4M73A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHAFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m73A01
4G9YA 2E7WA 2GQQA 2P5KA 2PLYA 4R1HA 1OYYA 4G7OF 2P5LC 4RB0A 3TDZC 3COAC 1IRFA 3J80Z 1S3JA 1XSVA 1W7PD 2ZMEB 3IWZA 4KIFA 2HWVA 3I54A 1KYZA 1ZRDA 1KYWA 4EJWA 5HOOA 3WTYC 3HUGA 4UHTA 5DCMA 1TBXA 2VBZA 2H09A 2IJLA 4EMSA 4BNCA 3TO7A 4PGGA 3O3KA 2W84A 5F6FA 1YFHA 4B8XA 2IT0A 1BI2A 2A6HF 4ON0A 1U3EM 4KT5C 3GX4X 1PDNC 3P7NA 4G8XA 5BS6A 2K7LA 3N4MA 1XSDA 3E5QA 5CVRA 2DPUA 5JR3A 1S6LA 1ZREA 1J7KA 3NRVA 4YFXF 1TW3A 5DUIA 3RYPA 3CUQB 1EH8A 1XD7A 3VFZA 2KIUA 4LGWA 4UV8A 1J2XA 2Z9OA 4U0VA 3EQLF 4HF1A 2ETHA 2FMYA 1XMKA 2VC1A 2H6CA 4L0ZB 2H94A 1HSJA 2VOPA 2JZYA 4A2UA 4UNOA 3L7WA 2Z5UA 4ZH4F 5FB2A 3AAFA 3GUDA 2L02A 2DTRA 1K7AA 4RAZA 3RTRA 4M6YA 5D8KB 1RIOH 4B09A 1SAXA 3HRTA 2H6BA 1MDMA 2EFQA 1W5TA 3ZN1A 1YIOA 3LA7A 2WC2A 2FF4A 5DEQA 1W4MA 3K2ZA 3K69A 3CUQC 3KP4A 3QU6A 3Q9VA 2OBPA 2RV8A 3TKYA 2A07F 2NRAC 4YG2F 5L3CA 5HLHA 2PFBA 4M9SA 3CUQA 2RGVA 2DLLA 1R36A 1D3YA 3QPTA 3KP5A 2G7UA 5E1WA 2LSOA 5ICGA 2LNBA 5FD6A 3GZ6A 4XBFA 2BGCA 5FFXA 1ZLJA 4WF2A 3R60A 5IT3A 2HR3A 2BYVE 1HW1A 3NEUA 3V8LA 3GF2A 2MC3A 5CLSA 3V4GA 4KNYA 3U2RA 1J9IA 1L3LA 1SD7A 4BXUA 4ESBA 2GA1A 3FM5A 1IUYA 1Q1HA 2RVCA 4U7DA 1H9GA 4EM1A 1MJAA 1WKMA 3R61A 1ON1A 3RIRA 4U88A 1S29A 1TNTA 4IHSA 4M9ZA 4RB3C 1FSHA 4AIJA 1FZPB 4ENKA 2XUBA 3MFKA 2XAJA 2COMA 3OOPA 1QZZA 3IRRA 3J81Z 3FMRA 4G6QA 4CDGA 3F72A 5IT9Z 1WWXA 4CXFA 4NB5A 2JRTA 4LLLA 2PJPA 3LAJA 2QBYA 1VTNC 3TQNA 3BPXA 4WXDA 2ZNZA 1ZARA 1XDSA 1TQIA 2KKOA 3TO9A 3MAJA 2P4WA 3CJNA 1ZLKA 3GXOA 1ZRCA 2J5PA 1ZGJA 1FT9A 4Q47A 2YR2A 2D2WA 3CO6C 1KQ8A 4JQFA 2P7VB 2DU9A 3EDPA 3HHGA 1UHMA 4M71A 4OIOF 3C7JA 1I1GA 1MJ9A 1BBYA 1DPUA 4ZZLA 3VODA 1U5TA 3BROA 3OV8A 4IF4A 4Y13A 2YSRA 3CDHA 1LDKB 1ON2A 1KA8A 1JXSA 3LA3A 3FZVA 4HF0A 1LEBA 4XLNF 2NAZA 3L00A 4XLPF 2YX4A 5ERIA 2XRNA 5L3GA 4UUVA 3IC7A 4U0YA 4EVIA 3ZN0A 4GGGA 1OR7A 1IZ1A 4RGUA 2LF7A 1SD6A 5E1ZB 3W6JB 3D5LA 3FXUA 5E1XA 4OIRF 1MJBA 1R00A 5E8GA 5ILVA 2KRFA 2FQ3A 1QO0D 2CO5A 4KMUX 4AWXB 4CHUA 4EM0B 3EYYA 2EFWA 2PQ8A 1JHHA 2VT2A 3WTSC 1KU7A 4L5IA 1SD5A 5H6RA 2GZWA 2F5EA 3RDIA 1S7OA 2MBFA 3BWGA 3S2WA 4EJOA 4H0EA 4LG0A 2PG4A 2O61A 3GYHX 1J5YA 3HYIA 4HAMA 5DCMB 5H6QA 2W57A 2V6CA 1FWZA 1S8NA 5DD8A 5A2QZ 3BOQA 3BPVA 3V7RA 1G6NA 1DP7P 3K1NA 1FX7A 1QBJA 6PAXA 4EJVA 3DP7A 3K1PA 4A12A 1SFXA 3DPLC 2F2EA 2STTA 4O5VA 4G7HF 2Y48A 4PDKA 3G73A 3U9GA 3M1EA 1E17A 3KLNA 1ZG3A 3F8MA 1FYLA 3P9IA 5KK1A 5AONA 1F9NA 1H0MA 1O7LA 1Z9CA 1T6SA 2EFNA 3CLOA 1HKTA 5CYVA 2YPRA 4L18B 4XSXF 3KP7A 4L9TA 2K4BA 5D4SA 3E6BA 4P96A 2ZBKA 1OYIA 5K5OA 1B9MA 4MQVA 3C3WA 4A6EA 2M87A 2V1XA 3TOAA 3MCZA 3LQRA 3GVAA 4LB6B 1PP8F 4MNUA 1R5GA 2IRFG 3KETA 3SHFA 1IN6A 3ZMSA 3LQQA 4TV7A 2RKHA 2J5OA 4ESFA 2FBIA 5LHIA 2ACJA 1SFEA 2XAGA 4HOBA 5K1YA 2NNNA 1SD4A 1HW5A 3ECOA 1EH7A 4LLGF 3KCCA 3P9KA 3QU3A 2HYGD 3GEZA 3LAPA 2EK5A 3HRMA 3I0TA 1EH6A 5FO5A 4IRGA 2V1UA 1YW9A 4HBLA 2DFIA 1U2WA 1GVJA 2E1NA 2ZKZA 5E20A 4I09A 1B59A 1XGNA 2VBYA 3WTXC 1LQ1A 3IKTA 4A0ZA 2EV0A 2M1BA 3KEOA 1KQ9A 2AXLA 4NHJA 2KJCA 4XSZF 1JGSA 1K78B 4RGRA 4Q48A 3R0AA 2JSCA 3GO5A 2Z3YA 5HDGA 2Z33A 3FWEA 3WE3A 2DK8A 2HKXA 2Q8KA 2FSWA 4WCGA 3M9AA 5D5UB 2VE8A 1Z1DA 2L4MA 2DW4A 3VB2A 4ZYEA 4S05A 1Z91A 5FGMA 1KQ0A 5LGNA 5IT9K 3T0YA 2H27A 1IN8A 4KMFA 2Y75A 1ZAOA 4RB2C 4WXCA 2ESHA 1RUOA 4HLYA 4QWQA 5LEJA 3SQNA 1B4AA 2P5VA 4EM2A 2D1VA 4KYWA 2FNPA 1J59A 2F5DA 1GXPA 2GAUA 3E6CC 4HX8A 2VC0A 2L01A 1XGMA 4WXHA 5F1RA 4HDUA 1ONVA 4KUMA 5JI6A 3IL2A 4CZZA 2IA2A 4I0AA 2B0LA 2CG4A 4KN4X 2CYYA 1JE8A 3KLOA 2IVMA 2BV6A 2P6SA 4JK1X 3L2CA 3J80K 3BJ6A 4BQAA 5BPDA 2STWA 3F23A 2ZCWA 3FM3A 3HSFA 2X4HA 5JVTA 2A68F 1U5TB 2A3SA 3F8CA 5CJ9A 4L9VA 1IRGA 4MTEA 3DKWA 4BAYA 2G7HA 4JBAA 5AIQA 1P6RA 2LF8A 3ZQ7A 1R23A 4LFUA 1RUNA 2QZ8A 2YU3A 1S7AA 1XMAA 5L3DA 3QP6A 1O57A 4GYGA 3GFLA 3F8BA 3TGNA 2LKPA 1HBXG 1BC7C 1FC3A 4UV9A 5ICCA 4MTDA 2FU4A 2QQ9A 5ICEA 1OKRA 3WGIA 2MD5A 3H92A 2HS5A 4HX4A 1LNWA 4O3MA 5JHUA 1P4XA 4MEXF 2PMUA 4HV5A 5J8FA 1EV7A 1K6OA 3ZMTA 3ZPLA 3F22A 2HEOA 3WTZA 1ZYRF 4HW0A 3HTUA 2VOOA 1W5SA 3HSRA 3FF5A 2OZ6A 3QRFF 1Y0UA 2EWNA 4RAYA 5H20A 5HDKA 1YYVA 4OIQF 1YQAA 1XSXA 4KN7X 3ZMUA 3H3ZA 1QGPA 2R7FA 2L3DA 2RC4A 3F8FA 1FBUA 3KZYA 2OA4A 4ETSA 2QWWA 2F5FA 3SFZA 3K9TA 1T39A 3GZ5A 1QQIA 2IA0A 5LGTA 2X0LA 5LLQA 3E97A 3T1BA 5LHHA 3N97A 4ENMA 1FY7A 3WODF 3JTGA 4A0YA 4ASNA 2XAHA 4ESJA 1FP2A 2M8EA 1I6XA 4D0PA 2QQBA 3GFMA 5E18F 4EJUA 2XVCA 1G3TA 4FT8A 4KIBA 2FA5A 2Y0MA 4CGZA 3WU0A 4GCVA 3LFKA 1T98A 4EV0A 5LGUA 3JSPA 5HS9A 2M5WA 1H9TA 5BPIA 3HSEA 4AIHA 2VBXA 1KU9A 1FNNA 4IRIA 2DBBA 3V7CA 3WE2A 4R79A 4OMZA 2VONA 2L4AA 2EFOA 3L09A 5D5XB 3M7GA 4P55A 1BI3A 5DCFA 1TW2A 1FPQA 5AIPA 3BZ6A 1BJAA 1XCBA 1ZG1A 1RNLA 2QYOA 3WU1B 3DPTA 2WTEA 1V3FA 1BIBA 2EFPA 4FHTA 2OD5A 3DEUA 4HLXA 2OAZA 4UVAA 1IW7F 4L0YB 1YTYA 3ECHA 4L9JA 3MZHA 2KIFA 4I7HA 4CICA 3L9FA 4RGSA 1T0FA 3C1DA 4UVBA 2WV0A 1R1VA 4BH9A 1W7PB 3P9CA 4FX4A 3F3XA 4CO8A 4E70A 3QAHA 3ZMDA 1CF7A 3H3UA 4GO1A 4N0BA 2EV5A 2NYXA 4IJAA 5ILSA 5CVIA 4G7ZF 1UFMA 5TRDA 3CUOA 5D8LB 2VXZA 1U6GA 3MZYA 5CVVA 2W24A 1O3RA 2HTJA 3IHUA 1Z7UA 1GHCA 3TDUC 3EYIA 3BP8A 1MZBA 3M8EA 3CO7C 2DT5A 3IRQA 5DUKA 1R1TA 2QLZA 2ISZA 4PZJA 3WGHA 4RB1A 5F64A 2PN6A 1LEAA 3VEPA 2XASA 3V8KA 4WWCA 1F4KA 2JT1A 1HXDA 3DFGA 1OMIA 1XB4A 2UZKA 2E7XA 4I98B 3HRUA 3SXYA 1SMTA 2CQKA 2L54A 1B1BA 2VE9A 1K78A 4P9UA 1UCRA 2FE3A 1WSUA 1IXCA 1AWCA 1SMYF 1CF7B 1YG2A 5BOXA 3F21A 3GW2A 2OU2A 1A04A 4KDPA 5K5QA 4U7BA 3WGGA 1IXSB 2M45A 2A6EF 4M74A 4ZYHA 2C6YA 2PMHA 1BC8C 1YW8A 4MQ9F 3BY6A 2PI0A 4GYIA 3SZPA 1G3YA 2FNAA 2ELHA 2XKOA 3QPHA 1FYKA 4K2EA 2HKOA 2XAFA 2HOEA 2XHKA 5A2QK 4BHPA 2CW0F 1E2XA 1FBQA 4OU0A 1MKMA 1T2KA 3E6MA 3IKVA 4MGRA 2JPCA 2HGCA 1F5TA 5FD5A 1IXRC 4XRFA 1YS6A 2GWRA 2KJBA 1U78A 1ZHFA 4LB5A 2XROA 5L3FA 5E17F 1XGOA 1IN7A 1I5ZA 1TQPA 2PBIA 1KU3A 3ABTA 2ZO4A 4WK8F 1TTYA 2DQLA 4BHBA 4MEYF 2RDPA 5ILUA 2Z99A 1L0OC 4HF2A 4I02A 1XDUA 3I5UA 1LB2A 3DXJF 4LLNA 1TQMA 3JW4A 4HX7A 1K79A 1BI1A 3BDDA 3F6OA 3F6VA 2VT3A 2OQRA 1UB9A 1FYMA 2JTVA 1O7FA 3KP3A 1G3SA 4Z2YA 5DYMA 3ZMZA 3FXQA 1ZGAA 4G6DA 4ENNA 2EB7A 3ABUA 3HHHA 3E6DA 1OPCA 2A5YB 3LSTA 2DK5A 5D5VB 3J81K 1LDDA 1AOYA 2MLKA 3E5UA 5LEKA 4HDVA 3MQ0A 2ZXJA 4EQQA 4GXOA 2P6TA 1XN7A 2ZNYA 1D8JA 3PQJA 3REOA 3PFIA 4UVCA 4LD5A 2IA1A 1QZYA 1UHWA 5J8CA 3T8TA 2OZUA 3RYRA 2QBYB 4LK0F 3I64A 2FXAA 1YO5C 2FBHA 2O0YA 3HIFA 4I2OA 3ULQB 1WRJA 2UXXA 5HLIA 3ERED 1BOAA 1WQ2A 5HVQC 4WX9A 2XGXA 2O03A 3KP2A 1MDMB 2RNJA 2MH9A 1PUEE 1HQCA 3RPQA 4NQWA 1BN5A 2K02A 1FP1D 1O3QA 3I59B 2DPDA 2GXGA 3KEQA 3EETA 3O2PE 4LMYA 1I1SA 3DF8A 3MWMA 1DUXC 5D5WB 5LRRA 3D0SA 3ZP5A 2EV6A 2DQRA 2GIVA 2ZJ2A 2VODA 4I0BA 3JSOA 3WTVC 2EJRA 2QENA 5BQTA 2UWMA 1IF1A 5D6EA 3E3VA 4N9IA 4YIIA 3T5XA 3HTSB 2HFHA 3LA2A 4L9NA 3RKYA 1REPC 2HQRA 3RI4A 2CSOA 5D6FA 3F8NA 3ISPA 3R0JA 2EA2A 4L5JA 2E1CA 5DV5A 4LJZF 1Z6TA 2UXNA 2FOKA 5LHGA 3NQOA 4DQ2A 2R7DA 4YIFA 2O6GE 2IP2A 2QUFA 2R3SA 1HKSA 3U1DA 4KIGA 1F1ZA 2V9VA 2IPQX 1CGPA 3I59A 3KFWX 3R4KA 5DDGA 5BMZA 5HS7A 4HV6A 1T38A 2HYFA 1HW2A 2MH2A 4F7ZA 2FRHA 2TDXA 2XAQA 5FLXK 1Z6RA 3DV8A 1LVAA 2VBWA 3FXRA 2BBYA 3ZMVA 1O3SA 3TO6A 4BHCA 1RZ4A 2LDUA 4KICA 1DDNA 5K5RA 4N9HA 1MGTA 3T8RA 2OQGA 4QLCU 3LWFA 1WI9A 2QQAA 1YW7A 1R5HA 2NS0A 5JFRA 1YS7A 4HQMA 1SFUA 2W25A 2G9WA 2F5CA 1J0RA 4S04A 2QVOA 3MEXA 3FMQA 2P7CB 2FBKA 1QPMA 1Z05A 1G3WA 3I4PA 4IXAA 1USTA 2O8XA 2HZTA 4M72A 3WTWC 5HS8A 1XCVA 2RQPA 2CGPA 2D1HA 1HKQA 3ROUA 2HQNA 5ED4A 4YFKF 2DI3A 2WWYA 3FX3A 4A6DA 1O3TA 4LK1F 2BE5F 2EA4A 5HDNA 3V8JA 3R6SA 1U8RA 1FBSA 3GFIA 1LJ9A 2DO7A 4OMYA 4ENJA 3K1MA 2P8TA 2DAOA 1QNTA 5TJJA 5LRSA 1TLHB 1FOKA 4EJTA 3KP6A 2XIGA 3RKXA 2MLGA 1V4RA 4PGHA 4P5OA 4Q5SF 1ODDA 3IWFA 3DQVC 4M73A 1ZN2A 2Q2EA 3FHZA 3PQKA 4A0XA 2AS5F 2KIMA 2XV4S 2D45A 2PEXA 4LG0B 3ELKA 1DPRA 2ZMEA 1MD0A 4AD9A 4OIPF 1C0WA 2QM3A 3SZTA 4IVNA 3V7SA 2JPBA 4EGYA 1D5VA 1STZA 1YLFA 2ISYA 1B6AA 4DNCA 2BEOA 4OINF 4ZZDA 1ZRFA 4UXNA 1XGSA 1TNSA 4I01A 4Y17A 2A61A 5L3EA 2YX7A 2GA2A 2ADUA 2V1DA 4EGZA 2FMLA 4KFCA 5DD4A 3WTUC 4A5NA 2XKPA 3WTTC 3M8FA 4RGXA 5HLGA 3I58A 2CWEA 2HDCA 4FX0A 1P4AA 1LDJA 1NHAA 5L3BA 5E8IA 4CYDA 4AVPA 1KGSA 1X3UA 3GFJA 1D8KA 3BJAA 4HZFA 1USSA 4RS8A 3GWZA 3RKWA 4P9FA 3FMSA 3TOBA 5EEHA 1BM9A 1P92A 1FSEA 3E5XA 4G94A 4Y15A 4ZYDA 2Q0OA 1ZG5A 4IHTA 3CTAA 1ULYA 2O3FA 5D4RA 3QP5A 5CVJA 1R7JA 1KU2A 3QOPA 1RI7A 1R22A 4A5MA 2K27A 4IRHA 3HOSA 4AIKA 1ZH5A 5CVUA 5FLXZ 2GXBA 2NNYA 3JTHA 3B02A 3VOEA 3HOTA 1IN5A 3BJOA 3O6BB 2MA3A 1R1UA 2A69F 2M30A 5KVRA 4HQEA 3I53A 3C18A 4U0WA 1FLIA 1PP7U 3RJPA 3K0LA 1G4DA 5J6XA 1B9NA 4ZYGA 3Q5FA 2VN2A 3EUHA 3GLXA 1R58A 1W7PA 4M6XA 2HTSA 4R8HA 3I71A 4HYEA 4BYYA 2V79A 3KE2A 1GXQA 2K86A 3W6KB 2ESNA 1IAWA 4PCQA 3JAMZ 2ZFWA 2IW5A 3G3ZA 4Q4ZF 4MHGA 3Q9SA 1P2FA 4M9XA 3ML6A 4YFNF 2FEZA 3WG9A 2RN7A 4IPAA 1IN4A 4OOIA 1OYWA 4HA8A 5FFZA 3JAMK 3RPUA 3HRSA 2CFXA 2K4JA 2W85A 1U5TC 3KZZA 1HSTA 3B73A 1BIAA 1J75A 1P4WA 5LBQA 5EEGA 1BI0A 4O6JA 5ICFA 1I27A 3J7AO 4KA4A 1JHFA
chains in the Genus database with same CATH superfamily
1A31A 4IOAF 4G9YA 4ZDLA 2DDBA 2RQQA 1MW7A 2E7WA 2GQQA 2VI6A 2P5KA 2PLYA 4R1HA 2XRLA 1OYYA 4G7OF 2P5LC 4RB0A 2HPMA 5F08A 4N4NB 2XF7A 3TDZC 4NC7A 3COAC 1IRFA 5IP7J 3J80Z 2HVQA 1S3JA 4EEFG 1XSVA 2H1LA 3BZCA 1W7PD 2ZMEB 3IWZA 4PJJA 4KIFA 5EG0B 2HWVA 3I54A 1KYZA 4LG3A 3ABKH 5DM6F 1KYWA 1ZRDA 4EJWA 5HOOA 3WTYC 3BTCA 3HUGA 4UHTA 4RAGA 5DCMA 1TBXA 2VBZA 1BW6A 5FLMJ 2H09A 4CCOA 2IJLA 4EMSA 4HNTA 1JKPC 4BNCA 4KITB 3K2AA 3TO7A 4PGGA 3O3KA 2W84A 1SVMA 1M1EB 3ZQCA 5F6FA 1YFHA 3L2VA 1OLTA 1H89C 4B8XA 3BTIA 3GCMA 4XL9A 2DJIA 1R6RA 1Y8RB 2IT0A 2F5VA 1BI2A 2A6HF 2XDVA 4ON0A 1U3EM 4KT5C 4QPQA 3GX4X 4CCJA 2X1CA 2WY7Q 2DOFA 1OCTC 2CUEA 4NC8A 1PDNC 3P7NA 4G8XA 5IPAA 5BS6A 3MKZA 2K7LA 3N4MA 3OL4A 3E5QA 1FMWA 5CVRA 1XSDA 2MW8A 1WJDA 2DPUA 5JR3A 1S6LA 1ZREA 1J7KA 3NRVA 4YFXF 4XORA 1HDDC 1TW3A 1PJRA 3GTQJ 4AC0A 5DUIA 3RYPA 4BY1J 2Z1DA 3S2DJ 3CUQB 2AQEA 4IKFA 1EH8A 1XD7A 3QYEA 3VFZA 2KIUA 2M0MA 2CH0A 4LGWA 4UV8A 1DU0A 2X1EA 3K4KA 3LMMA 1J2XA 2WADA 4U0VA 3JRGA 2Z9OA 3EQLF 3EPZA 4HF1A 1RC9A 2ETHA 2FMYA 2KRHA 1XMKA 3PL8A 2KQRA 1MSEC 2VC1A 3BG9A 2Z2SB 2H6CA 1S9HA 4L0ZB 1EA3A 2H94A 1HSJA 3DPUA 3V42A 3OYAA 2VOPA 2JZYA 4HNUA 3FXLA 4A2UA 4UNOA 1Y8QB 3L7WA 4XRSA 3LFUA 2DT7B 1LUJB 2Z5UA 4ZH4F 5FB2A 5EZGA 3AAFA 3GUDA 5IYCJ 2EIKH 2L02A 1BJZA 1HCRA 2DTRA 3FKJA 1ETOA 1K7AA 3N05A 4RAZA 3RTRA 4M6YA 5D8KB 1RIOH 4A3EJ 4B09A 1SAXA 3HRTA 1MBHA 3MKYB 2E71A 2H6BA 2H8WA 1MDMA 2I8DA 2EFQA 1W5TA 3ZN1A 1YIOA 1B8IB 3LA7A 2WC2A 1LFUP 2FF4A 2VASA 2EZKA 3SFIA 3HKZN 1W4MA 5DEQA 1R4MB 3K2ZA 3K69A 3CUQC 5J3LA 3IV5A 3KP4A 3QU6A 3Q9VA 5J1UA 2OBPA 2RV8A 3TKYA 2X6WA 2ZSIB 2A07F 2NRAC 4YG2F 5L3CA 2LBFA 1PUFB 5HLHA 2K3FA 2PFBA 4M9SA 5TGTA 3ESWB 3GTPJ 3IAS2 1Z7LA 3CUQA 1GVDA 2RGVA 1MMGA 2DLLA 1R36A 3MN2A 1VQPI 1D3YA 1IGNA 1VQKI 4Y7NJ 3QPTA 1YJWI 1NG7A 1RETA 2XAUA 3KP5A 2AO9A 2G7UA 2HYJA 3W2AA 5E1WA 3LNQA 4A3LJ 2LSOA 5ICGA 2LNBA 5FD6A 3GZ6A 5F0CA 4XBFA 2FOWA 2COBA 3A0BC 2BGCA 1BR1A 2BVMA 5FFXA 1ZLJA 4WF2A 3R60A 2XB0X 4RLFA 4DW6A 2F4IA 4HSRA 1N77A 5IT3A 3PO2J 1ZK8A 2HR3A 2BYVE 4BKXA 1FIPA 1HW1A 2NOGA 3NEUA 3SJMA 1JTXA 4YELA 3V8LA 5F0HA 3GF2A 2MC3A 4RLQA 1K4TA 1WJ5A 5CLSA 3NAUA 2R7ZJ 3V4GA 2NVUB 1S72I 3GBGA 4KNYA 2DFEA 3U2RA 1J9IA 1L3LA 3CLQA 1SD7A 2E1OA 4BXUA 4ESBA 2GA1A 3FM5A 1IUYA 3CJTB 2ECCA 1Q1HA 3C2HA 2RVCA 4U7DA 4C3IJ 4HNVA 3EUAA 1H9GA 4EM1A 3HPGA 3WHCA 1MJAA 2EZHA 2CQXA 1WKMA 2JUGA 1N75A 3FK6A 3R61A 3DTIA 1ON1A 2E36A 4U88A 3RIRA 3HOYJ 1S29A 3BQYA 1TNTA 1YX3A 4IHSA 2LYCA 3FXKA 4M9ZA 4RB3C 