4M76A

Integrin i domain of complement receptor 3 in complex with c3d
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
296
Chain Sequence
AMAVDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Structural insight on the recognition of surface-bound opsonins by the integrin I domain of complement receptor 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 107
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4m76A00
1O6HA 3DRAB 1W6JA 1O5MB 2WY8A 4GTPB 3E30B 4GTTB 5FOBB 3Q7FB 3DSVB 1FT1B 4LNBB 4V1RA 1GXOA 4ZRPA 3DSTB 4BOKA 4EHMB 4V1SA 1FT2B 3CU7A 1O6QA 3D5RA 2R2LB 4KKJA 1KZPB 3Q73B 2I07B 1N4QB 2F0YB 5FO9B 2H6FB 4GTRB 1GSZA 2BBCA 3EU5B 1QQFA 3E32B 4FXKB 4ZH1A 2A73B 4D4AA 1GHQA 2XQWA 4MBGB 2PMVA 3RJ3A 2IEJB 1HZFA 3E37B 3OXUA 3KSQB 1N94B 2B39A 2V3PA 2G02A 3E34B 1JCQB 1GXMA 4KKIA 2BB6A 3PZ2B 4YDEB 1FPPB 5FO7B 4D94A 1S63B 2SQCA 4GTQB 1TNYB 3SQCA 1TN8B 1O1TB 1QSJA 3OEDA 1N4SB 4C1SA 1KZOB 1D8DB 2GOXA 4GTMB 3HXDB 2G0DA 1NL4B 4L9PB 4YDOB 3HXFB 2WY7A 1H39A 4ONTA 4M76A 5JPMB 3SFYB 3PZ4B 1JCSB 2WIIB 1C3DA 3DPYB 1H3BA 1TNOB 1W6KA 1LD8B 1TNZB 1DCEB 1H35A 1SA4B 2V3NA 4GTSB 2ZIRB 1S64B 1N9AB 2WINB 1D8EB 3Q75B 1SA5B 1TNBB 3SFXB 2H6GB 1H3CA 2NOJA 2XWBB 1MZCB 1TN6B 1TNUB 2PN5A 3C72B 2ZISB 1N95B 1O79A 1N4PB 3PZ3B 3KSLB 4GTOB 1O1SB 1H3AA 3E33B 1QBQB 4BOJA 4LNGB 1H36A 1O6RA 1H37A 4D4BA 1NI1B 3D5SA 3HXCB 3HXEB 4GTVB 1R76A 3KLSA 3Q78B 5FO8B 3DSWB 1X81B 2BEDB 1TN7B 2V8KA 3Q7AB 4FXGB 1UMPA 1O1RB 1SQCA 2H6IB 5JPNB 3G6JB 1LD7B 1JCRB 3PZ1B 3Q79B 5AGDA 2BB5A 2V8IA 3KQ4A 1N4RB 4MU9A 4D4CA 3DSUB 1GXNA 4D4DA 4ZRQA 2H6HB 3DSXB 3K7XA 3DSSB 2XWJB 1LTXB 3HXBB 2V8JA 3EUVB 4LNVA
chains in the Genus database with same CATH superfamily
2AHFA 1O6HA 1O5MB 4GTPB 3E30B 2ZBLA 3DSVB 1N21A 1FT1B 4LNBB 5KKBA 1LF9A 1FT2B 1O6QA 2R2LB 1KZPB 1N23A 3E80A 1FMIA 3ON6A 1AYXA 4CJ0A 2H6FB 2AFAA 1QQFA 4FXKB 5C05A 2A73B 3M72A 3QWTA 1GHQA 5JMFA 2VN7A 3RJ3A 1KRFA 3M74A 2E22A 3OXUA 1FP3A 1H54A 3M02A 5IL3A 3LZ9A 3ANIA 1WU5A 3S4CA 3RX8A 2BB6A 2BRWA 2VN4A 3PZ2B 2OKXA 1N22A 3EQAA 2SQCA 4GTQB 5CD2A 1VD5A 5M7YA 1O1TB 4C1SA 4GAXA 1IS9A 4DI5A 2XFGA 2FBAA 1D8DB 3SDUA 1N1BA 4OJZA 4OK4A 2G0DA 4WVAA 1N1ZA 1DL2A 1HV6A 4AYPA 2CQTA 3DPYB 3WUXA 1TNOB 3W7WA 2EACA 4Z4JA 4L6XA 1LD8B 1X1JA 1DCEB 3NNBA 3PYBA 2Q1FA 2WDAA 3WKHA 1AGMA 2WINB 4OK2A 3SFXB 1J0MA 1H3CA 2XWBB 1JS4A 4CJ1A 1TNUB 1N7RA 2PN5A 3QRYA 1HXAA 2BRVX 3W7XA 3QG0A 1G87A 1ULVA 1WZZA 