4M77G

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77G00
1N9RA 3JB9J 3JCMc 4XU2A 4XTUA 3EFSA 5LJ5f 4C8QG 3JB9I 4M7DA 5GANd 1H641 1Y96B 3V8JA 4RCBA 4C92G 3JB9G 1BIAA 4M75A 4M75C 4XQ3A 4QVDA 1LJOA 2DZ9A 3PGGA 3QO3A 5LJ5j 4XU1A 4JUVA 5LJ3g 3BY7A 4PJOG 3QHSA 2EJGA 2YLCA 3L1AA 4M7AB 5GAOr 4M7AF 5LJ3h 3RKYA 5GAMg 1N9SA 2DXTA 4XTYA 2E1HA 2QTXA 2RM4A 1B34B 1U1SA 5GAMh 4Y91A 4M77F 4M77B 4MMKA 3JCMW 3JCMQ 4X9DA 3JCMg 4QVCA 1JRIA 4C92E 1B34A 2EJ9A 3EFRA 3RESA 2Y90A 1TH7A 2E64A 3JCMb 4M78A 4M78C 3JCMh 1LOJA 3V7RA 3L2ZA 3QSUA 5GAN7 4F7UG 5I21A 1WNLA 4PJOE 4M7DF 4M7DB 1JBMA 3JCMP 5GAOn 4N0AC 4M75F 4M75B 4EMKA 4EMKC 5LJ5g 5GMKl 5LJ5h 5GAN3 5GAOq 4M7AD 2RB6A 2E41A 5GMKh 1KQ1A 4HT9A 4M7AC 3AHUA 5GANe 5GMKj 4M77D 2DKGA 4XTVA 4F7UE 5LJ3d 4XU0A 2E10A 2VXFA 2FYKA 2E65A 5CAIA 5GMKm 5GAMd 4A54A 1BIBA 4M78F 3HFOA 4M78B 3RIRA 3JB9F 1M8VA 4JLIA 5GAOp 1X01A 4M7DD 5GAN2 3V8LA 2ZGWA 5GAN6 3JCMd 4C8QA 4M75D 4C8QC 5GAOl 4EMKB 4M7DE 4C92A 4C92C 1HXDA 5GANf 4N0AA 4NL3A 3JCMV 4PJOA 4PJOC 1WQWA 3SWNC 3SWNA 5GANj 3RKWA 2DJZA 5LJ5d 3HFNA 5GAN4 2DXUA 4NL2A 1MGQA 4DQ2A 3RERA 3BW1A 4XTXA 5LJ5e 2RA2A 5GAOm 2EAYA 4NOYA 4M7AE 4M7DG 3VU3C 1M5Q1 4HA8A 5GMKi 4M78D 3JB9H 2DTIA 4J5YA 4J6YA 4M75G 3QUIA 1I8FA 3V7SA 3JB9D 3GIBA 5GAN8 4M77E 4M78E 4RCCA 3RUXA 3FB9A 4F7UA 5LJ3e 4JRIA 1WQ7A 2HNIA 2RD1A 3V8KA 2YLBA 4C8QB 4C8QF 1KQ2A 4C92F 4C92B 5GAMe 1D3BA 1WPYA 2VXEA 4M7AG 3BFMA 3BDUA 2CGHA 4OP0A 1HK9A 2DTOA 4EMGA 3JCMJ 4XTWA 4PJOF 1YCYA 4PJOB 3SWNB 4HT8A 5GANg 2YHTA 3JCMe 4M75E 4M77G 4M78G 4M7DC 5GANh 2DTHA 3M4GA 1I81A 2DVEA 1I4K1 4XTZA 3JCMX 4V2SA 4J6WA 4X9CA 2I2LA 4EMHA 4JRKA 1Y96A 4XU3A 4PNOA 5LJ3f 2EWNA 5GMKe 4F7UF 1U1TA 2K57A 4F7UB 5GAMf 4C8QD 5LJ3j 4M7AA 4C92D 3INZA 4WF2A 3RKXA 1I5LA 3HSBA 2JN0A 5GAMj 1D3BB 2VC8A 2FB7A 3FJPA 5DY9A 4A53A 4C8QE 3JCMf 2EJFA 4M77A 1LNXA 4M77C 4MMLA 2DZCA 4PJOD 3SB2A 5GAN5 3V7CA 4J6XA 3FIFA 2DEQA
