4M77G

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77G00
3QO3A 3V8KA 3JCMe 5GMKe 5LJ3f 5GMKl 4EMKB 2EWNA 4XQ3A 4M78C 2CGHA 3V7RA 3VU3C 4C8QF 2QTXA 4XU3A 5GAN6 1MGQA 2YLBA 3JB9D 1M5Q1 2E64A 3FB9A 5GAOq 3RERA 4C8QG 1D3BA 1WQ7A 1WPYA 3SB2A 4C8QE 3JB9F 4F7UF 4C92D 1U1TA 3M4GA 1H641 1LNXA 3EFRA 3FIFA 1WQWA 3HFNA 4A54A 4C8QB 4EMKC 3JCMV 5GANd 4M77F 4XU2A 4M7DD 3BY7A 4MMKA 1Y96B 2FYKA 4F7UG 4M75D 3RKXA 3JCMJ 3HSBA 4RCCA 2DEQA 4C92F 4HT8A 2YLCA 4HA8A 4XU1A 4M77G 3RUXA 4EMHA 4F7UE 2K57A 4F7UB 1KQ2A 2E65A 4M77E 4C92G 4M77B 4M75F 4C8QC 2RB6A 4EMGA 4A53A 2DVEA 5LJ3g 4C92E 2RA2A 3L2ZA 4C92B 5GAMf 5LJ5f 1Y96A 5LJ5h 5LJ3h 4M75G 4JLIA 4JUVA 4M78A 4N0AC 3JCMd 1N9RA 5GAN2 3QSUA 4M75E 1BIBA 4J6WA 1B34A 4M75B 5GAN4 4QVDA 3JB9I 2DTHA 4M77C 4XTYA 3BDUA 3INZA 1U1SA 1I81A 4C92C 2VC8A 2YHTA 3EFSA 5GAOp 4M7AD 4EMKA 4XTXA 4QVCA 2VXEA 1X01A 3JCMW 5GAN3 5GAN5 3JB9G 4PJOD 1TH7A 4M75C 4MMLA 4XTZA 3JCMb 5GANf 4NL3A 5GANh 4M7AF 4M7DC 4M7DF 1I5LA 4PJOF 3RKYA 3PGGA 1M8VA 4C8QA 2VXFA 2DXUA 3SWNC 5LJ5g 5GAMg 2DKGA 4M7AG 4M7DG 3QHSA 4JRIA 4XTWA 4PJOG 5I21A 5CAIA 4X9CA 1HXDA 5LJ3j 5GAMh 5GAN8 3V8JA 4M7AB 5GAOn 5GAOl 4M7AE 1N9SA 4M7DB 4M7DE 4N0AA 4PJOE 2RM4A 1LOJA 3BFMA 3JCMX 1HK9A 2E41A 4F7UA 1BIAA 3AHUA 5DY9A 2DTOA 5GMKm 2DTIA 2ZGWA 3JCMf 4M77A 2EAYA 3JCMh 5GMKh 5GAOm 4XTUA 2EJFA 4J6YA 4RCBA 2DZ9A 4C92A 4J6XA 3SWNB 4M7AC 4DQ2A 5LJ5e 2EJGA 4X9DA 5LJ3e 3FJPA 4NL2A 1JRIA 2EJ9A 3QUIA 3BW1A 3JCMP 4NOYA 5GANg 1I8FA 4XU0A 4PJOC 4M75A 5LJ3d 1D3BB 1JBMA 5GAOr 1KQ1A 3V7SA 3JCMc 4V2SA 4WF2A 4Y91A 4M78D 5GMKi 2HNIA 3SWNA 3RESA 3GIBA 5LJ5j 5GAMj 3V7CA 4HT9A 2E1HA 4M77D 4M78F 4XTVA 4PJOB 5GAN7 2DJZA 4JRKA 5GANe 2DZCA 3JB9H 3JCMg 3L1AA 2E10A 4J5YA 5GMKj 2RD1A 4M78G 3V8LA 4PNOA 1WNLA 2DXTA 2Y90A 1I4K1 3HFOA 4M78E 1YCYA 2FB7A 4M78B 3RKWA 5GAMe 4M7AA 3JCMQ 4M7DA 1B34B 4OP0A 4PJOA 1LJOA 2I2LA 5LJ5d 5GAMd 5GANj 4C8QD 2JN0A 3RIRA 3JB9J
chains in the Genus database with same CATH superfamily
3O5ZA 2CP6A 2HQHA 1YHQQ 3BE3A 4DEYA 1LCKA 1S72T 4C8QG 3LYIA 2BKDN 1H8KA 4BE1A 1UGQB 3EFRA 3HHTB 1HJDA 2LX9A 2LQNA 1MMDA 3CCUA 2NUZA 3M0RA 4RG2A 4F7UG 5KYYB 3G7ZA 3MEUA 4KGXB 1MMGA 4M75F 1K0XA 1SSFA 5LJ3g 4OMFB 3ZFJA 1AD5A 3ER0A 4F04B 1B7TA 3VS4A 2BZXA 1VQKQ 1PM3A 5J39A 1UFFA 4FW1A 3JSCA 3QG1A 1VQOT 1ZA1B 4R0KA 4FIBA 3CCJA 2XD0A 3HL8A 2G6FX 4XTWA 5I21A 5A0DA 3DLMA 4OVAA 2VV5A 1TWBA 2KNBB 3EG2A 3HRUA 2ESWA 3OYFA 3AHUA 4FM4B 5DY9A 2DYBA 2R5MA 4RTUA 3VYGA 1UB4A 2Y4YA 3G6EQ 1UGRB 3KBGA 4QT7A 4V2SA 3G4SA 3I55T 4RUGA 1T0JA 1KD1R 1QCOA 2JS2A 4M78F 2JMAA 1R0CB 2GF7A 2EQIA 3OMCA 4C0ZA 5IHKA 2DAQA 5KYUB 1I4K1 2QG9B 4II1A 2L3PA 2X4YA 1ZSGA 4J9FA 3OA6A 4PJOA 2BUDA 1BB9A 2DYIA 2JOYA 1VQNQ 1WI7A 2CSIA 4OB2B 3LWIA 2EWNA 4RMOA 2HEQA 3NTHA 5EC7A 3ZEHA 2CT4A 5IHNA 5C6SA 1Q86U 2DXBA 3VKIA 2G3RA 1D0YA 3EH2A 5GAOm 5DLOA 4ZNXA 3G71Q 4C92F 2KR3A 2YLCA 2M1HA 3META 3G6ET 3EGXA 1OX8A 2JMCA 4ELYC 1EIFA 2HSEB 4JZ4A 1N9RA 4MZPA 3EG3A 2DBKA 1Z9ZA 3RBBB 1SKUB 5GAN5 4MMLA 2HKNA 2KT1A 4M75C 2XI9A 5GANf 3OW2A 4ORZA 2F2WA 2IG0A 2X4JA 1QVPA 3RDVA 3PMTA 5GAOn 5KCOA 3THKA 4IUUA 4LNPA 5KYYA 1TS9A 2DTOA 2E6ZA 1PKTA 2L3RA 4LN2A 3CPWP 3QUIA 4XU0A 1YJWQ 1E6GA 3G71T 3CCLQ 1TU0B 3TQ7P 3OY9A 1TTHB 4Y91A 1OOTA 4B9XA 4M77D 3GPLA 1NG2A 2DJZA 3VRYA 1RLQC 4OMLA 1S1NA 1VQ7T 2MIOA 3CCSA 3HFOA 1YCYA 3M0PA 1RLPC 5HCKA 2QA4T 2FL7A 2VGNA 4AFZC 2MWOA 1VQ6A 3JCMe 2KVQG 2JTMA 4XQ3A 1YNZA 1WJQA 4M78C 4BI8B 1V29B 4BI3A 1MGQA 2OI3A 3E2UA 3GF5A 4OMMA 3CCUQ 2E64A 2KI7A 1X2QA 4C5EA 2RK1A 4KH1B 2WSFE 1ZBJA 1ZSZC 4JRPA 4HCCA 2WSCE 3HSBA 1BCOA 4HA8A 3J80E 2KE9A 3SEMA 1JXMA 2DVJA 4M77B 2QQSA 3A1PA 2DVEA 1YJWT 1NZ9A 1LVKA 5KYUA 3CC4T 3CCLT 4M75G 3NPFA 4MZMA 4L59A 2AK5A 1QKXA 2O88A 1U1SA 4LD6A 2DIQA 4C92C 1TG0A 4ANJA 1TUCA 5D6WA 2EQUA 3CCRT 3CCJQ 4DBFA 2XKOC 4PFOA 2KROA 5I11A 4JRQA 3P8BB 4M7DF 4DBQA 1M8VA 1J3TA 4KULA 2RQRA 4JRIA 2NYSA 4OB1B 3GP8A 1Q82U 4PJOE 4IUTA 2EGAA 2NLUA 2CZ7B 2JM8A 2EJFA 2KBTA 2KK4A 1WHJA 3L2VA 4J6XA 2DEUA 3G4SQ 4X9DA 2WACA 4NL2A 2EJ9A 3BW1A 2GGRA 2K2VA 1D3BB 4E47A 1IGQA 4C0GA 5GMKi 3CCMT 2H3EB 1N8RR 2RN8A 2K4YA 4J9BA 1M90U 2M9UA 2Z0WA 2E12A 1S72A 3UT1A 4M78G 3M0QA 3MCAB 1KG1A 1OYXA 2O9VA 4OP0A 3CBPA 1PRMC 2JN0A 3CCJT 3V8KA 4ZTJA 2BTTA 2CZ1B 2QEXT 1M1FA 1H3HA 4LXCA 2A0FB 2RHZA 1I07A 2XIDA 5HY6A 3JCMJ 2BZ8A 2ZPFB 3G4ST 4C92G 2QK0A 4A53A 2VYTA 3H41A 1K9MR 1VQOA 5GAMf 1JB0E 5LJ5f 5IHIA 2LP5A 2ZCFB 4JS5A 1X2KA 1AVZC 1MMNA 2JVVA 3QZ9B 3A8HB 1C0MA 1GL5A 4XTYA 3LGFA 2RHYA 5A0GA 4OMQA 3CD6T 3QBYA 1HD3A 1U3OA 2B86A 1AOJA 4ESRA 3PTAA 2CYZB 2PUOB 4ZN1A 4MZTA 4KT0E 2RI2A 3I55A 4PJMA 3D7SB 3I9QA 3LGLA 3OYIA 1W1FA 4M77A 1U5SA 1Q86R 1M8MA 4J6YA 2DIGA 5FU7B 3VS2A 2ZPHB 1K4US 2EJGA 4M7DC 5GANg 2XG8D 3O8VA 2YUQA 4J7IA 2DETA 3JCMc 2YUNA 3PNWC 3M9QA 2ATCB 2HNIA 3SWNA 4EIKA 2O9SA 4J9IA 2OX7A 3CCSQ 2F2VA 1ZUYA 2ZZDA 4J9DA 1UHFA 3REAB 3CEYA 3RKWA 1VQ6Q 2DILA 4J9CA 3NTKA 3RMSA 1M9SA 4JZ3A 3MP8A 2L5QA 3HP9A 1WZOA 1M27C 1JJ2P 2CGHA 3BDLA 4RTWA 2RNAA 2PQWA 1M5Q1 1QQJA 5GJVB 1K73R 1O75A 1D3BA 4F16A 4ZGJB 5A2QE 4A54A 1VUBA 1GCQC 3JCMV 1WHLA 4XU2A 3I56T 2JW4A 2P84A 4N4HA 4RCCA 4HVWA 2O31A 2D0NA 1WX6A 3Q1JA 5L23A 4OB0B 2CZ6B 4C0DB 4IIMA 3M0TA 4RTZA 3WXMB 1C1AA 4BDYA 2YDLA 3CCST 2COYA 2VB6A 2D8HA 4AFSC 1K76A 2XICA 3OYYA 3UA6A 4QVCA 4PJOD 2KAFA 1SPKA 2F2XA 2JT4A 1T3LA 3VJPA 5J3BA 1NJIU 3RKYA 3PGGA 3FJ5A 3OYBA 4M7DG 5GAMh 1ZLMA 2LTOA 4N0AA 2HZYA 1WJRA 2ZGWA 1D1CA 2EAYA 3VS5A 2MK5A 2QAZA 1VQ7A 2MMPA 3URGA 3FJPA 5CIUA 5D7UA 3TU4K 1RADB 3J81E 1UTIA 1FXXA 4FYYB 1OPLA 2RQTA 3LWHA 1Q7YC 4WF2A 4J83A 2QA4A 2QI2A 1S72Q 1SRLA 2LT4A 4PKCC 2JNGA 5IXFA 2DNUA 1WXBA 2LNHB 2RQWA 2AKLA 2LC4A 4PJJA 2EYQA 1QP3A 3OB9A 4PJOB 1M3AA 4LUEA 1VQLT 3OSVA 3EG9B 1VQPT 1M3CA 2FB7A 3NFCA 2HBWA 5KCHA 5CQYA 1Q82C 1M1KU 1B34B 3UF4A 2E3IA 2X4XA 3MKDA 1G8XA 1UGPB 2BZYA 1QVFP 1AEYA 3V7RA 1GCPA 2YLBA 2K3BA 3CC4A 1TXQA 4KRTA 2P0PA 4C5HA 2P0QA 2RHXA 4FL6A 2LJ3A 1QVFA 1JXOA 2X3WD 2K7AA 2L0AA 3DKMA 1IHWA 3BY7A 3A8LB 2CP2A 2V8KA 1VQOQ 2KQWA 2HBPA 3QWXX 4PFPA 1GFDA 2AT1B 3CMET 3CCRA 4RTXA 4M77E 4EMGA 1K8AR 2XK0A 4RTVA 1AWJA 2CP0A 4BY6B 1BIBA 1KSWA 4QVDA 1FWZA 2DTHA 1MNEA 1EZZB 3OBWA 1M90R 2DD4A 1M2VB 3X25B 4WTOB 3JCMW 5GAN3 2HD0A 2E70A 3E1SA 3CPWS 1G83A 2KRSA 3I55Q 2J05A 2V8JA 4AG1C 5LJ5g 5GAMg 5CAIA 4X9CA 4GLMA 1BI2A 4M7AB 3X20B 2NWMA 3CCMA 4D8DA 2BIVA 1RAIB 2KDSA 3BFMA 2DTIA 4L6V5 5GMKh 2ED0A 4RTTA 2DJQA 4D8KA 4GLKA 2DZ9A 4IKFA 1H92A 3RNJA 4LDVA 2IPOB 2FPEA 4PLLA 2RHIA 4E7IA 3RESA 2CZ0B 3V7CA 2RJCA 2DA9A 5KYNA 3UWNA 2QEXA 1SEMA 4JRKA 5GANe 2DZCA 1PD0A 2ABLA 2RD1A 1NBEB 2CDTA 2EW3A 1BKBA 3JCMQ 3M53A 3R6OA 2EQKA 3TCJA 2X35A 1OU9A 5AYFA 4OGCA 2DPPB 3VS3A 1D0XA 1QLYA 3QDRB 5GAN6 2M0OA 