4M77D

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 20
structure length 75
sequence length 75
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77D00
2DXTA 2RM4A 4M75G 2CGHA 4M75D 5GMKj 3JCMe 3SWNB 2FYKA 3L1AA 4C8QD 3RIRA 4C8QF 1M5Q1 5GMKe 3JB9H 4JRKA 4C92B 4PJOC 1B34A 3FB9A 4WF2A 2RD1A 4A54A 5GANh 3AHUA 1KQ1A 2E41A 4A53A 4M75B 1HK9A 4EMHA 4M77A 3JCMd 5LJ5e 3RKWA 4PJOD 4PJOG 4M7DA 4M7DG 4PJOA 3V8LA 1I8FA 5LJ3h 4C92D 4XU0A 1WNLA 2I2LA 2JN0A 4C92G 5LJ3g 4V2SA 4C92F 4M77E 4HA8A 5GANd 5GAMh 4M7AC 5GAOm 1BIAA 3EFRA 5DY9A 5LJ5f 1I5LA 2EAYA 2VC8A 4PJOB 2RB6A 3L2ZA 5LJ3j 1Y96B 5GMKm 1HXDA 3V7RA 3QO3A 4RCCA 3JB9I 3RKYA 4XTYA 1B34B 1H641 4J5YA 3JCMW 1N9RA 2FB7A 3FIFA 1U1TA 1WPYA 2YLCA 4JUVA 3HSBA 4OP0A 2ZGWA 3JCMc 3RERA 1BIBA 2E65A 4XTVA 4M7DC 4M77C 4M7AE 4M78C 3JB9G 3V8JA 2DJZA 4C92A 4M7AG 4EMGA 4M7AD 5I21A 1U1SA 4QVCA 5GMKh 3QHSA 5GAOp 3BW1A 3PGGA 5LJ3f 1Y96A 5GMKl 1I81A 4NL3A 2QTXA 5GAN2 4HT8A 3JCMJ 2DZCA 5LJ5j 4QVDA 5LJ5d 4M78E 3QUIA 4JLIA 4F7UE 5GAOl 4M75E 3SWNA 3BY7A 4M7AB 2E10A 4X9DA 5LJ5g 5GAN8 3RESA 1KQ2A 2K57A 3V7SA 1D3BB 5GAOq 2EJ9A 3RKXA 1N9SA 4EMKC 2VXFA 1LNXA 1WQ7A 5GAMe 4PNOA 3JCMf 5GANg 5GAN4 4M77B 3EFSA 3INZA 4M75C 5CAIA 3GIBA 3HFOA 4NOYA 4M7DB 3JCMg 1TH7A 1WQWA 3RUXA 3V7CA 3V8KA 5GANf 4C92C 3HFNA 3FJPA 1MGQA 3JB9J 4XTWA 2DTHA 4Y91A 5GAOn 4PJOF 4M77D 4M7DF 3BFMA 4M77G 4X9CA 4XTZA 3SWNC 5LJ3d 4C8QG 1D3BA 4N0AA 4M77F 4NL2A 3QSUA 4M7DD 4XU2A 3JCMP 5GAMd 4C92E 4M78B 2HNIA 2YHTA 4F7UB 4M7DE 2RA2A 3JCMb 3JB9D 4C8QC 4XTXA 4C8QA 3BDUA 1M8VA 3JB9F 1X01A 1JBMA 2DZ9A 4XQ3A 4M78F 1YCYA 4EMKB 4F7UF 3JCMX 2E64A 4N0AC 4M78A 4M78G 1JRIA 2EJFA 4F7UG 4M78D 4F7UA 4M75A 5GAN3 4XU3A 2DKGA 2YLBA 4C8QE 3JCMV 5GAN6 5LJ3e 2DVEA 4DQ2A 2DTIA 3M4GA 2VXEA 2DEQA 3JCMh 2DXUA 4M7AF 3VU3C 1LOJA 5GANj 4J6XA 5GAMf 2EJGA 2EWNA 4J6WA 4JRIA 4RCBA 1I4K1 4HT9A 5GAOr 4M7AA 5GANe 2DTOA 4XTUA 4C8QB 4EMKA 3JCMQ 3SB2A 5GAN5 5GAMg 5LJ5h 5GMKi 4PJOE 4J6YA 5GAMj 4XU1A 1LJOA 5GAN7 4MMKA 4MMLA 2Y90A 4M75F 2E1HA
chains in the Genus database with same CATH superfamily
5GMKj 3G6ET 3QG1A 1WZOA 1T3SA 2R5MA 3NFCA 2DIGA 1W2BS 1QP2A 1IGQA 3VS4A 2ECZA 2DRMA 2E41A 1NJIU 1MMAA 2GQIA 5GJWB 3EGXB 2WSCE 1YFNA 2F2XA 4PJOD 3CCMA 6AT1B 2QEXT 3REBB 2EVRA 2LTOA 2JN0A 1I07A 1H8KA 1FX7A 2KEAA 1D0ZA 1HXDA 4A4GA 1U3OA 3JB9I 2CP6A 4J9GA 3ZBDA 4L59A 1U1TA 3QYGB 5FLXE 3CCLT 1RAHB 5KYUA 2P0QA 1M1KU 1Z9ZA 5I2MA 3JCMJ 1T0HA 2RHYA 2C0OA 3G1JA 4ZN1A 3RKXA 2YUQA 3DB4A 4AT1B 3ULRB 4KRTA 3INZA 5CAIA 2CP0A 3M0PA 3VS5A 4J9CA 1VQKQ 4XTWA 3OYLA 1NE8A 5DLOA 4C8QG 3I56A 2L2PA 4E7KA 1NG2A 2HNIA 3JB9D 4XTXA 5CCAA 2RK2A 4IUVA 1JJ2A 1VQ7Q 1QLYA 2EYWA 3I55T 3UA7A 1JJ2P 2GQVA 3C95A 2X4YA 2IG0A 3AT1B 4FT4A 1LOJA 2MCNA 2CH4A 2EQUA 3CPWS 3JCMQ 2KY9A 1UE9A 2LQNA 3L42A 4J6YA 2Y90A 3EAEA 4OVAA 3SWNB 2R57A 1YI2Q 3L2QA 1W6XA 3SD4A 3KFVA 3M0SA 4A4HA 3I9QA 4KT0E 1DJ7B 2AZVA 1K9MC 2AIRB 2A37A 4IUUA 4J7IA 2F5KA 1OPKA 2DYBA 3NTKA 1W2BP 2JS0A 4M7AC 2M02A 2J6FA 1HYOA 3J81E 2FEIA 2RNAA 2EQJA 2EQMA 1NLPC 2RJEA 4E7HA 1M1GA 3M5AA 4B9XA 3V8JA 4EMGA 1BCMA 3A5ZB 4AFQC 2A7YA 1UHFA 1AWXA 2QTXA 3P8BB 1K73C 4F7UE 2CDTA 3QUIA 2QQ9A 1G3SA 2JXBA 2QA4Q 4M7AB 3RESA 1KQSA 4A4EA 1SF9A 3JCMf 3VS7A 3G4ST 1Q82U 3CCQT 2J7IA 3SFMA 2HQXA 3GIBA 4JJDA 4M7DB 3V7CA 3E19A 3TVTA 1QVFP 3SDZA 1WFWA 2EQKA 5AT1B 3S3NA 2K3YA 4M77F 4IURA 1BBZA 4J9FA 1M90C 2LC4A 1T3LA 2LJ1A 4M78F 4N0AC 5ECAA 2YXYA 4GY5A 1WHMA 4KUDK 5CKHA 1I1JA 2KR3A 4LD9K 2DEQA 1R8OB 4J6XA 2Y4YA 1M2VB 2KDSA 3OMGA 1VQ9Q 4XTUA 1KHCA 1VQ7A 1YITQ 2HSPA 3A1PA 1FMVA 4P5NA 1X43A 4PJOE 2EPDA 2FRWA 2A28A 4M75F 2ROLA 2VWFA 3KBGA 3EH2A 2XK0A 3L1AA 3CC2T 4E7SA 2CP3A 1O75A 4PJOC 2FHDA 4FSXA 3X25B 4M77A 1TWBA 3TQ7P 2EFIA 2XG8D 4V2SA 3F70A 2LJ0A 5GAMh 4RTWA 5DY9A 1YI2A 3EGDA 2VC8A 1C1AA 1EX4A 1WJSA 2OI3A 5KYYA 1VQLA 2E4HA 2X4XA 3DLLA 3HSBA 4XTVA 4LNPA 3CCUT 2QXFA 4DA4A 1WGSA 1PKTA 1VQNA 4M7AG 1IREB 1TUDA 2ZPGB 3RBBB 1M1KC 1ZA2B 1D1BA 4GLMA 1QVGP 1VUBA 2DXCA 1OU9A 2BKDN 2W0ZA 3VRYA 4X9DA 3LX7A 3V7SA 1G3WA 2BZXA 3DLMA 3QIIA 1UEBA 4GBQA 2GFUA 2DE0X 3HFNA 2F69A 2FL7A 2XDDA 3JB9J 2EGAA 4FYVB 2KVQG 1M30A 4C0GA 2JTEA 2YHTA 4BY6C 1NJIC 2JNGA 2XDBA 3HHTB 2PZ1A 3JV3A 2Y4XA 1AT1B 4EMKB 4ATOA 1JRIA 1XJWB 3CPWP 1ZUKA 2O9VA 2RQWA 3FC3A 4GLKA 1IHVA 4DOVA 3SHWA 3CCSQ 4LDWA 4RCBA 1QW1A 2CP7A 1RAEB 2EGEA 1KQSP 5GAN5 4KULA 1K76A 1WHKA 2YRCA 1RLQC 1K0XA 3TSZA 4BACA 2BUDA 1UG1A 2CP5A 4ESRA 3EHRA 3AHUA 4A54A 5IXBA 1OI1A 4A53A 2XICA 5M9OA 2VVKA 1M90U 2E3HA 3CC7Q 3ASKA 1XQHA 4C92D 4FYWB 1SEMA 1MUZA 1QVPA 3I5RA 4FM4B 2AZSA 4HKEA 2FZKB 4BI4A 3DB3A 5CQYA 4CRIA 1M8MA 3OYGA 5HCKA 1PKSA 5KCHA 4FU6A 2IIMA 3QO3A 3QBYA 4LUDA 4E6RA 4ZN3A 2J05A 2PVOB 4CC4B 2KRMA 3A8OB 3LH0A 1N9RA 1C0MA 1PG5B 1VQ5T 3ZL7C 1VQLT 1BKBA 1WDXA 2LQKA 3CPWA 2DL5A 2CH4W 2QEXQ 2MOXA 1OEBA 3OYNA 1SKUB 4RTVA 5A2QE 4BI8B 2EKOA 3SWNA 2RI2A 1EFNA 4RTZA 2RPNA 1YWOA 4C0FA 3UPUA 2JTMA 1VQ8Q 5A0GA 2LJ3A 2JM8A 4PNOA 4F17A 2LCLA 2PUOB 3EFSA 3OBYA 4ORZA 1BI2A 3RUXA 3JSCA 1Y7XA 2KSSA 2ED1A 3HRSA 5A0LA 3CCEA 5IXFA 1RI9A 3VKIA 2LT4A 1MV3A 2RHZA 2BE7D 1VQPA 2EYYA 1YP5A 5J26A 2KNBB 1AHJB 1K9MR 1TXQA 2MWPA 4FW2A 4F7UG 4B6MA 2DF6A 4MZPA 1G3TA 3N5BB 4LDYA 4BDYA 3LWIA 3E1SA 4JZ4A 2SRCA 2YSQA 4XK8E 4ZGDB 4C8QB 2QA4A 2A08A 9ATCB 4FL6A 2RI5A 1ZSGA 2DL7A 1AWOA 4MMKA 2COZA 3M0TA 3CQTA 3CMET 4J8OA 4C5GA 2DXBA 1E6GA 1M3AA 5C0MA 1AZEA 3MEUA 1X6OA 2RF0A 8AT1B 3CXCA 4OMMA 3OYCA 2H3JA 4JRPA 3MKDA 2DD4A 4JJBA 2OAUA 3V8LA 4BUGA 1SG5A 4LUEA 2H8HA 2HQEA 4ZGEB 2GTJA 2V8IA 3Q1JA 5GMKm 2MMPA 3FRNA 3V7RA 1KHIA 2P0PA 1YJWQ 2BTTA 4RUGA 4KH1B 4X34A 1WPYA 4M7DC 1BIBA 2AK5A 3TREA 4J9EA 1QVGS 1IXDA 3UWNA 3OYJA 4D6WA 2OTLT 1M90R 4NL3A 3CC4T 4F14A 5CIUA 1K9AA 2KT8A 2O9SA 5GAOq 2EJ9A 5CVIA 5KYXB 2DLPA 1NBEB 2VXFA 1LNXA 3GNFB 2V1RA 1QCFA 2QDLA 1VQNQ 1KD1U 3JCMg 1ZSZA 4RG8A 2YT6A 2X51A 2KXCA 4Y91A 1W2BA 3OA6A 4M7DF 1G8XA 4M77G 3KUFA 1TTHB 3LH5A 5CR2A 1GCQA 4BI3A 1C6VX 1BI0A 1WLPB 1LPLA 4JPBW 2ZZDA 1K8AU 1N8RR 1Q82R 2FPDA 4E7JA 3CCQQ 2R5AA 2DVEA 2YUPA 3FDRA 3MHXA 3QDRB 1IRXA 2CSIA 4JRIA 3E9GA 1RUWA 3SB2A 4E7ZA 2YUNA 5KH6A 2VUBA 4J7FA 2RI3A 3CCET 3M0QA 3NHNA 2DILA 3CCRQ 2ABLA 4KGZB 3MP6A 1NLOC 1KJWA 4BE2A 3OYYA 4J83A 2JVVA 2EYZA 1I8FA 1VQ9T 2OTJA 2LCSA 1U06A 1X27A 1IO6A 5GANd 5L8RE 3PVQA 1QKXA 4ELYC 4R56A 2DA9A 3A8LB 1NPRA 5J3BA 2NUTA 2OAWA 1M9SA 3I56Q 3HKSA 4XTYA 1EIFA 1MMGA 5FU6C 4OMQA 1TU0B 2HL5C 4IUPA 7AT1B 2PTKA 2BZ8A 3D7SB 5LJ5d 2K5IA 3BY7A 2E10A 3GNGA 4C5HA 3C94A 3CXCS 1PCXA 1S72Q 4PFZA 3H0IA 3QPHA 1YJ9T 3PNWC 4JS4A 2L3PA 2MWOA 5L23A 2V1QA 1K73R 3HRTA 4HCZA 1AVZC 1YIJQ 3META 4C92E 2K79A 3H0HA 4F7UB 4EIKA 2LVMA 3OYMA 1ZHIA 3BDUA 1VQPT 4D8KA 1TG0A 1PD0A 1V1CA 3M55A 4M78A 2EJFA 3CD6A 1BCOA 