4M77G

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77G00
2DKGA 3RERA 4XQ3A 4JUVA 5GANh 2DJZA 1D3BB 3V8JA 4C8QC 5GAMj 4PNOA 5GAMf 3RUXA 3JB9J 5LJ3h 3BW1A 4RCBA 5GAN7 1LNXA 1KQ1A 4F7UA 4QVCA 4M78C 3L2ZA 4J6WA 2DEQA 4XTUA 4C92A 4M7AG 4M7AF 1Y96A 2JN0A 4M7DA 4M75C 4HA8A 4M7AD 2E41A 2E64A 2EAYA 4Y91A 4XU0A 1HK9A 1X01A 3SWNC 5LJ3g 3JCMX 2E1HA 3BFMA 2DTIA 3JCMb 1I8FA 4OP0A 4C8QA 4NL3A 5CAIA 4HT8A 4RCCA 4A54A 4EMKC 4F7UG 4F7UF 4C92G 3JB9I 4PJOE 1B34A 3SWNB 4C92F 3JCMe 4M78A 4M7DG 2DXTA 3AHUA 4F7UE 5GAMh 3V7CA 4M7DF 4C92D 2EJFA 5LJ5j 3BDUA 5GANe 5LJ5f 2YHTA 4M75A 4EMKB 4M7DD 3JCMd 4M7DE 1I81A 3JCMW 4X9DA 3SWNA 4C8QG 5LJ3e 4C8QF 4JRKA 5GANd 1MGQA 4C8QD 1WPYA 2YLCA 4QVDA 4EMKA 3JCMg 5LJ3d 2FYKA 1D3BA 1U1TA 4M78F 3FJPA 4M77C 5GAN6 1LJOA 4M78D 4M75G 5GANg 4M75F 1I5LA 3HFNA 4J5YA 4M7AE 3RIRA 3JCMP 4M75D 4M7DC 1H641 3V8KA 2DTHA 4M77B 2ZGWA 4HT9A 5LJ5h 3HSBA 3QUIA 1HXDA 4JLIA 4PJOB 4J6XA 5GMKj 2E65A 5GAMe 3JCMQ 3L1AA 2EWNA 1BIAA 1LOJA 5GAOq 4M77A 3GIBA 2Y90A 4C92E 3QSUA 5GAMd 4XU3A 5GMKm 5LJ5g 4M7AA 3JCMc 1N9RA 3QHSA 3RESA 4A53A 3JB9G 3PGGA 2HNIA 3JB9F 2K57A 4C8QE 3QO3A 2CGHA 2E10A 1WNLA 4M78G 5GAMg 3JB9D 3V7SA 5GAOr 4M77F 4XU1A 5GMKl 4WF2A 2YLBA 4M78E 4XTYA 5GAN4 1JRIA 4M7AB 1WQWA 4MMLA 4PJOC 3RKXA 3SB2A 4XTZA 5GMKh 5DY9A 4NOYA 4N0AC 4M75E 5LJ5e 1TH7A 1JBMA 1U1SA 5I21A 5GMKi 1KQ2A 4XTWA 1M5Q1 1N9SA 2EJGA 4V2SA 4JRIA 2I2LA 1I4K1 5LJ5d 4F7UB 4EMGA 2RA2A 5GAN8 5GAN5 3M4GA 3EFSA 2DXUA 4C92B 4XTVA 1YCYA 3HFOA 1Y96B 2FB7A 3JCMf 5GAN3 4M7DB 4PJOA 4XU2A 1WQ7A 5GANj 3BY7A 5GANf 3V7RA 3JB9H 3RKWA 4N0AA 3RKYA 3V8LA 2VXFA 3INZA 4XTXA 4C8QB 3JCMJ 2DZ9A 5LJ3j 4M7AC 5LJ3f 4EMHA 3FIFA 5GAOm 1BIBA 3EFRA 4J6YA 3FB9A 2EJ9A 4M77G 4NL2A 2QTXA 3VU3C 5GAOn 1B34B 4M78B 2DVEA 2RM4A 5GAOp 2DZCA 4PJOG 4M77D 5GMKe 4PJOF 4M77E 4DQ2A 4X9CA 2DTOA 2RD1A 4M75B 4PJOD 4MMKA 5GAOl 4C92C 5GAN2 1M8VA 3JCMV 3JCMh 2RB6A 2VXEA 2VC8A
chains in the Genus database with same CATH superfamily
2K7AA 3GNFB 2JMAA 2FPEA 3F70A 2RI2A 3QDFA 4J9FA 1LNXA 4QQ6A 2ZPBB 4XTUA 3AT1B 2QTVA 3SDZA 2GNCA 3C0CA 2CP6A 2R58A 3O5ZA 1X01A 5DM7R 1Z9ZA 2E6ZA 4O6JA 5I22A 2GCXA 2ESWA 3LWIA 3JRZA 4K11A 3G4ST 2HAXA 1ZUYA 2AZVA 4ORZA 2LJ3A 1NZ9A 1T0HA 2E5KA 3VUBA 1KQSS 5FRNA 4M7DD 3CBOA 5FU7B 2LMJA 2DK3A 2BE7D 2CYZB 3QXEB 2O4XB 2V8IA 2DXCA 2RJEA 3VS4A 2QYZA 4OB0B 4M75F 4J5YA 3CCRA 1VQ6Q 3PIOA 2DTHA 2YUPA 1M9SA 3I55Q 4LXCA 1J3TA 1BIAA 3GIBA 1NJIR 2QQRA 2MIOA 4GY5A 2M51A 2HDAA 5KYWA 4A4KA 2K3BA 4WF2A 1M30A 2ATCB 3OS5A 2RMOA 1AZGB 1PSFA 3CMAT 1VQLQ 2O88A 4M75E 1O9SA 4BDZA 1KQ2A 1GXIE 3EG3A 4R0KA 4V2SA 4FCYA 4BACA 2J6FA 2XU8A 1BKBA 1GCPA 4PJOA 4XU2A 2DJQA 5KYUA 1M8MA 1AWWA 1VQMA 4E47A 3HKSA 3M0QA 2FVUA 2LT1A 2NUPB 3MHXA 3OA6A 3BE3A 4UC4A 1MV0B 1U5SA 2KRMA 2WSCE 3UT1A 2RHIA 4X9CA 1HYOA 5GAOl 5A0DA 1Q81R 2ZAEA 1OZ2A 2KGTA 2QQ9A 1M2OA 3CC4Q 2OTJA 1TXQA 3REAB 2DYIA 1Q7YC 1PNJA 5GAN7 5IH2A 1OV3A 2BTTA 4FYVB 3DLLA 3L2ZA 3KBGA 3OYBA 3M5AA 1V1CA 3CPFA 2XDBA 1HK9A 3JCMX 2L5QA 1WJRA 2YSQA 1Y71A 4MZMA 4M78A 3G4SQ 3AHUA 2EJFA 2GQVA 1YN8A 4ELZC 1I81A 3JCMd 4LDXA 4X9DA 3LYIA 1I0CA 3NPFA 1MNDA 4BI8B 3CCEA 1AWJA 4M75G 1IO6A 1LPLA 1G3YA 4LE9A 4AMCA 1XNIA 1G5VA 2A28A 5IHNA 4KUDK 2C0TA 4JLIA 1OU9A 3X26B 2LQNA 1K73C 3WVDB 4B9XA 2L2PA 3E19A 2LT4A 2YXYA 1MV3A 3CCRT 5GMKl 3QKJA 4XTYA 5GJWB 4QKUA 4NOYA 2ZPIB 1M90R 2EYZA 1JBMA 3CMAQ 4DBFA 3M4GA 2XDPA 2GF7A 5GAN3 1M3CA 2XKOC 1T0JA 3PT9A 4E2FB 5GANf 1G83A 5J26A 1WHJA 3OYAA 3V8LA 2VXFA 2DZ9A 1VYVA 4OMPA 5CR2A 2VVKA 4RTXA 2LRQA 1GBRA 1KQSP 1D0ZA 1QVGA 2PQWA 1NG2A 2M0YA 3I9QA 4D8DA 4OB2B 5GANh 3H0IA 2CZ7B 4PJMA 1VQMT 3JAME 2QQBA 4Y92A 1UE9A 4C5IA 5KYNA 2FEIA 4OF1A 4M75C 1YNZA 3SWNC 3HRTA 1YWPA 4C0ZA 1NM7A 2H3JA 3A8OB 4NL3A 4RCCA 2OTJT 1JU5C 1H3ZA 1AEYA 5KYWB 3I5SA 1UEBA 4II1A 3MEAA 4PFZA 3UPUA 4LN2A 4N4HA 3CXCS 1KIKA 4PJLA 2A37A 2ED1A 2K2MA 4OMOA 1PC0A 1H8KA 1BI2A 4IIOA 1D3BA 3TCJA 3OYNA 2XK0A 5FW9A 5GANg 2JUFA 4OMNA 4M75D 3OB9A 3MEVA 5KE2A 2LQ8A 3CCJA 4E7SA 1WLPB 6AT1B 4PJOB 4KGXB 3PE0A 2G6FX 4GLMA 2MWOA 5GMKj 1AWXA 2FG0A 3JSCA 3JCMQ 2KSSA 5KYUB 3QSUA 3CCET 2LVMA 1YJWQ 1QCFA 3OYDA 5CIUA 4JS4A 3CCRQ 2BZYA 1ZSGA 4IIMA 4BE1A 5GAN4 1AOJA 3TSZA 4HKEA 2K6DA 1N9SA 1S72A 4OVAA 5IHIA 2JVVA 1TS9A 2F5TX 5GJVB 3H0FA 1YI2A 4GBQA 4HCKA 1BCOA 2CP0A 2DILA 4EPCA 4E7HA 2MI6A 1Z9QA 2KDSA 4PLLA 1VQ4A 3CCLA 2CREA 2P84A 4RMOA 4M78B 4PJOF 2RHYA 1TOVA 3E9FA 4PFPA 4M7AA 1H92A 3O8VA 4JUVA 2DAQA 3M57A 1Y7XA 1RLPC 4PNOA 2PTKA 3RMSA 2LCSA 1VQMQ 2AHJB 1AD5A 1EFNA 1Y96A 1BYMA 3VRZA 1KJWA 1S1NA 2EAYA 4C5GA 5C0MA 3OW2A 2EQJA 1O75A 4PJOE 4BE0A 2OTJQ 2YWWA 2H3EB 5LJ5j 3A8MB 3OYCA 2V26A 2RH2A 1QVFP 1GRIA 2CS7A 1SHFA 2DD5A 2YRVA 5HCKA 1WXTA 4AFUC 2H8HA 4M78F 1LJOA 2QQAA 1M90U 2HZYA 1MMDA 3V8KA 3OYJA 2IG0A 5D7UA 2ZPGB 3L1AA 2D0QB 2RO0A 4E7KA 4OMLA 1H3HA 3FLGA 2GFUA 2KMTA 4HVVA 1SHGA 3CCEQ 2QEXA 1N8RR 2D8HA 3JV3A 1OEBA 3NTIA 1RI9A 3CCJT 4VUBA 2X35A 3MO8A 4M78E 2XD0A 4MMLA 3PFSA 2E70A 1X6OA 1WDXA 2VWFA 1K4US 5LJ5d 4MZPA 1WGSA 3EG0A 4PLIA 4XTVA 1YCYA 1G3SA 2VYTA 1D1AA 3M56A 3CCVA 1NPPA 4J9IA 3MP8A 1JXMA 3FDRA 4PJOG 4JZ4A 1S72T 3GNGA 1YI2T 4PJNA 3CXCP 4RG2A 1UJ0A 2YUOA 4M4ZA 1D3BB 2HCKA 2EGEA 3CCLT 1VQ4T 1VOMA 4C92A 2L3QA 2L3PA 4L6V5 2D8JA 1N5ZA 1JQQA 3M0PA 5CKHA 4LD9K 5KCHA 3JCMe 3GP8A 1RAGB 3I56A 2VKNA 1WA7A 2VGNA 1TSFA 1VQNQ 4LUEA 2FZKB 2RQTA 1PKTA 2K9GA 2LCLA 2COWA 2FO0A 3S6WA 3JCMP 2QAZA 2NLUA 1QVGS 3H9NA 3SEMA 1SEMA 2EFIA 4HT9A 2K5FA 1MNEA 2ROLA 9ATCB 1ZSZA 4HXJA 3HTRA 5GAOq 1WFWA 2KE9A 1UDLA 3OYMA 4N4GA 1VYUA 2G3RA 3DLMA 4A4HA 4FL6A 1ZUUA 3KUFA 5M9OA 3QIIA 2JTFA 3CCJQ 4PJOC 4M7AB 3J81E 1PWTA 1SRMA 1QMCA 4JRQA 5DY9A 2O2OA 1M1KC 4FT4A 2JS2A 3ME9A 3M0TA 2QEXT 2HKNA 1M1FA 2RN8A 1Y96B 2MYSA 4CC4B 1OYXA 1VUBA 5AT1B 3RKWA 1KD1R 3OYEA 4AG1C 3QBYA 1V76A 3L2QA 1QWEA 2DZCA 4KT0E 1YWOA 2CP3A 1S72Q 4PJOD 2RI3A 2RK1A 1Q82C 1MMGA 1YI2Q 4XQ3A 5I11A 1JEGA 2CH4W 3VKIA 4KRTA 5GAMj 2QGGA 3CCVT 2F2XA 3M53A 2GTOA 2KAFA 4M78C 3CCLQ 1R77A 1VQ4Q 1UJYA 4M7AF 4JJNK 2AK5A 4YTLA 1IB8A 2E64A 3I35A 2ZPHB 4WTOB 5FWCA 3BFMA 2DETA 4RKUE 4RTWA 3G71A 1ZBXA 2XMFA 1IGUA 3LX7A 3SWNB 2GTJA 2DXTA 3LWHA 3OMGA 3L42A 1RUWA 3BDUA 3FEOA 1M90C 2KXDA 3OQ5A 5KCOA 2A36A 2DEUA 1OPLA 4QVDA 3OYHA 5DLOA 4M78D 3VS0A 3VYGA 4M7AE 4JZ3A 3E9GA 2JM9A 3UA7A 3I56T 4TVRA 2ZGWA 1YHQA 2EWNA 4QT7A 2LX9A 4M77A 3NMZC 5LL6S 2LQWA 4C0GA 5GAMd 5D6XA 2FZCB 1WHLA 2CGHA 3M59A 1WNLA 1YJWA 3OW2S 4HCCA 1JRIA 4AFSC 2DX1A 2X9HA 2M9UA 1QVPA 3HL8A 4E6RA 2F1LA 2D6FA 3G7ZA 4C92B 2DERA 2QEXQ 4FIBA 2FB7A 2NUTB 1V29B 5CVIA 2CP2A 2EYXA 2CDTA 3VJPA 4B6MA 5LJ3j 4F14A 3M55A 1BIBA 1YIJA 4J7FA 2DLPA 2AT1B 2QTXA 2P0KA 3CCUQ 1VQ7Q 2RM4A 3UATA 2YRDA 5GMKe 1WI7A 4RTVA 2JXBA 2ROTA 1W2BA 