4M77D

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 75
sequence length 75
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77D00
4QVDA 5LJ5h 1Y96B 2RB6A 4M7AE 4C92F 4M75F 4A54A 2CGHA 1HXDA 3SB2A 4C8QF 3V7SA 4RCCA 2VXFA 3RKXA 5LJ5e 2E41A 5LJ3e 2DXUA 3RESA 5GANh 4M7AF 4M78A 4XTWA 5LJ3d 3JB9F 5GAN4 3JCMd 3V8LA 2FYKA 2DEQA 1WQWA 4M78F 3BFMA 2ZGWA 5GAOm 5GAN2 3JCMW 3JCMb 5GAMj 2DTHA 2DTIA 3INZA 3VU3C 4MMKA 1KQ1A 4C92B 2EJFA 5GANe 4PJOC 5GAMg 1BIAA 1KQ2A 1H641 4HA8A 4NL3A 3L1AA 5GANd 4C92E 1I8FA 4HT9A 3RERA 4PNOA 4JUVA 4N0AC 1U1SA 1BIBA 1JBMA 5DY9A 2E65A 2EJGA 3JB9H 2YHTA 2FB7A 4M78B 4RCBA 5GAN7 2DVEA 4X9DA 3JCMc 5LJ3f 5LJ5f 3JCMJ 2DKGA 2RM4A 5GAOq 2HNIA 4EMKC 4M78E 2E1HA 3SWNA 3EFSA 1M5Q1 5GMKi 4A53A 5GMKj 5GAOl 5LJ5d 5GAOp 4PJOG 3V7RA 3JCMg 3RKWA 4M77C 1HK9A 5GANf 2DZ9A 3FJPA 4F7UA 5GAMh 4M77D 4M7DC 3QUIA 4M7DG 2I2LA 4M75C 4OP0A 4F7UG 5LJ3j 1B34A 5GAN8 4Y91A 4PJOD 4EMKA 4C8QC 1D3BA 5LJ3g 2YLCA 1WNLA 4M75D 1B34B 5GAMe 4XTZA 4C8QD 3RKYA 2DTOA 2K57A 1D3BB 3L2ZA 1WQ7A 4J6WA 5GMKm 4M7AC 2YLBA 5GAN6 4NL2A 4M77A 3RUXA 3JCMP 5GAOr 5GAOn 4JRKA 5GAN5 4M7AD 1LNXA 5GANj 4M78C 2DJZA 4QVCA 3JB9D 4NOYA 3QSUA 3V8KA 5I21A 5GANg 4M77G 4PJOA 1M8VA 3BY7A 4M75A 2EAYA 5GMKh 2EJ9A 3HFNA 3JCMh 4V2SA 4PJOB 1I81A 1MGQA 3QO3A 3SWNB 1JRIA 3HFOA 4C8QA 1TH7A 2VXEA 3JCMX 3JCMQ 1WPYA 4XU0A 1I4K1 4M75G 4J6YA 4N0AA 4PJOE 4M7AA 4C8QG 3FB9A 3RIRA 5GMKe 3JCMe 4MMLA 1N9RA 4F7UB 1Y96A 4M7DF 5LJ5j 4C92C 4M7DD 4M7AG 4JLIA 2E64A 4DQ2A 5GAMf 5GAN3 3JB9G 4XTUA 4PJOF 5CAIA 5GMKl 5LJ5g 4C92D 3HSBA 4F7UE 3JB9I 2DZCA 4M78G 4EMKB 4WF2A 4XU2A 3JB9J 3JCMV 4XU3A 1I5LA 5GAMd 4XU1A 4J6XA 4XQ3A 3EFRA 3FIFA 2Y90A 1X01A 3AHUA 4F7UF 4M77B 4M7DA 2QTXA 1LJOA 4X9CA 4M78D 4C92A 4M7DB 4EMGA 2DXTA 1LOJA 4M77E 3BDUA 4XTVA 2EWNA 4M75B 1U1TA 3PGGA 3QHSA 4HT8A 3SWNC 4C92G 4M7DE 3JCMf 4C8QB 2RA2A 3BW1A 4XTYA 3GIBA 2JN0A 2RD1A 4M75E 1YCYA 3M4GA 1N9SA 4M77F 3V8JA 2E10A 4XTXA 4C8QE 4M7AB 4JRIA 2VC8A 5LJ3h 4EMHA 4J5YA 3V7CA
chains in the Genus database with same CATH superfamily
1QMCA 3CCRQ 4A54A 1V76A 1Q82R 2CP3A 1V1CA 2FZCB 5L23A 3VKIA 1YIJA 2OTLA 1MV0B 4XTWA 4J9HA 3CCJQ 2HD0A 2L2PA 5AYFA 1S1NA 3M55A 2MMPA 2JMCA 5KCHA 3M53A 2CSIA 2JZ2A 3HPWA 1M1GA 3CXCP 2ED1A 1YITT 2GFUA 3CC2A 1TG0A 1EIFA 5GAOq 1AWJA 1Q81C 1VQPQ 1AZEA 2PVDB 3FEOA 5A2QE 1KD1U 1VQMT 2AKLA 1AT1B 3OS0A 3TSZA 4LD6A 2X4XA 2J05A 2C0TA 1D3BA 5LJ3g 1WHHA 5GAMe 1ZSZB 4XTZA 2OAUA 1ZA1B 4NL2A 3RUXA 3OS1A 1ZUYA 4D8KA 1AD5A 4M7AD 4QVCA 3QSUA 2MWPA 4MDWA 1X43A 3NHNA 5GMKh 3X20B 2CP0A 3JCMQ 1WI7A 2XG8D 2HSEB 4WCIA 2JNGA 3FB9A 2YDLA 3OB9A 1Y96A 3X24B 2ZPHB 3VS1A 2OTJT 4EMKB 5A0LA 4WF2A 4O6JA 1UHFA 1M2VA 2CT4A 3H0HA 2NUPB 3RMSA 1N8RU 4AFUC 3CCVA 2IIMA 1BCOA 3OY9A 4LDVA 1YJ9T 1K73C 2XHCA 3GIBA 3U23A 2C06A 4IIOA 2HKQB 2GGRA 2YXYA 1O9SA 3QBYA 1Q86C 4HXJA 2GQIA 2HDAA 1XJWB 2BZXA 2AZVA 4EPCA 3S3OA 5GAOm 1VQ5A 3CCSQ 3CXCS 4FT4A 5GAMj 3L2VA 1VQ4T 3M0PA 4FSSA 4LUEA 2O4XB 3QPHA 3MP1A 1WJSA 5FROA 4RUGA 3PMIA 4P5NA 3A1PA 1OPLA 4RKUE 2EJGA 3LH5A 5FU7B 2COWA 3C4SA 1QVGA 2EYWA 1VQ6Q 4EMKC 2QA4T 1U06A 2FZKB 3CPFA 5KYYB 2A28A 2DYIA 3CMAT 1AWOA 3QUIA 4DOVA 1NJIR 4C0ZA 3QJYA 2DFUA 4ZNXA 4M77A 1LNXA 2FPEA 2DL3A 1LCKA 1OX8A 2RQUA 2KXCA 3AT1B 2X9HA 1CSKA 5D6XA 1MV3A 1WPYA 3I9QA 3KBGA 1SPKA 4J6YA 3PNWC 3OMCA 4DA4A 4ZN3A 2KGTA 1U5SA 2A37A 4ESRA 1M3CA 4F7UB 1OV3A 4M7AG 5CAIA 1GFCA 4FSXA 4FYXB 3OYHA 1YITA 3M56A 2LT1A 1D1CA 3OW2P 2DIQA 2KRSA 3EFRA 2Y90A 1YCSB 4PK4A 5FU7C 4IUQA 2WSEE 4KGZB 3E9FA 3A8MB 2LQKA 1RAFB 1VQMA 1Y57A 2XMFA 4F14A 2O88A 1EX4A 3VRZA 4FT2A 3G4ST 2FPDA 2QQAA 2XK0A 2E10A 1RUWA 2HQEA 2EGEA 2QQBA 2JXBA 4DBQA 4PJMA 1K8AR 2X3XD 3OYLA 2XDPA 4E47A 4HVWA 2HKNA 3OBWA 1SHFA 3ULRB 2Z0WA 5GAN2 1K0SA 5GANe 5GANd 1VIFA 4HVUA 3UPUA 2OTJA 1ZX6A 4A4KA 3I55Q 3BE3A 5GAN7 5IXBA 5LJ5f 1GBRA 3PFSA 4M78E 5D6WA 2A7YA 4RG8A 1M5Q1 2PVGB 4FYVB 1PC0A 2ZPFB 2JVVA 2K7AA 1YI2A 3FJPA 1YJ9A 5KYUA 2CSQA 2F1LA 3RR6A 3OYMA 2EYZA 4ORZA 3REBB 2LRQA 2M0OA 3L2ZA 2DXCA 2G6FX 2D0NA 2DNUA 4N4IA 3M0TA 3V8KA 5FWCA 2QQRA 3GNFB 2MPXC 1VQ4A 3GP8A 4PLLA 1OU9A 5FRNA 3ASKA 4BDZA 1NYFA 1KD1C 2RHZA 3VS7A 4XU1A 2KY9A 2QA4A 5CKFA 4BB7A 3I56T 1FXXA 4LD9K 3TSWA 4C92A 2ECZA 1VQKQ 2E5KA 4M75B 1ZHIA 1SG5A 3CMAA 4DEXA 1HD3A 1WXBA 4ME7A 2OAWA 3QXEB 4JRIA 5LJ5h 3V7CA 4C92F 5J39A 2EQJA 2VXFA 1WDXA 2L3QA 2BKDN 3X25B 1VQ8Q 1QVFP 3SEMA 3RESA 2CDTA 2KRNA 4XK8E 2NUTB 2FYKA 1VQOA 4IUTA 1KQ1A 4OMNA 2F2WA 1Q81U 4JS4A 1YIJQ 2OTLQ 1K1ZA 4PFPA 4F17A 3OYNA 2J6KA 3RERA 2PUKB 3M57A 4A63B 1Q7YU 1WHGA 4O5VA 2E1HA 3MEWA 3NFCA 5KYYA 5HK0A 2L3RA 3RKWA 3PVLA 3CC2Q 4RG2A 1YP5A 1Y0MA 4M75C 1FYNA 4B6MA 4A4GA 4CC2A 2DTOA 3RNJA 2JS0A 1E6GA 1C1AA 2L3SA 4R0KA 2P0QA 2RHIA 2AHJB 3CBOA 1FMWA 5GANg 1WX6A 2ZCFB 1FWZA 3HFNA 1UGPB 5GJWB 1WHLA 3HFOA 2QXFA 3UWNA 1K0XA 2MIOA 3KUFA 5GMKe 1KK7A 4JLIA 1S72T 4AFZC 2ESWA 2KVQG 4F7UF 2I0NA 1KIKA 2RMOA 2F69A 3PGGA 3QHSA 4C5GA 4RMOA 1RAAB 4PFOA 1G83A 1QVFS 3CCVQ 2CUDA 4C8QE 2EPDA 1NZ9A 1M1KR 3JCMd 1Y96B 1R0CB 3D7SB 3QZ9B 2DYBA 2CGHA 4E7JA 3V7SA 4FCYA 2ROLA 5GAN4 2QI2A 3JCMW 2HL3A 4OVAA 1JJ2S 3HL8A 2XU8A 1OU8A 1OULA 4PLIA 3QZ5B 2EKOA 4KULA 4PJLA 3JB9H 2VGNA 4LDWA 2VWFA 3OYCA 4OMQA 2KR3A 3I56A 4BD3A 2LT4A 1WHMA 5GMKj 1OOTA 2W10A 5GAOl 2KMTA 4E6RA 9ATCB 5CKDA 1IHVA 2MWOA 3J81E 2DRMA 1QLYA 1UGRB 4OP0A 6AT1B 2XKOC 3VS5A 2QGGA 1M8MA 4DBRA 2EQIA 2FEIA 2HAXA 5IHNA 3PE0A 2V26A 4M78C 4J9BA 1VYTA 3MEVA 3I35A 7AT1B 4AFQC 1EZZB 3JRZA 3A98A 3ZEHA 3JCMJ 1VQ7T 1PHTA 2LNHB 2P4TA 3H8ZA 4HKEA 2D9TA 2FVUA 2DJQA 2F2VA 2O9SA 3C94A 4A4FA 2RQVA 5IH2A 1IGUA 2E5QA 3T9NA 1IGQA 1MHNA 1XNIA 3CQTA 4BE1A 3LWIA 3E9GA 4M77B 4E7IA 3I5SA 4X9CA 1YITQ 5FWBA 2QEXA 4HCBA 4M7DB 4EMGA 1K9AA 2QQ9A 3BDUA 5LL6S 2QQSA 2CH4W 2QDYB 3EG9B 4JZ4A 4UC4A 2VUBA 4MDXA 1IRXA 1VQMQ 1W2BA 2CZ6B 2ZAEA 3JV3A 2RB6A 4M75F 3C0CA 3VS0A 3EG1A 2R5MA 3EGDA 2CREA 5M9OA 3V8LA 1VOMA 1M90R 4B9XA 4J9IA 3QYGB 2K5IA 1G3SA 1VQLT 2PQWA 4HA8A 4NL3A 4PFZA 3DB3A 1NBEB 2CUBA 4PNOA 1K9MC 2QGFB 1U1SA 3DLLA 2D8HA 4OMFB 2FB7A 5HKCA 1Y71A 1RAIB 2RM4A 1PSEA 5KE3A 2X35A 3MEUA 1WZOA 5KYXA 2OTJQ 4CC3A 3QIIA 4BDYA 2VYTA 1PNJA 2K9GA 1UJ0A 3JCMg 4M77C 1Q95G 1Q82U 2ZPBB 4M7DC 2CP2A 1YJNA 3OSSC 1YI2Q 1YJ9Q 4J83A 1CKBA 4QT7A 1WQ7A 8AT1B 3M58A 3JCMP 2KRMA 5GAOn 5J26A 2AT1B 2HBWA 2LCSA 1VYVA 3NMZC 4JS5A 1IREB 1GXIE 4PJOB 1TH7A 5FW9A 3UDCA 1Q7YC 4CC7A 3OMGA 3CC7T 1D0YA 4GLKA 1ZBXA 5KYUB 3Q1JA 5GJVB 4OF1A 2ABLA 1VQ4Q 1BI2A 1M2OA 1JO8A 4JLGA 5GAMd 1QVFA 4L5GA 1HSQA 5CIUA 4CRIA 2DL7A 1YWOA 1GL5A 2P0KA 1BKBA 5HCKA 2IG0A 2QA4Q 2L3PA 1VQ9T 1GCPA 2QTVA 4QQGA 2HQXA 4XTXA 4LDXA 3H41A 4M78A 2CS7A 3EHQA 3CMAQ 4M7AE 1JJ2A 4QVZA 2RH2A 2LX7A 3CC4T 2CP6A 5LJ5e 2E41A 2JJ9A 1M3BA 3H0FA 2AIRB 