1FSHA 3HEFA 4AIJA 1FZPB 4D9JA 4ENKA 2XUBA 3S2HJ 3I4NJ 3L2UA 3MFKA 4CSWA 2XAJA 3S93A 4IHYA 2COMA 3OOPA 1QZZA 3IRRA 3VSKA 3J81Z 3FMRA 1VQLI 4G6QA 3HOWJ 4A93J 2W48A 4CDGA 3F72A 5IT9Z 1WWXA 4CXFA 4NB5A 3JRCA 1QA6A 2DYRH 1U0JA 5B5EC 2JRTA 4LLLA 4UB8C 3IH3A 3ZGKA 1WJAA 2PJPA 1LVKA 3LAJA 3JRBA 3RCOA 2QBYA 2G0EA 3QWLA 1VTNC 5JLXA 3TQNA 3BPXA 4WXDA 2ZNZA 1ZARA 1VF9A 2CQ7A 1DGWY 1XDSA 2VQHA 3K4MA 1TQIA 2E5ZA 2KKOA 3MAJA 3TO9A 2P4WA 2F6CA 3CJNA 1ZLKA 3GXOA 2LREA 5TISC 1ZRCA 2J5PA 4ZYAA 2JRMA 3CZ6A 1ZGJA 3CC2I 3PNYA 1Z0XA 4PUSA 2VQCA 1QPIA 4UUSA 2Y69H 1FT9A 1JUSA 4Q47A 5IOZA 5FKKA 2YR2A 1W5CC 2D2WA 3CO6C 2E2HJ 1TWCJ 1XG1A 1H8AC 1ZTRA 4JQFA 1KQ8A 2VKVA 2P7VB 2DU9A 2B63J 3EDPA 3HHGA 1YE9A 1Q1VA 1UHMA 4G12A 4M71A 5E3NA 4OIOF 3C7JA 2MGQA 1VQMI 1I1GA 1MJ9A 1WPKA 4DIQA 1BBYA 4HPQA 1BOBA 3KIOA 2DFHA 2LG4A 1DPUA 4XLFA 4ZZLA 2LH9A 3VODA 4A3BJ 1SFOJ 1U5TA 3BROA 3OV8A 4IO9F 2JVHA 4IF4A 4Y13A 2YSRA 3CDHA 3TL4X 5DS9A 1LDKB 1ON2A 1KA8A 2B9SA 1JXSA 1OR7C 3FZVA 3LA3A 4BEHB 4HF0A 1LEBA 3E1SA 2NAZA 3L00A 1PYVA 4XLNF 4XLPF 2YX4A 5ERIA 2XRNA 5L3GA 4UUVA 3IC7A 4U0YA 4EVIA 4GDFA 2ECBA 3ZN0A 3S3NA 1BA5A 4GGGA 5LD2C 2E60A 1OR7A 1IZ1A 2L2OA 2O8KA 3OSGA 2M2EA 1CQTA 4RGUA 2LF7A 1SD6A 2EZIA 5E1ZB 2BZTA 5F1JA 3W6JB 2WAEA 2XC7A 3D5LA 4RBOA 1G2HA 4HEA2 3FXUA 4QPOA 5E1XA 1TWGJ 4OIRF 2R7QA 1MJBA 1K4SA 1R00A 3Q3SA 1I3QJ 1K83J 3DU6A 1HC8A 5E8GA 3RZDJ 5ILVA 2KRFA 1OISA 5B66C 2BXYA 4DJAA 2FQ3A 1QO0D 2CO5A 2JQ7A 4KMUX 4AWXB 2DN0A 4CHUA 2O7OA 3EYYA 4EM0B 2WAFA 4NUBA 2EFWA 1VQOI 2PQ8A 3MD2A 1JHHA 2VT2A 3WTSC 3PSIA 1KU7A 1LFBA 4L5IA 1OFCX 1SD5A 3BTJA 5H6RA 2GZWA 2F5EA 3RDIA 1S7OA 2MBFA 2PJRB 4B48A 2M34A 3BWGA 3S2WA 4EJOA 4C2UA 2R7VA 4H0EA 1X2NA 5FJ8J 1ZGWA 4LG0A 2PG4A 5GTHC 3CCJI 2O61A 1ETQA 3GYHX 1J5YA 1OCPA 1SVOA 2XPWA 3HYIA 1IRZA 3K6GA 4HAMA 5DCMB 5H6QA 2GIZA 4OWRB 2V1NA 2W57A 2V6CA 3K10A 1FWZA 1S8NA 2VB6A 3UR3C 4CA0A 3S1RJ 2CW8A 5DD8A 5A2QZ 2YU9J 3BOQA 3BPVA 4LITA 3V7RA 1G6NA 3M1CA 1DP7P 3ZQHA 1B72B 3CD6I 2FUG2 3K1NA 1FX7A 1K61A 3KYCB 1QBJA 4UUTA 2BXZA 6PAXA 1E0EA 3BLYA 4EJVA 3DP7A 1A35A 3K1PA 4A12A 2EILH 4BY7J 2NS7A 1SFXA 3DPLC 3QQAA 3UKGA 1YIJI 2F2EA 2STTA 3G71I 2YS9A 4O5VA 4G7HF 2Y48A 1YRNB 4PDKA 3G73A 3S32A 3U9GA 3M1EA 1E17A 3KLNA 3Q0UA 1ZG3A 4FISA 3ZQQA 3F8MA 1FYLA 3ZQLA 1Z77A 3P9IA 3SEQA 3FBIB 5KK1A 5AONA 5FKLA 1F9NA 4BQOA 1H0MA 1O7LA 1Z9CA 4BJ6C 1T6SA 2EFNA 5J1RA 2K3PA 3CLOA 2K5CA 1HKTA 4IHVA 4D5CA 4E7HA 5CYVA 3CJRB 4JP0A 2YPRA 3SDBA 4L18B 3W3CA 4XSXF 3KP7A 5FKOA 3H9QA 2RAEA 4L9TA 2K4BA 5D4SA 3E6BA 4P96A 2ZBKA 1OYIA 5K5OA 2ZFUA 1B9MA 4MQVA 1R9TJ 3C3WA 2L7ZA 4A6EA 3MVPA 2M87A 2V1XA 3JR9A 3TOAA 2WAQA 3MCZA 4M3DA 3LQRA 2F4OB 3GVAA 4ZJZA 3L2WA 4LB6B 1PP8F 5F0FA 4MNUA 1R5GA 2IRFG 3RPUD 2K9QA 2W82A 4CCLA 2VKDA 3KETA 3SHFA 1IN6A 3VYRB 2R7WA 3ZMSA 2ME6A 4BL0B 2K9SA 3LQQA 5M3FJ 1X1DA 4TV7A 2RKHA 2J5OA 1AA7A 4ESFA 2FBIA 5LHIA 2O5RA 2ACJA 1SFEA 3HC7A 2XAGA 4HOBA 5K1YA 1WHUA 2NNNA 4P1WA 1SD4A 1VQ8I 3GTLJ 1HW5A 1RR7A 3ECOA 1EH7A 4LLGF 1YX5A 2W1OA 4NNJA 2GLOA 3KCCA 3P9KA 3OS2A 1X1CA 3QU3A 2HYGD 3GEZA 3LAPA 3CF5F 3A02A 1JUMA 2EK5A 3HRMA 3FXMA 4XONA 3I0TA 2LBFB 1EH6A 3LSMA 5FO5A 4IRGA 2V1UA 1YW9A 4HBLA 2PMZN 2Y30A 2DFIA 1UHSA 1U2WA 1IO2A 1GVJA 2E1NA 2ZKZA 4CCMA 5KNLA 3DBHB 3DLAA 5E20A 1T0FC 4I09A 3BR0A 2XSDC 1B59A 2BOLA 1XGNA 1G8XA 2X1DA 2VBYA 3FXJA 3WTXC 2V9PA 2NOJB 4YRVA 1LQ1A 3IKTA 4A0ZA 2EV0A 2M1BA 2V7FA 5HNHA 3KEOA 1KQ9A 2AXLA 4NHJA 2KJCA 4XSZF 1JGSA 1RKTA 3JREA 1K78B 4RGRA 3FIWA 4D7MA 2LD5A 3BCAA 2KPMA 4Q48A 3FISA 2JSCA 2ZMEC 3GO5A 3R0AA 2Z3YA 5HDGA 3H5RA 2Z33A 3FWEA 2ELJA 3WE3A 2DK8A 2HKXA 2X85A 2Q8KA 2FSWA 3ZRGA 5IY5H 4WCGA 2L7MP 3M9AA 4KJZA 2AHQA 5D5UB 2VE8A 2R7TA 1Z1DA 1O4XA 2M3AA 2L4MA 2DW4A 3VB2A 4ZYEA 4S05A 1Z91A 5FGMA 1KQ0A 3AG3H 5LGNA 5IT9K 2DOEA 3T0YA 2H27A 3LOCA 4XM3A 1IN8A 3M4OJ 4KMFA 2R5YA 2DFFA 1EKEA 5E3OA 1VI0A 3OIPA 2Y75A 2W7NA 3CC7I 1VNDA 3HPHA 2DOAA 2Y9ZA 4V19K 1ZAOA 2AQFA 2F48A 4RB2C 2VPLA 4WXCA 4DBRA 3JRAA 3BR5A 2ESHA 1RUOA 3OYLA 2MG4A 1VZ0A 4BBRJ 4HLYA 4QWQA 1WZ2A 2LP0A 5LEJA 1WCMJ 3SQNA 1WJEA 1B4AA 5EGOB 4PSXA 3IAM2 1YJ9I 2JA6J 2X48A 2P5VA 2WY8Q 4EM2A 1E3HA 2D1VA 4KYWA 2FNPA 5E3LA 2I10A 1J59A 2F5DA 1GXPA 1TZLA 2GAUA 3E6CC 2MSYA 3DCFA 4HX8A 2KIQA 2VC0A 2L01A 5B1AH 2V6EA 2NXNB 1XGMA 4NDLA 3IH2A 3OS1A 4WXHA 3VWBA 2ME0A 5F1RA 4HDUA 1ONVA 4LOCA 1AHDP 2GBYA 3OYEA 2L9RA 2QA4I 2KZVA 2X6OA 4KUMA 2NVQJ 5JI6A 3IL2A 2FQ4A 4CZZA 2IA2A 4I0AA 5FRMA 2B0LA 4JOMA 4ITVA 1R5ID 4U87A 2Y0SN 1PUFA 2QEXI 1HOMA 1F43A 2CG4A 4KN4X 3O8HA 2CYYA 2KL4A 3NARA 3BR6A 2IS1A 2K9MA 5KAIC 2QSFX 2DMUA 3KLOA 2ZJPF 1JE8A 2KT0A 2IVMA 2BV6A 3TMOA 2P6SA 4JK1X 3L2CA 3J80K 4A3JJ 1K6YA 3BJ6A 4BQAA 5BPDA 2STWA 3F23A 2ZCWA 3MKLA 4IL6C 3FM3A 3HSFA 4CZCA 2X4HA 4A3IJ 2LOOA 3JCUC 5JVTA 2A68F 1U5TB 2A3SA 1TWAJ 2LVSA 4G6TB 3F8CA 3KYDB 5CJ9A 4F92B 2CQQA 2LRDA 4L9VA 1HLVA 2A6TA 1IRGA 2MYSA 4MTEA 3DKWA 4BAYA 2G7HA 3CCUI 4JBAA 3K4CA 5AIQA 1P6RA 2LF8A 3ZQ7A 3OIQA 5CQEA 1R23A 4LFUA 1RUNA 2QZ8A 2YU3A 1S7AA 1XMAA 5L3DA 2XF6A 2L7FP 3QP6A 1O57A 4PJ0C 1PVEA 2FX0A 4AM3A 4GYGA 4BBSJ 3GFLA 3F8BA 3TGNA 2LKPA 5FKMA 2UUZA 1HBXG 1DGRM 3HGYA 4C3JJ 1BC7C 1FC3A 2EPFA 4UV9A 1XMXA 3UNGC 5ICCA 1IG7A 2E19A 2OCEA 3RSNA 4MTDA 2FU4A 4DZJA 1WFXA 1WGXA 2QQ9A 1S7EA 1ETVA 1IJWC 2JA8J 2KISA 1UELB 3CDIA 1OKRA 5ICEA 3HKZA 3WGIA 2MD5A 1FOYA 2CFOA 3H92A 1FMVA 3LSKA 2HS5A 4HX4A 5H2FC 1LNWA 3MMYB 4O3MA 5JHUA 1P4XA 2XGEA 5J1YA 4MEXF 2PMUA 4II3A 5M5YJ 4HV5A 4A3FJ 2HDDA 5J8FA 2M4GA 4BE1A 1EV7A 1H88C 1K6OA 3ZMTA 3ZPLA 1NK3P 5M5XJ 3S1NJ 3F22A 2HEOA 3CQZJ 1MBFA 4C2MJ 3Q0VA 4EATA 3WTZA 1ZYRF 4HW0A 3HTUA 2VOOA 1IC8A 5IYBJ 1RPWA 1W5SA 3HSRA 3FF5A 1ZR4A 3DKXA 5C4JJ 2OZ6A 4XLAA 1ETYA 3OYDA 3LSIA 3QRFF 1Y0UA 2EWNA 4RAYA 4RA2A 3BG3A 5H20A 5HDKA 1YYVA 2IGNA 1J09A 4OIQF 1YQAA 1XSXA 2QKMB 4KN7X 1MBJA 3ZMUA 1D1BA 2BY3A 3H3ZA 1WH5A 1QGPA 2R7FA 2R5ZB 2L3DA 1ETWA 2RC4A 3F8FA 1FBUA 2R7XA 3KZYA 4HSTA 3H0GJ 3S14J 2OA4A 4PJNA 4ETSA 5GPAA 3DKYA 3OYGA 1HDPA 2QWWA 3CJQB 2CS3A 1WJBA 2KDOA 2F5FA 1JTYA 2EQRA 3K9TA 3HB9A 3SFZA 4XRMA 2VUMJ 1T39A 2HDWA 3D5RC 3GZ5A 3IP4B 3M8JA 1QQIA 1QU3A 1T33A 2IA0A 1A36A 5LGTA 4E4HA 2I5UA 2X0LA 4BXXJ 3MZ8A 5LLQA 3CMYA 4XRSG 2HVSA 3E97A 3BR3A 3HJEA 3T1BA 1HA8A 1MMSA 4S0HB 3NWSA 4E7JA 5LHHA 3N97A 4ENMA 3AFHA 1V5EA 3HUGB 1MNEA 1FY7A 3WODF 2R7SA 3JTGA 2KMUA 2DXIA 4A0YA 2DODA 2IGMA 4ASNA 2XAHA 3WG7H 4NQWB 1FOWA 2DMQA 3OYFA 3HGGA 1FP2A 4ESJA 2M8EA 5EF6A 1X4OA 2BVLA 1I6XA 3O8GA 3J7YJ 2WV1A 1JUPA 4D0PA 1BR4A 2QQBA 4XK4A 3GFMA 4EJUA 5E18F 2VQLA 2XVCA 3VYTB 2OTLI 1G3TA 2E1MC 4FT8A 1I39A 4F3QA 4KIBA 3PUFA 2L0KA 3H9JA 4DGWB 3C2BA 3QPSA 1SEUA 2FA5A 2Y0MA 4XNFA 4CGZA 1FJLA 1Z21A 3DEWA 1KZHA 3WU0A 5E3MA 4GCVA 3LSPA 4L5EA 1Y1VJ 4PJLA 3LFKA 1T98A 3LSRA 1POGA 4EV0A 5LGUA 5IOYA 4XOTA 3JSPA 2OCCH 5HS9A 3HOUJ 4CH7A 2M5WA 4BDZA 1H9TA 2QCOA 2HXOA 4V2FA 5BPIA 1A6QA 3HSEA 1QVTA 2WA0A 2HI3A 4AIHA 5DTDA 5GAEJ 1W0TA 2VBXA 2DJNA 1KU9A 1FNNA 4IRIA 1SFKA 2DBBA 3V7CA 3WE2A 4R79A 4OMZA 2VONA 2L4AA 2EFOA 1EJ9A 3L09A 5D5XB 3HDDA 3M7GA 4P55A 1BI3A 5EDNA 4ZTJA 1JJ8C 3RQ4A 3OS0A 5DCFA 4BE0A 1TW2A 1FPQA 5AIPA 3BZ6A 1BJAA 1XCBA 4B47A 1ZG1A 1RNLA 2QYOA 2VJIA 3DPTA 2WTEA 3WU1B 4XQFA 5M3MJ 1V3FA 1BIBA 3LSHA 2EFPA 3AKZA 3CMMA 3PUBA 1Z67A 3OR1C 4FHTA 2OD5A 1EF4A 3DEUA 4HLXA 2OAZA 4UVAA 2MD0A 1IW7F 2HPIA 4L0YB 4XKWA 1YTYA 3ECHA 3ERMA 4XR6A 2XPVA 3AL0C 1ZQ3P 1IUFA 4L9JA 3MZHA 4D5FA 3OY9A 1Y56A 2KIFA 4I7HA 4CICA 3L9FA 2WBMA 4RGSA 1T0FA 2VKEA 1RR8C 3IH4A 3C1DA 1R49A 3F0CA 2CQNA 4UVBA 3W6VA 3KPHA 2WV0A 1SAUA 2IEKA 4BU2A 1R1VA 4GFBA 3A03A 4BH9A 2Y0SA 1SANA 4Y52J 4AIDA 1XS9A 3VYUB 1W7PB 3P9CA 4FX4A 3F3XA 2ZXWH 4CO8A 4E70A 3HOZJ 4FE4A 3QAHA 3ZMDA 1CF7A 1UJ8A 3H3UA 4GO1A 4M3BA 3D5SC 2WB1A 4N0BA 2EV5A 2NYXA 4IJAA 4X0GA 1E3OC 5ILSA 3CP2A 3PSFA 4NC6A 5CVIA 4G7ZF 1UFMA 3AG2H 5TRDA 5K7HA 3CUOA 3OMYA 4E7LA 5D8LB 2VXZA 4QIWN 1U6GA 3MZYA 5CVVA 1WI3A 3CMAI 2W24A 4Z6YA 2JA5J 2R7OA 5EGOA 1O3RA 2HTJA 2HVRA 3VPRA 3IHUA 1Z7UA 4RMNA 3K70C 1GHCA 2E1MB 3TDUC 1ENHA 1SC7A 3EYIA 3BP8A 3TW7A 2R92J 2X51A 1W1WE 1TWFJ 2LKSA 3CP8A 3EUKL 4RM3A 1MZBA 2D5VA 3S15J 3H0DA 3M8EA 1UZCA 3K4BA 3CO7C 2DT5A 1AKHA 3OIOA 4YIRX 2L7KA 1ZKGA 2KFDA 3IRQA 5DUKA 4MIMA 3I4MJ 1R1TA 2CUFA 1S5LC 2QLZA 2ISZA 4PZJA 3WGHA 4RB1A 2KDZA 3QPLA 1BL0A 5F64A 3OYIA 1MSFC 2IS6A 4IEJA 4F55A 2PN6A 1LEAA 4E6KG 3RQIA 3CCLI 5E79C 3VEPA 2XASA 1D0XA 3V8KA 4KISA 5FRNA 4XICA 2TCTA 4WWCA 1F4KA 3DFGA 1HXDA 2JT1A 4A69C 2LTPA 1FTTA 3OYNA 1OMIA 1U8BA 1XB4A 2X6YA 1ETKA 2UZKA 2VJ5A 1AU7A 4XLCA 2E7XA 5DM7F 4I98B 3LSJA 3HRUA 3SXYA 1SMTA 2CQKA 2L54A 1B1BA 4F91B 2VE9A 2DMTA 2DMPA 1QVUA 2L9VA 4J01A 1K78A 2QKLB 3PIPF 9ANTA 3PFYA 2V4JC 4P9UA 5LFAA 1GV5A 1UCRA 4D1QA 1VQ4I 1V54H 2FE3A 1WSUA 2VXDA 1IXCA 2HOTA 4BQNA 3U1KA 1I50J 3B6CA 1UG2A 1AWCA 2VJ4A 1SMYF 4C3HJ 1Y1WJ 2H1KA 3BT9A 1CF7B 2DA6A 1YG2A 5HLTA 4BUPA 4XOPA 5BOXA 3F21A 3K4LA 1LE8B 3GW2A 3PNVA 2OU2A 4AYBN 1FEXA 1A04A 4KDPA 5K5QA 1OJLA 4U7BA 3WGGA 1IXSB 2R93J 4E7ZA 3AL0B 3WU2C 4DYRA 2M45A 2A6EF 4M74A 4BGDA 3FHNA 4ZYHA 2CV0A 2VJJA 1ACIA 3ONQA 2C6YA 2PMHA 3ABMH 5BNGA 1V55H 4X1EA 2DA4A 2GM4A 4I99C 1BC8C 5CKTA 1GDTA 4CYCA 1JKQC 3CCSI 1YW8A 4MQ9F 4IQJA 1APLC 1R71A 3BY6A 2PI0A 3VSLA 3PM1A 4GYIA 3SZPA 2HXIA 1G3YA 2FNAA 3BG6A 3PIOF 4XKBA 1R4NB 4JX6A 2ELHA 3DTEA 2DT6A 3QYBA 2XKOA 3QPHA 2M7AA 1FYKA 4FTHA 4K2EA 2HKOA 2XAFA 3HM5A 5CPRB 3TW6A 2HOEA 2XHKA 5A2QK 1MBEA 4BHPA 3NWTA 1VQ7I 2CW0F 3A4CA 1E2XA 3QYFA 4MFDA 3CCVI 1FBQA 1Y39A 4OU0A 1MKMA 1T2KA 2KZGA 5FKNA 2W4SA 4PFPA 3E6MA 3IKVA 4MGRA 3F9KA 2JPCA 1D0YA 2HGCA 3FK7A 1F5TA 5FD5A 1IXRC 4XRFA 3G4SI 1YS6A 2BW3A 2GWRA 1NH3A 1GUUA 2KJBA 1FIAA 2L9NA 1IRXA 2QSGX 1GT0C 4JX4A 1U78A 1ZHFA 1X2MA 4LB5A 1DU6A 3HG9A 1WJCA 2XROA 3QOEA 2L9SA 1MH3A 2Y2ZA 4D7NA 5L3FA 1JT0A 5E17F 3A1YA 1XGOA 1IN7A 1W36C 2N8GA 1I5ZA 1TQPA 3OYBA 2PBIA 2JK3A 4I76A 3DTKA 2GOMA 3HL2A 1F36A 1KU3A 3ABTA 2ZO4A 1TWHJ 4WK8F 3C2GA 1TTYA 1NK2P 2DQLA 4BHBA 4MEYF 2RDPA 4ABZA 5ILUA 2Z99A 1L0OC 4HF2A 4BACA 4I02A 4H4KC 1XDUA 3BZKA 3I5UA 4NBQA 1LB2A 1TC3C 3DXJF 4IHWA 4LLNA 3FXOA 1TQMA 2WAQN 3JW4A 2M9HA 4HX7A 1K79A 1BI1A 3BDDA 3M3YJ 3F6OA 1ORKA 4MLOA 3F6VA 2VT3A 2OQRA 1UB9A 1FYMA 2JTVA 1O7FA 3CCYA 3KP3A 1XPXA 3AG4H 1G3SA 5IP9J 1TL8A 4Z2YA 4MFEA 5DYMA 2CUJA 1W0UA 3ZMZA 3FXQA 1ZGAA 4G6DA 4ENNA 3VYSB 4BEHA 2W00A 2LY9A 1YHQI 2EB7A 2CU7A 3ABUA 3HHHA 3OWTA 3E6DA 1TT0A 2PX9A 1X3ZB 2LFBA 4FQGA 2ZC2A 2R5ZA 3S17J 2LY2A 2CRGA 1U9OA 1OPCA 2FJ1A 3DBLB 1V5GA 2A5YB 2VIXA 3LSTA 2DK5A 5D5VB 5KCMA 3J81K 1LDDA 1AOYA 2MLKA 3I56I 3E5UA 2ELKA 3P5JA 5LEKA 1YOVB 3MQ0A 4XKCA 4HDVA 2ZXJA 2OTJI 1RESA 5F27A 5EZHA 4B1RA 4RM2A 4B43A 4CCKA 4EQQA 5C3EJ 4GXOA 2P6TA 4XLHA 1XN7A 3L2RA 2ZNYA 1D8JA 1QHHD 3PQJA 3REOA 3PFIA 1X1PA 2XB5A 4UVCA 3OYJA 2ID6A 4M3FA 3G1LA 4LD5A 2IA1A 4ANJA 1QZYA 2EINH 3IUOA 1UHWA 2CMPA 1A6IA 5J8CA 3T8TA 1JGGA 1T56A 2OZUA 3J7AY 4JYKA 3RYRA 2QBYB 1OCZH 4LK0F 3I64A 4RAFA 2FXAA 1YO5C 2FBHA 1MH4A 1X19A 2HQAA 4A3GJ 2O0YA 3HIFA 4I2OA 2E35A 1D1CA 1ZELA 3ULQB 3H5NA 3OR2C 4IOCF 1WRJA 2UXXA 2LR8A 5HLIA 3QODA 4DBQA 3ERED 1BOAA 1WQ2A 5HVQC 4WX9A 1YRNA 2MFZA 1VFCA 4HG2A 2XGXA 2O03A 3HXLA 1BW5A 3KP2A 1MDMB 2RREA 1X1AA 2RNJA 2MH9A 4UUSB 2QSHX 2NVXJ 1PUEE 3GTJJ 1HQCA 1BR2A 3RPQA 4AUXA 4NQWA 1BN5A 2CV2A 2K02A 1FP1D 1O3QA 3I59B 2DPDA 2X6XA 4I6ZA 2GXGA 3KEQA 2VKHA 3EETA 3BR2A 3O2PE 4LMYA 1I1SA 4FCYA 3DF8A 4V2GA 3MWMA 1DUXC 5D5WB 1X3WB 2Q2EB 5LRRA 3D0SA 4LIUA 2EV6A 2LC2A 3ZP5A 2DQRA 1IV8A 2OUMA 2GIVA 3I3LA 2ZXIA 2ZJ2A 2VODA 5C44J 2M7BA 3CF2A 3CCEI 3BC8A 4I0BA 3JSOA 4BJTA 3WTVC 2JSPA 3X2QH 1WJFA 2EJRA 2TRTA 2QENA 5BQTA 4II2A 2UWMA 1IF1A 4E7SA 5D6EA 3FKIJ 3E0JB 3OL3A 3E3VA 4N9IA 1MIJA 