3JCMV 2MPXC 4C5HA 5EC7A 4E7IA 2FRWA 3VUZA 3RUXA 3OYGA 1KQ1A 3CCVQ 1ARKA 3U23A 3CC7A 1QVGP 2YT6A 2K2VA 2NUZA 4M7AG 3CPWA 2V8KA 4OMFB 4FW2A 3RBBB 1XQHA 1ZSZB 2L89A 1JB0E 4GLKA 4BE2A 4CC3A 5KYYA 4KUIA 2BZ8A 2EPDA 2COYA 4C92F 3V7CA 1X6BA 4J9GA 1PHTA 1WXBA 1VQOA 2KYMA 4JRKA 3NGPA 2HEQA 1D09B 3MCAB 4LUDA 5LJ3d 1JJ2A 3E1SA 3G71T 4ZN1A 3EHRA 3I56Q 1HXDA 5HKCA 3D7SB 2PVDB 1RL2A 2KR3A 4C92E 3CCSA 3OBYA 2XI9A 1NEGA 2HL3A 2HBWA 2VB6A 4OGEA 2QG9B 3QHSA 5LJ5g 2EKHA 3TU4K 2HNIA 2X4JA 1GCQA 1UFFA 2EVRA 1VYTA 4F17A 1Q86C 1VIEA 1K8AR 1WQWA 2CT4A 3CMEA 7AT1B 1YHQT 5KYXA 2AZSA 5LJ5e 2OI3A 3T9NA 3ZEHA 2EJGA 3HHTB 3NTKA 1SG5A 1U06A 4RTTA 1YJWT 2RHUA 2LC4A 1NPRA 4JS5A 4MZTA 1RAAB 3TEEA 2HMAA 4IKFA 2K4YA 1CSKA 2KRNA 4AG2C 4M7AC 1KSWA 3FB9A 2DVEA 5GAOp 1PM3A 2ED0A 3M54A 3RMQA 1AZEA 2DBKA 4XAXB 5IAYA 1EZZB 3TQ7P 1D0XA 2EBPA 3G6EA 2BE9B 2YUNA 1R0BG 4PFOA 1YIJT 2V8JA 2YDLA 5HK0A 4X1VA 4M7AD 1KC8R 2EQIA 4E7ZA 1WXUA 3HPWA 4C8QA 4A54A 2QI2A 2CUDA 4C92G 4HVUA 5IXFA 4F7UE 4PK4A 3WVEB 2FPFA 5FLXE 3M0RA 3CC7T 3J7AF 1M3AA 2DM1A 1VQNA 3OW2P 4EMKA 4J8OA 1G8XA 2FYKA 3ZBDA 4ZNXA 1M3BA 2QASA 3EGXA 1WHKA 3Q1JA 4MDWA 5FU6B 1I5LA 3G71Q 4EDUA 1PD0A 4Z89A 1U8RA 1K1ZA 4ZGEB 2VGMA 2J6KA 4J6XA 1VQOT 2EYWA 1NJIU 2ZPFB 1LOJA 4FW1A 2LJ1A 2LJ0A 1UB4A 1WYXA 4XU3A 1WJSA 3RESA 2JTMA 1PG5B 1OX8A 2E6NA 2K5IA 4M77F 3OYFA 2YLBA 1WZOA 1RAHB 4J9BA 3SB2A 2LNHB 1YHQQ 2ZCFB 2RQWA 5GMKi 2MOXA 3CCST 2IVWA 2MF2A 1M5Q1 3M9QA 4OMQA 2LCCA 5GAN8 2RA2A 2DXUA 2EYQA 2O31A 2EQMA 3MPUB 2FHDA 3MEUA 1YITA 1QWFA 3EFOA 4WCIA 3GOXA 3INZA 3JCMJ 5KYYB 3CMET 2RJDA 2EJ9A 3X25B 1M4ZA 3LW5E 2JMCA 3VS1A 1KK7A 1Q81U 4M77E 2IPOB 1FWZA 1GFCA 1I1JA 2A0FB 4C92C 1BBZA 1TUCA 3LH0A 2VXEA 5EG2A 2E3HA 1BB9A 1Y57A 3V8JA 1TG0A 1X6GA 4FSSA 4EIKA 3BW1A 1YIJQ 4MDXA 4Q5WA 2WACA 1T3LA 2OX7A 1UHCA 2RPNA 4A4FA 3C12A 2BZXA 2KNBB 1K9AA 3JCMb 2GBQA 3G6ET 2J6OA 1Q7YR 3JB9I 2W10A 1WHGA 4FYWB 4C92D 2DO3A 2P0PA 2K3YA 3N5BB 1YP5A 1LCKA 3CC7Q 3THKA 3DB4A 4IUPA 3S3OA 1ZSZC 2HQEA 1G3WA 1FYNA 2VUBA 2XDDA 2P0QA 1W2BS 2YRCA 1OOTA 4ZGDB 2SEMA 4RG8A 2KT8A 5GAMe 3EGDA 4Z02A 1VQOQ 1VQNT 3TSWA 4BDYA 3CPWS 1UGSB 3VRYA 1GL5A 2Y4YA 2FZGB 3PVQA 3RKXA 4XTZA 3CBPA 1K73R 2KBTA 3QWYA 4BI3A 3CCSQ 2XHCA 3MKDA 1I4K1 2HQHA 3ASKA 5GAN5 1KG1A 1VQPA 3JCMf 3OY9A 3REBB 1M2VA 3C95A 1WQ7A 1JJ2S 1R0CB 4FM4B 3P8HA 4N0AA 4J83A 1WJQA 1JO8A 3R6OA 4C8QB 1E6HA 3MP6A 2LZ6B 4F04B 3OS0A 1NYGA 2OTLA 3CMEQ 1R8OB 3CCUA 1VQ7A 3P8BB 1TWBA 1M8VA 4LDYA 2QDYB 3JCMh 1MMAA 4IUVA 1YITT 3IQLA 3RERA 1P92A 1MMNA 1EIFA 3S3NA 1IXDA 3J80E 3EGXB 3A8GB 4OGCA 5I2SA 4DOWA 4HA8A 2RI5A 4FU6A 5LJ3g 2D1XA 5I2MA 1W4SA 5CAIA 2AKLA 2E5QA 3G6EQ 4JRPA 3GPLA 4OB3B 2MK5A 2RQRA 1ZA2B 3URGA 1SF9A 2V1QA 2PVGB 4M7DE 1G3TA 1I5OB 5LJ3e 4C8QF 1EX4A 1UG1A 4ZTFA 4JPBW 1WPYA 3PVLA 3JCMg 1NJIC 2I0NA 4M77C 4AFQC 2HD0A 2HSPA 4QQGA 2CZ0B 2PU9B 1TUDA 3VYHB 3A1PA 3EFOB 4KBMB 1W6XA 4ZN3A 1GFDA 2RF0A 2EQUA 3QJYA 5FU6C 4ESRA 3PGGA 3CQTA 1SKUB 4A4GA 1VIFA 3JB9F 4C8QE 4JJCA 4M78G 1YFNA 3KFVA 3UDCA 1W70A 3BDLA 3A8HB 2NYSA 1KFZA 2O9VA 1VQ9A 2OAUA 2B8AA 2BIVA 1TTHB 1TU0B 3LLRA 4CC2A 2KEAA 3M0UA 4CI0C 1Q81C 1JXOA 5GANj 1BI0A 5CCAA 3I5RA 2KK4A 1FMVA 4EMHA 5GAOm 2DYBA 3MJXA 3QJ6A 4NL2A 1QVFA 4JJDA 2NUPA 4LDWA 1VQPT 1T3SA 2EKOA 2IIMA 3META 2CH4A 1YITQ 3QPHA 3CCMA 2EYYA 2KI7A 2OTLT 2CZ6B 2X3WD 3M4YA 4F7UA 4QVCA 1W2BP 2F2VA 3LH5A 1YCSB 3CCUT 1VQ7T 4XU0A 2RNAA 3EGDB 2DTIA 4HT8A 1UGRB 3OYLA 1G2BA 2HBPA 4D8KA 2KVQG 4C8QG 5GANd 1IHVA 2DL5A 2LDMA 5J3BA 3A8LB 1ZA1B 5GAN6 1WX6A 3H41A 1ABOA 1K9MR 2DIGA 2KQWA 3FJ5A 4LNPA 2D0NA 3QYGB 1C0MA 3R6NA 1GCQC 1M2VB 1ZHIA 2E65A 1U3OA 4LD6A 1JJ2P 1D1CA 2JW4A 2K79A 1N8RU 1ZUKA 1OPKA 5GMKm 2R5AA 4PL6A 2M16A 1WHMA 4O5VA 3PTAA 4BY6B 4BI4A 3JB9G 4P5NA 1BI3A 2HL5C 1XTDA 1PCXA 1Q95G 1UGVA 5GMKh 1X69A 4QQDA 1TH7A 2E12A 5I21A 3OSVA 3H6ZA 3WXMB 2DL8A 3L2UA 5DLQE 4A4EA 2AIRB 1C6VX 3L2RA 2GQIA 3FC3A 4KULA 3RKYA 2LQKA 4XTXA 2J06A 3FIFA 4IURA 1VQ9T 3EG1A 4FYYB 3LGLA 5L23A 1NLPC 5ECAA 2JJ9A 2CSQA 4FYXB 2VC8A 1VQPQ 1BU1A 3CCQA 4L5GA 2DKGA 4C8QC 1RACB 1OU8A 2DBMA 2OTLQ 2PUOB 2YUQA 5IN1A 2PUKB 2JN0A 2RHXA 1HSQA 2DXBA 2MCNA 3C4SA 1CKBA 2L3RA 4EMKC 4DEYA 1DJ7B 2QQSA 1PSEA 1SRLA 3L2VA 3CCMT 5LJ5f 1YBYA 4C0DB 3NHNA 2EIFA 3JCMW 2DL7A 3OBWA 3S3MA 2QA4A 2KY9A 1OZ3A 4C8QD 2X4WA 1FXXA 1NE8A 4IUQA 4DBQA 2F2WA 1IHWA 4LDVA 3VV0A 4CRIA 3SFMA 5LJ5h 2K3XA 4KGZB 4J9CA 1QCOA 1FMKA 1OX9A 2JOYA 3QDRB 1HD3A 1ZQ1A 5AYFA 3JCMc 4HCZA 4JLGA 3VS3A 2K57A 3G1JA 2CSIA 1VQKA 2E10A 3JB9D 3EAEA 2FPDA 3X24B 5GAOr 4XU1A 1KHCA 1LVKA 3PIPA 1PRMC 5FRMA 1UTIA 3HRUA 2XG8D 2DVJA 1VQ8A 5L8RE 1HJDA 2HSEB 4F7UB 3EFSA 2DF6A 4OMMA 3HFOA 1KD1U 2CZ1B 2P4RA 1UGQB 2RK2A 2QXFA 2L0AA 2JT4A 1OI1A 1M1KR 3EG9A 2RJCA 3TVTA 1QQJA 1VQ9Q 1UUEA 2W0ZA 3RDVA 4Z88A 1YJNA 4JJBA 2RB6A 2XICA 3FJPA 2PVOB 5CQXA 4IUUA 1Y07A 4XK8E 3OYKA 3C94A 1K9MU 2DFUA 4J6WA 2O9SA 2D9TA 2DMOA 4DA4A 4KH0B 3GF5A 4M7DA 1Q82R 3EG2A 2GGRA 3X20B 1F1BB 3VS2A 2DNUA 2Y4XA 8AT1B 3CBMA 5A2QE 1I8FA 4J9DA 3CCQT 3CC2A 4Z8AA 4F7UF 4FT2A 1X27A 3CD6A 3CCMQ 2YHTA 1X2QA 3A5ZB 1VQ5A 1QVFS 1U1TA 5CO7A 2OAWA 2C0IA 1N8RC 2OJ2A 3EHQA 1SSHA 1XOVA 4M77B 3HSBA 4AT1B 2CP5A 2WSEE 4KGVB 2QA4T 3PMTA 2PNIA 1FMWA 4RTYA 4D6WA 1B07A 1N9RA 2DRKA 3VS5A 4IUTA 3M0SA 1NBEB 4N0AC 3H8ZA 1U1SA 1QP2A 3NFCA 2KXCA 4JRIA 1SSFA 4EMGA 4L59A 4BY6C 2J7IA 3RR6A 2X3XD 3OYYA 1ZX6A 5IXBA 1VQKT 1X43A 2HKQB 2RQVA 4RUGA 1ABQA 1UGPB 3HP9A 1UECA 2K5LA 2QGFB 4R56A 2EW3A 1VQ8T 2DTOA 2NWMA 3DKMA 4J9EA 5J39A 1NLOC 2R57A 2DJZA 5GAMf 3LGFA 4RCBA 3OMCA 2C06A 1YJ9A 5CKDA 1ACMB 1YJNT 5A0LA 2M02A 4OP0A 1B3QA 4F7UG 5FU7C 2A3LA 2MMPA 3CCQQ 1B34A 5GAMh 1W1FA 2P4TA 4E7JA 5GANe 5HK3A 1TUGB 2JZ2A 2A08A 2KT1A 4AFZC 1MGQA 3MP1A 5CKFA 3ULRB 2X4YA 2FRYA 3CC2T 3OYIA 3RIRA 4B9WA 3CD6T 4C0DC 3UF4A 4ATOA 3PNWC 1IGQA 3HRSA 2QA4Q 1VQ5T 3FRNA 3EG9B 1M1KU 5FWBA 1X2KA 2DL3A 5GAMg 5D6YA 5KYXB 1K8AU 3V7SA 4LDUA 4C0FA 1KD1C 2COZA 4NS5A 1IZ6A 4RTUA 1RAFB 5CKEA 2MAMA 1XJWB 2VASA 2VV5A 3PMIA 1PKSA 3VS7A 1MUZA 1QLYA 4M7DB 1KQSA 1Y0MA 2DIQA 2JM8A 1Q86R 1VQKQ 1Q82U 3JB9H 4CC7A 3H0HA 5LJ3f 1K0SA 2PZ1A 4M77G 5GAOn 2LTOA 5KE3A 3EH2A 1C1AA 3CEYA 4J7IA 1VQ8Q 2DE0X 3VS6A 1K9MC 4RTZA 2JTEA 2ECZA 2QK0A 1ZBJA 5LJ3h 1RI0A 1VA7A 4E7LA 1RADB 1KC8U 5CKBA 2E3IA 2B86A 5HY6A 4PKCC 1M1GA 2AKKA 2R5MA 2E1HA 4KH1B 1YJNQ 2KRSA 2CUBA 5C6SA 1VQ6A 4A63B 4M7DF 4DEXA 4ELYC 3I55A 1RAIB 2JS0A 4M75A 4EMKB 4QVZA 3SWNA 5A0GA 1AHJB 1YJ9T 4ZGJB 3RNJA 2DRMA 2YLCA 3P8DA 2M1HA 1RLQC 1X75C 2V1RA 3M58A 3EH1A 2FL7A 2F5KA 3HFNA 2XIDA 3OS1A 3CC2Q 4J9HA 3QZ9B 1VQLA 3CD6Q 3GLXA 2EGAA 2WSFE 4BD3A 2QDLA 1VQ5Q 1OULA 4DBHA 2BKDN 4A53A 3QO3A 1CKAA 2ZZDA 1NYFA 1AWOA 1I07A 2O4XA 2ZPEB 2DPPB 2KYBA 1MHNA 1D0YA 2ENMA 1UHFA 