1KS8A 4LNGB 4EL8A 1H36A 1RW9A 1L2AA 1O6RA 1H37A 2FUZA 4Q2BA 1NI1B 3SAEA 5IM1A 3HXCB 1HXCA 1TF4A 3QXQA 3Q78B 4J5TA 3VSMA 3W7TA 4WVBA 3Q7AB 1CB8A 1UMPA 1O1RB 1HMWA 3M7LA 3G6JB 1LD7B 2P0VA 1H12A 1N7NA 5AGDA 2V8IA 4F10A 3A3VA 3QSPA 1KSCA 2H6HB 2XWJB 5GZKA 2V8JA 2BRPA 1QAZA 2AHGA 3Q7FB 1GLMA 3M00A 1LOHA 4ZH5A 4V1RA 1XWQA 3DSTB 4BOKA 4EHMB 5ILZA 4V1SA 3CU7A 1G9JA 4KKJA 3Q73B 2F0YB 4LIXA 3E32B 4ZH1A 3W5MA 4MBGB 4E1YA 3E37B 4WVCA 4GL3A 1FO3A 2B39A 3G4DA 1N24A 1WU4A 3QFYA 1IA6A 1WU6A 3E34B 1V7XA 4KKIA 1HMUA 1DOGA 4RNQA 1HXGA 1S63B 1V5CA 3SQCA 1TN8B 2RGKA 5GW7A 4FJQA 1KZOB 1XW2A 3TF4A 2D8LA 1NL4B 2WY7A 1H39A 5ILYA 5ILIA 3PZ4B 3H7LA 2B4FA 3WIRA 3AFLA 3WKIA 2A8ZA 2WCOA 2WYNA 3N0FA 4MMIA 1H35A 2EAEA 1SA4B 2YIKA 2ZIRB 1S64B 1N9AB 3SDTA 3PMMA 1H13A 1N7OA 4OZVA 3RRSA 5ILHA 2H6GB 3VXDA 1LF6A 1CEMA 1TN6B 1N95B 2EADA 3PZ3B 1UT9A 1H3AA 1RQ5A 5IK0A 4WU0A 1J0NA 1GAHA 3D5SA 4DODA 3KLSA 5FO8B 2BEDB 2V8KA 1FBOA 2CQSA 3GZKA 3WC3A 5JPNB 3M78A 3PZ1B 3Q79B 2JF4A 3KQ4A 4D4CA 3QT9A 3ANJA 3SDQA 3P5PA 4F13A 2FUQA 3M76A 3DSXB 3K7XA 1X9DA 1HM2A 4NEIA 4LNVA 2DRRA 1NC5A 3H2WA 3DRAB 1W6JA 3M7EA 4GTTB 4YCRA 1GXOA 1LXKA 2F6DA 3QDEA 5ILDA 3N0GA 3M71A 2DRSA 3D5RA 1UG9A 2I07B 1N4QB 1NXCA 5FO9B 4GTRB 3ACSA 3RX5A 2BBCA 3EU5B 2FV1A 3M7BA 1KSDA 1RWCA 4D4AA 4L0GA 4AYQA 3WIQA 3KSQB 1N94B 2RI8A 2FUTA 2NVPA 1JCQB 1HM3A 3T33A 1GAIA 4YDEB 3PYAA 1OJMA 2ONGA 5FO7B 4D94A 5ILKA 5JMDA 3W7SA 3K11A 3M01A 4GTMB 3HXDB 4L9PB 4YDOB 4AYOA 3M75A 2GZ6A 5EATA 1H14A 2WIIB 4FNVA 3P2CA 1H3BA 1N20A 1W6KA 1F9DA 1TNZB 1HN0A 1KREA 3X17A 4GTSB 3SDRA 1D8EB 1N7QA 1SA5B 1TNBB 2DROA 2J5CA 2NOJA 5CZLA 1MZCB 4TF4A 3QT3A 1O79A 3ACTA 5M7IA 4GTOB 5ILJA 5IKAA 4BOJA 1QBQB 5IK6A 1X1IA 1G9GA 3GLYA 1EGUA 4FUSA 4XUVA 5CA3A 4TXTA 3DSWB 1X81B 3GT5A 2Z07A 1W3YA 3RENA 3WIWA 1SQCA 2D5JA 1N7PA 4MU9A 3WKFA 2ONHA 3DSUB 1GXNA 3DSSB 3W5NA 2RI9A 3EUVB 2X03A 2WY8A 5FOBB 4QT9A 4ZRPA 3M73A 2JG0A 4CE7A 3QPFA 2QNOA 1IA7A 3QFZA 1RWHA 1GSZA 1HCUA 3M7CA 1GA2A 3S4DA 2XQWA 2PMVA 1X1HA 4AYRA 2IEJB 1HZFA 3E6UA 1FAEA 3E7JA 1RWFA 2V3PA 2G02A 3W7UA 1GXMA 4KTPA 3EU8A 1FPPB 3P5RA 1F9OA 2E24A 1TNYB 3OEDA 1QSJA 5IK9A 1N4SB 4OZWA 5DGRA 1I8QA 1OJNA 2GOXA 5DGQA 3HXFB 5DHIA 1C82A 4KTRA 4ONTA 4M76A 5JPMB 3SFYB 3CIHA 1JCSB 1C3DA 5MEHA 2GH4A 4ZG8A 3RSYA 4DOEA 2V3NA 1F9GA 2EABA 3Q75B 3S4AA 4Q88A 3C72B 2ZISB 3H3KA 4JJJA 5GY3A 1N4PB 3D3IA 3KSLB 1CLCA 1O1SB 3S9VA 3E33B 1FCEA 1HX9A 3SDVA 1G6IA 3G4FA 1LXMA 1FO2A 1OJOA 2FV0A 4D4BA 3ANKA 3E73A 3HXEB 4GTVB 1R76A 3M77A 1F1SA 1OJPA 1RWGA 1FBWA 1TN7B 3S4BA 5IKHA 4MMHA 4FXGB 4Z4LA 3VSNA 5E2JA 5EASA 3A0OA 5DHKA 1XWTA 2DRQA 2H6IB 3NFVA 1K72A 1JCRB 1V7VA 3VW5A 3WKGA 2BB5A 1KFGA 1N4RB 3AFJA 1V5DA 3RX7A 4D4DA 2JJBA 1V7WA 4ZRQA 1L1YA 2ZZRA 5IL8A 1KWFA 3QXFA 1LTXB 3HXBB 1RWAA 5EAUA 1KKTA 3EZ8A
