 4R8HA 5CVVA 4G6DA 1BN5A 1KA8A 2Y75A 3WTXC 3GO5A 4M72A 3Q9VA 1AWCA 3I71A 2H27A 4OINF 1R23A 4LD5A 1CF7B 3U2RA 4ZZLA 3BPXA 2K02A 1YG2A 3TO9A 2LKPA 1FX7A 2R3SA 4EJWA 3J7AO 4G7HF 2JPBA 3CO6C 4L5JA 2HS5A 4L0ZB 2CW0F 3WTTC 5LHIA 1QGPA 1ZG5A 1XGMA 4BHBA 3DXJF 3J80Z 4UUVA 3K0LA 2PMHA 2DU9A 1S3JA 1WWXA 4A0XA 2HEOA 4L9TA 3BJAA 4EV0A 3R0AA 1GXPA 3U1DA 1LEAA 2FMYA 5E8GA 1TW3A 4A6DA 4HQEA 3KCCA 5A2QK 4EMSA 2ISYA 1UHWA 5BPIA 1AOYA 4IVNA 4KMUX 4EM0B 2CWEA 1ZH5A 4CHUA 3K1NA 4ZYEA 2RDPA 4LLGF 4A6EA 1ZAOA 3N97A 5DCMB 1HKTA 4BQAA 1IN8A 4Z2YA 1O7FA 5J8CA 4P96A 1LNWA 4EM2A 1HBXG 2D1VA 3R0JA 3R60A 2AXLA 3TO6A 3S2WA 1FYKA 4HYEA 6PAXA 4HBLA 1BIAA 1I5ZA 3RIRA 1FPQA 4HDVA 2UXNA 1XDSA 2QM3A 2DK5A 4XRFA 4MQVA 4KYWA 3J80K 4I0BA 3KEQA 3FMQA 2OD5A 1K79A 4HLYA 3MWMA 1PP8F 3GWZA 3DV8A 1BI1A 2TDXA 3FXRA 2FA5A 2DW4A 1TBXA 2FEZA 4HX4A 1WKMA 1FP2A 1IXSB 4WWCA 3L00A 3BPVA 3H92A 5EEGA 5HDGA 1ON2A 2H94A 4P55A 1Z6TA 1BC7C 2CQKA 5FLXZ 5JHUA 2HKXA 4M6XA 5ILVA 1YW7A 4U0VA 5JR3A 3BY6A 4HQMA 2OAZA 4A0ZA 2XRNA 4RB0A 3HSRA 3GYHX 3FM3A 3KP3A 1R7JA 3HOTA 2R7DA 1R00A 3LSTA 2ZJ2A 1W7PA 2P5KA 3C1DA 3LA2A 1YW8A 2KJCA 3EUHA 1XN7A 1F9NA 2GZWA 3RYRA 2HDCA 3MFKA 2MH9A 5CYVA 3MZYA 1A04A 2FBKA 2XAFA 2V1XA 5L3DA 1RZ4A 3GLXA 1HW2A 2P4WA 3V8JA 2M45A 4L5IA 4CZZA 2DTRA 2FQ3A 2W84A 4KIFA 3BDDA 2ZMEB 3Q9SA 2ZKZA 2BGCA 3F6VA 1EH6A 5ICGA 2ZFWA 2LSOA 3KZZA 2QVOA 2JT1A 3VFZA 4KT5C 3FHZA 2F5EA 3GF2A 2PLYA 4OIQF 2O8XA 1K78A 1LVAA 1XGNA 4LK0F 4RAYA 3R4KA 4BAYA 1B9MA 2XVCA 3QAHA 3FX3A 2PG4A 3OOPA 4CICA 3V7CA 3P7NA 2A68F 4S04A 3ZN0A 4D0PA 3RJPA 3M1EA 5HVQC 3IHUA 4ESBA 1HQCA 3QOPA 2ACJA 2YPRA 2P6TA 5LHHA 4CO8A 3G73A 2LF7A 3WE2A 4GCVA 3U9GA 1B1BA 2QQBA 1L3LA 4IRGA 3V8LA 1HW1A 1OKRA 3GFIA 1FZPB 3ROUA 2A69F 1R36A 4LGWA 2M5WA 5E1ZB 1O3QA 4EQQA 3I5UA 3QP5A 3TO7A 2G7HA 5FD6A 3F6OA 4PGGA 1W4MA 2XAHA 3TGNA 3I64A 4EM1A 4YFNF 4HF1A 3F23A 4M9ZA 1U8RA 3BZ6A 1TQIA 3MAJA 5CVIA 2O6GE 1SAXA 4L9VA 1S8NA 2ETHA 4MTDA 2OA4A 1HSTA 3DKWA 2V9VA 3DP7A 1R5GA 2KIFA 1LJ9A 1XMKA 1I1GA 3QU6A 2BV6A 4N0BA 5AIQA 3GXOA 4IPAA 2FF4A 4GYIA 5ICEA 4ENJA 1OYIA 3CUQA 3LA7A 3RTRA 3NRVA 2RQPA 3ABTA 2NRAC 1WQ2A 4XLPF 3ZMTA 1QZYA 4U7DA 1EH8A 3WGGA 2L01A 2OBPA 3T1BA 2VBXA 2NS0A 2BBYA 1SD6A 2Q8KA 1L0OC 3ZMUA 2VC0A 4E70A 2EB7A 1ZHFA 2QLZA 2VT3A 1J5YA 4L0YB 3ZN1A 2DPDA 3ERED 2VBWA 2XV4S 2DO7A 4UVBA 1H9TA 2VE8A 4KMFA 5LGUA 2GQQA 1G3YA 2ZO4A 4O5VA 2CFXA 4EGZA 3GX4X 1USSA 4NHJA 2ZBKA 1KQ9A 3H3UA 2RC4A 4MNUA 3WTSC 2V1UA 4OMYA 1WI9A 1SD7A 4S05A 2EFPA 2P7VB 3M8FA 1ON1A 1U6GA 1IN5A 3LWFA 2FBHA 2GA2A 1FWZA 3J81Z 2XHKA 5D8LB 4I01A 2F2EA 5D6FA 1VTNC 2FSWA 3QPHA 2K27A 2VODA 5HLIA 5D4SA 5E20A 4BH9A 3LAJA 1HKQA 4FX0A 4Q4ZF 1PDNC 3RKWA 4FHTA 4KNYA 2XAGA 3O2PE 2ESHA 4B8XA 4KN4X 3TOAA 1CGPA 1I1SA 3WGHA 1UFMA 2O03A 3RI4A 3KZYA 2FBIA 3IL2A 3SZPA 4XBFA 3ML6A 4ETSA 1XGSA 4LB5A 3IRQA 2YSRA 5FGMA 2Q2EA 3WGIA 4O3MA 3WODF 1ZREA 5D5WB 1SFXA 1Q1HA 3EYYA 3RKXA 2R7FA 1BOAA 4MTEA 4AIKA 5CLSA 1KGSA 3D0SA 4HV5A 3HYIA 1K7AA 3J81K 4BNCA 1BIBA 5DD4A 2Z5UA 2DT5A 1P4WA 1P2FA 2E1NA 2XUBA 1ZGJA 2CYYA 3E6CC 1HXDA 2QQ9A 3DQVC 1MZBA 5ICCA 2QQAA 3ZQ7A 3F8FA 2XIGA 4OIRF 2EV5A 3K1PA 1FOKA 1FYLA 3ECHA 5AIPA 3REOA 5JFRA 3QP6A 4LJZF 4A2UA 2A6HF 3JTHA 4L9NA 4IJAA 1EV7A 4AWXB 2FRHA 5BS6A 1K78B 1JHHA 3ZP5A 3KETA 2QBYA 2WV0A 1FSHA 3PQJA 3TDUC 2WWYA 1D5VA 1UHMA 2BEOA 5E8IA 5BMZA 5F6FA 4EJTA 3RKYA 1TW2A 4EGYA 4RGUA 1OMIA 2PI0A 2ZNZA 3K69A 5K5RA 2D1HA 2HQRA 3NQOA 3FWEA 3ZMVA 4GO1A 2J5PA 5DYMA 1G6NA 2ZCWA 2ZXJA 5ICFA 1YW9A 3ZMSA 4UV9A 1T39A 4LFUA 2OQGA 1ONVA 1W5SA 1KYZA 2RGVA 5LLQA 2P5LC 3EETA 2LDUA 3DF8A 5DV5A 3WG9A 4AD9A 5DEQA 5HS7A 1FY7A 2MLKA 3MQ0A 4WXCA 3T0YA 2G9WA 1IUYA 1YYVA 1BC8C 1XB4A 3JTGA 2XASA 5TRDA 4ZZDA 1ZRDA 5E18F 2CG4A 1TNSA 1FYMA 4HF0A 4IRIA 3WU0A 2W24A 3P9KA 3GEZA 5K1YA 2HTSA 5L3CA 3GW2A 2JPCA 4IRHA 4Y17A 5CVRA 3GZ6A 4RGSA 1R58A 1Z6RA 4AVPA 3I0TA 3RPQA 5ED4A 3CUQB 2EA4A 1P4AA 4N9IA 3IWFA 3WTUC 2K4BA 3HHGA 1U5TA 4LLNA 3WTVC 4HX8A 4NB5A 4OU0A 1XGOA 2L4AA 2UXXA 1YFHA 4A12A 2PBIA 5AONA 2F5FA 5H20A 4EVIA 5D4RA 1PUEE 5D5UB 1IZ1A 2O3FA 1OYWA 3SFZA 4UVCA 1P6RA 3BP8A 4QWQA 5E1XA 4GXOA 3HRSA 2GWRA 4L9JA 1YTYA 2IVMA 4XSXF 2HOEA 1SFEA 3TOBA 3RYPA 5D6EA 1IRGA 1CF7A 4ZYHA 2BYVE 2FXAA 3HOSA 5FLXK 3DPLC 1B9NA 3NEUA 1I27A 4NQWA 2IW5A 2E1CA 1R22A 3W6KB 3E6MA 5TJJA 1XSVA 3BJOA 2VE9A 1X3UA 1JHFA 4L18B 1FNNA 2VBYA 2EFNA 4HX7A 2QENA 2HQNA 5LRRA 4LK1F 2OQRA 3DFGA 2P7CB 3C7JA 1ZG3A 1LDDA 4YFXF 1IXRC 4IHTA 1BBYA 2J5OA 4PDKA 4CDGA 4LMYA 2OZ6A 5EEHA 3CO7C 4IXAA 1XCBA 3DEUA 3KEOA 3PQKA 4ESFA 3M8EA 2DLLA 4G6QA 1DPRA 4R79A 3KP4A 3ZMZA 2XAJA 2NYXA 4U88A 4LLLA 3AAFA 5DCMA 2W85A 2YR2A 1Z91A 2VOPA 3E97A 1LDKB 3VOEA 5FB2A 1J9IA 3VB2A 1UCRA 2CSOA 1T6SA 2STTA 3LQRA 1Z9CA 3D5LA 3CUOA 1NHAA 2O61A 4YG2F 2Z33A 4Y15A 4UNOA 5IT9Z 4MQ9F 3KFWX 3GFMA 1IF1A 5CJ9A 1TQMA 1XDUA 2WTEA 2UWMA 1V3FA 3Q5FA 1G3WA 3E5QA 4CYDA 1W5TA 2F5DA 2RKHA 5FFXA 2QZ8A 2IA2A 1MJAA 3HUGA 1KQ8A 3RPUA 1HKSA 5L3EA 4ZYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLG A;  3QU3 A;  3TDZ C;  3HRM A;  4G94 A;  2L3D A;  3T5X A;  4YII A;  1KQ0 A;  4KFC A;  5D5X B;  1ZRF A;  4RB1 A;  4I09 A;  5HDK A;  5F1R A;  2NAZ A;  5HS8 A;  2DQL A;  2GXG A;  2YU3 A;  1E2X A;  2L02 A;  5H6R A;  2JTV A;  3B02 A;  1J0R A;  5F64 A;  3LAP A;  2VBZ A;  3T8R A;  2A3S A;  2CGP A;  4WXD A;  4HOB A;  3KLN A;  3LQQ A;  3WTY C;  1LDJ A;  1J7K A;  1FLI A;  2X0L A;  3HHH A;  1DPU A;  5JI6 A;  1SFU A;  4CXF A;  4HW0 A;  3WE3 A;  1F5T A;  3KP5 A;  2XKP A;  4ASN A;  3GVA A;  1YO5 C;  3FF5 A;  5ILS A;  2P6S A;  2H09 A;  3EQL F;  3CDH A;  2VC1 A;  2KKO A;  3CTA A;  4LB6 B;  5D8K B;  4BYY A;  5HOO A;  2H6B A;  1SD5 A;  1P4X A;  1FBQ A;  1BI3 A;  1F4K A;  2FOK A;  3E5X A;  3I4P A;  2MC3 A;  4IHS A;  4BHP A;  3GFJ A;  3QPT A;  1B59 A;  3V4G A;  1FBU A;  1B4A A;  1DUX C;  1HSJ A;  3CUQ C;  2HR3 A;  3C18 A;  3FXU A;  2JZY A;  2M87 A;  2EJR A;  4I98 B;  2F5C A;  5LBQ A;  3I54 A;  2VT2 A;  2B0L A;  3F8M A;  4ZYD A;  1IRF A;  3F72 A;  1K6O A;  2C6Y A;  4HV6 A;  1G3S A;  2IPQ X;  2L4M A;  2PN6 A;  4JBA A;  2V1D A;  2V6C A;  3P9C A;  1O57 A;  3E3V A;  1ZLK A;  1W7P B;  2M1B A;  1U5T B;  5LHG A;  4RS8 A;  2D2W A;  3SQN A;  1S29 A;  4M71 A;  2PFB A;  2P5V A;  2M8E A;  5KK1 A;  3G3Z A;  2COM A;  4K2E A;  2O0Y A;  3F22 A;  1FT9 A;  2IT0 A;  1TQP A;  3QRF F;  4UXN A;  3RDI A;  2H6C A;  4YFK F;  2Z99 A;  3MEX A;  1B6A A;  3HSF A;  3JAM Z;  5HLG A;  2DAO A;  3V7S A;  1FC3 A;  1R1V A;  4N9H A;  4RB3 C;  3L9F A;  5DCF A;  1WRJ A;  3BJ6 A;  4G7O F;  4B09 A;  1LQ1 A;  4PZJ A;  3ULQ B;  3EDP A;  3BOQ A;  3R61 A;  4PCQ A;  4LG0 A;  1UB9 A;  4M74 A;  4GYG A;  2HKO A;  2ELH A;  3FZV A;  1U2W A;  3GUD A;  3CJN A;  3I58 A;  5J8F A;  1QQI A;  2EV6 A;  1RNL A;  2PQ8 A;  2Q0O A;  2M30 A;  3KP6 A;  3I59 A;  3KP7 A;  4I02 A;  1MDM A;  4XSZ F;  1XMA A;  2A61 A;  3K1M A;  1O3R A;  2JRT A;  3IKV A;  4G7Z F;  1BJA A;  1RIO H;  2RVC A;  3P9I A;  5E17 F;  3H3Z A;  2FML A;  5ERI A;  1S7A A;  4JQF A;  3JAM K;  4EJO A;  5LGN A;  5FD5 A;  1JXS A;  1SMY F;  3C3W A;  2X4H A;  2HGC A;  2Y48 A;  5D5V B;  4WXH A;  4WX9 A;  1D8J A;  2PEX A;  1J59 A;  2EFW A;  5J6X A;  2GA1 A;  2VON A;  2MD5 A;  2KRF A;  3GFL A;  4OIP F;  4CGZ A;  1O3S A;  2A5Y B;  1ZRC A;  5LEJ A;  4ENK A;  2DI3 A;  1G3T A;  1O7L A;  4A5M A;  1FBS A;  2QYO A;  5LGT A;  1DP7 P;  2D45 A;  1I6X A;  4M6Y A;  3ABU A;  1YIO A;  2G7U A;  2ESN A;  1TTY A;  2XAQ A;  1ZG1 A;  4ENN A;  1J75 A;  3F8B A;  4UHT A;  4HZF A;  3IC7 A;  4ESJ A;  3HTU A;  4BXU A;  3SXY A;  