1IRXA 5FROA 4ANJA 4DBRA 1PD1A 1M27C 2MWPA 3OSSC 2LX7A 3CC4A 2E4HA 3L2WA 3BY7A 3V7RA 1ZLMA 1WHHA 2CKKA 3EFRA 2NUTA 3QZ5B 4J6YA 5IT9E 1B34B 1AVZC 1QW1A 2LP5A 4M77D 4N4IA 1PRLC 4C5EA 4DQ2A 1AT1B 5GAN2 3UA6A 3KXTA 2EGCA 2X51A 2DD4A 1E7OA 2M0OA 1SPKA 5D6WA 3G4SA 3JB9J 2A7YA 3DB3A 2Z0WA 2RJFA 3EGUA 2DEQA 1QKXA 1KHIA 1RABB 2E41A 4Y91A 3ZL7C 2GFAA 1Q7YU 2ABLA 8ATCB 4ZTJA 4ME7A 3MEWA 2L8DA 4M7DG 1K76A 3SD4A 2SRCA 3GBQA 3QYHB 3X28B 1A0NB 2EQKA 2RQUA 4OB1B 1YJ9Q 2C0OA 1K0XA 3OS2A 2BUDA 1B7TA 5CQYA 1N27A 1FX7A 1VQ6T 1H641 3QG1A 2DA9A 3I55T 3NTHA 3QUIA 2J05A 1K8AC 3CMAA 2F69A 1Q86U 1RAEB 2Y90A 3CPWP 2DL4A 4BUGA 4DOVA 1IREB 2O01E 5IHKA 2L3SA 2KROA 4Y28E 1BI1A 3A98A 4R55A 5CK9A 1K73U 4X34A 1QP3A 3TREA 1VQLT 1E6GA 4HVWA 3ZFJA 1QCNA 1QKWA 1N6AA 4XTWA 2CP7A 2I2LA 3ER0A 4BB7A 2X4XA 4FSXA 4F16A 3CXCA 5KH6A 3SHWA 1WIEA 3UWNA 4PJJA 3VU3C 2RHZA 1D1BA 1OQKA 4HCBA 2JNGA 4QW2A 1GBQA 2HQXA 2LNVA 4M75B 2RD1A 4MMKA 3E2UA 3QWXX 1BK2A 4JDSA 1BCMA 1KC8C 2CT3A 4M7DC 1NEBA 3CC4T
chains in the Genus database with same CATH topology
2PVOB 5EG2A 5CQXA 4IUUA 3GNFB 1D3BB 3V8JA 3F70A 2RI2A 1Y07A 4XK8E 3BW1A 3OYKA 3CCLT 1LNXA 4QQ6A 1VQ4T 3C94A 1K9MU 4MDXA 2ZPBB 4Q5WA 4XTUA 4J6WA 4C92A 2WACA 3SDZA 2D9TA 4DA4A 3GF5A 4M7DA 4L6V5 3C12A 4A4FA 2R58A 1X01A 3X20B 5DM7R 2Y4XA 2E6ZA 4O6JA 3CBMA 5CKHA 1I8FA 2GCXA 3JCMb 5A2QE 3G6ET 3LWIA 3CCQT 3JRZA 4LD9K 3CC2A 4F7UF 5KCHA 3G4ST 3JB9I 3JCMe 3GP8A 4FT2A 2HAXA 3I56A 4C92D 1KQSS 1NZ9A 5FRNA 3VUBA 3CD6A 2VGNA 2YHTA 4M7DD 2DO3A 3CBOA 5FU7B 2P0PA 3A5ZB 2DK3A 2K3YA 3N5BB 2CYZB 3QXEB 2O4XB 2LCLA 2V8IA 3DB4A 4IUPA 2DXCA 1VQ5A 1QVFS 3S3OA 2HQEA 1G3WA 2VUBA 1U1TA 5CO7A 2RJEA 2XDDA 2P0QA 4OB0B 4M75F 1N8RC 4J5YA 3S6WA 3JCMP 1W2BS 2NLUA 1QVGS 3CCRA 1XOVA 3PIOA 2DTHA 4M77B 2EFIA 4HT9A 1M9SA 4ZGDB 2K5FA 3HSBA 4RG8A 5GAMe 4Z02A 1BIAA 2WSEE 5GAOq 2QA4T 1VQNT 3GIBA 3PMTA 3OYMA 4N4GA 2G3RA 2QQRA 4D6WA 3DLMA 4GY5A 4BDYA 1N9RA 3CPWS 4A4HA 4FL6A 1UGSB 3KUFA 4A4KA 5M9OA 3QIIA 4WF2A 4IUTA 2JTFA 2Y4YA 4PJOC 4M7AB 3OS5A 3J81E 3RKXA 1PSFA 3CMAT 4XTZA 4JRQA 5DY9A 4N0AC 3CBPA 4M75E 3H8ZA 1O9SA 1U1SA 4BDZA 1M1KC 1KQ2A 1QP2A 4FT4A 1GXIE 4BI3A 4V2SA 3ME9A 2XHCA 3NFCA 4JRIA 1I4K1 1SSFA 3ASKA 4EMGA 5GAN5 4L59A 4BY6C 2QEXT 4BACA 1KG1A 1M1FA 2XU8A 1VQPA 3JCMf 1BKBA 1Y96B 3OYYA 3OY9A 1VQKT 4PJOA 4XU2A 3C95A 1WQ7A 1JJ2S 1OYXA 1VUBA 3P8HA 4FM4B 3RKWA 4N0AA 4J83A 1WJQA 3R6OA 4C8QB 1VQMA 3OYEA 3MP6A 3OS0A 3QBYA 1UGPB 3HP9A 4E47A 2K5LA 2OTLA 3HKSA 2FVUA 2LT1A 3MHXA 3OA6A 3L2QA 1R8OB 4UC4A 4R56A 2DZCA 2WSCE 3UT1A 2RHIA 4KT0E 1VQ8T 4X9CA 2DTOA 3CCUA 4PJOD 5GAOl 2RI3A 2RK1A 1Q82C 3DKMA 3P8BB 5A0DA 1VQ7A 1M8VA 4LDYA 2QDYB 1OZ2A 3JCMh 5J39A 2QQ9A 4IUVA 1YITT 3RERA 2R57A 4XQ3A 1P92A 2DJZA 3S3NA 1EIFA 2OTJA 3VKIA 5GAMj 1Q7YC 5GAMf 3LGFA 3J80E 3CCVT 3A8GB 4RCBA 3M53A 3OMCA 5GAN7 2C06A 2KAFA 4M78C 3DLLA 3L2ZA 3KBGA 3OYBA 1YJ9A 4M7AF 4OGCA 5I2SA 3M5AA 5CKDA 4DOWA 4JJNK 4HA8A 2RI5A 2E64A 3CPFA 2ZPHB 4YTLA 2XDBA 1HK9A 4FU6A 5LJ3g 5A0LA 1YJNT 3JCMX 3BFMA 5I2MA 2L5QA 1W4SA 4OP0A 5CAIA 1WJRA 4F7UG 2E5QA 5FU7C 4RKUE 3G71A 2A3LA 3LH0A 1ZBXA 2MMPA 1B34A 3LX7A 1Y71A 4MZMA 3SWNB 4M78A 4JRPA 2DXTA 3AHUA 5GAMh 3LWHA 3GPLA 2P4TA 3OMGA 2EJFA 3L42A 4OB3B 2GQVA 3BDUA 3FEOA 5GANe 3URGA 5HK3A 4E7JA 1M90C 2PVGB 3OQ5A 1I81A 4ELZC 3JCMd 4LDXA 1G3TA 4X9DA 4M7DE 5LJ3e 2JZ2A 4C8QF 3LYIA 5KCOA 4ZTFA 1MGQA 1WPYA 4QVDA 4BI8B 3MP1A 5CKFA 3JCMg 3CCEA 1NJIC 3OYHA 2X4YA 4M77C 2HD0A 5DLOA 4M78D 4M75G 3VYGA 3CC2T 3OYIA 4M7AE 1G3YA 3RIRA 3E9GA 1XNIA 4QQGA 2CZ0B 3I56T 1G5VA 4TVRA 4B9WA 3CD6T 2ZGWA 4C0DC 4KUDK 4JLIA 2PU9B 4ATOA 3PNWC 3X26B 3VYHB 1YHQA 2EWNA 3HRSA 4KBMB 2LX9A 4M77A 4ZN3A 1K73C 5LL6S 3WVDB 4C0GA 1VQ5T 5GAMd 2EQUA 4B9XA 3FRNA 3QJYA 3E19A 5D6XA 5FU6C 1M1KU 2LT4A 3PGGA 4A4GA 1VIFA 3JB9F 4C8QE 5GAMg 2CGHA 3M59A 1WNLA 4M78G 5D6YA 3CCRT 1YJWA 1K8AU 3V7SA 4LDUA 4C0FA 3QKJA 5GMKl 3OW2S 4HCCA 3UDCA 4XTYA 1JRIA 1KD1C 3BDLA 4NS5A 3A8HB 1IZ6A 4NOYA 2ZPIB 2M9UA 1QVPA 1JBMA 1VQ9A 2OAUA 2B8AA 2BIVA 5CKEA 2MAMA 3HL8A 2VV5A 3PMIA 2D6FA 3LLRA 3M4GA 2XDPA 3G7ZA 2GF7A 4C92B 4FIBA 2FB7A 4CI0C 4M7DB 5GAN3 1Q81C 1KQSA 1V29B 2DIQA 2XKOC 5CVIA 5GANj 3PT9A 5GANf 1Q82U 3JB9H 1BI0A 5J26A 3VJPA 3OYAA 3V8LA 5CCAA 2VXFA 2KK4A 2DZ9A 5LJ3j 5LJ3f 4EMHA 3M55A 1BIBA 5GAOm 3QJ6A 5CR2A 4J7FA 1YIJA 4M77G 4NL2A 2QTXA 2P0KA 5GAOn 2LTOA 5KE3A 1QVFA 2RM4A 2LRQA 5GMKe 3CEYA 4J7IA 1W2BA 1QVGA 1K9MC 2PQWA 4LDWA 1VQPT 3JCMV 2EKOA 4C5HA 3META 4OB2B 5GANh 3QPHA 2CZ7B 4E7IA 1VQMT 3VUZA 3RUXA 3CCMA 5LJ3h 3JAME 3OYGA 2OTLT 1RI0A 4E7LA 2QQBA 2CZ6B 1KQ1A 3M4YA 4F7UA 4QVCA 4RG2A 3CC7A 1KC8U 5CKBA 4M7AG 2K2VA 4C5IA 3CPWA 4OF1A 2V8KA 4OMFB 4M75C 3CCUT 5HY6A 4PKCC 1VQ7T 4XU0A 3SWNC 1M1GA 1XQHA 2L89A 2E1HA 1JB0E 2R5MA 2DTIA 2H3JA 3A8OB 3HRTA 4GLKA 4C0ZA 4BE2A 4HT8A 4NL3A 4RCCA 1UGRB 4KUIA 5C6SA 2OTJT 1H3ZA 1VQ6A 4C92F 3OYLA 2HBPA 1UEBA 3V7CA 4M7DF 4II1A 4ELYC 3I55A 3MEAA 4M75A 4EMKB 2KVQG 1VQOA 4QVZA 4C8QG 3SWNA 5A0GA 1AHJB 4N4HA 3CXCS 3UPUA 1YJ9T 4JRKA 4ZGJB 5GANd 2LDMA 2YLCA 5J3BA 3P8DA 2M1HA 3MCAB 1BI2A 3A8LB 5LJ3d 1D3BA 1JJ2A 1X75C 3TCJA 5GAN6 3OYNA 2XK0A 3M58A 5GANg 2FL7A 2F5KA 2JUFA 3E1SA 3G71T 3HFNA 2XIDA 2DIGA 4ZN1A 4M75D 3OB9A 3OS1A 3MEVA 2KQWA 3QYGB 5KE2A 2LQ8A 3CCJA 1HXDA 3QZ9B 1VQLA 4PJOB 5GMKj 1ZHIA 2E65A 2MWOA 3JCMQ 3GLXA 3JSCA 4LD6A 2KSSA 5HKCA 2PVDB 2WSFE 1RL2A 4C92E 3CCSA 4BD3A 3QSUA 1N8RU 3CCET 3OBYA 5GMKm 2LVMA 2R5AA 2XI9A 5LJ5g 4PL6A 4OGEA 2M16A 3QHSA 4O5VA 2BKDN 3PTAA 4BY6B 4A53A 4BI4A 3TU4K 3JB9G 2HNIA 3QO3A 2X4JA 1BI3A 4P5NA 3OYDA 5CIUA 2ZZDA 4JS4A 1Q86C 4BE1A 1VIEA 5GAN4 2O4XA 2ZPEB 1WQWA 1XTDA 2DPPB 3CMEA 1YHQT 1MHNA 5GMKh 4QQDA 5LJ5e 1TH7A 2E12A 5I21A 4HKEA 3OSVA 3T9NA 1N9SA 5FROA 2EJGA 3H6ZA 3ZEHA 3WXMB 1S72A 3HHTB 4OVAA 3NTKA 3L2UA 5DLQE 2JVVA 4A4EA 2F5TX 3L2RA 1YI2A 2MWPA 3OSSC 1YJWT 2RHUA 3CC4A 2LC4A 3L2WA 1NPRA 3BY7A 3V7RA 4JS5A 4MZTA 3FC3A 4KULA 3RKYA 2LQKA 3TEEA 4XTXA 4IKFA 2K4YA 4M7AC 2CKKA 3FIFA 3EFRA 4EPCA 3QZ5B 4J6YA 2MI6A 3FB9A 4E7HA 2KDSA 4PLLA 5IT9E 4IURA 1VQ4A 1B34B 3CCLA 4RMOA 4M78B 2DVEA 1QW1A 5GAOp 1VQ9T 4M77D 4PJOF 4N4IA 2RHYA 4C5EA 4DQ2A 3M54A 3RMQA 3LGLA 4XAXB 5IAYA 3E9FA 5GAN2 3KXTA 2DD4A 4M7AA 2VC8A 3G6EA 3O8VA 3CCQA 2M0OA 2DKGA 4L5GA 5D6WA 4JUVA 2DAQA 3G4SA 3M57A 1Y7XA 4C8QC 4PNOA 3JB9J 2A7YA 3DB3A 3RMSA 2AHJB 1YIJT 2RJFA 2PUOB 2DEQA 2V8JA 5IN1A 2PUKB 1Y96A 2JN0A 5HK0A 1BYMA 1KHIA 4M7AD 2E41A 2EAYA 2RHXA 4Y91A 2DXBA 2GFAA 3C4SA 4C5GA 1Q7YU 5C0MA 3HPWA 4C8QA 2L3RA 3OW2A 4A54A 2QI2A 4EMKC 4ZTJA 1DJ7B 2EQJA 1O75A 3MEWA 4ME7A 4C92G 2QQSA 4PJOE 4BE0A 1PSEA 2L8DA 4M7DG 3L2VA 3CCMT 4F7UE 3WVEB 5LJ5j 5LJ5f 1YBYA 3SD4A 3A8MB 4C0DB 5FLXE 3OYCA 2EIFA 2RH2A 3JCMW 3CC7T 3QYHB 3OBWA 3X28B 