3JCMV 5HY6A 3M4GA 2KYMA 2RN8A 2JUFA 1LCKA 3QZ9B 4XAXB 5GAOr 1QVGA 2D9TA 3UF4A 4RTXA 4OB0B 1K1ZA 3A8GB 4PFOA 5GAN7 2PQWA 3G6EA 3QXEB 2K2MA 2RM4A 1X69A 3MEWA 4PJNA 1NEBA 2RH2A 2KBTA 4OMFB 1B7TA 3X20B 2QI2A 3ZEHA 1WXUA 1YWPA 5LJ3h 1WHJA 1FMKA 2GTOA 2MK5A 2DL3A 8ATCB 3CCRA 2QA4T 4UC4A 2MYSA 3L2ZA 1PHTA 1Y96B 1WHLA 1JXOA 1H641 1PRMC 1G5VA 1HJDA 3JCMW 2E12A 1MMNA 4JUVA 3EG3A 2KXDA 2VKNA 4M78C 3JB9G 2C0IA 2XHCA 2CZ6B 2ED0A 2EIFA 3QHSA 4EDUA 4FW1A 1UGVA 2LCCA 1SHGA 2VYTA 3GF5A 3CCVQ 4JS5A 3BDLA 4JDSA 1VQ9A 1PSEA 2XKOC 3LGFA 3VUBA 3QKJA 3WXMB 1ZQ1A 1B3QA 4NOYA 2MPXC 1VQLQ 1TH7A 4C92C 1MGQA 5HK3A 3RMSA 2V26A 2DO3A 3JCMP 1CSKA 4OMPA 3VS3A 1YITT 2GBQA 2LNVA 3OS5A 4C8QA 1XTDA 1NZ9A 1X01A 4CC7A 1KC8R 4F7UF 1UDLA 2E64A 1OZ3A 3CCSA 3OYHA 3NTIA 2A36A 1K73U 1JQQA 1G3YA 1OX8A 3EGUA 2DBKA 2PVGB 4M7AF 2EW3A 2EWNA 4E47A 1I4K1 1TUGB 3OYKA 2J06A 2GFAA 1JJ2S 4EMKA 2AT1B 2CUBA 4QT7A 2CS7A 2CZ1B 1RAGB 3JCMe 2CGHA 2RK1A 2XI9A 4C5IA 1E6HA 3QJYA 2GCXA 4JRKA 4FYXB 1B34A 3CC7A 3CCUQ 4M75B 4EMHA 5CKFA 2JZ2A 4PJJA 4JRQA 2X35A 3HP9A 4PJOA 2HKNA 2H3EB 4OMOA 3OBWA 2X9HA 3CMAQ 2XDPA 3MEAA 5EG2A 4HVWA 4RG2A 4WTOB 2KK4A 2K9GA 2EGCA 1VQ6Q 3NPFA 4BE0A 3HPWA 1RAIB 2JTFA 4M4ZA 2FO0A 3JCMc 2ZGWA 2WSFE 2DFUA 2QQBA 3HL8A 2DJZA 2JMCA 3OW2A 1WXBA 1KIKA 5GMKl 1MHNA 1Y07A 1N8RC 3VV0A 1OX9A 3I55A 5LJ5j 3X24B 1X6GA 4M75E 2D0NA 2F5TX 2KRNA 2LNHB 2RO0A 3LYIA 1N27A 2QGGA 1YJNT 1BK2A 2LQ8A 1KD1C 2M0OA 1WIEA 4ZNXA 2VB6A 3CCST 1RI0A 1BB9A 5KCOA 2VGNA 4FT2A 1R0CB 2EYQA 1UHCA 3QSUA 2QK0A 3CCJQ 3EG2A 4E2FB 1YHQT 1SPKA 3M56A 4ANJA 4F04B 3CCUA 5J39A 1Q86R 3C4SA 2DKGA 5LJ3e 3OY9A 2XD0A 2LP5A 1ACMB 2VXEA 3EFOB 4PL6A 4N4IA 4FIBA 5GAMf 4Z88A 1QMCA 1OULA 3NTHA 4ZTFA 3REAB 4RMOA 2DTOA 4DEYA 5GAMg 1E7OA 3JRZA 5LL6S 5IAYA 4M75D 3RMQA 1M3BA 1Z9QA 2ZPFB 3GBQA 1LVKA 3RIRA 2YUOA 1WI7A 4B9WA 5GANh 4FCYA 1P92A 1N5ZA 3M59A 2Z0WA 2KYBA 1TS9A 2HSEB 4KH0B 4C92F 4HA8A 1NM7A 2ZPEB 5LJ5f 4R0KA 3CCEQ 5IHNA 1VQ8T 4RCCA 3RKYA 2DD5A 2DBMA 3EFOA 3I5SA 3LLRA 2O01E 2ESWA 2JOYA 2A0FB 3JAME 5I21A 1FXXA 1Y96A 1VQ6A 3ME9A 1GXIE 1D1AA 1VYTA 4L5GA 3OYBA 1K4US 2PNIA 1KQ2A 3M9QA 2EQIA 2GGRA 5GAMe 5GANg 2XU8A 1BI1A 3NMZC 3OS2A 4LE9A 5KE2A 4PKCC 4QKUA 2DTHA 3CCVA 3SWNC 4M7DD 3GP8A 2VV5A 1YITA 1D09B 3SEMA 1Y71A 1JBMA 3C0CA 4M75A 4O6JA 1OZ2A 1Q81C 1OPLA 1KG1A 1X75C 4YTLA 2F1LA 4J9DA 4LDVA 1ZA1B 2NLUA 4RTYA 1D1CA 4E7LA 3UATA 1NPPA 5KYWA 1VQPQ 3PTAA 3OYDA 4O5VA 1YJWT 5IN1A 5GMKe 1MV0B 5FU7B 1VQ4A 1G83A 1O9SA 4CC2A 3PFSA 1G2BA 2MAMA 2P84A 1YJ9A 2X4WA 1WXTA 4M7DG 1PRLC 1Y0MA 5KE3A 2ZPIB 1ZBJA 4Z8AA 3EFRA 1I5LA 4MZMA 4PFPA 2LX7A 4NS5A 1OU8A 1JB0E 2PU9B 3VS2A 4D8DA 2JW4A 3FIFA 2YLCA 2XMFA 2DRKA 4M7AE 3TEEA 1YN8A 4C92A 3LWHA 1VQ4Q 2DEUA 4Z89A 1H92A 5GAOp 3PGGA 3G71Q 2NUTB 1I81A 5KYWB 2OJ2A 2COYA 1EZZB 3VYGA 4JLIA 1VQOQ 5GAN8 2QEXA 1UGRB 1MNEA 4EMKC 1IB8A 1ZSZC 2DJQA 3VJPA 4C0ZA 1GRIA 3OB9A 3J80E 2BZYA 4KGVB 2WACA 4KGXB 1ZX6A 2HBPA 1Q86U 2YWWA 2X3XD 1WA7A 2J6KA 5EC7A 4PJOF 1JU5C 1TSFA 3QZ5B 4X9CA 2B8AA 1D3BA 4XU2A 3H9NA 3M0RA 1ZUYA 1VQMT 4C8QC 1M8VA 2LQWA 2V8JA 2L0AA 3CCRT 2PVDB 4Q5WA 3CEYA 1T0JA 3P8DA 4OF1A 4M78D 5FRNA 2K7AA 1IGUA 1JXMA 1RADB 1TUCA 2V8KA 2LMJA 5IHKA 4QVZA 4DBFA 2RMOA 1WJQA 3GLXA 2E5QA 2RHIA 1Q95G 2AKKA 2M51A 1WHHA 3I56T 4HCCA 3R6OA 2FZCB 2E70A 4C8QF 1M27C 1FYNA 4WF2A 4C0DC 3RKWA 1YJNA 2HEQA 2ATCB 1VA7A 2FVUA 2NUPB 4BD3A 4XU0A 5KYNA 5LJ3g 1W4SA 2D1XA 2NUZA 2CZ7B 1BIAA 1R77A 4IKFA 2RB6A 3IQLA 3L2UA 2D0QB 3RR6A 2QYZA 4PJLA 1S72T 3OSSC 2HD0A 2X4JA 5KYUB 3S6WA 3H8ZA 1YJ9Q 2QGFB 2CKKA 4BY6B 4WCIA 4M7AD 1YJWA 4QVCA 2HZYA 1YIJT 1SSHA 1ARKA 1W1FA 1UGPB 4CC3A 3VS6A 2FRYA 2K4YA 3CBPA 4OB1B 3CCMQ 2HKQB 3EGXA 4RKUE 5I2SA 4AFUC 3CCQA 2LRQA 1KFZA 2DETA 4FSSA 4NL2A 3X28B 5GAMd 1NYFA 2IPOB 4AG2C 4M78B 2O4XA 2JS2A 2O88A 1K8AC 2LX9A 4BE1A 5FU6B 4F7UA 5CKDA 2K2VA 2DL4A 2RJDA 1XOVA 4DQ2A 3CC2A 1GFDA 4J6WA 2J6OA 1QVFA 2D8HA 1MMDA 2HCKA 2KMTA 2RQTA 1UUEA 5FU7C 4PLIA 3MP8A 3GOXA 1FWZA 2K5LA 2K3XA 4OB2B 4KBMB 4C8QD 2OTLA 1M5Q1 1OOTA 5D6WA 2QASA 3FB9A 2RD1A 3U23A 4R55A 3VRZA 4DOWA 2OX7A 4VUBA 1MNDA 1M4ZA 2HDAA 3OW2P 2M0YA 4C92G 2D8JA 1AD5A 3FLGA 5CK9A 1GBRA 2RHXA 3CCVT 4OMLA 4A63B 2DM1A 3G6EQ 1UB4A 5A0DA 1GCQC 4HXJA 1H3ZA 1PC0A 2FB7A 3OYEA 2DVJA 5DLQE 2KQWA 3OYFA 2R58A 3VYHB 4JLGA 2ZCFB 3M57A 1HSQA 1Q81U 4MDXA 5IT9E 3EG0A 3OYIA 2AKLA 2SEMA 2JMAA 1I0CA 2DAQA 5GJVB 1IZ6A 1WQWA 4CI0C 4JJNK 3CD6Q 3L2WA 3FJPA 3WVDB 1Q86C 2G6FX 2O4XB 1VQOA 4M77D 4DBRA 4LDXA 3S3OA 2E6NA 1R0BG 3WVEB 1U5SA 3OS0A 4Y92A 2QAZA 2RQUA 2GNCA 1H3HA 1AZGB 3MJXA 1KD1R 4TVRA 4J9BA 3EG9B 1UJYA 4IUQA 4C8QE 1M2VA 4DBHA 2DL8A 2DTIA 2COWA 2BIVA 2X3WD 1YCSB 1NEGA 3CMAT 2CT3A 2O2OA 4ME7A 4LD6A 5AYFA 2OTJQ 5GMKi 3VS0A 3UA6A 1AEYA 4MMLA 4EPCA 4J5YA 2L3QA 1VQ6T 3OYAA 1VIEA 4PK4A 1VQMA 2FYKA 1KK7A 2NYSA 3I55Q 2KE9A 1Q7YU 3HTRA 1V76A 4C92B 1QKWA 1RLPC 3TSWA 3PMTA 1M1KR 4M7DA 1K0SA 1JO8A 2CT4A 2YDLA 4OGCA 1GL5A 2HMAA 4LN2A 2DMOA 4M77E 2VASA 1SHFA 1CKAA 3MCAB 3R6NA 1RABB 2ENMA 4AFZC 2DNUA 1YJNQ 4JJCA 1GBQA 3MP1A 3PIPA 1VQKA 3RERA 4X1VA 5KYXA 1UTIA 3O8VA 2F2WA 3QWXX 2L5QA 2KT1A 2RJCA 1NJIR 2LT1A 2DZCA 3CCJT 4QVDA 3OQ5A 4M78E 2L3RA 3OMCA 5GAOl 2KROA 1YHQQ 2K57A 2CUDA 2CP2A 2MF2A 4ZGJB 1WQ7A 2EBPA 4PLLA 4M77B 1Q82C 4M75C 4LDUA 4HVVA 1U8RA 1S72A 1F1BB 1VQ4T 3LW5E 2L89A 1FMWA 3BFMA 4AFSC 3G71T 1Q81R 4HVUA 2CREA 2E6ZA 2PUKB 5I11A 5CKEA 1YIJA 2NWMA 1PD1A 3EGDB 3TCJA 1UJ0A 1QP3A 2M9UA 1SRLA 4QW2A 1UGQB 1ZBXA 2YLBA 4XU3A 4Z02A 2CYZB 2MIOA 3QDFA 3S3MA 3L2VA 3O5ZA 4N4GA 3M53A 4M7AA 3VS1A 1QCOA 3DKMA 5LJ5h 4J9HA 4XU1A 1BU1A 1WHGA 1PWTA 5IHIA 1IHWA 4BDZA 1PM3A 4MZTA 3CCLQ 3A8MB 1KQ1A 2M16A 3M4YA 2A3LA 3G4SA 2VGMA 5LJ5e 4JZ3A 2D6FA 1RL2A 4OB3B 3C12A 2I2LA 1GFCA 4AMCA 2HQHA 1QWFA 2EAYA 1S1NA 5LJ3j 4DEXA 3CMAA 3CC2Q 1VYUA 2DX1A 1Y57A 4QQ6A 5FWBA 1Q7YR 2I0NA 5D7UA 4QQDA 4OMNA 1VQKT 4II1A 3QWYA 3EH1A 2P0KA 1K8AR 4HT8A 4LXCA 1YHQA 1M2OA 3ZFJA 1VQ7T 1GCPA 5DM7R 5GAN4 3PE0A 3HFOA 5GANf 3MO8A 2QTVA 3CBOA 2FPFA 2AHJB 4KUIA 4MDWA 1UGSB 1QWEA 3FJ5A 1ABOA 1TOVA 2RA2A 1X2QA 2RQVA 1ABQA 1PSFA 5FW9A 1ZSZB 5FWCA 1YI2T 1X6BA 2DK3A 3CCMT 3X26B 1N6AA 1AWJA 2DXUA 4N4HA 3VU3C 2KI7A 2JT4A 2LZ6B 1VQ5A 3QYHB 4QQGA 3UT1A 3EG9A 5HK0A 1OYXA 5GAMj 4FYYB 2E1HA 2DYIA 1D0YA 3H41A 3CCLA 2P4RA 2KAFA 3MEVA 3H0FA 3JB9H 4IUTA 2NUPA 1VIFA 2FZGB 2C0TA 1I5OB 4PJMA 3THKA 3JCMd 3EHQA 5D6YA 4PJOG 1ZLMA 1WNLA 4A4FA 3H6ZA 3OW2S 3BE3A 4HCBA 1UFFA 2K5FA 2RHUA 2JJ9A 1SSFA 3MPUB 5KYYB 2JM9A 3I35A 1VQOT 2F2VA 2KRSA 2CZ0B 3PMIA 1X2KA 5CKBA 3CXCP 1KQSS 1SRMA 3G4SQ 1M1FA 2E65A 2ZAEA 3RNJA 3TU4K 4M77C 3URGA 1CKBA 1W70A 1RAAB 1JEGA 3L2RA 3BW1A 5LJ3f 1N8RU 1YNZA 5GAN2 1AOJA 2BE9B 2YRDA 2HBWA 2EYXA 1NYGA 4AG1C 5LJ5g 1VQMQ 4HCKA 1QVFS 1QQJA 