2EYZA 2VWFA 3JB9D 3OYGA 3H9NA 1W4SA 2KT8A 4X1VA 2MPXC 5FWBA 5GAN4 3I5RA 4EMKC 3F70A 2LRQA 4Y28E 5HK0A 2RHUA 4EMHA 3CD6A 1WGSA 1KQ2A 2A08A 2DE0X 3EG9A 1PD1A 3X24B 1OQKA 1Y96A 3VUZA 3OYEA 4DA4A 4JUVA 3ME9A 2C0OA 2BE7D 4JDSA 2W10A 1B34A 3JB9I 5KE2A 1NYFA 5M9OA 2DD5A 4ZGDB 1UECA 1EFNA 3QZ5B 2NUPB 2WSEE 3H0FA 1OEBA 3M56A 4PJOF 1SF9A 1AWWA 1M2OA 5D6XA 2RMOA 5I2SA 3OMGA 4J7FA 1VQ7Q 1FMVA 1LOJA 4B9WA 2E41A 5GMKm 3MHXA 4DOWA 4HKEA 4LDWA 1KC8C 3FEOA 4DBRA 2E5KA 2QA4Q 3J7AF 1FYNA 4NOYA 1GXIE 2GFUA 1D1AA 3JV3A 2RI3A 1JBMA 2XMFA 3S6WA 1BI0A 4JJBA 4LDXA 1K9AA 4XK8E 2KY9A 5CCAA 1KK7A 2J6OA 4O5VA 1M2VA 3TSZA 4BE2A 4OGEA 1VYVA 1NJIC 2MCNA 3M55A 1Q81U 3C94A 3EFOA 2CREA 4M7AA 1K0SA 3I56A 2KGTA 2QGGA 1JU5C 3CC4Q 2ZAEA 4J9EA 3FDRA 3JB9J 3CPWA 2ZPGB 2J6KA 3VU3C 1UUEA 2K5FA 4E7KA 1T3SA 1PRLC 2VVKA 1MMAA 3CCRQ 4C8QB 2JJ9A 3VS6A 4C0DC 1ZX6A 6AT1B 9ATCB 1VQMA 2FHDA 2IIMA 4F7UB 4LE9A 1YJ9T 1NLPC 2HAXA 2ENMA 3HKSA 1R77A 2ECZA 1VIEA 3CXCP 2D9TA 2DLPA 3H0IA 1I0CA 5GAN2 3QXEB 4J6WA 1M1KC 2H3JA 1QKWA 2XDDA 3JAME 1UHCA 4X34A 3R6NA 2YT6A 5J26A 4QQGA 2JUFA 2D0QB 4E7LA 1IGUA 2RQUA 5FW9A 3N5BB 4NL3A 4UC4A 4RTYA 3CCMQ 1WHMA 3QYGB 1M1KR 3M54A 5LJ3j 2QASA 1SG5A 1NE8A 2PVGB 4LDYA 2EKHA 2X9HA 2QQBA 1E7OA 1Q7YU 1MHNA 1WHGA 1VQLA 3LH5A 1VQPA 3SWNB 5LJ5e 5LJ3e 1JRIA 4PJOC 2V26A 1KQ1A 1PC0A 2O4XB 2QEXQ 2GTJA 3PIOA 4RG8A 2XDBA 2L3SA 2CKKA 3LH0A 3M5AA 4M4ZA 3PVLA 1JJ2S 2NUPA 4XTVA 3S3OA 2ED1A 4HXJA 4ZGEB 3M4YA 4J5YA 4A4KA 1CKAA 2AZSA 4HVUA 5AT1B 4CC2A 2DRKA 2HMAA 3PE0A 3CMEA 3OYNA 4QVZA 2A7YA 4Z89A 2R5AA 1IRXA 4HVVA 7AT1B 4GBQA 4OMPA 2OTLT 2R58A 3SB2A 3CD6Q 3JB9F 2CUBA 3OS1A 1G2BA 1RUWA 1TSFA 4FCYA 2M51A 1VQ9A 3MEAA 1D1BA 1WHKA 1FMKA 2HSPA 2DRMA 4JLIA 3NTIA 3JCMd 4F14A 2CP3A 2DL7A 4TVRA 4C5GA 1HSQA 5KE3A 2FZGB 1I81A 2YHTA 4BDZA 2RQVA 3CC2Q 2X4WA 1ABOA 1YP5A 5KYXB 2E4HA 4HCBA 4C8QA 2QQAA 1WHHA 3QKJA 3GNGA 4PJOG 1CKBA 3DB3A 5GAOl 4M7AE 3KXTA 4ZN3A 1N9SA 5CK9A 3VS1A 1ZA2B 3JCMX 4F7UA 2OTJT 1G3WA 1K1ZA 4AMCA 4ATOA 3WVDB 3VUBA 1RABB 4XTUA 1O9SA 1I8FA 2LQKA 3ASKA 5LJ3d 4IIOA 3MPUB 3V7SA 4WCIA 5IT9E 5FU6B 3M0SA 2EGCA 1QVFS 3I56Q 2O01E 1YIJA 4A4FA 2V1QA 3CC2T 4FSXA 3UATA 1KD1U 3CPFA 2LCLA 1UGVA 3OSSC 2Y4XA 1N6AA 4FU6A 1VQMQ 1YFNA 2IVWA 1B3QA 2K9GA 1WQWA 2O4XA 4M77F 3JRZA 1QVGP 3E9GA 2B8AA 3OBYA 3HRSA 4OF1A 3TVTA 2EIFA 1GBRA 1OZ3A 2M16A 2COZA 4Y92A 1QP2A 2JTFA 1Q81C 1IREB 4M75B 1AZGB 4QQ6A 3C4SA 2EQMA 1JJ2A 4PK4A 5CKDA 2FZKB 5GAOp 2LMJA 4XTXA 2K3YA 5CKEA 3DB4A 3PT9A 2V8IA 3OYMA 1KC8U 2DX1A 1HXDA 5CQXA 1VQLQ 1WJSA 1VQPQ 5IXBA 1BIAA 1IXDA 5ECAA 1D09B 3JCMh 1VQ8Q 3A98A 4XAXB 1VQMT 4YTLA 5FROA 3VYHB 2LCCA 8AT1B 1T0HA 2YRVA 2VGMA 2AHJB 2MWPA 3KUFA 1VQ5A 1MNDA 1W70A 3ZBDA 1NYGA 1KIKA 2L89A 3CCQT 5KYXA 2FO0A 2C06A 5IAYA 4DEXA 3PMIA 2F1LA 1AZEA 3CMEQ 1YJNT 4M78B 3RMQA 4BE0A 2HQXA 1RACB 3S3NA 2I2LA 1OZ2A 2I0NA 1OPKA 2J6FA 1M3BA 3QO3A 1YJ9A 1IZ6A 2QTXA 1YI2A 3HPWA 2H8HA 1X75C 2LDMA 4C8QE 1VQ9Q 2BE9B 1YITA 2E3HA 4EPCA 1PKSA 2CP7A 1Y96B 1GRIA 1NPRA 2P4RA 1PNJA 2QGFB 1VQ8T 2VASA 3CCVT 1Q7YR 4XU1A 4F7UE 1WLPB 4LD9K 3TEEA 2YUOA 2AZVA 2JZ2A 4C92B 2YWWA 4ZTFA 3C12A 1IB8A 3CQTA 1OX9A 2L2PA 4C5IA 4M77C 1WDXA 3TREA 1Q82R 4M7AD 1KHIA 2RI5A 3A8MB 1OU8A 2W0ZA 3WVEB 1XTDA 4FYWB 4JPBW 4PL6A 3PVQA 1I5LA 5FRMA 2YUPA 1VQ4A 1MV0B 3SWNC 4KUIA 2KXDA 1FMWA 3EG0A 3FRNA 3QJ6A 5EG2A 1VYTA 4A4HA 1N5ZA 3MP1A 4E7HA 1KFZA 3X28B 1N27A 3REBB 4D6WA 5LL6S 2RPNA 3HTRA 2D1XA 4BACA 4CC4B 2P0KA 5DM7R 1VQ9T 1JQQA 4M75A 4IUQA 1P92A 1ZUUA 1YIJQ 3EFOB 1X69A 3CBOA 2XU8A 3QPHA 4OMNA 4CRIA 2L3QA 2OTLA 5IN1A 2LZ6B 4LDUA 2JXBA 1N8RU 5GANj 4GY5A 1QCNA 2CS7A 3SDZA 3NGPA 2KRNA 2YRDA 5GAOq 4KGZB 3CXCS 4CI0C 2COWA 2EBPA 1H641 1LNXA 2ROTA 3HFNA 4IUPA 4JS4A 4M7DD 2X51A 1X6OA 4DOVA 4KH0B 1RAHB 2QXFA 4HCZA 4M77G 3T9NA 2DL5A 2PVOB 2RB6A 3C95A 3NMZC 2EQJA 1XQHA 4AFQC 1ZHIA 4M78A 4N0AC 3P8DA 3SD4A 1JEGA 2QTVA 4OB3B 1YHQT 2GQIA 3OYAA 1KD1C 1YIJT 4AT1B 4DBHA 1UDLA 2OTJA 1ZSZA 2SEMA 2HQEA 3CCEQ 1X01A 2DMOA 2KEAA 1V1CA 1K9MU 2EVRA 3PIPA 1BBZA 5HK3A 1EX4A 3I35A 4PJNA 2PUKB 3L2WA 2VXFA 2QQ9A 2DKGA 4FYVB 1KQSP 5GAN8 4E2FB 1G3YA 1E6HA 1NPPA 1TUGB 4M7DB 2A36A 2JTEA 5CKFA 1KQSA 2VUBA 5FU6C 4RCBA 4C92A 1H3ZA 4E7SA 1YN8A 2LJ1A 3EHQA 3OYHA 4IUVA 4CC3A 1VQ5Q 2J7IA 1ZBXA 1VQKT 1BK2A 1Y7XA 3CC2A 2O2OA 5FU7C 3GIBA 2RO0A 4N4IA 3EGDB 2NUTB 2K79A 2YSQA 1X43A 5C0MA 2K5LA 4JJNK 5CVIA 1VOMA 4PNOA 1WNLA 1M1GA 5GJWB 2DL4A 1YJ9Q 1IHVA 3FC3A 1NEGA 2PNIA 2LX7A 4C8QD 1YI2Q 3CCET 2JS0A 3GNFB 4FT4A 1RAFB 3RIRA 2DO3A 2FPDA 1I5OB 1YWPA 1YITQ 2HKQB 1W2BP 3FB9A 2A3LA 1QW1A 3OW2P 1KC8R 3UA7A 3H0HA 2FPFA 1ZUKA 3M4GA 3FIFA 3LX7A 5GANd 1W2BA 4FSSA 1V76A 2OAWA 4Q5WA 2K57A 4CC7A 4Z8AA 2ZPBB 1QWEA 4PLIA 3OS0A 1K73U 2RA2A 1VQ5T 3CBMA 2MAMA 1VQNT 1NJIR 2RJEA 3QSUA 4M75E 4ELZC 1BI1A 2K6DA 3L2QA 2AIRB 3EGUA 2L8DA 3A8GB 1B07A 1RAAB 5L8RE 3QDFA 1VQ4Q 4FW2A 3OYJA 1OV3A 1TH7A 1HYOA 4BD3A 1MV3A 4M7AF 2JM9A 2LQWA 2MYSA 4J8OA 1RAGB 2LVMA 4OMOA 1ZQ1A 4AFUC 1YI2T 2K2MA 2RJFA 1VA7A 2EFIA 1YITT 1YWOA 2CSQA 1AT1B 2FG0A 2GNCA 2MI6A 3CXCA 3CCQA 2DK3A 1YBYA 1C6VX 2CUDA 1G3SA 1R8OB 4DQ2A 2LT1A 3GBQA 1YJNA 1OI1A 3RR6A 1XOVA 3M0UA 1WXTA 2CP5A 2P4TA 2CH4A 2ZPIB 4BUGA 5LJ5j 5GAMj 3L42A 4F17A 2OTLQ 4HT9A 1WA7A 2V1RA 1UGSB 2F69A 4QW2A 1BYMA 4O6JA 5A0LA 4M78E 1U06A 1R0BG 4QQDA 2HL3A 5GAMe 4BB7A 4M7DA 1SHFA 1G5VA 5FRNA 1PSFA 1VQ4T 3CCVA 1QVGS 1VQ8A 2FZCB 1UJYA 2GBQA 2FRWA 1NM7A 1TOVA 1Y0MA 1BCMA 2C0IA 2FRYA 2AKKA 1A0NB 1XNIA 2KYMA 4RKUE 1W6XA 2F5TX 1WXUA 2EYXA 3EHRA 4MMKA 4NS5A 1PSEA 4HT8A 1G3TA 3UDCA 3EGDA 4QKUA 2NUTA 1X6GA 3MP6A 5CR2A 1RAEB 4C92E 2DF6A 2OTJQ 1ABQA 3CMAA 1DJ7B 3MO8A 2SRCA 1N8RC 3C0CA 1QCFA 4PJLA 2KRMA 3CCUT 4A4GA 2D6FA 3CC7A 4JJDA 3I5SA 5KYWB 2DL8A 1GCQA 4BY6C 3OYLA 1K8AU 3LLRA 4XTZA 2FEIA 5GANh 2HCKA 3NHNA 4JJCA 2DXUA 2YXYA 2HDAA 3OYDA 1ARKA 2VKNA 1QMCA 2RM4A 4FT2A 2GTOA 1TUDA 3QWYA 8ATCB 2DM1A 1NEBA 1GBQA 3JCMf 1UE9A 2OAUA 3VRZA 3SFMA 3M57A 4M7AC 2DL3A 2DXCA 1RL2A 1WFWA 3QIIA 1I1JA 1UJ0A 4Z02A 5FLXE 3OYCA 2E1HA 1WIEA 2EYYA 1K9MC 4A4EA 2QDYB 5GAN7 5FWCA 5GMKj 3P8HA 4AG2C 3GOXA 4Z88A 1LJOA 5KH6A 1UG1A 5LJ5d 5GAMd 4KBMB 1M4ZA 1RI9A 3OS5A 5GMKe 1YCSB 5LJ3f 3TSWA 5GMKl 4EMKB 4C8QF 1WYXA 3S3MA 4B6MA 2GQVA 1U8RA 2RJDA 4F7UF 1U1TA 3DLLA 1YHQA 1Y71A 4A63B 2RK2A 2CH4W 2FYKA 4M75D 1OULA 1Z9QA 4C0FA 1Q86C 4IURA 4J9GA 2E65A 3H8ZA 4JLGA 2XDPA 3QJYA 2XHCA 2LNVA 4E7ZA 1IO6A 4E6RA 1KJWA 3BDUA 1KHCA 5I22A 2PU9B 2VC8A 3EFSA 2PZ1A 3MEWA 2VXEA 2OJ2A 1CSKA 2EGEA 1PHTA 4EDUA 2F5KA 2EYWA 2GFAA 3VV0A 1D0ZA 1QWFA 3HRTA 1PCXA 3OYKA 3AT1B 2DFUA 4M7AG 1QVGA 1VQKA 1SSHA 4LUDA 1FX7A 3QHSA 4K11A 3VS7A 5DLQE 3CCQQ 1LPLA 3V8JA 4M7DE 2LCSA 5I2MA 1AWOA 4VUBA 3X26B 3FLGA 2E6NA 4KGVB 1YJNQ 5IH2A 1K73C 