1J3TA 3SHWA 2COYA 3VS2A 1A0NB 2LX9A 4LN2A 1OPKA 1T0JA 4OGCA 2DEQA 4HCZA 1VQ7A 4M78F 4ZGJB 2DEUA 3QWYA 4C92B 4OGEA 4PJOC 1B07A 5L8RE 1N8RR 2HQHA 1VA7A 4DOWA 1VQOQ 3FRNA 4FM4B 1BIBA 4FU6A 1KQSP 2MOXA 3CCJT 3C12A 4KUDK 1UHCA 3REAB 3O5ZA 3NTKA 2V8JA 1RLPC 1H8KA 2DZ9A 3PIPA 4KT0E 2YRCA 4JPBW 1NEGA 3VUZA 4F7UG 5GAN8 2LJ3A 4D8DA 1PD1A 2GF7A 1ABQA 4M75D 1X69A 3OYYA 4J6WA 5GMKm 4J7IA 5CK9A 1NM7A 2YLBA 5J3BA 1OQKA 2MF2A 4F16A 5GAN5 3A5ZB 3UA6A 2EBPA 1OYXA 2EW3A 3ER0A 4KUIA 1MGQA 1H3HA 2RHYA 2VXEA 2RF0A 1WIEA 4MMLA 5LJ5j 4JZ3A 4C92C 4IIMA 3GF5A 2JOYA 2LQWA 4FYYB 2DZCA 1AWWA 1WXUA 5CQXA 1W4SA 4M7DA 3OYDA 1PRMC 2A36A 2DD4A 4GY5A 4F04B 3EG9A 1BU1A 2FPFA 3SWNC 2LMJA 3WVDB 3ZFJA 4DBFA 1N9SA 2LQNA 4M77F 4DBHA 1WXTA 2RQWA 1M4ZA 2NYSA 4M7DF 1G8XA 4DEYA 4QVDA 1XOVA 4IURA 3A8OB 1QCNA 1R77A 3G71T 3EHRA 2YUOA 1QWFA 4IUUA 4GLMA 2D1XA 5IXFA 1TWBA 2H3EB 1OZ3A 2EJFA 8ATCB 3CC7A 5GAMg 4OMMA 4M4ZA 4LDUA 1B3QA 1KC8R 2M16A 1XTDA 3OYAA 1SEMA 3URGA 1JQQA 5DY9A 5FRMA 2KNBB 1RI9A 2M9UA 3S3NA 1SKUB 3CCST 1QP3A 4RTWA 2HNIA 5CQYA 2EFIA 2D6FA 1TS9A 2GQVA 2BTTA 2GTJA 1N27A 4KH0B 3OYEA 1VQ9A 2F5TX 2YWWA 3I56Q 1P92A 3CPWP 1UB4A 4BE0A 1VQ6T 2JTEA 1G3YA 1B34B 4EDUA 4E7ZA 1TOVA 2RHXA 3CD6T 3QWXX 4XAXB 2SRCA 4PJOA 1M3AA 1E6HA 4J9CA 1R0BG 5I2MA 4HCKA 4C8QA 1JRIA 2MK5A 2R58A 4M75G 2XIDA 4JJBA 1M9SA 2O9VA 3FLGA 3M59A 1YBYA 4OB2B 3DB4A 4PJOF 1WFWA 1QVPA 2BE9B 1BI0A 2K5FA 1WYXA 2DETA 1D1BA 1Q82C 1I1JA 1RACB 4BY6B 2RJFA 3EG2A 4N4HA 4JRPA 2RN8A 4VUBA 3EAEA 4AG1C 1U1TA 4HT8A 1ZUUA 4BUGA 4QKUA 4XTYA 3OW2S 2M1HA 3TCJA 3OA6A 4AFSC 4MZPA 2QEXQ 1NLPC 1W6XA 4Z89A 1KJWA 5FLXE 1B7TA 2DILA 2HMAA 4ELYC 3E1SA 4JRQA 1K9MU 2NLUA 1W70A 3VYHB 1I07A 2FRYA 2ZGWA 1I0CA 2KI7A 4MMKA 3L1AA 1YWPA 1VYUA 1UGSB 2RJEA 2V1QA 4N0AC 3CXCA 1QWEA 1SHGA 1NYGA 2YHTA 3LX7A 1V29B 3CCUT 2YRVA 3SWNA 4Y28E 3CPWS 5EC7A 3QDRB 2K3BA 1NPRA 2ENMA 3EGDB 4L59A 3V7RA 1HK9A 3EGXA 4BY6C 1UEBA 3I55T 4M77D 4IUPA 1WGSA 2GNCA 1PSFA 1OEBA 1ZSGA 2W0ZA 2K79A 4AT1B 1BI1A 1WNLA 1LPLA 2PUOB 3QYHB 2NWMA 4QQ6A 1Q81R 3E2UA 5GAN6 1MMDA 3G71A 3EH2A 1BB9A 1YJNQ 1NG2A 3M54A 5I21A 4J9FA 5KYXB 2DL5A 2X4JA 4E7LA 1YN8A 3A8LB 1G2BA 3G4SA 1EFNA 1N9RA 2NUZA 2MYSA 1ARKA 1O75A 3EFOA 3VYGA 3L2UA 4FIBA 3C95A 3H9NA 3MO8A 4M78G 2QDLA 3EH1A 2DK3A 4XU2A 2BUDA 2EGAA 4XU3A 4J6XA 3MP6A 1T3LA 3AHUA 2HEQA 3S6WA 3G6ET 4QQDA 1IB8A 2JS2A 2H3JA 1G3WA 1YJWT 5CKEA 2RK2A 4A4EA 4CI0C 3CCQT 1BI3A 1GCQA 4KRTA 3V8JA 1RI0A 2XDDA 2O01E 5CR2A 4BACA 4J5YA 1PM3A 3MJXA 1WHKA 1YHQT 1U8RA 3EGUA 1LVKA 3CD6A 2DD5A 5C0MA 4RCCA 3CCET 2YUQA 3LLRA 2JT4A 2LQ8A 2QG9B 2WACA 5IAYA 2EYQA 1GFDA 1UECA 1K73R 4RTVA 2K6DA 2P84A 4AG2C 3WVEB 1KQ2A 4FYWB 1PKTA 2JUFA 2WSCE 3RBBB 4HT9A 1VQ7Q 1X27A 1X6GA 2GBQA 1PRLC 3JAME 3J80E 1Q86R 4M78B 4RCBA 3LH0A 4CC4B 1QVGP 2DL4A 3MHXA 1TU0B 3A8GB 4LDYA 2D0QB 2R5AA 1AOJA 1B34A 2BIVA 2E4HA 2YLCA 2IPOB 2K57A 4C0FA 1K4US 1DJ7B 2LC4A 3NTHA 4ZGEB 1HJDA 2OX7A 3I5RA 4M77G 1M8VA 3GBQA 4Y92A 1X6BA 2HSPA 4M7DG 2VKNA 4N0AA 4M7AA 3GPLA 1Y07A 5DM7R 1UJYA 3VS4A 5EG2A 2KXDA 4PJJA 5GMKl 4C92D 3MKDA 4IUVA 3QDFA 2XDBA 3CCUA 3OW2A 2EYXA 3N5BB 1QCOA 1X2QA 3SFMA 3L2RA 3MCAB 4LE9A 2QTXA 1K8AC 1LJOA 4A4HA 4ZTJA 4PKCC 2CZ1B 3CCLT 3UF4A 2JN0A 3OYJA 3MEAA 1KG1A 2K2MA 4RTTA 2Y4YA 1HXDA 4Z02A 2CT3A 1NEBA 2RI5A 3CCVT 1IO6A 2A08A 1PKSA 2J6FA 1AZGB 2X4YA 1QKWA 2DTIA 3FJ5A 2M02A 2P4RA 1AVZC 3CPWA 2K5LA 5KE2A 3S3MA 3PTAA 2X4WA 2RI2A 2EGCA 3CC7Q 4J9GA 4HCCA 3M0SA 2AZSA 1H3ZA 1KSWA 3G6EA 3OYBA 3GOXA 4KGVB 1ZLMA 1UE9A 1YJWA 1MNEA 4PJOG 4C0GA 3VRYA 1VQ5T 2MCNA 5CCAA 3PIOA 3CCQA 2RK1A 1OZ2A 3IQLA 1Z9ZA 5LJ3j 2LVMA 4Y91A 1S72A 1FMVA 2J7IA 1AWXA 3TVTA 1YHQA 1M90U 3F70A 1VQ9Q 1IZ6A 3TREA 3CCEA 2JTFA 2FL7A 2DMOA 4NOYA 1VQNT 5CKBA 3M4YA 1MUZA 1I81A 2CZ7B 2L0AA 1MNDA 2KT1A 2EQMA 5IHKA 2L8DA 4F7UE 3JB9I 2KT8A 3R6OA 1QQJA 1I5LA 1AHJB 4J7FA 1TTHB 2QK0A 2HBPA 3FIFA 1X01A 1SSHA 1N6AA 1I5OB 1LOJA 2RO0A 4C92G 2LJ0A 3JCMf 4C8QB 1JU5C 2LP5A 3M4GA 1C0MA 1KD1R 1WJQA 5D6YA 2DBMA 1D09B 3SDZA 4MZMA 4X34A 3PVQA 4LNPA 2PU9B 2G3RA 3MP8A 2FG0A 3JCMb 1NLOC 3VU3C 2PZ1A 5DLQE 4JDSA 3A8HB 1I8FA 3CMET 1X75C 1JBMA 3M5AA 2F5KA 2DVEA 5LJ3f 4OMPA 1QP2A 3CCMT 3H0IA 2K3XA 3EFSA 2C0OA 2KYBA 5LJ5d 3CCLA 1SRMA 3NPFA 3VS6A 2JW4A 3CCRT 2H8HA 4C8QC 3OQ5A 2GFAA 2V8KA 1QKXA 4N4GA 3VJPA 2B8AA 4OMOA 4ATOA 1JXOA 3JCMh 3JCMX 3PT9A 3SWNB 2ED0A 2BZ8A 2CKKA 3G71Q 1YI2T 2XI9A 3X26B 5IT9E 3LWHA 3EGXB 4BE2A 2E6ZA 3SD4A 5FU6B 2E64A 4ZN1A 1VQPT 1G3TA 1RADB 2LJ1A 4ANJA 4E7SA 1M1KC 1WA7A 1TUGB 1ZSZC 3E19A 3G4SQ 1ACMB 1K76A 5C6SA 4LXCA 1U3OA 2EYYA 5KCOA 1KHIA 2FO0A 1RABB 4AMCA 2PNIA 1X6OA 2RQRA 2EWNA 1VQLA 4NS5A 1RL2A 4M75E 1YCYA 1BBZA 4KH1B 2DBKA 3M9QA 3TEEA 5LJ3h 5KYNA 5IN1A 2LDMA 5I22A 3EFOB 2L89A 1OI1A 4ELZC 1SRLA 2LCCA 1VQNA 2ROTA 2F2XA 4YTLA 3ZBDA 3JB9F 1NJIU 1WQWA 2SEMA 4E7KA 3ZL7C 2IVWA 3CD6Q 1YNZA 3INZA 1T0HA 2MI6A 1BIAA 3KFVA 5ECAA 1D0ZA 1H641 1VUBA 3UATA 4ZGDB 3WXMB 4R55A 2LZ6B 1SSFA 5FU6C 3BDLA 4X9DA 3OYIA 5D7UA 3P8BB 2HL5C 1TUDA 1D0XA 1VQOT 2YUPA 1KQSS 4OB3B 2KE9A 3CBMA 3L2QA 4GBQA 1ZUKA 2DVJA 3M0UA 2KK4A 3UA7A 3P8DA 2DM1A 4HVVA 2DO3A 2YRDA 1GBQA 2AKKA 5HY6A 3VS3A 1PG5B 1WJRA 1KC8U 3H6ZA 1ABOA 2EJ9A 4V2SA 3QO3A 2DL8A 2VB6A 3KXTA 4XU0A 2E70A 1JXMA 1YFNA 3CMEA 2L5QA 4Q5WA 3R6NA 1K8AU 4J8OA 5GAMf 4J9EA 5LJ5g 2KSSA 5KH6A 3HRUA 1NE8A 3CC4A 4JJDA 1GCQC 3CCMA 4C5HA 2BZYA 3RDVA 5KYWB 1MMAA 3FC3A 1ZA2B 1BCMA 2KDSA 4M78D 3CCUQ 3LYIA 1M90C 1JB0E 2QYZA 5A0DA 2EQKA 1PWTA 3CCRA 2EIFA 2RD1A 4C5EA 3GLXA 3FDRA 2PVOB 4M7AB 4JJNK 2QASA 2K2VA 1W2BP 2VGMA 3JSCA 3CCJA 2RNAA 1MMGA 3QJ6A 4C8QF 3RKXA 2DXUA 3LW5E 1D1AA 2ATCB 4II1A 2DTHA 1UTIA 1G5VA 1QW1A 3NTIA 1KFZA 2X51A 1ZSZA 4Z88A 5A0GA 2YSQA 1UGVA 1VQPA 1TSFA 2FZGB 2E65A 1W1FA 3JCMc 2ZPIB 2R57A 2DKGA 3OYGA 1WHJA 3VV0A 3M0QA 1JEGA 4TVRA 5GMKi 2LTOA 4K11A 2RI3A 2OI3A 5GAMh 3G6EQ 2DXBA 2A3LA 3G7ZA 1RAHB 2E6NA 2I2LA 1K9MR 1YJWQ 3P8HA 4EMKA 2RQTA 3L2WA 3CCQQ 3RKYA 3NGPA 5AT1B 2CZ0B 4M7AC 2KEAA 1Z9QA 2NUPA 4FW2A 4JRKA 5GAOr 4IKFA 5GANj 3OYFA 3JB9D 2LCLA 1S72Q 1YHQQ 2EAYA 3CBPA 3CCEQ 4C5IA 2CP5A 1I4K1 2CP7A 2O2OA 2ZPEB 2DLPA 2DIGA 2YT6A 4M7DD 3L42A 5DLOA 4LUDA 1FX7A 1XQHA 3JB9J 2K4YA 4XQ3A 4RTZA 4BI4A 1C6VX 1M30A 1Q7YR 1IHWA 4M77E 4XTVA 1W2BS 2O4XA 3X28B 2MAMA 4M7DE 2RA2A 2XICA 2KBTA 5HK3A 1UG1A 2VVKA 1FMKA 2DERA 1N8RC 1JJ2P 4RTYA 2CYZB 3SB2A 3CCSA 2E3HA 1RAGB 2AK5A 3CEYA 4RTXA 2RJDA 2QEXT 4EIKA 2V8IA 2GTOA 2E3IA 2RHUA 1VQ6A 1PD0A 1BYMA 5CVIA 4BI3A 2DRKA 1KQSA 4FL6A 5IHIA 4BI8B 3OBYA 4PL6A 2CH4A 1VQKT 2DAQA 4C0DB 3RMQA 4A53A 1VIEA 2K3YA 1NPPA 2X3WD 1PCXA 1T3SA 3OYKA 3META 1M27C 5GANf 1MMNA 4F7UA 2HCKA 1QCFA 3CCLQ 4PJOD 1UFFA 2HZYA 2JM8A 1KHCA 1VQ8T 3O8VA 2V1RA 4C8QD 3G1JA 1NJIC 1D3BB 4OB0B 1K73U 