4YIIA 3T5XA 5GADJ 3I9V2 3HTSB 2HOSA 2HFHA 3LA2A 1YITI 5C4XJ 4L9NA 3RKYA 2ICWG 4PFOA 1REPC 2HQRA 3RI4A 2DA2A 3GTOJ 2VPRA 2CSOA 3S1QJ 1N25A 4AYBA 1U9NA 1UMQA 3F8NA 3ISPA 5D6FA 3D1NI 2XF5A 1I6HJ 1OQYA 2EA2A 3R0JA 4L5JA 2E1CA 2V9KA 1YI2I 5DV5A 4LJZF 1E3PA 1Z6TA 2UXNA 2FOKA 5LHGA 1XX5A 3ZR8X 3NQOA 5EJCA 5B3SH 1ZR2A 1D1AA 4DQ2A 2R7DA 4YIFA 1N78A 2LY1A 2O6GE 4Y33A 2IP2A 2NVYJ 3DLLF 1MBKA 2QUFA 2R3SA 1HKSA 3U1DA 4KIGA 4BJ5C 2BY0A 1F1ZA 2V9VA 3H1CA 2IPQX 1CGPA 3H35A 2CW7A 2XSJC 3I59A 4XKVA 2DDAA 3KFWX 3R4KA 4B3AA 2IS2A 5DDGA 2M0CA 3CDLA 5BMZA 1VQ9I 2K9LA 4XN0A 5HS7A 3HOXJ 3ASNH 1B8IA 4HV6A 4XMYA 2E5NA 1T38A 2OPTA 2HYFA 1HW2A 2MH2A 2R4GA 3G2BA 4F7ZA 2FRHA 2WB1N 2TDXA 1IDYA 2BY2A 2XAQA 5FLXK 1Z6RA 4N4OB 3DV8A 1LVAA 3SDGA 2VBWA 3FXRA 2BBYA 3GZNB 3ZMVA 1O3SA 1MNDA 3BG7A 3TO6A 4BHCA 5J4YA 1RZ4A 2XGDA 4CUGA 2LDUA 5HNFA 1D5YA 4KICA 2VL8A 2ZB9A 1VQ5I 1DDNA 2XPUA 5K5RA 4N9HA 1SVLA 2FD5A 1MGTA 3T8RA 4W97A 2IGKA 1WH7A 4BXFA 2OQGA 4QLCU 3LWFA 2EH3A 1WI9A 2ZJQF 2QQAA 1YW7A 1R5HA 4A3DJ 4J00A 1IV6A 2NS0A 3SZGA 1YS7A 4M3GA 5JFRA 4HQMA 3TEDA 1SFUA 2LKXA 3SYTA 2W25A 4B44A 3K7AJ 2A5WA 4IHXA 2G9WA 2JMWA 2F5CA 3CCMI 2P0WA 1J0RA 4S04A 2QVOA 3MEXA 3S3OA 3FMQA 3OYHA 1JJ6C 2P7CB 2FBKA 3EUHC 2ID3A 3OYKA 2BHZA 4E7KA 1QPMA 3DEEA 1Z05A 1G3WA 2AXTC 2RNGA 3I4PA 1Z3XA 4IXAA 5J47A 2R7UA 1USTA 2O8XA 2HZTA 3GMEA 4M72A 3TBIA 3WTWC 1RRJA 3E7LA 5HS8A 4W1UA 3ZQFA 3GTKJ 5M5WJ 2JN6A 3HZJA 1XCVA 1TT5B 2RQPA 3OYCA 2CGPA 3ZXSA 1XTAA 1HKQA 2D1HA 4PJMA 3ROUA 2HQNA 2Y31A 1X1BA 4YFKF 5ED4A 3GTGJ 5JHFA 2VQGA 5KAFC 2DI3A 3A01B 4PSWA 3L1PA 3J7ZI 4ZTFA 4UY8I 2WWYA 2V26A 2OV7A 3FX3A 3PNTA 2CJJA 3M07A 4A6DA 1O3TA 4LK1F 3S3MA 2BE5F 3W2WA 2EA4A 2IBDA 3SEZA 1T95A 5GAGJ 2IS4A 5HDNA 3K4NA 2DYSH 3KEYA 3V8JA 1FTZA 4Y3OA 5K7FA 3R6SA 4OAZA 1U8RA 1HF0A 3DBRB 1FBSA 3GFIA 1LJ9A 1FOXA 2DO7A 2CV1A 4OMYA 4ENJA 3ASOH 3L2QA 2PMZA 3K1MA 1DP3A 2P8TA 1G59A 2DAOA 1JI8A 2Q1ZB 1QNTA 5TJJA 5LRSA 1TLHB 1FOKA 4EJTA 2QQ8A 4E7IA 2BY1A 2DCEA 3KP6A 5FLVA 2XIGA 3A2KA 2OF7A 5B1BH 3RKXA 4FE7A 5GP9A 2MLGA 1V4RA 4PGHA 1GLNA 3AG1H 3OSFA 4P5OA 1MMNA 2OC6A 1ODDA 4Q5SF 1XC5A 2X9DA 2R5YB 2JUCA 5J4VA 2IAIA 5EEAA 3IWFA 1LPQA 5EG0A 5JVGF 3DQVC 1UAAA 4M73A 3BR1A 1P7IA 1ZN2A 2Q2EA 3FHZA 3PQKA 1RKWA 4C30A 2BHYA 4A0XA 2AS5F 2KIMA 1LFPA 1AKHB 3RKQA 4BE2A 2XV4S 4MO7A 2D45A 2HQ5A 4C2TA 2PEXA 4LG0B 3ELKA 2EBIA 1DPRA 2XGCA 2ZMEA 3TP3A 4ZDPA 3Q0WA 1MNMC 1MD0A 4AD9A 2PJRA 3H36A 1Y6IA 4OIPF 1W36D 5F04A 4BDYA 2HZDA 4GRIA 3PO3J 4XIDA 1C0WA 1LKXA 2QM3A 3KZIC 1IDZA 3SZTA 2JVGA 4AVZA 4IVNA 1GV2A 2EZLA 3V7SA 3JRHA 1JKOC 4BQQA 2P81A 2JPBA 4EGYA 2BW3B 1D5VA 4CCNA 1STZA 1P9QC 1OCRH 3A0HC 1VQNI 1YLFA 2ISYA 1B6AA 4DNCA 3CCQI 2BEOA 4OINF 4ZZDA 1ZRFA 3ABLH 2GXAA 4UXNA 3LSGA 1XGSA 4KT6A 1TNSA 4I01A 5HODA 4Y17A 3ZCOA 4A3CJ 2OJED 1UG0A 2A61A 2KHMA 3DWLE 4BS9A 5L3EA 2YX7A 2GA2A 3FBNB 2ADUA 4PK4A 4XLEA 2V1DA 4EGZA 3U21A 1X4PA 2FMLA 4KFCA 5DD4A 3WTUC 1ITYA 4A5NA 2XKPA 2K40A 3WTTC 4M3EA 3M8FA 4RGXA 5EYRA 3H9GA 4IZZA 3S8PA 5HLGA 3FDYA 2CWEA 3I58A 5K7ZA 2HDCA 3H3VK 4FX0A 1T08B 3H5AA 1P4AA 3HBLA 1LDJA 3G1MA 1NHAA 2E2JJ 5L3BA 2E34A 5E8IA 4CYDA 4AVPA 4Y4RA 3OYMA 5CQGA 1KGSA 4X6AJ 1X3UA 4DOZA 1JKRC 1X58A 2GOXB 1D8KA 3GFJA 1VQ6I 1QZEA 2L5QA 2DA1A 5JLWA 2R7RA 3BJAA 1D0ZA 4HZFA 4QSHA 3W2VA 1USSA 2CUZA 4RS8A 3GWZA 3I55I 3RKWA 4P9FA 4B4CA 2JA7J 2YUSA 3FMSA 3TOBA 5EEHA 2MC4A 1BM9A 1P92A 1FSEA 3BCBA 3E5XA 4G94A 4Y15A 4ZYDA 2Q0OA 2DA3A 3RZOJ 4DZPA 1ZG5A 4IHTA 4RDUA 3CTAA 1ULYA 3BQZA 2LMDA 2O3FA 5D4RA 2O9LA 2NVTJ 4ZDOA 2DTZA 3QP5A 5CVJA 1R7JA 2QGUA 1KU2A 5GAHJ 4M6VA 1KONA 2DA5A 3QOPA 1QHGA 3KYLA 4ZC3A 3ZQIA 1RI7A 1R22A 5IYDJ 3HOVJ 4A5MA 2K27A 4IRHA 3JRFA 3PJRA 1OCCH 1V5FA 3HOSA 4AU7A 1A5JA 4AIKA 3GTMJ 2M8GX 1Y0NA 3CESA 1WVRA 2E2IJ 1ZH5A 5CVUA 1I3AA 2Z16A 1B72A 5FLXZ 3CMEI 4IQ4A 3ZOBA 3JTHA 2NNYA 2GXBA 3CC4I 1MMDA 1YJNI 3B02A 2HNHA 3VOEA 3B6AA 3HOTA 1IN5A 2IGOA 3BJOA 4A3KJ 3O6BB 1JT6A 1R1UA 2A69F 2MA3A 4DYQA 2Y9YA 2ZJRF 2M30A 5KVRA 2R0QC 4HQEA 2EIMH 4JX5A 2LK2A 3I53A 3C18A 4U0WA 2A05A 1FLIA 1PP7U 3RJPA 3WHBA 3JRIA 3K0LA 4J19A 2ZSHB 1G4DA 3G1OA 1DQUA 5J40A 4IX7A 5J6XA 1B9NA 4B3XA 2JA2A 2JJ7A 4ZYGA 3Q5FA 2VN2A 3CCRI 3EUHA 3GLXA 1R58A 1W7PA 2KRCA 4M6XA 2HTSA 1ETXA 4R8HA 3I71A 4HYEA 4BYYA 2V79A 4DYCA 2JWTA 5GPCA 1TP4A 3KE2A 3A01A 3LL7A 1GXQA 2DMNA 2K86A 3W6KB 2ESNA 1IAWA 4PCQA 4UB6C 3JAMZ 2K85A 2NS8A 2B7EA 4CYCB 5IP6A 2EIJH 2IW5A 2ZFWA 2M4KA 3DU5A 2UV1A 3JRDA 3G3ZA 4Q4ZF 4HRIA 4MHGA 3Q9SA 2VLAA 3BG5A 1P2FA 3OOUA 1T8IA 1NTCA 4M9XA 2MABA 4XN3A 4A3MJ 3ML6A 4YFNF 3S16J 2K9NA 3S1MJ 3G6EI 1NG6A 2LLKA 3VDXA 2FEZA 4OAYA 5KHDA 3WG9A 2RN7A 3MKWB 4IPAA 1IN4A 4OOIA 1QRYA 2IXSA 1OYWA 2HOAA 4HA8A 5FFZA 2H8RA 2QF7A 2ZXHA 2DA7A 4F52A 4YEJA 3JAMK 3K70D 3HRSA 3RPUA 2CFXA 3KX2A 2K4JA 1MMAA 1Z3YA 4FETA 5FROA 3K4JA 4F93B 2W85A 1U5TC 3GLLA 3KZZA 1HSTA 3TP0A 3B73A 1BIAA 4C9YA 1J75A 1ERDA 4LIVA 3ZQGA 5GTIC 2HU9A 1P4WA 1P7JA 2KP6A 5LBQA 5EEGA 1LE8A 1BI0A 1OCOH 1MBGA 2KLOA 4O6JA 3BTLA 4FASD 4QTRA 5ICFA 1I27A 2F4MB 3J7AO 4KA4A 1JHFA
chains in the Genus database with same CATH topology
4G9YA 2E7WA 2GQQA 2P5KA 2PLYA 4R1HA 1OYYA 4G7OF 2P5LC 4RB0A 3TDZC 3COAC 1IRFA 3J80Z 1S3JA 1XSVA 1W7PD 2ZMEB 3IWZA 4KIFA 2HWVA 3I54A 1KYZA 1ZRDA 1KYWA 4EJWA 5HOOA 3WTYC 3HUGA 4UHTA 5DCMA 1TBXA 2VBZA 2H09A 2IJLA 4EMSA 4BNCA 3TO7A 4PGGA 3O3KA 2W84A 5F6FA 1YFHA 4B8XA 2IT0A 1BI2A 2A6HF 4ON0A 1U3EM 4KT5C 3GX4X 1PDNC 3P7NA 4G8XA 5BS6A 2K7LA 3N4MA 1XSDA 3E5QA 5CVRA 2DPUA 5JR3A 1S6LA 1ZREA 1J7KA 3NRVA 4YFXF 1TW3A 5DUIA 3RYPA 3CUQB 1EH8A 1XD7A 3VFZA 2KIUA 4LGWA 4UV8A 1J2XA 2Z9OA 4U0VA 3EQLF 4HF1A 2ETHA 2FMYA 1XMKA 2VC1A 2H6CA 4L0ZB 2H94A 1HSJA 2VOPA 2JZYA 4A2UA 4UNOA 3L7WA 2Z5UA 4ZH4F 5FB2A 3AAFA 3GUDA 2L02A 2DTRA 1K7AA 4RAZA 3RTRA 4M6YA 5D8KB 1RIOH 4B09A 1SAXA 3HRTA 2H6BA 1MDMA 2EFQA 1W5TA 3ZN1A 1YIOA 3LA7A 2WC2A 2FF4A 5DEQA 1W4MA 3K2ZA 3K69A 3CUQC 3KP4A 3QU6A 3Q9VA 2OBPA 2RV8A 3TKYA 2A07F 2NRAC 4YG2F 5L3CA 5HLHA 2PFBA 4M9SA 3CUQA 2RGVA 2DLLA 1R36A 1D3YA 3QPTA 3KP5A 2G7UA 5E1WA 2LSOA 5ICGA 2LNBA 5FD6A 3GZ6A 4XBFA 2BGCA 5FFXA 1ZLJA 4WF2A 3R60A 5IT3A 2HR3A 2BYVE 1HW1A 3NEUA 3V8LA 3GF2A 2MC3A 5CLSA 3V4GA 4KNYA 3U2RA 1J9IA 1L3LA 1SD7A 4BXUA 4ESBA 2GA1A 3FM5A 1IUYA 1Q1HA 2RVCA 4U7DA 1H9GA 4EM1A 1MJAA 1WKMA 3R61A 1ON1A 3RIRA 4U88A 1S29A 1TNTA 4IHSA 4M9ZA 4RB3C 1FSHA 4AIJA 1FZPB 4ENKA 2XUBA 3MFKA 2XAJA 2COMA 3OOPA 1QZZA 3IRRA 3J81Z 3FMRA 4G6QA 4CDGA 3F72A 5IT9Z 1WWXA 4CXFA 4NB5A 2JRTA 4LLLA 2PJPA 3LAJA 2QBYA 1VTNC 3TQNA 3BPXA 4WXDA 2ZNZA 1ZARA 1XDSA 1TQIA 2KKOA 3TO9A 3MAJA 2P4WA 3CJNA 1ZLKA 3GXOA 1ZRCA 2J5PA 1ZGJA 1FT9A 4Q47A 2YR2A 2D2WA 3CO6C 1KQ8A 4JQFA 2P7VB 2DU9A 3EDPA 3HHGA 1UHMA 4M71A 4OIOF 3C7JA 1I1GA 1MJ9A 1BBYA 1DPUA 4ZZLA 3VODA 1U5TA 3BROA 3OV8A 4IF4A 4Y13A 2YSRA 3CDHA 1LDKB 1ON2A 1KA8A 1JXSA 3LA3A 3FZVA 4HF0A 1LEBA 4XLNF 2NAZA 3L00A 4XLPF 2YX4A 5ERIA 2XRNA 5L3GA 4UUVA 3IC7A 4U0YA 4EVIA 3ZN0A 4GGGA 1OR7A 1IZ1A 4RGUA 2LF7A 1SD6A 5E1ZB 3W6JB 3D5LA 3FXUA 5E1XA 4OIRF 1MJBA 1R00A 5E8GA 5ILVA 2KRFA 2FQ3A 1QO0D 2CO5A 4KMUX 4AWXB 4CHUA 4EM0B 3EYYA 2EFWA 2PQ8A 1JHHA 2VT2A 3WTSC 1KU7A 4L5IA 1SD5A 5H6RA 2GZWA 2F5EA 3RDIA 1S7OA 2MBFA 3BWGA 3S2WA 4EJOA 4H0EA 4LG0A 2PG4A 2O61A 3GYHX 1J5YA 3HYIA 4HAMA 5DCMB 5H6QA 2W57A 2V6CA 1FWZA 1S8NA 5DD8A 5A2QZ 3BOQA 3BPVA 3V7RA 1G6NA 1DP7P 3K1NA 1FX7A 1QBJA 6PAXA 4EJVA 3DP7A 3K1PA 4A12A 1SFXA 3DPLC 2F2EA 2STTA 4O5VA 4G7HF 2Y48A 4PDKA 3G73A 3U9GA 3M1EA 1E17A 3KLNA 1ZG3A 3F8MA 1FYLA 3P9IA 5KK1A 5AONA 1F9NA 1H0MA 1O7LA 1Z9CA 1T6SA 2EFNA 3CLOA 1HKTA 5CYVA 2YPRA 4L18B 4XSXF 3KP7A 4L9TA 2K4BA 5D4SA 3E6BA 4P96A 2ZBKA 1OYIA 5K5OA 1B9MA 4MQVA 3C3WA 4A6EA 2M87A 2V1XA 3TOAA 3MCZA 3LQRA 3GVAA 4LB6B 1PP8F 4MNUA 1R5GA 2IRFG 3KETA 3SHFA 1IN6A 3ZMSA 3LQQA 4TV7A 2RKHA 2J5OA 4ESFA 2FBIA 5LHIA 2ACJA 1SFEA 2XAGA 4HOBA 5K1YA 2NNNA 1SD4A 1HW5A 3ECOA 1EH7A 4LLGF 3KCCA 3P9KA 3QU3A 2HYGD 3GEZA 3LAPA 2EK5A 3HRMA 3I0TA 1EH6A 5FO5A 4IRGA 2V1UA 1YW9A 4HBLA 2DFIA 1U2WA 1GVJA 2E1NA 2ZKZA 5E20A 4I09A 1B59A 1XGNA 2VBYA 3WTXC 1LQ1A 3IKTA 4A0ZA 2EV0A 2M1BA 3KEOA 1KQ9A 2AXLA 4NHJA 2KJCA 4XSZF 1JGSA 1K78B 4RGRA 4Q48A 3R0AA 2JSCA 3GO5A 2Z3YA 5HDGA 2Z33A 3FWEA 3WE3A 2DK8A 2HKXA 2Q8KA 2FSWA 4WCGA 3M9AA 5D5UB 2VE8A 1Z1DA 2L4MA 2DW4A 3VB2A 4ZYEA 4S05A 1Z91A 5FGMA 1KQ0A 5LGNA 5IT9K 3T0YA 2H27A 1IN8A 4KMFA 2Y75A 1ZAOA 4RB2C 4WXCA 2ESHA 1RUOA 4HLYA 4QWQA 5LEJA 3SQNA 1B4AA 2P5VA 4EM2A 2D1VA 4KYWA 2FNPA 1J59A 2F5DA 1GXPA 2GAUA 3E6CC 4HX8A 2VC0A 2L01A 1XGMA 4WXHA 5F1RA 4HDUA 1ONVA 4KUMA 5JI6A 3IL2A 4CZZA 2IA2A 4I0AA 2B0LA 2CG4A 4KN4X 2CYYA 1JE8A 3KLOA 2IVMA 2BV6A 2P6SA 4JK1X 3L2CA 3J80K 3BJ6A 4BQAA 5BPDA 2STWA 3F23A 2ZCWA 3FM3A 3HSFA 2X4HA 5JVTA 2A68F 1U5TB 2A3SA 3F8CA 5CJ9A 4L9VA 1IRGA 4MTEA 3DKWA 4BAYA 2G7HA 4JBAA 5AIQA 1P6RA 2LF8A 3ZQ7A 1R23A 4LFUA 1RUNA 2QZ8A 2YU3A 1S7AA 1XMAA 5L3DA 3QP6A 1O57A 4GYGA 3GFLA 3F8BA 3TGNA 2LKPA 1HBXG 1BC7C 1FC3A 4UV9A 5ICCA 4MTDA 2FU4A 2QQ9A 5ICEA 1OKRA 3WGIA 2MD5A 3H92A 2HS5A 4HX4A 1LNWA 4O3MA 5JHUA 1P4XA 4MEXF 2PMUA 4HV5A 5J8FA 1EV7A 1K6OA 3ZMTA 3ZPLA 3F22A 2HEOA 3WTZA 1ZYRF 4HW0A 3HTUA 2VOOA 1W5SA 3HSRA 3FF5A 2OZ6A 3QRFF 1Y0UA 2EWNA 4RAYA 5H20A 5HDKA 1YYVA 4OIQF 1YQAA 1XSXA 4KN7X 3ZMUA 3H3ZA 1QGPA 2R7FA 2L3DA 2RC4A 3F8FA 1FBUA 3KZYA 2OA4A 4ETSA 2QWWA 2F5FA 3SFZA 3K9TA 1T39A 3GZ5A 1QQIA 2IA0A 5LGTA 2X0LA 5LLQA 3E97A 3T1BA 5LHHA 3N97A 4ENMA 1FY7A 3WODF 3JTGA 4A0YA 4ASNA 2XAHA 4ESJA 1FP2A 2M8EA 1I6XA 4D0PA 2QQBA 3GFMA 5E18F 4EJUA 2XVCA 1G3TA 4FT8A 4KIBA 2FA5A 2Y0MA 4CGZA 3WU0A 4GCVA 3LFKA 1T98A 4EV0A 5LGUA 3JSPA 5HS9A 2M5WA 1H9TA 5BPIA 3HSEA 4AIHA 2VBXA 1KU9A 1FNNA 4IRIA 2DBBA 3V7CA 3WE2A 4R79A 4OMZA 2VONA 2L4AA 2EFOA 3L09A 5D5XB 3M7GA 4P55A 1BI3A 5DCFA 1TW2A 1FPQA 5AIPA 3BZ6A 1BJAA 1XCBA 1ZG1A 1RNLA 2QYOA 3WU1B 3DPTA 2WTEA 1V3FA 1BIBA 2EFPA 4FHTA 2OD5A 3DEUA 4HLXA 2OAZA 4UVAA 1IW7F 4L0YB 1YTYA 3ECHA 4L9JA 3MZHA 2KIFA 4I7HA 4CICA 3L9FA 4RGSA 1T0FA 3C1DA 4UVBA 2WV0A 1R1VA 4BH9A 1W7PB 3P9CA 4FX4A 3F3XA 4CO8A 4E70A 3QAHA 3ZMDA 1CF7A 3H3UA 4GO1A 4N0BA 2EV5A 2NYXA 4IJAA 5ILSA 5CVIA 4G7ZF 1UFMA 5TRDA 3CUOA 5D8LB 2VXZA 1U6GA 3MZYA 5CVVA 2W24A 1O3RA 2HTJA 3IHUA 1Z7UA 1GHCA 3TDUC 3EYIA 3BP8A 1MZBA 3M8EA 3CO7C 2DT5A 3IRQA 5DUKA 1R1TA 2QLZA 2ISZA 4PZJA 3WGHA 4RB1A 5F64A 2PN6A 1LEAA 3VEPA 2XASA 3V8KA 4WWCA 1F4KA 2JT1A 1HXDA 3DFGA 1OMIA 1XB4A 2UZKA 2E7XA 4I98B 3HRUA 3SXYA 1SMTA 2CQKA 2L54A 1B1BA 2VE9A 1K78A 4P9UA 1UCRA 2FE3A 1WSUA 1IXCA 1AWCA 1SMYF 1CF7B 1YG2A 5BOXA 3F21A 3GW2A 2OU2A 1A04A 4KDPA 5K5QA 4U7BA 3WGGA 1IXSB 2M45A 2A6EF 4M74A 4ZYHA 2C6YA 2PMHA 1BC8C 1YW8A 4MQ9F 3BY6A 2PI0A 4GYIA 3SZPA 1G3YA 2FNAA 2ELHA 2XKOA 3QPHA 1FYKA 4K2EA 2HKOA 2XAFA 2HOEA 2XHKA 5A2QK 4BHPA 2CW0F 1E2XA 1FBQA 4OU0A 1MKMA 1T2KA 3E6MA 3IKVA 4MGRA 2JPCA 2HGCA 1F5TA 5FD5A 1IXRC 4XRFA 1YS6A 2GWRA 2KJBA 1U78A 1ZHFA 4LB5A 2XROA 5L3FA 5E17F 1XGOA 1IN7A 1I5ZA 1TQPA 2PBIA 1KU3A 3ABTA 2ZO4A 4WK8F 1TTYA 2DQLA 4BHBA 4MEYF 2RDPA 5ILUA 2Z99A 1L0OC 4HF2A 4I02A 1XDUA 3I5UA 1LB2A 3DXJF 4LLNA 1TQMA 3JW4A 4HX7A 1K79A 1BI1A 3BDDA 3F6OA 3F6VA 2VT3A 2OQRA 1UB9A 1FYMA 2JTVA 1O7FA 3KP3A 1G3SA 4Z2YA 5DYMA 3ZMZA 3FXQA 1ZGAA 4G6DA 4ENNA 2EB7A 3ABUA 3HHHA 3E6DA 1OPCA 2A5YB 3LSTA 2DK5A 5D5VB 3J81K 1LDDA 1AOYA 2MLKA 3E5UA 5LEKA 4HDVA 3MQ0A 2ZXJA 4EQQA 4GXOA 2P6TA 1XN7A 2ZNYA 1D8JA 3PQJA 3REOA 3PFIA 4UVCA 4LD5A 2IA1A 1QZYA 1UHWA 5J8CA 3T8TA 2OZUA 3RYRA 2QBYB 4LK0F 3I64A 2FXAA 1YO5C 2FBHA 2O0YA 3HIFA 4I2OA 3ULQB 1WRJA 2UXXA 5HLIA 3ERED 1BOAA 1WQ2A 5HVQC 4WX9A 2XGXA 2O03A 3KP2A 1MDMB 2RNJA 2MH9A 1PUEE 1HQCA 3RPQA 4NQWA 1BN5A 2K02A 1FP1D 1O3QA 3I59B 2DPDA 2GXGA 3KEQA 3EETA 3O2PE 4LMYA 1I1SA 3DF8A 