4MDWA 2LJ0A 3G1JA 4E7JA 1JO8A 3JCMP 3UPUA 3IQLA 4HCKA 1PG5B 4J9HA 1X27A 1AWXA 5CO7A 2DERA 1Q81R 3E9FA 3M58A 2FVUA 2MOXA 3KFVA 5KYWA 3G6EA 3CCEA 1F1BB 4M78D 4PFZA 1UEBA 4L5GA 5HKCA 2ZPEB 2E5QA 3PFSA 1PWTA 1M30A 1VIFA 3L2RA 3JB9H 3L1AA 3CCVQ 2LQ8A 2DXTA 2Y90A 2KXCA 3E19A 3SHWA 2EKOA 2M0YA 2CT3A 4R56A 3EAEA 2A37A 3EG1A 4BI4A 1Y57A 2EPDA 4XU3A 3A8OB 4ME7A 3VS0A 2K3XA 3MJXA 3RERA 2KSSA 1VQNA 3QYHB 1WQ7A 1WPYA 1SHGA 4C92D 2K5IA 4MDXA 3RKXA 2DEQA 2GCXA 2KMTA 3RUXA 3CMAQ 2PTKA 1VQ6T 4C8QC 3G71A 1RI0A 1ACMB 2RF0A 3L2ZA 1BU1A 2HL5C 5LJ5h 1ZSZB 5LJ3h 3CC7Q 2DBMA 1XJWB 2MF2A 5CKBA 1KQSS 5CKHA 2A28A 2KYBA 3INZA 1NLOC 1MUZA 1X6BA 1Y07A 4P5NA 4EMKA 2QQRA 1SRMA 3JB9G 4FYXB 3JCMb 3A5ZB 2ROLA 4N4GA 2PVDB 3L2UA 4KUDK 2J06A 3M59A 1HK9A 3GLXA 2R57A 1GFCA 2M02A 2QDLA 2D8JA 3OS2A 2X3XD 3OQ5A 5GAOr 3H6ZA 1Q95G 1BI3A 3ZL7C 3CMAT 3LW5E 1YJWA 3MEVA 5D6YA 3CCLA 3U23A 2RH2A 1K8AC 2QYZA 3CC7T 3JCMg 1W2BS 2E10A 1VYUA 3EGXB 3ULRB 3V8LA 3OW2S 2YRCA 2C0TA 1AHJB 4R55A 3EH1A 1M90C
chains in the Genus database with same CATH topology
2A7YA 2CGHA 2R5AA 3BDLA 2PQWA 1M5Q1 3FB9A 2A3LA 1S72T 1QW1A 1O75A 1D3BA 4C8QG 3LYIA 2BKDN 1K8AU 2OTLT 2R58A 3SB2A 4ZGJB 5A2QE 4BE1A 3M4GA 3JB9F 3FIFA 1UGQB 3EFRA 3HHTB 3LX7A 2LX9A 1VUBA 4A54A 5GANd 3JCMV 3OS1A 4XU2A 3I56T 3CCUA 1W2BA 4RG2A 4F7UG 4N4HA 4RCCA 3OYNA 4Q5WA 3G7ZA 1VQ9A 2K57A 3MEAA 4M7DE 3MEUA 4M75F 2ZPBB 1SSFA 3Q1JA 4PLIA 3OS0A 1K73U 4OB0B 5LJ3g 4OMFB 2RA2A 1VQ5T 2CZ6B 3CBMA 2MAMA 4C0DB 4JLIA 1VQNT 3NTIA 3JCMd 3WXMB 2RJEA 3QSUA 4BDYA 4M75E 4ELZC 1BI1A 3ZFJA 3L2QA 3ER0A 4TVRA 4C5GA 5KE3A 2L8DA 3CCST 3A8GB 1I81A 5L8RE 2YHTA 4BDZA 2XICA 3OYYA 3OYJA 4QVCA 4PJOD 2X4WA 1TH7A 2KAFA 5J39A 3JSCA 4BD3A 3VJPA 4M7AF 5J3BA 1NJIU 3QG1A 1VQOT 4J8OA 3RKYA 3PGGA 4HCBA 4C8QA 2QQAA 2LVMA 4FIBA 3OYBA 3CCJA 3QKJA 2XD0A 3HL8A 1ZQ1A 4M7DG 3GNGA 4XTWA 5I21A 4PJOG 5GAMh 5A0DA 3DLMA 3DB3A 4OVAA 2LTOA 2VV5A 5GAOl 3KXTA 1YI2T 4M7AE 3HRUA 1N9SA 4ZN3A 5CK9A 4N0AA 1VQ6A 3JCMX 2RJFA 4F7UA 2OTJT 1G3WA 1WJRA 4FM4B 2EFIA 5DY9A 3OYFA 3AHUA 4ATOA 1YITT 2ZGWA 2EAYA 2R5MA 3WVDB 3CCQA 2MI6A 3VUBA 3CXCA 4XTUA 2DK3A 1YBYA 3VYGA 1UB4A 1G3SA 1R8OB 2MMPA 3URGA 1VQ7A 2Y4YA 4DQ2A 2LT1A 1O9SA 3FJPA 5CIUA 1I8FA 2LQKA 3ASKA 3TU4K 5LJ3d 1YJNA 1OI1A 3J81E 1XOVA 3OW2A 1FXXA 1UGRB 3LWHA 3KBGA 3V7SA 1Q7YC 4V2SA 3G4SA 4WF2A 4J83A 2P4TA 2QA4A 2ZPIB 2QI2A 3I55T 4BUGA 5IT9E 5LJ5j 2LT4A 3L42A 5FU6B 5GAMj 4PKCC 2JNGA 4HT9A 1QVFS 2LC4A 4M78F 2EYQA 1QP3A 1UGSB 3OB9A 4PJOB 2GF7A 2F69A 4QW2A 3OMCA 1VQLT 3OSVA 1VQPT 2O01E 4C0ZA 2DAQA 1YIJA 1BYMA 4O6JA 4A4FA 5A0LA 1I4K1 4M78E 3NFCA 2FB7A 4II1A 4QQDA 5KCHA 5GAMe 2X4YA 5CQYA 4BB7A 1Q82C 1M1KU 1B34B 4M7DA 3OA6A 4PJOA 1G5VA 2BUDA 4FSXA 3CC2T 5FRNA 1PSFA 2JOYA 3CCVA 1VQ4T 1QVGS 1KD1U 3CPFA 1VQ8A 2LCLA 2X4XA 3OSSC 1UGPB 4OB2B 3LWIA 2EWNA 3V7RA 4RMOA 3NTHA 2YLBA 3ZEHA 2Y4XA 3CC4A 5C6SA 1N6AA 2DXBA 4FU6A 1Q86U 2P0PA 4C5HA 3VKIA 2IVWA 2P0QA 2RHXA 4FL6A 2G3RA 1QVFA 1XNIA 4RKUE 5GAOm 5DLOA 1WQWA 2O4XA 3DKMA 4M77F 3JRZA 2F5TX 3A8LB 3BY7A 2V8KA 4MMKA 3E9GA 2KQWA 1PSEA 2B8AA 1G3TA 2HBPA 4NS5A 2YLCA 3UDCA 4C92F 4HT8A 2M1HA 3CMET 3CCRA 3OBYA 3META 3HRSA 3MP6A 4M77E 4OF1A 4EMGA 5CR2A 3G6ET 2EIFA 1OZ3A 2M16A 4C92E 4ELYC 2XK0A 1QP2A 2JTFA 1Q81C 1EIFA 1DJ7B 3MO8A 3CMAA 1IREB 1N9RA 4MZPA 4BY6B 1BIBA 4M75B 1N8RC 4QVDA 1FWZA 2DTHA 3CCUT 4A4GA 2D6FA 3OBWA 4QQ6A 3C4SA 3CC7A 2EQMA 1JJ2A 5CKDA 5GAOp 2DD4A 4XTXA 3X25B 2K3YA 4BY6C 5GAN3 5GAN5 5CKEA 3JCMW 3OYLA 4M75C 3LLRA 2HD0A 4MMLA 2XI9A 3DB4A 3PT9A 2E70A 4XTZA 5GANf 3E1SA 5GANh 3CPWS 2IG0A 2V8IA 2X4JA 2DXUA 2V8JA 3OYMA 1QVPA 5LJ5g 5GAMg 3OYDA 1KC8U 5CAIA 4X9CA 1HXDA 3PMTA 5GAOn 1BI2A 4M7AB 5KCOA 4IUUA 5CQXA 1WJSA 3X20B 3CCMA 2BIVA 2RM4A 2KDSA 3BFMA 4FT2A 1BIAA 2DTOA 2DTIA 4L6V5 2E6ZA 3JCMf 3JCMh 5GMKh 2L3RA 4XAXB 2OAUA 1VQMT 3SFMA 4GLKA 4YTLA 2DZ9A 4IKFA 5FROA 3M57A 4M7AC 4LDVA 3VYHB 3QUIA 4XU0A 2DXCA 3G71T 2LCCA 4PLLA 1RL2A 2RHIA 2YRVA 3OY9A 3QIIA 5FLXE 4Z02A 2VGMA 2AHJB 4Y91A 3OYCA 2MWPA 4E7IA 3RESA 3KUFA 1VQ5A 2CZ0B 3V7CA 4B9XA 2E1HA 2RJCA 1K9MC 4M77D 4A4EA 3ZBDA 3UWNA 2L89A 2QDYB 5GAN7 2DJZA 4JRKA 5GANe 2DZCA 3GPLA 2QEXA 3CCQT 5IAYA 2C06A 3PMIA 1VQ7T 5GMKj 2RD1A 3CCSA 3HFOA 1YCYA 3P8HA 4M78B 3RMQA 4BE0A 1YJNT 1BKBA 2HQXA 3JCMQ 3M53A 3GOXA 3R6OA 3S3NA 2EQKA 1LJOA 2I2LA 2X35A 1OZ2A 3TCJA 5KH6A 5LJ5d 5GAMd 2FL7A 2QA4T 2VGNA 4KBMB 5AYFA 1M4ZA 2MWOA 3QO3A 4OGCA 3OS5A 5GMKe 2KVQG 5LJ3f 3JCMe 2JTMA 5GMKl 1YJ9A 2DPPB 4XQ3A 4EMKB 4M78C 1WJQA 4BI8B 1IZ6A 4C8QF 2QTXA 3QDRB 1V29B 4BI3A 1MGQA 2M0OA 3GF5A 5GAN6 3JB9D 2E64A 3OYGA 1YI2A 3S3MA 4C5EA 1W4SA 3HPWA 2GQVA 2RK1A 1U8RA 2WSFE 1X75C 2LDMA 4C8QE 2RJDA 4F7UF 1U1TA 3DLLA 1YITA 5GAN4 1Y71A 1YHQA 4EPCA 4EMKC 3F70A 4JRPA 2LRQA 1Y96B 2RK2A 4Y28E 4HCCA 2FYKA 1NPRA 2WSCE 4M75D 5HK0A 3HSBA 4C0FA 1Q86C 2RHUA 3CCVT 1VQ8T 4XU1A 4HA8A 4EMHA 4IURA 4F7UE 3J80E 4LD9K 1WGSA 3CD6A 3TEEA 1KQ2A 2E65A 3H8ZA 4M77B 2QQSA 3X24B 2DVEA 2JZ2A 1NZ9A 1YJWT 4C92B 3CC4T 1Y96A 3VUZA 4JLGA 3CCLT 3OYEA 4ZTFA 4M75G 2XDPA 3QJYA 3C12A 4JUVA 4DA4A 2XHCA 3ME9A 4JDSA 2LNVA 4MZMA 1B34A 4L59A 3JB9I 4C5IA 5KE2A 4M77C 5M9OA 3BDUA 2DD5A 1U1SA 4LD6A 2DIQA 1KHCA 3TREA 4C92C 2PU9B 2VC8A 3EFSA 3MEWA 4ZGDB 4M7AD 1KHIA 2RI5A 5D6WA 2EQUA 2VXEA 3A8MB 3CCRT 3QZ5B 2XKOC 3WVEB 1XTDA 4EDUA 2F5KA 2GFAA 2WSEE 3VV0A 4JRQA 4PL6A 3P8BB 4M7DF 3M56A 1I5LA 3HRTA 4PJOF 5FRMA 1M8VA 1VQ4A 3OYKA 5D6XA 4KULA 3SWNC 4KUIA 4M7AG 1QVGA 1VQKA 1FX7A 3QHSA 4JRIA 3FRNA 3QJ6A 5DLQE 5EG2A 4OB1B 3V8JA 3OMGA 4A4HA 5I2SA 3MP1A 5I2MA 4VUBA 4J7FA 3X26B 4E7HA 1Q82U 1LOJA 4B9WA 3FLGA 4PJOE 2E41A 3X28B 1N27A 2E6NA 5GMKm 4D6WA 3MHXA 4IUTA 5LL6S 2NLUA 4DOWA 4HKEA 2CZ7B 4LDWA 4MDWA 1K73C 2EJFA 1KC8C 2KK4A 3FEOA 3L2VA 4E7JA 4J6XA 4BACA 2P0KA 4X9DA 2WACA 4NL2A 5DM7R 3UPUA 2EJ9A 3JCMP 3BW1A 1VQ9T 4NOYA 3J7AF 1GXIE 2GFUA 2K2VA 4M75A 2RI3A 1D3BB 1JBMA 4IUQA 3S6WA 4E47A 1BI0A 5CO7A 4LDXA 3E9FA 3M58A 2FVUA 4C0GA 4XK8E 2KY9A 5CCAA 3G6EA 1P92A 3CCEA 4M78D 5GMKi 3CCMT 1UEBA 4L5GA 4O5VA 2ZPEB 5HKCA 2K4YA 2E5QA 3PFSA 4BE2A 3CBOA 4OGEA 2XU8A 1VIFA 1M90U 3QPHA 2M9UA 3L2RA 1NJIC 2E12A 3JB9H 3L1AA 4CRIA 1S72A 3UT1A 4M78G 3MCAB 2OTLA 1KG1A 1OYXA 2DXTA 2LQ8A 2Y90A 3E19A 3M55A 5IN1A 1Q81U 3C94A 2EKOA 4M7AA 4LDUA 3I56A 4R56A 4OP0A 1N8RU 3CBPA 3EAEA 5GANj 2JN0A 3FDRA 3CCJT 4BI4A 3JB9J 3CPWA 3V8KA 2ZPGB 4ZTJA 4GY5A 2CS7A 3VU3C 2CZ1B 4XU3A 3SDZA 2QEXT 3A8OB 1M1FA 2K5FA 4ME7A 5GAOq 4E7KA 2K3XA 3RERA 2KSSA 1VQNA 3QYHB 2RHZA 1WQ7A 1WPYA 3CXCS 4CI0C 4C92D 4C8QB 2XIDA 1H641 1LNXA 4IUPA 3HFNA 4C0DC 5HY6A 2K5IA 4MDXA 4JS4A 4M7DD 1X6OA 4DOVA 1VQMA 2FHDA 2QXFA 4HCZA 3RKXA 3JCMJ 2DEQA 2GCXA 2KMTA 3RUXA 4M77G 4F7UB 3T9NA 2ZPFB 1YJ9T 1VQ6T 3G4ST 4C92G 4C8QC 