4X1VA 3MPUB 1ZBJA 1E7OA 3HRTA 2DJZA 3BY7A 2YUNA 1YIJT 2OTLT 3HHTB 2KQWA 1M1KU 1Q86U 3OS2A 1HYOA 3TQ7P 2XD0A 3ME9A 1M1FA 3EG0A 4PJOE 2DA9A 3RIRA 3JCMe 1N5ZA 2FRWA 4WTOB 5GAN3 4DQ2A 1YJNT 3UT1A 3JB9G 3HP9A 5KYWA 4E7HA 3OS5A 3JCMV 3CC2T 3OSVA 5CO7A 1M2VB 3HTRA 2J06A 1F1BB 2M0YA 4C0DC 2DXTA 2J6OA 1IXDA 1GRIA 4OB1B 4RTUA 2O31A 2GCXA 3HRSA 2VC8A 4MZTA 1VQ5Q 4E2FB 1KC8C 1VQLQ 2PTKA 5LJ3e 2ZZDA 2KAFA 1RLQC 5GANh 4M7AF 2C0IA 4QW2A 5LJ3d 1X2KA 2Y4XA 5I11A 3BFMA 3VUBA 4KGXB 3I55A 1VQNQ 1TXQA 3J7AF 4R56A 4C92E 2M51A 4J9DA 1TUCA 2LNVA 3PMTA 4Z8AA 2DF6A 4JUVA 2VV5A 2DPPB 3QKJA 1H92A 4OMLA 2EQUA 4B9WA 3EG3A 5GAOp 2OJ2A 2KYMA 3HKSA 2WSFE 2ZPGB 3TU4K 2E12A 4KBMB 1QVGS 2EKHA 4PJNA 4L6V5 1ZQ1A 2JMAA 1UDLA 3QG1A 1UGQB 1BK2A 2A0FB 2JTMA 4JJCA 3DLMA 2COZA 4M75A 2VASA 2JM9A 2EVRA 2DX1A 2DE0X 1WLPB 3GNGA 4C8QG 1R8OB 2KROA 3M0RA 1OX9A 4XTUA 3HSBA 1SF9A 3DKMA 3LGLA 3LGFA 2BE7D 1VQKA 2QAZA 3CMEQ 4ZTFA 2NUTA 2P0PA 2B86A 4FW1A 1UUEA 5CKHA 1RAEB 4D6WA 5I2SA 3CC4Q 3CCMQ 1AEYA 2RPNA 2FHDA 1Y7XA 2RJCA 3BW1A 3THKA 1CKAA 1VQ8A 2D8JA 4EMHA
chains in the Genus database with same CATH topology
2LDMA 5FLXE 1Y96B 4C8QD 2L89A 3QZ9B 2CGHA 4A54A 1NJIC 4E7JA 1OI1A 4ELZC 3V7SA 2LCCA 1VQNA 4ELYC 4YTLA 3VKIA 3E1SA 1YIJA 2OTLA 3ZBDA 4XTWA 2NLUA 4JRQA 1K9MU 3JB9F 3VYHB 3JCMd 5GAN4 1NJIU 2QI2A 1WQWA 4E7KA 2IVWA 2ZGWA 2HD0A 3JCMW 5AYFA 4OVAA 3INZA 4MMKA 3M55A 1JJ2S 2MI6A 1BIAA 2MMPA 3HL8A 1H641 1VUBA 2XU8A 5KCHA 3L1AA 3M53A 4ZGDB 4PLIA 3WXMB 4R55A 2JZ2A 1UGSB 2RJEA 2EKOA 3QZ5B 4N0AC 3CXCA 3HPWA 1M1GA 4KULA 1SSFA 3JB9H 5FU6C 3BDLA 2YHTA 3LX7A 1YITT 2GFUA 3CC2A 4X9DA 1V29B 1EIFA 2VGNA 3CCUT 5GAOq 2YRVA 1Q81C 3OYIA 4LDWA 3OYCA 3I56A 3SWNA 3P8BB 4Y28E 2LT4A 2PVDB 3FEOA 3QDRB 4BD3A 5GMKj 3CPWS 1NPRA 5A2QE 5GAOl 1KD1U 2KMTA 4L59A 3V7RA 1VQOT 1HK9A 1VQMT 5CKDA 4BY6C 1UEBA 1KQSS 3I55T 4M77D 4IUPA 2MWOA 4OB3B 1WGSA 3J81E 3OS0A 3CBMA 4LD6A 1PSFA 1UGRB 3L2QA 4OP0A 2XKOC 2X4XA 1D3BA 5LJ3g 1BI1A 1WNLA 5GAMe 2KK4A 2PUOB 3P8DA 4XTZA 3QYHB 4QQ6A 2HAXA 2OAUA 5GAN6 2DO3A 4NL2A 3RUXA 1VQLA 3OS1A 3G71A 4M7AD 5HY6A 4M78C 4QVCA 3QSUA 1WJRA 2MWPA 3M54A 5I21A 4MDWA 3MEVA 1KC8U 3H6ZA 5GMKh 2EJ9A 4V2SA 3JRZA 3QO3A 3JCMJ 3X20B 3ZEHA 3JCMQ 3KXTA 2XG8D 2E70A 4XU0A 2P4TA 1VQ7T 2JNGA 3H8ZA 2D9TA 2FVUA 4HKEA 2X4JA 3FB9A 4E7LA 3C94A 3A8LB 3G4SA 3OB9A 4A4FA 3CMEA 1N9RA 2L5QA 1Y96A 4Q5WA 1O75A 4J8OA 3X24B 1K8AU 5GAMf 2E5QA 3VYGA 3L2UA 4FIBA 2ZPHB 2KSSA 3T9NA 5KH6A 5LJ5g 3C95A 1MHNA 2OTJT 3MO8A 3HRUA 4M78G 4EMKB 5A0LA 2DK3A 1NE8A 1XNIA 4O6JA 2BUDA 4WF2A 4XU2A 4XU3A 3CCMA 3CC4A 4C5HA 4BE1A 4J6XA 3MP6A 3AHUA 3LWIA 3E9GA 3S6WA 4M77B 3G6ET 3FC3A 4QQDA 4E7IA 3RMSA 2H3JA 1G3WA 4X9CA 4M78D 2KDSA 2QEXA 3CCVA 1N8RU 4HCBA 4M7DB 4EMGA 1YJWT 5CKEA 2QQ9A 3BDUA 3LYIA 5LL6S 1M90C 1JB0E 2RK2A 4A4EA 4CI0C 3OY9A 2QQSA 5A0DA 2EQKA 2QDYB 4LDVA 3CCRA 1YJ9T 2XHCA 1BI3A 3CCQT 1K73C 2EIFA 3GIBA 2RD1A 4UC4A 4C5EA 2VUBA 3V8JA 4MDXA 3GLXA 1RI0A 2PVOB 2O01E 3FDRA 4M7AB 5CR2A 2XDDA 4JJNK 4BACA 4J5YA 1W2BA 2CZ6B 2K2VA 2VGMA 1YHQT 1O9SA 2RB6A 3QBYA 1U8RA 4M75F 3JSCA 1Q86C 3CCJA 3CD6A 3QJ6A 2DD5A 4C8QF 5C0MA 4RCCA 3CCET 3RKXA 3LLRA 2R5MA 2DXUA 2LQ8A 3LW5E 5M9OA 2WACA 3V8LA 4EPCA 4B9XA 5IAYA 2EYQA 3S3OA 5GAOm 1VQ5A 3CXCS 4FT4A 4II1A 5GAMj 2DTHA 3QYGB 3L2VA 1G5VA 1QW1A 1G3SA 2K5IA 3NTIA 1VQ4T 3WVEB 1VQLT 1KQ2A 2PQWA 4HA8A 4NL3A 2O4XB 3QPHA 3MP1A 5A0GA 2JUFA 2WSCE 3DB3A 4HT9A 1VQPA 1WJSA 5FROA 4PNOA 1K9MC 3PMIA 4P5NA 3JAME 3J80E 1U1SA 4RKUE 2E65A 3DLLA 2EJGA 5HKCA 4M78B 2FB7A 4OMFB 4RCBA 5FU7B 3JCMc 3C4SA 1Y71A 2ZPIB 2R57A 3LH0A 2DKGA 2RM4A 3OYGA 1QVGA 1PSEA 5KE3A 2X35A 3VV0A 4EMKC 3MEUA 4TVRA 3MHXA 5GMKi 2QA4T 2LTOA 3QIIA 3A8GB 2RI3A 4LDYA 4BDYA 2VYTA 3CPFA 3JCMg 2C06A 2D0QB 4M77C 2R5AA 1Q82U 2ZPBB 5GAMh 2DXBA 2A3LA 3CMAT 4M7DC 3QUIA 3G7ZA 4DOVA 2E6NA 2I2LA 1B34A 2BIVA 3P8HA 4EMKA 4C0ZA 1YJNA 2YLCA 3L2WA 3OSSC 3QJYA 4J83A 3RKYA 2K57A 1WQ7A 4C0FA 2CZ0B 4M7AC 3M58A 1DJ7B 2LC4A 3NTHA 4M77A 4ZGEB 3JCMP 5GAOn 4JRKA 5J26A 5GAOr 4IKFA 1LNXA 5GANj 3OYFA 3JB9D 2LCLA 4M77G 4JS5A 1M8VA 1IREB 1GXIE 2EAYA 4PJOB 4M7DG 3CBPA 5D6XA 1TH7A 3UDCA 4C5IA 1WPYA 1Q7YC 3KBGA 1I4K1 2ZPEB 4J6YA 4N0AA 3PNWC 3OMCA 4DA4A 4M7AA 2DIGA 4ZN3A 1Y07A 3GPLA 3OMGA 5DM7R 3CC7T 4GLKA 1ZBXA 4F7UB 5EG2A 3Q1JA 4M7DD 4M7AG 3L42A 4OF1A 4FSXA 5CAIA 5GMKl 4C92D 4IUVA 5DLOA 3OYHA 1YITA 2XDBA 3M56A 2LT1A 3CCUA 1BI2A 1FX7A 1XQHA 3OW2A 2DIQA 3N5BB 4JLGA 3JB9J 2K4YA 3SFMA 3L2RA 5GAMd 1QVFA 4XQ3A 3EFRA 4L5GA 2Y90A 3MCAB 4BI4A 5FU7C 4IUQA 2QTXA 1K8AC 1LJOA 2WSEE 5CIUA 4A4HA 3E9FA 4ZTJA 4PKCC 2CZ1B 2LQKA 3A8MB 4CRIA 4M77E 3CCLT 1VQMA 2P0KA 4XTVA 1W2BS 1BKBA 2IG0A 2O4XA 2MAMA 3X28B 4M7DE 2RA2A 2XICA 1VQ9T 2JN0A 4FT2A 5HK3A 3G4ST 2QQAA 2XK0A 4QQGA 2HQXA 3OYJA 2E10A 4XTXA 4LDXA 3MEAA 4M78A 2CS7A 1KG1A 1N8RC 2HQEA 2QQBA 1JJ2A 4M7AE 4QVZA 2RH2A 2Y4YA 1HXDA 2CYZB 4Z02A 3SB2A 3CC4T 3CCSA 5LJ5e 2E41A 3OYLA 3CEYA 2XDPA 2LX9A 4E47A 2RJDA 2RI5A 4OGCA 2QEXT 3CCVT 2V8IA 2DEQA 4HCZA 3OBWA 4M78F 1VQ7A 4ZGJB 5GAN2 2X4YA 2DTIA 4C92B 5GANe 4OGEA 4PJOC 3CPWA 2K5LA 2RHUA 1VQ6A 5GANd 5L8RE 1VIFA 5KE2A 4DOWA 3FRNA 3S3MA 4FM4B 1BYMA 5CVIA 3PTAA 2X4WA 4BI3A 3UPUA 2OTJA 1BIBA 2RI2A 4FL6A 4FU6A 4A4KA 1KQSA 5GAN7 4BI8B 3CCJT 5LJ5f 3OBYA 3PFSA 4HCCA 4PL6A 1VQKT 3C12A 2DAQA 4KUDK 1H3ZA 4C0DB 3G6EA 4M78E 5D6WA 2A7YA 3RMQA 4RG8A 1M5Q1 3OYBA 4A53A 3GOXA 2PVGB 1VIEA 2K3YA 1NPPA 3NTKA 2ZPFB 2V8JA 1YJWA 4PJOG 2JVVA 4C0GA 3OYKA 3META 5GANf 1VQ5T 1YI2A 2DZ9A 3FJPA 5CCAA 3PIOA 4F7UA 3CCQA 3PIPA 1YJ9A 2RK1A 1OZ2A 4KT0E 5LJ3j 3VUZA 4F7UG 2LVMA 5GAN8 4Y91A 3OYMA 4PJOD 2GF7A 1S72A 4M75D 1KHCA 1VQ8T 1YHQA 3O8VA 1M90U 2LRQA 3F70A 3OYYA 2M0OA 3L2ZA 1D3BB 4J6WA 2DXCA 4J7IA 4OB0B 1IZ6A 5CK9A 2YLBA 5J3BA 3TREA 5GMKm 2JTFA 2MF2A 3CCEA 5GAN5 2FL7A 3HRTA 3A5ZB 2DJZA 4NOYA 1OYXA 4N4IA 3V8KA 5CKBA 1VQNT 3BY7A 3M4YA 1YIJT 2OTLT 3ER0A 3HHTB 4KUIA 2QQRA 2KQWA 1I81A 1MGQA 3GNFB 2RHYA 3OS2A 1Q86U 2VXEA 1M1KU 2CZ7B 2XD0A 3ME9A 1M1FA 1VQ4A 3GP8A 4PJOE 3RIRA 3JCMe 4PLLA 5FRNA 4MMLA 3ASKA 2EQMA 5LJ5j 4C92C 4BDZA 5GAN3 4DQ2A 3GF5A 2JOYA 3UT1A 1YJNT 3JB9G 2L8DA 4F7UE 3JB9I 2DZCA 1KD1C 2RHZA 3R6OA 3HP9A 4E7HA 3OS5A 3JCMV 1I5LA 1AHJB 4J7FA 4XU1A 3OSVA 3CC2T 2HBPA 2KY9A 3FIFA 2QA4A 1X01A 5CKFA 4BB7A 5CQXA 1W4SA 4M7DA 5CO7A 3I56T 3OYDA 1FXXA 1N6AA 4LD9K 4C0DC 4C92A 2DD4A 2DXTA 1LOJA 4GY5A 4M75B 1ZHIA 2RO0A 3CMAA 4OB1B 3SWNC 4C92G 3JCMf 4C8QB 3WVDB 2GCXA 3HRSA 4ME7A 3ZFJA 3M4GA 1N9SA 3QXEB 4M77F 4JRIA 2VC8A 4MZTA 1M4ZA 5LJ5h 1WJQA 3V7CA 4M7DF 1KC8C 5D6YA 4QVDA 1XOVA 4C92F 5J39A 2EQJA 4IURA 2VXFA 3A8OB 3SDZA 5LJ3e 2BKDN 3X25B 3G71T 4MZMA 1K73U 2ZZDA 2KAFA 4X34A 3RESA 5GANh 4M7AF 4IUUA 4QW2A 5LJ3d 2PU9B 2Y4XA 4XK8E 2FYKA 2G3RA 1VQOA 3MP8A 3BFMA 