1KYW A;  1S7O A;  1XSX A;  1C0W A;  5BQT A;  5JVT A;  2PJP A;  2GAU A;  2NNN A;  4A5N A;  1LB2 A;  2QWW A;  3V8K A;  1BI0 A;  3BRO A;  1FSE A;  2YX4 A;  2AS5 F;  4U0Y A;  2IRF G;  3FMS A;  4MHG A;  1LEB A;  1U3E M;  2FNP A;  1ODD A;  3W6J B;  2VN2 A;  4P9F A;  1JE8 A;  1D8K A;  4Q47 A;  3FM5 A;  1S6L A;  4OOI A;  4WCG A;  4P5O A;  4HDU A;  1IN4 A;  2NNY A;  1MGT A;  1IXC A;  1R1U A;  2ZNY A;  4IF4 A;  1YLF A;  5LEK A;  2RNJ A;  4RGX A;  5K5Q A;  1EH7 A;  1ULY A;  2CO5 A;  3E6B A;  3JSO A;  4PGH A;  5KVR A;  3ISP A;  4RB2 C;  2EK5 A;  1QZZ A;  1J2X A;  2MA3 A;  3TQN A;  2W25 A;  2K7L A;  1IW7 F;  2DBB A;  4HAM A;  4OMZ A;  4Y13 A;  3OV8 A;  3MZH A;  3K9T A;  1RUO A;  4R1H A;  3LA3 A;  3L7W A;  1RUN A;  1BM9 A;  4U0W A;  2KIM A;  3COA C;  2FU4 A;  4UVA A;  1F1Z A;  4KA4 A;  3SZT A;  4ENM A;  1H0M A;  1QO0 D;  1D3Y A;  1XD7 A;  1PP7 U;  1XCV A;  2GXB A;  4DQ2 A;  2KIU A;  2K4J A;  5HLH A;  2HFH A;  2OU2 A;  3LFK A;  1HW5 A;  4WF2 A;  4XLN F;  3E5U A;  1SMT A;  2LNB A;  5L3B A;  4FX4 A;  1V4R A;  4DNC A;  1U5T C;  2K86 A;  2A6E F;  4G8X A;  5FFZ A;  4QLC U;  3HRU A;  4F7Z A;  5K5O A;  2IJL A;  1G4D A;  2DFI A;  3O6B B;  4HLX A;  4M9X A;  1ZAR A;  2Z9O A;  3WTZ A;  5DDG A;  5L3F A;  4BHC A;  1OR7 A;  3GZ5 A;  4HF2 A;  3JW4 A;  1OYY A;  4MEX F;  1KU3 A;  4RAZ A;  2EFO A;  1QPM A;  4OIO F;  4UV8 A;  3ZPL A;  1IN7 A;  1SD4 A;  3HIF A;  3VOD A;  1RI7 A;  4H0E A;  1YQA A;  4G9Y A;  2QUF A;  2VXZ A;  1WSU A;  2DQR A;  3PFI A;  2EA2 A;  1YS6 A;  1GXQ A;  3ZMD A;  4FT8 A;  5CVU A;  3O3K A;  1T0F A;  3I53 A;  4KIG A;  2FNA A;  2XGX A;  5FO5 A;  4KIC A;  5DD8 A;  1MKM A;  4AIJ A;  2EFQ A;  3F3X A;  1R5H A;  4U7B A;  1Z7U A;  1R1T A;  3F21 A;  1MD0 A;  2ADU A;  3N4M A;  3BWG A;  3JSP A;  2EV0 A;  3HSE A;  2HWV A;  3VEP A;  1STZ A;  2RN7 A;  2W57 A;  4YIF A;  1BI2 A;  3HTS B;  4KIB A;  2GIV A;  2JSC A;  4LG0 B;  3ECO A;  3SHF A;  4GGG A;  1Z05 A;  2HZT A;  2ISZ A;  2EWN A;  4M73 A;  2QBY B;  2HYG D;  4WK8 F;  2IA0 A;  5E1W A;  2A07 F;  5DUK A;  4AIH A;  3L09 A;  2E7W A;  3IKT A;  2Z3Y A;  3I59 B;  2Y0M A;  5IT9 K;  3E6D A;  1MDM B;  2HTJ A;  3FXQ A;  4P9U A;  2E7X A;  3WU1 B;  4I2O A;  2P8T A;  5HDN A;  3FMR A;  5CVJ A;  2BE5 F;  1ZGA A;  3R6S A;  2PMU A;  3HRT A;  1KU7 A;  4Q48 A;  4I0A A;  1IN6 A;  4EJU A;  4HA8 A;  4TV7 A;  3IWZ A;  4KDP A;  1ZLJ A;  1W7P D;  2ZME A;  5L3G A;  2LF8 A;  1OPC A;  2XKO A;  4ON0 A;  1T38 A;  1Z1D A;  1REP C;  4MEY F;  1O3T A;  1MJ9 A;  1P92 A;  4KUM A;  4O6J A;  1FP1 D;  1QBJ A;  4A0Y A;  2IA1 A;  3V7R A;  4ZH4 F;  1GHC A;  1MJB A;  3CLO A;  1TLH B;  1TNT A;  4Q5S F;  1KU2 A;  3ELK A;  5BOX A;  2VOO A;  3MCZ A;  4KN7 X;  2XRO A;  1KU9 A;  3TKY A;  4JK1 X;  2HYF A;  3M7G A;  2UZK A;  3KLO A;  1YS7 A;  1E17 A;  3M9A A;  1Y0U A;  2MBF A;  3KE2 A;  5BPD A;  1U78 A;  3K2Z A;  1ZN2 A;  1IAW A;  1T2K A;  3EYI A;  4I7H A;  4RGR A;  3KP2 A;  2DK8 A;  3F8N A;  4M9S A;  2IP2 A;  5HS9 A;  1H9G A;  2V79 A;  2OZU A;  2DPU A;  1ZYR F;  2STW A;  3WTW C;  5DUI A;  5H6Q A;  5ILU A;  5IT3 A;  2YX7 A;  1GVJ A;  2L54 A;  3T8T A;  2KJB A;  5LRS A;  1T98 A;  1UST A;  2WC2 A;  2FE3 A;  3F8C A;  4MGR A;  1XSD A;  1QNT A;  3DPT A;  2MH2 A;  4EJV A;  3IRR A;  5A2Q Z;  3B73 A;  1DDN A;  2RV8 A;  1JGS A;  3L2C A;  4R8H A;  5CVV A;  4G6D A;  1BN5 A;  1KA8 A;  2Y75 A;  3WTX C;  3GO5 A;  4M72 A;  3Q9V A;  1AWC A;  3I71 A;  2H27 A;  4OIN F;  1R23 A;  4LD5 A;  1CF7 B;  3U2R A;  4ZZL A;  3BPX A;  2K02 A;  1YG2 A;  3TO9 A;  2LKP A;  1FX7 A;  2R3S A;  4EJW A;  3J7A O;  4G7H F;  2JPB A;  3CO6 C;  4L5J A;  2HS5 A;  4L0Z B;  2CW0 F;  3WTT C;  5LHI A;  1QGP A;  1ZG5 A;  1XGM A;  4BHB A;  3DXJ F;  3J80 Z;  4UUV A;  3K0L A;  2PMH A;  2DU9 A;  1S3J A;  1WWX A;  4A0X A;  2HEO A;  4L9T A;  3BJA A;  4EV0 A;  3R0A A;  1GXP A;  3U1D A;  1LEA A;  2FMY A;  5E8G A;  1TW3 A;  4A6D A;  4HQE A;  3KCC A;  5A2Q K;  4EMS A;  2ISY A;  1UHW A;  5BPI A;  1AOY A;  4IVN A;  4KMU X;  4EM0 B;  2CWE A;  1ZH5 A;  4CHU A;  3K1N A;  4ZYE A;  2RDP A;  4LLG F;  4A6E A;  1ZAO A;  3N97 A;  5DCM B;  1HKT A;  4BQA A;  1IN8 A;  4Z2Y A;  1O7F A;  5J8C A;  4P96 A;  1LNW A;  4EM2 A;  1HBX G;  2D1V A;  3R0J A;  3R60 A;  2AXL A;  3TO6 A;  3S2W A;  1FYK A;  4HYE A;  6PAX A;  4HBL A;  1BIA A;  1I5Z A;  3RIR A;  1FPQ A;  4HDV A;  2UXN A;  1XDS A;  2QM3 A;  2DK5 A;  4XRF A;  4MQV A;  4KYW A;  3J80 K;  4I0B A;  3KEQ A;  3FMQ A;  2OD5 A;  1K79 A;  4HLY A;  3MWM A;  1PP8 F;  3GWZ A;  3DV8 A;  1BI1 A;  2TDX A;  3FXR A;  2FA5 A;  2DW4 A;  1TBX A;  2FEZ A;  4HX4 A;  1WKM A;  1FP2 A;  1IXS B;  4WWC A;  3L00 A;  3BPV A;  3H92 A;  5EEG A;  5HDG A;  1ON2 A;  2H94 A;  4P55 A;  1Z6T A;  1BC7 C;  2CQK A;  5FLX Z;  5JHU A;  2HKX A;  4M6X A;  5ILV A;  1YW7 A;  4U0V A;  5JR3 A;  3BY6 A;  4HQM A;  2OAZ A;  4A0Z A;  2XRN A;  4RB0 A;  3HSR A;  3GYH X;  3FM3 A;  3KP3 A;  1R7J A;  3HOT A;  2R7D A;  1R00 A;  3LST A;  2ZJ2 A;  1W7P A;  2P5K A;  3C1D A;  3LA2 A;  1YW8 A;  2KJC A;  3EUH A;  1XN7 A;  1F9N A;  2GZW A;  3RYR A;  2HDC A;  3MFK A;  2MH9 A;  5CYV A;  3MZY A;  1A04 A;  2FBK A;  2XAF A;  2V1X A;  5L3D A;  1RZ4 A;  3GLX A;  1HW2 A;  2P4W A;  3V8J A;  2M45 A;  4L5I A;  4CZZ A;  2DTR A;  2FQ3 A;  2W84 A;  4KIF A;  3BDD A;  2ZME B;  3Q9S A;  2ZKZ A;  2BGC A;  3F6V A;  1EH6 A;  5ICG A;  2ZFW A;  2LSO A;  3KZZ A;  2QVO A;  2JT1 A;  3VFZ A;  4KT5 C;  3FHZ A;  2F5E A;  3GF2 A;  2PLY A;  4OIQ F;  2O8X A;  1K78 A;  1LVA A;  1XGN A;  4LK0 F;  4RAY A;  3R4K A;  4BAY A;  1B9M A;  2XVC A;  3QAH A;  3FX3 A;  2PG4 A;  3OOP A;  4CIC A;  3V7C A;  3P7N A;  2A68 F;  4S04 A;  3ZN0 A;  4D0P A;  3RJP A;  3M1E A;  5HVQ C;  3IHU A;  4ESB A;  1HQC A;  3QOP A;  2ACJ A;  2YPR A;  2P6T A;  5LHH A;  4CO8 A;  3G73 A;  2LF7 A;  3WE2 A;  4GCV A;  3U9G A;  1B1B A;  2QQB A;  1L3L A;  4IRG A;  3V8L A;  1HW1 A;  1OKR A;  3GFI A;  1FZP B;  3ROU A;  2A69 F;  1R36 A;  4LGW A;  2M5W A;  5E1Z B;  1O3Q A;  4EQQ A;  3I5U A;  3QP5 A;  3TO7 A;  2G7H A;  5FD6 A;  3F6O A;  4PGG A;  1W4M A;  2XAH A;  3TGN A;  3I64 A;  4EM1 A;  4YFN F;  4HF1 A;  3F23 A;  4M9Z A;  1U8R A;  3BZ6 A;  1TQI A;  3MAJ A;  5CVI A;  2O6G E;  1SAX A;  4L9V A;  1S8N A;  2ETH A;  4MTD A;  2OA4 A;  1HST A;  3DKW A;  2V9V A;  3DP7 A;  1R5G A;  2KIF A;  1LJ9 A;  1XMK A;  1I1G A;  3QU6 A;  2BV6 A;  4N0B A;  5AIQ A;  3GXO A;  4IPA A;  2FF4 A;  4GYI A;  5ICE A;  4ENJ A;  1OYI A;  3CUQ A;  3LA7 A;  3RTR A;  3NRV A;  2RQP A;  3ABT A;  2NRA C;  1WQ2 A;  4XLP F;  3ZMT A;  1QZY A;  4U7D A;  1EH8 A;  3WGG A;  2L01 A;  2OBP A;  3T1B A;  2VBX A;  2NS0 A;  2BBY A;  1SD6 A;  2Q8K A;  1L0O C;  3ZMU A;  2VC0 A;  4E70 A;  2EB7 A;  1ZHF A;  2QLZ A;  2VT3 A;  1J5Y A;  4L0Y B;  3ZN1 A;  2DPD A;  3ERE D;  2VBW A;  2XV4 S;  2DO7 A;  4UVB A;  1H9T A;  2VE8 A;  4KMF A;  5LGU A;  2GQQ A;  1G3Y A;  2ZO4 A;  4O5V A;  2CFX A;  4EGZ A;  3GX4 X;  1USS A;  4NHJ A;  2ZBK A;  1KQ9 A;  3H3U A;  2RC4 A;  4MNU A;  3WTS C;  2V1U A;  4OMY A;  1WI9 A;  1SD7 A;  4S05 A;  2EFP A;  2P7V B;  3M8F A;  1ON1 A;  1U6G A;  1IN5 A;  3LWF A;  2FBH A;  2GA2 A;  1FWZ A;  3J81 Z;  2XHK A;  5D8L B;  4I01 A;  2F2E A;  5D6F A;  1VTN C;  2FSW A;  3QPH A;  2K27 A;  2VOD A;  5HLI A;  5D4S A;  5E20 A;  4BH9 A;  3LAJ A;  1HKQ A;  4FX0 A;  4Q4Z F;  1PDN C;  3RKW A;  4FHT A;  4KNY A;  2XAG A;  3O2P E;  2ESH A;  4B8X A;  4KN4 X;  3TOA A;  1CGP A;  1I1S A;  3WGH A;  1UFM A;  2O03 A;  3RI4 A;  3KZY A;  2FBI A;  3IL2 A;  3SZP A;  4XBF