2PVOB 3G71A 2RB6A 3C95A 3HKSA 2HAXA 4A53A 1RI0A 2VYTA 3L2ZA 1VQOA 5GAMf 1JB0E 1VIEA 2EQJA 1XQHA 5LJ5f 5LJ3h 5LJ5h 2D9TA 2ZCFB 1ZHIA 4M78A 4N0AC 5GAN2 3P8DA 4JS5A 3SD4A 3GP8A 3QXEB 4J6WA 2JVVA 2MF2A 4OB3B 3QZ9B 1M1KC 5CKBA 2H3JA 1KQSS 2XDDA 1YHQT 3A8HB 5CKHA 4XTYA 3JAME 3OYAA 1YIJT 3LGFA 1KD1C 2RHYA 3INZA 2OTJA 4X34A 5A0GA 5J26A 1Y07A 4P5NA 4QQGA 4EMKA 2JUFA 2D0QB 2HQEA 3QBYA 2QQRA 1X01A 3CD6T 4E7LA 3JB9G 1K9MU 3N5BB 4NL3A 3JCMb 4UC4A 3A5ZB 3PIPA 5HK3A 2PUKB 3PTAA 3L2WA 2CYZB 2VXFA 3QYGB 2QQ9A 4N4GA 2DKGA 2PVDB 5GAN8 3M54A 5LJ3j 2PUOB 1G3YA 4ZN1A 3L2UA 4KUDK 1NPPA 4MZTA 4KT0E 1NE8A 2PVGB 4M7DB 2RI2A 3I55A 3M59A 1HK9A 3GLXA 4LDYA 5CKFA 3LGLA 3OYIA 2QQBA 4M77A 1KQSA 1Q7YU 1MHNA 2R57A 1VQLA 2VUBA 4J6YA 4RCBA 2DIGA 5FU6C 5FU7B 2ZPHB 4C92A 3SWNB 1VQPA 1H3ZA 5LJ5e 2EJGA 3OYHA 4IUVA 5LJ3e 4M7DC 1JRIA 4PJOC 3OS2A 3OQ5A 2XG8D 3O8VA 5GANg 4J7IA 5GAOr 1KQ1A 1ZBXA 1VQKT 3H6ZA 3JCMc 1Y7XA 3CC2A 2O4XB 1BI3A 3PIOA 3PNWC 3M9QA 4RG8A 5FU7C 3CMAT 2XDBA 2HNIA 3SWNA 2CKKA 3LH0A 3LW5E 1YJWA 3GIBA 3MEVA 5D6YA 3M5AA 3CCLA 2RH2A 2RO0A 1K8AC 4N4IA 1JJ2S 4XTVA 3S3OA 3CC7T 2ZZDA 4ZGEB 3JCMg 1W2BS 2E10A 3M4YA 2K5LA 4J5YA 4A4KA 5C0MA 4JJNK 5CVIA 3V8LA 4PNOA 3OW2S 1WNLA 3CEYA 1M1GA 3RKWA 3NTKA 1AHJB 3RMSA 4R55A 3FC3A 1M9SA 3MP8A 1M90C 2L5QA 3HP9A 4C8QD 3CCET 3GNFB 3CMEA 4FT4A 3RIRA 2DO3A 4QVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO3 A;  3V8K A;  3JCM e;  5GMK e;  5LJ3 f;  5GMK l;  4EMK B;  2EWN A;  4XQ3 A;  4M78 C;  2CGH A;  3V7R A;  3VU3 C;  4C8Q F;  2QTX A;  4XU3 A;  5GAN 6;  1MGQ A;  2YLB A;  3JB9 D;  1M5Q 1;  2E64 A;  3FB9 A;  5GAO q;  3RER A;  4C8Q G;  1D3B A;  1WQ7 A;  1WPY A;  3SB2 A;  4C8Q E;  3JB9 F;  4F7U F;  4C92 D;  1U1T A;  3M4G A;  1H64 1;  1LNX A;  3EFR A;  3FIF A;  1WQW A;  3HFN A;  4A54 A;  4C8Q B;  4EMK C;  3JCM V;  5GAN d;  4M77 F;  4XU2 A;  4M7D D;  3BY7 A;  4MMK A;  1Y96 B;  2FYK A;  4F7U G;  4M75 D;  3RKX A;  3JCM J;  3HSB A;  4RCC A;  2DEQ A;  4C92 F;  4HT8 A;  2YLC A;  4HA8 A;  4XU1 A;  4M77 G;  3RUX A;  4EMH A;  4F7U E;  2K57 A;  4F7U B;  1KQ2 A;  2E65 A;  4M77 E;  4C92 G;  4M77 B;  4M75 F;  4C8Q C;  2RB6 A;  4EMG A;  4A53 A;  2DVE A;  5LJ3 g;  4C92 E;  2RA2 A;  3L2Z A;  4C92 B;  5GAM f;  5LJ5 f;  1Y96 A;  5LJ5 h;  5LJ3 h;  4M75 G;  4JLI A;  4JUV A;  4M78 A;  4N0A C;  3JCM d;  1N9R A;  5GAN 2;  3QSU A;  4M75 E;  1BIB A;  4J6W A;  1B34 A;  4M75 B;  5GAN 4;  4QVD A;  3JB9 I;  2DTH A;  4M77 C;  4XTY A;  3BDU A;  3INZ A;  1U1S A;  1I81 A;  4C92 C;  2VC8 A;  2YHT A;  3EFS A;  5GAO p;  4M7A D;  4EMK A;  4XTX A;  4QVC A;  2VXE A;  1X01 A;  3JCM W;  5GAN 3;  5GAN 5;  3JB9 G;  4PJO D;  1TH7 A;  4M75 C;  4MML A;  4XTZ A;  3JCM b;  5GAN f;  4NL3 A;  5GAN h;  4M7A F;  4M7D C;  4M7D F;  1I5L A;  4PJO F;  3RKY A;  3PGG A;  1M8V A;  4C8Q A;  2VXF A;  2DXU A;  3SWN C;  5LJ5 g;  5GAM g;  2DKG A;  4M7A G;  4M7D G;  3QHS A;  4JRI A;  4XTW A;  4PJO G;  5I21 A;  5CAI A;  4X9C A;  1HXD A;  5LJ3 j;  5GAM h;  5GAN 8;  3V8J A;  4M7A B;  5GAO n;  5GAO l;  4M7A E;  1N9S A;  4M7D B;  4M7D E;  4N0A A;  4PJO E;  2RM4 A;  1LOJ A;  3BFM A;  3JCM X;  1HK9 A;  2E41 A;  4F7U A;  1BIA A;  3AHU A;  5DY9 A;  2DTO A;  5GMK m;  2DTI A;  2ZGW A;  3JCM f;  4M77 A;  2EAY A;  3JCM h;  5GMK h;  5GAO m;  4XTU A;  2EJF A;  4J6Y A;  4RCB A;  2DZ9 A;  4C92 A;  4J6X A;  3SWN B;  4M7A C;  4DQ2 A;  5LJ5 e;  2EJG A;  4X9D A;  5LJ3 e;  3FJP A;  4NL2 A;  1JRI A;  2EJ9 A;  3QUI A;  3BW1 A;  3JCM P;  4NOY A;  5GAN g;  1I8F A;  4XU0 A;  4PJO C;  4M75 A;  5LJ3 d;  1D3B B;  1JBM A;  5GAO r;  1KQ1 A;  3V7S A;  3JCM c;  4V2S A;  4WF2 A;  4Y91 A;  4M78 D;  5GMK i;  2HNI A;  3SWN A;  3RES A;  3GIB A;  5LJ5 j;  5GAM j;  3V7C A;  4HT9 A;  2E1H A;  4M77 D;  4M78 F;  4XTV A;  4PJO B;  5GAN 7;  2DJZ A;  4JRK A;  5GAN e;  2DZC A;  3JB9 H;  3JCM g;  3L1A A;  2E10 A;  4J5Y A;  5GMK j;  2RD1 A;  4M78 G;  3V8L A;  4PNO A;  1WNL A;  2DXT A;  2Y90 A;  1I4K 1;  3HFO A;  4M78 E;  1YCY A;  2FB7 A;  4M78 B;  3RKW A;  5GAM e;  4M7A A;  3JCM Q;  4M7D A;  1B34 B;  4OP0 A;  4PJO A;  1LJO A;  2I2L A;  5LJ5 d;  5GAM d;  5GAN j;  4C8Q D;  2JN0 A;  3RIR A;  3JB9 J; 
#chains in the Genus database with same CATH topology
 3O5Z A;  2CP6 A;  2HQH A;  1YHQ Q;  3BE3 A;  4DEY A;  1LCK A;  1S72 T;  4C8Q G;  3LYI A;  2BKD N;  1H8K A;  4BE1 A;  1UGQ B;  3EFR A;  3HHT B;  1HJD A;  2LX9 A;  2LQN A;  1MMD A;  3CCU A;  2NUZ A;  3M0R A;  4RG2 A;  4F7U G;  5KYY B;  3G7Z A;  3MEU A;  4KGX B;  1MMG A;  4M75 F;  1K0X A;  1SSF A;  5LJ3 g;  4OMF B;  3ZFJ A;  1AD5 A;  3ER0 A;  4F04 B;  1B7T A;  3VS4 A;  2BZX A;  1VQK Q;  1PM3 A;  5J39 A;  1UFF A;  4FW1 A;  3JSC A;  3QG1 A;  1VQO T;  1ZA1 B;  4R0K A;  4FIB A;  3CCJ A;  2XD0 A;  3HL8 A;  2G6F X;  4XTW A;  5I21 A;  5A0D A;  3DLM A;  4OVA A;  2VV5 A;  1TWB A;  2KNB B;  3EG2 A;  3HRU A;  2ESW A;  3OYF A;  3AHU A;  4FM4 B;  5DY9 A;  2DYB A;  2R5M A;  4RTU A;  3VYG A;  1UB4 A;  2Y4Y A;  3G6E Q;  1UGR B;  3KBG A;  4QT7 A;  4V2S A;  3G4S A;  3I55 T;  4RUG A;  1T0J A;  1KD1 R;  1QCO A;  2JS2 A;  4M78 F;  2JMA A;  1R0C B;  2GF7 A;  2EQI A;  3OMC A;  4C0Z A;  5IHK A;  2DAQ A;  5KYU B;  1I4K 1;  2QG9 B;  4II1 A;  2L3P A;  2X4Y A;  1ZSG A;  4J9F A;  3OA6 A;  4PJO A;  2BUD A;  1BB9 A;  2DYI A;  2JOY A;  1VQN Q;  1WI7 A;  2CSI A;  4OB2 B;  3LWI A;  2EWN A;  4RMO A;  2HEQ A;  3NTH A;  5EC7 A;  3ZEH A;  2CT4 A;  5IHN A;  5C6S A;  1Q86 U;  2DXB A;  3VKI A;  2G3R A;  1D0Y A;  3EH2 A;  5GAO m;  5DLO A;  4ZNX A;  3G71 Q;  4C92 F;  2KR3 A;  2YLC A;  2M1H A;  3MET A;  3G6E T;  3EGX A;  1OX8 A;  2JMC A;  4ELY C;  1EIF A;  2HSE B;  4JZ4 A;  1N9R A;  4MZP A;  3EG3 A;  2DBK A;  1Z9Z A;  3RBB B;  1SKU B;  5GAN 5;  4MML A;  2HKN A;  2KT1 A;  4M75 C;  2XI9 A;  5GAN f;  3OW2 A;  4ORZ A;  2F2W A;  2IG0 A;  2X4J A;  1QVP A;  3RDV A;  3PMT A;  5GAO n;  5KCO A;  3THK A;  4IUU A;  4LNP A;  5KYY A;  1TS9 A;  2DTO A;  2E6Z A;  1PKT A;  2L3R A;  4LN2 A;  3CPW P;  3QUI A;  4XU0 A;  1YJW Q;  1E6G A;  3G71 T;  3CCL Q;  1TU0 B;  3TQ7 P;  3OY9 A;  1TTH B;  4Y91 A;  1OOT A;  4B9X A;  4M77 D;  3GPL A;  1NG2 A;  2DJZ A;  3VRY A;  1RLQ C;  4OML A;  1S1N A;  1VQ7 T;  2MIO A;  3CCS A;  3HFO A;  1YCY A;  3M0P A;  1RLP C;  5HCK A;  2QA4 T;  2FL7 A;  2VGN A;  4AFZ C;  2MWO A;  1VQ6 A;  3JCM e;  2KVQ G;  2JTM A;  4XQ3 A;  1YNZ A;  1WJQ A;  4M78 C;  4BI8 B;  1V29 B;  4BI3 A;  1MGQ A;  2OI3 A;  3E2U A;  3GF5 A;  4OMM A;  3CCU Q;  2E64 A;  2KI7 A;  1X2Q A;  4C5E A;  2RK1 A;  4KH1 B;  2WSF E;  1ZBJ A;  1ZSZ C;  4JRP A;  4HCC A;  2WSC E;  3HSB A;  1BCO A;  4HA8 A;  3J80 E;  2KE9 A;  3SEM A;  1JXM A;  