2GF7A 1KC8C 1VQ5Q 3CPFA 1BI3A 3V8KA 4DBQA 3CMEA 4BB7A 2XIDA 5GAOn 3QJ6A 3PT9A 5LJ3d 2EKHA 2O31A 3E2UA 3EG1A 4N0AA 4C5EA 2DIQA 3JCMb 4K11A 2DERA 2W10A 4XQ3A 3CCJA 4M78G 5GAN3 3RDVA 5C6SA 2CSQA 5CO7A 1M3CA 3JCMh 3M54A 4J9IA 2L8DA 3CD6T 1J3TA 2IVWA 3NGPA 2QG9B 5GANj 5FROA 1PNJA 1VQ8A 1VOMA 1ZUUA 1UECA 5FRMA 1A0NB 4RTTA 2LDMA 3G71A 2DXTA 4M75G 2RJFA 1Q7YC 4F16A 2P4TA 4ZTJA 3PVLA 1BYMA 1HK9A 1YBYA 3J7AF 2DPPB 3FEOA 1OV3A 1RACB 2QQSA 3LGLA 3CBMA 4OGEA 5GAOm 2OTJT 4PJOB 4ELZC 2M1HA 1AWWA 5HKCA 2RQRA 3OS1A 3CMEQ 1B34B 2G3RA 3T9NA 4OP0A 2HAXA 4RTUA 3M58A 1RAFB 1WYXA 2L3SA 3GPLA 1V29B 3KXTA 2E3IA 3PIOA 2K3BA 1U1SA 5GMKh 2E5KA 1OQKA 4Y28E 3VUZA 3A8HB 1K9MU 2ROTA 1D3BB 2FG0A 1N9SA 4IIOA 3UDCA 2MI6A 1KC8U 4C0DB 3ER0A 4IIMA 4A4KA 1VYVA 2OTLQ 1WJRA 1XNIA 2FPEA 2HL3A 4XTZA 5D6XA 3CC4Q 3OSVA 1QCNA 5I22A 4M7DE 1HD3A 2QQRA 3E9FA 3M0UA 3JB9F 2DZ9A 1B07A 3A98A 1YCYA 3JCMX 5IH2A 1VQNT 5GAN6 2WSEE 2QDYB 4E7IA 5CQXA 3G7ZA 1KSWA 2YRVA 4L6V5 2EJGA 3HRUA 1WX6A 1D0XA 2K6DA 2KGTA 2ZPBB 2ZPHB 2C06A 3CC7T 4HT9A 3P8HA 5GANe 2B86A 1LJOA 3CC4A 2QQAA
chains in the Genus database with same CATH topology
1VQMA 5GMKj 4M75D 3QG1A 3RMQA 3G6ET 2FYKA 3CMET 2ZPFB 4J8OA 4C5GA 1Q7YU 3RIRA 2DXBA 2R5MA 3NFCA 2DIGA 1W2BS 1QP2A 4C92B 5C0MA 4B9WA 3MEUA 1X6OA 5GANh 2E41A 3CXCA 1NJIU 1P92A 3PMTA 3OYCA 2WSCE 2H3JA 4JRPA 4PJOD 3M59A 3CCMA 4M7DA 2QEXT 2DD4A 3V8LA 2OAUA 4BUGA 2LTOA 2JN0A 2HQEA 4OGCA 4ZGEB 4C92F 4M77E 4HA8A 2ZPEB 1FX7A 5LJ5f 2V8IA 3Q1JA 3MCAB 5GMKm 1HXDA 2MMPA 3FRNA 1VQ8T 3V7RA 4RCCA 4A4GA 3JB9I 3RKYA 2DD5A 1KHIA 2P0PA 3ZBDA 4L59A 4X34A 3MP1A 1U1TA 1WPYA 3QYGB 5FLXE 3PIPA 3LLRA 3CCLT 1VQKA 1VQ6T 1BIBA 1QVGS 3TREA 3RERA 4M7DC 2O01E 3UWNA 3O8VA 3OYJA 2JOYA 4D6WA 3JAME 2L5QA 2OTLT 2P0QA 2RJCA 5I21A 1M1KU 1FXXA 1Y96A 4NL3A 2LT1A 3CC4T 1VQ6A 3ME9A 2DZCA 5I2MA 3JCMJ 3CCJT 1GXIE 4L5GA 3OQ5A 4M78E 4QVDA 2L3RA 3OYBA 3OMCA 5GAOl 5CIUA 2RHYA 1KQ2A 2K57A 3M9QA 5GAOq 2EJ9A 4ZN1A 5CVIA 3RKXA 2MF2A 2VXFA 4ZGJB 1LNXA 1WQ7A 3DB4A 5GAMe 3GNFB 4PLLA 5GANg 2XU8A 1BI1A 4M77B 1Q82C 3INZA 4M75C 5CAIA 1KD1U 4LDUA 3OS2A 3JCMg 1U8RA 4RG8A 1S72A 5KE2A 4PKCC 4XTWA 2DTHA 3OYLA 4Y91A 1W2BA 3OA6A 1VQ4T 3LW5E 3CCVA 2L89A 4M7DF 1NE8A 3BFMA 4M77G 3SWNC 4C8QG 5DLOA 3KUFA 3I56A 3G71T 4M7DD 4E7KA 3GP8A 2VV5A 5CR2A 4BI3A 2HNIA 1BI0A 3JB9D 2E6ZA 2PUKB 4XTXA 1YITA 5CCAA 1Y71A 2RK2A 2ZZDA 4IUVA 5CKEA 1YIJA 1K8AU 1JBMA 1JJ2A 3TCJA 2M9UA 1QP3A 3I55T 4QW2A 1UGQB 4M75A 4E7JA 1ZBXA 2R5AA 2YLBA 2GQVA 4XU3A 4Z02A 2DVEA 3C95A 4O6JA 2CYZB 1OZ2A 2X4YA 2IG0A 1Q81C 3FDRA 3MHXA 3QDRB 1KG1A 4FT4A 1LOJA 1X75C 4YTLA 4JRIA 3S3MA 3L2VA 3E9GA 4LDVA 2NLUA 4N4GA 3M53A 2EQUA 3CPWS 4M7AA 3JCMQ 4E7LA 2KY9A 3SB2A 3DKMA 5LJ5h 3L42A 1NPPA 2VUBA 4J6YA 4J7FA 2RI3A 4XU1A 5KH6A 3CCET 2Y90A 3EAEA 3PTAA 4OVAA 3SWNB 2R57A 3OYDA 3L2QA 4O5VA 3SD4A 3MP6A 1YJWT 4A4HA 4BDZA 5IN1A 4KT0E 3OYYA 5GMKe 4J83A 1DJ7B 4MZTA 4BE2A 5FU7B 1VQ4A 3A8MB 1KQ1A 1O9SA 2JVVA 2M16A 3M4YA 1K9MC 2A3LA 3PFSA 2MAMA 3G4SA 1YJ9A 2VGMA 5LJ5e 4IUUA 2X4WA 4J7IA 4M7DG 2D6FA 2F5KA 1RL2A 5KE3A 1I8FA 2ZPIB 4OB3B 1VQ9T 3NTKA 3C12A 2OTJA 2I2LA 4M7AC 5GANd 3EFRA 5L8RE 1I5LA 4Q5WA 2EAYA 4MZMA 3J81E 4ELYC 4R56A 3A8LB 1NPRA 4NS5A 5J3BA 5LJ3j 3CMAA 1M9SA 1JB0E 2PU9B 2EQJA 3HKSA 4XTYA 1EIFA 5FU6C 3FIFA 2EQMA 2YLCA 4QQ6A 2RJEA 4E7HA 1M1GA 4M7AE 3M5AA 3TEEA 4IUPA 4QQDA 4B9XA 3V8JA 1VQKT 4C92A 3LWHA 4II1A 4EMGA 3A5ZB 5GAOp 2P0KA 3PGGA 2A7YA 1I81A 2QTXA 4HT8A 3P8BB 1YHQA 5LJ5d 1K73C 2K5IA 3QUIA 4JLIA 2QQ9A 1G3SA 3VYGA 4F7UE 3ZFJA 3BY7A 4M7AB 2E10A 5GAN8 2QEXA 1UGRB 3RESA 1KQSA 1VQ7T 3GNGA 4A4EA 3C94A 4C5HA 3CXCS 4EMKC 3VJPA 5DM7R 4C0ZA 3OB9A 3J80E 3JCMf 5GAN4 3QPHA 3G4ST 3CCQT 1YJ9T 3SFMA 1Q82U 2HQXA 3PNWC 3GIBA 4JS4A 3HFOA 2WACA 4M7DB 2MWOA 3MO8A 5GANf 3V7CA 3E19A 3CBOA 2HBPA 1Q86U 3HRTA 4HCZA 3SDZA 2EQKA 2AHJB 3QZ5B 4PJOF 3S3NA 4X9CA 2K3YA 2B8AA 1D3BA 4KUIA 4M77F 4MDWA 1UGSB 3META 4XU2A 4IURA 4C92E 4F7UB 2RA2A 2LVMA 1VQMT 4C8QC 3OYMA 1ZHIA 3BDUA 1VQPT 1M8VA 2V8JA 1M90C 1PSFA 2LC4A 3CCRT 2PVDB 4M78F 1YI2T 3CEYA 3M55A 4N0AC 3P8DA 2DK3A 4M78A 2EJFA 4GY5A 4M78D 4OF1A 3CCMT 3CD6A 4KUDK 5CKHA 3JCMV 5FRNA 5HY6A 4LD9K 3X26B 1N6AA 3M4GA 2DEQA 1R8OB 2DXUA 4N4HA 3VU3C 2V8KA 2JUFA 4J6XA 2Y4YA 3QZ9B 4QVZA 4XAXB 2KDSA 1WJQA 1VQ5A 3OMGA 5GAOr 1QVGA 3GLXA 2D9TA 3QYHB 1KHCA 4QQGA 4XTUA 3UT1A 1VQ7A 2E5QA 5HK0A 1OYXA 4OB0B 4P5NA 3A8GB 5GAMj 2RHIA 2PQWA 5GAN7 3QXEB 3G6EA 4PJOE 4M75F 2E1HA 2RM4A 3KBGA 3I56T 4HCCA 2XK0A 3R6OA 3L1AA 3CC2T 2E70A 3MEWA 3CCLA 2RH2A 2KAFA 3MEVA 4OMFB 4C8QF 3JB9H 1O75A 4IUTA 4PJOC 1VIFA 4WF2A 2FHDA 4FSXA 3X20B 3X25B 4M77A 2QI2A 4C0DC 3JCMd 3RKWA 3ZEHA 1YJNA 5D6YA 4PJOG 2FVUA 2EFIA 4BD3A 5LJ3h 4XU0A 1WNLA 4A4FA 2XG8D 5LJ3g 1W4SA 3F70A 3H6ZA 3OW2S 4V2SA 4HCBA 5GAMh 2K5FA 2RHUA 2CZ7B 1SSFA 1BIAA 5DY9A 3CCRA 1YI2A 2VC8A 2QA4T 1VQOT 4UC4A 2RB6A 4IKFA 3L2UA 2D0QB 3L2ZA 1Y96B 1WJSA 2CZ0B 1S72T 3OSSC 3PMIA 5CKBA 1VQLA 1H641 1G5VA 2HD0A 2X4JA 3JCMW 2E12A 2X4XA 3H8ZA 3S6WA 1KQSS 4JUVA 1M1FA 3DLLA 3HSBA 2E65A 4XTVA 3TU4K 3CCUT 2QXFA 4M77C 4M78C 2CKKA 3URGA 4BY6B 3JB9G 4DA4A 1WGSA 2XHCA 1VQNA 4M7AG 1IREB 2ZPGB 4M7AD 1YJWA 2CZ6B 2EIFA 4QVCA 1M1KC 3QHSA 4EDUA 3BW1A 5LJ3f 3L2RA 1YIJT 1N8RU 2LCCA 5GAN2 2VYTA 1VUBA 2DXCA 2BKDN 3GF5A 5LJ5g 4X9DA 3LX7A 1UGPB 4JS5A 1QVFS 3V7SA 1G3WA 3BDLA 4JDSA 1VQ9A 1PSEA 2K4YA 2XKOC 3CBPA 3LGFA 3VUBA 3QKJA 3WXMB 3DLMA 4OB1B 3QIIA 2GF7A 1UEBA 4RKUE 1KC8C 2GFUA 1ZQ1A 4NOYA 3CPFA 1TH7A 1BI3A 3V8KA 3CMEA 5I2SA 4BB7A 4C92C 3HFNA 3CCQA 2F69A 2FL7A 1MGQA 2LRQA 2XIDA 2XDDA 3JB9J 5HK3A 5GAOn 3RMSA 3QJ6A 3PT9A 5LJ3d 4NL2A 4N0AA 2KVQG 3X28B 2DO3A 3JCMP 5GAMd 4C0GA 1YITT 4M78B 2YHTA 4C5EA 4BY6C 1NJIC 2DIQA 2JNGA 2O4XA 2XDBA 3JCMb 2LNVA 3HHTB 3OS5A 4C8QA 1XTDA 1NZ9A 1X01A 2Y4XA 1K8AC 2LX9A 4BE1A 5FU6B 4XQ3A 4F7UF 4EMKB 4ATOA 3CCJA 2E64A 4F7UA 4M78G 1JRIA 5GAN3 1OZ3A 5CKDA 5C6SA 2K2VA 3OYHA 3NTIA 5CO7A 3CCSA 2RJDA 3FC3A 4GLKA 1XOVA 4DQ2A 1K73U 3CC2A 1G3YA 3OYAA 3JCMh 3M54A 2L8DA 4DOVA 3CD6T 4M7AF 2PVGB 2IVWA 5GANj 5FROA 2EWNA 4E47A 4J6WA 4LDWA 4RCBA 1I4K1 1QW1A 1VQ8A 1QVFA 3OYKA 2GFAA 1JJ2S 4EMKA 5GAN5 4KULA 5FRMA 2KMTA 5FU7C 4PLIA 2CS7A 3MP8A 2LDMA 1FWZA 3GOXA 2CZ1B 2K5LA 3G71A 2DXTA 4M75G 3JCMe 2CGHA 4BACA 2BUDA 2RJFA 2K3XA 2RK1A 4OB2B 2XI9A 4KBMB 4C5IA 4C8QD 1Q7YC 2OTLA 3QJYA 1M5Q1 2P4TA 2GCXA 4JRKA 5D6WA 1B34A 3FB9A 2RD1A 4A54A 3CC7A 3AHUA 1OI1A 4A53A 2XICA 4ZTJA 4M75B 1HK9A 4EMHA 1BYMA 5CKFA 5M9OA 1YBYA 2JZ2A 4JRQA 4R55A 2X35A 4DOWA 1M90U 3HP9A 4PJOA 3ASKA 4VUBA 1M4ZA 1XQHA 3OBWA 3J7AF 2DPPB 4C92D 3FEOA 4C92G 2XDPA 1QVPA 4FM4B 2QQSA 3MEAA 4HKEA 5EG2A 3FLGA 3CBMA 3LGLA 4OGEA 4RG2A 3DB3A 4BI4A 5CQYA 4CRIA 5CK9A 2KK4A 5GAOm 2OTJT 2RHXA 3OYGA 4ELZC 2M1HA 