3S3MA 3J7AF 2CS7A 2EQKA 2QA4A 2DD5A 2KY9A 1VQNA 2YRVA 4OB1B 1OZ3A 4C8QD 2X4WA 1FXXA 4EMKA 4J8OA 2FYKA 4M78F 3ZBDA 1NE8A 1LJOA 2QQAA 3Q1JA 5FU6B 2BUDA 4MDWA 3OS2A 1M90U 5CQYA 1I5LA 1N27A 1FX7A 1VQ6T 1H641 4EDUA 4IUQA 3V8KA 3QG1A 3OYJA 1U8RA 4LDVA 3VV0A 2IG0A 4CRIA 3I55T 3NTHA 3SFMA 4ZGEB 2K3XA 5LJ5h 3QUIA 2VGMA 4J6XA 1VQOT 2ZPGB 1NJIU 2ZPFB 3L1AA 2D0QB 2RO0A 3CMAA 4E7KA 1K8AC 2F69A 1LOJA 1Q86U 2Y90A 2JOYA 3FLGA 2GFUA 3QDRB 4BUGA 2KMTA 4DOVA 1IREB 1UB4A 1ZQ1A 4XU3A 2O01E 5AYFA 3JCMc 4HCZA 1WJSA 4JLGA 3RESA 2QEXA 2JTMA 4Y28E 2K57A 1VQKA 1BI1A 2E10A 3NTIA 3JB9D 2E6NA 3EAEA 3X24B 2K5IA 4M77F 4XU1A 3CCJT 5GAOr 4R55A 3OYFA 2YLBA 4VUBA 5CK9A 2X35A 3MO8A 1K73U 4M78E 1KHCA 1QP3A 4X34A 3TREA 4MMLA 1VQLT 2XD0A 3PIPA 5FRMA 3SB2A 3HRUA 3ZFJA 2XG8D 3PFSA 3CC4T 2E70A 2ZCFB 5GMKi 3CCST 2IVWA 1N6AA 1X6OA 2MF2A 4XTWA 1M5Q1 3M9QA 2LCCA 2I2LA 1VQ8A 5L8RE 5LJ5d 3ER0A 4F7UB 4MZPA 2RA2A 4BB7A 1WGSA 4PLIA 5GAN8 3EFSA 2DXUA 2EYQA 2X4XA 4FSXA 2EQMA 4XTVA 1YCYA 3HFOA 2FHDA 1KD1U 3MEUA 1G3SA 2CZ1B 1YITA 1UGQB 2RK2A 2QXFA 2VYTA 3GOXA 3INZA 5KH6A 3CXCA 3M56A 3JCMJ 1OI1A 3CMET 3CCVA 2RJDA 1NPPA 3UWNA 2EJ9A 3MP8A 3VU3C 3X25B 1M4ZA 3LW5E 2RHZA 2RJCA 3FDRA 4PJOG 4HCBA 1S72T 2JNGA 4QW2A 4M77E 1Q81U 1FWZA 2HQXA 2LNVA 4M75B 2RD1A 4MMKA 4C92C 4JDSA 1YJNA 3GNGA 1KC8C 1YI2T 4M7DC 2RB6A 2VXEA 2XICA 3FJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKG A;  3RER A;  4XQ3 A;  4JUV A;  5GAN h;  2DJZ A;  1D3B B;  3V8J A;  4C8Q C;  5GAM j;  4PNO A;  5GAM f;  3RUX A;  3JB9 J;  5LJ3 h;  3BW1 A;  4RCB A;  5GAN 7;  1LNX A;  1KQ1 A;  4F7U A;  4QVC A;  4M78 C;  3L2Z A;  4J6W A;  2DEQ A;  4XTU A;  4C92 A;  4M7A G;  4M7A F;  1Y96 A;  2JN0 A;  4M7D A;  4M75 C;  4HA8 A;  4M7A D;  2E41 A;  2E64 A;  2EAY A;  4Y91 A;  4XU0 A;  1HK9 A;  1X01 A;  3SWN C;  5LJ3 g;  3JCM X;  2E1H A;  3BFM A;  2DTI A;  3JCM b;  1I8F A;  4OP0 A;  4C8Q A;  4NL3 A;  5CAI A;  4HT8 A;  4RCC A;  4A54 A;  4EMK C;  4F7U G;  4F7U F;  4C92 G;  3JB9 I;  4PJO E;  1B34 A;  3SWN B;  4C92 F;  3JCM e;  4M78 A;  4M7D G;  2DXT A;  3AHU A;  4F7U E;  5GAM h;  3V7C A;  4M7D F;  4C92 D;  2EJF A;  5LJ5 j;  3BDU A;  5GAN e;  5LJ5 f;  2YHT A;  4M75 A;  4EMK B;  4M7D D;  3JCM d;  4M7D E;  1I81 A;  3JCM W;  4X9D A;  3SWN A;  4C8Q G;  5LJ3 e;  4C8Q F;  4JRK A;  5GAN d;  1MGQ A;  4C8Q D;  1WPY A;  2YLC A;  4QVD A;  4EMK A;  3JCM g;  5LJ3 d;  2FYK A;  1D3B A;  1U1T A;  4M78 F;  3FJP A;  4M77 C;  5GAN 6;  1LJO A;  4M78 D;  4M75 G;  5GAN g;  4M75 F;  1I5L A;  3HFN A;  4J5Y A;  4M7A E;  3RIR A;  3JCM P;  4M75 D;  4M7D C;  1H64 1;  3V8K A;  2DTH A;  4M77 B;  2ZGW A;  4HT9 A;  5LJ5 h;  3HSB A;  3QUI A;  1HXD A;  4JLI A;  4PJO B;  4J6X A;  5GMK j;  2E65 A;  5GAM e;  3JCM Q;  3L1A A;  2EWN A;  1BIA A;  1LOJ A;  5GAO q;  4M77 A;  3GIB A;  2Y90 A;  4C92 E;  3QSU A;  5GAM d;  4XU3 A;  5GMK m;  5LJ5 g;  4M7A A;  3JCM c;  1N9R A;  3QHS A;  3RES A;  4A53 A;  3JB9 G;  3PGG A;  2HNI A;  3JB9 F;  2K57 A;  4C8Q E;  3QO3 A;  2CGH A;  2E10 A;  1WNL A;  4M78 G;  5GAM g;  3JB9 D;  3V7S A;  5GAO r;  4M77 F;  4XU1 A;  5GMK l;  4WF2 A;  2YLB A;  4M78 E;  4XTY A;  5GAN 4;  1JRI A;  4M7A B;  1WQW A;  4MML A;  4PJO C;  3RKX A;  3SB2 A;  4XTZ A;  5GMK h;  5DY9 A;  4NOY A;  4N0A C;  4M75 E;  5LJ5 e;  1TH7 A;  1JBM A;  1U1S A;  5I21 A;  5GMK i;  1KQ2 A;  4XTW A;  1M5Q 1;  1N9S A;  2EJG A;  4V2S A;  4JRI A;  2I2L A;  1I4K 1;  5LJ5 d;  4F7U B;  4EMG A;  2RA2 A;  5GAN 8;  5GAN 5;  3M4G A;  3EFS A;  2DXU A;  4C92 B;  4XTV A;  1YCY A;  3HFO A;  1Y96 B;  2FB7 A;  3JCM f;  5GAN 3;  4M7D B;  4PJO A;  4XU2 A;  1WQ7 A;  5GAN j;  3BY7 A;  5GAN f;  3V7R A;  3JB9 H;  3RKW A;  4N0A A;  3RKY A;  3V8L A;  2VXF A;  3INZ A;  4XTX A;  4C8Q B;  3JCM J;  2DZ9 A;  5LJ3 j;  4M7A C;  5LJ3 f;  4EMH A;  3FIF A;  5GAO m;  1BIB A;  3EFR A;  4J6Y A;  3FB9 A;  2EJ9 A;  4M77 G;  4NL2 A;  2QTX A;  3VU3 C;  5GAO n;  1B34 B;  4M78 B;  2DVE A;  2RM4 A;  5GAO p;  2DZC A;  4PJO G;  4M77 D;  5GMK e;  4PJO F;  4M77 E;  4DQ2 A;  4X9C A;  2DTO A;  2RD1 A;  4M75 B;  4PJO D;  4MMK A;  5GAO l;  4C92 C;  5GAN 2;  1M8V A;  3JCM V;  3JCM h;  2RB6 A;  2VXE A;  2VC8 A; 
#chains in the Genus database with same CATH topology
 2K7A A;  3GNF B;  2JMA A;  2FPE A;  3F70 A;  2RI2 A;  3QDF A;  4J9F A;  1LNX A;  4QQ6 A;  2ZPB B;  4XTU A;  3AT1 B;  2QTV A;  3SDZ A;  2GNC A;  3C0C A;  2CP6 A;  2R58 A;  3O5Z A;  1X01 A;  5DM7 R;  1Z9Z A;  2E6Z A;  4O6J A;  5I22 A;  2GCX A;  2ESW A;  3LWI A;  3JRZ A;  4K11 A;  3G4S T;  2HAX A;  1ZUY A;  2AZV A;  4ORZ A;  2LJ3 A;  1NZ9 A;  1T0H A;  2E5K A;  3VUB A;  1KQS S;  5FRN A;  4M7D D;  3CBO A;  5FU7 B;  2LMJ A;  2DK3 A;  2BE7 D;  2CYZ B;  3QXE B;  2O4X B;  2V8I A;  2DXC A;  2RJE A;  3VS4 A;  2QYZ A;  4OB0 B;  4M75 F;  4J5Y A;  3CCR A;  1VQ6 Q;  3PIO A;  2DTH A;  2YUP A;  1M9S A;  3I55 Q;  4LXC A;  1J3T A;  1BIA A;  3GIB A;  1NJI R;  2QQR A;  2MIO A;  4GY5 A;  2M51 A;  2HDA A;  5KYW A;  4A4K A;  2K3B A;  4WF2 A;  1M30 A;  2ATC B;  3OS5 A;  2RMO A;  1AZG B;  1PSF A;  3CMA T;  1VQL Q;  2O88 A;  4M75 E;  1O9S A;  4BDZ A;  1KQ2 A;  1GXI E;  3EG3 A;  4R0K A;  4V2S A;  4FCY A;  4BAC A;  2J6F A;  2XU8 A;  1BKB A;  1GCP A;  4PJO A;  4XU2 A;  2DJQ A;  5KYU A;  1M8M A;  1AWW A;  1VQM A;  4E47 A;  3HKS A;  3M0Q A;  2FVU A;  2LT1 A;  2NUP B;  3MHX A;  3OA6 A;  3BE3 A;  4UC4 A;  1MV0 B;  1U5S A;  2KRM A;  2WSC E;  3UT1 A;  2RHI A;  4X9C A;  1HYO A;  5GAO l;  5A0D A;  1Q81 R;  2ZAE A;  1OZ2 A;  2KGT A;  2QQ9 A;  1M2O A;  3CC4 Q;  2OTJ A;  1TXQ A;  3REA B;  2DYI A;  1Q7Y C;  1PNJ A;  5GAN 7;  5IH2 A;  1OV3 A;  2BTT A;  4FYV B;  3DLL A;  3L2Z A;  3KBG A;  3OYB A;  3M5A A;  1V1C A;  3CPF A;  2XDB A;  1HK9 A;  3JCM X;  2L5Q A;  1WJR A;  2YSQ A;  1Y71 A;  4MZM A;  4M78 A;  3G4S Q;  3AHU A;  2EJF A;  2GQV A;  1YN8 A;  4ELZ C;  1I81 A;  3JCM d;  4LDX A;  4X9D A;  3LYI A;  1I0C A;  3NPF A;  1MND A;  4BI8 B;  3CCE A;  1AWJ A;  4M75 G;  1IO6 A;  1LPL A;  1G3Y A;  4LE9 A;  4AMC A;  1XNI A;  1G5V A;  2A28 A;  5IHN A;  4KUD K;  2C0T A;  4JLI A;  1OU9 A;  3X26 B;  2LQN A;  1K73 C;  3WVD B;  4B9X A;  2L2P A;  3E19 A;  2LT4 A;  2YXY A;  1MV3 A;  3CCR T;  5GMK l;  3QKJ A;  4XTY A;  5GJW B;  4QKU A;  4NOY A;  2ZPI B;  1M90 R;  2EYZ A;  1JBM A;  3CMA Q;  4DBF A;  3M4G A;  2XDP A;  2GF7 A;  5GAN 3;  1M3C A;  2XKO C;  1T0J A;  3PT9 A;  4E2F B;  5GAN f;  1G83 A;  5J26 A;  1WHJ A;  3OYA A;  3V8L A;  2VXF A;  2DZ9 A;  1VYV A;  4OMP A;  5CR2 A;  2VVK A;  4RTX A;  2LRQ A;  1GBR A;  1KQS P;  1D0Z A;  1QVG A;  2PQW A;  1NG2 A;  2M0Y A;  3I9Q A;  4D8D A;  4OB2 B;  5GAN h;  3H0I A;  2CZ7 B;  