chains in the Genus database with same CATH topology
2AHFA 1O6HA 1O5MB 4GTPB 3E30B 2ZBLA 3DSVB 1FT1B 4LNBB 5KKBA 1LF9A 1FT2B 1O6QA 2R2LB 1KZPB 1FMIA 3ON6A 1AYXA 4CJ0A 2H6FB 2AFAA 1QQFA 4FXKB 2A73B 3M72A 3QWTA 1GHQA 2VN7A 3RJ3A 1KRFA 3M74A 3OXUA 1FP3A 1H54A 3ANIA 1WU5A 3S4CA 3RX8A 2BB6A 3PZ2B 2VN4A 2OKXA 3EQAA 2SQCA 4GTQB 5CD2A 1VD5A 5M7YA 1O1TB 4C1SA 1IS9A 2XFGA 2FBAA 1D8DB 3SDUA 2G0DA 4WVAA 1DL2A 4AYPA 2CQTA 3DPYB 3WUXA 1TNOB 3W7WA 2EACA 4Z4JA 4L6XA 1LD8B 1DCEB 3PYBA 3WKHA 1AGMA 2WINB 3SFXB 1H3CA 2XWBB 1JS4A 4CJ1A 1TNUB 2PN5A 3QRYA 3W7XA 3QG0A 1G87A 1ULVA 1WZZA 1KS8A 4LNGB 4EL8A 1H36A 1L2AA 1O6RA 1H37A 2FUZA 4Q2BA 1NI1B 3SAEA 3HXCB 1TF4A 3QXQA 3Q78B 4J5TA 3W7TA 4WVBA 3Q7AB 1UMPA 1O1RB 3M7LA 3G6JB 1LD7B 2P0VA 1H12A 5AGDA 2V8IA 3A3VA 3QSPA 1KSCA 2H6HB 2XWJB 5GZKA 2V8JA 2AHGA 3Q7FB 1GLMA 4ZH5A 4V1RA 1XWQA 3DSTB 4BOKA 4EHMB 4V1SA 3CU7A 1G9JA 4KKJA 3Q73B 2F0YB 4LIXA 3E32B 4ZH1A 3W5MA 4MBGB 3E37B 4WVCA 4GL3A 1FO3A 2B39A 1WU4A 3QFYA 1IA6A 1WU6A 3E34B 1V7XA 4KKIA 1DOGA 1S63B 1V5CA 3SQCA 1TN8B 2RGKA 5GW7A 1KZOB 1XW2A 3TF4A 2D8LA 1NL4B 2WY7A 1H39A 3PZ4B 3H7LA 2B4FA 3WIRA 3WKIA 2A8ZA 2WYNA 1H35A 2EAEA 1SA4B 2YIKA 2ZIRB 1S64B 1N9AB 3SDTA 3PMMA 1H13A 3RRSA 2H6GB 3VXDA 1LF6A 1CEMA 1TN6B 1N95B 2EADA 3PZ3B 1UT9A 1H3AA 1RQ5A 4WU0A 1GAHA 3D5SA 4DODA 3KLSA 5FO8B 2BEDB 2V8KA 1FBOA 2CQSA 3GZKA 3WC3A 5JPNB 3M78A 3PZ1B 3Q79B 2JF4A 3KQ4A 4D4CA 3QT9A 3ANJA 3SDQA 3P5PA 3M76A 3DSXB 3K7XA 1X9DA 4LNVA 2DRRA 1NC5A 3H2WA 3DRAB 1W6JA 3M7EA 4GTTB 4YCRA 1GXOA 2F6DA 3QDEA 3M71A 2DRSA 3D5RA 1UG9A 2I07B 1N4QB 1NXCA 5FO9B 4GTRB 3ACSA 3RX5A 2BBCA 3EU5B 2FV1A 3M7BA 1KSDA 4D4AA 4L0GA 4AYQA 3WIQA 3KSQB 1N94B 2RI8A 2NVPA 1JCQB 3T33A 1GAIA 4YDEB 3PYAA 5FO7B 4D94A 3W7SA 3K11A 4GTMB 3HXDB 4L9PB 4YDOB 4AYOA 3M75A 2GZ6A 1H14A 2WIIB 3P2CA 1H3BA 1W6KA 1F9DA 1TNZB 1KREA 3X17A 4GTSB 3SDRA 1D8EB 1SA5B 1TNBB 2DROA 5CZLA 2NOJA 1MZCB 4TF4A 3QT3A 1O79A 3ACTA 5M7IA 4GTOB 4BOJA 1QBQB 1G9GA 3GLYA 4FUSA 4XUVA 5CA3A 4TXTA 3DSWB 1X81B 3GT5A 2Z07A 3WIWA 3RENA 1SQCA 2D5JA 4MU9A 3WKFA 3DSUB 1GXNA 3DSSB 