3MWMA 1DUXC 5D5WB 5LRRA 3D0SA 3ZP5A 2EV6A 2DQRA 2GIVA 2ZJ2A 2VODA 4I0BA 3JSOA 3WTVC 2EJRA 2QENA 5BQTA 2UWMA 1IF1A 5D6EA 3E3VA 4N9IA 4YIIA 3T5XA 3HTSB 2HFHA 3LA2A 4L9NA 3RKYA 1REPC 2HQRA 3RI4A 2CSOA 5D6FA 3F8NA 3ISPA 3R0JA 2EA2A 4L5JA 2E1CA 5DV5A 4LJZF 1Z6TA 2UXNA 2FOKA 5LHGA 3NQOA 4DQ2A 2R7DA 4YIFA 2O6GE 2IP2A 2QUFA 2R3SA 1HKSA 3U1DA 4KIGA 1F1ZA 2V9VA 2IPQX 1CGPA 3I59A 3KFWX 3R4KA 5DDGA 5BMZA 5HS7A 4HV6A 1T38A 2HYFA 1HW2A 2MH2A 4F7ZA 2FRHA 2TDXA 2XAQA 5FLXK 1Z6RA 3DV8A 1LVAA 2VBWA 3FXRA 2BBYA 3ZMVA 1O3SA 3TO6A 4BHCA 1RZ4A 2LDUA 4KICA 1DDNA 5K5RA 4N9HA 1MGTA 3T8RA 2OQGA 4QLCU 3LWFA 1WI9A 2QQAA 1YW7A 1R5HA 2NS0A 5JFRA 1YS7A 4HQMA 1SFUA 2W25A 2G9WA 2F5CA 1J0RA 4S04A 2QVOA 3MEXA 3FMQA 2P7CB 2FBKA 1QPMA 1Z05A 1G3WA 3I4PA 4IXAA 1USTA 2O8XA 2HZTA 4M72A 3WTWC 5HS8A 1XCVA 2RQPA 2CGPA 2D1HA 1HKQA 3ROUA 2HQNA 5ED4A 4YFKF 2DI3A 2WWYA 3FX3A 4A6DA 1O3TA 4LK1F 2BE5F 2EA4A 5HDNA 3V8JA 3R6SA 1U8RA 1FBSA 3GFIA 1LJ9A 2DO7A 4OMYA 4ENJA 3K1MA 2P8TA 2DAOA 1QNTA 5TJJA 5LRSA 1TLHB 1FOKA 4EJTA 3KP6A 2XIGA 3RKXA 2MLGA 1V4RA 4PGHA 4P5OA 4Q5SF 1ODDA 3IWFA 3DQVC 4M73A 1ZN2A 2Q2EA 3FHZA 3PQKA 4A0XA 2AS5F 2KIMA 2XV4S 2D45A 2PEXA 4LG0B 3ELKA 1DPRA 2ZMEA 1MD0A 4AD9A 4OIPF 1C0WA 2QM3A 3SZTA 4IVNA 3V7SA 2JPBA 4EGYA 1D5VA 1STZA 1YLFA 2ISYA 1B6AA 4DNCA 2BEOA 4OINF 4ZZDA 1ZRFA 4UXNA 1XGSA 1TNSA 4I01A 4Y17A 2A61A 5L3EA 2YX7A 2GA2A 2ADUA 2V1DA 4EGZA 2FMLA 4KFCA 5DD4A 3WTUC 4A5NA 2XKPA 3WTTC 3M8FA 4RGXA 5HLGA 3I58A 2CWEA 2HDCA 4FX0A 1P4AA 1LDJA 1NHAA 5L3BA 5E8IA 4CYDA 4AVPA 1KGSA 1X3UA 3GFJA 1D8KA 3BJAA 4HZFA 1USSA 4RS8A 3GWZA 3RKWA 4P9FA 3FMSA 3TOBA 5EEHA 1BM9A 1P92A 1FSEA 3E5XA 4G94A 4Y15A 4ZYDA 2Q0OA 1ZG5A 4IHTA 3CTAA 1ULYA 2O3FA 5D4RA 3QP5A 5CVJA 1R7JA 1KU2A 3QOPA 1RI7A 1R22A 4A5MA 2K27A 4IRHA 3HOSA 4AIKA 1ZH5A 5CVUA 5FLXZ 2GXBA 2NNYA 3JTHA 3B02A 3VOEA 3HOTA 1IN5A 3BJOA 3O6BB 2MA3A 1R1UA 2A69F 2M30A 5KVRA 4HQEA 3I53A 3C18A 4U0WA 1FLIA 1PP7U 3RJPA 3K0LA 1G4DA 5J6XA 1B9NA 4ZYGA 3Q5FA 2VN2A 3EUHA 3GLXA 1R58A 1W7PA 4M6XA 2HTSA 4R8HA 3I71A 4HYEA 4BYYA 2V79A 3KE2A 1GXQA 2K86A 3W6KB 2ESNA 1IAWA 4PCQA 3JAMZ 2ZFWA 2IW5A 3G3ZA 4Q4ZF 4MHGA 3Q9SA 1P2FA 4M9XA 3ML6A 4YFNF 2FEZA 3WG9A 2RN7A 4IPAA 1IN4A 4OOIA 1OYWA 4HA8A 5FFZA 3JAMK 3RPUA 3HRSA 2CFXA 2K4JA 2W85A 1U5TC 3KZZA 1HSTA 3B73A 1BIAA 1J75A 1P4WA 5LBQA 5EEGA 1BI0A 4O6JA 5ICFA 1I27A 3J7AO 4KA4A 1JHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9Y A;  2E7W A;  2GQQ A;  2P5K A;  2PLY A;  4R1H A;  1OYY A;  4G7O F;  2P5L C;  4RB0 A;  3TDZ C;  3COA C;  1IRF A;  3J80 Z;  1S3J A;  1XSV A;  1W7P D;  2ZME B;  3IWZ A;  4KIF A;  2HWV A;  3I54 A;  1KYZ A;  1ZRD A;  1KYW A;  4EJW A;  5HOO A;  3WTY C;  3HUG A;  4UHT A;  5DCM A;  1TBX A;  2VBZ A;  2H09 A;  2IJL A;  4EMS A;  4BNC A;  3TO7 A;  4PGG A;  3O3K A;  2W84 A;  5F6F A;  1YFH A;  4B8X A;  2IT0 A;  1BI2 A;  2A6H F;  4ON0 A;  1U3E M;  4KT5 C;  3GX4 X;  1PDN C;  3P7N A;  4G8X A;  5BS6 A;  2K7L A;  3N4M A;  1XSD A;  3E5Q A;  5CVR A;  2DPU A;  5JR3 A;  1S6L A;  1ZRE A;  1J7K A;  3NRV A;  4YFX F;  1TW3 A;  5DUI A;  3RYP A;  3CUQ B;  1EH8 A;  1XD7 A;  3VFZ A;  2KIU A;  4LGW A;  4UV8 A;  1J2X A;  2Z9O A;  4U0V A;  3EQL F;  4HF1 A;  2ETH A;  2FMY A;  1XMK A;  2VC1 A;  2H6C A;  4L0Z B;  2H94 A;  1HSJ A;  2VOP A;  2JZY A;  4A2U A;  4UNO A;  3L7W A;  2Z5U A;  4ZH4 F;  5FB2 A;  3AAF A;  3GUD A;  2L02 A;  2DTR A;  1K7A A;  4RAZ A;  3RTR A;  4M6Y A;  5D8K B;  1RIO H;  4B09 A;  1SAX A;  3HRT A;  2H6B A;  1MDM A;  2EFQ A;  1W5T A;  3ZN1 A;  1YIO A;  3LA7 A;  2WC2 A;  2FF4 A;  5DEQ A;  1W4M A;  3K2Z A;  3K69 A;  3CUQ C;  3KP4 A;  3QU6 A;  3Q9V A;  2OBP A;  2RV8 A;  3TKY A;  2A07 F;  2NRA C;  4YG2 F;  5L3C A;  5HLH A;  2PFB A;  4M9S A;  3CUQ A;  2RGV A;  2DLL A;  1R36 A;  1D3Y A;  3QPT A;  3KP5 A;  2G7U A;  5E1W A;  2LSO A;  5ICG A;  2LNB A;  5FD6 A;  3GZ6 A;  4XBF A;  2BGC A;  5FFX A;  1ZLJ A;  4WF2 A;  3R60 A;  5IT3 A;  2HR3 A;  2BYV E;  1HW1 A;  3NEU A;  3V8L A;  3GF2 A;  2MC3 A;  5CLS A;  3V4G A;  4KNY A;  3U2R A;  1J9I A;  1L3L A;  1SD7 A;  4BXU A;  4ESB A;  2GA1 A;  3FM5 A;  1IUY A;  1Q1H A;  2RVC A;  4U7D A;  1H9G A;  4EM1 A;  1MJA A;  1WKM A;  3R61 A;  1ON1 A;  3RIR A;  4U88 A;  1S29 A;  1TNT A;  4IHS A;  4M9Z A;  4RB3 C;  1FSH A;  4AIJ A;  1FZP B;  4ENK A;  2XUB A;  3MFK A;  2XAJ A;  2COM A;  3OOP A;  1QZZ A;  3IRR A;  3J81 Z;  3FMR A;  4G6Q A;  4CDG A;  3F72 A;  5IT9 Z;  1WWX A;  4CXF A;  4NB5 A;  2JRT A;  4LLL A;  2PJP A;  3LAJ A;  2QBY A;  1VTN C;  3TQN A;  3BPX A;  4WXD A;  2ZNZ A;  1ZAR A;  1XDS A;  1TQI A;  2KKO A;  3TO9 A;  3MAJ A;  2P4W A;  3CJN A;  1ZLK A;  3GXO A;  1ZRC A;  2J5P A;  1ZGJ A;  1FT9 A;  4Q47 A;  2YR2 A;  2D2W A;  3CO6 C;  1KQ8 A;  4JQF A;  2P7V B;  2DU9 A;  3EDP A;  3HHG A;  1UHM A;  4M71 A;  4OIO F;  3C7J A;  1I1G A;  1MJ9 A;  1BBY A;  1DPU A;  4ZZL A;  3VOD A;  1U5T A;  3BRO A;  3OV8 A;  4IF4 A;  4Y13 A;  2YSR A;  3CDH A;  1LDK B;  1ON2 A;  1KA8 A;  1JXS A;  3LA3 A;  3FZV A;  4HF0 A;  1LEB A;  4XLN F;  2NAZ A;  3L00 A;  4XLP F;  2YX4 A;  5ERI A;  2XRN A;  5L3G A;  4UUV A;  3IC7 A;  4U0Y A;  4EVI A;  3ZN0 A;  4GGG A;  1OR7 A;  1IZ1 A;  4RGU A;  2LF7 A;  1SD6 A;  5E1Z B;  3W6J B;  3D5L A;  3FXU A;  5E1X A;  4OIR F;  1MJB A;  1R00 A;  5E8G A;  5ILV A;  2KRF A;  2FQ3 A;  1QO0 D;  2CO5 A;  4KMU X;  4AWX B;  4CHU A;  4EM0 B;  3EYY A;  2EFW A;  2PQ8 A;  1JHH A;  2VT2 A;  3WTS C;  1KU7 A;  4L5I A;  1SD5 A;  5H6R A;  2GZW A;  2F5E A;  3RDI A;  1S7O A;  2MBF A;  3BWG A;  3S2W A;  4EJO A;  4H0E A;  4LG0 A;  2PG4 A;  2O61 A;  3GYH X;  1J5Y A;  3HYI A;  4HAM A;  5DCM B;  5H6Q A;  2W57 A;  2V6C A;  1FWZ A;  1S8N A;  5DD8 A;  5A2Q Z;  3BOQ A;  3BPV A;  3V7R A;  1G6N A;  1DP7 P;  3K1N A;  1FX7 A;  1QBJ A;  6PAX A;  4EJV A;  3DP7 A;  3K1P A;  4A12 A;  1SFX A;  3DPL C;  2F2E A;  2STT A;  4O5V A;  4G7H F;  2Y48 A;  4PDK A;  3G73 A;  3U9G A;  3M1E A;  1E17 A;  3KLN A;  1ZG3 A;  3F8M A;  1FYL A;  3P9I A;  5KK1 A;  5AON A;  1F9N A;  1H0M A;  1O7L A;  1Z9C A;  1T6S A;  2EFN A;  3CLO A;  1HKT A;  5CYV A;  2YPR A;  4L18 B;  4XSX F;  3KP7 A;  4L9T A;  2K4B A;  5D4S A;  3E6B A;  4P96 A;  2ZBK A;  1OYI A;  5K5O A;  1B9M A;  4MQV A;  3C3W A;  4A6E A;  2M87 A;  2V1X A;  3TOA A;  3MCZ A;  3LQR A;  3GVA A;  4LB6 B;  1PP8 F;  4MNU A;  1R5G A;  2IRF G;  3KET A;  3SHF A;  1IN6 A;  3ZMS A;  3LQQ A;  4TV7 A;  2RKH A;  2J5O A;  4ESF A;  2FBI A;  5LHI A;  2ACJ A;  1SFE A;  2XAG A;  4HOB A;  5K1Y A;  2NNN A;  1SD4 A;  1HW5 A;  3ECO A;  1EH7 A;  4LLG F;  3KCC A;  3P9K A;  3QU3 A;  2HYG D;  3GEZ A;  3LAP A;  2EK5 A;  3HRM A;  3I0T A;  1EH6 A;  5FO5 A;  4IRG A;  2V1U A;  1YW9 A;  4HBL A;  2DFI A;  1U2W A;  1GVJ A;  2E1N A;  2ZKZ A;  5E20 A;  4I09 A;  1B59 A;  1XGN A;  2VBY A;  3WTX C;  1LQ1 A;  3IKT A;  4A0Z A;  2EV0 A;  2M1B A;  3KEO A;  1KQ9 A;  2AXL A;  4NHJ A;  2KJC A;  4XSZ F;  1JGS A;  1K78 B;  4RGR A;  4Q48 A;  3R0A A;  2JSC A;  3GO5 A;  2Z3Y A;  5HDG A;  2Z33 A;  3FWE A;  3WE3 A;  2DK8 A;  2HKX A;  2Q8K A;  2FSW A;  4WCG A;  3M9A A;  5D5U B;  2VE8 A;  1Z1D A;  2L4M A;  2DW4 A;  3VB2 A;  4ZYE A;  4S05 A;  1Z91 A;  5FGM A;  1KQ0 A;  5LGN A;  5IT9 K;  3T0Y A;  2H27 A;  1IN8 A;  4KMF A;  2Y75 A;  1ZAO A;  4RB2 C;  4WXC A;  2ESH A;  1RUO A;  4HLY A;  4QWQ A;  5LEJ A;  3SQN A;  1B4A A;  2P5V A;  4EM2 A;  2D1V A;  4KYW A;  2FNP A;  1J59 A;  2F5D A;  1GXP A;  2GAU A;  3E6C C;  4HX8 A;  2VC0 A;  2L01 A;  1XGM A;  4WXH A;  5F1R A;  4HDU A;  1ONV A;  4KUM A;  5JI6 A;  3IL2 A;  4CZZ A;  2IA2 A;  4I0A A;  2B0L A;  2CG4 A;  4KN4 X;  2CYY A;  1JE8 A;  3KLO A;  2IVM A;  2BV6 A;  2P6S A;  4JK1 X;  3L2C A;  3J80 K;  3BJ6 A;  4BQA A;  5BPD A;  2STW A;  3F23 A;  2ZCW A;  3FM3 A;  3HSF A;  2X4H A;  5JVT A;  2A68 F;  1U5T B;  2A3S A;  3F8C A;  5CJ9 A;  4L9V A;  1IRG A;  4MTE A;  3DKW A;  4BAY A;  2G7H A;  4JBA A;  5AIQ A;  1P6R A;  2LF8 A;  3ZQ7 A;  1R23 A;  4LFU A;  1RUN A;  2QZ8 A;  2YU3 A;  1S7A A;  1XMA A;  5L3D A;  3QP6 A;  1O57 A;  4GYG A;  3GFL A;  3F8B A;  3TGN A;  2LKP A;  1HBX G;  1BC7 C;  1FC3 A;  4UV9 A;  5ICC A;  4MTD A;  2FU4 A;  2QQ9 A;  5ICE A;  1OKR A;  3WGI A;  2MD5 A;  3H92 A;  2HS5 A;  4HX4 A;  1LNW A;  4O3M A;  5JHU A;  1P4X A;  4MEX F;  2PMU A;  4HV5 A;  5J8F A;  1EV7 A;  1K6O A;  3ZMT A;  3ZPL A;  3F22 A;  2HEO A;  3WTZ A;  1ZYR F;  4HW0 A;  3HTU A;  2VOO A;  1W5S A;  3HSR A;  3FF5 A;  2OZ6 A;  3QRF F;  1Y0U A;  2EWN A;  4RAY A;  5H20 A;  5HDK A;  1YYV A;  4OIQ F;  1YQA A;  1XSX A;  4KN7 X;  3ZMU A;  3H3Z A;  1QGP A;  2R7F A;  2L3D A;  2RC4 A;  3F8F A;  1FBU A;  3KZY A;  2OA4 A;  4ETS A;  2QWW A;  2F5F A;  3SFZ A;  3K9T A;  1T39 A;  3GZ5 A;  1QQI A;  2IA0 A;  5LGT A;  2X0L A;  5LLQ A;  3E97 A;  3T1B A;  5LHH A;  3N97 A;  4ENM A;  1FY7 A;  3WOD F;  3JTG A;  4A0Y A;  4ASN A;  2XAH A;  4ESJ A;  1FP2 A;  2M8E A;  1I6X A;  4D0P A;  2QQB A;  3GFM A;  5E18 F;  4EJU A;  2XVC A;  1G3T A;  4FT8 A;  4KIB A;  2FA5 A;  2Y0M A;  4CGZ A;  3WU0 A;  4GCV A;  3LFK A;  1T98 A;  4EV0 A;  5LGU A;  3JSP A;  5HS9 A;  2M5W A;  1H9T A;  5BPI A;  3HSE A;  4AIH A;  2VBX A;  1KU9 A;  1FNN A;  4IRI A;  2DBB A;  3V7C A;  3WE2 A;  4R79 A;  4OMZ A;  2VON A;  2L4A A;  2EFO A;  3L09 A;  5D5X B;  3M7G A;  4P55 A;  1BI3 A;  5DCF A;  1TW2 A;  1FPQ A;  5AIP A;  3BZ6 A;  1BJA A;  1XCB A;  1ZG1 A;  1RNL A;  2QYO A;  3WU1 B;  3DPT A;  2WTE A;  1V3F A;  1BIB A;  2EFP A;  4FHT A;  2OD5 A;  3DEU A;  4HLX A;  2OAZ A;  4UVA A;  1IW7 F;  4L0Y B;  1YTY A;  3ECH A;  4L9J A;  3MZH A;  2KIF A;  4I7H A;  4CIC A;  3L9F A;  4RGS A;  1T0F A;  3C1D A;  4UVB A;  2WV0 A;  1R1V A;  4BH9 A;  1W7P B;  3P9C A;  4FX4 A;  3F3X A;  4CO8 A;  4E70 A;  3QAH A;  3ZMD A;  1CF7 A;  3H3U A;  4GO1 A;  4N0B A;  2EV5 A;  2NYX A;  4IJA A;  5ILS A;  5CVI A;  4G7Z F;  1UFM A;  5TRD A;  3CUO A;  5D8L B;  2VXZ A;  1U6G A;  3MZY A;  5CVV A;  2W24 A;  1O3R A;  2HTJ A;  3IHU A;  1Z7U A;  1GHC A;  3TDU C;  3EYI A;  3BP8 A;  1MZB A;  3M8E A;  3CO7 C;  2DT5 A;  3IRQ A;  5DUK A;  1R1T A;  2QLZ A;  2ISZ A;  4PZJ A;  3WGH A;  4RB1 A;  5F64 A;  2PN6 A;  1LEA A;  3VEP A;  2XAS A;  3V8K A;  4WWC A;  1F4K A;  2JT1 A;  1HXD A;  3DFG A;  1OMI A;  1XB4 A;  2UZK A;  2E7X A;  4I98 B;  3HRU A;  3SXY A;  1SMT A;  2CQK A;  2L54 A;  1B1B A;  2VE9 A;  1K78 A;  4P9U A;  1UCR A;  2FE3 A;  1WSU A;  1IXC A;  1AWC A;  1SMY F;  1CF7 B;  1YG2 A;  5BOX A;  3F21 A;  3GW2 A;  2OU2 A;  1A04 A;  4KDP A;  5K5Q A;  4U7B A;  3WGG A;  1IXS B;  2M45 A;  2A6E F;  4M74 A;  4ZYH A;  2C6Y A;  2PMH A;  1BC8 C;  1YW8 A;  4MQ9 F;  3BY6 A;  2PI0 A;  4GYI A;  3SZP A;  1G3Y A;  2FNA A;  2ELH A;  2XKO A;  3QPH A;  1FYK A;  4K2E A;  2HKO A;  2XAF A;  2HOE A;  2XHK A;  5A2Q K;  4BHP A;  2CW0 F;  1E2X A;  1FBQ A;  4OU0 A;  1MKM A;  1T2K A;  3E6M A;  3IKV A;  4MGR A;  2JPC A;  2HGC A;  1F5T A;  5FD5 A;  1IXR C;  4XRF A;  1YS6 A;  2GWR A;  2KJB A;  1U78 A;  1ZHF A;  4LB5 A;  2XRO A;  5L3F A;  5E17 F;  1XGO A;  1IN7 A;  1I5Z A;  1TQP A;  2PBI A;  1KU3 A;  3ABT A;  2ZO4 A;  4WK8 F;  1TTY A;  2DQL A;  4BHB A;  4MEY F;  2RDP A;  5ILU A;  2Z99 A;  1L0O C;  4HF2 A;  4I02 A;  1XDU A;  3I5U A;  1LB2 A;  3DXJ F;  4LLN A;  1TQM A;  3JW4 A;  4HX7 A;  1K79 A;  1BI1 A;  3BDD A;  3F6O A;  3F6V A;  2VT3 A;  2OQR A;  1UB9 A;  1FYM A;  2JTV A;  1O7F A;  3KP3 A;  1G3S A;  4Z2Y A;  5DYM A;  3ZMZ A;  3FXQ A;  1ZGA A;  4G6D A;  4ENN A;  2EB7 A;  3ABU A;  3HHH A;  3E6D A;  1OPC A;  2A5Y B;  3LST A;  2DK5 A;  5D5V B;  3J81 K;  1LDD A;  1AOY A;  2MLK A;  