4PJM A;  1VQM T;  3JAM E;  2QQB A;  4Y92 A;  1UE9 A;  4C5I A;  5KYN A;  2FEI A;  4OF1 A;  4M75 C;  1YNZ A;  3SWN C;  3HRT A;  1YWP A;  4C0Z A;  1NM7 A;  2H3J A;  3A8O B;  4NL3 A;  4RCC A;  2OTJ T;  1JU5 C;  1H3Z A;  1AEY A;  5KYW B;  3I5S A;  1UEB A;  4II1 A;  3MEA A;  4PFZ A;  3UPU A;  4LN2 A;  4N4H A;  3CXC S;  1KIK A;  4PJL A;  2A37 A;  2ED1 A;  2K2M A;  4OMO A;  1PC0 A;  1H8K A;  1BI2 A;  4IIO A;  1D3B A;  3TCJ A;  3OYN A;  2XK0 A;  5FW9 A;  5GAN g;  2JUF A;  4OMN A;  4M75 D;  3OB9 A;  3MEV A;  5KE2 A;  2LQ8 A;  3CCJ A;  4E7S A;  1WLP B;  6AT1 B;  4PJO B;  4KGX B;  3PE0 A;  2G6F X;  4GLM A;  2MWO A;  5GMK j;  1AWX A;  2FG0 A;  3JSC A;  3JCM Q;  2KSS A;  5KYU B;  3QSU A;  3CCE T;  2LVM A;  1YJW Q;  1QCF A;  3OYD A;  5CIU A;  4JS4 A;  3CCR Q;  2BZY A;  1ZSG A;  4IIM A;  4BE1 A;  5GAN 4;  1AOJ A;  3TSZ A;  4HKE A;  2K6D A;  1N9S A;  1S72 A;  4OVA A;  5IHI A;  2JVV A;  1TS9 A;  2F5T X;  5GJV B;  3H0F A;  1YI2 A;  4GBQ A;  4HCK A;  1BCO A;  2CP0 A;  2DIL A;  4EPC A;  4E7H A;  2MI6 A;  1Z9Q A;  2KDS A;  4PLL A;  1VQ4 A;  3CCL A;  2CRE A;  2P84 A;  4RMO A;  4M78 B;  4PJO F;  2RHY A;  1TOV A;  3E9F A;  4PFP A;  4M7A A;  1H92 A;  3O8V A;  4JUV A;  2DAQ A;  3M57 A;  1Y7X A;  1RLP C;  4PNO A;  2PTK A;  3RMS A;  2LCS A;  1VQM Q;  2AHJ B;  1AD5 A;  1EFN A;  1Y96 A;  1BYM A;  3VRZ A;  1KJW A;  1S1N A;  2EAY A;  4C5G A;  5C0M A;  3OW2 A;  2EQJ A;  1O75 A;  4PJO E;  4BE0 A;  2OTJ Q;  2YWW A;  2H3E B;  5LJ5 j;  3A8M B;  3OYC A;  2V26 A;  2RH2 A;  1QVF P;  1GRI A;  2CS7 A;  1SHF A;  2DD5 A;  2YRV A;  5HCK A;  1WXT A;  4AFU C;  2H8H A;  4M78 F;  1LJO A;  2QQA A;  1M90 U;  2HZY A;  1MMD A;  3V8K A;  3OYJ A;  2IG0 A;  5D7U A;  2ZPG B;  3L1A A;  2D0Q B;  2RO0 A;  4E7K A;  4OML A;  1H3H A;  3FLG A;  2GFU A;  2KMT A;  4HVV A;  1SHG A;  3CCE Q;  2QEX A;  1N8R R;  2D8H A;  3JV3 A;  1OEB A;  3NTI A;  1RI9 A;  3CCJ T;  4VUB A;  2X35 A;  3MO8 A;  4M78 E;  2XD0 A;  4MML A;  3PFS A;  2E70 A;  1X6O A;  1WDX A;  2VWF A;  1K4U S;  5LJ5 d;  4MZP A;  1WGS A;  3EG0 A;  4PLI A;  4XTV A;  1YCY A;  1G3S A;  2VYT A;  1D1A A;  3M56 A;  3CCV A;  1NPP A;  4J9I A;  3MP8 A;  1JXM A;  3FDR A;  4PJO G;  4JZ4 A;  1S72 T;  3GNG A;  1YI2 T;  4PJN A;  3CXC P;  4RG2 A;  1UJ0 A;  2YUO A;  4M4Z A;  1D3B B;  2HCK A;  2EGE A;  3CCL T;  1VQ4 T;  1VOM A;  4C92 A;  2L3Q A;  2L3P A;  4L6V 5;  2D8J A;  1N5Z A;  1JQQ A;  3M0P A;  5CKH A;  4LD9 K;  5KCH A;  3JCM e;  3GP8 A;  1RAG B;  3I56 A;  2VKN A;  1WA7 A;  2VGN A;  1TSF A;  1VQN Q;  4LUE A;  2FZK B;  2RQT A;  1PKT A;  2K9G A;  2LCL A;  2COW A;  2FO0 A;  3S6W A;  3JCM P;  2QAZ A;  2NLU A;  1QVG S;  3H9N A;  3SEM A;  1SEM A;  2EFI A;  4HT9 A;  2K5F A;  1MNE A;  2ROL A;  9ATC B;  1ZSZ A;  4HXJ A;  3HTR A;  5GAO q;  1WFW A;  2KE9 A;  1UDL A;  3OYM A;  4N4G A;  1VYU A;  2G3R A;  3DLM A;  4A4H A;  4FL6 A;  1ZUU A;  3KUF A;  5M9O A;  3QII A;  2JTF A;  3CCJ Q;  4PJO C;  4M7A B;  3J81 E;  1PWT A;  1SRM A;  1QMC A;  4JRQ A;  5DY9 A;  2O2O A;  1M1K C;  4FT4 A;  2JS2 A;  3ME9 A;  3M0T A;  2QEX T;  2HKN A;  1M1F A;  2RN8 A;  1Y96 B;  2MYS A;  4CC4 B;  1OYX A;  1VUB A;  5AT1 B;  3RKW A;  1KD1 R;  3OYE A;  4AG1 C;  3QBY A;  1V76 A;  3L2Q A;  1QWE A;  2DZC A;  4KT0 E;  1YWO A;  2CP3 A;  1S72 Q;  4PJO D;  2RI3 A;  2RK1 A;  1Q82 C;  1MMG A;  1YI2 Q;  4XQ3 A;  5I11 A;  1JEG A;  2CH4 W;  3VKI A;  4KRT A;  5GAM j;  2QGG A;  3CCV T;  2F2X A;  3M53 A;  2GTO A;  2KAF A;  4M78 C;  3CCL Q;  1R77 A;  1VQ4 Q;  1UJY A;  4M7A F;  4JJN K;  2AK5 A;  4YTL A;  1IB8 A;  2E64 A;  3I35 A;  2ZPH B;  4WTO B;  5FWC A;  3BFM A;  2DET A;  4RKU E;  4RTW A;  3G71 A;  1ZBX A;  2XMF A;  1IGU A;  3LX7 A;  3SWN B;  2GTJ A;  2DXT A;  3LWH A;  3OMG A;  3L42 A;  1RUW A;  3BDU A;  3FEO A;  1M90 C;  2KXD A;  3OQ5 A;  5KCO A;  2A36 A;  2DEU A;  1OPL A;  4QVD A;  3OYH A;  5DLO A;  4M78 D;  3VS0 A;  3VYG A;  4M7A E;  4JZ3 A;  3E9G A;  2JM9 A;  3UA7 A;  3I56 T;  4TVR A;  2ZGW A;  1YHQ A;  2EWN A;  4QT7 A;  2LX9 A;  4M77 A;  3NMZ C;  5LL6 S;  2LQW A;  4C0G A;  5GAM d;  5D6X A;  2FZC B;  1WHL A;  2CGH A;  3M59 A;  1WNL A;  1YJW A;  3OW2 S;  4HCC A;  1JRI A;  4AFS C;  2DX1 A;  2X9H A;  2M9U A;  1QVP A;  3HL8 A;  4E6R A;  2F1L A;  2D6F A;  3G7Z A;  4C92 B;  2DER A;  2QEX Q;  4FIB A;  2FB7 A;  2NUT B;  1V29 B;  5CVI A;  2CP2 A;  2EYX A;  2CDT A;  3VJP A;  4B6M A;  5LJ3 j;  4F14 A;  3M55 A;  1BIB A;  1YIJ A;  4J7F A;  2DLP A;  2AT1 B;  2QTX A;  2P0K A;  3CCU Q;  1VQ7 Q;  2RM4 A;  3UAT A;  2YRD A;  5GMK e;  1WI7 A;  4RTV A;  2JXB A;  2ROT A;  1W2B A;  3JCM V;  2MPX C;  4C5H A;  5EC7 A;  4E7I A;  2FRW A;  3VUZ A;  3RUX A;  3OYG A;  1KQ1 A;  3CCV Q;  1ARK A;  3U23 A;  3CC7 A;  1QVG P;  2YT6 A;  2K2V A;  2NUZ A;  4M7A G;  3CPW A;  2V8K A;  4OMF B;  4FW2 A;  3RBB B;  1XQH A;  1ZSZ B;  2L89 A;  1JB0 E;  4GLK A;  4BE2 A;  4CC3 A;  5KYY A;  4KUI A;  2BZ8 A;  2EPD A;  2COY A;  4C92 F;  3V7C A;  1X6B A;  4J9G A;  1PHT A;  1WXB A;  1VQO A;  2KYM A;  4JRK A;  3NGP A;  2HEQ A;  1D09 B;  3MCA B;  4LUD A;  5LJ3 d;  1JJ2 A;  3E1S A;  3G71 T;  4ZN1 A;  3EHR A;  3I56 Q;  1HXD A;  5HKC A;  3D7S B;  2PVD B;  1RL2 A;  2KR3 A;  4C92 E;  3CCS A;  3OBY A;  2XI9 A;  1NEG A;  2HL3 A;  2HBW A;  2VB6 A;  4OGE A;  2QG9 B;  3QHS A;  5LJ5 g;  2EKH A;  3TU4 K;  2HNI A;  2X4J A;  1GCQ A;  1UFF A;  2EVR A;  1VYT A;  4F17 A;  1Q86 C;  1VIE A;  1K8A R;  1WQW A;  2CT4 A;  3CME A;  7AT1 B;  1YHQ T;  5KYX A;  2AZS A;  5LJ5 e;  2OI3 A;  3T9N A;  3ZEH A;  2EJG A;  3HHT B;  3NTK A;  1SG5 A;  1U06 A;  4RTT A;  1YJW T;  2RHU A;  2LC4 A;  1NPR A;  4JS5 A;  4MZT A;  1RAA B;  3TEE A;  2HMA A;  4IKF A;  2K4Y A;  1CSK A;  2KRN A;  4AG2 C;  4M7A C;  1KSW A;  3FB9 A;  2DVE A;  5GAO p;  1PM3 A;  2ED0 A;  3M54 A;  3RMQ A;  1AZE A;  2DBK A;  4XAX B;  5IAY A;  1EZZ B;  3TQ7 P;  1D0X A;  2EBP A;  3G6E A;  2BE9 B;  2YUN A;  1R0B G;  4PFO A;  1YIJ T;  2V8J A;  2YDL A;  5HK0 A;  4X1V A;  4M7A D;  1KC8 R;  2EQI A;  4E7Z A;  1WXU A;  3HPW A;  4C8Q A;  4A54 A;  2QI2 A;  2CUD A;  4C92 G;  4HVU A;  5IXF A;  4F7U E;  4PK4 A;  3WVE B;  2FPF A;  5FLX E;  3M0R A;  3CC7 T;  3J7A F;  1M3A A;  2DM1 A;  1VQN A;  3OW2 P;  4EMK A;  4J8O A;  1G8X A;  2FYK A;  3ZBD A;  4ZNX A;  1M3B A;  2QAS A;  3EGX A;  1WHK A;  3Q1J A;  4MDW A;  5FU6 B;  1I5L A;  3G71 Q;  4EDU A;  1PD0 A;  4Z89 A;  1U8R A;  1K1Z A;  4ZGE B;  2VGM A;  2J6K A;  4J6X A;  1VQO T;  2EYW A;  1NJI U;  2ZPF B;  1LOJ A;  4FW1 A;  2LJ1 A;  2LJ0 A;  1UB4 A;  1WYX A;  4XU3 A;  1WJS A;  3RES A;  2JTM A;  1PG5 B;  1OX8 A;  2E6N A;  2K5I A;  4M77 F;  3OYF A;  2YLB A;  1WZO A;  1RAH