3W5NA 2RI9A 3EUVB 2WY8A 5FOBB 4QT9A 4ZRPA 3M73A 2JG0A 4CE7A 3QPFA 2QNOA 1IA7A 3QFZA 1GSZA 1HCUA 3M7CA 1GA2A 3S4DA 2XQWA 2PMVA 4AYRA 2IEJB 1HZFA 3E6UA 1FAEA 2V3PA 2G02A 3W7UA 1GXMA 4KTPA 3EU8A 1FPPB 3P5RA 1F9OA 1TNYB 3OEDA 1QSJA 1N4SB 5DGRA 2GOXA 5DGQA 3HXFB 4KTRA 4ONTA 4M76A 5JPMB 3SFYB 3CIHA 1JCSB 1C3DA 5MEHA 2GH4A 4ZG8A 3RSYA 4DOEA 2V3NA 2EABA 3Q75B 3S4AA 4Q88A 3C72B 2ZISB 3H3KA 4JJJA 5GY3A 1N4PB 3D3IA 3KSLB 1CLCA 1O1SB 3S9VA 3E33B 1FCEA 3SDVA 1G6IA 2FV0A 1FO2A 4D4BA 3ANKA 3E73A 3HXEB 4GTVB 1R76A 3M77A 1FBWA 1TN7B 3S4BA 4FXGB 4Z4LA 5E2JA 1XWTA 2DRQA 2H6IB 1K72A 1JCRB 1V7VA 3VW5A 3WKGA 2BB5A 1KFGA 1N4RB 3AFJA 1V5DA 3RX7A 4D4DA 2JJBA 1V7WA 4ZRQA 1L1YA 2ZZRA 1KWFA 3QXFA 1LTXB 3HXBB 1KKTA 3EZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6H A;  3DRA B;  1W6J A;  1O5M B;  2WY8 A;  4GTP B;  3E30 B;  4GTT B;  5FOB B;  3Q7F B;  3DSV B;  1FT1 B;  4LNB B;  4V1R A;  1GXO A;  4ZRP A;  3DST B;  4BOK A;  4EHM B;  4V1S A;  1FT2 B;  3CU7 A;  1O6Q A;  3D5R A;  2R2L B;  4KKJ A;  1KZP B;  3Q73 B;  2I07 B;  1N4Q B;  2F0Y B;  5FO9 B;  2H6F B;  4GTR B;  1GSZ A;  2BBC A;  3EU5 B;  1QQF A;  3E32 B;  4FXK B;  4ZH1 A;  2A73 B;  4D4A A;  1GHQ A;  2XQW A;  4MBG B;  2PMV A;  3RJ3 A;  2IEJ B;  1HZF A;  3E37 B;  3OXU A;  3KSQ B;  1N94 B;  2B39 A;  2V3P A;  2G02 A;  3E34 B;  1JCQ B;  1GXM A;  4KKI A;  2BB6 A;  3PZ2 B;  4YDE B;  1FPP B;  5FO7 B;  4D94 A;  1S63 B;  2SQC A;  4GTQ B;  1TNY B;  3SQC A;  1TN8 B;  1O1T B;  1QSJ A;  3OED A;  1N4S B;  4C1S A;  1KZO B;  1D8D B;  2GOX A;  4GTM B;  3HXD B;  2G0D A;  1NL4 B;  4L9P B;  4YDO B;  3HXF B;  2WY7 A;  1H39 A;  4ONT A;  4M76 A;  5JPM B;  3SFY B;  3PZ4 B;  1JCS B;  2WII B;  1C3D A;  3DPY B;  1H3B A;  1TNO B;  1W6K A;  1LD8 B;  1TNZ B;  1DCE B;  1H35 A;  1SA4 B;  2V3N A;  4GTS B;  2ZIR B;  1S64 B;  1N9A B;  2WIN B;  1D8E B;  3Q75 B;  1SA5 B;  1TNB B;  3SFX B;  2H6G B;  1H3C A;  2NOJ A;  2XWB B;  1MZC B;  1TN6 B;  1TNU B;  2PN5 A;  3C72 B;  2ZIS B;  1N95 B;  1O79 A;  1N4P B;  3PZ3 B;  3KSL B;  4GTO B;  1O1S B;  1H3A A;  3E33 B;  1QBQ B;  4BOJ A;  4LNG B;  1H36 A;  1O6R A;  1H37 A;  4D4B A;  1NI1 B;  3D5S A;  3HXC B;  3HXE B;  4GTV B;  1R76 A;  3KLS A;  3Q78 B;  5FO8 B;  3DSW B;  1X81 B;  2BED B;  1TN7 B;  2V8K A;  3Q7A B;  4FXG B;  1UMP A;  1O1R B;  1SQC A;  2H6I B;  5JPN B;  3G6J B;  1LD7 B;  1JCR B;  3PZ1 B;  3Q79 B;  5AGD A;  2BB5 A;  2V8I A;  3KQ4 A;  1N4R B;  4MU9 A;  4D4C A;  3DSU B;  1GXN A;  4D4D A;  4ZRQ A;  2H6H B;  3DSX B;  3K7X A;  3DSS B;  2XWJ B;  1LTX B;  3HXB B;  2V8J A;  3EUV B;  4LNV A; 