3E5U A;  5LEK A;  4HDV A;  3MQ0 A;  2ZXJ A;  4EQQ A;  4GXO A;  2P6T A;  1XN7 A;  2ZNY A;  1D8J A;  3PQJ A;  3REO A;  3PFI A;  4UVC A;  4LD5 A;  2IA1 A;  1QZY A;  1UHW A;  5J8C A;  3T8T A;  2OZU A;  3RYR A;  2QBY B;  4LK0 F;  3I64 A;  2FXA A;  1YO5 C;  2FBH A;  2O0Y A;  3HIF A;  4I2O A;  3ULQ B;  1WRJ A;  2UXX A;  5HLI A;  3ERE D;  1BOA A;  1WQ2 A;  5HVQ C;  4WX9 A;  2XGX A;  2O03 A;  3KP2 A;  1MDM B;  2RNJ A;  2MH9 A;  1PUE E;  1HQC A;  3RPQ A;  4NQW A;  1BN5 A;  2K02 A;  1FP1 D;  1O3Q A;  3I59 B;  2DPD A;  2GXG A;  3KEQ A;  3EET A;  3O2P E;  4LMY A;  1I1S A;  3DF8 A;  3MWM A;  1DUX C;  5D5W B;  5LRR A;  3D0S A;  3ZP5 A;  2EV6 A;  2DQR A;  2GIV A;  2ZJ2 A;  2VOD A;  4I0B A;  3JSO A;  3WTV C;  2EJR A;  2QEN A;  5BQT A;  2UWM A;  1IF1 A;  5D6E A;  3E3V A;  4N9I A;  4YII A;  3T5X A;  3HTS B;  2HFH A;  3LA2 A;  4L9N A;  3RKY A;  1REP C;  2HQR A;  3RI4 A;  2CSO A;  5D6F A;  3F8N A;  3ISP A;  3R0J A;  2EA2 A;  4L5J A;  2E1C A;  5DV5 A;  4LJZ F;  1Z6T A;  2UXN A;  2FOK A;  5LHG A;  3NQO A;  4DQ2 A;  2R7D A;  4YIF A;  2O6G E;  2IP2 A;  2QUF A;  2R3S A;  1HKS A;  3U1D A;  4KIG A;  1F1Z A;  2V9V A;  2IPQ X;  1CGP A;  3I59 A;  3KFW X;  3R4K A;  5DDG A;  5BMZ A;  5HS7 A;  4HV6 A;  1T38 A;  2HYF A;  1HW2 A;  2MH2 A;  4F7Z A;  2FRH A;  2TDX A;  2XAQ A;  5FLX K;  1Z6R A;  3DV8 A;  1LVA A;  2VBW A;  3FXR A;  2BBY A;  3ZMV A;  1O3S A;  3TO6 A;  4BHC A;  1RZ4 A;  2LDU A;  4KIC A;  1DDN A;  5K5R A;  4N9H A;  1MGT A;  3T8R A;  2OQG A;  4QLC U;  3LWF A;  1WI9 A;  2QQA A;  1YW7 A;  1R5H A;  2NS0 A;  5JFR A;  1YS7 A;  4HQM A;  1SFU A;  2W25 A;  2G9W A;  2F5C A;  1J0R A;  4S04 A;  2QVO A;  3MEX A;  3FMQ A;  2P7C B;  2FBK A;  1QPM A;  1Z05 A;  1G3W A;  3I4P A;  4IXA A;  1UST A;  2O8X A;  2HZT A;  4M72 A;  3WTW C;  5HS8 A;  1XCV A;  2RQP A;  2CGP A;  2D1H A;  1HKQ A;  3ROU A;  2HQN A;  5ED4 A;  4YFK F;  2DI3 A;  2WWY A;  3FX3 A;  4A6D A;  1O3T A;  4LK1 F;  2BE5 F;  2EA4 A;  5HDN A;  3V8J A;  3R6S A;  1U8R A;  1FBS A;  3GFI A;  1LJ9 A;  2DO7 A;  4OMY A;  4ENJ A;  3K1M A;  2P8T A;  2DAO A;  1QNT A;  5TJJ A;  5LRS A;  1TLH B;  1FOK A;  4EJT A;  3KP6 A;  2XIG A;  3RKX A;  2MLG A;  1V4R A;  4PGH A;  4P5O A;  4Q5S F;  1ODD A;  3IWF A;  3DQV C;  4M73 A;  1ZN2 A;  2Q2E A;  3FHZ A;  3PQK A;  4A0X A;  2AS5 F;  2KIM A;  2XV4 S;  2D45 A;  2PEX A;  4LG0 B;  3ELK A;  1DPR A;  2ZME A;  1MD0 A;  4AD9 A;  4OIP F;  1C0W A;  2QM3 A;  3SZT A;  4IVN A;  3V7S A;  2JPB A;  4EGY A;  1D5V A;  1STZ A;  1YLF A;  2ISY A;  1B6A A;  4DNC A;  2BEO A;  4OIN F;  4ZZD A;  1ZRF A;  4UXN A;  1XGS A;  1TNS A;  4I01 A;  4Y17 A;  2A61 A;  5L3E A;  2YX7 A;  2GA2 A;  2ADU A;  2V1D A;  4EGZ A;  2FML A;  4KFC A;  5DD4 A;  3WTU C;  4A5N A;  2XKP A;  3WTT C;  3M8F A;  4RGX A;  5HLG A;  3I58 A;  2CWE A;  2HDC A;  4FX0 A;  1P4A A;  1LDJ A;  1NHA A;  5L3B A;  5E8I A;  4CYD A;  4AVP A;  1KGS A;  1X3U A;  3GFJ A;  1D8K A;  3BJA A;  4HZF A;  1USS A;  4RS8 A;  3GWZ A;  3RKW A;  4P9F A;  3FMS A;  3TOB A;  5EEH A;  1BM9 A;  1P92 A;  1FSE A;  3E5X A;  4G94 A;  4Y15 A;  4ZYD A;  2Q0O A;  1ZG5 A;  4IHT A;  3CTA A;  1ULY A;  2O3F A;  5D4R A;  3QP5 A;  5CVJ A;  1R7J A;  1KU2 A;  3QOP A;  1RI7 A;  1R22 A;  4A5M A;  2K27 A;  4IRH A;  3HOS A;  4AIK A;  1ZH5 A;  5CVU A;  5FLX Z;  2GXB A;  2NNY A;  3JTH A;  3B02 A;  3VOE A;  3HOT A;  1IN5 A;  3BJO A;  3O6B B;  2MA3 A;  1R1U A;  2A69 F;  2M30 A;  5KVR A;  4HQE A;  3I53 A;  3C18 A;  4U0W A;  1FLI A;  1PP7 U;  3RJP A;  3K0L A;  1G4D A;  5J6X A;  1B9N A;  4ZYG A;  3Q5F A;  2VN2 A;  3EUH A;  3GLX A;  1R58 A;  1W7P A;  4M6X A;  2HTS A;  4R8H A;  3I71 A;  4HYE A;  4BYY A;  2V79 A;  3KE2 A;  1GXQ A;  2K86 A;  3W6K B;  2ESN A;  1IAW A;  4PCQ A;  3JAM Z;  2ZFW A;  2IW5 A;  3G3Z A;  4Q4Z F;  4MHG A;  3Q9S A;  1P2F A;  4M9X A;  3ML6 A;  4YFN F;  2FEZ A;  3WG9 A;  2RN7 A;  4IPA A;  1IN4 A;  4OOI A;  1OYW A;  4HA8 A;  5FFZ A;  3JAM K;  3RPU A;  3HRS A;  2CFX A;  2K4J A;  2W85 A;  1U5T C;  3KZZ A;  1HST A;  3B73 A;  1BIA A;  1J75 A;  1P4W A;  5LBQ A;  5EEG A;  1BI0 A;  4O6J A;  5ICF A;  1I27 A;  3J7A O;  4KA4 A;  1JHF A; 
#chains in the Genus database with same CATH topology
 1A31 A;  4IOA F;  4G9Y A;  4ZDL A;  2DDB A;  2RQQ A;  1MW7 A;  2E7W A;  2GQQ A;  2VI6 A;  2P5K A;  2PLY A;  4R1H A;  2XRL A;  1OYY A;  4G7O F;  2P5L C;  4RB0 A;  2HPM A;  5F08 A;  4N4N B;  2XF7 A;  3TDZ C;  4NC7 A;  3COA C;  1IRF A;  5IP7 J;  3J80 Z;  2HVQ A;  1S3J A;  4EEF G;  1XSV A;  2H1L A;  3BZC A;  1W7P D;  2ZME B;  3IWZ A;  4PJJ A;  4KIF A;  5EG0 B;  2HWV A;  3I54 A;  1KYZ A;  4LG3 A;  3ABK H;  5DM6 F;  1KYW A;  1ZRD A;  4EJW A;  5HOO A;  3WTY C;  3BTC A;  3HUG A;  4UHT A;  4RAG A;  5DCM A;  1TBX A;  2VBZ A;  1BW6 A;  5FLM J;  2H09 A;  4CCO A;  2IJL A;  4EMS A;  4HNT A;  1JKP C;  4BNC A;  4KIT B;  3K2A A;  3TO7 A;  4PGG A;  3O3K A;  2W84 A;  1SVM A;  1M1E B;  3ZQC A;  5F6F A;  1YFH A;  3L2V A;  1OLT A;  1H89 C;  4B8X A;  3BTI A;  3GCM A;  4XL9 A;  2DJI A;  1R6R A;  1Y8R B;  2IT0 A;  2F5V A;  1BI2 A;  2A6H F;  2XDV A;  4ON0 A;  1U3E M;  4KT5 C;  4QPQ A;  3GX4 X;  4CCJ A;  2X1C A;  2WY7 Q;  2DOF A;  1OCT C;  2CUE A;  4NC8 A;  1PDN C;  3P7N A;  4G8X A;  5IPA A;  5BS6 A;  3MKZ A;  2K7L A;  3N4M A;  3OL4 A;  3E5Q A;  1FMW A;  5CVR A;  1XSD A;  2MW8 A;  1WJD A;  2DPU A;  5JR3 A;  1S6L A;  1ZRE A;  1J7K A;  3NRV A;  4YFX F;  4XOR A;  1HDD C;  1TW3 A;  1PJR A;  3GTQ J;  4AC0 A;  5DUI A;  3RYP A;  4BY1 J;  2Z1D A;  3S2D J;  3CUQ B;  2AQE A;  4IKF A;  1EH8 A;  1XD7 A;  3QYE A;  3VFZ A;  2KIU A;  2M0M A;  2CH0 A;  4LGW A;  4UV8 A;  1DU0 A;  2X1E A;  3K4K A;  3LMM A;  1J2X A;  2WAD A;  4U0V A;  3JRG A;  2Z9O A;  3EQL F;  3EPZ A;  4HF1 A;  1RC9 A;  2ETH A;  2FMY A;  2KRH A;  1XMK A;  3PL8 A;  2KQR A;  1MSE C;  2VC1 A;  3BG9 A;  2Z2S B;  2H6C A;  1S9H A;  4L0Z B;  1EA3 A;  2H94 A;  1HSJ A;  3DPU A;  3V42 A;  3OYA A;  2VOP A;  2JZY A;  4HNU A;  3FXL A;  4A2U A;  4UNO A;  1Y8Q B;  3L7W A;  4XRS A;  3LFU A;  2DT7 B;  1LUJ B;  2Z5U A;  4ZH4 F;  5FB2 A;  5EZG A;  3AAF A;  3GUD A;  5IYC J;  2EIK H;  2L02 A;  1BJZ A;  1HCR A;  2DTR A;  3FKJ A;  1ETO A;  1K7A A;  3N05 A;  4RAZ A;  3RTR A;  4M6Y A;  5D8K B;  1RIO H;  4A3E J;  4B09 A;  1SAX A;  3HRT A;  1MBH A;  3MKY B;  2E71 A;  2H6B A;  2H8W A;  1MDM A;  2I8D A;  2EFQ A;  1W5T A;  3ZN1 A;  1YIO A;  1B8I B;  3LA7 A;  2WC2 A;  1LFU P;  2FF4 A;  2VAS A;  2EZK A;  3SFI A;  3HKZ N;  1W4M A;  5DEQ A;  1R4M B;  3K2Z A;  3K69 A;  3CUQ C;  5J3L A;  3IV5 A;  3KP4 A;  3QU6 A;  3Q9V A;  5J1U A;  2OBP A;  2RV8 A;  3TKY A;  2X6W A;  2ZSI B;  2A07 F;  2NRA C;  4YG2 F;  5L3C A;  2LBF A;  1PUF B;  5HLH A;  2K3F A;  2PFB A;  4M9S A;  5TGT A;  3ESW B;  3GTP J;  3IAS 2;  1Z7L A;  3CUQ A;  1GVD A;  2RGV A;  1MMG A;  2DLL A;  1R36 A;  3MN2 A;  1VQP I;  1D3Y A;  1IGN A;  1VQK I;  4Y7N J;  3QPT A;  1YJW I;  1NG7 A;  1RET A;  2XAU A;  3KP5 A;  2AO9 A;  2G7U A;  2HYJ A;  3W2A A;  5E1W A;  3LNQ A;  4A3L J;  2LSO A;  5ICG A;  2LNB A;  5FD6 A;  3GZ6 A;  5F0C A;  4XBF A;  2FOW A;  2COB A;  3A0B C;  2BGC A;  1BR1 A;  2BVM A;  5FFX A;  1ZLJ A;  4WF2 A;  3R60 A;  2XB0 X;  4RLF A;  4DW6 A;  2F4I A;  4HSR A;  1N77 A;  5IT3 A;  3PO2 J;  1ZK8 A;  2HR3 A;  2BYV E;  4BKX A;  1FIP A;  1HW1 A;  2NOG A;  3NEU A;  3SJM A;  1JTX A;  4YEL A;  3V8L A;  5F0H A;  3GF2 A;  2MC3 A;  4RLQ A;  1K4T A;  1WJ5 A;  5CLS A;  3NAU A;  2R7Z J;  3V4G A;  2NVU B;  1S72 I;  3GBG A;  4KNY A;  2DFE A;  3U2R A;  1J9I A;  1L3L A;  3CLQ A;  1SD7 A;  2E1O A;  4BXU A;  4ESB A;  2GA1 A;  3FM5 A;  1IUY A;  3CJT B;  2ECC A;  1Q1H A;  3C2H A;  2RVC A;  4U7D A;  4C3I J;  4HNV A;  3EUA A;  1H9G A;  4EM1 A;  3HPG A;  3WHC A;  1MJA A;  2EZH A;  2CQX A;  1WKM A;  2JUG A;  1N75 A;  3FK6 A;  3R61 A;  3DTI A;  1ON1 A;  2E36 A;  4U88 A;  3RIR A;  3HOY J;  1S29 A;  3BQY A;  1TNT A;  1YX3 A;  4IHS A;  2LYC A;  3FXK A;  4M9Z A;  4RB3 C;  1FSH A;  3HEF A;  4AIJ A;  1FZP B;  4D9J A;  4ENK A;  2XUB A;  3S2H J;  3I4N J;  3L2U A;  3MFK A;  4CSW A;  2XAJ A;  3S93 A;  4IHY A;  2COM A;  3OOP A;  1QZZ A;  3IRR A;  3VSK A;  3J81 Z;  3FMR A;  1VQL I;  4G6Q A;  3HOW J;  4A93 J;  2W48 A;  4CDG A;  3F72 A;  5IT9 Z;  1WWX A;  4CXF A;  4NB5 A;  3JRC A;  1QA6 A;  2DYR H;  1U0J A;  5B5E C;  2JRT A;  4LLL A;  4UB8 C;  3IH3 A;  3ZGK A;  1WJA A;  2PJP A;  1LVK A;  3LAJ A;  3JRB A;  3RCO A;  2QBY A;  2G0E A;  3QWL A;  1VTN C;  5JLX A;  3TQN A;  3BPX A;  4WXD A;  2ZNZ A;  1ZAR A;  1VF9 A;  2CQ7 A;  1DGW Y;  1XDS A;  2VQH A;  3K4M A;  1TQI A;  2E5Z A;  2KKO A;  3MAJ A;  3TO9 A;  2P4W A;  2F6C A;  3CJN A;  1ZLK A;  3GXO A;  2LRE A;  5TIS C;  1ZRC A;  2J5P A;  4ZYA A;  2JRM A;  3CZ6 A;  1ZGJ A;  3CC2 I;  3PNY A;  1Z0X A;  4PUS A;  2VQC A;  1QPI A;  4UUS A;  2Y69 H;  1FT9 A;  1JUS A;  4Q47 A;  5IOZ A;  5FKK A;  2YR2 A;  1W5C C;  2D2W A;  3CO6 C;  2E2H J;  1TWC J;  1XG1 A;  1H8A C;  1ZTR A;  4JQF A;  1KQ8 A;  2VKV A;  2P7V B;  2DU9 A;  2B63 J;  3EDP A;  3HHG A;  1YE9 A;  1Q1V A;  1UHM A;  4G12 A;  4M71 A;  5E3N A;  4OIO F;  3C7J A;  2MGQ A;  1VQM I;  1I1G A;  1MJ9 A;  1WPK A;  4DIQ A;  1BBY A;  4HPQ A;  1BOB A;  3KIO A;  2DFH A;  2LG4 A;  1DPU A;  4XLF A;  4ZZL A;  2LH9 A;  3VOD A;  4A3B J;  1SFO J;  1U5T A;  3BRO A;  3OV8 A;  4IO9 F;  2JVH A;  4IF4 A;  4Y13 A;  2YSR A;  3CDH A;  3TL4 X;  5DS9 A;  1LDK B;  1ON2 A;  1KA8 A;  2B9S A;  1JXS A;  1OR7 C;  3FZV A;  3LA3 A;  4BEH B;  4HF0 A;  1LEB A;  3E1S A;  2NAZ A;  3L00 A;  1PYV A;  4XLN F;  4XLP F;  2YX4 A;  5ERI A;  2XRN A;  5L3G A;  4UUV A;  3IC7 A;  4U0Y A;  4EVI A;  4GDF A;  2ECB A;  3ZN0 A;  3S3N A;  1BA5 A;  4GGG A;  5LD2 C;  2E60 A;  1OR7 A;  1IZ1 A;  2L2O A;  2O8K A;  3OSG A;  2M2E A;  1CQT A;  4RGU A;  2LF7 A;  1SD6 A;  2EZI A;  5E1Z B;  2BZT A;  5F1J A;  3W6J B;  2WAE A;  2XC7 A;  3D5L A;  4RBO A;  1G2H A;  4HEA 2;  3FXU A;  4QPO A;  5E1X A;  1TWG J;  4OIR F;  2R7Q A;  1MJB A;  1K4S A;  1R00 A;  3Q3S A;  1I3Q J;  1K83 J;  3DU6 A;  1HC8 A;  5E8G A;  3RZD J;  5ILV A;  2KRF A;  1OIS A;  5B66 C;  2BXY A;  4DJA A;  2FQ3 A;  1QO0 D;  2CO5 A;  2JQ7 A;  4KMU X;  4AWX B;  2DN0 A;  4CHU A;  2O7O A;  3EYY A;  4EM0 B;  2WAF A;  4NUB A;  2EFW A;  1VQO I;  2PQ8 A;  3MD2 A;  1JHH A;  2VT2 A;  3WTS C;  3PSI A;  1KU7 A;  1LFB A;  4L5I A;  1OFC X;  1SD5 A;  3BTJ A;  5H6R A;  2GZW A;  2F5E A;  3RDI A;  1S7O A;  2MBF A;  2PJR B;  4B48 A;  2M34 A;  3BWG A;  3S2W A;  4EJO A;  4C2U A;  2R7V A;  4H0E A;  1X2N A;  5FJ8 J;  1ZGW A;  4LG0 A;  2PG4 A;  5GTH C;  3CCJ I;  2O61 A;  1ETQ A;  3GYH X;  1J5Y A;  1OCP A;  1SVO A;  2XPW A;  3HYI A;  1IRZ A;  3K6G A;  4HAM A;  5DCM B;  5H6Q A;  2GIZ A;  4OWR B;  2V1N A;  2W57 A;  2V6C A;  3K10 A;  1FWZ A;  1S8N A;  2VB6 A;  3UR3 C;  4CA0 A;  3S1R J;  2CW8 A;  5DD8 A;  5A2Q Z;  2YU9 J;  3BOQ A;  3BPV A;  4LIT A;  3V7R A;  1G6N A;  3M1C A;  1DP7 P;  3ZQH A;  1B72 B;  3CD6 I;  2FUG 2;  3K1N A;  1FX7 A;  1K61 A;  3KYC B;  1QBJ A;  4UUT A;  2BXZ A;  6PAX A;  1E0E A;  3BLY A;  4EJV A;  3DP7 A;  1A35 A;  3K1P A;  4A12 A;  2EIL H;  4BY7 J;  2NS7 A;  1SFX A;  3DPL C;  3QQA A;  3UKG A;  1YIJ I;  2F2E A;  2STT A;  3G71 I;  2YS9 A;  4O5V A;  4G7H F;  2Y48 A;  1YRN B;  4PDK A;  3G73 A;  3S32 A;  3U9G A;  3M1E A;  1E17 A;  3KLN A;  3Q0U A;  1ZG3 A;  4FIS A;  3ZQQ A;  3F8M A;  1FYL A;  3ZQL A;  1Z77 A;  3P9I A;  3SEQ A;  3FBI B;  5KK1 A;  5AON A;  5FKL A;  1F9N A;  4BQO A;  1H0M A;  1O7L A;  1Z9C A;  4BJ6 C;  1T6S A;  2EFN A;  5J1R A;  