2DVJ A;  4M77 B;  2QQS A;  3A1P A;  2DVE A;  1YJW T;  1NZ9 A;  1LVK A;  5KYU A;  3CC4 T;  3CCL T;  4M75 G;  3NPF A;  4MZM A;  4L59 A;  2AK5 A;  1QKX A;  2O88 A;  1U1S A;  4LD6 A;  2DIQ A;  4C92 C;  1TG0 A;  4ANJ A;  1TUC A;  5D6W A;  2EQU A;  3CCR T;  3CCJ Q;  4DBF A;  2XKO C;  4PFO A;  2KRO A;  5I11 A;  4JRQ A;  3P8B B;  4M7D F;  4DBQ A;  1M8V A;  1J3T A;  4KUL A;  2RQR A;  4JRI A;  2NYS A;  4OB1 B;  3GP8 A;  1Q82 U;  4PJO E;  4IUT A;  2EGA A;  2NLU A;  2CZ7 B;  2JM8 A;  2EJF A;  2KBT A;  2KK4 A;  1WHJ A;  3L2V A;  4J6X A;  2DEU A;  3G4S Q;  4X9D A;  2WAC A;  4NL2 A;  2EJ9 A;  3BW1 A;  2GGR A;  2K2V A;  1D3B B;  4E47 A;  1IGQ A;  4C0G A;  5GMK i;  3CCM T;  2H3E B;  1N8R R;  2RN8 A;  2K4Y A;  4J9B A;  1M90 U;  2M9U A;  2Z0W A;  2E12 A;  1S72 A;  3UT1 A;  4M78 G;  3M0Q A;  3MCA B;  1KG1 A;  1OYX A;  2O9V A;  4OP0 A;  3CBP A;  1PRM C;  2JN0 A;  3CCJ T;  3V8K A;  4ZTJ A;  2BTT A;  2CZ1 B;  2QEX T;  1M1F A;  1H3H A;  4LXC A;  2A0F B;  2RHZ A;  1I07 A;  2XID A;  5HY6 A;  3JCM J;  2BZ8 A;  2ZPF B;  3G4S T;  4C92 G;  2QK0 A;  4A53 A;  2VYT A;  3H41 A;  1K9M R;  1VQO A;  5GAM f;  1JB0 E;  5LJ5 f;  5IHI A;  2LP5 A;  2ZCF B;  4JS5 A;  1X2K A;  1AVZ C;  1MMN A;  2JVV A;  3QZ9 B;  3A8H B;  1C0M A;  1GL5 A;  4XTY A;  3LGF A;  2RHY A;  5A0G A;  4OMQ A;  3CD6 T;  3QBY A;  1HD3 A;  1U3O A;  2B86 A;  1AOJ A;  4ESR A;  3PTA A;  2CYZ B;  2PUO B;  4ZN1 A;  4MZT A;  4KT0 E;  2RI2 A;  3I55 A;  4PJM A;  3D7S B;  3I9Q A;  3LGL A;  3OYI A;  1W1F A;  4M77 A;  1U5S A;  1Q86 R;  1M8M A;  4J6Y A;  2DIG A;  5FU7 B;  3VS2 A;  2ZPH B;  1K4U S;  2EJG A;  4M7D C;  5GAN g;  2XG8 D;  3O8V A;  2YUQ A;  4J7I A;  2DET A;  3JCM c;  2YUN A;  3PNW C;  3M9Q A;  2ATC B;  2HNI A;  3SWN A;  4EIK A;  2O9S A;  4J9I A;  2OX7 A;  3CCS Q;  2F2V A;  1ZUY A;  2ZZD A;  4J9D A;  1UHF A;  3REA B;  3CEY A;  3RKW A;  1VQ6 Q;  2DIL A;  4J9C A;  3NTK A;  3RMS A;  1M9S A;  4JZ3 A;  3MP8 A;  2L5Q A;  3HP9 A;  1WZO A;  1M27 C;  1JJ2 P;  2CGH A;  3BDL A;  4RTW A;  2RNA A;  2PQW A;  1M5Q 1;  1QQJ A;  5GJV B;  1K73 R;  1O75 A;  1D3B A;  4F16 A;  4ZGJ B;  5A2Q E;  4A54 A;  1VUB A;  1GCQ C;  3JCM V;  1WHL A;  4XU2 A;  3I56 T;  2JW4 A;  2P84 A;  4N4H A;  4RCC A;  4HVW A;  2O31 A;  2D0N A;  1WX6 A;  3Q1J A;  5L23 A;  4OB0 B;  2CZ6 B;  4C0D B;  4IIM A;  3M0T A;  4RTZ A;  3WXM B;  1C1A A;  4BDY A;  2YDL A;  3CCS T;  2COY A;  2VB6 A;  2D8H A;  4AFS C;  1K76 A;  2XIC A;  3OYY A;  3UA6 A;  4QVC A;  4PJO D;  2KAF A;  1SPK A;  2F2X A;  2JT4 A;  1T3L A;  3VJP A;  5J3B A;  1NJI U;  3RKY A;  3PGG A;  3FJ5 A;  3OYB A;  4M7D G;  5GAM h;  1ZLM A;  2LTO A;  4N0A A;  2HZY A;  1WJR A;  2ZGW A;  1D1C A;  2EAY A;  3VS5 A;  2MK5 A;  2QAZ A;  1VQ7 A;  2MMP A;  3URG A;  3FJP A;  5CIU A;  5D7U A;  3TU4 K;  1RAD B;  3J81 E;  1UTI A;  1FXX A;  4FYY B;  1OPL A;  2RQT A;  3LWH A;  1Q7Y C;  4WF2 A;  4J83 A;  2QA4 A;  2QI2 A;  1S72 Q;  1SRL A;  2LT4 A;  4PKC C;  2JNG A;  5IXF A;  2DNU A;  1WXB A;  2LNH B;  2RQW A;  2AKL A;  2LC4 A;  4PJJ A;  2EYQ A;  1QP3 A;  3OB9 A;  4PJO B;  1M3A A;  4LUE A;  1VQL T;  3OSV A;  3EG9 B;  1VQP T;  1M3C A;  2FB7 A;  3NFC A;  2HBW A;  5KCH A;  5CQY A;  1Q82 C;  1M1K U;  1B34 B;  3UF4 A;  2E3I A;  2X4X A;  3MKD A;  1G8X A;  1UGP B;  2BZY A;  1QVF P;  1AEY A;  3V7R A;  1GCP A;  2YLB A;  2K3B A;  3CC4 A;  1TXQ A;  4KRT A;  2P0P A;  4C5H A;  2P0Q A;  2RHX A;  4FL6 A;  2LJ3 A;  1QVF A;  1JXO A;  2X3W D;  2K7A A;  2L0A A;  3DKM A;  1IHW A;  3BY7 A;  3A8L B;  2CP2 A;  2V8K A;  1VQO Q;  2KQW A;  2HBP A;  3QWX X;  4PFP A;  1GFD A;  2AT1 B;  3CME T;  3CCR A;  4RTX A;  4M77 E;  4EMG A;  1K8A R;  2XK0 A;  4RTV A;  1AWJ A;  2CP0 A;  4BY6 B;  1BIB A;  1KSW A;  4QVD A;  1FWZ A;  2DTH A;  1MNE A;  1EZZ B;  3OBW A;  1M90 R;  2DD4 A;  1M2V B;  3X25 B;  4WTO B;  3JCM W;  5GAN 3;  2HD0 A;  2E70 A;  3E1S A;  3CPW S;  1G83 A;  2KRS A;  3I55 Q;  2J05 A;  2V8J A;  4AG1 C;  5LJ5 g;  5GAM g;  5CAI A;  4X9C A;  4GLM A;  1BI2 A;  4M7A B;  3X20 B;  2NWM A;  3CCM A;  4D8D A;  2BIV A;  1RAI B;  2KDS A;  3BFM A;  2DTI A;  4L6V 5;  5GMK h;  2ED0 A;  4RTT A;  2DJQ A;  4D8K A;  4GLK A;  2DZ9 A;  4IKF A;  1H92 A;  3RNJ A;  4LDV A;  2IPO B;  2FPE A;  4PLL A;  2RHI A;  4E7I A;  3RES A;  2CZ0 B;  3V7C A;  2RJC A;  2DA9 A;  5KYN A;  3UWN A;  2QEX A;  1SEM A;  4JRK A;  5GAN e;  2DZC A;  1PD0 A;  2ABL A;  2RD1 A;  1NBE B;  2CDT A;  2EW3 A;  1BKB A;  3JCM Q;  3M53 A;  3R6O A;  2EQK A;  3TCJ A;  2X35 A;  1OU9 A;  5AYF A;  4OGC A;  2DPP B;  3VS3 A;  1D0X A;  1QLY A;  3QDR B;  5GAN 6;  2M0O A;  2EYZ A;  2VWF A;  3JB9 D;  3OYG A;  3H9N A;  1W4S A;  2KT8 A;  4X1V A;  2MPX C;  5FWB A;  5GAN 4;  3I5R A;  4EMK C;  3F70 A;  2LRQ A;  4Y28 E;  5HK0 A;  2RHU A;  4EMH A;  3CD6 A;  1WGS A;  1KQ2 A;  2A08 A;  2DE0 X;  3EG9 A;  1PD1 A;  3X24 B;  1OQK A;  1Y96 A;  3VUZ A;  3OYE A;  4DA4 A;  4JUV A;  3ME9 A;  2C0O A;  2BE7 D;  4JDS A;  2W10 A;  1B34 A;  3JB9 I;  5KE2 A;  1NYF A;  5M9O A;  2DD5 A;  4ZGD B;  1UEC A;  1EFN A;  3QZ5 B;  2NUP B;  2WSE E;  3H0F A;  1OEB A;  3M56 A;  4PJO F;  1SF9 A;  1AWW A;  1M2O A;  5D6X A;  2RMO A;  5I2S A;  3OMG A;  4J7F A;  1VQ7 Q;  1FMV A;  1LOJ A;  4B9W A;  2E41 A;  5GMK m;  3MHX A;  4DOW A;  4HKE A;  4LDW A;  1KC8 C;  3FEO A;  4DBR A;  2E5K A;  2QA4 Q;  3J7A F;  1FYN A;  4NOY A;  1GXI E;  2GFU A;  1D1A A;  3JV3 A;  2RI3 A;  1JBM A;  2XMF A;  3S6W A;  1BI0 A;  4JJB A;  4LDX A;  1K9A A;  4XK8 E;  2KY9 A;  5CCA A;  1KK7 A;  2J6O A;  4O5V A;  1M2V A;  3TSZ A;  4BE2 A;  4OGE A;  1VYV A;  1NJI C;  2MCN A;  3M55 A;  1Q81 U;  3C94 A;  3EFO A;  2CRE A;  4M7A A;  1K0S A;  3I56 A;  2KGT A;  2QGG A;  1JU5 C;  3CC4 Q;  2ZAE A;  4J9E A;  3FDR A;  3JB9 J;  3CPW A;  2ZPG B;  2J6K A;  3VU3 C;  1UUE A;  2K5F A;  4E7K A;  1T3S A;  1PRL C;  2VVK A;  1MMA A;  3CCR Q;  4C8Q B;  2JJ9 A;  3VS6 A;  4C0D C;  1ZX6 A;  6AT1 B;  9ATC B;  1VQM A;  2FHD A;  2IIM A;  4F7U B;  4LE9 A;  1YJ9 T;  1NLP C;  2HAX A;  2ENM A;  3HKS A;  1R77 A;  2ECZ A;  1VIE A;  3CXC P;  2D9T A;  2DLP A;  3H0I A;  1I0C A;  5GAN 2;  3QXE B;  4J6W A;  1M1K C;  2H3J A;  1QKW A;  2XDD A;  3JAM E;  1UHC A;  4X34 A;  3R6N A;  2YT6 A;  5J26 A;  4QQG A;  2JUF A;  2D0Q B;  4E7L A;  1IGU A;  2RQU A;  5FW9 A;  3N5B B;  4NL3 A;  4UC4 A;  4RTY A;  3CCM Q;  1WHM A;  3QYG B;  1M1K R;  3M54 A;  5LJ3 j;  2QAS A;  1SG5 A;  1NE8 A;  2PVG B;  4LDY A;  2EKH A;  2X9H A;  2QQB A;  1E7O A;  1Q7Y U;  1MHN A;  1WHG A;  1VQL A;  3LH5 A;  1VQP A;  3SWN B;  5LJ5 e;  5LJ3 e;  1JRI A;  4PJO C;  2V26 A;  1KQ1 A;  1PC0 A;  2O4X B;  2QEX Q;  2GTJ A;  3PIO A;  4RG8 A;  2XDB