B;  4J9B A;  3SB2 A;  2LNH B;  1YHQ Q;  2ZCF B;  2RQW A;  5GMK i;  2MOX A;  3CCS T;  2IVW A;  2MF2 A;  1M5Q 1;  3M9Q A;  4OMQ A;  2LCC A;  5GAN 8;  2RA2 A;  2DXU A;  2EYQ A;  2O31 A;  2EQM A;  3MPU B;  2FHD A;  3MEU A;  1YIT A;  1QWF A;  3EFO A;  4WCI A;  3GOX A;  3INZ A;  3JCM J;  5KYY B;  3CME T;  2RJD A;  2EJ9 A;  3X25 B;  1M4Z A;  3LW5 E;  2JMC A;  3VS1 A;  1KK7 A;  1Q81 U;  4M77 E;  2IPO B;  1FWZ A;  1GFC A;  1I1J A;  2A0F B;  4C92 C;  1BBZ A;  1TUC A;  3LH0 A;  2VXE A;  5EG2 A;  2E3H A;  1BB9 A;  1Y57 A;  3V8J A;  1TG0 A;  1X6G A;  4FSS A;  4EIK A;  3BW1 A;  1YIJ Q;  4MDX A;  4Q5W A;  2WAC A;  1T3L A;  2OX7 A;  1UHC A;  2RPN A;  4A4F A;  3C12 A;  2BZX A;  2KNB B;  1K9A A;  3JCM b;  2GBQ A;  3G6E T;  2J6O A;  1Q7Y R;  3JB9 I;  2W10 A;  1WHG A;  4FYW B;  4C92 D;  2DO3 A;  2P0P A;  2K3Y A;  3N5B B;  1YP5 A;  1LCK A;  3CC7 Q;  3THK A;  3DB4 A;  4IUP A;  3S3O A;  1ZSZ C;  2HQE A;  1G3W A;  1FYN A;  2VUB A;  2XDD A;  2P0Q A;  1W2B S;  2YRC A;  1OOT A;  4ZGD B;  2SEM A;  4RG8 A;  2KT8 A;  5GAM e;  3EGD A;  4Z02 A;  1VQO Q;  1VQN T;  3TSW A;  4BDY A;  3CPW S;  1UGS B;  3VRY A;  1GL5 A;  2Y4Y A;  2FZG B;  3PVQ A;  3RKX A;  4XTZ A;  3CBP A;  1K73 R;  2KBT A;  3QWY A;  4BI3 A;  3CCS Q;  2XHC A;  3MKD A;  1I4K 1;  2HQH A;  3ASK A;  5GAN 5;  1KG1 A;  1VQP A;  3JCM f;  3OY9 A;  3REB B;  1M2V A;  3C95 A;  1WQ7 A;  1JJ2 S;  1R0C B;  4FM4 B;  3P8H A;  4N0A A;  4J83 A;  1WJQ A;  1JO8 A;  3R6O A;  4C8Q B;  1E6H A;  3MP6 A;  2LZ6 B;  4F04 B;  3OS0 A;  1NYG A;  2OTL A;  3CME Q;  1R8O B;  3CCU A;  1VQ7 A;  3P8B B;  1TWB A;  1M8V A;  4LDY A;  2QDY B;  3JCM h;  1MMA A;  4IUV A;  1YIT T;  3IQL A;  3RER A;  1P92 A;  1MMN A;  1EIF A;  3S3N A;  1IXD A;  3J80 E;  3EGX B;  3A8G B;  4OGC A;  5I2S A;  4DOW A;  4HA8 A;  2RI5 A;  4FU6 A;  5LJ3 g;  2D1X A;  5I2M A;  1W4S A;  5CAI A;  2AKL A;  2E5Q A;  3G6E Q;  4JRP A;  3GPL A;  4OB3 B;  2MK5 A;  2RQR A;  1ZA2 B;  3URG A;  1SF9 A;  2V1Q A;  2PVG B;  4M7D E;  1G3T A;  1I5O B;  5LJ3 e;  4C8Q F;  1EX4 A;  1UG1 A;  4ZTF A;  4JPB W;  1WPY A;  3PVL A;  3JCM g;  1NJI C;  2I0N A;  4M77 C;  4AFQ C;  2HD0 A;  2HSP A;  4QQG A;  2CZ0 B;  2PU9 B;  1TUD A;  3VYH B;  3A1P A;  3EFO B;  4KBM B;  1W6X A;  4ZN3 A;  1GFD A;  2RF0 A;  2EQU A;  3QJY A;  5FU6 C;  4ESR A;  3PGG A;  3CQT A;  1SKU B;  4A4G A;  1VIF A;  3JB9 F;  4C8Q E;  4JJC A;  4M78 G;  1YFN A;  3KFV A;  3UDC A;  1W70 A;  3BDL A;  3A8H B;  2NYS A;  1KFZ A;  2O9V A;  1VQ9 A;  2OAU A;  2B8A A;  2BIV A;  1TTH B;  1TU0 B;  3LLR A;  4CC2 A;  2KEA A;  3M0U A;  4CI0 C;  1Q81 C;  1JXO A;  5GAN j;  1BI0 A;  5CCA A;  3I5R A;  2KK4 A;  1FMV A;  4EMH A;  5GAO m;  2DYB A;  3MJX A;  3QJ6 A;  4NL2 A;  1QVF A;  4JJD A;  2NUP A;  4LDW A;  1VQP T;  1T3S A;  2EKO A;  2IIM A;  3MET A;  2CH4 A;  1YIT Q;  3QPH A;  3CCM A;  2EYY A;  2KI7 A;  2OTL T;  2CZ6 B;  2X3W D;  3M4Y A;  4F7U A;  4QVC A;  1W2B P;  2F2V A;  3LH5 A;  1YCS B;  3CCU T;  1VQ7 T;  4XU0 A;  2RNA A;  3EGD B;  2DTI A;  4HT8 A;  1UGR B;  3OYL A;  1G2B A;  2HBP A;  4D8K A;  2KVQ G;  4C8Q G;  5GAN d;  1IHV A;  2DL5 A;  2LDM A;  5J3B A;  3A8L B;  1ZA1 B;  5GAN 6;  1WX6 A;  3H41 A;  1ABO A;  1K9M R;  2DIG A;  2KQW A;  3FJ5 A;  4LNP A;  2D0N A;  3QYG B;  1C0M A;  3R6N A;  1GCQ C;  1M2V B;  1ZHI A;  2E65 A;  1U3O A;  4LD6 A;  1JJ2 P;  1D1C A;  2JW4 A;  2K79 A;  1N8R U;  1ZUK A;  1OPK A;  5GMK m;  2R5A A;  4PL6 A;  2M16 A;  1WHM A;  4O5V A;  3PTA A;  4BY6 B;  4BI4 A;  3JB9 G;  4P5N A;  1BI3 A;  2HL5 C;  1XTD A;  1PCX A;  1Q95 G;  1UGV A;  5GMK h;  1X69 A;  4QQD A;  1TH7 A;  2E12 A;  5I21 A;  3OSV A;  3H6Z A;  3WXM B;  2DL8 A;  3L2U A;  5DLQ E;  4A4E A;  2AIR B;  1C6V X;  3L2R A;  2GQI A;  3FC3 A;  4KUL A;  3RKY A;  2LQK A;  4XTX A;  2J06 A;  3FIF A;  4IUR A;  1VQ9 T;  3EG1 A;  4FYY B;  3LGL A;  5L23 A;  1NLP C;  5ECA A;  2JJ9 A;  2CSQ A;  4FYX B;  2VC8 A;  1VQP Q;  1BU1 A;  3CCQ A;  4L5G A;  2DKG A;  4C8Q C;  1RAC B;  1OU8 A;  2DBM A;  2OTL Q;  2PUO B;  2YUQ A;  5IN1 A;  2PUK B;  2JN0 A;  2RHX A;  1HSQ A;  2DXB A;  2MCN A;  3C4S A;  1CKB A;  2L3R A;  4EMK C;  4DEY A;  1DJ7 B;  2QQS A;  1PSE A;  1SRL A;  3L2V A;  3CCM T;  5LJ5 f;  1YBY A;  4C0D B;  3NHN A;  2EIF A;  3JCM W;  2DL7 A;  3OBW A;  3S3M A;  2QA4 A;  2KY9 A;  1OZ3 A;  4C8Q D;  2X4W A;  1FXX A;  1NE8 A;  4IUQ A;  4DBQ A;  2F2W A;  1IHW A;  4LDV A;  3VV0 A;  4CRI A;  3SFM A;  5LJ5 h;  2K3X A;  4KGZ B;  4J9C A;  1QCO A;  1FMK A;  1OX9 A;  2JOY A;  3QDR B;  1HD3 A;  1ZQ1 A;  5AYF A;  3JCM c;  4HCZ A;  4JLG A;  3VS3 A;  2K57 A;  3G1J A;  2CSI A;  1VQK A;  2E10 A;  3JB9 D;  3EAE A;  2FPD A;  3X24 B;  5GAO r;  4XU1 A;  1KHC A;  1LVK A;  3PIP A;  1PRM C;  5FRM A;  1UTI A;  3HRU A;  2XG8 D;  2DVJ A;  1VQ8 A;  5L8R E;  1HJD A;  2HSE B;  4F7U B;  3EFS A;  2DF6 A;  4OMM A;  3HFO A;  1KD1 U;  2CZ1 B;  2P4R A;  1UGQ B;  2RK2 A;  2QXF A;  2L0A A;  2JT4 A;  1OI1 A;  1M1K R;  3EG9 A;  2RJC A;  3TVT A;  1QQJ A;  1VQ9 Q;  1UUE A;  2W0Z A;  3RDV A;  4Z88 A;  1YJN A;  4JJB A;  2RB6 A;  2XIC A;  3FJP A;  2PVO B;  5CQX A;  4IUU A;  1Y07 A;  4XK8 E;  3OYK A;  3C94 A;  1K9M U;  2DFU A;  4J6W A;  2O9S A;  2D9T A;  2DMO A;  4DA4 A;  4KH0 B;  3GF5 A;  4M7D A;  1Q82 R;  3EG2 A;  2GGR A;  3X20 B;  1F1B B;  3VS2 A;  2DNU A;  2Y4X A;  8AT1 B;  3CBM A;  5A2Q E;  1I8F A;  4J9D A;  3CCQ T;  3CC2 A;  4Z8A A;  4F7U F;  4FT2 A;  1X27 A;  3CD6 A;  3CCM Q;  2YHT A;  1X2Q A;  3A5Z B;  1VQ5 A;  1QVF S;  1U1T A;  5CO7 A;  2OAW A;  2C0I A;  1N8R C;  2OJ2 A;  3EHQ A;  1SSH A;  1XOV A;  4M77 B;  3HSB A;  4AT1 B;  2CP5 A;  2WSE E;  4KGV B;  2QA4 T;  3PMT A;  2PNI A;  1FMW A;  4RTY A;  4D6W A;  1B07 A;  1N9R A;  2DRK A;  3VS5 A;  4IUT A;  3M0S A;  1NBE B;  4N0A C;  3H8Z A;  1U1S A;  1QP2 A;  3NFC A;  2KXC A;  4JRI A;  1SSF A;  4EMG A;  4L59 A;  4BY6 C;  2J7I A;  3RR6 A;  2X3X D;  3OYY A;  1ZX6 A;  5IXB A;  1VQK T;  1X43 A;  2HKQ B;  2RQV A;  4RUG A;  1ABQ A;  1UGP B;  3HP9 A;  1UEC A;  2K5L A;  2QGF B;  4R56 A;  2EW3 A;  1VQ8 T;  2DTO A;  2NWM A;  3DKM A;  4J9E A;  5J39 A;  1NLO C;  2R57 A;  2DJZ A;  5GAM f;  3LGF A;  4RCB A;  3OMC A;  2C06 A;  1YJ9 A;  5CKD A;  1ACM B;  1YJN T;  5A0L A;  2M02 A;  4OP0 A;  1B3Q A;  4F7U G;  5FU7 C;  2A3L A;  2MMP A;  3CCQ Q;  1B34 A;  5GAM h;  1W1F A;  2P4T A;  4E7J A;  5GAN e;  5HK3 A;  1TUG B;  2JZ2 A;  2A08 A;  2KT1 A;  4AFZ C;  1MGQ A;  3MP1 A;  5CKF A;  3ULR B;  2X4Y A;  2FRY A;  3CC2 T;  3OYI A;  3RIR A;  4B9W A;  3CD6 T;  4C0D C;  3UF4 A;  4ATO A;  3PNW C;  1IGQ A;  3HRS A;  2QA4 Q;  1VQ5 T;  3FRN A;  3EG9 B;  1M1K U;  5FWB A;  1X2K A;  2DL3 A;  