2K3P A;  3CLO A;  2K5C A;  1HKT A;  4IHV A;  4D5C A;  4E7H A;  5CYV A;  3CJR B;  4JP0 A;  2YPR A;  3SDB A;  4L18 B;  3W3C A;  4XSX F;  3KP7 A;  5FKO A;  3H9Q A;  2RAE A;  4L9T A;  2K4B A;  5D4S A;  3E6B A;  4P96 A;  2ZBK A;  1OYI A;  5K5O A;  2ZFU A;  1B9M A;  4MQV A;  1R9T J;  3C3W A;  2L7Z A;  4A6E A;  3MVP A;  2M87 A;  2V1X A;  3JR9 A;  3TOA A;  2WAQ A;  3MCZ A;  4M3D A;  3LQR A;  2F4O B;  3GVA A;  4ZJZ A;  3L2W A;  4LB6 B;  1PP8 F;  5F0F A;  4MNU A;  1R5G A;  2IRF G;  3RPU D;  2K9Q A;  2W82 A;  4CCL A;  2VKD A;  3KET A;  3SHF A;  1IN6 A;  3VYR B;  2R7W A;  3ZMS A;  2ME6 A;  4BL0 B;  2K9S A;  3LQQ A;  5M3F J;  1X1D A;  4TV7 A;  2RKH A;  2J5O A;  1AA7 A;  4ESF A;  2FBI A;  5LHI A;  2O5R A;  2ACJ A;  1SFE A;  3HC7 A;  2XAG A;  4HOB A;  5K1Y A;  1WHU A;  2NNN A;  4P1W A;  1SD4 A;  1VQ8 I;  3GTL J;  1HW5 A;  1RR7 A;  3ECO A;  1EH7 A;  4LLG F;  1YX5 A;  2W1O A;  4NNJ A;  2GLO A;  3KCC A;  3P9K A;  3OS2 A;  1X1C A;  3QU3 A;  2HYG D;  3GEZ A;  3LAP A;  3CF5 F;  3A02 A;  1JUM A;  2EK5 A;  3HRM A;  3FXM A;  4XON A;  3I0T A;  2LBF B;  1EH6 A;  3LSM A;  5FO5 A;  4IRG A;  2V1U A;  1YW9 A;  4HBL A;  2PMZ N;  2Y30 A;  2DFI A;  1UHS A;  1U2W A;  1IO2 A;  1GVJ A;  2E1N A;  2ZKZ A;  4CCM A;  5KNL A;  3DBH B;  3DLA A;  5E20 A;  1T0F C;  4I09 A;  3BR0 A;  2XSD C;  1B59 A;  2BOL A;  1XGN A;  1G8X A;  2X1D A;  2VBY A;  3FXJ A;  3WTX C;  2V9P A;  2NOJ B;  4YRV A;  1LQ1 A;  3IKT A;  4A0Z A;  2EV0 A;  2M1B A;  2V7F A;  5HNH A;  3KEO A;  1KQ9 A;  2AXL A;  4NHJ A;  2KJC A;  4XSZ F;  1JGS A;  1RKT A;  3JRE A;  1K78 B;  4RGR A;  3FIW A;  4D7M A;  2LD5 A;  3BCA A;  2KPM A;  4Q48 A;  3FIS A;  2JSC A;  2ZME C;  3GO5 A;  3R0A A;  2Z3Y A;  5HDG A;  3H5R A;  2Z33 A;  3FWE A;  2ELJ A;  3WE3 A;  2DK8 A;  2HKX A;  2X85 A;  2Q8K A;  2FSW A;  3ZRG A;  5IY5 H;  4WCG A;  2L7M P;  3M9A A;  4KJZ A;  2AHQ A;  5D5U B;  2VE8 A;  2R7T A;  1Z1D A;  1O4X A;  2M3A A;  2L4M A;  2DW4 A;  3VB2 A;  4ZYE A;  4S05 A;  1Z91 A;  5FGM A;  1KQ0 A;  3AG3 H;  5LGN A;  5IT9 K;  2DOE A;  3T0Y A;  2H27 A;  3LOC A;  4XM3 A;  1IN8 A;  3M4O J;  4KMF A;  2R5Y A;  2DFF A;  1EKE A;  5E3O A;  1VI0 A;  3OIP A;  2Y75 A;  2W7N A;  3CC7 I;  1VND A;  3HPH A;  2DOA A;  2Y9Z A;  4V19 K;  1ZAO A;  2AQF A;  2F48 A;  4RB2 C;  2VPL A;  4WXC A;  4DBR A;  3JRA A;  3BR5 A;  2ESH A;  1RUO A;  3OYL A;  2MG4 A;  1VZ0 A;  4BBR J;  4HLY A;  4QWQ A;  1WZ2 A;  2LP0 A;  5LEJ A;  1WCM J;  3SQN A;  1WJE A;  1B4A A;  5EGO B;  4PSX A;  3IAM 2;  1YJ9 I;  2JA6 J;  2X48 A;  2P5V A;  2WY8 Q;  4EM2 A;  1E3H A;  2D1V A;  4KYW A;  2FNP A;  5E3L A;  2I10 A;  1J59 A;  2F5D A;  1GXP A;  1TZL A;  2GAU A;  3E6C C;  2MSY A;  3DCF A;  4HX8 A;  2KIQ A;  2VC0 A;  2L01 A;  5B1A H;  2V6E A;  2NXN B;  1XGM A;  4NDL A;  3IH2 A;  3OS1 A;  4WXH A;  3VWB A;  2ME0 A;  5F1R A;  4HDU A;  1ONV A;  4LOC A;  1AHD P;  2GBY A;  3OYE A;  2L9R A;  2QA4 I;  2KZV A;  2X6O A;  4KUM A;  2NVQ J;  5JI6 A;  3IL2 A;  2FQ4 A;  4CZZ A;  2IA2 A;  4I0A A;  5FRM A;  2B0L A;  4JOM A;  4ITV A;  1R5I D;  4U87 A;  2Y0S N;  1PUF A;  2QEX I;  1HOM A;  1F43 A;  2CG4 A;  4KN4 X;  3O8H A;  2CYY A;  2KL4 A;  3NAR A;  3BR6 A;  2IS1 A;  2K9M A;  5KAI C;  2QSF X;  2DMU A;  3KLO A;  2ZJP F;  1JE8 A;  2KT0 A;  2IVM A;  2BV6 A;  3TMO A;  2P6S A;  4JK1 X;  3L2C A;  3J80 K;  4A3J J;  1K6Y A;  3BJ6 A;  4BQA A;  5BPD A;  2STW A;  3F23 A;  2ZCW A;  3MKL A;  4IL6 C;  3FM3 A;  3HSF A;  4CZC A;  2X4H A;  4A3I J;  2LOO A;  3JCU C;  5JVT A;  2A68 F;  1U5T B;  2A3S A;  1TWA J;  2LVS A;  4G6T B;  3F8C A;  3KYD B;  5CJ9 A;  4F92 B;  2CQQ A;  2LRD A;  4L9V A;  1HLV A;  2A6T A;  1IRG A;  2MYS A;  4MTE A;  3DKW A;  4BAY A;  2G7H A;  3CCU I;  4JBA A;  3K4C A;  5AIQ A;  1P6R A;  2LF8 A;  3ZQ7 A;  3OIQ A;  5CQE A;  1R23 A;  4LFU A;  1RUN A;  2QZ8 A;  2YU3 A;  1S7A A;  1XMA A;  5L3D A;  2XF6 A;  2L7F P;  3QP6 A;  1O57 A;  4PJ0 C;  1PVE A;  2FX0 A;  4AM3 A;  4GYG A;  4BBS J;  3GFL A;  3F8B A;  3TGN A;  2LKP A;  5FKM A;  2UUZ A;  1HBX G;  1DGR M;  3HGY A;  4C3J J;  1BC7 C;  1FC3 A;  2EPF A;  4UV9 A;  1XMX A;  3UNG C;  5ICC A;  1IG7 A;  2E19 A;  2OCE A;  3RSN A;  4MTD A;  2FU4 A;  4DZJ A;  1WFX A;  1WGX A;  2QQ9 A;  1S7E A;  1ETV A;  1IJW C;  2JA8 J;  2KIS A;  1UEL B;  3CDI A;  1OKR A;  5ICE A;  3HKZ A;  3WGI A;  2MD5 A;  1FOY A;  2CFO A;  3H92 A;  1FMV A;  3LSK A;  2HS5 A;  4HX4 A;  5H2F C;  1LNW A;  3MMY B;  4O3M A;  5JHU A;  1P4X A;  2XGE A;  5J1Y A;  4MEX F;  2PMU A;  4II3 A;  5M5Y J;  4HV5 A;  4A3F J;  2HDD A;  5J8F A;  2M4G A;  4BE1 A;  1EV7 A;  1H88 C;  1K6O A;  3ZMT A;  3ZPL A;  1NK3 P;  5M5X J;  3S1N J;  3F22 A;  2HEO A;  3CQZ J;  1MBF A;  4C2M J;  3Q0V A;  4EAT A;  3WTZ A;  1ZYR F;  4HW0 A;  3HTU A;  2VOO A;  1IC8 A;  5IYB J;  1RPW A;  1W5S A;  3HSR A;  3FF5 A;  1ZR4 A;  3DKX A;  5C4J J;  2OZ6 A;  4XLA A;  1ETY A;  3OYD A;  3LSI A;  3QRF F;  1Y0U A;  2EWN A;  4RAY A;  4RA2 A;  3BG3 A;  5H20 A;  5HDK A;  1YYV A;  2IGN A;  1J09 A;  4OIQ F;  1YQA A;  1XSX A;  2QKM B;  4KN7 X;  1MBJ A;  3ZMU A;  1D1B A;  2BY3 A;  3H3Z A;  1WH5 A;  1QGP A;  2R7F A;  2R5Z B;  2L3D A;  1ETW A;  2RC4 A;  3F8F A;  1FBU A;  2R7X A;  3KZY A;  4HST A;  3H0G J;  3S14 J;  2OA4 A;  4PJN A;  4ETS A;  5GPA A;  3DKY A;  3OYG A;  1HDP A;  2QWW A;  3CJQ B;  2CS3 A;  1WJB A;  2KDO A;  2F5F A;  1JTY A;  2EQR A;  3K9T A;  3HB9 A;  3SFZ A;  4XRM A;  2VUM J;  1T39 A;  2HDW A;  3D5R C;  3GZ5 A;  3IP4 B;  3M8J A;  1QQI A;  1QU3 A;  1T33 A;  2IA0 A;  1A36 A;  5LGT A;  4E4H A;  2I5U A;  2X0L A;  4BXX J;  3MZ8 A;  5LLQ A;  3CMY A;  4XRS G;  2HVS A;  3E97 A;  3BR3 A;  3HJE A;  3T1B A;  1HA8 A;  1MMS A;  4S0H B;  3NWS A;  4E7J A;  5LHH A;  3N97 A;  4ENM A;  3AFH A;  1V5E A;  3HUG B;  1MNE A;  1FY7 A;  3WOD F;  2R7S A;  3JTG A;  2KMU A;  2DXI A;  4A0Y A;  2DOD A;  2IGM A;  4ASN A;  2XAH A;  3WG7 H;  4NQW B;  1FOW A;  2DMQ A;  3OYF A;  3HGG A;  1FP2 A;  4ESJ A;  2M8E A;  5EF6 A;  1X4O A;  2BVL A;  1I6X A;  3O8G A;  3J7Y J;  2WV1 A;  1JUP A;  4D0P A;  1BR4 A;  2QQB A;  4XK4 A;  3GFM A;  4EJU A;  5E18 F;  2VQL A;  2XVC A;  3VYT B;  2OTL I;  1G3T A;  2E1M C;  4FT8 A;  1I39 A;  4F3Q A;  4KIB A;  3PUF A;  2L0K A;  3H9J A;  4DGW B;  3C2B A;  3QPS A;  1SEU A;  2FA5 A;  2Y0M A;  4XNF A;  4CGZ A;  1FJL A;  1Z21 A;  3DEW A;  1KZH A;  3WU0 A;  5E3M A;  4GCV A;  3LSP A;  4L5E A;  1Y1V J;  4PJL A;  3LFK A;  1T98 A;  3LSR A;  1POG A;  4EV0 A;  5LGU A;  5IOY A;  4XOT A;  3JSP A;  2OCC H;  5HS9 A;  3HOU J;  4CH7 A;  2M5W A;  4BDZ A;  1H9T A;  2QCO A;  2HXO A;  4V2F A;  5BPI A;  1A6Q A;  3HSE A;  1QVT A;  2WA0 A;  2HI3 A;  4AIH A;  5DTD A;  5GAE J;  1W0T A;  2VBX A;  2DJN A;  1KU9 A;  1FNN A;  4IRI A;  1SFK A;  2DBB A;  3V7C A;  3WE2 A;  4R79 A;  4OMZ A;  2VON A;  2L4A A;  2EFO A;  1EJ9 A;  3L09 A;  5D5X B;  3HDD A;  3M7G A;  4P55 A;  1BI3 A;  5EDN A;  4ZTJ A;  1JJ8 C;  3RQ4 A;  3OS0 A;  5DCF A;  4BE0 A;  1TW2 A;  1FPQ A;  5AIP A;  3BZ6 A;  1BJA A;  1XCB A;  4B47 A;  1ZG1 A;  1RNL A;  2QYO A;  2VJI A;  3DPT A;  2WTE A;  3WU1 B;  4XQF A;  5M3M J;  1V3F A;  1BIB A;  3LSH A;  2EFP A;  3AKZ A;  3CMM A;  3PUB A;  1Z67 A;  3OR1 C;  4FHT A;  2OD5 A;  1EF4 A;  3DEU A;  4HLX A;  2OAZ A;  4UVA A;  2MD0 A;  1IW7 F;  2HPI A;  4L0Y B;  4XKW A;  1YTY A;  3ECH A;  3ERM A;  4XR6 A;  2XPV A;  3AL0 C;  1ZQ3 P;  1IUF A;  4L9J A;  3MZH A;  4D5F A;  3OY9 A;  1Y56 A;  2KIF A;  4I7H A;  4CIC A;  3L9F A;  2WBM A;  4RGS A;  1T0F A;  2VKE A;  1RR8 C;  3IH4 A;  3C1D A;  1R49 A;  3F0C A;  2CQN A;  4UVB A;  3W6V A;  3KPH A;  2WV0 A;  1SAU A;  2IEK A;  4BU2 A;  1R1V A;  4GFB A;  3A03 A;  4BH9 A;  2Y0S A;  1SAN A;  4Y52 J;  4AID A;  1XS9 A;  3VYU B;  1W7P B;  3P9C A;  4FX4 A;  3F3X A;  2ZXW H;  4CO8 A;  4E70 A;  3HOZ J;  4FE4 A;  3QAH A;  3ZMD A;  1CF7 A;  1UJ8 A;  3H3U A;  4GO1 A;  4M3B A;  3D5S C;  2WB1 A;  4N0B A;  2EV5 A;  2NYX A;  4IJA A;  4X0G A;  1E3O C;  5ILS A;  3CP2 A;  3PSF A;  4NC6 A;  5CVI A;  4G7Z F;  1UFM A;  3AG2 H;  5TRD A;  5K7H A;  3CUO A;  3OMY A;  4E7L A;  5D8L B;  2VXZ A;  4QIW N;  1U6G A;  3MZY A;  5CVV A;  1WI3 A;  3CMA I;  2W24 A;  4Z6Y A;  2JA5 J;  2R7O A;  5EGO A;  1O3R A;  2HTJ A;  2HVR A;  3VPR A;  3IHU A;  1Z7U A;  4RMN A;  3K70 C;  1GHC A;  2E1M B;  3TDU C;  1ENH A;  1SC7 A;  3EYI A;  3BP8 A;  3TW7 A;  2R92 J;  2X51 A;  1W1W E;  1TWF J;  2LKS A;  3CP8 A;  3EUK L;  4RM3 A;  1MZB A;  2D5V A;  3S15 J;  3H0D A;  3M8E A;  1UZC A;  3K4B A;  3CO7 C;  2DT5 A;  1AKH A;  3OIO A;  4YIR X;  2L7K A;  1ZKG A;  2KFD A;  3IRQ A;  5DUK A;  4MIM A;  3I4M J;  1R1T A;  2CUF A;  1S5L C;  2QLZ A;  2ISZ A;  4PZJ A;  3WGH A;  4RB1 A;  2KDZ A;  3QPL A;  1BL0 A;  5F64 A;  3OYI A;  1MSF C;  2IS6 A;  4IEJ A;  4F55 A;  2PN6 A;  1LEA A;  4E6K G;  3RQI A;  3CCL I;  5E79 C;  3VEP A;  2XAS A;  1D0X A;  3V8K A;  4KIS A;  5FRN A;  4XIC A;  2TCT A;  4WWC A;  1F4K A;  3DFG A;  1HXD A;  2JT1 A;  4A69 C;  2LTP A;  1FTT A;  3OYN A;  1OMI A;  1U8B A;  1XB4 A;  2X6Y A;  1ETK A;  2UZK A;  2VJ5 A;  1AU7 A;  4XLC A;  2E7X A;  5DM7 F;  4I98 B;  3LSJ A;  3HRU A;  3SXY A;  1SMT A;  2CQK A;  2L54 A;  1B1B A;  4F91 B;  2VE9 A;  2DMT A;  2DMP A;  1QVU A;  2L9V A;  4J01 A;  1K78 A;  2QKL B;  3PIP F;  9ANT A;  3PFY A;  2V4J C;  4P9U A;  5LFA A;  1GV5 A;  1UCR A;  4D1Q A;  1VQ4 I;  1V54 H;  2FE3 A;  1WSU A;  2VXD A;  1IXC A;  2HOT A;  4BQN A;  3U1K A;  1I50 J;  3B6C A;  1UG2 A;  1AWC A;  2VJ4 A;  1SMY F;  4C3H J;  1Y1W J;  2H1K A;  3BT9 A;  1CF7 B;  2DA6 A;  1YG2 A;  5HLT A;  4BUP A;  4XOP A;  5BOX A;  3F21 A;  3K4L A;  1LE8 B;  3GW2 A;  3PNV A;  2OU2 A;  4AYB N;  1FEX A;  1A04 A;  4KDP A;  5K5Q A;  1OJL A;  4U7B A;  3WGG A;  1IXS B;  2R93 J;  4E7Z A;  3AL0 B;  3WU2 C;  4DYR A;  2M45 A;  2A6E F;  4M74 A;  4BGD A;  3FHN A;  4ZYH A;  2CV0 A;  2VJJ A;  1ACI A;  3ONQ A;  2C6Y A;  2PMH A;  3ABM H;  5BNG A;  1V55 H;  4X1E A;  2DA4 A;  2GM4 A;  4I99 C;  1BC8 C;  5CKT A;  1GDT A;  4CYC A;  1JKQ C;  3CCS I;  1YW8 A;  4MQ9 F;  4IQJ A;  1APL C;  1R71 A;  3BY6 A;  2PI0 A;  3VSL A;  3PM1 A;  4GYI A;  3SZP A;  2HXI A;  1G3Y A;  2FNA A;  3BG6 A;  3PIO F;  4XKB A;  1R4N B;  4JX6 A;  2ELH A;  3DTE A;  2DT6 A;  3QYB A;  2XKO A;  3QPH A;  2M7A A;  1FYK A;  4FTH A;  4K2E A;  2HKO A;  2XAF A;  3HM5 A;  5CPR B;  3TW6 A;  2HOE A;  2XHK A;  5A2Q K;  1MBE A;  4BHP A;  3NWT A;  1VQ7 I;  2CW0 F;  3A4C A;  1E2X A;  3QYF A;  4MFD A;  3CCV I;  1FBQ A;  1Y39 A;  4OU0 A;  1MKM A;  1T2K A;  2KZG A;  5FKN A;  2W4S A;  4PFP A;  3E6M A;  3IKV A;  4MGR A;  3F9K A;  2JPC A;  1D0Y A;  2HGC A;  3FK7 A;  1F5T A;  5FD5 A;  1IXR C;  4XRF A;  3G4S I;  1YS6 A;  2BW3 A;  2GWR A;  1NH3 A;  1GUU A;  2KJB A;  1FIA A;  2L9N A;  1IRX A;  2QSG X;  1GT0 C;  4JX4 A;  1U78 A;  1ZHF A;  1X2M A;  4LB5 A;  1DU6 A;  3HG9 A;  1WJC A;  2XRO A;  3QOE A;  2L9S A;  1MH3 A;  2Y2Z A;  4D7N A;  5L3F A;  1JT0 A;  5E17 F;  3A1Y A;  1XGO A;  1IN7 A;  1W36 C;  2N8G A;  1I5Z A;  1TQP A;  3OYB A;  2PBI A;  2JK3 A;  4I76 A;  3DTK A;  2GOM A;  3HL2 A;  1F36 A;  1KU3 A;  3ABT A;  2ZO4 A;  1TWH J;  4WK8 F;  3C2G A;  1TTY A;  1NK2 P;  2DQL A;  4BHB A;  4MEY F;  2RDP A;  4ABZ A;  5ILU A;  2Z99 A;  1L0O C;  4HF2 A;  4BAC A;  4I02 A;  4H4K C;  1XDU A;  3BZK A;  3I5U A;  4NBQ A;  1LB2 A;  1TC3 C;  3DXJ F;  4IHW A;  4LLN A;  3FXO A;  1TQM A;  2WAQ N;  3JW4 A;  2M9H A;  4HX7 A;  1K79 A;  1BI1 A;  3BDD A;  3M3Y J;  3F6O A;  1ORK A;  4MLO A;  3F6V A;  2VT3 A;  2OQR A;  1UB9 A;  1FYM A;  2JTV A;  1O7F A;  