chains in the Genus database with same CATH superfamily
3CCEQ 1UDLA 3D7SB 4RTWA 4FU6A 3QIIA 3OYDA 3L2RA 4OGCA 2FRYA 4FM4B 4MZTA 3HP9A 1D09B 4E7IA 1BI2A 4QVCA 1TWBA 1VQOA 2K3XA 4J9IA 4ZGEB 1X43A 1X27A 4MDXA 1YFNA 2I0NA 4F16A 2QEXT 4DOVA 2JTFA 4HCBA 4JZ4A 1M90C 5L8RE 3CCJA 1UJYA 3QYGB 4DA4A 2D8HA 4XU0A 3CCVQ 5IHKA 5LL6S 4BUGA 2K4YA 5EG2A 1PHTA 3X24B 4ZGJB 3M0SA 2JNGA 5IHNA 1NEGA 3ER0A 4M75D 2AIRB 4AT1B 2X4XA 4J7IA 3CPWA 2LQWA 3HKSA 1KD1C 1D0XA 5CQYA 5LJ5e 1YJ9A 2OI3A 2ZPFB 1FMVA 1GFDA 3WXMB 3M0QA 4PLIA 1QCNA 1Q82U 1U5SA 4HKEA 1QWFA 3JCMJ 2DETA 3L2UA 4M78G 1SKUB 1ZLMA 2L5QA 3MPUB 2I2LA 3OB9A 4YTLA 3KXTA 5LJ3f 4WCIA 1XJWB 2EWNA 4ANJA 1Y57A 3EGDA 4ZN3A 1OU9A 1KSWA 3TSWA 2MPXC 3UPUA 4ZTJA 1WX6A 1PM3A 4FL6A 3CCST 2CYZB 1G83A 4M7DA 2DL7A 2M9UA 2FPEA 4CI0C 2CZ1B 2P84A 1BCMA 3REBB 1QVFS 2DF6A 2H3JA 1VQ8T 3EGDB 3HHTB 1K73C 1M30A 1XQHA 4J9CA 3OYCA 1VQ6T 3QBYA 2GF7A 2L3SA 1YP5A 1NG2A 4FCYA 1JEGA 2DD5A 4F7UG 3JAME 2P0QA 4M7DB 1Y7XA 5GAOn 5A0DA 1YITA 2XMFA 3G4SA 2K5LA 4M7AD 1UUEA 4HT9A 1RAHB 5IN1A 1VQPT 3G1JA 1S72A 2ECZA 4IUVA 2GTOA 2P4RA 5CAIA 3FJ5A 4OB2B 2LRQA 2R57A 1W4SA 4J9FA 3P8DA 1B3QA 2VVKA 2JOYA 4LUEA 2L3QA 4L5GA 2DRKA 3I56Q 1M3BA 2WACA 4BD3A 2VASA 2X3WD 2DM1A 2VYTA 4M78D 3CXCA 3FB9A 4IUTA 4LN2A 3V8KA 1K8AC 2QQSA 1JXMA 4LD6A 4HT8A 1UB4A 4M77G 2HD0A 2RJFA 1I81A 2K9GA 2XDBA 1IRXA 2LCSA 3CCET 2K3BA 4LUDA 1IHVA 2FG0A 2YDLA 3I9QA 4OMOA 5GAMj 4KGZB 1WJRA 3GBQA 1WJQA 5GAN5 2MYSA 2XKOC 1C1AA 1YWPA 2HQEA 4KGXB 2EYYA 3ZBDA 3JB9G 2ZAEA 2AHJB 4RG2A 2RHYA 1KIKA 2V8KA 1N9SA 3PVQA 3CC2Q 4MMKA 2LX9A 1BKBA 5CCAA 2RI2A 1B34A 2VGNA 2KR3A 2KAFA 1Q81C 3PNWC 4C5IA 3JCMP 3CCVT 1IREB 1PD0A 2M51A 5HY6A 3H9NA 4IUUA 1M4ZA 1ABOA 4JS5A 5LJ3d 5J26A 1K8AU 3CCMQ 1U3OA 4PFZA 1K0XA 