3VUBA 3JCMb 4IUTA 1OZ3A 3VU3C 3I55A 1KQ1A 1Q81U 2EJFA 3CC7A 5GAMg 4JS4A 3J7AF 5DLQE 4JDSA 4R56A 3A8HB 4LDUA 4C92E 3OYNA 1I8FA 3CMET 2LNVA 3RERA 2PUKB 2M16A 3M57A 1XTDA 3PMTA 3OYAA 3URGA 4JUVA 1Q7YU 1X75C 1JBMA 3M5AA 2VV5A 2DPPB 3QKJA 5DY9A 3S3NA 2M9UA 5FRMA 2F5KA 2DVEA 5LJ3f 3CCST 1QP3A 2HNIA 1QP2A 3CCMT 4O5VA 2E1HA 2K3XA 3EFSA 5CQYA 3MEWA 2EFIA 3NFCA 2D6FA 2EQUA 5LJ5d 4B9WA 3CCLA 5GAOp 5HK0A 2GQVA 2L3RA 3RKWA 3HKSA 1N27A 3OYEA 2WSFE 2ZPGB 4RG2A 3TU4K 1VQ9A 2F5TX 2E12A 3CCRT 1P92A 4BE0A 1UB4A 4KBMB 4M75C 1VQ6T 1QVGS 4A4GA 4C8QC 3OQ5A 1G3YA 1B34B 4L6V5 1ZQ1A 2DTOA 2GFAA 4EDUA 3QG1A 2V8KA 1UGQB 2RHXA 2P0QA 2RHIA 4N4GA 3VJPA 3CD6T 2B8AA 2AHJB 2JTMA 3CBOA 4ATOA 4XAXB 5GANg 4PJOA 2ZCFB 1FWZA 3DLMA 4M75A 5I2MA 3HFNA 1UGPB 3JCMh 3JCMX 3PT9A 3SWNB 1JRIA 3HFOA 4C8QA 2QXFA 2CKKA 3UWNA 1YI2T 2R58A 4M75G 2XI9A 3X26B 2XIDA 5IT9E 1M9SA 3GNGA 3KUFA 4C8QG 3LWHA 1R8OB 5GMKe 3FLGA 3M59A 1YBYA 2E6ZA 4OB2B 3SD4A 4BE2A 5FU6B 3DB4A 2E64A 4JLIA 4ZN1A 1S72T 4XTUA 1G3TA 4PJOF 1VQPT 3HSBA 3DKMA 3LGLA 1QVPA 2K5FA 1BI0A 3LGFA 1M1KC 1VQKA 2KVQG 3E19A 1Q82C 4ZTFA 5C6SA 4F7UF 2P0PA 4BY6B 5KCOA 1KHIA 5CKHA 2RJFA 4N4HA 4D6WA 5I2SA 1X6OA 4JRPA 4VUBA 2EWNA 2F69A 3EAEA 1U1TA 3PGGA 3QHSA 4C5GA 4HT8A 2FHDA 1Y7XA 2RJCA 3BW1A 4XTYA 4BUGA 4NS5A 2M1HA 3TCJA 4RMOA 1RL2A 3OA6A 3OW2S 4M75E 4MZPA 1YCYA 1QVFS 4C8QE 1VQ8A 3M9QA 3TEEA 5LJ3h 1NZ9A 5IN1A 4EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVD A;  5LJ5 h;  1Y96 B;  2RB6 A;  4M7A E;  4C92 F;  4M75 F;  4A54 A;  2CGH A;  1HXD A;  3SB2 A;  4C8Q F;  3V7S A;  4RCC A;  2VXF A;  3RKX A;  5LJ5 e;  2E41 A;  5LJ3 e;  2DXU A;  3RES A;  5GAN h;  4M7A F;  4M78 A;  4XTW A;  5LJ3 d;  3JB9 F;  5GAN 4;  3JCM d;  3V8L A;  2FYK A;  2DEQ A;  1WQW A;  4M78 F;  3BFM A;  2ZGW A;  5GAO m;  5GAN 2;  3JCM W;  3JCM b;  5GAM j;  2DTH A;  2DTI A;  3INZ A;  3VU3 C;  4MMK A;  1KQ1 A;  4C92 B;  2EJF A;  5GAN e;  4PJO C;  5GAM g;  1BIA A;  1KQ2 A;  1H64 1;  4HA8 A;  4NL3 A;  3L1A A;  5GAN d;  4C92 E;  1I8F A;  4HT9 A;  3RER A;  4PNO A;  4JUV A;  4N0A C;  1U1S A;  1BIB A;  1JBM A;  5DY9 A;  2E65 A;  2EJG A;  3JB9 H;  2YHT A;  2FB7 A;  4M78 B;  4RCB A;  5GAN 7;  2DVE A;  4X9D A;  3JCM c;  5LJ3 f;  5LJ5 f;  3JCM J;  2DKG A;  2RM4 A;  5GAO q;  2HNI A;  4EMK C;  4M78 E;  2E1H A;  3SWN A;  3EFS A;  1M5Q 1;  5GMK i;  4A53 A;  5GMK j;  5GAO l;  5LJ5 d;  5GAO p;  4PJO G;  3V7R A;  3JCM g;  3RKW A;  4M77 C;  1HK9 A;  5GAN f;  2DZ9 A;  3FJP A;  4F7U A;  5GAM h;  4M77 D;  4M7D C;  3QUI A;  4M7D G;  2I2L A;  4M75 C;  4OP0 A;  4F7U G;  5LJ3 j;  1B34 A;  5GAN 8;  4Y91 A;  4PJO D;  4EMK A;  4C8Q C;  1D3B A;  5LJ3 g;  2YLC A;  1WNL A;  4M75 D;  1B34 B;  5GAM e;  4XTZ A;  4C8Q D;  3RKY A;  2DTO A;  2K57 A;  1D3B B;  3L2Z A;  1WQ7 A;  4J6W A;  5GMK m;  4M7A C;  2YLB A;  5GAN 6;  4NL2 A;  4M77 A;  3RUX A;  3JCM P;  5GAO r;  5GAO n;  4JRK A;  5GAN 5;  4M7A D;  1LNX A;  5GAN j;  4M78 C;  2DJZ A;  4QVC A;  3JB9 D;  4NOY A;  3QSU A;  3V8K A;  5I21 A;  5GAN g;  4M77 G;  4PJO A;  1M8V A;  3BY7 A;  4M75 A;  2EAY A;  5GMK h;  2EJ9 A;  3HFN A;  3JCM h;  4V2S A;  4PJO B;  1I81 A;  1MGQ A;  3QO3 A;  3SWN B;  1JRI A;  3HFO A;  4C8Q A;  1TH7 A;  2VXE A;  3JCM X;  3JCM Q;  1WPY A;  4XU0 A;  1I4K 1;  4M75 G;  4J6Y A;  4N0A A;  4PJO E;  4M7A A;  4C8Q G;  3FB9 A;  3RIR A;  5GMK e;  3JCM e;  4MML A;  1N9R A;  4F7U B;  1Y96 A;  4M7D F;  5LJ5 j;  4C92 C;  4M7D D;  4M7A G;  4JLI A;  2E64 A;  4DQ2 A;  5GAM f;  5GAN 3;  3JB9 G;  4XTU A;  4PJO F;  5CAI A;  5GMK l;  5LJ5 g;  4C92 D;  3HSB A;  4F7U E;  3JB9 I;  2DZC A;  4M78 G;  4EMK B;  4WF2 A;  4XU2 A;  3JB9 J;  3JCM V;  4XU3 A;  1I5L A;  5GAM d;  4XU1 A;  4J6X A;  4XQ3 A;  3EFR A;  3FIF A;  2Y90 A;  1X01 A;  3AHU A;  4F7U F;  4M77 B;  4M7D A;  2QTX A;  1LJO A;  4X9C A;  4M78 D;  4C92 A;  4M7D B;  4EMG A;  2DXT A;  1LOJ A;  4M77 E;  3BDU A;  4XTV A;  2EWN A;  4M75 B;  1U1T A;  3PGG A;  3QHS A;  4HT8 A;  3SWN C;  4C92 G;  4M7D E;  3JCM f;  4C8Q B;  2RA2 A;  3BW1 A;  4XTY A;  3GIB A;  2JN0 A;  2RD1 A;  4M75 E;  1YCY A;  3M4G A;  1N9S A;  4M77 F;  3V8J A;  2E10 A;  4XTX A;  4C8Q E;  4M7A B;  4JRI A;  2VC8 A;  5LJ3 h;  4EMH A;  4J5Y A;  3V7C A; 
#chains in the Genus database with same CATH topology
 1QMC A;  3CCR Q;  4A54 A;  1V76 A;  1Q82 R;  2CP3 A;  1V1C A;  2FZC B;  5L23 A;  3VKI A;  1YIJ A;  2OTL A;  1MV0 B;  4XTW A;  4J9H A;  3CCJ Q;  2HD0 A;  2L2P A;  5AYF A;  1S1N A;  3M55 A;  2MMP A;  2JMC A;  5KCH A;  3M53 A;  2CSI A;  2JZ2 A;  3HPW A;  1M1G A;  3CXC P;  2ED1 A;  1YIT T;  2GFU A;  3CC2 A;  1TG0 A;  1EIF A;  5GAO q;  1AWJ A;  1Q81 C;  1VQP Q;  1AZE A;  2PVD B;  3FEO A;  5A2Q E;  1KD1 U;  1VQM T;  2AKL A;  1AT1 B;  3OS0 A;  3TSZ A;  4LD6 A;  2X4X A;  2J05 A;  2C0T A;  1D3B A;  5LJ3 g;  1WHH A;  5GAM e;  1ZSZ B;  4XTZ A;  2OAU A;  1ZA1 B;  4NL2 A;  3RUX A;  3OS1 A;  1ZUY A;  4D8K A;  1AD5 A;  4M7A D;  4QVC A;  3QSU A;  2MWP A;  4MDW A;  1X43 A;  3NHN A;  5GMK h;  3X20 B;  2CP0 A;  3JCM Q;  1WI7 A;  2XG8 D;  2HSE B;  4WCI A;  2JNG A;  3FB9 A;  2YDL A;  3OB9 A;  1Y96 A;  3X24 B;  2ZPH B;  3VS1 A;  2OTJ T;  4EMK B;  5A0L A;  4WF2 A;  4O6J A;  1UHF A;  1M2V A;  2CT4 A;  3H0H A;  2NUP B;  3RMS A;  1N8R U;  4AFU C;  3CCV A;  2IIM A;  1BCO A;  3OY9 A;  4LDV A;  1YJ9 T;  1K73 C;  2XHC A;  3GIB A;  3U23 A;  2C06 A;  4IIO A;  2HKQ B;  2GGR A;  2YXY A;  1O9S A;  3QBY A;  1Q86 C;  4HXJ A;  2GQI A;  2HDA A;  1XJW B;  2BZX A;  2AZV A;  4EPC A;  3S3O A;  5GAO m;  1VQ5 A;  3CCS Q;  3CXC S;  4FT4 A;  5GAM j;  3L2V A;  1VQ4 T;  3M0P A;  4FSS A;  4LUE A;  2O4X B;  3QPH A;  3MP1 A;  1WJS A;  5FRO A;  4RUG A;  3PMI A;  4P5N A;  3A1P A;  1OPL A;  4RKU E;  2EJG A;  3LH5 A;  5FU7 B;  2COW A;  3C4S A;  1QVG A;  2EYW A;  1VQ6 Q;  4EMK C;  2QA4 T;  1U06 A;  2FZK B;  3CPF A;  5KYY B;  2A28 A;  2DYI A;  3CMA T;  1AWO A;  3QUI A;  4DOV A;  1NJI R;  4C0Z A;  3QJY A;  2DFU A;  4ZNX A;  4M77 A;  1LNX A;  2FPE A;  2DL3 A;  1LCK A;  1OX8 A;  2RQU A;  2KXC A;  3AT1 B;  2X9H A;  1CSK A;  5D6X A;  1MV3 A;  1WPY A;  3I9Q A;  3KBG A;  1SPK A;  4J6Y A;  3PNW C;  3OMC A;  4DA4 A;  4ZN3 A;  2KGT A;  1U5S A;  2A37 A;  4ESR A;  1M3C A;  4F7U B;  1OV3 A;  4M7A G;  5CAI A;  1GFC A;  4FSX A;  4FYX B;  3OYH A;  1YIT A;  3M56 A;  2LT1 A;  1D1C A;  3OW2 P;  2DIQ A;  2KRS A;  3EFR A;  2Y90 A;  1YCS B;  4PK4 A;  5FU7 C;  4IUQ A;  2WSE E;  4KGZ B;  3E9F A;  3A8M B;  2LQK A;  1RAF B;  1VQM A;  1Y57 A;  2XMF A;  4F14 A;  2O88 A;  1EX4 A;  3VRZ A;  4FT2 A;  3G4S T;  2FPD A;  2QQA A;  2XK0 A;  2E10 A;  1RUW A;  2HQE A;  2EGE A;  2QQB A;  2JXB A;  4DBQ A;  4PJM A;  