3CCVT 4PJOB 5KCHA 4FU6A 5HKCA 3QO3A 1UB4A 3QBYA 5A0DA 3OS1A 1B34B 4ZN3A 3HPWA 4BE0A 2PVOB 1H3ZA 3A8OB 2G3RA 1N9RA 2FB7A 2JTFA 3LH0A 3T9NA 4OP0A 2ZGWA 3JCMc 3M58A 2WSFE 1VQ5T 2HAXA 3GPLA 1BKBA 3OYEA 1VQLT 2LQKA 2QQBA 1V29B 3HL8A 3CPWA 3KXTA 2DJZA 5DLQE 2KQWA 3OW2A 3OYFA 3PIOA 2R58A 3VYHB 4JLGA 2ZCFB 1U1SA 3M57A 5GMKh 5GMKl 1MHNA 1Y07A 3OYNA 1N8RC 3VV0A 4Y28E 3I55A 3VUZA 3A8HB 5LJ5j 5A2QE 4BI8B 3X24B 1Q81U 4MDXA 2EKOA 4M75E 3SWNA 1K9MU 2RI2A 5IT9E 4C0FA 3OYIA 2F5TX 3UPUA 1D3BB 2JTMA 5A0GA 1N9SA 2RO0A 3LYIA 1N27A 3UDCA 4PNOA 1YJNT 2MI6A 2LCLA 1KC8U 2PUOB 2DAQA 3EFSA 2LQ8A 3OBYA 4C0DB 1KD1C 1IZ6A 3ER0A 1BI2A 1WQWA 2M0OA 3RUXA 4A4KA 4CI0C 4JJNK 3JSCA 1Y7XA 2KSSA 3L2WA 3CCST 1RI0A 3FJPA 3HRSA 3WVDB 1Q86C 5A0LA 3CCEA 5KCOA 2O4XB 2VGNA 4FT2A 1WJRA 1XNIA 4M77D 1VQOA 4XTZA 4LDXA 2EYQA 3VKIA 3S3OA 5D6XA 2E6NA 3QSUA 2LT4A 2RHZA 3WVEB 3OS0A 1VQPA 3OSVA 4M7DE 5J26A 1YHQT 2QQRA 3E9FA 1AHJB 3M56A 3JB9F 2DZ9A 4TVRA 3JCMX 1YCYA 3CCUA 2MWPA 4F7UG 5J39A 1VQNT 3C4SA 2DKGA 4IUQA 4C8QE 5GAN6 2WSEE 5LJ3e 3OY9A 2XD0A 2DTIA 4MZPA 2VXEA 1G3TA 2QDYB 4E7IA 2BIVA 5CQXA 3G7ZA 3N5BB 4PL6A 4N4IA 2YRVA 4FIBA 2EJGA 4L6V5 4LDYA 5GAMf 4BDYA 3LWIA 3E1SA 3HRUA 3CC7T 2ZPHB 2ZPBB 4XK8E 2C06A 3NTHA 4ZTFA 3P8HA 3CMAT 4HT9A 5GANe 4RMOA 4ZGDB 2DTOA 4LD6A 4ME7A 4C8QB 2QA4A 5AYFA 4FL6A 5GAMg 2RI5A 5GMKi 1LJOA 4MMKA 3JRZA 4MMLA 4EPCA 4J5YA 5LL6S 3CC4A 5IAYA 1VIEA 2QQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXT A;  2RM4 A;  4M75 G;  2CGH A;  4M75 D;  5GMK j;  3JCM e;  3SWN B;  2FYK A;  3L1A A;  4C8Q D;  3RIR A;  4C8Q F;  1M5Q 1;  5GMK e;  3JB9 H;  4JRK A;  4C92 B;  4PJO C;  1B34 A;  3FB9 A;  4WF2 A;  2RD1 A;  4A54 A;  5GAN h;  3AHU A;  1KQ1 A;  2E41 A;  4A53 A;  4M75 B;  1HK9 A;  4EMH A;  4M77 A;  3JCM d;  5LJ5 e;  3RKW A;  4PJO D;  4PJO G;  4M7D A;  4M7D G;  4PJO A;  3V8L A;  1I8F A;  5LJ3 h;  4C92 D;  4XU0 A;  1WNL A;  2I2L A;  2JN0 A;  4C92 G;  5LJ3 g;  4V2S A;  4C92 F;  4M77 E;  4HA8 A;  5GAN d;  5GAM h;  4M7A C;  5GAO m;  1BIA A;  3EFR A;  5DY9 A;  5LJ5 f;  1I5L A;  2EAY A;  2VC8 A;  4PJO B;  2RB6 A;  3L2Z A;  5LJ3 j;  1Y96 B;  5GMK m;  1HXD A;  3V7R A;  3QO3 A;  4RCC A;  3JB9 I;  3RKY A;  4XTY A;  1B34 B;  1H64 1;  4J5Y A;  3JCM W;  1N9R A;  2FB7 A;  3FIF A;  1U1T A;  1WPY A;  2YLC A;  4JUV A;  3HSB A;  4OP0 A;  2ZGW A;  3JCM c;  3RER A;  1BIB A;  2E65 A;  4XTV A;  4M7D C;  4M77 C;  4M7A E;  4M78 C;  3JB9 G;  3V8J A;  2DJZ A;  4C92 A;  4M7A G;  4EMG A;  4M7A D;  5I21 A;  1U1S A;  4QVC A;  5GMK h;  3QHS A;  5GAO p;  3BW1 A;  3PGG A;  5LJ3 f;  1Y96 A;  5GMK l;  1I81 A;  4NL3 A;  2QTX A;  5GAN 2;  4HT8 A;  3JCM J;  2DZC A;  5LJ5 j;  4QVD A;  5LJ5 d;  4M78 E;  3QUI A;  4JLI A;  4F7U E;  5GAO l;  4M75 E;  3SWN A;  3BY7 A;  4M7A B;  2E10 A;  4X9D A;  5LJ5 g;  5GAN 8;  3RES A;  1KQ2 A;  2K57 A;  3V7S A;  1D3B B;  5GAO q;  2EJ9 A;  3RKX A;  1N9S A;  4EMK C;  2VXF A;  1LNX A;  1WQ7 A;  5GAM e;  4PNO A;  3JCM f;  5GAN g;  5GAN 4;  4M77 B;  3EFS A;  3INZ A;  4M75 C;  5CAI A;  3GIB A;  3HFO A;  4NOY A;  4M7D B;  3JCM g;  1TH7 A;  1WQW A;  3RUX A;  3V7C A;  3V8K A;  5GAN f;  4C92 C;  3HFN A;  3FJP A;  1MGQ A;  3JB9 J;  4XTW A;  2DTH A;  4Y91 A;  5GAO n;  4PJO F;  4M77 D;  4M7D F;  3BFM A;  4M77 G;  4X9C A;  4XTZ A;  3SWN C;  5LJ3 d;  4C8Q G;  1D3B A;  4N0A A;  4M77 F;  4NL2 A;  3QSU A;  4M7D D;  4XU2 A;  3JCM P;  5GAM d;  4C92 E;  4M78 B;  2HNI A;  2YHT A;  4F7U B;  4M7D E;  2RA2 A;  3JCM b;  3JB9 D;  4C8Q C;  4XTX A;  4C8Q A;  3BDU A;  1M8V A;  3JB9 F;  1X01 A;  1JBM A;  2DZ9 A;  4XQ3 A;  4M78 F;  1YCY A;  4EMK B;  4F7U F;  3JCM X;  2E64 A;  4N0A C;  4M78 A;  4M78 G;  1JRI A;  2EJF A;  4F7U G;  4M78 D;  4F7U A;  4M75 A;  5GAN 3;  4XU3 A;  2DKG A;  2YLB A;  4C8Q E;  3JCM V;  5GAN 6;  5LJ3 e;  2DVE A;  4DQ2 A;  2DTI A;  3M4G A;  2VXE A;  2DEQ A;  3JCM h;  2DXU A;  4M7A F;  3VU3 C;  1LOJ A;  5GAN j;  4J6X A;  5GAM f;  2EJG A;  2EWN A;  4J6W A;  4JRI A;  4RCB A;  1I4K 1;  4HT9 A;  5GAO r;  4M7A A;  5GAN e;  2DTO A;  4XTU A;  4C8Q B;  4EMK A;  3JCM Q;  3SB2 A;  5GAN 5;  5GAM g;  5LJ5 h;  5GMK i;  4PJO E;  4J6Y A;  5GAM j;  4XU1 A;  1LJO A;  5GAN 7;  4MMK A;  4MML A;  2Y90 A;  4M75 F;  2E1H A; 
#chains in the Genus database with same CATH topology
 5GMK j;  3G6E T;  3QG1 A;  1WZO A;  1T3S A;  2R5M A;  3NFC A;  2DIG A;  1W2B S;  1QP2 A;  1IGQ A;  3VS4 A;  2ECZ A;  2DRM A;  2E41 A;  1NJI U;  1MMA A;  2GQI A;  5GJW B;  3EGX B;  2WSC E;  1YFN A;  2F2X A;  4PJO D;  3CCM A;  6AT1 B;  2QEX T;  3REB B;  2EVR A;  2LTO A;  2JN0 A;  1I07 A;  1H8K A;  1FX7 A;  2KEA A;  1D0Z A;  1HXD A;  4A4G A;  1U3O A;  3JB9 I;  2CP6 A;  4J9G A;  3ZBD A;  4L59 A;  1U1T A;  3QYG B;  5FLX E;  3CCL T;  1RAH B;  5KYU A;  2P0Q A;  1M1K U;  1Z9Z A;  5I2M A;  3JCM J;  1T0H A;  2RHY A;  2C0O A;  3G1J A;  4ZN1 A;  3RKX A;  2YUQ A;  3DB4 A;  4AT1 B;  3ULR B;  4KRT A;  3INZ A;  5CAI A;  2CP0 A;  3M0P A;  3VS5 A;  4J9C A;  1VQK Q;  4XTW A;  3OYL A;  1NE8 A;  5DLO A;  4C8Q G;  3I56 A;  2L2P A;  4E7K A;  1NG2 A;  2HNI A;  3JB9 D;  4XTX A;  5CCA A;  2RK2 A;  4IUV A;  1JJ2 A;  1VQ7 Q;  1QLY A;  2EYW A;  3I55 T;  3UA7 A;  1JJ2 P;  2GQV A;  3C95 A;  2X4Y A;  2IG0 A;  3AT1 B;  4FT4 A;  1LOJ A;  2MCN A;  2CH4 A;  2EQU A;  3CPW S;  3JCM Q;  2KY9 A;  1UE9 A;  2LQN A;  3L42 A;  4J6Y A;  2Y90 A;  3EAE A;  4OVA A;  3SWN B;  2R57 A;  1YI2 Q;  3L2Q A;  1W6X A;  3SD4 A;  3KFV A;  3M0S A;  4A4H A;  3I9Q A;  4KT0 E;  1DJ7 B;  2AZV A;  1K9M C;  2AIR B;  2A37 A;  4IUU A;  4J7I A;  2F5K A;  1OPK A;  2DYB A;  3NTK A;  1W2B P;  2JS0 A;  4M7A C;  2M02 A;  2J6F A;  1HYO A;  3J81 E;  2FEI A;  2RNA A;  2EQJ A;  2EQM A;  1NLP C;  2RJE A;  4E7H A;  1M1G A;  3M5A A;  4B9X A;  3V8J A;  4EMG A;  1BCM A;  3A5Z B;  4AFQ C;  2A7Y A;  1UHF A;  1AWX A;  2QTX A;  3P8B B;  1K73 C;  4F7U E;  2CDT A;  3QUI A;  2QQ9 A;  1G3S A;  2JXB A;  2QA4 Q;  4M7A B;  3RES A;  1KQS A;  4A4E A;  1SF9 A;  3JCM f;  3VS7 A;  3G4S T;  1Q82 U;  3CCQ T;  2J7I A;  3SFM A;  2HQX A;  3GIB A;  4JJD A;  4M7D B;  3V7C A;  3E19 A;  3TVT A;  1QVF P;  3SDZ A;  1WFW A;  2EQK A;  5AT1 B;  3S3N A;  2K3Y A;  4M77 F;  4IUR A;  1BBZ A;  4J9F A;  1M90 C;  2LC4 A;  1T3L A;  2LJ1 A;  4M78 F;  4N0A C;  5ECA A;  2YXY A;  4GY5 A;  1WHM A;  4KUD K;  5CKH A;  1I1J A;  2KR3 A;  4LD9 K;  2DEQ A;  1R8O B;  4J6X A;  2Y4Y A;  1M2V B;  2KDS A;  3OMG A;  1VQ9 Q;  4XTU A;  1KHC A;  1VQ7 A;  1YIT Q;  2HSP A;  3A1P A;  1FMV A;  4P5N A;  1X43 A;  4PJO E;  2EPD A;  2FRW A;  2A28 A;  4M75 F;  2ROL A;  2VWF A;  3KBG A;  3EH2 A;  2XK0 A;  3L1A A;  3CC2 T;  4E7S A;  2CP3 A;  1O75 A;  4PJO C;  