A;  2L3S A;  2CKK A;  3LH0 A;  3M5A A;  4M4Z A;  3PVL A;  1JJ2 S;  2NUP A;  4XTV A;  3S3O A;  2ED1 A;  4HXJ A;  4ZGE B;  3M4Y A;  4J5Y A;  4A4K A;  1CKA A;  2AZS A;  4HVU A;  5AT1 B;  4CC2 A;  2DRK A;  2HMA A;  3PE0 A;  3CME A;  3OYN A;  4QVZ A;  2A7Y A;  4Z89 A;  2R5A A;  1IRX A;  4HVV A;  7AT1 B;  4GBQ A;  4OMP A;  2OTL T;  2R58 A;  3SB2 A;  3CD6 Q;  3JB9 F;  2CUB A;  3OS1 A;  1G2B A;  1RUW A;  1TSF A;  4FCY A;  2M51 A;  1VQ9 A;  3MEA A;  1D1B A;  1WHK A;  1FMK A;  2HSP A;  2DRM A;  4JLI A;  3NTI A;  3JCM d;  4F14 A;  2CP3 A;  2DL7 A;  4TVR A;  4C5G A;  1HSQ A;  5KE3 A;  2FZG B;  1I81 A;  2YHT A;  4BDZ A;  2RQV A;  3CC2 Q;  2X4W A;  1ABO A;  1YP5 A;  5KYX B;  2E4H A;  4HCB A;  4C8Q A;  2QQA A;  1WHH A;  3QKJ A;  3GNG A;  4PJO G;  1CKB A;  3DB3 A;  5GAO l;  4M7A E;  3KXT A;  4ZN3 A;  1N9S A;  5CK9 A;  3VS1 A;  1ZA2 B;  3JCM X;  4F7U A;  2OTJ T;  1G3W A;  1K1Z A;  4AMC A;  4ATO A;  3WVD B;  3VUB A;  1RAB B;  4XTU A;  1O9S A;  1I8F A;  2LQK A;  3ASK A;  5LJ3 d;  4IIO A;  3MPU B;  3V7S A;  4WCI A;  5IT9 E;  5FU6 B;  3M0S A;  2EGC A;  1QVF S;  3I56 Q;  2O01 E;  1YIJ A;  4A4F A;  2V1Q A;  3CC2 T;  4FSX A;  3UAT A;  1KD1 U;  3CPF A;  2LCL A;  1UGV A;  3OSS C;  2Y4X A;  1N6A A;  4FU6 A;  1VQM Q;  1YFN A;  2IVW A;  1B3Q A;  2K9G A;  1WQW A;  2O4X A;  4M77 F;  3JRZ A;  1QVG P;  3E9G A;  2B8A A;  3OBY A;  3HRS A;  4OF1 A;  3TVT A;  2EIF A;  1GBR A;  1OZ3 A;  2M16 A;  2COZ A;  4Y92 A;  1QP2 A;  2JTF A;  1Q81 C;  1IRE B;  4M75 B;  1AZG B;  4QQ6 A;  3C4S A;  2EQM A;  1JJ2 A;  4PK4 A;  5CKD A;  2FZK B;  5GAO p;  2LMJ A;  4XTX A;  2K3Y A;  5CKE A;  3DB4 A;  3PT9 A;  2V8I A;  3OYM A;  1KC8 U;  2DX1 A;  1HXD A;  5CQX A;  1VQL Q;  1WJS A;  1VQP Q;  5IXB A;  1BIA A;  1IXD A;  5ECA A;  1D09 B;  3JCM h;  1VQ8 Q;  3A98 A;  4XAX B;  1VQM T;  4YTL A;  5FRO A;  3VYH B;  2LCC A;  8AT1 B;  1T0H A;  2YRV A;  2VGM A;  2AHJ B;  2MWP A;  3KUF A;  1VQ5 A;  1MND A;  1W70 A;  3ZBD A;  1NYG A;  1KIK A;  2L89 A;  3CCQ T;  5KYX A;  2FO0 A;  2C06 A;  5IAY A;  4DEX A;  3PMI A;  2F1L A;  1AZE A;  3CME Q;  1YJN T;  4M78 B;  3RMQ A;  4BE0 A;  2HQX A;  1RAC B;  3S3N A;  2I2L A;  1OZ2 A;  2I0N A;  1OPK A;  2J6F A;  1M3B A;  3QO3 A;  1YJ9 A;  1IZ6 A;  2QTX A;  1YI2 A;  3HPW A;  2H8H A;  1X75 C;  2LDM A;  4C8Q E;  1VQ9 Q;  2BE9 B;  1YIT A;  2E3H A;  4EPC A;  1PKS A;  2CP7 A;  1Y96 B;  1GRI A;  1NPR A;  2P4R A;  1PNJ A;  2QGF B;  1VQ8 T;  2VAS A;  3CCV T;  1Q7Y R;  4XU1 A;  4F7U E;  1WLP B;  4LD9 K;  3TEE A;  2YUO A;  2AZV A;  2JZ2 A;  4C92 B;  2YWW A;  4ZTF A;  3C12 A;  1IB8 A;  3CQT A;  1OX9 A;  2L2P A;  4C5I A;  4M77 C;  1WDX A;  3TRE A;  1Q82 R;  4M7A D;  1KHI A;  2RI5 A;  3A8M B;  1OU8 A;  2W0Z A;  3WVE B;  1XTD A;  4FYW B;  4JPB W;  4PL6 A;  3PVQ A;  1I5L A;  5FRM A;  2YUP A;  1VQ4 A;  1MV0 B;  3SWN C;  4KUI A;  2KXD A;  1FMW A;  3EG0 A;  3FRN A;  3QJ6 A;  5EG2 A;  1VYT A;  4A4H A;  1N5Z A;  3MP1 A;  4E7H A;  1KFZ A;  3X28 B;  1N27 A;  3REB B;  4D6W A;  5LL6 S;  2RPN A;  3HTR A;  2D1X A;  4BAC A;  4CC4 B;  2P0K A;  5DM7 R;  1VQ9 T;  1JQQ A;  4M75 A;  4IUQ A;  1P92 A;  1ZUU A;  1YIJ Q;  3EFO B;  1X69 A;  3CBO A;  2XU8 A;  3QPH A;  4OMN A;  4CRI A;  2L3Q A;  2OTL A;  5IN1 A;  2LZ6 B;  4LDU A;  2JXB A;  1N8R U;  5GAN j;  4GY5 A;  1QCN A;  2CS7 A;  3SDZ A;  3NGP A;  2KRN A;  2YRD A;  5GAO q;  4KGZ B;  3CXC S;  4CI0 C;  2COW A;  2EBP A;  1H64 1;  1LNX A;  2ROT A;  3HFN A;  4IUP A;  4JS4 A;  4M7D D;  2X51 A;  1X6O A;  4DOV A;  4KH0 B;  1RAH B;  2QXF A;  4HCZ A;  4M77 G;  3T9N A;  2DL5 A;  2PVO B;  2RB6 A;  3C95 A;  3NMZ C;  2EQJ A;  1XQH A;  4AFQ C;  1ZHI A;  4M78 A;  4N0A C;  3P8D A;  3SD4 A;  1JEG A;  2QTV A;  4OB3 B;  1YHQ T;  2GQI A;  3OYA A;  1KD1 C;  1YIJ T;  4AT1 B;  4DBH A;  1UDL A;  2OTJ A;  1ZSZ A;  2SEM A;  2HQE A;  3CCE Q;  1X01 A;  2DMO A;  2KEA A;  1V1C A;  1K9M U;  2EVR A;  3PIP A;  1BBZ A;  5HK3 A;  1EX4 A;  3I35 A;  4PJN A;  2PUK B;  3L2W A;  2VXF A;  2QQ9 A;  2DKG A;  4FYV B;  1KQS P;  5GAN 8;  4E2F B;  1G3Y A;  1E6H A;  1NPP A;  1TUG B;  4M7D B;  2A36 A;  2JTE A;  5CKF A;  1KQS A;  2VUB A;  5FU6 C;  4RCB A;  4C92 A;  1H3Z A;  4E7S A;  1YN8 A;  2LJ1 A;  3EHQ A;  3OYH A;  4IUV A;  4CC3 A;  1VQ5 Q;  2J7I A;  1ZBX A;  1VQK T;  1BK2 A;  1Y7X A;  3CC2 A;  2O2O A;  5FU7 C;  3GIB A;  2RO0 A;  4N4I A;  3EGD B;  2NUT B;  2K79 A;  2YSQ A;  1X43 A;  5C0M A;  2K5L A;  4JJN K;  5CVI A;  1VOM A;  4PNO A;  1WNL A;  1M1G A;  5GJW B;  2DL4 A;  1YJ9 Q;  1IHV A;  3FC3 A;  1NEG A;  2PNI A;  2LX7 A;  4C8Q D;  1YI2 Q;  3CCE T;  2JS0 A;  3GNF B;  4FT4 A;  1RAF B;  3RIR A;  2DO3 A;  2FPD A;  1I5O B;  1YWP A;  1YIT Q;  2HKQ B;  1W2B P;  3FB9 A;  2A3L A;  1QW1 A;  3OW2 P;  1KC8 R;  3UA7 A;  3H0H A;  2FPF A;  1ZUK A;  3M4G A;  3FIF A;  3LX7 A;  5GAN d;  1W2B A;  4FSS A;  1V76 A;  2OAW A;  4Q5W A;  2K57 A;  4CC7 A;  4Z8A A;  2ZPB B;  1QWE A;  4PLI A;  3OS0 A;  1K73 U;  2RA2 A;  1VQ5 T;  3CBM A;  2MAM A;  1VQN T;  1NJI R;  2RJE A;  3QSU A;  4M75 E;  4ELZ C;  1BI1 A;  2K6D A;  3L2Q A;  2AIR B;  3EGU A;  2L8D A;  3A8G B;  1B07 A;  1RAA B;  5L8R E;  3QDF A;  1VQ4 Q;  4FW2 A;  3OYJ A;  1OV3 A;  1TH7 A;  1HYO A;  4BD3 A;  1MV3 A;  4M7A F;  2JM9 A;  2LQW A;  2MYS A;  4J8O A;  1RAG B;  2LVM A;  4OMO A;  1ZQ1 A;  4AFU C;  1YI2 T;  2K2M A;  2RJF A;  1VA7 A;  2EFI A;  1YIT T;  1YWO A;  2CSQ A;  1AT1 B;  2FG0 A;  2GNC A;  2MI6 A;  3CXC A;  3CCQ A;  2DK3 A;  1YBY A;  1C6V X;  2CUD A;  1G3S A;  1R8O B;  4DQ2 A;  2LT1 A;  3GBQ A;  1YJN A;  1OI1 A;  3RR6 A;  1XOV A;  3M0U A;  1WXT A;  2CP5 A;  2P4T A;  2CH4 A;  2ZPI B;  4BUG A;  5LJ5 j;  5GAM j;  3L42 A;  4F17 A;  2OTL Q;  4HT9 A;  1WA7 A;  2V1R A;  1UGS B;  2F69 A;  4QW2 A;  1BYM A;  4O6J A;  5A0L A;  4M78 E;  1U06 A;  1R0B G;  4QQD A;  2HL3 A;  5GAM e;  4BB7 A;  4M7D A;  1SHF A;  1G5V A;  5FRN A;  1PSF A;  1VQ4 T;  3CCV A;  1QVG S;  1VQ8 A;  2FZC B;  1UJY A;  2GBQ A;  2FRW A;  1NM7 A;  1TOV A;  1Y0M A;  1BCM A;  2C0I A;  2FRY A;  2AKK A;  1A0N B;  1XNI A;  2KYM A;  4RKU E;  1W6X A;  2F5T X;  1WXU A;  2EYX A;  3EHR A;  4MMK A;  4NS5 A;  1PSE A;  4HT8 A;  1G3T A;  3UDC A;  3EGD A;  4QKU A;  2NUT A;  1X6G A;  3MP6 A;  5CR2 A;  1RAE B;  4C92 E;  2DF6 A;  2OTJ Q;  1ABQ A;  3CMA A;  1DJ7 B;  3MO8 A;  2SRC A;  1N8R C;  3C0C A;  1QCF A;  4PJL A;  2KRM A;  3CCU T;  4A4G A;  2D6F A;  3CC7 A;  4JJD A;  3I5S A;  5KYW B;  2DL8 A;  1GCQ A;  4BY6 C;  3OYL A;  1K8A U;  3LLR A;  4XTZ A;  2FEI A;  5GAN h;  2HCK A;  3NHN A;  4JJC A;  2DXU A;  2YXY A;  2HDA A;  3OYD A;  1ARK A;  2VKN A;  1QMC A;  2RM4 A;  4FT2 A;  2GTO A;  1TUD A;  