1K8A R;  2X3X D;  3OYL A;  2XDP A;  4E47 A;  4HVW A;  2HKN A;  3OBW A;  1SHF A;  3ULR B;  2Z0W A;  5GAN 2;  1K0S A;  5GAN e;  5GAN d;  1VIF A;  4HVU A;  3UPU A;  2OTJ A;  1ZX6 A;  4A4K A;  3I55 Q;  3BE3 A;  5GAN 7;  5IXB A;  5LJ5 f;  1GBR A;  3PFS A;  4M78 E;  5D6W A;  2A7Y A;  4RG8 A;  1M5Q 1;  2PVG B;  4FYV B;  1PC0 A;  2ZPF B;  2JVV A;  2K7A A;  1YI2 A;  3FJP A;  1YJ9 A;  5KYU A;  2CSQ A;  2F1L A;  3RR6 A;  3OYM A;  2EYZ A;  4ORZ A;  3REB B;  2LRQ A;  2M0O A;  3L2Z A;  2DXC A;  2G6F X;  2D0N A;  2DNU A;  4N4I A;  3M0T A;  3V8K A;  5FWC A;  2QQR A;  3GNF B;  2MPX C;  1VQ4 A;  3GP8 A;  4PLL A;  1OU9 A;  5FRN A;  3ASK A;  4BDZ A;  1NYF A;  1KD1 C;  2RHZ A;  3VS7 A;  4XU1 A;  2KY9 A;  2QA4 A;  5CKF A;  4BB7 A;  3I56 T;  1FXX A;  4LD9 K;  3TSW A;  4C92 A;  2ECZ A;  1VQK Q;  2E5K A;  4M75 B;  1ZHI A;  1SG5 A;  3CMA A;  4DEX A;  1HD3 A;  1WXB A;  4ME7 A;  2OAW A;  3QXE B;  4JRI A;  5LJ5 h;  3V7C A;  4C92 F;  5J39 A;  2EQJ A;  2VXF A;  1WDX A;  2L3Q A;  2BKD N;  3X25 B;  1VQ8 Q;  1QVF P;  3SEM A;  3RES A;  2CDT A;  2KRN A;  4XK8 E;  2NUT B;  2FYK A;  1VQO A;  4IUT A;  1KQ1 A;  4OMN A;  2F2W A;  1Q81 U;  4JS4 A;  1YIJ Q;  2OTL Q;  1K1Z A;  4PFP A;  4F17 A;  3OYN A;  2J6K A;  3RER A;  2PUK B;  3M57 A;  4A63 B;  1Q7Y U;  1WHG A;  4O5V A;  2E1H A;  3MEW A;  3NFC A;  5KYY A;  5HK0 A;  2L3R A;  3RKW A;  3PVL A;  3CC2 Q;  4RG2 A;  1YP5 A;  1Y0M A;  4M75 C;  1FYN A;  4B6M A;  4A4G A;  4CC2 A;  2DTO A;  3RNJ A;  2JS0 A;  1E6G A;  1C1A A;  2L3S A;  4R0K A;  2P0Q A;  2RHI A;  2AHJ B;  3CBO A;  1FMW A;  5GAN g;  1WX6 A;  2ZCF B;  1FWZ A;  3HFN A;  1UGP B;  5GJW B;  1WHL A;  3HFO A;  2QXF A;  3UWN A;  1K0X A;  2MIO A;  3KUF A;  5GMK e;  1KK7 A;  4JLI A;  1S72 T;  4AFZ C;  2ESW A;  2KVQ G;  4F7U F;  2I0N A;  1KIK A;  2RMO A;  2F69 A;  3PGG A;  3QHS A;  4C5G A;  4RMO A;  1RAA B;  4PFO A;  1G83 A;  1QVF S;  3CCV Q;  2CUD A;  4C8Q E;  2EPD A;  1NZ9 A;  1M1K R;  3JCM d;  1Y96 B;  1R0C B;  3D7S B;  3QZ9 B;  2DYB A;  2CGH A;  4E7J A;  3V7S A;  4FCY A;  2ROL A;  5GAN 4;  2QI2 A;  3JCM W;  2HL3 A;  4OVA A;  1JJ2 S;  3HL8 A;  2XU8 A;  1OU8 A;  1OUL A;  4PLI A;  3QZ5 B;  2EKO A;  4KUL A;  4PJL A;  3JB9 H;  2VGN A;  4LDW A;  2VWF A;  3OYC A;  4OMQ A;  2KR3 A;  3I56 A;  4BD3 A;  2LT4 A;  1WHM A;  5GMK j;  1OOT A;  2W10 A;  5GAO l;  2KMT A;  4E6R A;  9ATC B;  5CKD A;  1IHV A;  2MWO A;  3J81 E;  2DRM A;  1QLY A;  1UGR B;  4OP0 A;  6AT1 B;  2XKO C;  3VS5 A;  2QGG A;  1M8M A;  4DBR A;  2EQI A;  2FEI A;  2HAX A;  5IHN A;  3PE0 A;  2V26 A;  4M78 C;  4J9B A;  1VYT A;  3MEV A;  3I35 A;  7AT1 B;  4AFQ C;  1EZZ B;  3JRZ A;  3A98 A;  3ZEH A;  3JCM J;  1VQ7 T;  1PHT A;  2LNH B;  2P4T A;  3H8Z A;  4HKE A;  2D9T A;  2FVU A;  2DJQ A;  2F2V A;  2O9S A;  3C94 A;  4A4F A;  2RQV A;  5IH2 A;  1IGU A;  2E5Q A;  3T9N A;  1IGQ A;  1MHN A;  1XNI A;  3CQT A;  4BE1 A;  3LWI A;  3E9G A;  4M77 B;  4E7I A;  3I5S A;  4X9C A;  1YIT Q;  5FWB A;  2QEX A;  4HCB A;  4M7D B;  4EMG A;  1K9A A;  2QQ9 A;  3BDU A;  5LL6 S;  2QQS A;  2CH4 W;  2QDY B;  3EG9 B;  4JZ4 A;  4UC4 A;  2VUB A;  4MDX A;  1IRX A;  1VQM Q;  1W2B A;  2CZ6 B;  2ZAE A;  3JV3 A;  2RB6 A;  4M75 F;  3C0C A;  3VS0 A;  3EG1 A;  2R5M A;  3EGD A;  2CRE A;  5M9O A;  3V8L A;  1VOM A;  1M90 R;  4B9X A;  4J9I A;  3QYG B;  2K5I A;  1G3S A;  1VQL T;  2PQW A;  4HA8 A;  4NL3 A;  4PFZ A;  3DB3 A;  1NBE B;  2CUB A;  4PNO A;  1K9M C;  2QGF B;  1U1S A;  3DLL A;  2D8H A;  4OMF B;  2FB7 A;  5HKC A;  1Y71 A;  1RAI B;  2RM4 A;  1PSE A;  5KE3 A;  2X35 A;  3MEU A;  1WZO A;  5KYX A;  2OTJ Q;  4CC3 A;  3QII A;  4BDY A;  2VYT A;  1PNJ A;  2K9G A;  1UJ0 A;  3JCM g;  4M77 C;  1Q95 G;  1Q82 U;  2ZPB B;  4M7D C;  2CP2 A;  1YJN A;  3OSS C;  1YI2 Q;  1YJ9 Q;  4J83 A;  1CKB A;  4QT7 A;  1WQ7 A;  8AT1 B;  3M58 A;  3JCM P;  2KRM A;  5GAO n;  5J26 A;  2AT1 B;  2HBW A;  2LCS A;  1VYV A;  3NMZ C;  4JS5 A;  1IRE B;  1GXI E;  4PJO B;  1TH7 A;  5FW9 A;  3UDC A;  1Q7Y C;  4CC7 A;  3OMG A;  3CC7 T;  1D0Y A;  4GLK A;  1ZBX A;  5KYU B;  3Q1J A;  5GJV B;  4OF1 A;  2ABL A;  1VQ4 Q;  1BI2 A;  1M2O A;  1JO8 A;  4JLG A;  5GAM d;  1QVF A;  4L5G A;  1HSQ A;  5CIU A;  4CRI A;  2DL7 A;  1YWO A;  1GL5 A;  2P0K A;  1BKB A;  5HCK A;  2IG0 A;  2QA4 Q;  2L3P A;  1VQ9 T;  1GCP A;  2QTV A;  4QQG A;  2HQX A;  4XTX A;  4LDX A;  3H41 A;  4M78 A;  2CS7 A;  3EHQ A;  3CMA Q;  4M7A E;  1JJ2 A;  4QVZ A;  2RH2 A;  2LX7 A;  3CC4 T;  2CP6 A;  5LJ5 e;  2E41 A;  2JJ9 A;  1M3B A;  3H0F A;  2AIR B;  1J3T A;  3SHW A;  2COY A;  3VS2 A;  1A0N B;  2LX9 A;  4LN2 A;  1OPK A;  1T0J A;  4OGC A;  2DEQ A;  4HCZ A;  1VQ7 A;  4M78 F;  4ZGJ B;  2DEU A;  3QWY A;  4C92 B;  4OGE A;  4PJO C;  1B07 A;  5L8R E;  1N8R R;  2HQH A;  1VA7 A;  4DOW A;  1VQO Q;  3FRN A;  4FM4 B;  1BIB A;  4FU6 A;  1KQS P;  2MOX A;  3CCJ T;  3C12 A;  4KUD K;  1UHC A;  3REA B;  3O5Z A;  3NTK A;  2V8J A;  1RLP C;  1H8K A;  2DZ9 A;  3PIP A;  4KT0 E;  2YRC A;  4JPB W;  1NEG A;  3VUZ A;  4F7U G;  5GAN 8;  2LJ3 A;  4D8D A;  1PD1 A;  2GF7 A;  1ABQ A;  4M75 D;  1X69 A;  3OYY A;  4J6W A;  5GMK m;  4J7I A;  5CK9 A;  1NM7 A;  2YLB A;  5J3B A;  1OQK A;  2MF2 A;  4F16 A;  5GAN 5;  3A5Z B;  3UA6 A;  2EBP A;  1OYX A;  2EW3 A;  3ER0 A;  4KUI A;  1MGQ A;  1H3H A;  2RHY A;  2VXE A;  2RF0 A;  1WIE A;  4MML A;  5LJ5 j;  4JZ3 A;  4C92 C;  4IIM A;  3GF5 A;  2JOY A;  2LQW A;  4FYY B;  2DZC A;  1AWW A;  1WXU A;  5CQX A;  1W4S A;  4M7D A;  3OYD A;  1PRM C;  2A36 A;  2DD4 A;  4GY5 A;  4F04 B;  3EG9 A;  1BU1 A;  2FPF A;  3SWN C;  2LMJ A;  3WVD B;  3ZFJ A;  4DBF A;  1N9S A;  2LQN A;  4M77 F;  4DBH A;  1WXT A;  2RQW A;  1M4Z A;  2NYS A;  4M7D F;  1G8X A;  4DEY A;  4QVD A;  1XOV A;  4IUR A;  3A8O B;  1QCN A;  1R77 A;  3G71 T;  3EHR A;  2YUO A;  1QWF A;  4IUU A;  4GLM A;  2D1X A;  5IXF A;  1TWB A;  2H3E B;  1OZ3 A;  2EJF A;  8ATC B;  3CC7 A;  5GAM g;  4OMM A;  4M4Z A;  4LDU A;  1B3Q A;  1KC8 R;  2M16 A;  1XTD A;  3OYA A;  1SEM A;  3URG A;  1JQQ A;  5DY9 A;  5FRM A;  2KNB B;  1RI9 A;  2M9U A;  3S3N A;  1SKU B;  3CCS T;  1QP3 A;  4RTW A;  2HNI A;  5CQY A;  2EFI A;  2D6F A;  1TS9 A;  2GQV A;  2BTT A;  2GTJ A;  1N27 A;  4KH0 B;  3OYE A;  1VQ9 A;  2F5T X;  2YWW A;  3I56 Q;  1P92 A;  3CPW P;  1UB4 A;  4BE0 A;  1VQ6 T;  2JTE A;  1G3Y A;  1B34 B;  4EDU A;  4E7Z A;  1TOV A;  2RHX A;  3CD6 T;  3QWX X;  4XAX B;  2SRC A;  4PJO A;  1M3A A;  1E6H A;  4J9C A;  1R0B G;  5I2M A;  4HCK A;  4C8Q A;  1JRI A;  2MK5 A;  2R58 A;  4M75 G;  2XID A;  4JJB A;  1M9S A;  2O9V A;  3FLG A;  3M59 A;  1YBY A;  4OB2 B;  3DB4 A;  4PJO F;  1WFW A;  1QVP A;  2BE9 B;  1BI0 A;  2K5F A;  1WYX