3RIRA 4Z88A 3CCRQ 3ZEHA 1TUGB 2E5KA 1VQMQ 3VRZA 4X1VA 1GBQA 2OX7A 2Y4YA 2HQXA 3QKJA 2WSFE 2L8DA 1I1JA 4HVUA 1ZSGA 3SWNC 1CKAA 2DJZA 2ED1A 4IKFA 2RA2A 1X75C 4HA8A 3NPFA 1I8FA 2X4YA 5GAMe 3OYAA 5FLXE 5DM7R 1Q86R 2EPDA 3JCMe 2H8HA 2DERA 3AT1B 2FO0A 3CD6A 2LDMA 1QP3A 3JCMX 1H3ZA 2A7YA 1VQ7Q 5I2SA 2CZ6B 4CC4B 4AG1C 1VQNA 3RKXA 5HK0A 1I5OB 3QWYA 4A4EA 1QVFA 5AYFA 2BUDA 3ULRB 3TSZA 3NTKA 5FWBA 1UGVA 3LGLA 1VQ5Q 1M2VA 4CC2A 4C8QG 3V8JA 4C92G 1W6XA 4RCBA 1BIAA 2XI9A 2RQVA 4PJOG 2D9TA 2O2OA 1QVGP 1M1KU 4XTYA 1K4US 2QTXA 4BE2A 4L6V5 4HVWA 4FYVB 3CC7Q 1AZEA 2XDDA 3EFRA 2IPOB 1TH7A 1KC8C 1C6VX 1ABQA 2CKKA 3RNJA 2JUFA 1B7TA 2BE7D 4J9EA 4CC3A 1FMKA 2CH4A 1LCKA 5ECAA 1GRIA 2M0OA 4PJLA 1K9MR 2O9SA 1VIFA 4GLKA 1OQKA 8AT1B 2VXFA 1GCQC 3PE0A 1I0CA 5GMKm 3UWNA 4A54A 3I56T 3M53A 1OULA 1VQKA 3H0IA 2V26A 4D8KA 2Y4XA 5GAN6 3C12A 1BI3A 1QVPA 1OPKA 3SDZA 1OV3A 2FZKB 2CUBA 3SWNA 1X6OA 5GANj 2LQKA 1AHJB 4MZMA 5GJWB 5DLOA 4XTXA 3CPFA 5IHIA 5GMKi 2QDLA 3SD4A 4M78E 1RAAB 3LYIA 2RD1A 3EFOA 5HCKA 4AFSC 1KQ2A 3I55A 2WSEE 2RHIA 2CGHA 4F14A 3SWNB 2YHTA 2KXCA 2LP5A 2J06A 3NMZC 4OMQA 3EH1A 2OTLQ 2BTTA 2MWPA 4C8QD 4E7LA 3EFOB 3C0CA 3UATA 4C92D 3VYGA 1V76A 1KFZA 2DK3A 1WJSA 3VJPA 5AT1B 2RNAA 4PJOD 1PRLC 1ZA1B 2JS2A 2K5IA 1GBRA 3M9QA 1WIEA 2QDYB 3CC2T 4HCCA 1K1ZA 2KVQG 2EGCA 5CKFA 4RTVA 1R77A 3EG3A 2J6FA 2O4XA 2M16A 2MF2A 3CMAQ 1AWWA 1X69A 1WLPB 5GAN7 2RO0A 1VQLA 2KI7A 1JBMA 5KYUA 3DB3A 3CEYA 3CCMT 3UA6A 5J3BA 4BY6C 3CCRT 2LCLA 2RN8A 3M55A 5GANe 1QLYA 3CMEQ 3DKMA 3I5SA 1VQMT 3I35A 2RH2A 2O4XB 3G6EQ 3VS4A 1GCQA 4BI3A 1MNEA 2LQ8A 2KEAA 1BIBA 2MI6A 3CC4A 2MK5A 1XOVA 1M8VA 1H92A 4OF1A 1X6GA 2ZGWA 3M59A 5GAOl 1JJ2S 4FSSA 3CCLQ 1VQ6Q 1B07A 5GJVB 3CCUQ 1K73R 4M77E 4OB3B 1KQSP 2ZPEB 1X6BA 3S3MA 1VQ7T 1QCOA 1WHHA 2YUNA 4KH0B 2BIVA 2FVUA 1ZUKA 1RAIB 4V2SA 1BI0A 