3QWY A;  8ATC B;  2DM1 A;  1NEB A;  1GBQ A;  3JCM f;  1UE9 A;  2OAU A;  3VRZ A;  3SFM A;  3M57 A;  4M7A C;  2DL3 A;  2DXC A;  1RL2 A;  1WFW A;  3QII A;  1I1J A;  1UJ0 A;  4Z02 A;  5FLX E;  3OYC A;  2E1H A;  1WIE A;  2EYY A;  1K9M C;  4A4E A;  2QDY B;  5GAN 7;  5FWC A;  5GMK j;  3P8H A;  4AG2 C;  3GOX A;  4Z88 A;  1LJO A;  5KH6 A;  1UG1 A;  5LJ5 d;  5GAM d;  4KBM B;  1M4Z A;  1RI9 A;  3OS5 A;  5GMK e;  1YCS B;  5LJ3 f;  3TSW A;  5GMK l;  4EMK B;  4C8Q F;  1WYX A;  3S3M A;  4B6M A;  2GQV A;  1U8R A;  2RJD A;  4F7U F;  1U1T A;  3DLL A;  1YHQ A;  1Y71 A;  4A63 B;  2RK2 A;  2CH4 W;  2FYK A;  4M75 D;  1OUL A;  1Z9Q A;  4C0F A;  1Q86 C;  4IUR A;  4J9G A;  2E65 A;  3H8Z A;  4JLG A;  2XDP A;  3QJY A;  2XHC A;  2LNV A;  4E7Z A;  1IO6 A;  4E6R A;  1KJW A;  3BDU A;  1KHC A;  5I22 A;  2PU9 B;  2VC8 A;  3EFS A;  2PZ1 A;  3MEW A;  2VXE A;  2OJ2 A;  1CSK A;  2EGE A;  1PHT A;  4EDU A;  2F5K A;  2EYW A;  2GFA A;  3VV0 A;  1D0Z A;  1QWF A;  3HRT A;  1PCX A;  3OYK A;  3AT1 B;  2DFU A;  4M7A G;  1QVG A;  1VQK A;  1SSH A;  4LUD A;  1FX7 A;  3QHS A;  4K11 A;  3VS7 A;  5DLQ E;  3CCQ Q;  1LPL A;  3V8J A;  4M7D E;  2LCS A;  5I2M A;  1AWO A;  4VUB A;  3X26 B;  3FLG A;  2E6N A;  4KGV B;  1YJN Q;  5IH2 A;  1K73 C;  4MDW A;  2LJ0 A;  3G1J A;  4E7J A;  1JO8 A;  3JCM P;  3UPU A;  3IQL A;  4HCK A;  1PG5 B;  4J9H A;  1X27 A;  1AWX A;  5CO7 A;  2DER A;  1Q81 R;  3E9F A;  3M58 A;  2FVU A;  2MOX A;  3KFV A;  5KYW A;  3G6E A;  3CCE A;  1F1B B;  4M78 D;  4PFZ A;  1UEB A;  4L5G A;  5HKC A;  2ZPE B;  2E5Q A;  3PFS A;  1PWT A;  1M30 A;  1VIF A;  3L2R A;  3JB9 H;  3L1A A;  3CCV Q;  2LQ8 A;  2DXT A;  2Y90 A;  2KXC A;  3E19 A;  3SHW A;  2EKO A;  2M0Y A;  2CT3 A;  4R56 A;  3EAE A;  2A37 A;  3EG1 A;  4BI4 A;  1Y57 A;  2EPD A;  4XU3 A;  3A8O B;  4ME7 A;  3VS0 A;  2K3X A;  3MJX A;  3RER A;  2KSS A;  1VQN A;  3QYH B;  1WQ7 A;  1WPY A;  1SHG A;  4C92 D;  2K5I A;  4MDX A;  3RKX A;  2DEQ A;  2GCX A;  2KMT A;  3RUX A;  3CMA Q;  2PTK A;  1VQ6 T;  4C8Q C;  3G71 A;  1RI0 A;  1ACM B;  2RF0 A;  3L2Z A;  1BU1 A;  2HL5 C;  5LJ5 h;  1ZSZ B;  5LJ3 h;  3CC7 Q;  2DBM A;  1XJW B;  2MF2 A;  5CKB A;  1KQS S;  5CKH A;  2A28 A;  2KYB A;  3INZ A;  1NLO C;  1MUZ A;  1X6B A;  1Y07 A;  4P5N A;  4EMK A;  2QQR A;  1SRM A;  3JB9 G;  4FYX B;  3JCM b;  3A5Z B;  2ROL A;  4N4G A;  2PVD B;  3L2U A;  4KUD K;  2J06 A;  3M59 A;  1HK9 A;  3GLX A;  2R57 A;  1GFC A;  2M02 A;  2QDL A;  2D8J A;  3OS2 A;  2X3X D;  3OQ5 A;  5GAO r;  3H6Z A;  1Q95 G;  1BI3 A;  3ZL7 C;  3CMA T;  3LW5 E;  1YJW A;  3MEV A;  5D6Y A;  3CCL A;  3U23 A;  2RH2 A;  1K8A C;  2QYZ A;  3CC7 T;  3JCM g;  1W2B S;  2E10 A;  1VYU A;  3EGX B;  3ULR B;  3V8L A;  3OW2 S;  2YRC A;  2C0T A;  1AHJ B;  4R55 A;  3EH1 A;  1M90 C; 
#chains in the Genus database with same CATH homology
 2A7Y A;  2CGH A;  2R5A A;  3BDL A;  2PQW A;  1M5Q 1;  3FB9 A;  2A3L A;  1S72 T;  1QW1 A;  1O75 A;  1D3B A;  4C8Q G;  3LYI A;  2BKD N;  1K8A U;  2OTL T;  2R58 A;  3SB2 A;  4ZGJ B;  5A2Q E;  4BE1 A;  3M4G A;  3JB9 F;  3FIF A;  1UGQ B;  3EFR A;  3HHT B;  3LX7 A;  2LX9 A;  1VUB A;  4A54 A;  5GAN d;  3JCM V;  3OS1 A;  4XU2 A;  3I56 T;  3CCU A;  1W2B A;  4RG2 A;  4F7U G;  4N4H A;  4RCC A;  3OYN A;  4Q5W A;  3G7Z A;  1VQ9 A;  2K57 A;  3MEA A;  4M7D E;  3MEU A;  4M75 F;  2ZPB B;  1SSF A;  3Q1J A;  4PLI A;  3OS0 A;  1K73 U;  4OB0 B;  5LJ3 g;  4OMF B;  2RA2 A;  1VQ5 T;  2CZ6 B;  3CBM A;  2MAM A;  4C0D B;  4JLI A;  1VQN T;  3NTI A;  3JCM d;  3WXM B;  2RJE A;  3QSU A;  4BDY A;  4M75 E;  4ELZ C;  1BI1 A;  3ZFJ A;  3L2Q A;  3ER0 A;  4TVR A;  4C5G A;  5KE3 A;  2L8D A;  3CCS T;  3A8G B;  1I81 A;  5L8R E;  2YHT A;  4BDZ A;  2XIC A;  3OYY A;  3OYJ A;  4QVC A;  4PJO D;  2X4W A;  1TH7 A;  2KAF A;  5J39 A;  3JSC A;  4BD3 A;  3VJP A;  4M7A F;  5J3B A;  1NJI U;  3QG1 A;  1VQO T;  4J8O A;  3RKY A;  3PGG A;  4HCB A;  4C8Q A;  2QQA A;  2LVM A;  4FIB A;  3OYB A;  3CCJ A;  3QKJ A;  2XD0 A;  3HL8 A;  1ZQ1 A;  4M7D G;  3GNG A;  4XTW A;  5I21 A;  4PJO G;  5GAM h;  5A0D A;  3DLM A;  3DB3 A;  4OVA A;  2LTO A;  2VV5 A;  5GAO l;  3KXT A;  1YI2 T;  4M7A E;  3HRU A;  1N9S A;  4ZN3 A;  5CK9 A;  4N0A A;  1VQ6 A;  3JCM X;  2RJF A;  4F7U A;  2OTJ T;  1G3W A;  1WJR A;  4FM4 B;  2EFI A;  5DY9 A;  3OYF A;  3AHU A;  4ATO A;  1YIT T;  2ZGW A;  2EAY A;  2R5M A;  3WVD B;  3CCQ A;  2MI6 A;  3VUB A;  3CXC A;  4XTU A;  2DK3 A;  1YBY A;  3VYG A;  1UB4 A;  1G3S A;  1R8O B;  2MMP A;  3URG A;  1VQ7 A;  2Y4Y A;  4DQ2 A;  2LT1 A;  1O9S A;  3FJP A;  5CIU A;  1I8F A;  2LQK A;  3ASK A;  3TU4 K;  5LJ3 d;  1YJN A;  1OI1 A;  3J81 E;  1XOV A;  3OW2 A;  1FXX A;  1UGR B;  3LWH A;  3KBG A;  3V7S A;  1Q7Y C;  4V2S A;  3G4S A;  4WF2 A;  4J83 A;  2P4T A;  2QA4 A;  2ZPI B;  2QI2 A;  3I55 T;  4BUG A;  5IT9 E;  5LJ5 j;  2LT4 A;  3L42 A;  5FU6 B;  5GAM j;  4PKC C;  2JNG A;  4HT9 A;  1QVF S;  2LC4 A;  4M78 F;  2EYQ A;  1QP3 A;  1UGS B;  3OB9 A;  4PJO B;  2GF7 A;  2F69 A;  4QW2 A;  3OMC A;  1VQL T;  3OSV A;  1VQP T;  2O01 E;  4C0Z A;  2DAQ A;  1YIJ A;  1BYM A;  4O6J A;  4A4F A;  5A0L A;  1I4K 1;  4M78 E;  3NFC A;  2FB7 A;  4II1 A;  4QQD A;  5KCH A;  5GAM e;  2X4Y A;  5CQY A;  4BB7 A;  1Q82 C;  1M1K U;  1B34 B;  4M7D A;  3OA6 A;  4PJO A;  1G5V A;  2BUD A;  4FSX A;  3CC2 T;  5FRN A;  1PSF A;  2JOY A;  3CCV A;  1VQ4 T;  1QVG S;  1KD1 U;  3CPF A;  1VQ8 A;  2LCL A;  2X4X A;  3OSS C;  1UGP B;  4OB2 B;  3LWI A;  2EWN A;  3V7R A;  4RMO A;  3NTH A;  2YLB A;  3ZEH A;  2Y4X A;  3CC4 A;  5C6S A;  1N6A A;  2DXB A;  4FU6 A;  1Q86 U;  2P0P A;  4C5H A;  3VKI A;  2IVW A;  2P0Q A;  2RHX A;  4FL6 A;  2G3R A;  1QVF A;  1XNI A;  4RKU E;  5GAO m;  5DLO A;  1WQW A;  2O4X A;  3DKM A;  4M77 F;  3JRZ A;  2F5T X;  3A8L B;  3BY7 A;  2V8K A;  4MMK A;  3E9G A;  2KQW A;  1PSE A;  2B8A A;  1G3T A;  2HBP A;  4NS5 A;  2YLC A;  3UDC A;  4C92 F;  4HT8 A;  2M1H A;  3CME T;  3CCR A;  3OBY A;  3MET A;  3HRS A;  3MP6 A;  4M77 E;  4OF1 A;  4EMG A;  5CR2 A;  3G6E T;  2EIF A;  1OZ3 A;  2M16 A;  4C92 E;  4ELY C;  2XK0 A;  1QP2 A;  2JTF A;  1Q81 C;  1EIF A;  1DJ7 B;  3MO8 A;  3CMA A;  1IRE B;  1N9R A;  4MZP A;  4BY6 B;  1BIB A;  4M75 B;  1N8R C;  4QVD A;  1FWZ A;  2DTH A;  3CCU T;  4A4G A;  2D6F A;  3OBW A;  4QQ6 A;  3C4S A;  3CC7 A;  2EQM A;  1JJ2 A;  5CKD A;  5GAO p;  2DD4 A;  4XTX A;  3X25 B;  2K3Y A;  4BY6 C;  5GAN 3;  5GAN 5;  5CKE A;  3JCM W;  3OYL A;  4M75 C;  3LLR A;  2HD0 A;  4MML A;  2XI9 A;  3DB4 A;  3PT9 A;  2E70 A;  4XTZ A;  5GAN f;  3E1S A;  5GAN h;  3CPW S;  2IG0 A;  2V8I A;  2X4J A;  2DXU A;  2V8J A;  3OYM A;  1QVP A;  5LJ5 g;  5GAM g;  3OYD A;  