A;  2DET A;  1D1B A;  1Q82 C;  1I1J A;  1RAC B;  4BY6 B;  2RJF A;  3EG2 A;  4N4H A;  4JRP A;  2RN8 A;  4VUB A;  3EAE A;  4AG1 C;  1U1T A;  4HT8 A;  1ZUU A;  4BUG A;  4QKU A;  4XTY A;  3OW2 S;  2M1H A;  3TCJ A;  3OA6 A;  4AFS C;  4MZP A;  2QEX Q;  1NLP C;  1W6X A;  4Z89 A;  1KJW A;  5FLX E;  1B7T A;  2DIL A;  2HMA A;  4ELY C;  3E1S A;  4JRQ A;  1K9M U;  2NLU A;  1W70 A;  3VYH B;  1I07 A;  2FRY A;  2ZGW A;  1I0C A;  2KI7 A;  4MMK A;  3L1A A;  1YWP A;  1VYU A;  1UGS B;  2RJE A;  2V1Q A;  4N0A C;  3CXC A;  1QWE A;  1SHG A;  1NYG A;  2YHT A;  3LX7 A;  1V29 B;  3CCU T;  2YRV A;  3SWN A;  4Y28 E;  3CPW S;  5EC7 A;  3QDR B;  2K3B A;  1NPR A;  2ENM A;  3EGD B;  4L59 A;  3V7R A;  1HK9 A;  3EGX A;  4BY6 C;  1UEB A;  3I55 T;  4M77 D;  4IUP A;  1WGS A;  2GNC A;  1PSF A;  1OEB A;  1ZSG A;  2W0Z A;  2K79 A;  4AT1 B;  1BI1 A;  1WNL A;  1LPL A;  2PUO B;  3QYH B;  2NWM A;  4QQ6 A;  1Q81 R;  3E2U A;  5GAN 6;  1MMD A;  3G71 A;  3EH2 A;  1BB9 A;  1YJN Q;  1NG2 A;  3M54 A;  5I21 A;  4J9F A;  5KYX B;  2DL5 A;  2X4J A;  4E7L A;  1YN8 A;  3A8L B;  1G2B A;  3G4S A;  1EFN A;  1N9R A;  2NUZ A;  2MYS A;  1ARK A;  1O75 A;  3EFO A;  3VYG A;  3L2U A;  4FIB A;  3C95 A;  3H9N A;  3MO8 A;  4M78 G;  2QDL A;  3EH1 A;  2DK3 A;  4XU2 A;  2BUD A;  2EGA A;  4XU3 A;  4J6X A;  3MP6 A;  1T3L A;  3AHU A;  2HEQ A;  3S6W A;  3G6E T;  4QQD A;  1IB8 A;  2JS2 A;  2H3J A;  1G3W A;  1YJW T;  5CKE A;  2RK2 A;  4A4E A;  4CI0 C;  3CCQ T;  1BI3 A;  1GCQ A;  4KRT A;  3V8J A;  1RI0 A;  2XDD A;  2O01 E;  5CR2 A;  4BAC A;  4J5Y A;  1PM3 A;  3MJX A;  1WHK A;  1YHQ T;  1U8R A;  3EGU A;  1LVK A;  3CD6 A;  2DD5 A;  5C0M A;  4RCC A;  3CCE T;  2YUQ A;  3LLR A;  2JT4 A;  2LQ8 A;  2QG9 B;  2WAC A;  5IAY A;  2EYQ A;  1GFD A;  1UEC A;  1K73 R;  4RTV A;  2K6D A;  2P84 A;  4AG2 C;  3WVE B;  1KQ2 A;  4FYW B;  1PKT A;  2JUF A;  2WSC E;  3RBB B;  4HT9 A;  1VQ7 Q;  1X27 A;  1X6G A;  2GBQ A;  1PRL C;  3JAM E;  3J80 E;  1Q86 R;  4M78 B;  4RCB A;  3LH0 A;  4CC4 B;  1QVG P;  2DL4 A;  3MHX A;  1TU0 B;  3A8G B;  4LDY A;  2D0Q B;  2R5A A;  1AOJ A;  1B34 A;  2BIV A;  2E4H A;  2YLC A;  2IPO B;  2K57 A;  4C0F A;  1K4U S;  1DJ7 B;  2LC4 A;  3NTH A;  4ZGE B;  1HJD A;  2OX7 A;  3I5R A;  4M77 G;  1M8V A;  3GBQ A;  4Y92 A;  1X6B A;  2HSP A;  4M7D G;  2VKN A;  4N0A A;  4M7A A;  3GPL A;  1Y07 A;  5DM7 R;  1UJY A;  3VS4 A;  5EG2 A;  2KXD A;  4PJJ A;  5GMK l;  4C92 D;  3MKD A;  4IUV A;  3QDF A;  2XDB A;  3CCU A;  3OW2 A;  2EYX A;  3N5B B;  1QCO A;  1X2Q A;  3SFM A;  3L2R A;  3MCA B;  4LE9 A;  2QTX A;  1K8A C;  1LJO A;  4A4H A;  4ZTJ A;  4PKC C;  2CZ1 B;  3CCL T;  3UF4 A;  2JN0 A;  3OYJ A;  3MEA A;  1KG1 A;  2K2M A;  4RTT A;  2Y4Y A;  1HXD A;  4Z02 A;  2CT3 A;  1NEB A;  2RI5 A;  3CCV T;  1IO6 A;  2A08 A;  1PKS A;  2J6F A;  1AZG B;  2X4Y A;  1QKW A;  2DTI A;  3FJ5 A;  2M02 A;  2P4R A;  1AVZ C;  3CPW A;  2K5L A;  5KE2 A;  3S3M A;  3PTA A;  2X4W A;  2RI2 A;  2EGC A;  3CC7 Q;  4J9G A;  4HCC A;  3M0S A;  2AZS A;  1H3Z A;  1KSW A;  3G6E A;  3OYB A;  3GOX A;  4KGV B;  1ZLM A;  1UE9 A;  1YJW A;  1MNE A;  4PJO G;  4C0G A;  3VRY A;  1VQ5 T;  2MCN A;  5CCA A;  3PIO A;  3CCQ A;  2RK1 A;  1OZ2 A;  3IQL A;  1Z9Z A;  5LJ3 j;  2LVM A;  4Y91 A;  1S72 A;  1FMV A;  2J7I A;  1AWX A;  3TVT A;  1YHQ A;  1M90 U;  3F70 A;  1VQ9 Q;  1IZ6 A;  3TRE A;  3CCE A;  2JTF A;  2FL7 A;  2DMO A;  4NOY A;  1VQN T;  5CKB A;  3M4Y A;  1MUZ A;  1I81 A;  2CZ7 B;  2L0A A;  1MND A;  2KT1 A;  2EQM A;  5IHK A;  2L8D A;  4F7U E;  3JB9 I;  2KT8 A;  3R6O A;  1QQJ A;  1I5L A;  1AHJ B;  4J7F A;  1TTH B;  2QK0 A;  2HBP A;  3FIF A;  1X01 A;  1SSH A;  1N6A A;  1I5O B;  1LOJ A;  2RO0 A;  4C92 G;  2LJ0 A;  3JCM f;  4C8Q B;  1JU5 C;  2LP5 A;  3M4G A;  1C0M A;  1KD1 R;  1WJQ A;  5D6Y A;  2DBM A;  1D09 B;  3SDZ A;  4MZM A;  4X34 A;  3PVQ A;  4LNP A;  2PU9 B;  2G3R A;  3MP8 A;  2FG0 A;  3JCM b;  1NLO C;  3VU3 C;  2PZ1 A;  5DLQ E;  4JDS A;  3A8H B;  1I8F A;  3CME T;  1X75 C;  1JBM A;  3M5A A;  2F5K A;  2DVE A;  5LJ3 f;  4OMP A;  1QP2 A;  3CCM T;  3H0I A;  2K3X A;  3EFS A;  2C0O A;  2KYB A;  5LJ5 d;  3CCL A;  1SRM A;  3NPF A;  3VS6 A;  2JW4 A;  3CCR T;  2H8H A;  4C8Q C;  3OQ5 A;  2GFA A;  2V8K A;  1QKX A;  4N4G A;  3VJP A;  2B8A A;  4OMO A;  4ATO A;  1JXO A;  3JCM h;  3JCM X;  3PT9 A;  3SWN B;  2ED0 A;  2BZ8 A;  2CKK A;  3G71 Q;  1YI2 T;  2XI9 A;  3X26 B;  5IT9 E;  3LWH A;  3EGX B;  4BE2 A;  2E6Z A;  3SD4 A;  5FU6 B;  2E64 A;  4ZN1 A;  1VQP T;  1G3T A;  1RAD B;  2LJ1 A;  4ANJ A;  4E7S A;  1M1K C;  1WA7 A;  1TUG B;  1ZSZ C;  3E19 A;  3G4S Q;  1ACM B;  1K76 A;  5C6S A;  4LXC A;  1U3O A;  2EYY A;  5KCO A;  1KHI A;  2FO0 A;  1RAB B;  4AMC A;  2PNI A;  1X6O A;  2RQR A;  2EWN A;  1VQL A;  4NS5 A;  1RL2 A;  4M75 E;  1YCY A;  1BBZ A;  4KH1 B;  2DBK A;  3M9Q A;  3TEE A;  5LJ3 h;  5KYN A;  5IN1 A;  2LDM A;  5I22 A;  3EFO B;  2L89 A;  1OI1 A;  4ELZ C;  1SRL A;  2LCC A;  1VQN A;  2ROT A;  2F2X A;  4YTL A;  3ZBD A;  3JB9 F;  1NJI U;  1WQW A;  2SEM A;  4E7K A;  3ZL7 C;  2IVW A;  3CD6 Q;  1YNZ A;  3INZ A;  1T0H A;  2MI6 A;  1BIA A;  3KFV A;  5ECA A;  1D0Z A;  1H64 1;  1VUB A;  3UAT A;  4ZGD B;  3WXM B;  4R55 A;  2LZ6 B;  1SSF A;  5FU6 C;  3BDL A;  4X9D A;  3OYI A;  5D7U A;  3P8B B;  2HL5 C;  1TUD A;  1D0X A;  1VQO T;  2YUP A;  1KQS S;  4OB3 B;  2KE9 A;  3CBM A;  3L2Q A;  4GBQ A;  1ZUK A;  2DVJ A;  3M0U A;  2KK4 A;  3UA7 A;  3P8D A;  2DM1 A;  4HVV A;  2DO3 A;  2YRD A;  1GBQ A;  2AKK A;  5HY6 A;  3VS3 A;  1PG5 B;  1WJR A;  1KC8 U;  3H6Z A;  1ABO A;  2EJ9 A;  4V2S A;  3QO3 A;  2DL8 A;  2VB6 A;  3KXT A;  4XU0 A;  2E70 A;  1JXM A;  1YFN A;  3CME A;  2L5Q A;  4Q5W A;  3R6N A;  1K8A U;  4J8O A;  5GAM f;  4J9E A;  5LJ5 g;  2KSS A;  5KH6 A;  3HRU A;  1NE8 A;  3CC4 A;  4JJD A;  1GCQ C;  3CCM A;  4C5H A;  2BZY A;  3RDV A;  5KYW B;  1MMA A;  3FC3 A;  1ZA2 B;  1BCM A;  2KDS A;  4M78 D;  3CCU Q;  3LYI A;  1M90 C;  1JB0 E;  2QYZ A;  5A0D A;  2EQK A;  1PWT A;  3CCR A;  2EIF A;  2RD1 A;  4C5E A;  3GLX A;  3FDR A;  2PVO B;  4M7A B;  4JJN K;  2QAS A;  2K2V A;  1W2B P;  2VGM A;  3JSC A;  3CCJ A;  2RNA A;  1MMG A;  3QJ6 A;  4C8Q F;  3RKX A;  2DXU A;  3LW5 E;  1D1A A;  2ATC B;  4II1 A;  2DTH A;  1UTI A;  1G5V A;  1QW1 A;  3NTI A;  1KFZ A;  2X51 A;  1ZSZ A;  4Z88 A;  5A0G A;  2YSQ A;  1UGV A;  1VQP A;  1TSF A;  2FZG B;  2E65 A;  1W1F A;  3JCM c;  2ZPI B;  2R57 A;  2DKG A;  3OYG A;  1WHJ A;  3VV0 A;  3M0Q A;  1JEG A;  4TVR A;  5GMK i;  2LTO A;  4K11 A;  2RI3 A;  2OI3 A;  5GAM h;  3G6E Q;  2DXB A;  2A3L A;  3G7Z A;  1RAH B;  2E6N A;  2I2L A;  1K9M R;  1YJW Q;  3P8H A;  4EMK A;  2RQT A;  3L2W