3G71Q 4MZPA 1VQ5T 2KK4A 4WF2A 3PIOA 2CSQA 1FWZA 1WGSA 4Y92A 2C0IA 2QQ9A 2SRCA 3JCMc 3EG2A 3L2QA 4OMFB 3CC7T 2J6OA 5LJ5j 2JVVA 2E5QA 5GAMg 1OEBA 2E1HA 3M0RA 4M77F 5D6WA 3MP6A 5CR2A 2HBWA 3JCMW 4J9HA 1TU0B 2QK0A 1K8AR 1Q86U 1QKXA 3JCMg 1ZHIA 2IVWA 2EJ9A 2D0QB 1TS9A 2CH4W 4KULA 2RK1A 3UF4A 4EMKC 2KY9A 4RTTA 3GOXA 3VRYA 1DJ7B 3MJXA 1GCPA 4DBQA 4QW2A 1ZSZA 2FYKA 2VB6A 4K11A 5KYWA 2DL5A 2ATCB 4Z02A 3JB9F 4N4GA 4JLIA 1VQ9Q 1C0MA 2CP5A 3OYMA 4BDZA 1T3LA 1ACMB 2RJCA 2E3IA 4BY6B 4BI8B 4C0ZA 4E7ZA 4BACA 2DXUA 2MIOA 1PKSA 1ZSZB 1NLPC 2C06A 5KYWB 5KCHA 3JB9H 2MOXA 2QA4A 1KQSA 5GAN8 1LVKA 2L0AA 4LNPA 1YIJQ 1SHFA 1NZ9A 1WPYA 2OTLT 4M7AG 2D6FA 1GL5A 3M4YA 4RKUE 1K9MU 3TVTA 3VKIA 1BBZA 1M27C 1D0YA 4O5VA 2A37A 3O8VA 4JRKA 4F17A 1SPKA 4KT0E 2JM8A 2VGMA 3OYYA 3OYKA 4C8QE 3CXCP 1M1KR 1E6HA 1G3TA 2RJDA 4M77C 1Z9ZA 4J6XA 2RQRA 4FYXB 4XU2A 1J3TA 1H641 1YJWQ 3HTRA 3CMAT 1M2OA 1NYFA 2HSPA 2KYMA 2VUBA 4JUVA 1YJNQ 2J6KA 2BZXA 1TUCA 1OOTA 4JJNK 4X9DA 2Y90A 2X4WA 2ZPGB 3CMET 1HD3A 1JU5C 3G6ET 3C94A 4KRTA 1M90U 3U23A 4EMKA 1BB9A 3QWXX 3ZFJA 3UA7A 3OYEA 1PWTA 1QMCA 3HRUA 2K7AA 1RI9A 2HDAA 1AVZC 4GBQA 1VA7A 1Q7YC 2DJQA 1UE9A 4ELZC 3H8ZA 3C4SA 2LTOA 3CCLT 2K3YA 2QEXA 4PJMA 3CCUT 2PNIA 2KT1A 2RK2A 4EMKB 4N4IA 1KD1U 5CK9A 3F70A 2PUOB 2DIGA 3UT1A 2L3PA 2Z0WA 1PCXA 3PTAA 3RMQA 2J05A 2RF0A 3HFNA 3H41A 3BW1A 1ZX6A 4M7DG 2DO3A 2JM9A 3LH0A 1G8XA 3OW2S 4JRIA 1QP2A 2EW3A 4ORZA 1N8RC 3G71T 2F5KA 5GANg 2GTJA 3TCJA 4PL6A 5CVIA 3OA6A 2KROA 1I4K1 1RI0A 2YXYA 3RBBB 4E2FB 4EPCA 1W1FA 1Y96A 4XU3A 2YRVA 3QDRB 2MAMA 2CP6A 2K57A 2M1HA 3OS2A 5DY9A 3FJPA 5CKHA 3L42A 2F2WA 4M77A 1T0HA 2NWMA 2VWFA 3MP1A 4QQ6A 4FT2A 4AMCA 2OTJQ 3LGFA 2QTVA 1Y96B 1M8MA 5GAN4 1VQ4Q 3PGGA 3A8LB 1K73U 4XU1A 2YLCA 2PVDB 1YWOA 4M77B 5KYXB 2JXBA 3CCSA 2JMCA 2KDSA 2QI2A 2ROLA 3H0HA 3QSUA 1VYUA 2WSCE 