A;  3ML6 A;  4ETS A;  1XGS A;  4LB5 A;  3IRQ A;  2YSR A;  5FGM A;  2Q2E A;  3WGI A;  4O3M A;  3WOD F;  1ZRE A;  5D5W B;  1SFX A;  1Q1H A;  3EYY A;  3RKX A;  2R7F A;  1BOA A;  4MTE A;  4AIK A;  5CLS A;  1KGS A;  3D0S A;  4HV5 A;  3HYI A;  1K7A A;  3J81 K;  4BNC A;  1BIB A;  5DD4 A;  2Z5U A;  2DT5 A;  1P4W A;  1P2F A;  2E1N A;  2XUB A;  1ZGJ A;  2CYY A;  3E6C C;  1HXD A;  2QQ9 A;  3DQV C;  1MZB A;  5ICC A;  2QQA A;  3ZQ7 A;  3F8F A;  2XIG A;  4OIR F;  2EV5 A;  3K1P A;  1FOK A;  1FYL A;  3ECH A;  5AIP A;  3REO A;  5JFR A;  3QP6 A;  4LJZ F;  4A2U A;  2A6H F;  3JTH A;  4L9N A;  4IJA A;  1EV7 A;  4AWX B;  2FRH A;  5BS6 A;  1K78 B;  1JHH A;  3ZP5 A;  3KET A;  2QBY A;  2WV0 A;  1FSH A;  3PQJ A;  3TDU C;  2WWY A;  1D5V A;  1UHM A;  2BEO A;  5E8I A;  5BMZ A;  5F6F A;  4EJT A;  3RKY A;  1TW2 A;  4EGY A;  4RGU A;  1OMI A;  2PI0 A;  2ZNZ A;  3K69 A;  5K5R A;  2D1H A;  2HQR A;  3NQO A;  3FWE A;  3ZMV A;  4GO1 A;  2J5P A;  5DYM A;  1G6N A;  2ZCW A;  2ZXJ A;  5ICF A;  1YW9 A;  3ZMS A;  4UV9 A;  1T39 A;  4LFU A;  2OQG A;  1ONV A;  1W5S A;  1KYZ A;  2RGV A;  5LLQ A;  2P5L C;  3EET A;  2LDU A;  3DF8 A;  5DV5 A;  3WG9 A;  4AD9 A;  5DEQ A;  5HS7 A;  1FY7 A;  2MLK A;  3MQ0 A;  4WXC A;  3T0Y A;  2G9W A;  1IUY A;  1YYV A;  1BC8 C;  1XB4 A;  3JTG A;  2XAS A;  5TRD A;  4ZZD A;  1ZRD A;  5E18 F;  2CG4 A;  1TNS A;  1FYM A;  4HF0 A;  4IRI A;  3WU0 A;  2W24 A;  3P9K A;  3GEZ A;  5K1Y A;  2HTS A;  5L3C A;  3GW2 A;  2JPC A;  4IRH A;  4Y17 A;  5CVR A;  3GZ6 A;  4RGS A;  1R58 A;  1Z6R A;  4AVP A;  3I0T A;  3RPQ A;  5ED4 A;  3CUQ B;  2EA4 A;  1P4A A;  4N9I A;  3IWF A;  3WTU C;  2K4B A;  3HHG A;  1U5T A;  4LLN A;  3WTV C;  4HX8 A;  4NB5 A;  4OU0 A;  1XGO A;  2L4A A;  2UXX A;  1YFH A;  4A12 A;  2PBI A;  5AON A;  2F5F A;  5H20 A;  4EVI A;  5D4R A;  1PUE E;  5D5U B;  1IZ1 A;  2O3F A;  1OYW A;  3SFZ A;  4UVC A;  1P6R A;  3BP8 A;  4QWQ A;  5E1X A;  4GXO A;  3HRS A;  2GWR A;  4L9J A;  1YTY A;  2IVM A;  4XSX F;  2HOE A;  1SFE A;  3TOB A;  3RYP A;  5D6E A;  1IRG A;  1CF7 A;  4ZYH A;  2BYV E;  2FXA A;  3HOS A;  5FLX K;  3DPL C;  1B9N A;  3NEU A;  1I27 A;  4NQW A;  2IW5 A;  2E1C A;  1R22 A;  3W6K B;  3E6M A;  5TJJ A;  1XSV A;  3BJO A;  2VE9 A;  1X3U A;  1JHF A;  4L18 B;  1FNN A;  2VBY A;  2EFN A;  4HX7 A;  2QEN A;  2HQN A;  5LRR A;  4LK1 F;  2OQR A;  3DFG A;  2P7C B;  3C7J A;  1ZG3 A;  1LDD A;  4YFX F;  1IXR C;  4IHT A;  1BBY A;  2J5O A;  4PDK A;  4CDG A;  4LMY A;  2OZ6 A;  5EEH A;  3CO7 C;  4IXA A;  1XCB A;  3DEU A;  3KEO A;  3PQK A;  4ESF A;  3M8E A;  2DLL A;  4G6Q A;  1DPR A;  4R79 A;  3KP4 A;  3ZMZ A;  2XAJ A;  2NYX A;  4U88 A;  4LLL A;  3AAF A;  5DCM A;  2W85 A;  2YR2 A;  1Z91 A;  2VOP A;  3E97 A;  1LDK B;  3VOE A;  5FB2 A;  1J9I A;  3VB2 A;  1UCR A;  2CSO A;  1T6S A;  2STT A;  3LQR A;  1Z9C A;  3D5L A;  3CUO A;  1NHA A;  2O61 A;  4YG2 F;  2Z33 A;  4Y15 A;  4UNO A;  5IT9 Z;  4MQ9 F;  3KFW X;  3GFM A;  1IF1 A;  5CJ9 A;  1TQM A;  1XDU A;  2WTE A;  2UWM A;  1V3F A;  3Q5F A;  1G3W A;  3E5Q A;  4CYD A;  1W5T A;  2F5D A;  2RKH A;  5FFX A;  2QZ8 A;  2IA2 A;  1MJA A;  3HUG A;  1KQ8 A;  3RPU A;  1HKS A;  5L3E A;  4ZYG A; 
#chains in the Genus database with same CATH topology
 2UUZ A;  2MLG A;  1ERD A;  1D5Y A;  3QU3 A;  4CUG A;  4II2 A;  4JOM A;  3TDZ C;  3HRM A;  4G94 A;  4ZC3 A;  1PUF A;  2L3D A;  3T5X A;  2K5C A;  3FXM A;  1KQ0 A;  4YII A;  3VYU B;  5FRO A;  3S14 J;  4KFC A;  5D5X B;  3RSN A;  5C3E J;  1ZRF A;  4RB1 A;  4I09 A;  4B4C A;  5HDK A;  2L5Q A;  3JRG A;  1S72 I;  3GTQ J;  3TP3 A;  5F1R A;  2NAZ A;  5IY5 H;  1OCZ H;  5HS8 A;  5J1R A;  2DQL A;  2DYR H;  2GXG A;  4RBO A;  4U87 A;  3CCL I;  2YU3 A;  1E2X A;  2L02 A;  5H6R A;  2JTV A;  3B02 A;  1J0R A;  1YHQ I;  2QA4 I;  5F64 A;  4DZP A;  2VBZ A;  3LAP A;  2XSJ C;  4Y52 J;  3S32 A;  2JA6 J;  4PJ0 C;  3CP8 A;  1B72 B;  2KT0 A;  1FIA A;  2ELJ A;  3T8R A;  3PNV A;  2A3S A;  1FOX A;  3H9J A;  1RKW A;  2Y0S A;  2CGP A;  4WXD A;  4HOB A;  3MD2 A;  3KLN A;  3LQQ A;  3WTY C;  3DLL F;  3DTE A;  1RET A;  4XKW A;  1LDJ A;  2K9N A;  1J7K A;  4HEA 2;  2DMQ A;  5EJC A;  2LMD A;  3F0C A;  1YIJ I;  2BVM A;  1FLI A;  4DYR A;  4LG3 A;  1YI2 I;  2X0L A;  3HHH A;  4JP0 A;  1DPU A;  2WAF A;  5JI6 A;  1SFU A;  4CXF A;  3VYR B;  1WZ2 A;  4HW0 A;  3WE3 A;  3CCJ I;  1F5T A;  2QQ8 A;  3KP5 A;  3G4S I;  4CYC A;  3J7Z I;  3H1C A;  2XKP A;  4ASN A;  3DTK A;  3GVA A;  1D1B A;  3CZ6 A;  1D1C A;  1YO5 C;  3A01 A;  3FF5 A;  2QKL B;  2IEK A;  5ILS A;  2IGM A;  2P6S A;  2H09 A;  3EQL F;  4MIM A;  4A3K J;  3CDH A;  1D1A A;  2VC1 A;  2KKO A;  3CTA A;  3PNY A;  4LB6 B;  2CRG A;  4A3D J;  3BQY A;  2VB6 A;  4BDY A;  5IYD J;  2ZJP F;  1AA7 A;  5D8K B;  3D5S C;  4BYY A;  3LSH A;  5HOO A;  2H6B A;  3GTM J;  1SD5 A;  1P4X A;  1FBQ A;  4QIW N;  1BI3 A;  2DMT A;  2E60 A;  5TGT A;  1F4K A;  2OC6 A;  1A36 A;  2FOK A;  3E5X A;  5IP6 A;  3KYL A;  3I4P A;  2MC3 A;  2RQQ A;  2FJ1 A;  4IHS A;  2VQC A;  4BHP A;  3GFJ A;  1JTX A;  3QPT A;  1B59 A;  3V4G A;  1FBU A;  2CS3 A;  1B4A A;  1DUX C;  3H5A A;  1HSJ A;  3DEE A;  2KRH A;  3CUQ C;  1NG6 A;  3I3L A;  2Q1Z B;  4FTH A;  1I3A A;  5HNH A;  2HR3 A;  2L9N A;  1RPW A;  2WY8 Q;  1NH3 A;  3BQZ A;  4XON A;  3C18 A;  2CJJ A;  3GLL A;  1YJ9 I;  1ENH A;  3FXU A;  4I76 A;  2JZY A;  3ABM H;  2M87 A;  4D9J A;  2EJR A;  3CC2 I;  3J7A Y;  4I98 B;  4PJM A;  2F5C A;  5LBQ A;  3I54 A;  3AKZ A;  2W1O A;  4CA0 A;  2VT2 A;  5EG0 A;  2B0L A;  2DFH A;  3A0H C;  3F8M A;  4IEJ A;  1U0J A;  4ZYD A;  4BE1 A;  1IRF A;  3WG7 H;  4IO9 F;  4BKX A;  3F72 A;  1K6O A;  4EAT A;  5K7H A;  2KL4 A;  3B6A A;  1WH7 A;  3O8G A;  3HM5 A;  3BG5 A;  4DZJ A;  2OCE A;  5J40 A;  1XS9 A;  2C6Y A;  4HV6 A;  1G3S A;  5FLM J;  2IPQ X;  2L4M A;  3SZG A;  2BXY A;  2PN6 A;  1VND A;  3UKG A;  3ZRG A;  3BZC A;  2V1D A;  2V6C A;  3P9C A;  4HNU A;  1O57 A;  4J19 A;  3E3V A;  1NTC A;  1ZLK A;  1W7P B;  4IHW A;  5C4X J;  2M1B A;  1U5T B;  5LHG A;  3OIO A;  4RS8 A;  2D2W A;  2P0W A;  1WPK A;  3SQN A;  3GTL J;  1S29 A;  4M71 A;  2DT7 B;  2PFB A;  1AKH A;  2P5V A;  1BA5 A;  4DGW B;  2M8E A;  1OLT A;  5KK1 A;  3EUK L;  3G3Z A;  5EZG A;  2COM A;  2MW8 A;  4K2E A;  4RDU A;  2L9R A;  1YIT I;  2O0Y A;  3F22 A;  2L2O A;  1FT9 A;  1ZR2 A;  2IT0 A;  2WAE A;  3JRH A;  3GTP J;  1TQP A;  4G6T B;  3QRF F;  5B66 C;  5F08 A;  4IHX A;  4UXN A;  3RDI A;  4Z6Y A;  2CQN A;  2H6C A;  2VJJ A;  2LBF A;  1MSE C;  4YFK F;  2Z99 A;  2E19 A;  3MEX A;  1B6A A;  1MBK A;  3HSF A;  3JAM Z;  4HPQ A;  4JX4 A;  5HLG A;  2GIZ A;  2DAO A;  3CQZ J;  3V7S A;  1MBH A;  3SEQ A;  1FC3 A;  1R1V A;  4N9H A;  4RB3 C;  3L9F A;  5DCF A;  1R6R A;  1WRJ A;  3BJ6 A;  4MO7 A;  2BY1 A;  4G7O F;  3HB9 A;  4B09 A;  1LQ1 A;  2CUZ A;  4PZJ A;  2M8G X;  3EDP A;  3ULQ B;  5J1U A;  3BOQ A;  3PFY A;  4PJN A;  3BTI A;  1S7E A;  1PYV A;  2DA3 A;  3R61 A;  4HSR A;  4X0G A;  3ZOB A;  3K4K A;  4PCQ A;  1YRN B;  1QHH D;  4XLA A;  4NQW B;  4LG0 A;  1UB9 A;  3K7A J;  4M3D A;  4M74 A;  3H0G J;  3TED A;  4B47 A;  4GYG A;  2Z1D A;  1ETQ A;  2ELH A;  2HKO A;  3FZV A;  2DJI A;  1U2W A;  3GUD A;  3CJN A;  2ZC2 A;  3I58 A;  2E1O A;  1BW6 A;  2N8G A;  5J8F A;  1QQI A;  3A0B C;  3LFU A;  2EV6 A;  2D5V A;  1RNL A;  2BW3 B;  4DW6 A;  2PQ8 A;  2Q0O A;  5DM7 F;  2EIJ H;  2M30 A;  3KP6 A;  3IAM 2;  3I59 A;  5KAF C;  4CCN A;  3IH2 A;  3KP7 A;  4I02 A;  3HEF A;  1WJE A;  3H3V K;  1PJR A;  1MDM A;  2A05 A;  3BR5 A;  1VF9 A;  1XMA A;  4XSZ F;  