3CCY A;  3KP3 A;  1XPX A;  3AG4 H;  1G3S A;  5IP9 J;  1TL8 A;  4Z2Y A;  4MFE A;  5DYM A;  2CUJ A;  1W0U A;  3ZMZ A;  3FXQ A;  1ZGA A;  4G6D A;  4ENN A;  3VYS B;  4BEH A;  2W00 A;  2LY9 A;  1YHQ I;  2EB7 A;  2CU7 A;  3ABU A;  3HHH A;  3OWT A;  3E6D A;  1TT0 A;  2PX9 A;  1X3Z B;  2LFB A;  4FQG A;  2ZC2 A;  2R5Z A;  3S17 J;  2LY2 A;  2CRG A;  1U9O A;  1OPC A;  2FJ1 A;  3DBL B;  1V5G A;  2A5Y B;  2VIX A;  3LST A;  2DK5 A;  5D5V B;  5KCM A;  3J81 K;  1LDD A;  1AOY A;  2MLK A;  3I56 I;  3E5U A;  2ELK A;  3P5J A;  5LEK A;  1YOV B;  3MQ0 A;  4XKC A;  4HDV A;  2ZXJ A;  2OTJ I;  1RES A;  5F27 A;  5EZH A;  4B1R A;  4RM2 A;  4B43 A;  4CCK A;  4EQQ A;  5C3E J;  4GXO A;  2P6T A;  4XLH A;  1XN7 A;  3L2R A;  2ZNY A;  1D8J A;  1QHH D;  3PQJ A;  3REO A;  3PFI A;  1X1P A;  2XB5 A;  4UVC A;  3OYJ A;  2ID6 A;  4M3F A;  3G1L A;  4LD5 A;  2IA1 A;  4ANJ A;  1QZY A;  2EIN H;  3IUO A;  1UHW A;  2CMP A;  1A6I A;  5J8C A;  3T8T A;  1JGG A;  1T56 A;  2OZU A;  3J7A Y;  4JYK A;  3RYR A;  2QBY B;  1OCZ H;  4LK0 F;  3I64 A;  4RAF A;  2FXA A;  1YO5 C;  2FBH A;  1MH4 A;  1X19 A;  2HQA A;  4A3G J;  2O0Y A;  3HIF A;  4I2O A;  2E35 A;  1D1C A;  1ZEL A;  3ULQ B;  3H5N A;  3OR2 C;  4IOC F;  1WRJ A;  2UXX A;  2LR8 A;  5HLI A;  3QOD A;  4DBQ A;  3ERE D;  1BOA A;  1WQ2 A;  5HVQ C;  4WX9 A;  1YRN A;  2MFZ A;  1VFC A;  4HG2 A;  2XGX A;  2O03 A;  3HXL A;  1BW5 A;  3KP2 A;  1MDM B;  2RRE A;  1X1A A;  2RNJ A;  2MH9 A;  4UUS B;  2QSH X;  2NVX J;  1PUE E;  3GTJ J;  1HQC A;  1BR2 A;  3RPQ A;  4AUX A;  4NQW A;  1BN5 A;  2CV2 A;  2K02 A;  1FP1 D;  1O3Q A;  3I59 B;  2DPD A;  2X6X A;  4I6Z A;  2GXG A;  3KEQ A;  2VKH A;  3EET A;  3BR2 A;  3O2P E;  4LMY A;  1I1S A;  4FCY A;  3DF8 A;  4V2G A;  3MWM A;  1DUX C;  5D5W B;  1X3W B;  2Q2E B;  5LRR A;  3D0S A;  4LIU A;  2EV6 A;  2LC2 A;  3ZP5 A;  2DQR A;  1IV8 A;  2OUM A;  2GIV A;  3I3L A;  2ZXI A;  2ZJ2 A;  2VOD A;  5C44 J;  2M7B A;  3CF2 A;  3CCE I;  3BC8 A;  4I0B A;  3JSO A;  4BJT A;  3WTV C;  2JSP A;  3X2Q H;  1WJF A;  2EJR A;  2TRT A;  2QEN A;  5BQT A;  4II2 A;  2UWM A;  1IF1 A;  4E7S A;  5D6E A;  3FKI J;  3E0J B;  3OL3 A;  3E3V A;  4N9I A;  1MIJ A;  4YII A;  3T5X A;  5GAD J;  3I9V 2;  3HTS B;  2HOS A;  2HFH A;  3LA2 A;  1YIT I;  5C4X J;  4L9N A;  3RKY A;  2ICW G;  4PFO A;  1REP C;  2HQR A;  3RI4 A;  2DA2 A;  3GTO J;  2VPR A;  2CSO A;  3S1Q J;  1N25 A;  4AYB A;  1U9N A;  1UMQ A;  3F8N A;  3ISP A;  5D6F A;  3D1N I;  2XF5 A;  1I6H J;  1OQY A;  2EA2 A;  3R0J A;  4L5J A;  2E1C A;  2V9K A;  1YI2 I;  5DV5 A;  4LJZ F;  1E3P A;  1Z6T A;  2UXN A;  2FOK A;  5LHG A;  1XX5 A;  3ZR8 X;  3NQO A;  5EJC A;  5B3S H;  1ZR2 A;  1D1A A;  4DQ2 A;  2R7D A;  4YIF A;  1N78 A;  2LY1 A;  2O6G E;  4Y33 A;  2IP2 A;  2NVY J;  3DLL F;  1MBK A;  2QUF A;  2R3S A;  1HKS A;  3U1D A;  4KIG A;  4BJ5 C;  2BY0 A;  1F1Z A;  2V9V A;  3H1C A;  2IPQ X;  1CGP A;  3H35 A;  2CW7 A;  2XSJ C;  3I59 A;  4XKV A;  2DDA A;  3KFW X;  3R4K A;  4B3A A;  2IS2 A;  5DDG A;  2M0C A;  3CDL A;  5BMZ A;  1VQ9 I;  2K9L A;  4XN0 A;  5HS7 A;  3HOX J;  3ASN H;  1B8I A;  4HV6 A;  4XMY A;  2E5N A;  1T38 A;  2OPT A;  2HYF A;  1HW2 A;  2MH2 A;  2R4G A;  3G2B A;  4F7Z A;  2FRH A;  2WB1 N;  2TDX A;  1IDY A;  2BY2 A;  2XAQ A;  5FLX K;  1Z6R A;  4N4O B;  3DV8 A;  1LVA A;  3SDG A;  2VBW A;  3FXR A;  2BBY A;  3GZN B;  3ZMV A;  1O3S A;  1MND A;  3BG7 A;  3TO6 A;  4BHC A;  5J4Y A;  1RZ4 A;  2XGD A;  4CUG A;  2LDU A;  5HNF A;  1D5Y A;  4KIC A;  2VL8 A;  2ZB9 A;  1VQ5 I;  1DDN A;  2XPU A;  5K5R A;  4N9H A;  1SVL A;  2FD5 A;  1MGT A;  3T8R A;  4W97 A;  2IGK A;  1WH7 A;  4BXF A;  2OQG A;  4QLC U;  3LWF A;  2EH3 A;  1WI9 A;  2ZJQ F;  2QQA A;  1YW7 A;  1R5H A;  4A3D J;  4J00 A;  1IV6 A;  2NS0 A;  3SZG A;  1YS7 A;  4M3G A;  5JFR A;  4HQM A;  3TED A;  1SFU A;  2LKX A;  3SYT A;  2W25 A;  4B44 A;  3K7A J;  2A5W A;  4IHX A;  2G9W A;  2JMW A;  2F5C A;  3CCM I;  2P0W A;  1J0R A;  4S04 A;  2QVO A;  3MEX A;  3S3O A;  3FMQ A;  3OYH A;  1JJ6 C;  2P7C B;  2FBK A;  3EUH C;  2ID3 A;  3OYK A;  2BHZ A;  4E7K A;  1QPM A;  3DEE A;  1Z05 A;  1G3W A;  2AXT C;  2RNG A;  3I4P A;  1Z3X A;  4IXA A;  5J47 A;  2R7U A;  1UST A;  2O8X A;  2HZT A;  3GME A;  4M72 A;  3TBI A;  3WTW C;  1RRJ A;  3E7L A;  5HS8 A;  4W1U A;  3ZQF A;  3GTK J;  5M5W J;  2JN6 A;  3HZJ A;  1XCV A;  1TT5 B;  2RQP A;  3OYC A;  2CGP A;  3ZXS A;  1XTA A;  1HKQ A;  2D1H A;  4PJM A;  3ROU A;  2HQN A;  2Y31 A;  1X1B A;  4YFK F;  5ED4 A;  3GTG J;  5JHF A;  2VQG A;  5KAF C;  2DI3 A;  3A01 B;  4PSW A;  3L1P A;  3J7Z I;  4ZTF A;  4UY8 I;  2WWY A;  2V26 A;  2OV7 A;  3FX3 A;  3PNT A;  2CJJ A;  3M07 A;  4A6D A;  1O3T A;  4LK1 F;  3S3M A;  2BE5 F;  3W2W A;  2EA4 A;  2IBD A;  3SEZ A;  1T95 A;  5GAG J;  2IS4 A;  5HDN A;  3K4N A;  2DYS H;  3KEY A;  3V8J A;  1FTZ A;  4Y3O A;  5K7F A;  3R6S A;  4OAZ A;  1U8R A;  1HF0 A;  3DBR B;  1FBS A;  3GFI A;  1LJ9 A;  1FOX A;  2DO7 A;  2CV1 A;  4OMY A;  4ENJ A;  3ASO H;  3L2Q A;  2PMZ A;  3K1M A;  1DP3 A;  2P8T A;  1G59 A;  2DAO A;  1JI8 A;  2Q1Z B;  1QNT A;  5TJJ A;  5LRS A;  1TLH B;  1FOK A;  4EJT A;  2QQ8 A;  4E7I A;  2BY1 A;  2DCE A;  3KP6 A;  5FLV A;  2XIG A;  3A2K A;  2OF7 A;  5B1B H;  3RKX A;  4FE7 A;  5GP9 A;  2MLG A;  1V4R A;  4PGH A;  1GLN A;  3AG1 H;  3OSF A;  4P5O A;  1MMN A;  2OC6 A;  1ODD A;  4Q5S F;  1XC5 A;  2X9D A;  2R5Y B;  2JUC A;  5J4V A;  2IAI A;  5EEA A;  3IWF A;  1LPQ A;  5EG0 A;  5JVG F;  3DQV C;  1UAA A;  4M73 A;  3BR1 A;  1P7I A;  1ZN2 A;  2Q2E A;  3FHZ A;  3PQK A;  1RKW A;  4C30 A;  2BHY A;  4A0X A;  2AS5 F;  2KIM A;  1LFP A;  1AKH B;  3RKQ A;  4BE2 A;  2XV4 S;  4MO7 A;  2D45 A;  2HQ5 A;  4C2T A;  2PEX A;  4LG0 B;  3ELK A;  2EBI A;  1DPR A;  2XGC A;  2ZME A;  3TP3 A;  4ZDP A;  3Q0W A;  1MNM C;  1MD0 A;  4AD9 A;  2PJR A;  3H36 A;  1Y6I A;  4OIP F;  1W36 D;  5F04 A;  4BDY A;  2HZD A;  4GRI A;  3PO3 J;  4XID A;  1C0W A;  1LKX A;  2QM3 A;  3KZI C;  1IDZ A;  3SZT A;  2JVG A;  4AVZ A;  4IVN A;  1GV2 A;  2EZL A;  3V7S A;  3JRH A;  1JKO C;  4BQQ A;  2P81 A;  2JPB A;  4EGY A;  2BW3 B;  1D5V A;  4CCN A;  1STZ A;  1P9Q C;  1OCR H;  3A0H C;  1VQN I;  1YLF A;  2ISY A;  1B6A A;  4DNC A;  3CCQ I;  2BEO A;  4OIN F;  4ZZD A;  1ZRF A;  3ABL H;  2GXA A;  4UXN A;  3LSG A;  1XGS A;  4KT6 A;  1TNS A;  4I01 A;  5HOD A;  4Y17 A;  3ZCO A;  4A3C J;  2OJE D;  1UG0 A;  2A61 A;  2KHM A;  3DWL E;  4BS9 A;  5L3E A;  2YX7 A;  2GA2 A;  3FBN B;  2ADU A;  4PK4 A;  4XLE A;  2V1D A;  4EGZ A;  3U21 A;  1X4P A;  2FML A;  4KFC A;  5DD4 A;  3WTU C;  1ITY A;  4A5N A;  2XKP A;  2K40 A;  3WTT C;  4M3E A;  3M8F A;  4RGX A;  5EYR A;  3H9G A;  4IZZ A;  3S8P A;  5HLG A;  3FDY A;  2CWE A;  3I58 A;  5K7Z A;  2HDC A;  3H3V K;  4FX0 A;  1T08 B;  3H5A A;  1P4A A;  3HBL A;  1LDJ A;  3G1M A;  1NHA A;  2E2J J;  5L3B A;  2E34 A;  5E8I A;  4CYD A;  4AVP A;  4Y4R A;  3OYM A;  5CQG A;  1KGS A;  4X6A J;  1X3U A;  4DOZ A;  1JKR C;  1X58 A;  2GOX B;  1D8K A;  3GFJ A;  1VQ6 I;  1QZE A;  2L5Q A;  2DA1 A;  5JLW A;  2R7R A;  3BJA A;  1D0Z A;  4HZF A;  4QSH A;  3W2V A;  1USS A;  2CUZ A;  4RS8 A;  3GWZ A;  3I55 I;  3RKW A;  4P9F A;  4B4C A;  2JA7 J;  2YUS A;  3FMS A;  3TOB A;  5EEH A;  2MC4 A;  1BM9 A;  1P92 A;  1FSE A;  3BCB A;  3E5X A;  4G94 A;  4Y15 A;  4ZYD A;  2Q0O A;  2DA3 A;  3RZO J;  4DZP A;  1ZG5 A;  4IHT A;  4RDU A;  3CTA A;  1ULY A;  3BQZ A;  2LMD A;  2O3F A;  5D4R A;  2O9L A;  2NVT J;  4ZDO A;  2DTZ A;  3QP5 A;  5CVJ A;  1R7J A;  2QGU A;  1KU2 A;  5GAH J;  4M6V A;  1KON A;  2DA5 A;  3QOP A;  1QHG A;  3KYL A;  4ZC3 A;  3ZQI A;  1RI7 A;  1R22 A;  5IYD J;  3HOV J;  4A5M A;  2K27 A;  4IRH A;  3JRF A;  3PJR A;  1OCC H;  1V5F A;  3HOS A;  4AU7 A;  1A5J A;  4AIK A;  3GTM J;  2M8G X;  1Y0N A;  3CES A;  1WVR A;  2E2I J;  1ZH5 A;  5CVU A;  1I3A A;  2Z16 A;  1B72 A;  5FLX Z;  3CME I;  4IQ4 A;  3ZOB A;  3JTH A;  2NNY A;  2GXB A;  3CC4 I;  1MMD A;  1YJN I;  3B02 A;  2HNH A;  3VOE A;  3B6A A;  3HOT A;  1IN5 A;  2IGO A;  3BJO A;  4A3K J;  3O6B B;  1JT6 A;  1R1U A;  2A69 F;  2MA3 A;  4DYQ A;  2Y9Y A;  2ZJR F;  2M30 A;  5KVR A;  2R0Q C;  4HQE A;  2EIM H;  4JX5 A;  2LK2 A;  3I53 A;  3C18 A;  4U0W A;  2A05 A;  1FLI A;  1PP7 U;  3RJP A;  3WHB A;  3JRI A;  3K0L A;  4J19 A;  2ZSH B;  1G4D A;  3G1O A;  1DQU A;  5J40 A;  4IX7 A;  5J6X A;  1B9N A;  4B3X A;  2JA2 A;  2JJ7 A;  4ZYG A;  3Q5F A;  2VN2 A;  3CCR I;  3EUH A;  3GLX A;  1R58 A;  1W7P A;  2KRC A;  4M6X A;  2HTS A;  1ETX A;  4R8H A;  3I71 A;  4HYE A;  4BYY A;  2V79 A;  4DYC A;  2JWT A;  5GPC A;  1TP4 A;  3KE2 A;  3A01 A;  3LL7 A;  1GXQ A;  2DMN A;  2K86 A;  3W6K B;  2ESN A;  1IAW A;  4PCQ A;  4UB6 C;  3JAM Z;  2K85 A;  2NS8 A;  2B7E A;  4CYC B;  5IP6 A;  2EIJ H;  2IW5 A;  2ZFW A;  2M4K A;  3DU5 A;  2UV1 A;  3JRD A;  3G3Z A;  4Q4Z F;  4HRI A;  4MHG A;  3Q9S A;  2VLA A;  3BG5 A;  1P2F A;  3OOU A;  1T8I A;  1NTC A;  4M9X A;  2MAB A;  4XN3 A;  4A3M J;  3ML6 A;  4YFN F;  3S16 J;  2K9N A;  3S1M J;  3G6E I;  1NG6 A;  2LLK A;  3VDX A;  2FEZ A;  4OAY A;  5KHD A;  3WG9 A;  2RN7 A;  3MKW B;  4IPA A;  1IN4 A;  4OOI A;  1QRY A;  2IXS A;  1OYW A;  2HOA A;  4HA8 A;  5FFZ A;  2H8R A;  2QF7 A;  2ZXH A;  2DA7 A;  4F52 A;  4YEJ A;  3JAM K;  3K70 D;  3HRS A;  3RPU A;  2CFX A;  3KX2 A;  2K4J A;  1MMA A;  1Z3Y A;  4FET A;  5FRO A;  3K4J A;  4F93 B;  2W85 A;  1U5T C;  3GLL A;  3KZZ A;  1HST A;  3TP0 A;  3B73 A;  1BIA A;  4C9Y A;  1J75 A;  1ERD A;  4LIV A;  3ZQG A;  5GTI C;  2HU9 A;  1P4W A;  1P7J A;  2KP6 A;  5LBQ A;  5EEG A;  1LE8 A;  1BI0 A;  1OCO H;  1MBG A;  2KLO A;  4O6J A;  3BTL A;  4FAS D;  4QTR A;  5ICF A;  1I27 A;  2F4M B;  3J7A O;  4KA4 A;  1JHF A; 
#chains in the Genus database with same CATH homology
 4G9Y A;  2E7W A;  2GQQ A;  2P5K A;  2PLY A;  4R1H A;  1OYY A;  4G7O F;  2P5L C;  4RB0 A;  3TDZ C;  3COA C;  1IRF A;  3J80 Z;  1S3J A;  1XSV A;  1W7P D;  2ZME B;  3IWZ A;  4KIF A;  2HWV A;  3I54 A;  1KYZ A;  1ZRD A;  1KYW A;  4EJW A;  5HOO A;  3WTY C;  3HUG A;  4UHT A;  5DCM A;  1TBX A;  2VBZ A;  2H09 A;  2IJL A;  4EMS A;  4BNC A;  3TO7 A;  4PGG A;  3O3K A;  2W84 A;  5F6F A;  1YFH A;  4B8X A;  2IT0 A;  1BI2 A;  2A6H F;  4ON0 A;  1U3E M;  4KT5 C;  3GX4 X;  1PDN C;  3P7N A;  4G8X A;  5BS6 A;  2K7L A;  3N4M A;  1XSD A;  3E5Q A;  5CVR A;  2DPU A;  5JR3 A;  1S6L A;  1ZRE A;  1J7K A;  3NRV A;  4YFX F;  1TW3 A;  5DUI A;  3RYP A;  3CUQ B;  1EH8 A;  1XD7 A;  3VFZ A;  2KIU A;  4LGW A;  4UV8 A;  1J2X A;  2Z9O A;  4U0V A;  3EQL F;  4HF1 A;  2ETH A;  2FMY A;  1XMK A;  2VC1 A;  2H6C A;  4L0Z B;  2H94 A;  1HSJ A;  2VOP A;  2JZY A;  4A2U A;  4UNO A;  3L7W A;  2Z5U A;  4ZH4 F;  5FB2 A;  3AAF A;  3GUD A;  2L02 A;  2DTR A;  1K7A A;  4RAZ A;  3RTR A;  4M6Y A;  5D8K B;  1RIO H;  4B09 A;  1SAX A;  3HRT A;  2H6B A;  1MDM A;  2EFQ A;  1W5T A;  3ZN1 A;  1YIO A;  3LA7 A;  2WC2 A;  2FF4 A;  5DEQ A;  1W4M A;  3K2Z A;  3K69 A;  3CUQ C;  3KP4 A;  3QU6 A;  3Q9V A;  2OBP A;  2RV8 A;  3TKY A;  2A07 F;  2NRA C;  4YG2 F;  5L3C A;  5HLH A;  2PFB A;  4M9S A;  3CUQ A;  2RGV A;  2DLL A;  1R36 A;  1D3Y A;  3QPT A;  3KP5 A;  2G7U A;  5E1W A;  2LSO A;  5ICG A;  2LNB A;  5FD6 A;  3GZ6 A;  4XBF A;  2BGC A;  5FFX A;  1ZLJ A;  4WF2 A;  3R60 A;  5IT3 A;  2HR3 A;  2BYV E;  1HW1 A;  3NEU A;  3V8L A;  3GF2 A;  2MC3 A;  5CLS A;  3V4G A;  4KNY A;  3U2R A;  1J9I A;  1L3L A;  1SD7 A;  4BXU A;  4ESB A;  2GA1 A;  3FM5 A;  1IUY A;  1Q1H A;  2RVC A;  4U7D A;  1H9G A;  4EM1 A;  1MJA A;  1WKM A;  3R61 A;  1ON1 A;  3RIR A;  4U88 