5GAM g;  5D6Y A;  5KYX B;  1K8A U;  3V7S A;  4LDU A;  4C0F A;  1KD1 C;  2COZ A;  4NS5 A;  1IZ6 A;  4RTU A;  1RAF B;  5CKE A;  2MAM A;  1XJW B;  2VAS A;  2VV5 A;  3PMI A;  1PKS A;  3VS7 A;  1MUZ A;  1QLY A;  4M7D B;  1KQS A;  1Y0M A;  2DIQ A;  2JM8 A;  1Q86 R;  1VQK Q;  1Q82 U;  3JB9 H;  4CC7 A;  3H0H A;  5LJ3 f;  1K0S A;  2PZ1 A;  4M77 G;  5GAO n;  2LTO A;  5KE3 A;  3EH2 A;  1C1A A;  3CEY A;  4J7I A;  1VQ8 Q;  2DE0 X;  3VS6 A;  1K9M C;  4RTZ A;  2JTE A;  2ECZ A;  2QK0 A;  1ZBJ A;  5LJ3 h;  1RI0 A;  1VA7 A;  4E7L A;  1RAD B;  1KC8 U;  5CKB A;  2E3I A;  2B86 A;  5HY6 A;  4PKC C;  1M1G A;  2AKK A;  2R5M A;  2E1H A;  4KH1 B;  1YJN Q;  2KRS A;  2CUB A;  5C6S A;  1VQ6 A;  4A63 B;  4M7D F;  4DEX A;  4ELY C;  3I55 A;  1RAI B;  2JS0 A;  4M75 A;  4EMK B;  4QVZ A;  3SWN A;  5A0G A;  1AHJ B;  1YJ9 T;  4ZGJ B;  3RNJ A;  2DRM A;  2YLC A;  3P8D A;  2M1H A;  1RLQ C;  1X75 C;  2V1R A;  3M58 A;  3EH1 A;  2FL7 A;  2F5K A;  3HFN A;  2XID A;  3OS1 A;  3CC2 Q;  4J9H A;  3QZ9 B;  1VQL A;  3CD6 Q;  3GLX A;  2EGA A;  2WSF E;  4BD3 A;  2QDL A;  1VQ5 Q;  1OUL A;  4DBH A;  2BKD N;  4A53 A;  3QO3 A;  1CKA A;  2ZZD A;  1NYF A;  1AWO A;  1I07 A;  2O4X A;  2ZPE B;  2DPP B;  2KYB A;  1MHN A;  1D0Y A;  2ENM A;  1UHF A;  1IRX A;  5FRO A;  4ANJ A;  4DBR A;  1PD1 A;  1M27 C;  2MWP A;  3OSS C;  2LX7 A;  3CC4 A;  2E4H A;  3L2W A;  3BY7 A;  3V7R A;  1ZLM A;  1WHH A;  2CKK A;  3EFR A;  2NUT A;  3QZ5 B;  4J6Y A;  5IT9 E;  1B34 B;  1AVZ C;  1QW1 A;  2LP5 A;  4M77 D;  4N4I A;  1PRL C;  4C5E A;  4DQ2 A;  1AT1 B;  5GAN 2;  3UA6 A;  3KXT A;  2EGC A;  2X51 A;  2DD4 A;  1E7O A;  2M0O A;  1SPK A;  5D6W A;  3G4S A;  3JB9 J;  2A7Y A;  3DB3 A;  2Z0W A;  2RJF A;  3EGU A;  2DEQ A;  1QKX A;  1KHI A;  1RAB B;  2E41 A;  4Y91 A;  3ZL7 C;  2GFA A;  1Q7Y U;  2ABL A;  8ATC B;  4ZTJ A;  4ME7 A;  3MEW A;  2L8D A;  4M7D G;  1K76 A;  3SD4 A;  2SRC A;  3GBQ A;  3QYH B;  3X28 B;  1A0N B;  2EQK A;  2RQU A;  4OB1 B;  1YJ9 Q;  2C0O A;  1K0X A;  3OS2 A;  2BUD A;  1B7T A;  5CQY A;  1N27 A;  1FX7 A;  1VQ6 T;  1H64 1;  3QG1 A;  2DA9 A;  3I55 T;  3NTH A;  3QUI A;  2J05 A;  1K8A C;  3CMA A;  2F69 A;  1Q86 U;  1RAE B;  2Y90 A;  3CPW P;  2DL4 A;  4BUG A;  4DOV A;  1IRE B;  2O01 E;  5IHK A;  2L3S A;  2KRO A;  4Y28 E;  1BI1 A;  3A98 A;  4R55 A;  5CK9 A;  1K73 U;  4X34 A;  1QP3 A;  3TRE A;  1VQL T;  1E6G A;  4HVW A;  3ZFJ A;  1QCN A;  1QKW A;  1N6A A;  4XTW A;  2CP7 A;  2I2L A;  3ER0 A;  4BB7 A;  2X4X A;  4FSX A;  4F16 A;  3CXC A;  5KH6 A;  3SHW A;  1WIE A;  3UWN A;  4PJJ A;  3VU3 C;  2RHZ A;  1D1B A;  1OQK A;  4HCB A;  2JNG A;  4QW2 A;  1GBQ A;  2HQX A;  2LNV A;  4M75 B;  2RD1 A;  4MMK A;  3E2U A;  3QWX X;  1BK2 A;  4JDS A;  1BCM A;  1KC8 C;  2CT3 A;  4M7D C;  1NEB A;  3CC4 T; 
#chains in the Genus database with same CATH homology
 2PVO B;  5EG2 A;  5CQX A;  4IUU A;  3GNF B;  1D3B B;  3V8J A;  3F70 A;  2RI2 A;  1Y07 A;  4XK8 E;  3BW1 A;  3OYK A;  3CCL T;  1LNX A;  4QQ6 A;  1VQ4 T;  3C94 A;  1K9M U;  4MDX A;  2ZPB B;  4Q5W A;  4XTU A;  4J6W A;  4C92 A;  2WAC A;  3SDZ A;  2D9T A;  4DA4 A;  3GF5 A;  4M7D A;  4L6V 5;  3C12 A;  4A4F A;  2R58 A;  1X01 A;  3X20 B;  5DM7 R;  2Y4X A;  2E6Z A;  4O6J A;  3CBM A;  5CKH A;  1I8F A;  2GCX A;  3JCM b;  5A2Q E;  3G6E T;  3LWI A;  3CCQ T;  3JRZ A;  4LD9 K;  3CC2 A;  4F7U F;  5KCH A;  3G4S T;  3JB9 I;  3JCM e;  3GP8 A;  4FT2 A;  2HAX A;  3I56 A;  4C92 D;  1KQS S;  1NZ9 A;  5FRN A;  3VUB A;  3CD6 A;  2VGN A;  2YHT A;  4M7D D;  2DO3 A;  3CBO A;  5FU7 B;  2P0P A;  3A5Z B;  2DK3 A;  2K3Y A;  3N5B B;  2CYZ B;  3QXE B;  2O4X B;  2LCL A;  2V8I A;  3DB4 A;  4IUP A;  2DXC A;  1VQ5 A;  1QVF S;  3S3O A;  2HQE A;  1G3W A;  2VUB A;  1U1T A;  5CO7 A;  2RJE A;  2XDD A;  2P0Q A;  4OB0 B;  4M75 F;  1N8R C;  4J5Y A;  3S6W A;  3JCM P;  1W2B S;  2NLU A;  1QVG S;  3CCR A;  1XOV A;  3PIO A;  2DTH A;  4M77 B;  2EFI A;  4HT9 A;  1M9S A;  4ZGD B;  2K5F A;  3HSB A;  4RG8 A;  5GAM e;  4Z02 A;  1BIA A;  2WSE E;  5GAO q;  2QA4 T;  1VQN T;  3GIB A;  3PMT A;  3OYM A;  4N4G A;  2G3R A;  2QQR A;  4D6W A;  3DLM A;  4GY5 A;  4BDY A;  1N9R A;  3CPW S;  4A4H A;  4FL6 A;  1UGS B;  3KUF A;  4A4K A;  5M9O A;  3QII A;  4WF2 A;  4IUT A;  2JTF A;  2Y4Y A;  4PJO C;  4M7A B;  3OS5 A;  3J81 E;  3RKX A;  1PSF A;  3CMA T;  4XTZ A;  4JRQ A;  5DY9 A;  4N0A C;  3CBP A;  4M75 E;  3H8Z A;  1O9S A;  1U1S A;  4BDZ A;  1M1K C;  1KQ2 A;  1QP2 A;  4FT4 A;  1GXI E;  4BI3 A;  4V2S A;  3ME9 A;  2XHC A;  3NFC A;  4JRI A;  1I4K 1;  1SSF A;  3ASK A;  4EMG A;  5GAN 5;  4L59 A;  4BY6 C;  2QEX T;  4BAC A;  1KG1 A;  1M1F A;  2XU8 A;  1VQP A;  3JCM f;  1BKB A;  1Y96 B;  3OYY A;  3OY9 A;  1VQK T;  4PJO A;  4XU2 A;  3C95 A;  1WQ7 A;  1JJ2 S;  1OYX A;  1VUB A;  3P8H A;  4FM4 B;  3RKW A;  4N0A A;  4J83 A;  1WJQ A;  3R6O A;  4C8Q B;  1VQM A;  3OYE A;  3MP6 A;  3OS0 A;  3QBY A;  1UGP B;  3HP9 A;  4E47 A;  2K5L A;  2OTL A;  3HKS A;  2FVU A;  2LT1 A;  3MHX A;  3OA6 A;  3L2Q A;  1R8O B;  4UC4 A;  4R56 A;  2DZC A;  2WSC E;  3UT1 A;  2RHI A;  4KT0 E;  1VQ8 T;  4X9C A;  2DTO A;  3CCU A;  4PJO D;  5GAO l;  2RI3 A;  2RK1 A;  1Q82 C;  3DKM A;  3P8B B;  5A0D A;  1VQ7 A;  1M8V A;  4LDY A;  2QDY B;  1OZ2 A;  3JCM h;  5J39 A;  2QQ9 A;  4IUV A;  1YIT T;  3RER A;  2R57 A;  4XQ3 A;  1P92 A;  2DJZ A;  3S3N A;  1EIF A;  2OTJ A;  3VKI A;  5GAM j;  1Q7Y C;  5GAM f;  3LGF A;  3J80 E;  3CCV T;  3A8G B;  4RCB A;  3M53 A;  3OMC A;  5GAN 7;  2C06 A;  2KAF A;  4M78 C;  3DLL A;  3L2Z A;  3KBG A;  3OYB A;  1YJ9 A;  4M7A F;  4OGC A;  5I2S A;  3M5A A;  5CKD A;  4DOW A;  4JJN K;  4HA8 A;  2RI5 A;  2E64 A;  3CPF A;  2ZPH B;  4YTL A;  2XDB A;  1HK9 A;  4FU6 A;  5LJ3 g;  5A0L A;  1YJN T;  3JCM X;  3BFM A;  5I2M A;  2L5Q A;  1W4S A;  4OP0 A;  5CAI A;  1WJR A;  4F7U G;  2E5Q A;  5FU7 C;  4RKU E;  3G71 A;  2A3L A;  3LH0 A;  1ZBX A;  2MMP A;  1B34 A;  3LX7 A;  1Y71 A;  4MZM A;  3SWN B;  4M78 A;  4JRP A;  2DXT A;  3AHU A;  5GAM h;  3LWH A;  3GPL A;  2P4T A;  3OMG A;  2EJF A;  3L42 A;  4OB3 B;  2GQV A;  3BDU A;  3FEO A;  5GAN e;  3URG A;  5HK3 A;  4E7J A;  1M90 C;  2PVG B;  3OQ5 A;  1I81 A;  4ELZ C;  3JCM d;  4LDX A;  1G3T A;  4X9D A;  4M7D E;  5LJ3 e;  2JZ2 A;  4C8Q F;  3LYI A;  5KCO A;  4ZTF A;  1MGQ A;  1WPY A;  4QVD A;  4BI8 B;  3MP1 A;  5CKF A;  3JCM g;  3CCE A;  1NJI C;  3OYH A;  2X4Y A;  4M77 C;  2HD0 A;  5DLO A;  4M78 D;  4M75 G;  3VYG A;  3CC2 T;  3OYI A;  4M7A E;  1G3Y A;  3RIR A;  3E9G A;  1XNI A;  4QQG A;  2CZ0 B;  3I56 T;  1G5V A;  4TVR A;  4B9W A;  3CD6 T;  2ZGW A;  4C0D C;  4KUD K;  4JLI A;  2PU9 B;  4ATO A;  3PNW C;  3X26 B;  3VYH B;  