4HG2 A;  2A61 A;  3K1M A;  1IV8 A;  3KZI C;  1O3R A;  2JRT A;  2I10 A;  3IKV A;  4G7Z F;  2EH3 A;  1BJA A;  2ZB9 A;  1RIO H;  4MLO A;  3I9V 2;  2RVC A;  3P9I A;  5E17 F;  3H3Z A;  2FML A;  5ERI A;  1S7A A;  1IJW C;  4JQF A;  3JAM K;  4KT6 A;  3BLY A;  4EJO A;  5LGN A;  5FD5 A;  2ID3 A;  1JXS A;  1SMY F;  3BR1 A;  3C3W A;  4II3 A;  2X4H A;  2XRL A;  2HGC A;  2Y48 A;  3OSG A;  3CC4 I;  1POG A;  3IH3 A;  2K3P A;  5D5V B;  4WXH A;  3M3Y J;  4WX9 A;  1D8J A;  2HYJ A;  2PEX A;  1QHG A;  1J59 A;  4PUS A;  2EFW A;  4GRI A;  2CQ7 A;  5J6X A;  2GA1 A;  2KLO A;  1TT0 A;  2MD5 A;  2VON A;  2KRF A;  3DPU A;  2LY2 A;  3PSF A;  3FIW A;  1T56 A;  9ANT A;  3LL7 A;  2DMP A;  1SAU A;  3GFL A;  4OIP F;  4CGZ A;  2HPI A;  1O3S A;  2A5Y B;  1ZRC A;  5LEJ A;  4ENK A;  2DI3 A;  2F4M B;  1G3T A;  1OCP A;  5FKO A;  1O7L A;  4A5M A;  1FBS A;  2M34 A;  2QYO A;  2KZG A;  4BBS J;  5LGT A;  4RM3 A;  4AID A;  5DTD A;  1DP7 P;  2V7F A;  2XF5 A;  2D45 A;  2OPT A;  1I6X A;  4M6Y A;  3ABU A;  2M0M A;  1YIO A;  2G7U A;  1X58 A;  2DYS H;  2ESN A;  3FK7 A;  4XN0 A;  1TTY A;  2XAQ A;  1ZG1 A;  4ENN A;  1TWA J;  1J75 A;  3F8B A;  4UHT A;  2JVG A;  1WJF A;  4HZF A;  5IYC J;  3IC7 A;  4ESJ A;  3HTU A;  4BXU A;  3SXY A;  4NC6 A;  1KYW A;  1QPI A;  1S7O A;  2GM4 A;  1XSX A;  5M5W J;  5EDN A;  1C0W A;  1MBJ A;  3PIO F;  5BQT A;  5JVT A;  2PJP A;  2FD5 A;  4BS9 A;  2GAU A;  1ZKG A;  2NNN A;  4UUS B;  3FXL A;  4A3L J;  1BR4 A;  3KYC B;  4A5N A;  4F3Q A;  1LB2 A;  2QWW A;  3V8K A;  1BW5 A;  1BI0 A;  2LLK A;  3BRO A;  3HUG B;  1FSE A;  2YX4 A;  2XPW A;  4HRI A;  2AS5 F;  3JRB A;  4U0Y A;  2W48 A;  2IRF G;  3I56 I;  2KRC A;  3FMS A;  4ZDL A;  2VL8 A;  4N4O B;  5HLT A;  4MHG A;  1LEB A;  2L9V A;  1U3E M;  2FNP A;  4HST A;  2OTJ I;  1ODD A;  2R7U A;  3FK6 A;  3W6J B;  2VN2 A;  1PUF B;  1T33 A;  4P9F A;  1JE8 A;  3HOX J;  1D8K A;  4Q47 A;  3FM5 A;  2KIQ A;  1PVE A;  2HPM A;  1S6L A;  4OOI A;  5J3L A;  1TC3 C;  4WCG A;  4P5O A;  4HDU A;  1V5F A;  1IN4 A;  2NNY A;  1R9T J;  1MGT A;  3L2V A;  1E3O C;  2QF7 A;  3K10 A;  1R4N B;  3K70 C;  4V2F A;  1Y1W J;  4RMN A;  3W2W A;  3N05 A;  1IXC A;  1R1U A;  2ZNY A;  2DXI A;  4IF4 A;  1V55 H;  4NBQ A;  1VQ9 I;  2KP6 A;  3LNQ A;  1P7J A;  4YEL A;  2K40 A;  1YLF A;  5LEK A;  3BR0 A;  1CQT A;  1IDY A;  2RNJ A;  4RGX A;  1MH4 A;  3BTJ A;  4M3G A;  1EH7 A;  5K5Q A;  1ULY A;  3NWS A;  1IRZ A;  2F4O B;  5M5Y J;  2CO5 A;  3E6B A;  3OL3 A;  4PGH A;  3JSO A;  3W2A A;  3S93 A;  2DDA A;  5KVR A;  3ISP A;  4RB2 C;  3MN2 A;  3PUB A;  3IAS 2;  4XLC A;  1P9Q C;  1LFB A;  2EK5 A;  1QZZ A;  2NOJ B;  4M3B A;  4CH7 A;  4D7N A;  1J2X A;  2MA3 A;  2HXO A;  3TQN A;  2W25 A;  3H35 A;  2K7L A;  1IW7 F;  3ZQH A;  2DBB A;  3JRF A;  4HAM A;  1TWH J;  2EIN H;  2L9S A;  5E3N A;  5EGO A;  2CUJ A;  1Z3X A;  4OMZ A;  4CYC B;  4YIR X;  4Y13 A;  3OV8 A;  3G1L A;  3MZH A;  2M0C A;  3LSR A;  3K9T A;  2K9L A;  3A01 B;  4B3A A;  1RUO A;  4R1H A;  1U9O A;  4IX7 A;  3CES A;  3LA3 A;  3L7W A;  3KPH A;  5GTH C;  2XB0 X;  1RUN A;  1BM9 A;  3QWL A;  4U0W A;  2KIM A;  3COA C;  1FTZ A;  1NG7 A;  2FU4 A;  3K4L A;  4UVA A;  1F1Z A;  4UB8 C;  4KA4 A;  3SZT A;  1SVM A;  1VI0 A;  4ENM A;  1QO0 D;  1H0M A;  1JGG A;  2JUC A;  4DYC A;  1D3Y A;  3VSL A;  2NVT J;  1XD7 A;  3K4B A;  1PP7 U;  2YU9 J;  1XCV A;  2GXB A;  4BAC A;  4DQ2 A;  2KIU A;  2K4J A;  4M6V A;  4XKB A;  2Y69 H;  1AU7 A;  5HLH A;  1OJL A;  2HFH A;  2WA0 A;  2OU2 A;  3LFK A;  1HW5 A;  4WF2 A;  4BJT A;  4XLN F;  3E5U A;  1SMT A;  2R7R A;  5LFA A;  2LNB A;  5L3B A;  4FX4 A;  2W7N A;  1VQ8 I;  1V4R A;  4DNC A;  2YUS A;  1VQK I;  1JI8 A;  1U5T C;  2K86 A;  2Y9Y A;  1GVD A;  2A6E F;  3MKZ A;  4G8X A;  5FFZ A;  1JT6 A;  4QLC U;  2W82 A;  3HRU A;  4F7Z A;  3QOE A;  5K5O A;  3DLA A;  4NUB A;  5EG0 B;  4CCK A;  3S1M J;  2IJL A;  2HOT A;  1G4D A;  2DFI A;  2NXN B;  1VQL I;  3O6B B;  4E7L A;  4HLX A;  2M7B A;  3S1N J;  1K4S A;  4M9X A;  1ZAR A;  2Z9O A;  3L2R A;  3VDX A;  3JRE A;  5DS9 A;  3WTZ A;  1D0Y A;  5DDG A;  5L3F A;  1DQU A;  4BHC A;  2GBY A;  1OR7 A;  4JYK A;  3ABK H;  3GZ5 A;  4BQO A;  4UY8 I;  2R5Z A;  4HF2 A;  3JW4 A;  4E7I A;  1OYY A;  3K4N A;  4I99 C;  4MEX F;  1MMA A;  1KU3 A;  3WU2 C;  4RAZ A;  3RQI A;  3MVP A;  2ZJQ F;  1QPM A;  2EFO A;  4DOZ A;  4OIO F;  2LH9 A;  4UV8 A;  3ZPL A;  1IN7 A;  1SD4 A;  3HIF A;  3VOD A;  4XQF A;  1RI7 A;  4H0E A;  1YQA A;  1HDD C;  1QZE A;  4G9Y A;  2QUF A;  2VXZ A;  2A6T A;  1WSU A;  2DQR A;  3PFI A;  2EA2 A;  1JKR C;  2PJR A;  1YS6 A;  1GXQ A;  3ZMD A;  4FT8 A;  5CVU A;  3JCU C;  4OAZ A;  4BXX J;  2LBF B;  3O3K A;  1T0F A;  5F0H A;  1MNE A;  2HOA A;  4IQ4 A;  3I53 A;  3K70 D;  2CW8 A;  4KIG A;  2FNA A;  2XGX A;  5FO5 A;  3CJR B;  4KIC A;  5DD8 A;  2NS7 A;  1MKM A;  3ZGK A;  4AIJ A;  2EFQ A;  3AG2 H;  2HOS A;  2MYS A;  3F3X A;  1ETK A;  4A3F J;  3HPH A;  3WHC A;  4FE4 A;  1A5J A;  1R71 A;  3B6C A;  2X1C A;  3W2V A;  1R5H A;  2Y2Z A;  4U7B A;  1A6Q A;  3AG4 H;  1Z7U A;  1R1T A;  3F21 A;  2OF7 A;  5B5E C;  3LSJ A;  5HNF A;  4XOR A;  1MD0 A;  2ADU A;  3ABL H;  3N4M A;  3BWG A;  3JSP A;  2WBM A;  2COB A;  2BHY A;  4XLH A;  2EV0 A;  5HOD A;  2GOX B;  3HSE A;  2HWV A;  3VEP A;  1STZ A;  2RN7 A;  2W57 A;  2HZD A;  4YIF A;  2O8K A;  1BI2 A;  3HTS B;  4KIB A;  2GIV A;  2JSC A;  2VKE A;  4LG0 B;  3ECO A;  2LG4 A;  3G71 I;  3SHF A;  1ZGW A;  4GGG A;  2NVU B;  1Z05 A;  2HZT A;  5FKN A;  2ISZ A;  1TWG J;  3OMY A;  2EWN A;  3LOC A;  4M73 A;  3BT9 A;  2DOF A;  3M1C A;  2KZV A;  3CCU I;  2QBY B;  2HYG D;  2WB1 N;  3Q0U A;  4WK8 F;  2ICW G;  4V19 K;  1W0T A;  2IA0 A;  3F9K A;  5E1W A;  2A07 F;  5DUK A;  2DFF A;  4AIH A;  3L09 A;  2F48 A;  2E7W A;  3IKT A;  2Z3Y A;  2OJE D;  2VAS A;  1VQ6 I;  5GAG J;  3I59 B;  2NVY J;  4C9Y A;  1WGX A;  1ETX A;  2Y0M A;  5IT9 K;  2L7Z A;  3E6D A;  1MMS A;  2QSH X;  1MDM B;  2HTJ A;  2IBD A;  3OYD A;  1D0X A;  1WVR A;  3FXQ A;  4P9U A;  4QTR A;  2CH0 A;  2E7X A;  4FE7 A;  3WU1 B;  4I2O A;  4IQJ A;  4UUT A;  2P8T A;  5HDN A;  3FMR A;  3W6V A;  5CVJ A;  5J4Y A;  3SDG A;  2BE5 F;  1ZGA A;  2E71 A;  3JR9 A;  3R6S A;  2K9S A;  2PMU A;  2LP0 A;  2VPR A;  3HRT A;  2CMP A;  1KU7 A;  1TZL A;  4Q48 A;  5B3S H;  4I0A A;  1IGN A;  1IN6 A;  4EJU A;  2MFZ A;  4HA8 A;  4TV7 A;  3IWZ A;  4KDP A;  3LSP A;  1I6H J;  2ZSH B;  1ZLJ A;  1RR8 C;  1W7P D;  4C2M J;  3V42 A;  5F04 A;  3IUO A;  2DA4 A;  2ZME A;  5L3G A;  2LF8 A;  5C44 J;  2NOG A;  4BGD A;  1OPC A;  2DFE A;  2XKO A;  2DA2 A;  2BHZ A;  4ON0 A;  4BBR J;  1X4P A;  2Y30 A;  1Z1D A;  1T38 A;  1W36 C;  1REP C;  4MEY F;  1O3T A;  2K9Q A;  1MJ9 A;  1P92 A;  2X48 A;  4AYB N;  4E7S A;  2FOW A;  2R7S A;  4HNT A;  4KUM A;  4O6J A;  1FP1 D;  2R4G A;  1U8B A;  1QBJ A;  2LVS A;  4A0Y A;  2IA1 A;  3V7R A;  2OUM A;  4ZH4 F;  2CV0 A;  1H8A C;  3K4C A;  3OYG A;  2KQR A;  1GHC A;  1MJB A;  2M7A A;  3CLO A;  4Y4R A;  3A03 A;  1VZ0 A;  3CCS I;  1TLH B;  1F36 A;  4V2G A;  2DMU A;  1TNT A;  4Q5S F;  5H2F C;  1KU2 A;  5C4J J;  3ELK A;  5BOX A;  2K85 A;  1DU6 A;  1XG1 A;  1YE9 A;  3FXK A;  2VOO A;  3MCZ A;  2X85 A;  1Y0N A;  1QVT A;  5GPA A;  1HA8 A;  4BJ5 C;  1X1A A;  4KN7 X;  5CPR B;  2XRO A;  1R49 A;  2IXS A;  4I6Z A;  1KU9 A;  1MMG A;  3TKY A;  2KFD A;  4JK1 X;  1VQP I;  2HYF A;  3M7G A;  1WH5 A;  3KLO A;  1YS7 A;  2UZK A;  1E17 A;  3M9A A;  1T95 A;  2E5Z A;  1Y0U A;  1SVL A;  5EF6 A;  4BE2 A;  2MBF A;  2XPU A;  3KE2 A;  1FOY A;  2ZFU A;  5BPD A;  