4KGVB 3L2ZA 3VS3A 1UG1A 1QVFP 2CSIA 1VQ8A 2KQWA 2EKOA 4HXJA 2FPDA 4PK4A 4DEYA 2EQMA 2DA9A 1VQ9T 5KYYA 2PVGB 1EIFA 1HSQA 3M0UA 1WDXA 2RQUA 5GAOp 1YHQA 1T3SA 4M7DD 5KE2A 4E47A 1WZOA 4C0DC 1HXDA 4P5NA 4QQGA 1RAGB 3CCQQ 1VQPA 1QWEA 4C0GA 1PKTA 2BZ8A 1YI2Q 5KYYB 1YIJT 1Y07A 1MMAA 3X28B 4DBRA 2QASA 1RL2A 1UGRB 2RQTA 2DX1A 2HAXA 2KYBA 1TTHB 1IO6A 4RMOA 1W70A 4XTWA 4M75E 4FW2A 1IZ6A 2DTHA 1E6GA 3VUZA 2DLPA 1BYMA 9ATCB 5GMKe 5LJ3j 1I5LA 3TEEA 1YJWT 1AWXA 3OYNA 2CZ0B 2DVJA 4LD9K 3OYFA 2P0PA 3SHWA 1YJNT 5I2MA 2F2VA 1N9RA 1FX7A 4XTUA 3CCEA 1FYNA 1GFCA 2HCKA 1NM7A 4JDSA 2COZA 4AFUC 3RKYA 4JRQA 4DBHA 1VQOQ 3HL8A 5FU7C 3EHRA 3VV0A 2ROTA 4E7JA 1Q81U 3RESA 2COYA 1SF9A 1BU1A 2LZ6B 3KFVA 4ZTFA 2BE9B 1WNLA 4XAXB 2ZPHB 4N0AC 2DPPB 4M75F 5LJ5g 3LWHA 3CCJQ 2YWWA 4MDWA 5GAOq 5HK3A 2RB6A 1NPPA 2E41A 2KBTA 1MUZA 4LDVA 2E65A 5FWCA 4BI4A 1RAFB 2A36A 1R8OB 2E6NA 2AKKA 3CCVA 2YSQA 3WVDB 1PRMC 3V8LA 4OB1B 1WXUA 1G3YA 2FHDA 2NLUA 1YJ9Q 4OGEA 1MMGA 2ED0A 2GFAA 4RG8A 5GAOm 4NOYA 2KRMA 4M7AE 1SEMA 2DTIA 4J6YA 4ZNXA 4E7KA 2DAQA 4RCCA 2QQBA 5LJ3e 2YLBA 8ATCB 1M3AA 1Y0MA 4C0DB 4LXCA 3JV3A 2VXEA 2EGAA 5CKDA 4EMGA 3GNFB 3OMGA 2DVEA 2IG0A 4KUDK 4EMHA 1PD1A 2OTJT 2LJ0A 3EGXA 4J83A 1NYGA 1VYTA 4A4KA 2DE0X 1OZ3A 3CBOA 1VQ4T 5CO7A 2ZPBB 2CDTA 2CT4A 3MEUA 4FT4A 1NE8A 2GQIA 3P8HA 4IIOA 2KRNA 3E19A 3M0TA 1M90R 4M75C 5L23A 3BY7A 1H3HA 4OVAA 4M7AF 3L1AA 2OAWA 3EGXB 1LPLA 1ZA2B 3KUFA 5FRNA 2YRCA 2DILA 1U1SA 5GAMh 2V1RA 1W2BS 2HSEB 1KC8U 4OMNA 1AZGB 1JO8A 3PVLA 3JCMb 3JCMh 4RTYA 2XU8A 5C0MA 2HBPA 1QW1A 2PTKA 1YITQ 1EFNA 2FZCB 3G4SQ 2PU9B 2O31A 4E7HA 2D1XA 2EKHA 2X3XD 1KD1R 1A0NB 1S72Q 5CQXA 3FLGA 1WHLA 2COWA 4JZ3A 1O9SA 4C5EA 4D6WA 4F7UE 5FU7B 3TREA 3CPWS 3CCQT 5D6XA 3X26B 4M78F 2P4TA 1HYOA 1YI2T 2M0YA 1O75A 2KT8A 4IURA 4OB0B 4PJJA 1UHCA 4M7DE 1G2BA 4B6MA 3REAB 