A;  3CCQ Q;  3RKY A;  3NGP A;  5AT1 B;  2CZ0 B;  4M7A C;  2KEA A;  1Z9Q A;  2NUP A;  4FW2 A;  4JRK A;  5GAO r;  4IKF A;  5GAN j;  3OYF A;  3JB9 D;  2LCL A;  1S72 Q;  1YHQ Q;  2EAY A;  3CBP A;  3CCE Q;  4C5I A;  2CP5 A;  1I4K 1;  2CP7 A;  2O2O A;  2ZPE B;  2DLP A;  2DIG A;  2YT6 A;  4M7D D;  3L42 A;  5DLO A;  4LUD A;  1FX7 A;  1XQH A;  3JB9 J;  2K4Y A;  4XQ3 A;  4RTZ A;  4BI4 A;  1C6V X;  1M30 A;  1Q7Y R;  1IHW A;  4M77 E;  4XTV A;  1W2B S;  2O4X A;  3X28 B;  2MAM A;  4M7D E;  2RA2 A;  2XIC A;  2KBT A;  5HK3 A;  1UG1 A;  2VVK A;  1FMK A;  2DER A;  1N8R C;  1JJ2 P;  4RTY A;  2CYZ B;  3SB2 A;  3CCS A;  2E3H A;  1RAG B;  2AK5 A;  3CEY A;  4RTX A;  2RJD A;  2QEX T;  4EIK A;  2V8I A;  2GTO A;  2E3I A;  2RHU A;  1VQ6 A;  1PD0 A;  1BYM A;  5CVI A;  4BI3 A;  2DRK A;  1KQS A;  4FL6 A;  5IHI A;  4BI8 B;  3OBY A;  4PL6 A;  2CH4 A;  1VQK T;  2DAQ A;  4C0D B;  3RMQ A;  4A53 A;  1VIE A;  2K3Y A;  1NPP A;  2X3W D;  1PCX A;  1T3S A;  3OYK A;  3MET A;  1M27 C;  5GAN f;  1MMN A;  4F7U A;  2HCK A;  1QCF A;  3CCL Q;  4PJO D;  1UFF A;  2HZY A;  2JM8 A;  1KHC A;  1VQ8 T;  3O8V A;  2V1R A;  4C8Q D;  3G1J A;  1NJI C;  1D3B B;  4OB0 B;  1K73 U;  4X1V A;  3MPU B;  1ZBJ A;  1E7O A;  3HRT A;  2DJZ A;  3BY7 A;  2YUN A;  1YIJ T;  2OTL T;  3HHT B;  2KQW A;  1M1K U;  1Q86 U;  3OS2 A;  1HYO A;  3TQ7 P;  2XD0 A;  3ME9 A;  1M1F A;  3EG0 A;  4PJO E;  2DA9 A;  3RIR A;  3JCM e;  1N5Z A;  2FRW A;  4WTO B;  5GAN 3;  4DQ2 A;  1YJN T;  3UT1 A;  3JB9 G;  3HP9 A;  5KYW A;  4E7H A;  3OS5 A;  3JCM V;  3CC2 T;  3OSV A;  5CO7 A;  1M2V B;  3HTR A;  2J06 A;  1F1B B;  2M0Y A;  4C0D C;  2DXT A;  2J6O A;  1IXD A;  1GRI A;  4OB1 B;  4RTU A;  2O31 A;  2GCX A;  3HRS A;  2VC8 A;  4MZT A;  1VQ5 Q;  4E2F B;  1KC8 C;  1VQL Q;  2PTK A;  5LJ3 e;  2ZZD A;  2KAF A;  1RLQ C;  5GAN h;  4M7A F;  2C0I A;  4QW2 A;  5LJ3 d;  1X2K A;  2Y4X A;  5I11 A;  3BFM A;  3VUB A;  4KGX B;  3I55 A;  1VQN Q;  1TXQ A;  3J7A F;  4R56 A;  4C92 E;  2M51 A;  4J9D A;  1TUC A;  2LNV A;  3PMT A;  4Z8A A;  2DF6 A;  4JUV A;  2VV5 A;  2DPP B;  3QKJ A;  1H92 A;  4OML A;  2EQU A;  4B9W A;  3EG3 A;  5GAO p;  2OJ2 A;  2KYM A;  3HKS A;  2WSF E;  2ZPG B;  3TU4 K;  2E12 A;  4KBM B;  1QVG S;  2EKH A;  4PJN A;  4L6V 5;  1ZQ1 A;  2JMA A;  1UDL A;  3QG1 A;  1UGQ B;  1BK2 A;  2A0F B;  2JTM A;  4JJC A;  3DLM A;  2COZ A;  4M75 A;  2VAS A;  2JM9 A;  2EVR A;  2DX1 A;  2DE0 X;  1WLP B;  3GNG A;  4C8Q G;  1R8O B;  2KRO A;  3M0R A;  1OX9 A;  4XTU A;  3HSB A;  1SF9 A;  3DKM A;  3LGL A;  3LGF A;  2BE7 D;  1VQK A;  2QAZ A;  3CME Q;  4ZTF A;  2NUT A;  2P0P A;  2B86 A;  4FW1 A;  1UUE A;  5CKH A;  1RAE B;  4D6W A;  5I2S A;  3CC4 Q;  3CCM Q;  1AEY A;  2RPN A;  2FHD A;  1Y7X A;  2RJC A;  3BW1 A;  3THK A;  1CKA A;  1VQ8 A;  2D8J A;  4EMH A; 
#chains in the Genus database with same CATH homology
 2LDM A;  5FLX E;  1Y96 B;  4C8Q D;  2L89 A;  3QZ9 B;  2CGH A;  4A54 A;  1NJI C;  4E7J A;  1OI1 A;  4ELZ C;  3V7S A;  2LCC A;  1VQN A;  4ELY C;  4YTL A;  3VKI A;  3E1S A;  1YIJ A;  2OTL A;  3ZBD A;  4XTW A;  2NLU A;  4JRQ A;  1K9M U;  3JB9 F;  3VYH B;  3JCM d;  5GAN 4;  1NJI U;  2QI2 A;  1WQW A;  4E7K A;  2IVW A;  2ZGW A;  2HD0 A;  3JCM W;  5AYF A;  4OVA A;  3INZ A;  4MMK A;  3M55 A;  1JJ2 S;  2MI6 A;  1BIA A;  2MMP A;  3HL8 A;  1H64 1;  1VUB A;  2XU8 A;  5KCH A;  3L1A A;  3M53 A;  4ZGD B;  4PLI A;  3WXM B;  4R55 A;  2JZ2 A;  1UGS B;  2RJE A;  2EKO A;  3QZ5 B;  4N0A C;  3CXC A;  3HPW A;  1M1G A;  4KUL A;  1SSF A;  3JB9 H;  5FU6 C;  3BDL A;  2YHT A;  3LX7 A;  1YIT T;  2GFU A;  3CC2 A;  4X9D A;  1V29 B;  1EIF A;  2VGN A;  3CCU T;  5GAO q;  2YRV A;  1Q81 C;  3OYI A;  4LDW A;  3OYC A;  3I56 A;  3SWN A;  3P8B B;  4Y28 E;  2LT4 A;  2PVD B;  3FEO A;  3QDR B;  4BD3 A;  5GMK j;  3CPW S;  1NPR A;  5A2Q E;  5GAO l;  1KD1 U;  2KMT A;  4L59 A;  3V7R A;  1VQO T;  1HK9 A;  1VQM T;  5CKD A;  4BY6 C;  1UEB A;  1KQS S;  3I55 T;  4M77 D;  4IUP A;  2MWO A;  4OB3 B;  1WGS A;  3J81 E;  3OS0 A;  3CBM A;  4LD6 A;  1PSF A;  1UGR B;  3L2Q A;  4OP0 A;  2XKO C;  2X4X A;  1D3B A;  5LJ3 g;  1BI1 A;  1WNL A;  5GAM e;  2KK4 A;  2PUO B;  3P8D A;  4XTZ A;  3QYH B;  4QQ6 A;  2HAX A;  2OAU A;  5GAN 6;  2DO3 A;  4NL2 A;  3RUX A;  1VQL A;  3OS1 A;  3G71 A;  4M7A D;  5HY6 A;  4M78 C;  4QVC A;  3QSU A;  1WJR A;  2MWP A;  3M54 A;  5I21 A;  4MDW A;  3MEV A;  1KC8 U;  3H6Z A;  5GMK h;  2EJ9 A;  4V2S A;  3JRZ A;  3QO3 A;  3JCM J;  3X20 B;  3ZEH A;  3JCM Q;  3KXT A;  2XG8 D;  2E70 A;  4XU0 A;  2P4T A;  1VQ7 T;  2JNG A;  3H8Z A;  2D9T A;  2FVU A;  4HKE A;  2X4J A;  3FB9 A;  4E7L A;  3C94 A;  3A8L B;  3G4S A;  3OB9 A;  4A4F A;  3CME A;  1N9R A;  2L5Q A;  1Y96 A;  4Q5W A;  1O75 A;  4J8O A;  3X24 B;  1K8A U;  5GAM f;  2E5Q A;  3VYG A;  3L2U A;  4FIB A;  2ZPH B;  2KSS A;  3T9N A;  5KH6 A;  5LJ5 g;  3C95 A;  1MHN A;  2OTJ T;  3MO8 A;  3HRU A;  4M78 G;  4EMK B;  5A0L A;  2DK3 A;  1NE8 A;  1XNI A;  4O6J A;  2BUD A;  4WF2 A;  4XU2 A;  4XU3 A;  3CCM A;  3CC4 A;  4C5H A;  4BE1 A;  4J6X A;  3MP6 A;  3AHU A;  3LWI A;  3E9G A;  3S6W A;  4M77 B;  3G6E T;  3FC3 A;  4QQD A;  4E7I A;  3RMS A;  2H3J A;  1G3W A;  4X9C A;  4M78 D;  2KDS A;  2QEX A;  3CCV A;  1N8R U;  4HCB A;  4M7D B;  4EMG A;  1YJW T;  5CKE A;  2QQ9 A;  3BDU A;  3LYI A;  5LL6 S;  1M90 C;  1JB0 E;  2RK2 A;  4A4E A;  4CI0 C;  3OY9 A;  2QQS A;  5A0D A;  2EQK A;  2QDY B;  4LDV A;  3CCR A;  1YJ9 T;  2XHC A;  1BI3 A;  3CCQ T;  1K73 C;  2EIF A;  3GIB A;  2RD1 A;  4UC4 A;  4C5E A;  2VUB A;  3V8J A;  4MDX A;  3GLX A;  1RI0 A;  2PVO B;  2O01 E;  3FDR A;  4M7A B;  5CR2 A;  2XDD A;  4JJN K;  4BAC A;  4J5Y A;  1W2B A;  2CZ6 B;  2K2V A;  2VGM A;  1YHQ T;  1O9S A;  2RB6 A;  3QBY A;  1U8R A;  4M75 F;  3JSC A;  1Q86 C;  3CCJ A;  3CD6 A;  3QJ6 A;  2DD5 A;  4C8Q F;  5C0M A;  4RCC A;  3CCE T;  3RKX A;  3LLR A;  2R5M A;  2DXU A;  2LQ8 A;  3LW5 E;  5M9O A;  2WAC A;  3V8L A;  4EPC A;  4B9X A;  5IAY A;  2EYQ A;  3S3O A;  5GAO m;  1VQ5 A;  3CXC S;  4FT4 A;  4II1 A;  5GAM j;  2DTH A;  3QYG B;  3L2V A;  1G5V A;  1QW1 A;  1G3S A;  2K5I A;  3NTI A;  1VQ4 T;  3WVE B;  1VQL T;  1KQ2 A;  2PQW A;  4HA8 A;  4NL3 A;  2O4X B;  3QPH A;  3MP1 A;  5A0G A;  2JUF A;  2WSC E;  3DB3 A;  4HT9 A;  1VQP A;  1WJS A;  5FRO A;  4PNO A;  1K9M C;  3PMI A;  4P5N A;  3JAM E;  3J80 E;  1U1S A;  4RKU E;  2E65 A;  3DLL A;  2EJG A;  5HKC A;  4M78 B;  2FB7 A;  4OMF B;  4RCB A;  5FU7 B;  3JCM c;  3C4S A;  1Y71 A;  2ZPI B;  2R57 A;  3LH0 A;  2DKG A;  2RM4 A;  3OYG A;  1QVG A;  1PSE A;  5KE3 A;  2X35 A;  3VV0 A;  4EMK C;  3MEU A;  4TVR A;  3MHX A;  5GMK i;  2QA4 T;  2LTO A;  3QII A;  3A8G B;  