2FHD A;  4FSX A;  3X25 B;  4M77 A;  1TWB A;  3TQ7 P;  2EFI A;  2XG8 D;  4V2S A;  3F70 A;  2LJ0 A;  5GAM h;  4RTW A;  5DY9 A;  1YI2 A;  3EGD A;  2VC8 A;  1C1A A;  1EX4 A;  1WJS A;  2OI3 A;  5KYY A;  1VQL A;  2E4H A;  2X4X A;  3DLL A;  3HSB A;  4XTV A;  4LNP A;  3CCU T;  2QXF A;  4DA4 A;  1WGS A;  1PKT A;  1VQN A;  4M7A G;  1IRE B;  1TUD A;  2ZPG B;  3RBB B;  1M1K C;  1ZA2 B;  1D1B A;  4GLM A;  1QVG P;  1VUB A;  2DXC A;  1OU9 A;  2BKD N;  2W0Z A;  3VRY A;  4X9D A;  3LX7 A;  3V7S A;  1G3W A;  2BZX A;  3DLM A;  3QII A;  1UEB A;  4GBQ A;  2GFU A;  2DE0 X;  3HFN A;  2F69 A;  2FL7 A;  2XDD A;  3JB9 J;  2EGA A;  4FYV B;  2KVQ G;  1M30 A;  4C0G A;  2JTE A;  2YHT A;  4BY6 C;  1NJI C;  2JNG A;  2XDB A;  3HHT B;  2PZ1 A;  3JV3 A;  2Y4X A;  1AT1 B;  4EMK B;  4ATO A;  1JRI A;  1XJW B;  3CPW P;  1ZUK A;  2O9V A;  2RQW A;  3FC3 A;  4GLK A;  1IHV A;  4DOV A;  3SHW A;  3CCS Q;  4LDW A;  4RCB A;  1QW1 A;  2CP7 A;  1RAE B;  2EGE A;  1KQS P;  5GAN 5;  4KUL A;  1K76 A;  1WHK A;  2YRC A;  1RLQ C;  1K0X A;  3TSZ A;  4BAC A;  2BUD A;  1UG1 A;  2CP5 A;  4ESR A;  3EHR A;  3AHU A;  4A54 A;  5IXB A;  1OI1 A;  4A53 A;  2XIC A;  5M9O A;  2VVK A;  1M90 U;  2E3H A;  3CC7 Q;  3ASK A;  1XQH A;  4C92 D;  4FYW B;  1SEM A;  1MUZ A;  1QVP A;  3I5R A;  4FM4 B;  2AZS A;  4HKE A;  2FZK B;  4BI4 A;  3DB3 A;  5CQY A;  4CRI A;  1M8M A;  3OYG A;  5HCK A;  1PKS A;  5KCH A;  4FU6 A;  2IIM A;  3QO3 A;  3QBY A;  4LUD A;  4E6R A;  4ZN3 A;  2J05 A;  2PVO B;  4CC4 B;  2KRM A;  3A8O B;  3LH0 A;  1N9R A;  1C0M A;  1PG5 B;  1VQ5 T;  3ZL7 C;  1VQL T;  1BKB A;  1WDX A;  2LQK A;  3CPW A;  2DL5 A;  2CH4 W;  2QEX Q;  2MOX A;  1OEB A;  3OYN A;  1SKU B;  4RTV A;  5A2Q E;  4BI8 B;  2EKO A;  3SWN A;  2RI2 A;  1EFN A;  4RTZ A;  2RPN A;  1YWO A;  4C0F A;  3UPU A;  2JTM A;  1VQ8 Q;  5A0G A;  2LJ3 A;  2JM8 A;  4PNO A;  4F17 A;  2LCL A;  2PUO B;  3EFS A;  3OBY A;  4ORZ A;  1BI2 A;  3RUX A;  3JSC A;  1Y7X A;  2KSS A;  2ED1 A;  3HRS A;  5A0L A;  3CCE A;  5IXF A;  1RI9 A;  3VKI A;  2LT4 A;  1MV3 A;  2RHZ A;  2BE7 D;  1VQP A;  2EYY A;  1YP5 A;  5J26 A;  2KNB B;  1AHJ B;  1K9M R;  1TXQ A;  2MWP A;  4FW2 A;  4F7U G;  4B6M A;  2DF6 A;  4MZP A;  1G3T A;  3N5B B;  4LDY A;  4BDY A;  3LWI A;  3E1S A;  4JZ4 A;  2SRC A;  2YSQ A;  4XK8 E;  4ZGD B;  4C8Q B;  2QA4 A;  2A08 A;  9ATC B;  4FL6 A;  2RI5 A;  1ZSG A;  2DL7 A;  1AWO A;  4MMK A;  2COZ A;  3M0T A;  3CQT A;  3CME T;  4J8O A;  4C5G A;  2DXB A;  1E6G A;  1M3A A;  5C0M A;  1AZE A;  3MEU A;  1X6O A;  2RF0 A;  8AT1 B;  3CXC A;  4OMM A;  3OYC A;  2H3J A;  4JRP A;  3MKD A;  2DD4 A;  4JJB A;  2OAU A;  3V8L A;  4BUG A;  1SG5 A;  4LUE A;  2H8H A;  2HQE A;  4ZGE B;  2GTJ A;  2V8I A;  3Q1J A;  5GMK m;  2MMP A;  3FRN A;  3V7R A;  1KHI A;  2P0P A;  1YJW Q;  2BTT A;  4RUG A;  4KH1 B;  4X34 A;  1WPY A;  4M7D C;  1BIB A;  2AK5 A;  3TRE A;  4J9E A;  1QVG S;  1IXD A;  3UWN A;  3OYJ A;  4D6W A;  2OTL T;  1M90 R;  4NL3 A;  3CC4 T;  4F14 A;  5CIU A;  1K9A A;  2KT8 A;  2O9S A;  5GAO q;  2EJ9 A;  5CVI A;  5KYX B;  2DLP A;  1NBE B;  2VXF A;  1LNX A;  3GNF B;  2V1R A;  1QCF A;  2QDL A;  1VQN Q;  1KD1 U;  3JCM g;  1ZSZ A;  4RG8 A;  2YT6 A;  2X51 A;  2KXC A;  4Y91 A;  1W2B A;  3OA6 A;  4M7D F;  1G8X A;  4M77 G;  3KUF A;  1TTH B;  3LH5 A;  5CR2 A;  1GCQ A;  4BI3 A;  1C6V X;  1BI0 A;  1WLP B;  1LPL A;  4JPB W;  2ZZD A;  1K8A U;  1N8R R;  1Q82 R;  2FPD A;  4E7J A;  3CCQ Q;  2R5A A;  2DVE A;  2YUP A;  3FDR A;  3MHX A;  3QDR B;  1IRX A;  2CSI A;  4JRI A;  3E9G A;  1RUW A;  3SB2 A;  4E7Z A;  2YUN A;  5KH6 A;  2VUB A;  4J7F A;  2RI3 A;  3CCE T;  3M0Q A;  3NHN A;  2DIL A;  3CCR Q;  2ABL A;  4KGZ B;  3MP6 A;  1NLO C;  1KJW A;  4BE2 A;  3OYY A;  4J83 A;  2JVV A;  2EYZ A;  1I8F A;  1VQ9 T;  2OTJ A;  2LCS A;  1U06 A;  1X27 A;  1IO6 A;  5GAN d;  5L8R E;  3PVQ A;  1QKX A;  4ELY C;  4R56 A;  2DA9 A;  3A8L B;  1NPR A;  5J3B A;  2NUT A;  2OAW A;  1M9S A;  3I56 Q;  3HKS A;  4XTY A;  1EIF A;  1MMG A;  5FU6 C;  4OMQ A;  1TU0 B;  2HL5 C;  4IUP A;  7AT1 B;  2PTK A;  2BZ8 A;  3D7S B;  5LJ5 d;  2K5I A;  3BY7 A;  2E10 A;  3GNG A;  4C5H A;  3C94 A;  3CXC S;  1PCX A;  1S72 Q;  4PFZ A;  3H0I A;  3QPH A;  1YJ9 T;  3PNW C;  4JS4 A;  2L3P A;  2MWO A;  5L23 A;  2V1Q A;  1K73 R;  3HRT A;  4HCZ A;  1AVZ C;  1YIJ Q;  3MET A;  4C92 E;  2K79 A;  3H0H A;  4F7U B;  4EIK A;  2LVM A;  3OYM A;  1ZHI A;  3BDU A;  1VQP T;  4D8K A;  1TG0 A;  1PD0 A;  1V1C A;  3M55 A;  4M78 A;  2EJF A;  3CD6 A;  1BCO A;  3JCM V;  5HY6 A;  3M4G A;  2KYM A;  2RN8 A;  2JUF A;  1LCK A;  3QZ9 B;  4XAX B;  5GAO r;  1QVG A;  2D9T A;  3UF4 A;  4RTX A;  4OB0 B;  1K1Z A;  3A8G B;  4PFO A;  5GAN 7;  2PQW A;  3G6E A;  3QXE B;  2K2M A;  2RM4 A;  1X69 A;  3MEW A;  4PJN A;  1NEB A;  2RH2 A;  2KBT A;  4OMF B;  1B7T A;  3X20 B;  2QI2 A;  3ZEH A;  1WXU A;  1YWP A;  5LJ3 h;  1WHJ A;  1FMK A;  2GTO A;  2MK5 A;  2DL3 A;  8ATC B;  3CCR A;  2QA4 T;  4UC4 A;  2MYS A;  3L2Z A;  1PHT A;  1Y96 B;  1WHL A;  1JXO A;  1H64 1;  1PRM C;  1G5V A;  1HJD A;  3JCM W;  2E12 A;  1MMN A;  4JUV A;  3EG3 A;  2KXD A;  2VKN A;  4M78 C;  3JB9 G;  2C0I A;  2XHC A;  2CZ6 B;  2ED0 A;  2EIF A;  3QHS A;  4EDU A;  4FW1 A;  1UGV A;  2LCC A;  1SHG A;  2VYT A;  3GF5 A;  3CCV Q;  4JS5 A;  3BDL A;  4JDS A;  1VQ9 A;  1PSE A;  2XKO C;  3LGF A;  3VUB A;  3QKJ A;  3WXM B;  1ZQ1 A;  1B3Q A;  4NOY A;  2MPX C;  1VQL Q;  1TH7 A;  4C92 C;  1MGQ A;  5HK3 A;  3RMS A;  2V26 A;  2DO3 A;  3JCM P;  1CSK A;  4OMP A;  3VS3 A;  1YIT T;  2GBQ A;  2LNV A;  3OS5 A;  4C8Q A;  1XTD A;  1NZ9 A;  1X01 A;  4CC7 A;  1KC8 R;  4F7U F;  1UDL A;  2E64 A;  1OZ3 A;  3CCS A;  3OYH A;  3NTI A;  2A36 A;  1K73 U;  1JQQ A;  1G3Y A;  1OX8 A;  3EGU A;  2DBK A;  2PVG B;  4M7A F;  2EW3 A;  2EWN A;  4E47 A;  1I4K 1;  1TUG B;  3OYK A;  2J06 A;  2GFA A;  1JJ2 S;  4EMK A;  2AT1 B;  2CUB A;  4QT7 A;  2CS7 A;  2CZ1 B;  1RAG B;  3JCM e;  2CGH A;  2RK1 A;  2XI9 A;  4C5I A;  1E6H A;  3QJY A;  2GCX A;  4JRK A;  4FYX B;  1B34 A;  3CC7 A;  3CCU Q;  4M75 B;  4EMH A;  5CKF A;  2JZ2 A;  4PJJ A;  4JRQ A;  2X35 A;  3HP9 A;  4PJO A;  2HKN A;  2H3E B;  4OMO A;  3OBW A;  2X9H A;  3CMA Q;  2XDP A;  3MEA A;  5EG2 A;  4HVW A;  4RG2 A;  4WTO B;  2KK4 A;  2K9G A;  2EGC A;  1VQ6 Q;  3NPF A;  4BE0 A;  3HPW A;  1RAI B;  2JTF A;  4M4Z A;  2FO0 A;  3JCM c;  2ZGW A;  2WSF E;  2DFU A;  2QQB A;  3HL8 A;  2DJZ A;  2JMC A;  3OW2 A;  1WXB A;  1KIK A;  5GMK l;  1MHN A;  1Y07 A;  1N8R C;  3VV0 A;  1OX9 A;  3I55 A;  5LJ5 j;  3X24 B;  1X6G A;  4M75 E;  2D0N A;  2F5T X;  2KRN A;  2LNH B;  2RO0 A;  3LYI A;  1N27 A;  2QGG A;  1YJN T;  1BK2 A;  2LQ8 A;  1KD1 