#chains in the Genus database with same CATH topology
 2AHF A;  1O6H A;  1O5M B;  4GTP B;  3E30 B;  2ZBL A;  3DSV B;  1N21 A;  1FT1 B;  4LNB B;  5KKB A;  1LF9 A;  1FT2 B;  1O6Q A;  2R2L B;  1KZP B;  1N23 A;  3E80 A;  1FMI A;  3ON6 A;  1AYX A;  4CJ0 A;  2H6F B;  2AFA A;  1QQF A;  4FXK B;  5C05 A;  2A73 B;  3M72 A;  3QWT A;  1GHQ A;  5JMF A;  2VN7 A;  3RJ3 A;  1KRF A;  3M74 A;  2E22 A;  3OXU A;  1FP3 A;  1H54 A;  3M02 A;  5IL3 A;  3LZ9 A;  3ANI A;  1WU5 A;  3S4C A;  3RX8 A;  2BB6 A;  2BRW A;  2VN4 A;  3PZ2 B;  2OKX A;  1N22 A;  3EQA A;  2SQC A;  4GTQ B;  5CD2 A;  1VD5 A;  5M7Y A;  1O1T B;  4C1S A;  4GAX A;  1IS9 A;  4DI5 A;  2XFG A;  2FBA A;  1D8D B;  3SDU A;  1N1B A;  4OJZ A;  4OK4 A;  2G0D A;  4WVA A;  1N1Z A;  1DL2 A;  1HV6 A;  4AYP A;  2CQT A;  3DPY B;  3WUX A;  1TNO B;  3W7W A;  2EAC A;  4Z4J A;  4L6X A;  1LD8 B;  1X1J A;  1DCE B;  3NNB A;  3PYB A;  2Q1F A;  2WDA A;  3WKH A;  1AGM A;  2WIN B;  4OK2 A;  3SFX B;  1J0M A;  1H3C A;  2XWB B;  1JS4 A;  4CJ1 A;  1TNU B;  1N7R A;  2PN5 A;  3QRY A;  1HXA A;  2BRV X;  3W7X A;  3QG0 A;  1G87 A;  1ULV A;  1WZZ A;  1KS8 A;  4LNG B;  4EL8 A;  1H36 A;  1RW9 A;  1L2A A;  1O6R A;  1H37 A;  2FUZ A;  4Q2B A;  1NI1 B;  3SAE A;  5IM1 A;  3HXC B;  1HXC A;  1TF4 A;  3QXQ A;  3Q78 B;  4J5T A;  3VSM A;  3W7T A;  4WVB A;  3Q7A B;  1CB8 A;  1UMP A;  1O1R B;  1HMW A;  3M7L A;  3G6J B;  1LD7 B;  2P0V A;  1H12 A;  1N7N A;  5AGD A;  2V8I A;  4F10 A;  3A3V A;  3QSP A;  1KSC A;  2H6H B;  2XWJ B;  5GZK A;  2V8J A;  2BRP A;  1QAZ A;  2AHG A;  3Q7F B;  1GLM A;  3M00 A;  1LOH A;  4ZH5 A;  4V1R A;  1XWQ A;  3DST B;  4BOK A;  4EHM B;  5ILZ A;  4V1S A;  3CU7 A;  1G9J A;  4KKJ A;  3Q73 B;  2F0Y B;  4LIX A;  3E32 B;  4ZH1 A;  3W5M A;  4MBG B;  4E1Y A;  3E37 B;  4WVC A;  4GL3 A;  1FO3 A;  2B39 A;  3G4D A;  1N24 A;  1WU4 A;  3QFY A;  1IA6 A;  1WU6 A;  3E34 B;  1V7X A;  4KKI A;  1HMU A;  1DOG A;  4RNQ A;  1HXG A;  1S63 B;  1V5C A;  3SQC A;  1TN8 B;  2RGK A;  5GW7 A;  4FJQ A;  1KZO B;  1XW2 A;  3TF4 A;  2D8L A;  1NL4 B;  2WY7 A;  1H39 A;  5ILY A;  5ILI A;  3PZ4 B;  3H7L A;  2B4F A;  3WIR A;  3AFL A;  3WKI A;  2A8Z A;  2WCO A;  2WYN A;  3N0F A;  4MMI A;  1H35 A;  2EAE A;  1SA4 B;  2YIK A;  2ZIR B;  1S64 