1YHQ A;  2EWN A;  3HRS A;  4KBM B;  2LX9 A;  4M77 A;  4ZN3 A;  1K73 C;  5LL6 S;  3WVD B;  4C0G A;  1VQ5 T;  5GAM d;  2EQU A;  4B9X A;  3FRN A;  3QJY A;  3E19 A;  5D6X A;  5FU6 C;  1M1K U;  2LT4 A;  3PGG A;  4A4G A;  1VIF A;  3JB9 F;  4C8Q E;  5GAM g;  2CGH A;  3M59 A;  1WNL A;  4M78 G;  5D6Y A;  3CCR T;  1YJW A;  1K8A U;  3V7S A;  4LDU A;  4C0F A;  3QKJ A;  5GMK l;  3OW2 S;  4HCC A;  3UDC A;  4XTY A;  1JRI A;  1KD1 C;  3BDL A;  4NS5 A;  3A8H B;  1IZ6 A;  4NOY A;  2ZPI B;  2M9U A;  1QVP A;  1JBM A;  1VQ9 A;  2OAU A;  2B8A A;  2BIV A;  5CKE A;  2MAM A;  3HL8 A;  2VV5 A;  3PMI A;  2D6F A;  3LLR A;  3M4G A;  2XDP A;  3G7Z A;  2GF7 A;  4C92 B;  4FIB A;  2FB7 A;  4CI0 C;  4M7D B;  5GAN 3;  1Q81 C;  1KQS A;  1V29 B;  2DIQ A;  2XKO C;  5CVI A;  5GAN j;  3PT9 A;  5GAN f;  1Q82 U;  3JB9 H;  1BI0 A;  5J26 A;  3VJP A;  3OYA A;  3V8L A;  5CCA A;  2VXF A;  2KK4 A;  2DZ9 A;  5LJ3 j;  5LJ3 f;  4EMH A;  3M55 A;  1BIB A;  5GAO m;  3QJ6 A;  5CR2 A;  4J7F A;  1YIJ A;  4M77 G;  4NL2 A;  2QTX A;  2P0K A;  5GAO n;  2LTO A;  5KE3 A;  1QVF A;  2RM4 A;  2LRQ A;  5GMK e;  3CEY A;  4J7I A;  1W2B A;  1QVG A;  1K9M C;  2PQW A;  4LDW A;  1VQP T;  3JCM V;  2EKO A;  4C5H A;  3MET A;  4OB2 B;  5GAN h;  3QPH A;  2CZ7 B;  4E7I A;  1VQM T;  3VUZ A;  3RUX A;  3CCM A;  5LJ3 h;  3JAM E;  3OYG A;  2OTL T;  1RI0 A;  4E7L A;  2QQB A;  2CZ6 B;  1KQ1 A;  3M4Y A;  4F7U A;  4QVC A;  4RG2 A;  3CC7 A;  1KC8 U;  5CKB A;  4M7A G;  2K2V A;  4C5I A;  3CPW A;  4OF1 A;  2V8K A;  4OMF B;  4M75 C;  3CCU T;  5HY6 A;  4PKC C;  1VQ7 T;  4XU0 A;  3SWN C;  1M1G A;  1XQH A;  2L89 A;  2E1H A;  1JB0 E;  2R5M A;  2DTI A;  2H3J A;  3A8O B;  3HRT A;  4GLK A;  4C0Z A;  4BE2 A;  4HT8 A;  4NL3 A;  4RCC A;  1UGR B;  4KUI A;  5C6S A;  2OTJ T;  1H3Z A;  1VQ6 A;  4C92 F;  3OYL A;  2HBP A;  1UEB A;  3V7C A;  4M7D F;  4II1 A;  4ELY C;  3I55 A;  3MEA A;  4M75 A;  4EMK B;  2KVQ G;  1VQO A;  4QVZ A;  4C8Q G;  3SWN A;  5A0G A;  1AHJ B;  4N4H A;  3CXC S;  3UPU A;  1YJ9 T;  4JRK A;  4ZGJ B;  5GAN d;  2LDM A;  2YLC A;  5J3B A;  3P8D A;  2M1H A;  3MCA B;  1BI2 A;  3A8L B;  5LJ3 d;  1D3B A;  1JJ2 A;  1X75 C;  3TCJ A;  5GAN 6;  3OYN A;  2XK0 A;  3M58 A;  5GAN g;  2FL7 A;  2F5K A;  2JUF A;  3E1S A;  3G71 T;  3HFN A;  2XID A;  2DIG A;  4ZN1 A;  4M75 D;  3OB9 A;  3OS1 A;  3MEV A;  2KQW A;  3QYG B;  5KE2 A;  2LQ8 A;  3CCJ A;  1HXD A;  3QZ9 B;  1VQL A;  4PJO B;  5GMK j;  1ZHI A;  2E65 A;  2MWO A;  3JCM Q;  3GLX A;  3JSC A;  4LD6 A;  2KSS A;  5HKC A;  2PVD B;  2WSF E;  1RL2 A;  4C92 E;  3CCS A;  4BD3 A;  3QSU A;  1N8R U;  3CCE T;  3OBY A;  5GMK m;  2LVM A;  2R5A A;  2XI9 A;  5LJ5 g;  4PL6 A;  4OGE A;  2M16 A;  3QHS A;  4O5V A;  2BKD N;  3PTA A;  4BY6 B;  4A53 A;  4BI4 A;  3TU4 K;  3JB9 G;  2HNI A;  3QO3 A;  2X4J A;  1BI3 A;  4P5N A;  3OYD A;  5CIU A;  2ZZD A;  4JS4 A;  1Q86 C;  4BE1 A;  1VIE A;  5GAN 4;  2O4X A;  2ZPE B;  1WQW A;  1XTD A;  2DPP B;  3CME A;  1YHQ T;  1MHN A;  5GMK h;  4QQD A;  5LJ5 e;  1TH7 A;  2E12 A;  5I21 A;  4HKE A;  3OSV A;  3T9N A;  1N9S A;  5FRO A;  2EJG A;  3H6Z A;  3ZEH A;  3WXM B;  1S72 A;  3HHT B;  4OVA A;  3NTK A;  3L2U A;  5DLQ E;  2JVV A;  4A4E A;  2F5T X;  3L2R A;  1YI2 A;  2MWP A;  3OSS C;  1YJW T;  2RHU A;  3CC4 A;  2LC4 A;  3L2W A;  1NPR A;  3BY7 A;  3V7R A;  4JS5 A;  4MZT A;  3FC3 A;  4KUL A;  3RKY A;  2LQK A;  3TEE A;  4XTX A;  4IKF A;  2K4Y A;  4M7A C;  2CKK A;  3FIF A;  3EFR A;  4EPC A;  3QZ5 B;  4J6Y A;  2MI6 A;  3FB9 A;  4E7H A;  2KDS A;  4PLL A;  5IT9 E;  4IUR A;  1VQ4 A;  1B34 B;  3CCL A;  4RMO A;  4M78 B;  2DVE A;  1QW1 A;  5GAO p;  1VQ9 T;  4M77 D;  4PJO F;  4N4I A;  2RHY A;  4C5E A;  4DQ2 A;  3M54 A;  3RMQ A;  3LGL A;  4XAX B;  5IAY A;  3E9F A;  5GAN 2;  3KXT A;  2DD4 A;  4M7A A;  2VC8 A;  3G6E A;  3O8V A;  3CCQ A;  2M0O A;  2DKG A;  4L5G A;  5D6W A;  4JUV A;  2DAQ A;  3G4S A;  3M57 A;  1Y7X A;  4C8Q C;  4PNO A;  3JB9 J;  2A7Y A;  3DB3 A;  3RMS A;  2AHJ B;  1YIJ T;  2RJF A;  2PUO B;  2DEQ A;  2V8J A;  5IN1 A;  2PUK B;  1Y96 A;  2JN0 A;  5HK0 A;  1BYM A;  1KHI A;  4M7A D;  2E41 A;  2EAY A;  2RHX A;  4Y91 A;  2DXB A;  2GFA A;  3C4S A;  4C5G A;  1Q7Y U;  5C0M A;  3HPW A;  4C8Q A;  2L3R A;  3OW2 A;  4A54 A;  2QI2 A;  4EMK C;  4ZTJ A;  1DJ7 B;  2EQJ A;  1O75 A;  3MEW A;  4ME7 A;  4C92 G;  2QQS A;  4PJO E;  4BE0 A;  1PSE A;  2L8D A;  4M7D G;  3L2V A;  3CCM T;  4F7U E;  3WVE B;  5LJ5 j;  5LJ5 f;  1YBY A;  3SD4 A;  3A8M B;  4C0D B;  5FLX E;  3OYC A;  2EIF A;  2RH2 A;  3JCM W;  3CC7 T;  3QYH B;  3OBW A;  3X28 B;  3S3M A;  3J7A F;  2CS7 A;  2EQK A;  2QA4 A;  2DD5 A;  2KY9 A;  1VQN A;  2YRV A;  4OB1 B;  1OZ3 A;  4C8Q D;  2X4W A;  1FXX A;  4EMK A;  4J8O A;  2FYK A;  4M78 F;  3ZBD A;  1NE8 A;  1LJO A;  2QQA A;  3Q1J A;  5FU6 B;  2BUD A;  4MDW A;  3OS2 A;  1M90 U;  5CQY A;  1I5L A;  1N27 A;  1FX7 A;  1VQ6 T;  1H64 1;  4EDU A;  4IUQ A;  3V8K A;  3QG1 A;  3OYJ A;  1U8R A;  4LDV A;  3VV0 A;  2IG0 A;  4CRI A;  3I55 T;  3NTH A;  3SFM A;  4ZGE B;  2K3X A;  5LJ5 h;  3QUI A;  2VGM A;  4J6X A;  1VQO T;  2ZPG B;  1NJI U;  2ZPF B;  3L1A A;  2D0Q B;  2RO0 A;  3CMA A;  4E7K A;  1K8A C;  2F69 A;  1LOJ A;  1Q86 U;  2Y90 A;  2JOY A;  3FLG A;  2GFU A;  3QDR B;  4BUG A;  2KMT A;  4DOV A;  1IRE B;  1UB4 A;  1ZQ1 A;  4XU3 A;  2O01 E;  5AYF A;  3JCM c;  4HCZ A;  1WJS A;  4JLG A;  3RES A;  2QEX A;  2JTM A;  4Y28 E;  2K57 A;  1VQK A;  1BI1 A;  2E10 A;  3NTI A;  3JB9 D;  2E6N A;  3EAE A;  3X24 B;  2K5I A;  4M77 F;  4XU1 A;  3CCJ T;  5GAO r;  4R55 A;  3OYF A;  2YLB A;  4VUB A;  5CK9 A;  2X35 A;  3MO8 A;  1K73 U;  4M78 E;  1KHC A;  1QP3 A;  4X34 A;  3TRE A;  4MML A;  1VQL T;  2XD0 A;  3PIP A;  5FRM A;  3SB2 A;  3HRU A;  3ZFJ A;  2XG8 D;  3PFS A;  3CC4 T;  2E70 A;  2ZCF B;  5GMK i;  3CCS T;  2IVW A;  1N6A A;  1X6O A;  2MF2 A;  4XTW A;  1M5Q 1;  3M9Q A;  2LCC A;  2I2L A;  1VQ8 A;  5L8R E;  5LJ5 d;  3ER0 A;  4F7U B;  4MZP A;  2RA2 A;  4BB7 A;  1WGS A;  4PLI A;  5GAN 8;  3EFS A;  2DXU A;  2EYQ A;  2X4X A;  4FSX A;  2EQM A;  4XTV A;  1YCY A;  3HFO A;  2FHD A;  1KD1 U;  3MEU A;  1G3S A;  2CZ1 B;  1YIT A;  1UGQ B;  2RK2 A;  2QXF A;  2VYT A;  3GOX A;  3INZ A;  5KH6 A;  3CXC A;  3M56 A;  3JCM J;  1OI1 A;  3CME T;  3CCV A;  2RJD A;  1NPP A;  3UWN A;  2EJ9 A;  3MP8 A;  3VU3 C;  3X25 B;  1M4Z A;  3LW5 E;  2RHZ A;  2RJC A;  3FDR A;  4PJO G;  4HCB A;  1S72 T;  2JNG A;  4QW2 A;  4M77 E;  1Q81 U;  1FWZ A;  2HQX A;  2LNV A;  4M75 B;  2RD1 A;  4MMK A;  4C92 C;  4JDS A;  1YJN A;  3GNG A;  1KC8 C;  1YI2 T;  4M7D C;  2RB6 A;  2VXE A;  2XIC A;  3FJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...