3DKY A;  1U78 A;  2EIK H;  3K2Z A;  3A02 A;  1YX5 A;  1ZN2 A;  4EEF G;  1GDT A;  1E3H A;  1IAW A;  1T2K A;  3EYI A;  4I7H A;  2X9D A;  1HF0 A;  5JVG F;  3OYL A;  1T8I A;  2KMU A;  3OYN A;  4RGR A;  3KP2 A;  1BOB A;  4IL6 C;  2LY9 A;  2XGE A;  2DK8 A;  3OYB A;  3F8N A;  4M9S A;  5M3M J;  1XMX A;  1SEU A;  2IP2 A;  3NAR A;  5HS9 A;  1LUJ B;  4AUX A;  1H9G A;  2V79 A;  2OZU A;  2DPU A;  1ZYR F;  2STW A;  3WTW C;  2ELK A;  5DUI A;  5H6Q A;  5ILU A;  5IT3 A;  3ERM A;  2YX7 A;  1GVJ A;  2L54 A;  3KX2 A;  3T8T A;  2KJB A;  2EZI A;  5LRS A;  2VJ5 A;  2WC2 A;  1T98 A;  1UST A;  2FE3 A;  3F8C A;  3RCO A;  2K9M A;  4MGR A;  1XSD A;  1G2H A;  1QNT A;  3DPT A;  1MBF A;  4A3E J;  1OQY A;  2DT6 A;  2MH2 A;  4EJV A;  1MSF C;  3IRR A;  5A2Q Z;  3B73 A;  4CCM A;  1YX3 A;  1DDN A;  2RV8 A;  3H9Q A;  1JGS A;  4F55 A;  2DA6 A;  3L2C A;  4R8H A;  1RC9 A;  2IGK A;  4G6D A;  5CVV A;  1BN5 A;  2ZXW H;  3Q3S A;  1KA8 A;  2Z2S B;  2Y75 A;  2MC4 A;  3AG3 H;  3WTX C;  3GO5 A;  4M72 A;  3HOZ J;  3Q9V A;  4XRM A;  1XTA A;  1Z7L A;  1X2N A;  3A1Y A;  2VJI A;  4L5E A;  1AWC A;  3I71 A;  2H27 A;  2CW7 A;  1N77 A;  4OIN F;  1LFP A;  2L7F P;  1R23 A;  4BJ6 C;  1MMD A;  1SC7 A;  4C30 A;  4JX5 A;  4LD5 A;  1CF7 B;  3U2R A;  4ZZL A;  3BPX A;  4XN3 A;  1ZQ3 P;  2JA7 J;  2K02 A;  1X19 A;  1YG2 A;  3C2B A;  3TO9 A;  2LKP A;  1FX7 A;  3CME I;  2R3S A;  2HNH A;  3LMM A;  3FKJ A;  3OOU A;  4EJW A;  3J7A O;  2W00 A;  4G7H F;  1QU3 A;  5L3E A;  3QYF A;  4BDZ A;  2V6E A;  2JPB A;  3CO6 C;  4BE0 A;  4L5J A;  3FIS A;  2HS5 A;  4L0Z B;  2CW0 F;  3WTT C;  3CCV I;  5LHI A;  3QPS A;  2LRE A;  3PO2 J;  5GPC A;  1DGR M;  1QGP A;  1ZG5 A;  1XGM A;  4BHB A;  3HOU J;  3DXJ F;  3J80 Z;  4UUV A;  1EA3 A;  1HC8 A;  3K0L A;  3D5R C;  2PMH A;  5BNG A;  2IS4 A;  2DU9 A;  1S3J A;  4PJJ A;  1WWX A;  1SFO J;  4A0X A;  4F91 B;  2HEO A;  3I4M J;  4L9T A;  2KPM A;  3BJA A;  2WB1 A;  2QKM B;  5F27 A;  4EV0 A;  1JT0 A;  1W36 D;  2B7E A;  3BC8 A;  1WCM J;  3R0A A;  4A3M J;  1GXP A;  3U1D A;  1LEA A;  2FMY A;  4E7J A;  5E8G A;  2YS9 A;  1TW3 A;  3UNG C;  4FAS D;  3L2Q A;  4A6D A;  4HQE A;  3OS2 A;  3KCC A;  3J7Y J;  2EPF A;  5A2Q K;  4EMS A;  1IV6 A;  2DCE A;  2PX9 A;  4LIU A;  2ISY A;  1UHW A;  3RPU D;  5BPI A;  3HGG A;  1AOY A;  2LYC A;  4IVN A;  4KMU X;  4XOT A;  4EM0 B;  2CWE A;  1ETO A;  1ZH5 A;  3HJE A;  2EIM H;  2XF7 A;  4ZDP A;  4CHU A;  3K1N A;  4AU7 A;  4XLE A;  4C3J J;  4ZYE A;  2RDP A;  4LLG F;  4A6E A;  3HGY A;  4P1W A;  4CZC A;  2F4I A;  1ZAO A;  5DCM B;  3N97 A;  1HKT A;  5JLX A;  4E7H A;  3DTI A;  4BQA A;  4XNF A;  1IN8 A;  2GOM A;  4Z2Y A;  1O7F A;  2O7O A;  2WY7 Q;  2B9S A;  5J8C A;  2R5Y A;  3EUA A;  4P96 A;  1LNW A;  4XL9 A;  3AL0 B;  2LR8 A;  4EM2 A;  1HBX G;  2D1V A;  3R0J A;  4LIT A;  4PJL A;  2ZXH A;  3R60 A;  1S9H A;  2R5Z B;  1V54 H;  2AXL A;  3TO6 A;  3S2W A;  3CCQ I;  4HYE A;  1FYK A;  1ETW A;  2E2I J;  6PAX A;  4PSX A;  4HBL A;  1UAA A;  1BIA A;  1I5Z A;  3RIR A;  1FPQ A;  1HCR A;  4HDV A;  2UXN A;  1XDS A;  2M3A A;  2QM3 A;  4AYB A;  4MFE A;  4FET A;  1U9N A;  2DK5 A;  4XRF A;  3CDI A;  4BQQ A;  4MQV A;  4KYW A;  3J80 K;  2PJR B;  3JRC A;  4I0B A;  2I5U A;  4Y7N J;  3KEQ A;  3FMQ A;  2OD5 A;  1K79 A;  4HLY A;  3MWM A;  2JRM A;  3DBH B;  3GWZ A;  1PP8 F;  1K4T A;  3HKZ A;  3DV8 A;  2ME6 A;  1W1W E;  3LSM A;  1BI1 A;  2TDX A;  3FXR A;  2FA5 A;  2L0K A;  2DW4 A;  1TBX A;  2FEZ A;  4HX4 A;  1WKM A;  1FP2 A;  1IXS B;  3H0D A;  4WWC A;  2EZH A;  4M3F A;  4XIC A;  1E0E A;  2LOO A;  3AFH A;  1A6I A;  3BG3 A;  4OAY A;  2JSP A;  3L00 A;  3BPV A;  3DU5 A;  3PSI A;  4XKC A;  1Y1V J;  3H92 A;  5EEG A;  5FKM A;  2VIX A;  5HDG A;  1ON2 A;  2H94 A;  3DBR B;  1Z6T A;  4P55 A;  4QPO A;  3ZR8 X;  1BC7 C;  2CQK A;  1RKT A;  3VYT B;  1HLV A;  3OL4 A;  5FLX Z;  1XPX A;  4XK4 A;  5JHU A;  2HKX A;  3H36 A;  2VLA A;  4M6X A;  4ZTF A;  5ILV A;  1YW7 A;  1QVU A;  4U0V A;  5JR3 A;  2R7V A;  3OYE A;  3BY6 A;  3G2B A;  2B63 J;  4HQM A;  2OAZ A;  2DA7 A;  2DTZ A;  2XRN A;  4A0Z A;  4RB0 A;  3HSR A;  3GYH X;  1WJA A;  3FM3 A;  3KP3 A;  1R7J A;  3HOT A;  3I4N J;  2R7D A;  1R00 A;  3LST A;  2ZJ2 A;  1X3W B;  1FMW A;  1W7P A;  2P5K A;  1WJC A;  3C1D A;  2HQA A;  5JHF A;  3LA2 A;  4GDF A;  1YW8 A;  2KJC A;  3EUH A;  1IO2 A;  1XN7 A;  5KCM A;  2AO9 A;  3HXL A;  3LSG A;  1BR1 A;  2FQ4 A;  5KAI C;  1F9N A;  2GZW A;  3RYR A;  1UG0 A;  5EEA A;  2LKS A;  3ZCO A;  4NC8 A;  3A4C A;  2HDC A;  2AXT C;  3U21 A;  4DBQ A;  3MFK A;  2MH9 A;  2VKD A;  4PSW A;  4YEJ A;  5CYV A;  5CKT A;  3MZY A;  1X1B A;  1A04 A;  2FBK A;  2XAF A;  1Q1V A;  4J00 A;  2V1X A;  5L3D A;  1RZ4 A;  2OCC H;  3GLX A;  1HW2 A;  3JRA A;  2VQL A;  2P4W A;  3OR2 C;  3V8J A;  2M45 A;  4L5I A;  3L2U A;  4CZZ A;  4DJA A;  2DTR A;  3FKI J;  2FQ3 A;  2WAD A;  2W84 A;  2WAQ N;  4KIF A;  2X6O A;  1YOV B;  3BDD A;  4YRV A;  3OR1 C;  2ZME B;  4PFP A;  3Q9S A;  2E2J J;  2ZKZ A;  2BGC A;  3F6V A;  3ZQC A;  1EH6 A;  1VQ7 I;  5ICG A;  1GLN A;  2XDV A;  2XSD C;  1G59 A;  3TL4 X;  2L7K A;  2CFO A;  2ZFW A;  2LSO A;  2VKV A;  5IOZ A;  2Y9Z A;  3KZZ A;  1BL0 A;  3S17 J;  2HDD A;  3MKY B;  2QVO A;  1OIS A;  2JT1 A;  3OYK A;  3VFZ A;  4IHV A;  4KT5 C;  3FHZ A;  4F93 B;  2X51 A;  2KIS A;  2F5E A;  3GF2 A;  2PLY A;  4OIQ F;  2O8X A;  1K78 A;  1EKE A;  1JUM A;  1LVA A;  1XGN A;  4LK0 F;  4RAY A;  3E0J B;  3BG7 A;  2FUG 2;  1X4O A;  3R4K A;  4BAY A;  3RKQ A;  2E1M B;  2X1E A;  4IOC F;  2M4G A;  1B9M A;  1O4X A;  2XVC A;  1JJ8 C;  3QAH A;  3FX3 A;  4CCO A;  1EF4 A;  2PG4 A;  2CQQ A;  3OOP A;  4CIC A;  3V7C A;  1DP3 A;  1DGW Y;  3P7N A;  2A68 F;  4E6K G;  4D5F A;  4S04 A;  3ZN0 A;  4D0P A;  3RJP A;  3M1E A;  3IV5 A;  5GAE J;  5HVQ C;  3TMO A;  3IHU A;  5E3L A;  4ESB A;  1HQC A;  1R5I D;  1WJB A;  1K83 J;  2AQF A;  3QOP A;  2ACJ A;  2XB5 A;  2YPR A;  2P6T A;  3H9G A;  5LHH A;  1DU0 A;  4CO8 A;  3G73 A;  2JK3 A;  2LF7 A;  1W5C C;  3OYC A;  2NVX J;  4AVZ A;  3WE2 A;  4ANJ A;  2VUM J;  4GCV A;  2LD5 A;  3U9G A;  1B1B A;  2QQB A;  1L3L A;  2BOL A;  4IRG A;  2BY0 A;  3V8L A;  1HW1 A;  1OKR A;  3ZQQ A;  3GFI A;  1X1D A;  1Z77 A;  4W97 A;  1FZP B;  4E4H A;  2DDB A;  1A35 A;  3GTK J;  2DMN A;  1FIP A;  2A69 F;  3ROU A;  4DBR A;  1R36 A;  1LVK A;  2K3F A;  1Y6I A;  1AKH B;  1QA6 A;  4LGW A;  2M5W A;  5E1Z B;  1O3Q A;  4EQQ A;  3SFI A;  3I5U A;  3QP5 A;  3TO7 A;  2G7H A;  5FD6 A;  3VWB A;  3F6O A;  4PGG A;  1Z21 A;  4IKF A;  1JKO C;  3QYE A;  1JKP C;  3M07 A;  1ETY A;  1W4M A;  5GAH J;  2XAH A;  2JVH A;  3TGN A;  3I64 A;  4PK4 A;  4EM1 A;  4YFN F;  4HF1 A;  1Z3Y A;  3F23 A;  4M9Z A;  1U8R A;  3BZ6 A;  1JJ6 C;  4B1R A;  1Y56 A;  1TQI A;  2DJN A;  3S1R J;  3MAJ A;  1VQ5 I;  5CVI A;  3SEZ A;  2O6G E;  1SAX A;  2OTL I;  4L9V A;  4BUP A;  2E35 A;  1S8N A;  1V5G A;  1FMV A;  2ETH A;  4MTD A;  1ETV A;  4B3X A;  1ZK8 A;  3BR6 A;  1Y39 A;  3G1O A;  3GME A;  1MW7 A;  3GTG J;  3S2H J;  2OA4 A;  2VI6 A;  3W3C A;  2FX0 A;  2HXI A;  2H8W A;  2L7M P;  1HST A;  3GTJ J;  2V9P A;  3DKW A;  4B44 A;  2V9V A;  5IP7 J;  2DA1 A;  3O8H A;  3DP7 A;  5DM6 F;  4DIQ A;  1R5G A;  5FKL A;  1I39 A;  3HOV J;  2KIF A;  2R7O A;  4C2U A;  1LJ9 A;  1XMK A;  2V9K A;  3BG6 A;  1I1G A;  1H88 C;  1LE8 A;  3QU6 A;  1I3Q J;  3WHB A;  2BV6 A;  5K7F A;  4UUS A;  4N0B A;  2P81 A;  3NAU A;  3CMA I;  5AIQ A;  3GXO A;  2F6C A;  3OYF A;  4IPA A;  4XKV A;  1MND A;  2FF4 A;  2LK2 A;  1K61 A;  4AC0 A;  4GYI A;  2KHM