B;  1N9A B;  3SDT A;  3PMM A;  1H13 A;  1N7O A;  4OZV A;  3RRS A;  5ILH A;  2H6G B;  3VXD A;  1LF6 A;  1CEM A;  1TN6 B;  1N95 B;  2EAD A;  3PZ3 B;  1UT9 A;  1H3A A;  1RQ5 A;  5IK0 A;  4WU0 A;  1J0N A;  1GAH A;  3D5S A;  4DOD A;  3KLS A;  5FO8 B;  2BED B;  2V8K A;  1FBO A;  2CQS A;  3GZK A;  3WC3 A;  5JPN B;  3M78 A;  3PZ1 B;  3Q79 B;  2JF4 A;  3KQ4 A;  4D4C A;  3QT9 A;  3ANJ A;  3SDQ A;  3P5P A;  4F13 A;  2FUQ A;  3M76 A;  3DSX B;  3K7X A;  1X9D A;  1HM2 A;  4NEI A;  4LNV A;  2DRR A;  1NC5 A;  3H2W A;  3DRA B;  1W6J A;  3M7E A;  4GTT B;  4YCR A;  1GXO A;  1LXK A;  2F6D A;  3QDE A;  5ILD A;  3N0G A;  3M71 A;  2DRS A;  3D5R A;  1UG9 A;  2I07 B;  1N4Q B;  1NXC A;  5FO9 B;  4GTR B;  3ACS A;  3RX5 A;  2BBC A;  3EU5 B;  2FV1 A;  3M7B A;  1KSD A;  1RWC A;  4D4A A;  4L0G A;  4AYQ A;  3WIQ A;  3KSQ B;  1N94 B;  2RI8 A;  2FUT A;  2NVP A;  1JCQ B;  1HM3 A;  3T33 A;  1GAI A;  4YDE B;  3PYA A;  1OJM A;  2ONG A;  5FO7 B;  4D94 A;  5ILK A;  5JMD A;  3W7S A;  3K11 A;  3M01 A;  4GTM B;  3HXD B;  4L9P B;  4YDO B;  4AYO A;  3M75 A;  2GZ6 A;  5EAT A;  1H14 A;  2WII B;  4FNV A;  3P2C A;  1H3B A;  1N20 A;  1W6K A;  1F9D A;  1TNZ B;  1HN0 A;  1KRE A;  3X17 A;  4GTS B;  3SDR A;  1D8E B;  1N7Q A;  1SA5 B;  1TNB B;  2DRO A;  2J5C A;  2NOJ A;  5CZL A;  1MZC B;  4TF4 A;  3QT3 A;  1O79 A;  3ACT A;  5M7I A;  4GTO B;  5ILJ A;  5IKA A;  4BOJ A;  1QBQ B;  5IK6 A;  1X1I A;  1G9G A;  3GLY A;  1EGU A;  4FUS A;  4XUV A;  5CA3 A;  4TXT A;  3DSW B;  1X81 B;  3GT5 A;  2Z07 A;  1W3Y A;  3REN A;  3WIW A;  1SQC A;  2D5J A;  1N7P A;  4MU9 A;  3WKF A;  2ONH A;  3DSU B;  1GXN A;  3DSS B;  3W5N A;  2RI9 A;  3EUV B;  2X03 A;  2WY8 A;  5FOB B;  4QT9 A;  4ZRP A;  3M73 A;  2JG0 A;  4CE7 A;  3QPF A;  2QNO A;  1IA7 A;  3QFZ A;  1RWH A;  1GSZ A;  1HCU A;  3M7C A;  1GA2 A;  3S4D A;  2XQW A;  2PMV A;  1X1H A;  4AYR A;  2IEJ B;  1HZF A;  3E6U A;  1FAE A;  3E7J A;  1RWF A;  2V3P A;  2G02 A;  3W7U A;  1GXM A;  4KTP A;  3EU8 A;  1FPP B;  3P5R A;  1F9O A;  2E24 A;  1TNY B;  3OED A;  1QSJ A;  5IK9 A;  1N4S B;  4OZW A;  5DGR A;  1I8Q A;  1OJN A;  2GOX A;  5DGQ A;  3HXF B;  5DHI A;  1C82 A;  4KTR A;  4ONT A;  4M76 A;  5JPM B;  3SFY B;  3CIH A;  1JCS B;  1C3D A;  5MEH A;  2GH4 A;  4ZG8 A;  3RSY A;  4DOE A;  2V3N A;  1F9G A;  2EAB A;  3Q75 B;  3S4A A;  4Q88 A;  3C72 B;  2ZIS B;  3H3K A;  4JJJ A;  5GY3 A;  1N4P B;  3D3I A;  3KSL B;  1CLC