C;  2M0O A;  1WIE A;  4ZNX A;  2VB6 A;  3CCS T;  1RI0 A;  1BB9 A;  5KCO A;  2VGN A;  4FT2 A;  1R0C B;  2EYQ A;  1UHC A;  3QSU A;  2QK0 A;  3CCJ Q;  3EG2 A;  4E2F B;  1YHQ T;  1SPK A;  3M56 A;  4ANJ A;  4F04 B;  3CCU A;  5J39 A;  1Q86 R;  3C4S A;  2DKG A;  5LJ3 e;  3OY9 A;  2XD0 A;  2LP5 A;  1ACM B;  2VXE A;  3EFO B;  4PL6 A;  4N4I A;  4FIB A;  5GAM f;  4Z88 A;  1QMC A;  1OUL A;  3NTH A;  4ZTF A;  3REA B;  4RMO A;  2DTO A;  4DEY A;  5GAM g;  1E7O A;  3JRZ A;  5LL6 S;  5IAY A;  4M75 D;  3RMQ A;  1M3B A;  1Z9Q A;  2ZPF B;  3GBQ A;  1LVK A;  3RIR A;  2YUO A;  1WI7 A;  4B9W A;  5GAN h;  4FCY A;  1P92 A;  1N5Z A;  3M59 A;  2Z0W A;  2KYB A;  1TS9 A;  2HSE B;  4KH0 B;  4C92 F;  4HA8 A;  1NM7 A;  2ZPE B;  5LJ5 f;  4R0K A;  3CCE Q;  5IHN A;  1VQ8 T;  4RCC A;  3RKY A;  2DD5 A;  2DBM A;  3EFO A;  3I5S A;  3LLR A;  2O01 E;  2ESW A;  2JOY A;  2A0F B;  3JAM E;  5I21 A;  1FXX A;  1Y96 A;  1VQ6 A;  3ME9 A;  1GXI E;  1D1A A;  1VYT A;  4L5G A;  3OYB A;  1K4U S;  2PNI A;  1KQ2 A;  3M9Q A;  2EQI A;  2GGR A;  5GAM e;  5GAN g;  2XU8 A;  1BI1 A;  3NMZ C;  3OS2 A;  4LE9 A;  5KE2 A;  4PKC C;  4QKU A;  2DTH A;  3CCV A;  3SWN C;  4M7D D;  3GP8 A;  2VV5 A;  1YIT A;  1D09 B;  3SEM A;  1Y71 A;  1JBM A;  3C0C A;  4M75 A;  4O6J A;  1OZ2 A;  1Q81 C;  1OPL A;  1KG1 A;  1X75 C;  4YTL A;  2F1L A;  4J9D A;  4LDV A;  1ZA1 B;  2NLU A;  4RTY A;  1D1C A;  4E7L A;  3UAT A;  1NPP A;  5KYW A;  1VQP Q;  3PTA A;  3OYD A;  4O5V A;  1YJW T;  5IN1 A;  5GMK e;  1MV0 B;  5FU7 B;  1VQ4 A;  1G83 A;  1O9S A;  4CC2 A;  3PFS A;  1G2B A;  2MAM A;  2P84 A;  1YJ9 A;  2X4W A;  1WXT A;  4M7D G;  1PRL C;  1Y0M A;  5KE3 A;  2ZPI B;  1ZBJ A;  4Z8A A;  3EFR A;  1I5L A;  4MZM A;  4PFP A;  2LX7 A;  4NS5 A;  1OU8 A;  1JB0 E;  2PU9 B;  3VS2 A;  4D8D A;  2JW4 A;  3FIF A;  2YLC A;  2XMF A;  2DRK A;  4M7A E;  3TEE A;  1YN8 A;  4C92 A;  3LWH A;  1VQ4 Q;  2DEU A;  4Z89 A;  1H92 A;  5GAO p;  3PGG A;  3G71 Q;  2NUT B;  1I81 A;  5KYW B;  2OJ2 A;  2COY A;  1EZZ B;  3VYG A;  4JLI A;  1VQO Q;  5GAN 8;  2QEX A;  1UGR B;  1MNE A;  4EMK C;  1IB8 A;  1ZSZ C;  2DJQ A;  3VJP A;  4C0Z A;  1GRI A;  3OB9 A;  3J80 E;  2BZY A;  4KGV B;  2WAC A;  4KGX B;  1ZX6 A;  2HBP A;  1Q86 U;  2YWW A;  2X3X D;  1WA7 A;  2J6K A;  5EC7 A;  4PJO F;  1JU5 C;  1TSF A;  3QZ5 B;  4X9C A;  2B8A A;  1D3B A;  4XU2 A;  3H9N A;  3M0R A;  1ZUY A;  1VQM T;  4C8Q C;  1M8V A;  2LQW A;  2V8J A;  2L0A A;  3CCR T;  2PVD B;  4Q5W A;  3CEY A;  1T0J A;  3P8D A;  4OF1 A;  4M78 D;  5FRN A;  2K7A A;  1IGU A;  1JXM A;  1RAD B;  1TUC A;  2V8K A;  2LMJ A;  5IHK A;  4QVZ A;  4DBF A;  2RMO A;  1WJQ A;  3GLX A;  2E5Q A;  2RHI A;  1Q95 G;  2AKK A;  2M51 A;  1WHH A;  3I56 T;  4HCC A;  3R6O A;  2FZC B;  2E70 A;  4C8Q F;  1M27 C;  1FYN A;  4WF2 A;  4C0D C;  3RKW A;  1YJN A;  2HEQ A;  2ATC B;  1VA7 A;  2FVU A;  2NUP B;  4BD3 A;  4XU0 A;  5KYN A;  5LJ3 g;  1W4S A;  2D1X A;  2NUZ A;  2CZ7 B;  1BIA A;  1R77 A;  4IKF A;  2RB6 A;  3IQL A;  3L2U A;  2D0Q B;  3RR6 A;  2QYZ A;  4PJL A;  1S72 T;  3OSS C;  2HD0 A;  2X4J A;  5KYU B;  3S6W A;  3H8Z A;  1YJ9 Q;  2QGF B;  2CKK A;  4BY6 B;  4WCI A;  4M7A D;  1YJW A;  4QVC A;  2HZY A;  1YIJ T;  1SSH A;  1ARK A;  1W1F A;  1UGP B;  4CC3 A;  3VS6 A;  2FRY A;  2K4Y A;  3CBP A;  4OB1 B;  3CCM Q;  2HKQ B;  3EGX A;  4RKU E;  5I2S A;  4AFU C;  3CCQ A;  2LRQ A;  1KFZ A;  2DET A;  4FSS A;  4NL2 A;  3X28 B;  5GAM d;  1NYF A;  2IPO B;  4AG2 C;  4M78 B;  2O4X A;  2JS2 A;  2O88 A;  1K8A C;  2LX9 A;  4BE1 A;  5FU6 B;  4F7U A;  5CKD A;  2K2V A;  2DL4 A;  2RJD A;  1XOV A;  4DQ2 A;  3CC2 A;  1GFD A;  4J6W A;  2J6O A;  1QVF A;  2D8H A;  1MMD A;  2HCK A;  2KMT A;  2RQT A;  1UUE A;  5FU7 C;  4PLI A;  3MP8 A;  3GOX A;  1FWZ A;  2K5L A;  2K3X A;  4OB2 B;  4KBM B;  4C8Q D;  2OTL A;  1M5Q 1;  1OOT A;  5D6W A;  2QAS A;  3FB9 A;  2RD1 A;  3U23 A;  4R55 A;  3VRZ A;  4DOW A;  2OX7 A;  4VUB A;  1MND A;  1M4Z A;  2HDA A;  3OW2 P;  2M0Y A;  4C92 G;  2D8J A;  1AD5 A;  3FLG A;  5CK9 A;  1GBR A;  2RHX A;  3CCV T;  4OML A;  4A63 B;  2DM1 A;  3G6E Q;  1UB4 A;  5A0D A;  1GCQ C;  4HXJ A;  1H3Z A;  1PC0 A;  2FB7 A;  3OYE A;  2DVJ A;  5DLQ E;  2KQW A;  3OYF A;  2R58 A;  3VYH B;  4JLG A;  2ZCF B;  3M57 A;  1HSQ A;  1Q81 U;  4MDX A;  5IT9 E;  3EG0 A;  3OYI A;  2AKL A;  2SEM A;  2JMA A;  1I0C A;  2DAQ A;  5GJV B;  1IZ6 A;  1WQW A;  4CI0 C;  4JJN K;  3CD6 Q;  3L2W A;  3FJP A;  3WVD B;  1Q86 C;  2G6F X;  2O4X B;  1VQO A;  4M77 D;  4DBR A;  4LDX A;  3S3O A;  2E6N A;  1R0B G;  3WVE B;  1U5S A;  3OS0 A;  4Y92 A;  2QAZ A;  2RQU A;  2GNC A;  1H3H A;  1AZG B;  3MJX A;  1KD1 R;  4TVR A;  4J9B A;  3EG9 B;  1UJY A;  4IUQ A;  4C8Q E;  1M2V A;  4DBH A;  2DL8 A;  2DTI A;  2COW A;  2BIV A;  2X3W D;  1YCS B;  1NEG A;  3CMA T;  2CT3 A;  2O2O A;  4ME7 A;  4LD6 A;  5AYF A;  2OTJ Q;  5GMK i;  3VS0 A;  3UA6 A;  1AEY A;  4MML A;  4EPC A;  4J5Y A;  2L3Q A;  1VQ6 T;  3OYA A;  1VIE A;  4PK4 A;  1VQM A;  2FYK A;  1KK7 A;  2NYS A;  3I55 Q;  2KE9 A;  1Q7Y U;  3HTR A;  1V76 A;  4C92 B;  1QKW A;  1RLP C;  3TSW A;  3PMT A;  1M1K R;  4M7D A;  1K0S A;  1JO8 A;  2CT4 A;  2YDL A;  4OGC A;  1GL5 A;  2HMA A;  4LN2 A;  2DMO A;  4M77 E;  2VAS A;  1SHF A;  1CKA A;  3MCA B;  3R6N A;  1RAB B;  2ENM A;  4AFZ C;  2DNU A;  1YJN Q;  4JJC A;  1GBQ A;  3MP1 A;  3PIP A;  1VQK A;  3RER A;  4X1V A;  5KYX A;  1UTI A;  3O8V A;  2F2W A;  3QWX X;  2L5Q A;  2KT1 A;  2RJC A;  1NJI R;  2LT1 A;  2DZC A;  3CCJ T;  4QVD A;  3OQ5 A;  4M78 E;  2L3R A;  3OMC A;  5GAO l;  2KRO A;  1YHQ Q;  2K57 A;  2CUD A;  2CP2 A;  2MF2 A;  4ZGJ B;  1WQ7 A;  2EBP A;  4PLL A;  4M77 B;  1Q82 C;  4M75 C;  4LDU A;  4HVV A;  1U8R A;  1S72 A;  1F1B B;  1VQ4 T;  3LW5 E;  2L89 A;  1FMW A;  3BFM A;  4AFS C;  3G71 T;  1Q81 R;  4HVU A;  2CRE A;  2E6Z A;  2PUK B;  5I11 A;  5CKE A;  1YIJ A;  2NWM A;  1PD1 A;  3EGD B;  3TCJ A;  1UJ0 A;  1QP3 A;  2M9U A;  1SRL A;  4QW2 A;  1UGQ B;  1ZBX A;  2YLB A;  4XU3 A;  4Z02 A;  2CYZ B;  2MIO A;  3QDF A;  3S3M A;  3L2V A;  3O5Z A;  4N4G A;  3M53 A;  4M7A A;  3VS1 A;  1QCO A;  3DKM A;  5LJ5 h;  4J9H A;  4XU1 A;  1BU1 A;  1WHG A;  1PWT A;  5IHI A;  1IHW A;  4BDZ A;  1PM3 A;  4MZT A;  3CCL Q;  3A8M B;  1KQ1 A;  2M16 A;  3M4Y A;  2A3L A;  3G4S A;  2VGM A;  5LJ5 e;  4JZ3 A;  2D6F A;  1RL2 A;  4OB3 B;  3C12 A;  2I2L A;  1GFC A;  4AMC A;  2HQH A;  1QWF A;  2EAY A;  1S1N A;  5LJ3 j;  4DEX A;  3CMA A;  3CC2 Q;  1VYU A;  2DX1 A;  1Y57 A;  4QQ6 A;  5FWB A;  1Q7Y R;  2I0N A;  5D7U A;  4QQD A;  4OMN A;  1VQK T;  4II1 A;  3QWY A;  3EH1 A;  2P0K A;  1K8A R;  4HT8 A;  4LXC A;  1YHQ A;  1M2O A;  3ZFJ A;  1VQ7 T;  1GCP A;  