A;  2EBI A;  1GV5 A;  5ICE A;  3CF5 F;  4ENJ A;  1OYI A;  3CUQ A;  5E3O A;  3LA7 A;  2IGO A;  3RTR A;  2JWT A;  3NRV A;  1APL C;  2R93 J;  2RQP A;  3ABT A;  1B8I A;  2NRA C;  1WQ2 A;  3G1M A;  4XLF A;  1ZEL A;  2VKH A;  2VXD A;  3C2H A;  4XLP F;  3IP4 B;  4PFO A;  3ZMT A;  1QZY A;  4U7D A;  1EH8 A;  3WGG A;  1EJ9 A;  2L01 A;  5LD2 C;  2OBP A;  3T1B A;  2VBX A;  2NS0 A;  4KJZ A;  2BBY A;  5FRM A;  1SD6 A;  3MZ8 A;  2Q8K A;  1L0O C;  3BG9 A;  3OY9 A;  5B1B H;  3ZMU A;  1NK2 P;  2CUE A;  1VQN I;  1I50 J;  2VC0 A;  3IH4 A;  4E70 A;  1SFK A;  1SVO A;  2EB7 A;  1ZHF A;  2QLZ A;  2VT3 A;  3AL0 C;  5E79 C;  1J5Y A;  1OR7 C;  3ZXS A;  2LY1 A;  4L0Y B;  2VPL A;  1W0U A;  3ZN1 A;  2DPD A;  3ERE D;  3SJM A;  1R4M B;  3Q0W A;  3GTO J;  2VBW A;  2XV4 S;  1WFX A;  3ONQ A;  2DO7 A;  4N4N B;  4UVB A;  1H9T A;  2VE8 A;  2CV2 A;  4KMF A;  5LGU A;  3S2D J;  2GQQ A;  1G3Y A;  4ITV A;  1IRX A;  2ZO4 A;  4O5V A;  3GCM A;  4D5C A;  2QEX I;  3MKW B;  5IYB J;  2CFX A;  4EGZ A;  4DYQ A;  3GX4 X;  1T0F C;  4D1Q A;  1USS A;  3DU6 A;  4BQN A;  2R5Y B;  2WAQ A;  2RRE A;  4NHJ A;  4A3I J;  2ZBK A;  3S3O A;  2PMZ A;  3S3M A;  1UG2 A;  1KQ9 A;  4HNV A;  2JUG A;  1N78 A;  3H3U A;  2RC4 A;  4RAG A;  4MNU A;  3WTS C;  2V1U A;  4OMY A;  3S15 J;  1WI9 A;  1SD7 A;  2X6Y A;  3TW6 A;  4Y3O A;  4M3E A;  1G8X A;  5TIS C;  2BY2 A;  3HKZ N;  3HPG A;  4S05 A;  2BXZ A;  2EFP A;  2P7V B;  3M8F A;  1ON1 A;  1U6G A;  5FKK A;  1IN5 A;  3LWF A;  3LSK A;  1AHD P;  2FBH A;  2GA2 A;  1FWZ A;  3J81 Z;  2XHK A;  5D8L B;  4I01 A;  2F2E A;  5D6F A;  1VTN C;  2FSW A;  1GV2 A;  3FHN A;  3QPH A;  4KIT B;  2EZK A;  2K27 A;  2VOD A;  1UHS A;  2VQH A;  5HLI A;  5D4S A;  5E20 A;  4BH9 A;  1K6Y A;  4ABZ A;  3LAJ A;  3UR3 C;  1HKQ A;  4E7K A;  4FX0 A;  4Q4Z F;  1PDN C;  3RKW A;  3HOW J;  4FHT A;  2R0Q C;  1F43 A;  5FLV A;  1MIJ A;  4ZTJ A;  2CQX A;  4KNY A;  3OYI A;  1NK3 P;  2XAG A;  3O2P E;  3K4J A;  1FJL A;  2ESH A;  4B8X A;  4KN4 X;  2HVS A;  3TOA A;  1CGP A;  1I1S A;  3WGH A;  1UFM A;  3FDY A;  2BZT A;  2O03 A;  3RI4 A;  3KZY A;  2FBI A;  3IL2 A;  4E7Z A;  1TWF J;  3SZP A;  2TCT A;  4XBF A;  3ML6 A;  2R7W A;  2R7X A;  4ETS A;  2VQG A;  3A2K A;  1IG7 A;  5FRN A;  1XGS A;  1M1E B;  2XC7 A;  2QGU A;  4LB5 A;  3JRD A;  3IRQ A;  2OV7 A;  2YSR A;  3RZO J;  5FGM A;  4BEH A;  2Q2E A;  3WGI A;  4O3M A;  2GXA A;  2M2E A;  2X1D A;  3WOD F;  4FIS A;  2DOD A;  3OYH A;  3DKX A;  1ZRE A;  1BJZ A;  5D5W B;  1SFX A;  4J01 A;  1Q1H A;  3EYY A;  3RKX A;  2R7F A;  1VQO I;  1BOA A;  2ZME C;  1Y8R B;  4LIV A;  4AM3 A;  1E3P A;  4MTE A;  4BU2 A;  4AIK A;  1OCR H;  5IOY A;  5IP9 J;  3S16 J;  2HI3 A;  3FXJ A;  5CLS A;  2ZSI B;  1KGS A;  2MAB A;  1V5E A;  3D0S A;  2WV1 A;  4HV5 A;  3HYI A;  5F0F A;  3J81 K;  1K7A A;  3P5J A;  4BNC A;  2IAI A;  1BIB A;  1OCC H;  2NS8 A;  5DD4 A;  2F5V A;  3CP2 A;  5EGO B;  2Z5U A;  2DT5 A;  1P4W A;  3CJT B;  3OYM A;  1P2F A;  2E1N A;  2XUB A;  1ZGJ A;  2CYY A;  3E6C C;  1HXD A;  2QQ9 A;  4XM3 A;  4BXF A;  3DQV C;  3CCR I;  1MZB A;  2R7T A;  2E1M C;  5ICC A;  1UZC A;  2QQA A;  1OCO H;  3ZQI A;  3ZQ7 A;  3F8F A;  2XIG A;  4OIR F;  2EV5 A;  2TRT A;  3K1P A;  2R7Z J;  1FOK A;  5FJ8 J;  4JX6 A;  3H5R A;  1FYL A;  1ZTR A;  2JQ7 A;  3ECH A;  3VPR A;  5AIP A;  3REO A;  1TWC J;  3QPL A;  5JFR A;  3QP6 A;  3CD6 I;  2R92 J;  4RM2 A;  4LJZ F;  2E2H J;  2DOA A;  4A2U A;  2A6H F;  3JTH A;  1XC5 A;  4L9N A;  5E3M A;  3K6G A;  3CDL A;  4IJA A;  3S3N A;  1FEX A;  1EV7 A;  1S5L C;  1MMN A;  4AWX B;  3S8P A;  5GTI C;  2FRH A;  5BS6 A;  1K78 B;  2XPV A;  1JHH A;  3ZP5 A;  1TP4 A;  2KDO A;  3KET A;  2QBY A;  2WV0 A;  1FSH A;  3BCB A;  3PQJ A;  3TDU C;  1JKQ C;  2WWY A;  1D5V A;  1UHM A;  2BEO A;  5E8I A;  5BMZ A;  5F6F A;  4EJT A;  2UV1 A;  3RKY A;  1TW2 A;  1B72 A;  5KHD A;  4EGY A;  1IC8 A;  4RGU A;  5M5X J;  1OMI A;  1IDZ A;  4BY7 J;  1Y8Q B;  2PI0 A;  2ZNZ A;  3K69 A;  5K5R A;  5J4V A;  2D1H A;  4F52 A;  1VFC A;  1A31 A;  2HQ5 A;  2HQR A;  3G6E I;  1TT5 B;  3NQO A;  2MD0 A;  3FWE A;  3ZMV A;  4GO1 A;  2J5P A;  3BTL A;  4W1U A;  5DYM A;  1G6N A;  2IGN A;  3HOY J;  3X2Q H;  1WJD A;  3OIQ A;  2ZCW A;  4XOP A;  2ZXJ A;  4FCY A;  5ICF A;  5CQG A;  2LTP A;  1YW9 A;  3ZMS A;  2VJ4 A;  4UV9 A;  1T39 A;  2IS2 A;  3L1P A;  4LFU A;  3SDB A;  1RRJ A;  2CU7 A;  2OQG A;  1ONV A;  1T08 B;  2V26 A;  1X1C A;  1W5S A;  4Y33 A;  1YJN I;  3TP0 A;  2HVR A;  1KYZ A;  2RGV A;  3BZK A;  5LLQ A;  1MBE A;  3S1Q J;  4A3G J;  2P5L C;  2ECB A;  5J1Y A;  5F0C A;  2H8R A;  3RQ4 A;  3EET A;  2LDU A;  3DF8 A;  2JN6 A;  4F92 B;  5KNL A;  1TL8 A;  5DV5 A;  3WG9 A;  4S0H B;  1UMQ A;  2EQR A;  4AD9 A;  5DEQ A;  1QRY A;  5HS7 A;  1FY7 A;  1ZR4 A;  4QPQ A;  2MLK A;  2A5W A;  2JA5 J;  4XR6 A;  3MQ0 A;  4WXC A;  1SAN A;  2GLO A;  3T0Y A;  2EZL A;  2G9W A;  2DN0 A;  3LSI A;  1IUY A;  1YYV A;  1BC8 C;  1Z67 A;  1XB4 A;  4ZYA A;  4NC7 A;  3JTG A;  2RNG A;  2XAS A;  1KZH A;  3QQA A;  4BY1 J;  5TRD A;  4A93 J;  4CSW A;  3KYD B;  4ZZD A;  4X1E A;  1ZRD A;  5E18 F;  1X2M A;  3BR3 A;  2CG4 A;  2LKX A;  1TNS A;  3OSF A;  1FYM A;  4HF0 A;  5CQE A;  5EZH A;  4IRI A;  3WU0 A;  1OFC X;  5GAD J;  1MBG A;  4A3J J;  2V4J C;  2W24 A;  2ECC A;  3VYS B;  4A3B J;  3P9K A;  3GEZ A;  3RZD J;  4C3H J;  5K1Y A;  2HTS A;  5L3C A;  4OWR B;  3GW2 A;  3OS1 A;  2JPC A;  4IRH A;  2MG4 A;  3CF2 A;  1LE8 B;  1VQM I;  4Y17 A;  3C2G A;  4D7M A;  3OYA A;  5CVR A;  3GZ6 A;  5JLW A;  4RGS A;  1R58 A;  1Z6R A;  4AVP A;  1WHU A;  3I0T A;  4ZJZ A;  3CC7 I;  3RPQ A;  3CJQ B;  5ED4 A;  1UJ8 A;  3CUQ B;  2EA4 A;  2E5N A;  1P4A A;  3K2A A;  4N9I A;  4XMY A;  4C2T A;  1N75 A;  2CUF A;  3BR2 A;  3IWF A;  3WTU C;  2K4B A;  3OS0 A;  1B8I B;  2Y31 A;  3M4O J;  1HDP A;  4RAF A;  3HHG A;  1U5T A;  3QYB A;  5J47 A;  2QSF X;  4XRS A;  4LLN A;  3WTV C;  2BY3 A;  3CCY A;  4HX8 A;  4NB5 A;  4OU0 A;  1XGO A;  3PL8 A;  2L4A A;  2UXX A;  3U1K A;  3TBI A;  1YFH A;  4A12 A;  3CCM I;  2PBI A;  2M4K A;  5AON A;  3ASO H;  5EYR A;  3KIO A;  2F5F A;  3HBL A;  5H20 A;  4RA2 A;  4EVI A;  4ZDO A;  3ASN H;  2XGC A;  5K7Z A;  5D4R A;  2Y0S N;  1PUE E;  4G12 A;  5D5U B;  3HC7 A;  1IZ1 A;  2O3F A;  1OYW A;  2JJ7 A;  3SFZ A;  4UVC A;  1JUS A;  1P6R A;  2EIL H;  3CCE I;  3BP8 A;  1JTY A;  4QWQ A;  1HOM A;  2I8D A;  2BVL A;  5E1X A;  4GXO A;  3E7L A;  3HRS A;  2GWR A;  3PJR A;  4L9J A;  3BCA A;  4RLQ A;  1YTY A;  2IVM A;  2PMZ N;  1RR7 A;  2H1L A;  4XSX F;  3HL2 A;  5M3F J;  4LOC A;  2JA8 J;  1GT0 C;  2HOE A;  1SFE A;  3TOB A;  2LC2 A;  3RYP A;  4XRS G;  3E1S A;  5D6E A;  1IRG A;  2LRD A;  1CF7 A;  2G0E A;  4NNJ A;  4ZYH A;  4B48 A;  3PO3 J;  2V1N A;  3MMY B;  2BYV E;  4C3I J;  2FXA A;  3HOS A;  3HDD A;  5FLX K;  2LFB A;  1YJW I;  1YRN A;  1D0Z A;  1N25 A;  3DPL C;  1B9N A;  3EPZ A;  4IZZ A;  3NEU A;  1I27 A;  4NQW A;  2AHQ A;  2IW5 A;  2E1C A;  2H1K A;  1R22 A;  3PIP F;  2R7Q A;  3W6K B;  3E6M A;  2DOE A;  1BR2 A;  3JRI A;  1KON A;  5TJJ A;  2O9L A;  1XSV A;  1X1P A;  1MH3 A;  2E34 A;  3DWL E;  2ME0 A;  4XID A;  4A3C J;  2HDW A;  3BJO A;  3HZJ A;  4IHY A;  2VE9 A;  4IOA F;  1X3U A;  1JHF A;  4L18 B;  3QOD A;  1FNN A;  2W4S A;  2VBY A;  4FQG A;  1WI3 A;  2BW3 A;  4BL0 B;  2EFN A;  2O5R A;  2QSG X;  4HX7 A;  2QEN A;  2MGQ A;  3OWT A;  2HQN A;  5LRR A;  4LK1 F;  2OQR A;  3DFG A;  2P7C B;  3C7J A;  3ZQF A;  1ZG3 A;  1LDD A;  1XX5 A;  3OYJ A;  1H89 C;  2MSY A;  2ID6 A;  4YFX F;  1JUP A;  5B1A H;  