A;  1S29 A;  1TNT A;  4IHS A;  4M9Z A;  4RB3 C;  1FSH A;  4AIJ A;  1FZP B;  4ENK A;  2XUB A;  3MFK A;  2XAJ A;  2COM A;  3OOP A;  1QZZ A;  3IRR A;  3J81 Z;  3FMR A;  4G6Q A;  4CDG A;  3F72 A;  5IT9 Z;  1WWX A;  4CXF A;  4NB5 A;  2JRT A;  4LLL A;  2PJP A;  3LAJ A;  2QBY A;  1VTN C;  3TQN A;  3BPX A;  4WXD A;  2ZNZ A;  1ZAR A;  1XDS A;  1TQI A;  2KKO A;  3TO9 A;  3MAJ A;  2P4W A;  3CJN A;  1ZLK A;  3GXO A;  1ZRC A;  2J5P A;  1ZGJ A;  1FT9 A;  4Q47 A;  2YR2 A;  2D2W A;  3CO6 C;  1KQ8 A;  4JQF A;  2P7V B;  2DU9 A;  3EDP A;  3HHG A;  1UHM A;  4M71 A;  4OIO F;  3C7J A;  1I1G A;  1MJ9 A;  1BBY A;  1DPU A;  4ZZL A;  3VOD A;  1U5T A;  3BRO A;  3OV8 A;  4IF4 A;  4Y13 A;  2YSR A;  3CDH A;  1LDK B;  1ON2 A;  1KA8 A;  1JXS A;  3LA3 A;  3FZV A;  4HF0 A;  1LEB A;  4XLN F;  2NAZ A;  3L00 A;  4XLP F;  2YX4 A;  5ERI A;  2XRN A;  5L3G A;  4UUV A;  3IC7 A;  4U0Y A;  4EVI A;  3ZN0 A;  4GGG A;  1OR7 A;  1IZ1 A;  4RGU A;  2LF7 A;  1SD6 A;  5E1Z B;  3W6J B;  3D5L A;  3FXU A;  5E1X A;  4OIR F;  1MJB A;  1R00 A;  5E8G A;  5ILV A;  2KRF A;  2FQ3 A;  1QO0 D;  2CO5 A;  4KMU X;  4AWX B;  4CHU A;  4EM0 B;  3EYY A;  2EFW A;  2PQ8 A;  1JHH A;  2VT2 A;  3WTS C;  1KU7 A;  4L5I A;  1SD5 A;  5H6R A;  2GZW A;  2F5E A;  3RDI A;  1S7O A;  2MBF A;  3BWG A;  3S2W A;  4EJO A;  4H0E A;  4LG0 A;  2PG4 A;  2O61 A;  3GYH X;  1J5Y A;  3HYI A;  4HAM A;  5DCM B;  5H6Q A;  2W57 A;  2V6C A;  1FWZ A;  1S8N A;  5DD8 A;  5A2Q Z;  3BOQ A;  3BPV A;  3V7R A;  1G6N A;  1DP7 P;  3K1N A;  1FX7 A;  1QBJ A;  6PAX A;  4EJV A;  3DP7 A;  3K1P A;  4A12 A;  1SFX A;  3DPL C;  2F2E A;  2STT A;  4O5V A;  4G7H F;  2Y48 A;  4PDK A;  3G73 A;  3U9G A;  3M1E A;  1E17 A;  3KLN A;  1ZG3 A;  3F8M A;  1FYL A;  3P9I A;  5KK1 A;  5AON A;  1F9N A;  1H0M A;  1O7L A;  1Z9C A;  1T6S A;  2EFN A;  3CLO A;  1HKT A;  5CYV A;  2YPR A;  4L18 B;  4XSX F;  3KP7 A;  4L9T A;  2K4B A;  5D4S A;  3E6B A;  4P96 A;  2ZBK A;  1OYI A;  5K5O A;  1B9M A;  4MQV A;  3C3W A;  4A6E A;  2M87 A;  2V1X A;  3TOA A;  3MCZ A;  3LQR A;  3GVA A;  4LB6 B;  1PP8 F;  4MNU A;  1R5G A;  2IRF G;  3KET A;  3SHF A;  1IN6 A;  3ZMS A;  3LQQ A;  4TV7 A;  2RKH A;  2J5O A;  4ESF A;  2FBI A;  5LHI A;  2ACJ A;  1SFE A;  2XAG A;  4HOB A;  5K1Y A;  2NNN A;  1SD4 A;  1HW5 A;  3ECO A;  1EH7 A;  4LLG F;  3KCC A;  3P9K A;  3QU3 A;  2HYG D;  3GEZ A;  3LAP A;  2EK5 A;  3HRM A;  3I0T A;  1EH6 A;  5FO5 A;  4IRG A;  2V1U A;  1YW9 A;  4HBL A;  2DFI A;  1U2W A;  1GVJ A;  2E1N A;  2ZKZ A;  5E20 A;  4I09 A;  1B59 A;  1XGN A;  2VBY A;  3WTX C;  1LQ1 A;  3IKT A;  4A0Z A;  2EV0 A;  2M1B A;  3KEO A;  1KQ9 A;  2AXL A;  4NHJ A;  2KJC A;  4XSZ F;  1JGS A;  1K78 B;  4RGR A;  4Q48 A;  3R0A A;  2JSC A;  3GO5 A;  2Z3Y A;  5HDG A;  2Z33 A;  3FWE A;  3WE3 A;  2DK8 A;  2HKX A;  2Q8K A;  2FSW A;  4WCG A;  3M9A A;  5D5U B;  2VE8 A;  1Z1D A;  2L4M A;  2DW4 A;  3VB2 A;  4ZYE A;  4S05 A;  1Z91 A;  5FGM A;  1KQ0 A;  5LGN A;  5IT9 K;  3T0Y A;  2H27 A;  1IN8 A;  4KMF A;  2Y75 A;  1ZAO A;  4RB2 C;  4WXC A;  2ESH A;  1RUO A;  4HLY A;  4QWQ A;  5LEJ A;  3SQN A;  1B4A A;  2P5V A;  4EM2 A;  2D1V A;  4KYW A;  2FNP A;  1J59 A;  2F5D A;  1GXP A;  2GAU A;  3E6C C;  4HX8 A;  2VC0 A;  2L01 A;  1XGM A;  4WXH A;  5F1R A;  4HDU A;  1ONV A;  4KUM A;  5JI6 A;  3IL2 A;  4CZZ A;  2IA2 A;  4I0A A;  2B0L A;  2CG4 A;  4KN4 X;  2CYY A;  1JE8 A;  3KLO A;  2IVM A;  2BV6 A;  2P6S A;  4JK1 X;  3L2C A;  3J80 K;  3BJ6 A;  4BQA A;  5BPD A;  2STW A;  3F23 A;  2ZCW A;  3FM3 A;  3HSF A;  2X4H A;  5JVT A;  2A68 F;  1U5T B;  2A3S A;  3F8C A;  5CJ9 A;  4L9V A;  1IRG A;  4MTE A;  3DKW A;  4BAY A;  2G7H A;  4JBA A;  5AIQ A;  1P6R A;  2LF8 A;  3ZQ7 A;  1R23 A;  4LFU A;  1RUN A;  2QZ8 A;  2YU3 A;  1S7A A;  1XMA A;  5L3D A;  3QP6 A;  1O57 A;  4GYG A;  3GFL A;  3F8B A;  3TGN A;  2LKP A;  1HBX G;  1BC7 C;  1FC3 A;  4UV9 A;  5ICC A;  4MTD A;  2FU4 A;  2QQ9 A;  5ICE A;  1OKR A;  3WGI A;  2MD5 A;  3H92 A;  2HS5 A;  4HX4 A;  1LNW A;  4O3M A;  5JHU A;  1P4X A;  4MEX F;  2PMU A;  4HV5 A;  5J8F A;  1EV7 A;  1K6O A;  3ZMT A;  3ZPL A;  3F22 A;  2HEO A;  3WTZ A;  1ZYR F;  4HW0 A;  3HTU A;  2VOO A;  1W5S A;  3HSR A;  3FF5 A;  2OZ6 A;  3QRF F;  1Y0U A;  2EWN A;  4RAY A;  5H20 A;  5HDK A;  1YYV A;  4OIQ F;  1YQA A;  1XSX A;  4KN7 X;  3ZMU A;  3H3Z A;  1QGP A;  2R7F A;  2L3D A;  2RC4 A;  3F8F A;  1FBU A;  3KZY A;  2OA4 A;  4ETS A;  2QWW A;  2F5F A;  3SFZ A;  3K9T A;  1T39 A;  3GZ5 A;  1QQI A;  2IA0 A;  5LGT A;  2X0L A;  5LLQ A;  3E97 A;  3T1B A;  5LHH A;  3N97 A;  4ENM A;  1FY7 A;  3WOD F;  3JTG A;  4A0Y A;  4ASN A;  2XAH A;  4ESJ A;  1FP2 A;  2M8E A;  1I6X A;  4D0P A;  2QQB A;  3GFM A;  5E18 F;  4EJU A;  2XVC A;  1G3T A;  4FT8 A;  4KIB A;  2FA5 A;  2Y0M A;  4CGZ A;  3WU0 A;  4GCV A;  3LFK A;  1T98 A;  4EV0 A;  5LGU A;  3JSP A;  5HS9 A;  2M5W A;  1H9T A;  5BPI A;  3HSE A;  4AIH A;  2VBX A;  1KU9 A;  1FNN A;  4IRI A;  2DBB A;  3V7C A;  3WE2 A;  4R79 A;  4OMZ A;  2VON A;  2L4A A;  2EFO A;  3L09 A;  5D5X B;  3M7G A;  4P55 A;  1BI3 A;  5DCF A;  1TW2 A;  1FPQ A;  5AIP A;  3BZ6 A;  1BJA A;  1XCB A;  1ZG1 A;  1RNL A;  2QYO A;  3WU1 B;  3DPT A;  2WTE A;  1V3F A;  1BIB A;  2EFP A;  4FHT A;  2OD5 A;  3DEU A;  4HLX A;  2OAZ A;  4UVA A;  1IW7 F;  4L0Y B;  1YTY A;  3ECH A;  4L9J A;  3MZH A;  2KIF A;  4I7H A;  4CIC A;  3L9F A;  4RGS A;  1T0F A;  3C1D A;  4UVB A;  2WV0 A;  1R1V A;  4BH9 A;  1W7P B;  3P9C A;  4FX4 A;  3F3X A;  4CO8 A;  4E70 A;  3QAH A;  3ZMD A;  1CF7 A;  3H3U A;  4GO1 A;  4N0B A;  2EV5 A;  2NYX A;  4IJA A;  5ILS A;  5CVI A;  4G7Z F;  1UFM A;  5TRD A;  3CUO A;  5D8L B;  2VXZ A;  1U6G A;  3MZY A;  5CVV A;  2W24 A;  1O3R A;  2HTJ A;  3IHU A;  1Z7U A;  1GHC A;  3TDU C;  3EYI A;  3BP8 A;  1MZB A;  3M8E A;  3CO7 C;  2DT5 A;  3IRQ A;  5DUK A;  1R1T A;  2QLZ A;  2ISZ A;  4PZJ A;  3WGH A;  4RB1 A;  5F64 A;  2PN6 A;  1LEA A;  3VEP A;  2XAS A;  3V8K A;  4WWC A;  1F4K A;  2JT1 A;  1HXD A;  3DFG A;  1OMI A;  1XB4 A;  2UZK A;  2E7X A;  4I98 B;  3HRU A;  3SXY A;  1SMT A;  2CQK A;  2L54 A;  1B1B A;  2VE9 A;  1K78 A;  4P9U A;  1UCR A;  2FE3 A;  1WSU A;  1IXC A;  1AWC A;  1SMY F;  1CF7 B;  1YG2 A;  5BOX A;  3F21 A;  3GW2 A;  2OU2 A;  1A04 A;  4KDP A;  5K5Q A;  4U7B A;  3WGG A;  1IXS B;  2M45 A;  2A6E F;  4M74 A;  4ZYH A;  2C6Y A;  2PMH A;  1BC8 C;  1YW8 A;  4MQ9 F;  3BY6 A;  2PI0 A;  4GYI A;  3SZP A;  1G3Y A;  2FNA A;  2ELH A;  2XKO A;  3QPH A;  1FYK A;  4K2E A;  2HKO A;  2XAF A;  2HOE A;  2XHK A;  5A2Q K;  4BHP A;  2CW0 F;  1E2X A;  1FBQ A;  4OU0 A;  1MKM A;  1T2K A;  3E6M A;  3IKV A;  4MGR A;  2JPC A;  2HGC A;  1F5T A;  5FD5 A;  1IXR C;  4XRF A;  1YS6 A;  2GWR A;  2KJB A;  1U78 A;  1ZHF A;  4LB5 A;  2XRO A;  5L3F A;  5E17 F;  1XGO A;  1IN7 A;  1I5Z A;  1TQP A;  2PBI A;  1KU3 A;  3ABT A;  2ZO4 A;  4WK8 F;  1TTY A;  2DQL A;  4BHB A;  4MEY F;  2RDP A;  5ILU A;  2Z99 A;  1L0O C;  4HF2 A;  4I02 A;  1XDU A;  3I5U A;  1LB2 A;  3DXJ F;  4LLN A;  1TQM A;  3JW4 A;  4HX7 A;  1K79 A;  1BI1 A;  3BDD A;  3F6O A;  3F6V A;  2VT3 A;  2OQR A;  1UB9 A;  1FYM A;  2JTV A;  1O7F A;  3KP3 A;  1G3S A;  4Z2Y A;  5DYM A;  3ZMZ A;  3FXQ A;  1ZGA A;  4G6D A;  4ENN A;  2EB7 A;  3ABU A;  3HHH A;  3E6D A;  1OPC A;  2A5Y B;  3LST A;  2DK5 A;  5D5V B;  3J81 K;  1LDD A;  1AOY A;  2MLK A;  3E5U A;  5LEK A;  4HDV A;  3MQ0 A;  2ZXJ A;  4EQQ A;  4GXO A;  2P6T A;  1XN7 A;  2ZNY A;  1D8J A;  3PQJ A;  3REO A;  3PFI A;  4UVC A;  4LD5 A;  2IA1 A;  1QZY A;  1UHW A;  5J8C A;  3T8T A;  2OZU A;  3RYR A;  2QBY B;  4LK0 F;  3I64 A;  2FXA A;  1YO5 C;  2FBH A;  2O0Y A;  3HIF A;  4I2O A;  3ULQ B;  1WRJ A;  2UXX A;  5HLI A;  3ERE D;  1BOA A;  1WQ2 A;  5HVQ C;  4WX9 A;  2XGX A;  2O03 A;  3KP2 A;  1MDM B;  2RNJ A;  2MH9 A;  1PUE E;  1HQC A;  3RPQ A;  4NQW A;  1BN5 A;  2K02 A;  1FP1 D;  1O3Q A;  3I59 B;  2DPD A;  2GXG A;  3KEQ A;  3EET A;  3O2P E;  4LMY A;  1I1S A;  3DF8 A;  3MWM A;  1DUX C;  5D5W B;  5LRR A;  3D0S A;  3ZP5 A;  2EV6 A;  2DQR A;  2GIV A;  2ZJ2 A;  2VOD A;  4I0B A;  3JSO A;  3WTV C;  2EJR A;  2QEN A;  5BQT A;  2UWM A;  1IF1 A;  5D6E A;  3E3V A;  4N9I A;  4YII A;  3T5X A;  3HTS B;  2HFH A;  3LA2 A;  4L9N A;  3RKY A;  1REP C;  2HQR A;  3RI4 A;  2CSO A;  5D6F A;  3F8N A;  3ISP A;  3R0J A;  2EA2 A;  4L5J A;  2E1C A;  5DV5 A;  4LJZ F;  1Z6T A;  2UXN A;  2FOK A;  5LHG A;  3NQO A;  4DQ2 A;  2R7D A;  4YIF A;  2O6G E;  2IP2 A;  2QUF A;  2R3S A;  1HKS A;  3U1D A;  4KIG A;  1F1Z A;  2V9V A;  2IPQ X;  1CGP A;  3I59 A;  3KFW X;  3R4K A;  5DDG A;  5BMZ A;  5HS7 A;  4HV6 A;  1T38 A;  2HYF A;  1HW2 A;  2MH2 A;  4F7Z A;  2FRH A;  2TDX A;  2XAQ A;  5FLX K;  1Z6R A;  3DV8 A;  1LVA A;  2VBW A;  3FXR A;  2BBY A;  3ZMV A;  1O3S A;  3TO6 A;  4BHC A;  1RZ4 A;  2LDU A;  4KIC A;  1DDN A;  5K5R A;  4N9H A;  1MGT A;  3T8R A;  2OQG A;  4QLC U;  3LWF A;  1WI9 A;  2QQA A;  1YW7 A;  1R5H A;  2NS0 A;  5JFR A;  1YS7 A;  4HQM A;  1SFU A;  2W25 A;  2G9W A;  2F5C A;  1J0R A;  4S04 A;  2QVO A;  3MEX A;  3FMQ A;  2P7C B;  2FBK A;  1QPM A;  1Z05 A;  1G3W A;  3I4P A;  4IXA A;  1UST A;  2O8X A;  2HZT A;  4M72 A;  3WTW C;  5HS8 A;  1XCV A;  2RQP A;  2CGP A;  2D1H A;  1HKQ A;  3ROU A;  2HQN A;  5ED4 A;  4YFK F;  2DI3 A;  2WWY A;  3FX3 A;  4A6D A;  1O3T A;  4LK1 F;  2BE5 F;  2EA4 A;  5HDN A;  3V8J A;  3R6S A;  1U8R A;  1FBS A;  3GFI A;  1LJ9 A;  2DO7 A;  4OMY A;  4ENJ A;  3K1M A;  2P8T A;  2DAO A;  1QNT A;  5TJJ A;  5LRS A;  1TLH B;  1FOK A;  4EJT A;  3KP6 A;  2XIG A;  3RKX A;  2MLG A;  1V4R A;  4PGH A;  4P5O A;  4Q5S F;  1ODD A;  3IWF A;  3DQV C;  4M73 A;  1ZN2 A;  2Q2E A;  3FHZ A;  3PQK A;  4A0X A;  2AS5 F;  2KIM A;  2XV4 S;  2D45 A;  2PEX A;  4LG0 B;  3ELK A;  1DPR A;  2ZME A;  1MD0 A;  4AD9 A;  4OIP F;  1C0W A;  2QM3 A;  3SZT A;  4IVN A;  3V7S A;  2JPB A;  4EGY A;  1D5V A;  1STZ A;  1YLF A;  2ISY A;  1B6A A;  4DNC A;  2BEO A;  4OIN F;  4ZZD A;  1ZRF A;  4UXN A;  1XGS A;  1TNS A;  4I01 A;  4Y17 A;  2A61 A;  5L3E A;  2YX7 A;  2GA2 A;  2ADU A;  2V1D A;  4EGZ A;  2FML A;  4KFC A;  5DD4 A;  3WTU C;  4A5N A;  2XKP A;  3WTT C;  3M8F A;  4RGX A;  5HLG A;  3I58 A;  2CWE A;  2HDC A;  4FX0 A;  1P4A A;  1LDJ A;  1NHA A;  5L3B A;  5E8I A;  4CYD A;  4AVP A;  1KGS A;  1X3U A;  3GFJ A;  1D8K A;  3BJA A;  4HZF A;  1USS A;  4RS8 A;  3GWZ A;  3RKW A;  4P9F A;  3FMS A;  3TOB A;  5EEH A;  1BM9 A;  1P92 A;  1FSE A;  3E5X A;  4G94 A;  4Y15 A;  4ZYD A;  2Q0O A;  1ZG5 A;  4IHT A;  3CTA A;  1ULY A;  2O3F A;  5D4R A;  3QP5 A;  5CVJ A;  1R7J A;  1KU2 A;  3QOP A;  1RI7 A;  1R22 A;  4A5M A;  2K27 A;  4IRH A;  3HOS A;  4AIK A;  1ZH5 A;  5CVU A;  5FLX Z;  2GXB A;  2NNY A;  3JTH A;  3B02 A;  3VOE A;  3HOT A;  1IN5 A;  3BJO A;  3O6B B;  2MA3 A;  1R1U A;  2A69 F;  2M30 A;  5KVR A;  4HQE A;  3I53 A;  3C18 A;  4U0W A;  1FLI A;  1PP7 U;  3RJP A;  3K0L A;  1G4D A;  5J6X A;  1B9N A;  4ZYG A;  3Q5F A;  2VN2 A;  3EUH A;  3GLX A;  1R58 A;  1W7P A;  4M6X A;  2HTS A;  4R8H A;  3I71 A;  4HYE A;  4BYY A;  2V79 A;  3KE2 A;  1GXQ A;  2K86 A;  3W6K B;  2ESN A;  1IAW A;  4PCQ A;  3JAM Z;  2ZFW A;  2IW5 A;  3G3Z A;  4Q4Z F;  4MHG A;  3Q9S A;  1P2F A;  4M9X A;  3ML6 A;  4YFN F;  2FEZ A;  3WG9 A;  2RN7 A;  4IPA A;  1IN4 A;  4OOI A;  1OYW A;  4HA8 A;  5FFZ A;  3JAM K;  3RPU A;  3HRS A;  2CFX A;  2K4J A;  2W85 A;  1U5T C;  3KZZ A;  1HST A;  3B73 A;  1BIA A;  1J75 A;  1P4W A;  5LBQ A;  5EEG A;  1BI0 A;  4O6J A;  5ICF A;  1I27 A;  3J7A O;  4KA4 A;  1JHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...