5DM7 R;  5GAN 4;  3PE0 A;  3HFO A;  5GAN f;  3MO8 A;  2QTV A;  3CBO A;  2FPF A;  2AHJ B;  4KUI A;  4MDW A;  1UGS B;  1QWE A;  3FJ5 A;  1ABO A;  1TOV A;  2RA2 A;  1X2Q A;  2RQV A;  1ABQ A;  1PSF A;  5FW9 A;  1ZSZ B;  5FWC A;  1YI2 T;  1X6B A;  2DK3 A;  3CCM T;  3X26 B;  1N6A A;  1AWJ A;  2DXU A;  4N4H A;  3VU3 C;  2KI7 A;  2JT4 A;  2LZ6 B;  1VQ5 A;  3QYH B;  4QQG A;  3UT1 A;  3EG9 A;  5HK0 A;  1OYX A;  5GAM j;  4FYY B;  2E1H A;  2DYI A;  1D0Y A;  3H41 A;  3CCL A;  2P4R A;  2KAF A;  3MEV A;  3H0F A;  3JB9 H;  4IUT A;  2NUP A;  1VIF A;  2FZG B;  2C0T A;  1I5O B;  4PJM A;  3THK A;  3JCM d;  3EHQ A;  5D6Y A;  4PJO G;  1ZLM A;  1WNL A;  4A4F A;  3H6Z A;  3OW2 S;  3BE3 A;  4HCB A;  1UFF A;  2K5F A;  2RHU A;  2JJ9 A;  1SSF A;  3MPU B;  5KYY B;  2JM9 A;  3I35 A;  1VQO T;  2F2V A;  2KRS A;  2CZ0 B;  3PMI A;  1X2K A;  5CKB A;  3CXC P;  1KQS S;  1SRM A;  3G4S Q;  1M1F A;  2E65 A;  2ZAE A;  3RNJ A;  3TU4 K;  4M77 C;  3URG A;  1CKB A;  1W70 A;  1RAA B;  1JEG A;  3L2R A;  3BW1 A;  5LJ3 f;  1N8R U;  1YNZ A;  5GAN 2;  1AOJ A;  2BE9 B;  2YRD A;  2HBW A;  2EYX A;  1NYG A;  4AG1 C;  5LJ5 g;  1VQM Q;  4HCK A;  1QVF S;  1QQJ A;  2GF7 A;  1KC8 C;  1VQ5 Q;  3CPF A;  1BI3 A;  3V8K A;  4DBQ A;  3CME A;  4BB7 A;  2XID A;  5GAO n;  3QJ6 A;  3PT9 A;  5LJ3 d;  2EKH A;  2O31 A;  3E2U A;  3EG1 A;  4N0A A;  4C5E A;  2DIQ A;  3JCM b;  4K11 A;  2DER A;  2W10 A;  4XQ3 A;  3CCJ A;  4M78 G;  5GAN 3;  3RDV A;  5C6S A;  2CSQ A;  5CO7 A;  1M3C A;  3JCM h;  3M54 A;  4J9I A;  2L8D A;  3CD6 T;  1J3T A;  2IVW A;  3NGP A;  2QG9 B;  5GAN j;  5FRO A;  1PNJ A;  1VQ8 A;  1VOM A;  1ZUU A;  1UEC A;  5FRM A;  1A0N B;  4RTT A;  2LDM A;  3G71 A;  2DXT A;  4M75 G;  2RJF A;  1Q7Y C;  4F16 A;  2P4T A;  4ZTJ A;  3PVL A;  1BYM A;  1HK9 A;  1YBY A;  3J7A F;  2DPP B;  3FEO A;  1OV3 A;  1RAC B;  2QQS A;  3LGL A;  3CBM A;  4OGE A;  5GAO m;  2OTJ T;  4PJO B;  4ELZ C;  2M1H A;  1AWW A;  5HKC A;  2RQR A;  3OS1 A;  3CME Q;  1B34 B;  2G3R A;  3T9N A;  4OP0 A;  2HAX A;  4RTU A;  3M58 A;  1RAF B;  1WYX A;  2L3S A;  3GPL A;  1V29 B;  3KXT A;  2E3I A;  3PIO A;  2K3B A;  1U1S A;  5GMK h;  2E5K A;  1OQK A;  4Y28 E;  3VUZ A;  3A8H B;  1K9M U;  2ROT A;  1D3B B;  2FG0 A;  1N9S A;  4IIO A;  3UDC A;  2MI6 A;  1KC8 U;  4C0D B;  3ER0 A;  4IIM A;  4A4K A;  1VYV A;  2OTL Q;  1WJR A;  1XNI A;  2FPE A;  2HL3 A;  4XTZ A;  5D6X A;  3CC4 Q;  3OSV A;  1QCN A;  5I22 A;  4M7D E;  1HD3 A;  2QQR A;  3E9F A;  3M0U A;  3JB9 F;  2DZ9 A;  1B07 A;  3A98 A;  1YCY A;  3JCM X;  5IH2 A;  1VQN T;  5GAN 6;  2WSE E;  2QDY B;  4E7I A;  5CQX A;  3G7Z A;  1KSW A;  2YRV A;  4L6V 5;  2EJG A;  3HRU A;  1WX6 A;  1D0X A;  2K6D A;  2KGT A;  2ZPB B;  2ZPH B;  2C06 A;  3CC7 T;  4HT9 A;  3P8H A;  5GAN e;  2B86 A;  1LJO A;  3CC4 A;  2QQA A; 
#chains in the Genus database with same CATH homology
 1VQM A;  5GMK j;  4M75 D;  3QG1 A;  3RMQ A;  3G6E T;  2FYK A;  3CME T;  2ZPF B;  4J8O A;  4C5G A;  1Q7Y U;  3RIR A;  2DXB A;  2R5M A;  3NFC A;  2DIG A;  1W2B S;  1QP2 A;  4C92 B;  5C0M A;  4B9W A;  3MEU A;  1X6O A;  5GAN h;  2E41 A;  3CXC A;  1NJI U;  1P92 A;  3PMT A;  3OYC A;  2WSC E;  2H3J A;  4JRP A;  4PJO D;  3M59 A;  3CCM A;  4M7D A;  2QEX T;  2DD4 A;  3V8L A;  2OAU A;  4BUG A;  2LTO A;  2JN0 A;  2HQE A;  4OGC A;  4ZGE B;  4C92 F;  4M77 E;  4HA8 A;  2ZPE B;  1FX7 A;  5LJ5 f;  2V8I A;  3Q1J A;  3MCA B;  5GMK m;  1HXD A;  2MMP A;  3FRN A;  1VQ8 T;  3V7R A;  4RCC A;  4A4G A;  3JB9 I;  3RKY A;  2DD5 A;  1KHI A;  2P0P A;  3ZBD A;  4L59 A;  4X34 A;  3MP1 A;  1U1T A;  1WPY A;  3QYG B;  5FLX E;  3PIP A;  3LLR A;  3CCL T;  1VQK A;  1VQ6 T;  1BIB A;  1QVG S;  3TRE A;  3RER A;  4M7D C;  2O01 E;  3UWN A;  3O8V A;  3OYJ A;  2JOY A;  4D6W A;  3JAM E;  2L5Q A;  2OTL T;  2P0Q A;  2RJC A;  5I21 A;  1M1K U;  1FXX A;  1Y96 A;  4NL3 A;  2LT1 A;  3CC4 T;  1VQ6 A;  3ME9 A;  2DZC A;  5I2M A;  3JCM J;  3CCJ T;  1GXI E;  4L5G A;  3OQ5 A;  4M78 E;  4QVD A;  2L3R A;  3OYB A;  3OMC A;  5GAO l;  5CIU A;  2RHY A;  1KQ2 A;  2K57 A;  3M9Q A;  5GAO q;  2EJ9 A;  4ZN1 A;  5CVI A;  3RKX A;  2MF2 A;  2VXF A;  4ZGJ B;  1LNX A;  1WQ7 A;  3DB4 A;  5GAM e;  3GNF B;  4PLL A;  5GAN g;  2XU8 A;  1BI1 A;  4M77 B;  1Q82 C;  3INZ A;  4M75 C;  5CAI A;  1KD1 U;  4LDU A;  3OS2 A;  3JCM g;  1U8R A;  4RG8 A;  1S72 A;  5KE2 A;  4PKC C;  4XTW A;  2DTH A;  3OYL A;  4Y91 A;  1W2B A;  3OA6 A;  1VQ4 T;  3LW5 E;  3CCV A;  2L89 A;  4M7D F;  1NE8 A;  3BFM A;  4M77 G;  3SWN C;  4C8Q G;  5DLO A;  3KUF A;  3I56 A;  3G71 T;  4M7D D;  4E7K A;  3GP8 A;  2VV5 A;  5CR2 A;  4BI3 A;  2HNI A;  1BI0 A;  3JB9 D;  2E6Z A;  2PUK B;  4XTX A;  1YIT A;  5CCA A;  1Y71 A;  2RK2 A;  2ZZD A;  4IUV A;  5CKE A;  1YIJ A;  1K8A U;  1JBM A;  1JJ2 A;  3TCJ A;  2M9U A;  1QP3 A;  3I55 T;  4QW2 A;  1UGQ B;  4M75 A;  4E7J A;  1ZBX A;  2R5A A;  2YLB A;  2GQV A;  4XU3 A;  4Z02 A;  2DVE A;  3C95 A;  4O6J A;  2CYZ B;  1OZ2 A;  2X4Y A;  2IG0 A;  1Q81 C;  3FDR A;  3MHX A;  3QDR B;  1KG1 A;  4FT4 A;  1LOJ A;  1X75 C;  4YTL A;  4JRI A;  3S3M A;  3L2V A;  3E9G A;  4LDV A;  2NLU A;  4N4G A;  3M53 A;  2EQU A;  3CPW S;  4M7A A;  3JCM Q;  4E7L A;  2KY9 A;  3SB2 A;  3DKM A;  5LJ5 h;  3L42 A;  1NPP A;  2VUB A;  4J6Y A;  4J7F A;  2RI3 A;  4XU1 A;  5KH6 A;  3CCE T;  2Y90 A;  3EAE A;  3PTA A;  4OVA A;  3SWN B;  2R57 A;  3OYD A;  3L2Q A;  4O5V A;  3SD4 A;  3MP6 A;  1YJW T;  4A4H A;  4BDZ A;  5IN1 A;  4KT0 E;  3OYY A;  5GMK e;  4J83 A;  1DJ7 B;  4MZT A;  4BE2 A;  5FU7 B;  1VQ4 A;  3A8M B;  1KQ1 A;  1O9S A;  2JVV A;  2M16 A;  3M4Y A;  1K9M C;  2A3L A;  3PFS A;  2MAM A;  3G4S A;  1YJ9 A;  2VGM A;  5LJ5 e;  4IUU A;  2X4W A;  4J7I A;  4M7D G;  2D6F A;  2F5K A;  1RL2 A;  5KE3 A;  1I8F A;  2ZPI B;  4OB3 B;  1VQ9 T;  3NTK A;  3C12 A;  2OTJ A;  2I2L A;  4M7A C;  5GAN d;  3EFR A;  5L8R E;  1I5L A;  4Q5W A;  2EAY A;  4MZM A;  3J81 E;  4ELY C;  4R56 A;  3A8L B;  1NPR A;  4NS5 A;  5J3B A;  5LJ3 j;  3CMA A;  1M9S A;  1JB0 E;  2PU9 B;  2EQJ A;  3HKS A;  4XTY A;  1EIF A;  5FU6 C;  3FIF A;  2EQM A;  2YLC A;  4QQ6 A;  2RJE A;  4E7H A;  1M1G A;  4M7A E;  3M5A A;  3TEE A;  4IUP A;  4QQD A;  4B9X A;  3V8J A;  1VQK T;  4C92 A;  3LWH A;  4II1 A;  4EMG A;  3A5Z B;  5GAO p;  2P0K A;  3PGG A;  2A7Y A;  1I81 A;  2QTX A;  4HT8 A;  3P8B B;  1YHQ A;  5LJ5 d;  1K73 C;  2K5I A;  3QUI A;  4JLI A;  2QQ9 A;  1G3S A;  3VYG A;  4F7U E;  3ZFJ A;  3BY7 A;  4M7A B;  2E10 A;  5GAN 8;  2QEX A;  1UGR B;  3RES A;  1KQS A;  1VQ7 T;  3GNG A;  4A4E A;  3C94 A;  4C5H A;  3CXC S;  4EMK C;  3VJP A;  5DM7 R;  4C0Z A;  3OB9 A;  3J80 E;  3JCM f;  5GAN 4;  3QPH A;  3G4S T;  3CCQ T;  1YJ9 T;  