A;  1O1S B;  3S9V A;  3E33 B;  1FCE A;  1HX9 A;  3SDV A;  1G6I A;  3G4F A;  1LXM A;  1FO2 A;  1OJO A;  2FV0 A;  4D4B A;  3ANK A;  3E73 A;  3HXE B;  4GTV B;  1R76 A;  3M77 A;  1F1S A;  1OJP A;  1RWG A;  1FBW A;  1TN7 B;  3S4B A;  5IKH A;  4MMH A;  4FXG B;  4Z4L A;  3VSN A;  5E2J A;  5EAS A;  3A0O A;  5DHK A;  1XWT A;  2DRQ A;  2H6I B;  3NFV A;  1K72 A;  1JCR B;  1V7V A;  3VW5 A;  3WKG A;  2BB5 A;  1KFG A;  1N4R B;  3AFJ A;  1V5D A;  3RX7 A;  4D4D A;  2JJB A;  1V7W A;  4ZRQ A;  1L1Y A;  2ZZR A;  5IL8 A;  1KWF A;  3QXF A;  1LTX B;  3HXB B;  1RWA A;  5EAU A;  1KKT A;  3EZ8 A; 
#chains in the Genus database with same CATH homology
 2AHF A;  1O6H A;  1O5M B;  4GTP B;  3E30 B;  2ZBL A;  3DSV B;  1FT1 B;  4LNB B;  5KKB A;  1LF9 A;  1FT2 B;  1O6Q A;  2R2L B;  1KZP B;  1FMI A;  3ON6 A;  1AYX A;  4CJ0 A;  2H6F B;  2AFA A;  1QQF A;  4FXK B;  2A73 B;  3M72 A;  3QWT A;  1GHQ A;  2VN7 A;  3RJ3 A;  1KRF A;  3M74 A;  3OXU A;  1FP3 A;  1H54 A;  3ANI A;  1WU5 A;  3S4C A;  3RX8 A;  2BB6 A;  3PZ2 B;  2VN4 A;  2OKX A;  3EQA A;  2SQC A;  4GTQ B;  5CD2 A;  1VD5 A;  5M7Y A;  1O1T B;  4C1S A;  1IS9 A;  2XFG A;  2FBA A;  1D8D B;  3SDU A;  2G0D A;  4WVA A;  1DL2 A;  4AYP A;  2CQT A;  3DPY B;  3WUX A;  1TNO B;  3W7W A;  2EAC A;  4Z4J A;  4L6X A;  1LD8 B;  1DCE B;  3PYB A;  3WKH A;  1AGM A;  2WIN B;  3SFX B;  1H3C A;  2XWB B;  1JS4 A;  4CJ1 A;  1TNU B;  2PN5 A;  3QRY A;  3W7X A;  3QG0 A;  1G87 A;  1ULV A;  1WZZ A;  1KS8 A;  4LNG B;  4EL8 A;  1H36 A;  1L2A A;  1O6R A;  1H37 A;  2FUZ A;  4Q2B A;  1NI1 B;  3SAE A;  3HXC B;  1TF4 A;  3QXQ A;  3Q78 B;  4J5T A;  3W7T A;  4WVB A;  3Q7A B;  1UMP A;  1O1R B;  3M7L A;  3G6J B;  1LD7 B;  2P0V A;  1H12 A;  5AGD A;  2V8I A;  3A3V A;  3QSP A;  1KSC A;  2H6H B;  2XWJ B;  5GZK A;  2V8J A;  2AHG A;  3Q7F B;  1GLM A;  4ZH5 A;  4V1R A;  1XWQ A;  3DST B;  4BOK A;  4EHM B;  4V1S A;  3CU7 A;  1G9J A;  4KKJ A;  3Q73 B;  2F0Y B;  4LIX A;  3E32 B;  4ZH1 A;  3W5M A;  4MBG B;  3E37 B;  4WVC A;  4GL3 A;  1FO3 A;  2B39 A;  1WU4 A;  3QFY A;  1IA6 A;  1WU6 A;  3E34 B;  1V7X A;  4KKI A;  1DOG A;  1S63 B;  1V5C A;  3SQC A;  1TN8 B;  2RGK A;  5GW7 A;  1KZO B;  1XW2 A;  3TF4 A;  2D8L A;  1NL4 B;  2WY7 A;  1H39 A;  3PZ4 B;  3H7L A;  2B4F A;  3WIR A;  3WKI A;  2A8Z A;  2WYN A;  1H35 A;  2EAE A;  1SA4 B;  2YIK A;  2ZIR B;  1S64 B;  1N9A B;  3SDT A;  3PMM A;  1H13 A;  3RRS A;  2H6G B;  