1MNM C;  3VSK A;  1IXR C;  1ACI A;  4IHT A;  1BBY A;  2J5O A;  4PDK A;  4CDG A;  4LMY A;  3NWT A;  2OZ6 A;  5EEH A;  3CO7 C;  3PM1 A;  1Z0X A;  4IXA A;  2X6W A;  1XCB A;  3EUH C;  3DEU A;  3DEW A;  3KEO A;  3PQK A;  4ESF A;  3TW7 A;  3ZQG A;  2NVQ J;  5F1J A;  3OIP A;  2IS1 A;  3M8E A;  2DLL A;  2XF6 A;  4G6Q A;  4GFB A;  1DPR A;  2KDZ A;  3PNT A;  4R79 A;  3CMM A;  3KP4 A;  3ZMZ A;  4H4K C;  2XAJ A;  2NYX A;  4U88 A;  1IUF A;  2QCO A;  3Q0V A;  2E36 A;  4LLL A;  5DCM A;  3AAF A;  2W85 A;  2YR2 A;  1FTT A;  1GUU A;  1FOW A;  1X3Z B;  1Z91 A;  2X6X A;  2Z16 A;  2VOP A;  1LPQ A;  3FBN B;  2HVQ A;  4NDL A;  3D1N I;  3CLQ A;  2AQE A;  4MFD A;  2IS6 A;  3E97 A;  2ZJR F;  1LDK B;  3H5N A;  3VOE A;  5FB2 A;  3M8J A;  1J9I A;  3FBI B;  4QSH A;  3VB2 A;  3ESW B;  1VQ4 I;  1ORK A;  3L2W A;  4BEH B;  1UEL B;  2Q2E B;  3AG1 H;  1UCR A;  2CSO A;  1T6S A;  2STT A;  3ZQL A;  1LKX A;  5IPA A;  4CCJ A;  3LQR A;  2RAE A;  1Z9C A;  2XGD A;  3D5L A;  3PUF A;  3CUO A;  1NHA A;  3GZN B;  2O61 A;  4YG2 F;  3KEY A;  2Z33 A;  4RLF A;  3BTC A;  2JMW A;  4B43 A;  4Y15 A;  4UNO A;  5IT9 Z;  4MQ9 F;  1OCT C;  1P7I A;  1LFU P;  3HG9 A;  4X6A J;  3KFW X;  3GFM A;  4CCL A;  2CV1 A;  1IF1 A;  5CJ9 A;  1J09 A;  1TQM A;  1XDU A;  2ZXI A;  2WTE A;  1RES A;  2XAU A;  2UWM A;  1V3F A;  3Q5F A;  3SYT A;  1G3W A;  3E5Q A;  4CYD A;  1W5T A;  2F5D A;  2RKH A;  4KIS A;  5GP9 A;  3DCF A;  3K4M A;  3CMY A;  2JA2 A;  4UB6 C;  2HU9 A;  1ITY A;  5FFX A;  3GBG A;  2M9H A;  2QZ8 A;  2IA2 A;  3MKL A;  4ZYG A;  1MJA A;  3HUG A;  2DA5 A;  1KQ8 A;  3I55 I;  4A69 C;  1WJ5 A;  3RPU A;  3FXO A;  1HKS A;  4JBA A;  3DBL B; 
#chains in the Genus database with same CATH homology
 2MLG A;  3QU3 A;  3TDZ C;  3HRM A;  4G94 A;  2L3D A;  3T5X A;  4YII A;  1KQ0 A;  4KFC A;  5D5X B;  1ZRF A;  4RB1 A;  4I09 A;  5HDK A;  5F1R A;  2NAZ A;  5HS8 A;  2DQL A;  2GXG A;  2YU3 A;  1E2X A;  2L02 A;  5H6R A;  2JTV A;  3B02 A;  1J0R A;  5F64 A;  3LAP A;  2VBZ A;  3T8R A;  2A3S A;  2CGP A;  4WXD A;  4HOB A;  3KLN A;  3LQQ A;  3WTY C;  1LDJ A;  1J7K A;  1FLI A;  2X0L A;  3HHH A;  1DPU A;  5JI6 A;  1SFU A;  4CXF A;  4HW0 A;  3WE3 A;  1F5T A;  3KP5 A;  2XKP A;  4ASN A;  3GVA A;  1YO5 C;  3FF5 A;  5ILS A;  2P6S A;  2H09 A;  3EQL F;  3CDH A;  2VC1 A;  2KKO A;  3CTA A;  4LB6 B;  5D8K B;  4BYY A;  5HOO A;  2H6B A;  1SD5 A;  1P4X A;  1FBQ A;  1BI3 A;  1F4K A;  2FOK A;  3E5X A;  3I4P A;  2MC3 A;  4IHS A;  4BHP A;  3GFJ A;  3QPT A;  1B59 A;  3V4G A;  1FBU A;  1B4A A;  1DUX C;  1HSJ A;  3CUQ C;  2HR3 A;  3C18 A;  3FXU A;  2JZY A;  2M87 A;  2EJR A;  4I98 B;  2F5C A;  5LBQ A;  3I54 A;  2VT2 A;  2B0L A;  3F8M A;  4ZYD A;  1IRF A;  3F72 A;  1K6O A;  2C6Y A;  4HV6 A;  1G3S A;  2IPQ X;  2L4M A;  2PN6 A;  4JBA A;  2V1D A;  2V6C A;  3P9C A;  1O57 A;  3E3V A;  1ZLK A;  1W7P B;  2M1B A;  1U5T B;  5LHG A;  4RS8 A;  2D2W A;  3SQN A;  1S29 A;  4M71 A;  2PFB A;  2P5V A;  2M8E A;  5KK1 A;  3G3Z A;  2COM A;  4K2E A;  2O0Y A;  3F22 A;  1FT9 A;  2IT0 A;  1TQP A;  3QRF F;  4UXN A;  3RDI A;  2H6C A;  4YFK F;  2Z99 A;  3MEX A;  1B6A A;  3HSF A;  3JAM Z;  5HLG A;  2DAO A;  3V7S A;  1FC3 A;  1R1V A;  4N9H A;  4RB3 C;  3L9F A;  5DCF A;  1WRJ A;  3BJ6 A;  4G7O F;  4B09 A;  1LQ1 A;  4PZJ A;  3ULQ B;  3EDP A;  3BOQ A;  3R61 A;  4PCQ A;  4LG0 A;  1UB9 A;  4M74 A;  4GYG A;  2HKO A;  2ELH A;  3FZV A;  1U2W A;  3GUD A;  3CJN A;  3I58 A;  5J8F A;  1QQI A;  2EV6 A;  1RNL A;  2PQ8 A;  2Q0O A;  2M30 A;  3KP6 A;  3I59 A;  3KP7 A;  4I02 A;  1MDM A;  4XSZ F;  1XMA A;  2A61 A;  3K1M A;  1O3R A;  2JRT A;  3IKV A;  4G7Z F;  1BJA A;  1RIO H;  2RVC A;  3P9I A;  5E17 F;  3H3Z A;  2FML A;  5ERI A;  1S7A A;  4JQF A;  3JAM K;  4EJO A;  5LGN A;  5FD5 A;  1JXS A;  1SMY F;  3C3W A;  2X4H A;  2HGC A;  2Y48 A;  5D5V B;  4WXH A;  4WX9 A;  1D8J A;  2PEX A;  1J59 A;  2EFW A;  5J6X A;  2GA1 A;  2VON A;  2MD5 A;  2KRF A;  3GFL A;  4OIP F;  4CGZ A;  1O3S A;  2A5Y B;  1ZRC A;  5LEJ A;  4ENK A;  2DI3 A;  1G3T A;  1O7L A;  4A5M A;  1FBS A;  2QYO A;  5LGT A;  1DP7 P;  2D45 A;  1I6X A;  4M6Y A;  3ABU A;  1YIO A;  2G7U A;  2ESN A;  1TTY A;  2XAQ A;  1ZG1 A;  4ENN A;  1J75 A;  3F8B A;  4UHT A;  4HZF A;  3IC7 A;  4ESJ A;  3HTU A;  4BXU A;  3SXY A;  1KYW A;  1S7O A;  1XSX A;  1C0W A;  5BQT A;  5JVT A;  2PJP A;  2GAU A;  2NNN A;  4A5N A;  1LB2 A;  2QWW A;  3V8K A;  1BI0 A;  3BRO A;  1FSE A;  2YX4 A;  2AS5 F;  4U0Y A;  2IRF G;  3FMS A;  4MHG A;  1LEB A;  1U3E M;  2FNP A;  1ODD A;  3W6J B;  2VN2 A;  4P9F A;  1JE8 A;  1D8K A;  4Q47 A;  3FM5 A;  1S6L A;  4OOI A;  4WCG A;  4P5O A;  4HDU A;  1IN4 A;  2NNY A;  1MGT A;  1IXC A;  1R1U A;  2ZNY A;  4IF4 A;  1YLF A;  5LEK A;  2RNJ A;  4RGX A;  5K5Q A;  1EH7 A;  1ULY A;  2CO5 A;  3E6B A;  3JSO A;  4PGH A;  5KVR A;  3ISP A;  4RB2 C;  2EK5 A;  1QZZ A;  1J2X A;  2MA3 A;  3TQN A;  2W25 A;  2K7L A;  1IW7 F;  2DBB A;  4HAM A;  4OMZ A;  4Y13 A;  3OV8 A;  3MZH A;  3K9T A;  1RUO A;  4R1H A;  3LA3 A;  3L7W A;  1RUN A;  1BM9 A;  4U0W A;  2KIM A;  3COA C;  2FU4 A;  4UVA A;  1F1Z A;  4KA4 A;  3SZT A;  4ENM A;  1H0M A;  1QO0 D;  1D3Y A;  1XD7 A;  1PP7 U;  1XCV A;  2GXB A;  4DQ2 A;  2KIU A;  2K4J A;  5HLH A;  2HFH A;  2OU2 A;  3LFK A;  1HW5 A;  4WF2 A;  4XLN F;  3E5U A;  1SMT A;  2LNB A;  5L3B A;  4FX4 A;  1V4R A;  4DNC A;  1U5T C;  2K86 A;  2A6E F;  4G8X A;  5FFZ A;  4QLC U;  3HRU A;  4F7Z A;  5K5O A;  2IJL A;  1G4D A;  2DFI A;  3O6B B;  4HLX A;  4M9X A;  1ZAR A;  2Z9O A;  3WTZ A;  5DDG A;  5L3F A;  4BHC A;  1OR7 A;  3GZ5 A;  4HF2 A;  3JW4 A;  1OYY A;  4MEX F;  1KU3 A;  4RAZ A;  2EFO A;  1QPM A;  4OIO F;  4UV8 A;  3ZPL A;  1IN7 A;  1SD4 A;  3HIF A;  3VOD A;  1RI7 A;  4H0E A;  1YQA A;  4G9Y A;  2QUF A;  2VXZ A;  1WSU A;  2DQR A;  3PFI A;  2EA2 A;  1YS6 A;  1GXQ A;  3ZMD A;  4FT8 A;  5CVU A;  3O3K A;  1T0F A;  3I53 A;  4KIG A;  2FNA A;  2XGX A;  5FO5 A;  4KIC A;  5DD8 A;  1MKM A;  4AIJ A;  2EFQ A;  3F3X A;  1R5H A;  4U7B A;  1Z7U A;  1R1T A;  3F21 A;  1MD0 A;  2ADU A;  3N4M A;  3BWG A;  3JSP A;  2EV0 A;  3HSE A;  2HWV A;  3VEP A;  1STZ A;  2RN7 A;  2W57 A;  4YIF A;  1BI2 A;  3HTS B;  4KIB A;  2GIV A;  2JSC A;  4LG0 B;  3ECO A;  3SHF A;  4GGG A;  1Z05 A;  2HZT A;  2ISZ A;  2EWN A;  4M73 A;  2QBY B;  2HYG D;  4WK8 F;  2IA0 A;  5E1W A;  2A07 F;  5DUK A;  4AIH A;  3L09 A;  2E7W A;  3IKT A;  2Z3Y A;  3I59 B;  2Y0M A;  5IT9 K;  3E6D A;  1MDM B;  2HTJ A;  3FXQ A;  4P9U A;  2E7X A;  3WU1 B;  4I2O A;  2P8T A;  5HDN A;  3FMR A;  5CVJ A;  2BE5 F;  1ZGA A;  3R6S A;  2PMU A;  3HRT A;  1KU7 A;  4Q48 A;  4I0A A;  1IN6 A;  4EJU A;  4HA8 A;  4TV7 A;  3IWZ A;  4KDP A;  1ZLJ A;  1W7P D;  2ZME A;  5L3G A;  2LF8 A;  1OPC A;  2XKO A;  4ON0 A;  1T38 A;  1Z1D A;  1REP C;  4MEY F;  1O3T A;  1MJ9 A;  1P92 A;  4KUM A;  4O6J A;  1FP1 D;  1QBJ A;  4A0Y A;  2IA1 A;  3V7R A;  4ZH4 F;  1GHC A;  1MJB A;  3CLO A;  1TLH B;  1TNT A;  4Q5S F;  1KU2 A;  3ELK A;  5BOX A;  2VOO A;  3MCZ A;  4KN7 X;  2XRO A;  1KU9 A;  3TKY A;  4JK1 X;  2HYF A;  3M7G A;  2UZK A;  3KLO A;  1YS7 A;  1E17 A;  3M9A A;  1Y0U A;  2MBF A;  3KE2 A;  5BPD A;  1U78 A;  3K2Z A;  1ZN2 A;  1IAW A;  1T2K A;  3EYI A;  4I7H A;  4RGR A;  3KP2 A;  2DK8 A;  3F8N A;  4M9S A;  2IP2 A;  5HS9 A;  1H9G A;  2V79 A;  2OZU A;  2DPU A;  1ZYR F;  2STW A;  3WTW C;  5DUI A;  5H6Q A;  5ILU A;  5IT3 A;  2YX7 A;  1GVJ A;  2L54 A;  3T8T A;  2KJB A;  5LRS A;  1T98 A;  1UST A;  2WC2 A;  2FE3 A;  3F8C A;  4MGR A;  1XSD A;  1QNT A;  3DPT A;  