3SFM A;  1Q82 U;  2HQX A;  3PNW C;  3GIB A;  4JS4 A;  3HFO A;  2WAC A;  4M7D B;  2MWO A;  3MO8 A;  5GAN f;  3V7C A;  3E19 A;  3CBO A;  2HBP A;  1Q86 U;  3HRT A;  4HCZ A;  3SDZ A;  2EQK A;  2AHJ B;  3QZ5 B;  4PJO F;  3S3N A;  4X9C A;  2K3Y A;  2B8A A;  1D3B A;  4KUI A;  4M77 F;  4MDW A;  1UGS B;  3MET A;  4XU2 A;  4IUR A;  4C92 E;  4F7U B;  2RA2 A;  2LVM A;  1VQM T;  4C8Q C;  3OYM A;  1ZHI A;  3BDU A;  1VQP T;  1M8V A;  2V8J A;  1M90 C;  1PSF A;  2LC4 A;  3CCR T;  2PVD B;  4M78 F;  1YI2 T;  3CEY A;  3M55 A;  4N0A C;  3P8D A;  2DK3 A;  4M78 A;  2EJF A;  4GY5 A;  4M78 D;  4OF1 A;  3CCM T;  3CD6 A;  4KUD K;  5CKH A;  3JCM V;  5FRN A;  5HY6 A;  4LD9 K;  3X26 B;  1N6A A;  3M4G A;  2DEQ A;  1R8O B;  2DXU A;  4N4H A;  3VU3 C;  2V8K A;  2JUF A;  4J6X A;  2Y4Y A;  3QZ9 B;  4QVZ A;  4XAX B;  2KDS A;  1WJQ A;  1VQ5 A;  3OMG A;  5GAO r;  1QVG A;  3GLX A;  2D9T A;  3QYH B;  1KHC A;  4QQG A;  4XTU A;  3UT1 A;  1VQ7 A;  2E5Q A;  5HK0 A;  1OYX A;  4OB0 B;  4P5N A;  3A8G B;  5GAM j;  2RHI A;  2PQW A;  5GAN 7;  3QXE B;  3G6E A;  4PJO E;  4M75 F;  2E1H A;  2RM4 A;  3KBG A;  3I56 T;  4HCC A;  2XK0 A;  3R6O A;  3L1A A;  3CC2 T;  2E70 A;  3MEW A;  3CCL A;  2RH2 A;  2KAF A;  3MEV A;  4OMF B;  4C8Q F;  3JB9 H;  1O75 A;  4IUT A;  4PJO C;  1VIF A;  4WF2 A;  2FHD A;  4FSX A;  3X20 B;  3X25 B;  4M77 A;  2QI2 A;  4C0D C;  3JCM d;  3RKW A;  3ZEH A;  1YJN A;  5D6Y A;  4PJO G;  2FVU A;  2EFI A;  4BD3 A;  5LJ3 h;  4XU0 A;  1WNL A;  4A4F A;  2XG8 D;  5LJ3 g;  1W4S A;  3F70 A;  3H6Z A;  3OW2 S;  4V2S A;  4HCB A;  5GAM h;  2K5F A;  2RHU A;  2CZ7 B;  1SSF A;  1BIA A;  5DY9 A;  3CCR A;  1YI2 A;  2VC8 A;  2QA4 T;  1VQO T;  4UC4 A;  2RB6 A;  4IKF A;  3L2U A;  2D0Q B;  3L2Z A;  1Y96 B;  1WJS A;  2CZ0 B;  1S72 T;  3OSS C;  3PMI A;  5CKB A;  1VQL A;  1H64 1;  1G5V A;  2HD0 A;  2X4J A;  3JCM W;  2E12 A;  2X4X A;  3H8Z A;  3S6W A;  1KQS S;  4JUV A;  1M1F A;  3DLL A;  3HSB A;  2E65 A;  4XTV A;  3TU4 K;  3CCU T;  2QXF A;  4M77 C;  4M78 C;  2CKK A;  3URG A;  4BY6 B;  3JB9 G;  4DA4 A;  1WGS A;  2XHC A;  1VQN A;  4M7A G;  1IRE B;  2ZPG B;  4M7A D;  1YJW A;  2CZ6 B;  2EIF A;  4QVC A;  1M1K C;  3QHS A;  4EDU A;  3BW1 A;  5LJ3 f;  3L2R A;  1YIJ T;  1N8R U;  2LCC A;  5GAN 2;  2VYT A;  1VUB A;  2DXC A;  2BKD N;  3GF5 A;  5LJ5 g;  4X9D A;  3LX7 A;  1UGP B;  4JS5 A;  1QVF S;  3V7S A;  1G3W A;  3BDL A;  4JDS A;  1VQ9 A;  1PSE A;  2K4Y A;  2XKO C;  3CBP A;  3LGF A;  3VUB A;  3QKJ A;  3WXM B;  3DLM A;  4OB1 B;  3QII A;  2GF7 A;  1UEB A;  4RKU E;  1KC8 C;  2GFU A;  1ZQ1 A;  4NOY A;  3CPF A;  1TH7 A;  1BI3 A;  3V8K A;  3CME A;  5I2S A;  4BB7 A;  4C92 C;  3HFN A;  3CCQ A;  2F69 A;  2FL7 A;  1MGQ A;  2LRQ A;  2XID A;  2XDD A;  3JB9 J;  5HK3 A;  5GAO n;  3RMS A;  3QJ6 A;  3PT9 A;  5LJ3 d;  4NL2 A;  4N0A A;  2KVQ G;  3X28 B;  2DO3 A;  3JCM P;  5GAM d;  4C0G A;  1YIT T;  4M78 B;  2YHT A;  4C5E A;  4BY6 C;  1NJI C;  2DIQ A;  2JNG A;  2O4X A;  2XDB A;  3JCM b;  2LNV A;  3HHT B;  3OS5 A;  4C8Q A;  1XTD A;  1NZ9 A;  1X01 A;  2Y4X A;  1K8A C;  2LX9 A;  4BE1 A;  5FU6 B;  4XQ3 A;  4F7U F;  4EMK B;  4ATO A;  3CCJ A;  2E64 A;  4F7U A;  4M78 G;  1JRI A;  5GAN 3;  1OZ3 A;  5CKD A;  5C6S A;  2K2V A;  3OYH A;  3NTI A;  5CO7 A;  3CCS A;  2RJD A;  3FC3 A;  4GLK A;  1XOV A;  4DQ2 A;  1K73 U;  3CC2 A;  1G3Y A;  3OYA A;  3JCM h;  3M54 A;  2L8D A;  4DOV A;  3CD6 T;  4M7A F;  2PVG B;  2IVW A;  5GAN j;  5FRO A;  2EWN A;  4E47 A;  4J6W A;  4LDW A;  4RCB A;  1I4K 1;  1QW1 A;  1VQ8 A;  1QVF A;  3OYK A;  2GFA A;  1JJ2 S;  4EMK A;  5GAN 5;  4KUL A;  5FRM A;  2KMT A;  5FU7 C;  4PLI A;  2CS7 A;  3MP8 A;  2LDM A;  1FWZ A;  3GOX A;  2CZ1 B;  2K5L A;  3G71 A;  2DXT A;  4M75 G;  3JCM e;  2CGH A;  4BAC A;  2BUD A;  2RJF A;  2K3X A;  2RK1 A;  4OB2 B;  2XI9 A;  4KBM B;  4C5I A;  4C8Q D;  1Q7Y C;  2OTL A;  3QJY A;  1M5Q 1;  2P4T A;  2GCX A;  4JRK A;  5D6W A;  1B34 A;  3FB9 A;  2RD1 A;  4A54 A;  3CC7 A;  3AHU A;  1OI1 A;  4A53 A;  2XIC A;  4ZTJ A;  4M75 B;  1HK9 A;  4EMH A;  1BYM A;  5CKF A;  5M9O A;  1YBY A;  2JZ2 A;  4JRQ A;  4R55 A;  2X35 A;  4DOW A;  1M90 U;  3HP9 A;  4PJO A;  3ASK A;  4VUB A;  1M4Z A;  1XQH A;  3OBW A;  3J7A F;  2DPP B;  4C92 D;  3FEO A;  4C92 G;  2XDP A;  1QVP A;  4FM4 B;  2QQS A;  3MEA A;  4HKE A;  5EG2 A;  3FLG A;  3CBM A;  3LGL A;  4OGE A;  4RG2 A;  3DB3 A;  4BI4 A;  5CQY A;  4CRI A;  5CK9 A;  2KK4 A;  5GAO m;  2OTJ T;  2RHX A;  3OYG A;  4ELZ C;  2M1H A;  3CCV T;  4PJO B;  5KCH A;  4FU6 A;  5HKC A;  3QO3 A;  1UB4 A;  3QBY A;  5A0D A;  3OS1 A;  1B34 B;  4ZN3 A;  3HPW A;  4BE0 A;  2PVO B;  1H3Z A;  3A8O B;  2G3R A;  1N9R A;  2FB7 A;  2JTF A;  3LH0 A;  3T9N A;  4OP0 A;  2ZGW A;  3JCM c;  3M58 A;  2WSF E;  1VQ5 T;  2HAX A;  3GPL A;  1BKB A;  3OYE A;  1VQL T;  2LQK A;  2QQB A;  1V29 B;  3HL8 A;  3CPW A;  3KXT A;  2DJZ A;  5DLQ E;  2KQW A;  3OW2 A;  3OYF A;  3PIO A;  2R58 A;  3VYH B;  4JLG A;  2ZCF B;  1U1S A;  3M57 A;  5GMK h;  5GMK l;  1MHN A;  1Y07 A;  3OYN A;  1N8R C;  3VV0 A;  4Y28 E;  3I55 A;  3VUZ A;  3A8H B;  5LJ5 j;  5A2Q E;  4BI8 B;  3X24 B;  1Q81 U;  4MDX A;  2EKO A;  4M75 E;  3SWN A;  1K9M U;  2RI2 A;  5IT9 E;  4C0F A;  3OYI A;  2F5T X;  3UPU A;  1D3B B;  2JTM A;  5A0G A;  1N9S A;  2RO0 A;  3LYI A;  1N27 A;  3UDC A;  4PNO A;  1YJN T;  2MI6 A;  2LCL A;  1KC8 U;  2PUO B;  2DAQ A;  3EFS A;  2LQ8 A;  3OBY A;  4C0D B;  1KD1 C;  1IZ6 A;  3ER0 A;  1BI2 A;  1WQW A;  2M0O A;  3RUX A;  4A4K A;  4CI0 C;  4JJN K;  3JSC A;  1Y7X A;  2KSS A;  3L2W A;  3CCS T;  1RI0 A;  3FJP A;  3HRS A;  3WVD B;  1Q86 C;  5A0L A;  3CCE A;  5KCO A;  2O4X B;  2VGN A;  4FT2 A;  1WJR A;  1XNI A;  4M77 D;  1VQO A;  4XTZ A;  4LDX A;  2EYQ A;  3VKI A;  3S3O A;  5D6X A;  2E6N A;  3QSU A;  2LT4 A;  2RHZ A;  3WVE B;  3OS0 A;  1VQP A;  3OSV A;  4M7D E;  5J26 A;  1YHQ T;  2QQR A;  3E9F A;  1AHJ B;  3M56 A;  3JB9 F;  2DZ9 A;  4TVR A;  3JCM X;  1YCY A;  3CCU A;  2MWP A;  4F7U G;  5J39 A;  1VQN T;  3C4S A;  2DKG A;  4IUQ A;  4C8Q E;  5GAN 6;  2WSE E;  5LJ3 e;  3OY9 A;  2XD0 A;  2DTI A;  4MZP A;  2VXE A;  1G3T A;  2QDY B;  4E7I A;  2BIV A;  5CQX A;  3G7Z A;  3N5B B;  4PL6 A;  4N4I A;  2YRV A;  4FIB A;  2EJG A;  4L6V 5;  4LDY A;  5GAM f;  4BDY A;  3LWI A;  3E1S A;  3HRU A;  3CC7 T;  2ZPH B;  2ZPB B;  4XK8 E;  2C06 A;  3NTH A;  4ZTF A;  3P8H A;  3CMA T;  4HT9 A;  5GAN e;  4RMO A;  4ZGD B;  2DTO A;  4LD6 A;  4ME7 A;  4C8Q B;  2QA4 A;  5AYF A;  4FL6 A;  5GAM g;  2RI5 A;  5GMK i;  1LJO A;  4MMK A;  3JRZ A;  4MML A;  4EPC A;  4J5Y A;  5LL6 S;  3CC4 A;  5IAY A;  1VIE A;  2QQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...