2RI3 A;  4LDY A;  4BDY A;  2VYT A;  3CPF A;  3JCM g;  2C06 A;  2D0Q B;  4M77 C;  2R5A A;  1Q82 U;  2ZPB B;  5GAM h;  2DXB A;  2A3L A;  3CMA T;  4M7D C;  3QUI A;  3G7Z A;  4DOV A;  2E6N A;  2I2L A;  1B34 A;  2BIV A;  3P8H A;  4EMK A;  4C0Z A;  1YJN A;  2YLC A;  3L2W A;  3OSS C;  3QJY A;  4J83 A;  3RKY A;  2K57 A;  1WQ7 A;  4C0F A;  2CZ0 B;  4M7A C;  3M58 A;  1DJ7 B;  2LC4 A;  3NTH A;  4M77 A;  4ZGE B;  3JCM P;  5GAO n;  4JRK A;  5J26 A;  5GAO r;  4IKF A;  1LNX A;  5GAN j;  3OYF A;  3JB9 D;  2LCL A;  4M77 G;  4JS5 A;  1M8V A;  1IRE B;  1GXI E;  2EAY A;  4PJO B;  4M7D G;  3CBP A;  5D6X A;  1TH7 A;  3UDC A;  4C5I A;  1WPY A;  1Q7Y C;  3KBG A;  1I4K 1;  2ZPE B;  4J6Y A;  4N0A A;  3PNW C;  3OMC A;  4DA4 A;  4M7A A;  2DIG A;  4ZN3 A;  1Y07 A;  3GPL A;  3OMG A;  5DM7 R;  3CC7 T;  4GLK A;  1ZBX A;  4F7U B;  5EG2 A;  3Q1J A;  4M7D D;  4M7A G;  3L42 A;  4OF1 A;  4FSX A;  5CAI A;  5GMK l;  4C92 D;  4IUV A;  5DLO A;  3OYH A;  1YIT A;  2XDB A;  3M56 A;  2LT1 A;  3CCU A;  1BI2 A;  1FX7 A;  1XQH A;  3OW2 A;  2DIQ A;  3N5B B;  4JLG A;  3JB9 J;  2K4Y A;  3SFM A;  3L2R A;  5GAM d;  1QVF A;  4XQ3 A;  3EFR A;  4L5G A;  2Y90 A;  3MCA B;  4BI4 A;  5FU7 C;  4IUQ A;  2QTX A;  1K8A C;  1LJO A;  2WSE E;  5CIU A;  4A4H A;  3E9F A;  4ZTJ A;  4PKC C;  2CZ1 B;  2LQK A;  3A8M B;  4CRI A;  4M77 E;  3CCL T;  1VQM A;  2P0K A;  4XTV A;  1W2B S;  1BKB A;  2IG0 A;  2O4X A;  2MAM A;  3X28 B;  4M7D E;  2RA2 A;  2XIC A;  1VQ9 T;  2JN0 A;  4FT2 A;  5HK3 A;  3G4S T;  2QQA A;  2XK0 A;  4QQG A;  2HQX A;  3OYJ A;  2E10 A;  4XTX A;  4LDX A;  3MEA A;  4M78 A;  2CS7 A;  1KG1 A;  1N8R C;  2HQE A;  2QQB A;  1JJ2 A;  4M7A E;  4QVZ A;  2RH2 A;  2Y4Y A;  1HXD A;  2CYZ B;  4Z02 A;  3SB2 A;  3CC4 T;  3CCS A;  5LJ5 e;  2E41 A;  3OYL A;  3CEY A;  2XDP A;  2LX9 A;  4E47 A;  2RJD A;  2RI5 A;  4OGC A;  2QEX T;  3CCV T;  2V8I A;  2DEQ A;  4HCZ A;  3OBW A;  4M78 F;  1VQ7 A;  4ZGJ B;  5GAN 2;  2X4Y A;  2DTI A;  4C92 B;  5GAN e;  4OGE A;  4PJO C;  3CPW A;  2K5L A;  2RHU A;  1VQ6 A;  5GAN d;  5L8R E;  1VIF A;  5KE2 A;  4DOW A;  3FRN A;  3S3M A;  4FM4 B;  1BYM A;  5CVI A;  3PTA A;  2X4W A;  4BI3 A;  3UPU A;  2OTJ A;  1BIB A;  2RI2 A;  4FL6 A;  4FU6 A;  4A4K A;  1KQS A;  5GAN 7;  4BI8 B;  3CCJ T;  5LJ5 f;  3OBY A;  3PFS A;  4HCC A;  4PL6 A;  1VQK T;  3C12 A;  2DAQ A;  4KUD K;  1H3Z A;  4C0D B;  3G6E A;  4M78 E;  5D6W A;  2A7Y A;  3RMQ A;  4RG8 A;  1M5Q 1;  3OYB A;  4A53 A;  3GOX A;  2PVG B;  1VIE A;  2K3Y A;  1NPP A;  3NTK A;  2ZPF B;  2V8J A;  1YJW A;  4PJO G;  2JVV A;  4C0G A;  3OYK A;  3MET A;  5GAN f;  1VQ5 T;  1YI2 A;  2DZ9 A;  3FJP A;  5CCA A;  3PIO A;  4F7U A;  3CCQ A;  3PIP A;  1YJ9 A;  2RK1 A;  1OZ2 A;  4KT0 E;  5LJ3 j;  3VUZ A;  4F7U G;  2LVM A;  5GAN 8;  4Y91 A;  3OYM A;  4PJO D;  2GF7 A;  1S72 A;  4M75 D;  1KHC A;  1VQ8 T;  1YHQ A;  3O8V A;  1M90 U;  2LRQ A;  3F70 A;  3OYY A;  2M0O A;  3L2Z A;  1D3B B;  4J6W A;  2DXC A;  4J7I A;  4OB0 B;  1IZ6 A;  5CK9 A;  2YLB A;  5J3B A;  3TRE A;  5GMK m;  2JTF A;  2MF2 A;  3CCE A;  5GAN 5;  2FL7 A;  3HRT A;  3A5Z B;  2DJZ A;  4NOY A;  1OYX A;  4N4I A;  3V8K A;  5CKB A;  1VQN T;  3BY7 A;  3M4Y A;  1YIJ T;  2OTL T;  3ER0 A;  3HHT B;  4KUI A;  2QQR A;  2KQW A;  1I81 A;  1MGQ A;  3GNF B;  2RHY A;  3OS2 A;  1Q86 U;  2VXE A;  1M1K U;  2CZ7 B;  2XD0 A;  3ME9 A;  1M1F A;  1VQ4 A;  3GP8 A;  4PJO E;  3RIR A;  3JCM e;  4PLL A;  5FRN A;  4MML A;  3ASK A;  2EQM A;  5LJ5 j;  4C92 C;  4BDZ A;  5GAN 3;  4DQ2 A;  3GF5 A;  2JOY A;  3UT1 A;  1YJN T;  3JB9 G;  2L8D A;  4F7U E;  3JB9 I;  2DZC A;  1KD1 C;  2RHZ A;  3R6O A;  3HP9 A;  4E7H A;  3OS5 A;  3JCM V;  1I5L A;  1AHJ B;  4J7F A;  4XU1 A;  3OSV A;  3CC2 T;  2HBP A;  2KY9 A;  3FIF A;  2QA4 A;  1X01 A;  5CKF A;  4BB7 A;  5CQX A;  1W4S A;  4M7D A;  5CO7 A;  3I56 T;  3OYD A;  1FXX A;  1N6A A;  4LD9 K;  4C0D C;  4C92 A;  2DD4 A;  2DXT A;  1LOJ A;  4GY5 A;  4M75 B;  1ZHI A;  2RO0 A;  3CMA A;  4OB1 B;  3SWN C;  4C92 G;  3JCM f;  4C8Q B;  3WVD B;  2GCX A;  3HRS A;  4ME7 A;  3ZFJ A;  3M4G A;  1N9S A;  3QXE B;  4M77 F;  4JRI A;  2VC8 A;  4MZT A;  1M4Z A;  5LJ5 h;  1WJQ A;  3V7C A;  4M7D F;  1KC8 C;  5D6Y A;  4QVD A;  1XOV A;  4C92 F;  5J39 A;  2EQJ A;  4IUR A;  2VXF A;  3A8O B;  3SDZ A;  5LJ3 e;  2BKD N;  3X25 B;  3G71 T;  4MZM A;  1K73 U;  2ZZD A;  2KAF A;  4X34 A;  3RES A;  5GAN h;  4M7A F;  4IUU A;  4QW2 A;  5LJ3 d;  2PU9 B;  2Y4X A;  4XK8 E;  2FYK A;  2G3R A;  1VQO A;  3MP8 A;  3BFM A;  3VUB A;  3JCM b;  4IUT A;  1OZ3 A;  3VU3 C;  3I55 A;  1KQ1 A;  1Q81 U;  2EJF A;  3CC7 A;  5GAM g;  4JS4 A;  3J7A F;  5DLQ E;  4JDS A;  4R56 A;  3A8H B;  4LDU A;  4C92 E;  3OYN A;  1I8F A;  3CME T;  2LNV A;  3RER A;  2PUK B;  2M16 A;  3M57 A;  1XTD A;  3PMT A;  3OYA A;  3URG A;  4JUV A;  1Q7Y U;  1X75 C;  1JBM A;  3M5A A;  2VV5 A;  2DPP B;  3QKJ A;  5DY9 A;  3S3N A;  2M9U A;  5FRM A;  2F5K A;  2DVE A;  5LJ3 f;  3CCS T;  1QP3 A;  2HNI A;  1QP2 A;  3CCM T;  4O5V A;  2E1H A;  2K3X A;  3EFS A;  5CQY A;  3MEW A;  2EFI A;  3NFC A;  2D6F A;  2EQU A;  5LJ5 d;  4B9W A;  3CCL A;  5GAO p;  5HK0 A;  2GQV A;  2L3R A;  3RKW A;  3HKS A;  1N27 A;  3OYE A;  2WSF E;  2ZPG B;  4RG2 A;  3TU4 K;  1VQ9 A;  2F5T X;  2E12 A;  3CCR T;  1P92 A;  4BE0 A;  1UB4 A;  4KBM B;  4M75 C;  1VQ6 T;  1QVG S;  4A4G A;  4C8Q C;  3OQ5 A;  1G3Y A;  1B34 B;  4L6V 5;  1ZQ1 A;  2DTO A;  2GFA A;  4EDU A;  3QG1 A;  2V8K A;  1UGQ B;  2RHX A;  2P0Q A;  2RHI A;  4N4G A;  3VJP A;  3CD6 T;  2B8A A;  2AHJ B;  2JTM A;  3CBO A;  4ATO A;  4XAX B;  5GAN g;  4PJO A;  2ZCF B;  1FWZ A;  3DLM A;  4M75 A;  5I2M A;  3HFN A;  1UGP B;  3JCM h;  3JCM X;  3PT9 A;  3SWN B;  1JRI A;  3HFO A;  4C8Q A;  2QXF A;  2CKK A;  3UWN A;  1YI2 T;  2R58 A;  4M75 G;  2XI9 A;  3X26 B;  2XID A;  5IT9 E;  1M9S A;  3GNG A;  3KUF A;  4C8Q G;  3LWH A;  1R8O B;  5GMK e;  3FLG A;  3M59 A;  1YBY A;  2E6Z A;  4OB2 B;  3SD4 A;  4BE2 A;  5FU6 B;  3DB4 A;  2E64 A;  4JLI A;  4ZN1 A;  1S72 T;  4XTU A;  1G3T A;  4PJO F;  1VQP T;  3HSB A;  3DKM A;  3LGL A;  1QVP A;  2K5F A;  1BI0 A;  3LGF A;  1M1K C;  1VQK A;  2KVQ G;  3E19 A;  1Q82 C;  4ZTF A;  5C6S A;  4F7U F;  2P0P A;  4BY6 B;  5KCO A;  1KHI A;  5CKH A;  2RJF A;  4N4H A;  4D6W A;  5I2S A;  1X6O A;  4JRP A;  4VUB A;  2EWN A;  2F69 A;  3EAE A;  1U1T A;  3PGG A;  3QHS A;  4C5G A;  4HT8 A;  2FHD A;  1Y7X A;  2RJC A;  3BW1 A;  4XTY A;  4BUG A;  4NS5 A;  2M1H A;  3TCJ A;  4RMO A;  1RL2 A;  3OA6 A;  3OW2 S;  4M75 E;  4MZP A;  1YCY A;  1QVF S;  4C8Q E;  1VQ8 A;  3M9Q A;  3TEE A;  5LJ3 h;  1NZ9 A;  5IN1 A;  4EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...