2MH2 A;  4EJV A;  3IRR A;  5A2Q Z;  3B73 A;  1DDN A;  2RV8 A;  1JGS A;  3L2C A;  4R8H A;  5CVV A;  4G6D A;  1BN5 A;  1KA8 A;  2Y75 A;  3WTX C;  3GO5 A;  4M72 A;  3Q9V A;  1AWC A;  3I71 A;  2H27 A;  4OIN F;  1R23 A;  4LD5 A;  1CF7 B;  3U2R A;  4ZZL A;  3BPX A;  2K02 A;  1YG2 A;  3TO9 A;  2LKP A;  1FX7 A;  2R3S A;  4EJW A;  3J7A O;  4G7H F;  2JPB A;  3CO6 C;  4L5J A;  2HS5 A;  4L0Z B;  2CW0 F;  3WTT C;  5LHI A;  1QGP A;  1ZG5 A;  1XGM A;  4BHB A;  3DXJ F;  3J80 Z;  4UUV A;  3K0L A;  2PMH A;  2DU9 A;  1S3J A;  1WWX A;  4A0X A;  2HEO A;  4L9T A;  3BJA A;  4EV0 A;  3R0A A;  1GXP A;  3U1D A;  1LEA A;  2FMY A;  5E8G A;  1TW3 A;  4A6D A;  4HQE A;  3KCC A;  5A2Q K;  4EMS A;  2ISY A;  1UHW A;  5BPI A;  1AOY A;  4IVN A;  4KMU X;  4EM0 B;  2CWE A;  1ZH5 A;  4CHU A;  3K1N A;  4ZYE A;  2RDP A;  4LLG F;  4A6E A;  1ZAO A;  3N97 A;  5DCM B;  1HKT A;  4BQA A;  1IN8 A;  4Z2Y A;  1O7F A;  5J8C A;  4P96 A;  1LNW A;  4EM2 A;  1HBX G;  2D1V A;  3R0J A;  3R60 A;  2AXL A;  3TO6 A;  3S2W A;  1FYK A;  4HYE A;  6PAX A;  4HBL A;  1BIA A;  1I5Z A;  3RIR A;  1FPQ A;  4HDV A;  2UXN A;  1XDS A;  2QM3 A;  2DK5 A;  4XRF A;  4MQV A;  4KYW A;  3J80 K;  4I0B A;  3KEQ A;  3FMQ A;  2OD5 A;  1K79 A;  4HLY A;  3MWM A;  1PP8 F;  3GWZ A;  3DV8 A;  1BI1 A;  2TDX A;  3FXR A;  2FA5 A;  2DW4 A;  1TBX A;  2FEZ A;  4HX4 A;  1WKM A;  1FP2 A;  1IXS B;  4WWC A;  3L00 A;  3BPV A;  3H92 A;  5EEG A;  5HDG A;  1ON2 A;  2H94 A;  4P55 A;  1Z6T A;  1BC7 C;  2CQK A;  5FLX Z;  5JHU A;  2HKX A;  4M6X A;  5ILV A;  1YW7 A;  4U0V A;  5JR3 A;  3BY6 A;  4HQM A;  2OAZ A;  4A0Z A;  2XRN A;  4RB0 A;  3HSR A;  3GYH X;  3FM3 A;  3KP3 A;  1R7J A;  3HOT A;  2R7D A;  1R00 A;  3LST A;  2ZJ2 A;  1W7P A;  2P5K A;  3C1D A;  3LA2 A;  1YW8 A;  2KJC A;  3EUH A;  1XN7 A;  1F9N A;  2GZW A;  3RYR A;  2HDC A;  3MFK A;  2MH9 A;  5CYV A;  3MZY A;  1A04 A;  2FBK A;  2XAF A;  2V1X A;  5L3D A;  1RZ4 A;  3GLX A;  1HW2 A;  2P4W A;  3V8J A;  2M45 A;  4L5I A;  4CZZ A;  2DTR A;  2FQ3 A;  2W84 A;  4KIF A;  3BDD A;  2ZME B;  3Q9S A;  2ZKZ A;  2BGC A;  3F6V A;  1EH6 A;  5ICG A;  2ZFW A;  2LSO A;  3KZZ A;  2QVO A;  2JT1 A;  3VFZ A;  4KT5 C;  3FHZ A;  2F5E A;  3GF2 A;  2PLY A;  4OIQ F;  2O8X A;  1K78 A;  1LVA A;  1XGN A;  4LK0 F;  4RAY A;  3R4K A;  4BAY A;  1B9M A;  2XVC A;  3QAH A;  3FX3 A;  2PG4 A;  3OOP A;  4CIC A;  3V7C A;  3P7N A;  2A68 F;  4S04 A;  3ZN0 A;  4D0P A;  3RJP A;  3M1E A;  5HVQ C;  3IHU A;  4ESB A;  1HQC A;  3QOP A;  2ACJ A;  2YPR A;  2P6T A;  5LHH A;  4CO8 A;  3G73 A;  2LF7 A;  3WE2 A;  4GCV A;  3U9G A;  1B1B A;  2QQB A;  1L3L A;  4IRG A;  3V8L A;  1HW1 A;  1OKR A;  3GFI A;  1FZP B;  3ROU A;  2A69 F;  1R36 A;  4LGW A;  2M5W A;  5E1Z B;  1O3Q A;  4EQQ A;  3I5U A;  3QP5 A;  3TO7 A;  2G7H A;  5FD6 A;  3F6O A;  4PGG A;  1W4M A;  2XAH A;  3TGN A;  3I64 A;  4EM1 A;  4YFN F;  4HF1 A;  3F23 A;  4M9Z A;  1U8R A;  3BZ6 A;  1TQI A;  3MAJ A;  5CVI A;  2O6G E;  1SAX A;  4L9V A;  1S8N A;  2ETH A;  4MTD A;  2OA4 A;  1HST A;  3DKW A;  2V9V A;  3DP7 A;  1R5G A;  2KIF A;  1LJ9 A;  1XMK A;  1I1G A;  3QU6 A;  2BV6 A;  4N0B A;  5AIQ A;  3GXO A;  4IPA A;  2FF4 A;  4GYI A;  5ICE A;  4ENJ A;  1OYI A;  3CUQ A;  3LA7 A;  3RTR A;  3NRV A;  2RQP A;  3ABT A;  2NRA C;  1WQ2 A;  4XLP F;  3ZMT A;  1QZY A;  4U7D A;  1EH8 A;  3WGG A;  2L01 A;  2OBP A;  3T1B A;  2VBX A;  2NS0 A;  2BBY A;  1SD6 A;  2Q8K A;  1L0O C;  3ZMU A;  2VC0 A;  4E70 A;  2EB7 A;  1ZHF A;  2QLZ A;  2VT3 A;  1J5Y A;  4L0Y B;  3ZN1 A;  2DPD A;  3ERE D;  2VBW A;  2XV4 S;  2DO7 A;  4UVB A;  1H9T A;  2VE8 A;  4KMF A;  5LGU A;  2GQQ A;  1G3Y A;  2ZO4 A;  4O5V A;  2CFX A;  4EGZ A;  3GX4 X;  1USS A;  4NHJ A;  2ZBK A;  1KQ9 A;  3H3U A;  2RC4 A;  4MNU A;  3WTS C;  2V1U A;  4OMY A;  1WI9 A;  1SD7 A;  4S05 A;  2EFP A;  2P7V B;  3M8F A;  1ON1 A;  1U6G A;  1IN5 A;  3LWF A;  2FBH A;  2GA2 A;  1FWZ A;  3J81 Z;  2XHK A;  5D8L B;  4I01 A;  2F2E A;  5D6F A;  1VTN C;  2FSW A;  3QPH A;  2K27 A;  2VOD A;  5HLI A;  5D4S A;  5E20 A;  4BH9 A;  3LAJ A;  1HKQ A;  4FX0 A;  4Q4Z F;  1PDN C;  3RKW A;  4FHT A;  4KNY A;  2XAG A;  3O2P E;  2ESH A;  4B8X A;  4KN4 X;  3TOA A;  1CGP A;  1I1S A;  3WGH A;  1UFM A;  2O03 A;  3RI4 A;  3KZY A;  2FBI A;  3IL2 A;  3SZP A;  4XBF A;  3ML6 A;  4ETS A;  1XGS A;  4LB5 A;  3IRQ A;  2YSR A;  5FGM A;  2Q2E A;  3WGI A;  4O3M A;  3WOD F;  1ZRE A;  5D5W B;  1SFX A;  1Q1H A;  3EYY A;  3RKX A;  2R7F A;  1BOA A;  4MTE A;  4AIK A;  5CLS A;  1KGS A;  3D0S A;  4HV5 A;  3HYI A;  1K7A A;  3J81 K;  4BNC A;  1BIB A;  5DD4 A;  2Z5U A;  2DT5 A;  1P4W A;  1P2F A;  2E1N A;  2XUB A;  1ZGJ A;  2CYY A;  3E6C C;  1HXD A;  2QQ9 A;  3DQV C;  1MZB A;  5ICC A;  2QQA A;  3ZQ7 A;  3F8F A;  2XIG A;  4OIR F;  2EV5 A;  3K1P A;  1FOK A;  1FYL A;  3ECH A;  5AIP A;  3REO A;  5JFR A;  3QP6 A;  4LJZ F;  4A2U A;  2A6H F;  3JTH A;  4L9N A;  4IJA A;  1EV7 A;  4AWX B;  2FRH A;  5BS6 A;  1K78 B;  1JHH A;  3ZP5 A;  3KET A;  2QBY A;  2WV0 A;  1FSH A;  3PQJ A;  3TDU C;  2WWY A;  1D5V A;  1UHM A;  2BEO A;  5E8I A;  5BMZ A;  5F6F A;  4EJT A;  3RKY A;  1TW2 A;  4EGY A;  4RGU A;  1OMI A;  2PI0 A;  2ZNZ A;  3K69 A;  5K5R A;  2D1H A;  2HQR A;  3NQO A;  3FWE A;  3ZMV A;  4GO1 A;  2J5P A;  5DYM A;  1G6N A;  2ZCW A;  2ZXJ A;  5ICF A;  1YW9 A;  3ZMS A;  4UV9 A;  1T39 A;  4LFU A;  2OQG A;  1ONV A;  1W5S A;  1KYZ A;  2RGV A;  5LLQ A;  2P5L C;  3EET A;  2LDU A;  3DF8 A;  5DV5 A;  3WG9 A;  4AD9 A;  5DEQ A;  5HS7 A;  1FY7 A;  2MLK A;  3MQ0 A;  4WXC A;  3T0Y A;  2G9W A;  1IUY A;  1YYV A;  1BC8 C;  1XB4 A;  3JTG A;  2XAS A;  5TRD A;  4ZZD A;  1ZRD A;  5E18 F;  2CG4 A;  1TNS A;  1FYM A;  4HF0 A;  4IRI A;  3WU0 A;  2W24 A;  3P9K A;  3GEZ A;  5K1Y A;  2HTS A;  5L3C A;  3GW2 A;  2JPC A;  4IRH A;  4Y17 A;  5CVR A;  3GZ6 A;  4RGS A;  1R58 A;  1Z6R A;  4AVP A;  3I0T A;  3RPQ A;  5ED4 A;  3CUQ B;  2EA4 A;  1P4A A;  4N9I A;  3IWF A;  3WTU C;  2K4B A;  3HHG A;  1U5T A;  4LLN A;  3WTV C;  4HX8 A;  4NB5 A;  4OU0 A;  1XGO A;  2L4A A;  2UXX A;  1YFH A;  4A12 A;  2PBI A;  5AON A;  2F5F A;  5H20 A;  4EVI A;  5D4R A;  1PUE E;  5D5U B;  1IZ1 A;  2O3F A;  1OYW A;  3SFZ A;  4UVC A;  1P6R A;  3BP8 A;  4QWQ A;  5E1X A;  4GXO A;  3HRS A;  2GWR A;  4L9J A;  1YTY A;  2IVM A;  4XSX F;  2HOE A;  1SFE A;  3TOB A;  3RYP A;  5D6E A;  1IRG A;  1CF7 A;  4ZYH A;  2BYV E;  2FXA A;  3HOS A;  5FLX K;  3DPL C;  1B9N A;  3NEU A;  1I27 A;  4NQW A;  2IW5 A;  2E1C A;  1R22 A;  3W6K B;  3E6M A;  5TJJ A;  1XSV A;  3BJO A;  2VE9 A;  1X3U A;  1JHF A;  4L18 B;  1FNN A;  2VBY A;  2EFN A;  4HX7 A;  2QEN A;  2HQN A;  5LRR A;  4LK1 F;  2OQR A;  3DFG A;  2P7C B;  3C7J A;  1ZG3 A;  1LDD A;  4YFX F;  1IXR C;  4IHT A;  1BBY A;  2J5O A;  4PDK A;  4CDG A;  4LMY A;  2OZ6 A;  5EEH A;  3CO7 C;  4IXA A;  1XCB A;  3DEU A;  3KEO A;  3PQK A;  4ESF A;  3M8E A;  2DLL A;  4G6Q A;  1DPR A;  4R79 A;  3KP4 A;  3ZMZ A;  2XAJ A;  2NYX A;  4U88 A;  4LLL A;  3AAF A;  5DCM A;  2W85 A;  2YR2 A;  1Z91 A;  2VOP A;  3E97 A;  1LDK B;  3VOE A;  5FB2 A;  1J9I A;  3VB2 A;  1UCR A;  2CSO A;  1T6S A;  2STT A;  3LQR A;  1Z9C A;  3D5L A;  3CUO A;  1NHA A;  2O61 A;  4YG2 F;  2Z33 A;  4Y15 A;  4UNO A;  5IT9 Z;  4MQ9 F;  3KFW X;  3GFM A;  1IF1 A;  5CJ9 A;  1TQM A;  1XDU A;  2WTE A;  2UWM A;  1V3F A;  3Q5F A;  1G3W A;  3E5Q A;  4CYD A;  1W5T A;  2F5D A;  2RKH A;  5FFX A;  2QZ8 A;  2IA2 A;  1MJA A;  3HUG A;  1KQ8 A;  3RPU A;  1HKS A;  5L3E A;  4ZYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...