3VXD A;  1LF6 A;  1CEM A;  1TN6 B;  1N95 B;  2EAD A;  3PZ3 B;  1UT9 A;  1H3A A;  1RQ5 A;  4WU0 A;  1GAH A;  3D5S A;  4DOD A;  3KLS A;  5FO8 B;  2BED B;  2V8K A;  1FBO A;  2CQS A;  3GZK A;  3WC3 A;  5JPN B;  3M78 A;  3PZ1 B;  3Q79 B;  2JF4 A;  3KQ4 A;  4D4C A;  3QT9 A;  3ANJ A;  3SDQ A;  3P5P A;  3M76 A;  3DSX B;  3K7X A;  1X9D A;  4LNV A;  2DRR A;  1NC5 A;  3H2W A;  3DRA B;  1W6J A;  3M7E A;  4GTT B;  4YCR A;  1GXO A;  2F6D A;  3QDE A;  3M71 A;  2DRS A;  3D5R A;  1UG9 A;  2I07 B;  1N4Q B;  1NXC A;  5FO9 B;  4GTR B;  3ACS A;  3RX5 A;  2BBC A;  3EU5 B;  2FV1 A;  3M7B A;  1KSD A;  4D4A A;  4L0G A;  4AYQ A;  3WIQ A;  3KSQ B;  1N94 B;  2RI8 A;  2NVP A;  1JCQ B;  3T33 A;  1GAI A;  4YDE B;  3PYA A;  5FO7 B;  4D94 A;  3W7S A;  3K11 A;  4GTM B;  3HXD B;  4L9P B;  4YDO B;  4AYO A;  3M75 A;  2GZ6 A;  1H14 A;  2WII B;  3P2C A;  1H3B A;  1W6K A;  1F9D A;  1TNZ B;  1KRE A;  3X17 A;  4GTS B;  3SDR A;  1D8E B;  1SA5 B;  1TNB B;  2DRO A;  5CZL A;  2NOJ A;  1MZC B;  4TF4 A;  3QT3 A;  1O79 A;  3ACT A;  5M7I A;  4GTO B;  4BOJ A;  1QBQ B;  1G9G A;  3GLY A;  4FUS A;  4XUV A;  5CA3 A;  4TXT A;  3DSW B;  1X81 B;  3GT5 A;  2Z07 A;  3WIW A;  3REN A;  1SQC A;  2D5J A;  4MU9 A;  3WKF A;  3DSU B;  1GXN A;  3DSS B;  3W5N A;  2RI9 A;  3EUV B;  2WY8 A;  5FOB B;  4QT9 A;  4ZRP A;  3M73 A;  2JG0 A;  4CE7 A;  3QPF A;  2QNO A;  1IA7 A;  3QFZ A;  1GSZ A;  1HCU A;  3M7C A;  1GA2 A;  3S4D A;  2XQW A;  2PMV A;  4AYR A;  2IEJ B;  1HZF A;  3E6U A;  1FAE A;  2V3P A;  2G02 A;  3W7U A;  1GXM A;  4KTP A;  3EU8 A;  1FPP B;  3P5R A;  1F9O A;  1TNY B;  3OED A;  1QSJ A;  1N4S B;  5DGR A;  2GOX A;  5DGQ A;  3HXF B;  4KTR A;  4ONT A;  4M76 A;  5JPM B;  3SFY B;  3CIH A;  1JCS B;  1C3D A;  5MEH A;  2GH4 A;  4ZG8 A;  3RSY A;  4DOE A;  2V3N A;  2EAB A;  3Q75 B;  3S4A A;  4Q88 A;  3C72 B;  2ZIS B;  3H3K A;  4JJJ A;  5GY3 A;  1N4P B;  3D3I A;  3KSL B;  1CLC A;  1O1S B;  3S9V A;  3E33 B;  1FCE A;  3SDV A;  1G6I A;  2FV0 A;  1FO2 A;  4D4B A;  3ANK A;  3E73 A;  3HXE B;  4GTV B;  1R76 A;  3M77 A;  1FBW A;  1TN7 B;  3S4B A;  4FXG B;  4Z4L A;  5E2J A;  1XWT A;  2DRQ A;  2H6I B;  1K72 A;  1JCR B;  1V7V A;  3VW5 A;  3WKG A;  2BB5 A;  1KFG A;  1N4R B;  3AFJ A;  1V5D A;  3RX7 A;  4D4D A;  2JJB A;  1V7W A;  4ZRQ A;  1L1Y A;  2ZZR A;  1KWF A;  3QXF A;  1LTX B;  3HXB B;  1KKT A;  3EZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...