1KC8 U;  5CAI A;  4X9C A;  1HXD A;  3PMT A;  5GAO n;  1BI2 A;  4M7A B;  5KCO A;  4IUU A;  5CQX A;  1WJS A;  3X20 B;  3CCM A;  2BIV A;  2RM4 A;  2KDS A;  3BFM A;  4FT2 A;  1BIA A;  2DTO A;  2DTI A;  4L6V 5;  2E6Z A;  3JCM f;  3JCM h;  5GMK h;  2L3R A;  4XAX B;  2OAU A;  1VQM T;  3SFM A;  4GLK A;  4YTL A;  2DZ9 A;  4IKF A;  5FRO A;  3M57 A;  4M7A C;  4LDV A;  3VYH B;  3QUI A;  4XU0 A;  2DXC A;  3G71 T;  2LCC A;  4PLL A;  1RL2 A;  2RHI A;  2YRV A;  3OY9 A;  3QII A;  5FLX E;  4Z02 A;  2VGM A;  2AHJ B;  4Y91 A;  3OYC A;  2MWP A;  4E7I A;  3RES A;  3KUF A;  1VQ5 A;  2CZ0 B;  3V7C A;  4B9X A;  2E1H A;  2RJC A;  1K9M C;  4M77 D;  4A4E A;  3ZBD A;  3UWN A;  2L89 A;  2QDY B;  5GAN 7;  2DJZ A;  4JRK A;  5GAN e;  2DZC A;  3GPL A;  2QEX A;  3CCQ T;  5IAY A;  2C06 A;  3PMI A;  1VQ7 T;  5GMK j;  2RD1 A;  3CCS A;  3HFO A;  1YCY A;  3P8H A;  4M78 B;  3RMQ A;  4BE0 A;  1YJN T;  1BKB A;  2HQX A;  3JCM Q;  3M53 A;  3GOX A;  3R6O A;  3S3N A;  2EQK A;  1LJO A;  2I2L A;  2X35 A;  1OZ2 A;  3TCJ A;  5KH6 A;  5LJ5 d;  5GAM d;  2FL7 A;  2QA4 T;  2VGN A;  4KBM B;  5AYF A;  1M4Z A;  2MWO A;  3QO3 A;  4OGC A;  3OS5 A;  5GMK e;  2KVQ G;  5LJ3 f;  3JCM e;  2JTM A;  5GMK l;  1YJ9 A;  2DPP B;  4XQ3 A;  4EMK B;  4M78 C;  1WJQ A;  4BI8 B;  1IZ6 A;  4C8Q F;  2QTX A;  3QDR B;  1V29 B;  4BI3 A;  1MGQ A;  2M0O A;  3GF5 A;  5GAN 6;  3JB9 D;  2E64 A;  3OYG A;  1YI2 A;  3S3M A;  4C5E A;  1W4S A;  3HPW A;  2GQV A;  2RK1 A;  1U8R A;  2WSF E;  1X75 C;  2LDM A;  4C8Q E;  2RJD A;  4F7U F;  1U1T A;  3DLL A;  1YIT A;  5GAN 4;  1Y71 A;  1YHQ A;  4EPC A;  4EMK C;  3F70 A;  4JRP A;  2LRQ A;  1Y96 B;  2RK2 A;  4Y28 E;  4HCC A;  2FYK A;  1NPR A;  2WSC E;  4M75 D;  5HK0 A;  3HSB A;  4C0F A;  1Q86 C;  2RHU A;  3CCV T;  1VQ8 T;  4XU1 A;  4HA8 A;  4EMH A;  4IUR A;  4F7U E;  3J80 E;  4LD9 K;  1WGS A;  3CD6 A;  3TEE A;  1KQ2 A;  2E65 A;  3H8Z A;  4M77 B;  2QQS A;  3X24 B;  2DVE A;  2JZ2 A;  1NZ9 A;  1YJW T;  4C92 B;  3CC4 T;  1Y96 A;  3VUZ A;  4JLG A;  3CCL T;  3OYE A;  4ZTF A;  4M75 G;  2XDP A;  3QJY A;  3C12 A;  4JUV A;  4DA4 A;  2XHC A;  3ME9 A;  4JDS A;  2LNV A;  4MZM A;  1B34 A;  4L59 A;  3JB9 I;  4C5I A;  5KE2 A;  4M77 C;  5M9O A;  3BDU A;  2DD5 A;  1U1S A;  4LD6 A;  2DIQ A;  1KHC A;  3TRE A;  4C92 C;  2PU9 B;  2VC8 A;  3EFS A;  3MEW A;  4ZGD B;  4M7A D;  1KHI A;  2RI5 A;  5D6W A;  2EQU A;  2VXE A;  3A8M B;  3CCR T;  3QZ5 B;  2XKO C;  3WVE B;  1XTD A;  4EDU A;  2F5K A;  2GFA A;  2WSE E;  3VV0 A;  4JRQ A;  4PL6 A;  3P8B B;  4M7D F;  3M56 A;  1I5L A;  3HRT A;  4PJO F;  5FRM A;  1M8V A;  1VQ4 A;  3OYK A;  5D6X A;  4KUL A;  3SWN C;  4KUI A;  4M7A G;  1QVG A;  1VQK A;  1FX7 A;  3QHS A;  4JRI A;  3FRN A;  3QJ6 A;  5DLQ E;  5EG2 A;  4OB1 B;  3V8J A;  3OMG A;  4A4H A;  5I2S A;  3MP1 A;  5I2M A;  4VUB A;  4J7F A;  3X26 B;  4E7H A;  1Q82 U;  1LOJ A;  4B9W A;  3FLG A;  4PJO E;  2E41 A;  3X28 B;  1N27 A;  2E6N A;  5GMK m;  4D6W A;  3MHX A;  4IUT A;  5LL6 S;  2NLU A;  4DOW A;  4HKE A;  2CZ7 B;  4LDW A;  4MDW A;  1K73 C;  2EJF A;  1KC8 C;  2KK4 A;  3FEO A;  3L2V A;  4E7J A;  4J6X A;  4BAC A;  2P0K A;  4X9D A;  2WAC A;  4NL2 A;  5DM7 R;  3UPU A;  2EJ9 A;  3JCM P;  3BW1 A;  1VQ9 T;  4NOY A;  3J7A F;  1GXI E;  2GFU A;  2K2V A;  4M75 A;  2RI3 A;  1D3B B;  1JBM A;  4IUQ A;  3S6W A;  4E47 A;  1BI0 A;  5CO7 A;  4LDX A;  3E9F A;  3M58 A;  2FVU A;  4C0G A;  4XK8 E;  2KY9 A;  5CCA A;  3G6E A;  1P92 A;  3CCE A;  4M78 D;  5GMK i;  3CCM T;  1UEB A;  4L5G A;  4O5V A;  2ZPE B;  5HKC A;  2K4Y A;  2E5Q A;  3PFS A;  4BE2 A;  3CBO A;  4OGE A;  2XU8 A;  1VIF A;  1M90 U;  3QPH A;  2M9U A;  3L2R A;  1NJI C;  2E12 A;  3JB9 H;  3L1A A;  4CRI A;  1S72 A;  3UT1 A;  4M78 G;  3MCA B;  2OTL A;  1KG1 A;  1OYX A;  2DXT A;  2LQ8 A;  2Y90 A;  3E19 A;  3M55 A;  5IN1 A;  1Q81 U;  3C94 A;  2EKO A;  4M7A A;  4LDU A;  3I56 A;  4R56 A;  4OP0 A;  1N8R U;  3CBP A;  3EAE A;  5GAN j;  2JN0 A;  3FDR A;  3CCJ T;  4BI4 A;  3JB9 J;  3CPW A;  3V8K A;  2ZPG B;  4ZTJ A;  4GY5 A;  2CS7 A;  3VU3 C;  2CZ1 B;  4XU3 A;  3SDZ A;  2QEX T;  3A8O B;  1M1F A;  2K5F A;  4ME7 A;  5GAO q;  4E7K A;  2K3X A;  3RER A;  2KSS A;  1VQN A;  3QYH B;  2RHZ A;  1WQ7 A;  1WPY A;  3CXC S;  4CI0 C;  4C92 D;  4C8Q B;  2XID A;  1H64 1;  1LNX A;  4IUP A;  3HFN A;  4C0D C;  5HY6 A;  2K5I A;  4MDX A;  4JS4 A;  4M7D D;  1X6O A;  4DOV A;  1VQM A;  2FHD A;  2QXF A;  4HCZ A;  3RKX A;  3JCM J;  2DEQ A;  2GCX A;  2KMT A;  3RUX A;  4M77 G;  4F7U B;  3T9N A;  2ZPF B;  1YJ9 T;  1VQ6 T;  3G4S T;  4C92 G;  4C8Q C;  2PVO B;  3G71 A;  2RB6 A;  3C95 A;  3HKS A;  2HAX A;  4A53 A;  1RI0 A;  2VYT A;  3L2Z A;  1VQO A;  5GAM f;  1JB0 E;  1VIE A;  2EQJ A;  1XQH A;  5LJ5 f;  5LJ3 h;  5LJ5 h;  2D9T A;  2ZCF B;  1ZHI A;  4M78 A;  4N0A C;  5GAN 2;  3P8D A;  4JS5 A;  3SD4 A;  3GP8 A;  3QXE B;  4J6W A;  2JVV A;  2MF2 A;  4OB3 B;  3QZ9 B;  1M1K C;  5CKB A;  2H3J A;  1KQS S;  2XDD A;  1YHQ T;  3A8H B;  5CKH A;  4XTY A;  3JAM E;  3OYA A;  1YIJ T;  3LGF A;  1KD1 C;  2RHY A;  3INZ A;  2OTJ A;  4X34 A;  5A0G A;  5J26 A;  1Y07 A;  4P5N A;  4QQG A;  4EMK A;  2JUF A;  2D0Q B;  2HQE A;  3QBY A;  2QQR A;  1X01 A;  3CD6 T;  4E7L A;  3JB9 G;  1K9M U;  3N5B B;  4NL3 A;  3JCM b;  4UC4 A;  3A5Z B;  3PIP A;  5HK3 A;  2PUK B;  3PTA A;  3L2W A;  2CYZ B;  2VXF A;  3QYG B;  2QQ9 A;  4N4G A;  2DKG A;  2PVD B;  5GAN 8;  3M54 A;  5LJ3 j;  2PUO B;  1G3Y A;  4ZN1 A;  3L2U A;  4KUD K;  1NPP A;  4MZT A;  4KT0 E;  1NE8 A;  2PVG B;  4M7D B;  2RI2 A;  3I55 A;  3M59 A;  1HK9 A;  3GLX A;  4LDY A;  5CKF A;  3LGL A;  3OYI A;  2QQB A;  4M77 A;  1KQS A;  1Q7Y U;  1MHN A;  2R57 A;  1VQL A;  2VUB A;  4J6Y A;  4RCB A;  2DIG A;  5FU6 C;  5FU7 B;  2ZPH B;  4C92 A;  3SWN B;  1VQP A;  1H3Z A;  5LJ5 e;  2EJG A;  3OYH A;  4IUV A;  5LJ3 e;  4M7D C;  1JRI A;  4PJO C;  3OS2 A;  3OQ5 A;  2XG8 D;  3O8V A;  5GAN g;  4J7I A;  5GAO r;  1KQ1 A;  1ZBX A;  1VQK T;  3H6Z A;  3JCM c;  1Y7X A;  3CC2 A;  2O4X B;  1BI3 A;  3PIO A;  3PNW C;  3M9Q A;  4RG8 A;  5FU7 C;  3CMA T;  2XDB A;  2HNI A;  3SWN A;  2CKK A;  3LH0 A;  3LW5 E;  1YJW A;  3GIB A;  3MEV A;  5D6Y A;  3M5A A;  3CCL A;  2RH2 A;  2RO0 A;  1K8A C;  4N4I A;  1JJ2 S;  4XTV A;  3S3O A;  3CC7 T;  2ZZD A;  4ZGE B;  3JCM g;  1W2B S;  2E10 A;  3M4Y A;  2K5L A;  4J5Y A;  4A4K A;  5C0M A;  4JJN K;  5CVI A;  3V8L A;  4PNO A;  3OW2 S;  1WNL A;  3CEY A;  1M1G A;  3RKW A;  3NTK A;  1AHJ B;  3RMS A;  4R55 A;  3FC3 A;  1M9S A;  3MP8 A;  1M90 C;  2L5Q A;  3HP9 A;  4C8Q D;  3CCE T;  3GNF B;  3CME A;  4FT4 A;  3RIR A;  2DO3 A;  4QVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...