2YUOA 4A4GA 3I56A 1IHWA 2QAZA 1MHNA 1RADB 3BDLA 3OMCA 3EH2A 4HVVA 2XICA 5DLQE 1BK2A 1SSHA 3BFMA 4FYYB 3OY9A 4OMPA 2FRWA 3T9NA 2K6DA 1IB8A 1UECA 3E9FA 1Q7YR 4F7UF 4M7AC 2O01E 1NJIC 2ABLA 2DIQA 3OYIA 4MMLA 4KUIA 1G5VA 2EQUA 2LNVA 3MO8A 3JB9J 2JTEA 2V8IA 1UGSB 3URGA 1VQOT 2L3RA 2DL8A 5M9OA 2E12A 1KHCA 4QVDA 1E7OA 4M75A 2K79A 3M56A 4Y28E 1G3SA 3MEWA 3RR6A 3JRZA 3EAEA 3OS0A 4RTUA 4GY5A 4PFOA 3CCJT 4M4ZA 2VKNA 4KH1B 3CC2A 1PG5B 2E64A 4M78C 4RTZA 4DOWA 1M3CA 1N8RR 4IUPA 1MMNA 3S3NA 2DEUA 1OX8A 4BE1A 2JT4A 4M75B 5CKEA 1NLOC 3DLLA 2JJ9A 5I11A 1JXOA 1PNJA 3M57A 5GAN3 1IGUA 2E4HA 3NGPA 2DD4A 1D1BA 5C6SA 1AD5A 1R0BG 2LNHB 3JSCA 4IUQA 3MEVA 3I5RA 3LH5A 2C0OA 3ME9A 3PMTA 5D6YA 1YJ9T 1YCSB 3CCMA 1UTIA 4J9GA 2EYWA 2LJ3A 2R58A 2A3LA 4PLLA 2GBQA 3CCRA 1XTDA 1VQMA 4R56A 3HRSA 3OSVA 3FEOA 5A2QE 3VU3C 1M5Q1 4O6JA 2LT1A 4QVZA 2F69A 3QUIA 4LDUA 3CBPA 1WQ7A 1JJ2P 4ZGDB 1ZUUA 4E7SA 1OPLA 4B9WA 1RABB 3OYHA 5A0GA 2F2XA 4DEXA 2C0TA 2DBKA 3QJYA 1Q82C 3CD6Q 1WYXA 4M7DC 5GANh 2AZSA 3R6NA 2B8AA 1WFWA 4XTZA 2O88A 3J7AF 1VQNQ 3EHQA 2E6ZA 1VQ7A 5GAMf 4FIBA 2CS7A 3S3OA 3M0PA 2MWOA 4RTXA 4M7AA 4E6RA 2KNBB 3INZA 3EG9A 2VC8A 2LX7A 2QGFB 3JCMf 5IXBA 3SB2A 1UGQB 1WI7A 1Q81R 1ZBXA 3EFSA 2IIMA 1W2BA 1VQ5A 2DZ9A 3QO3A 1SSFA 5LJ3g 4M7AB 2KSSA 3EG9B 1YITT 3G4ST 4QKUA 2RM4A 1KJWA 4Y91A 2E3HA 1PC0A 1KG1A 3JCMQ 1S72T 1SRMA 1JRIA 3QZ9B 4C5HA 3SFMA 4C92E 1WHMA 4ZN1A 4M78A 3CC7A 2RHZA 4ELYC 1OZ2A 4PJOE 3EG0A 2QGGA 5J39A 3S6WA 2CP3A 2FPFA 1IGQA 1OYXA 2VV5A 1SG5A 2LT4A 1AT1B 2GGRA 3QJ6A 3QG1A 1TUDA 2W10A 1V29B 4JPBW 4B9XA 2RJEA 1VQKQ 1RUWA 1Z9QA 5FW9A 4M78B 3PMIA 1ZUYA 2CP0A 3G7ZA 1QQJA 2KE9A 3QDFA 4PJNA 3X25B 4FYWB 1ZBJA 3H6ZA 3RMSA 2GFUA 1M9SA 4NL2A 1MGQA 2K2MA 4OMMA 3OQ5A 2R5MA 3OYJA 4PKCC 4J5YA 3V7SA 2AT1B 3J81E 3M58A 4Q5WA 3H0FA 3I55Q 1JJ2A 1UEBA 4FSXA 4F7UA 4C8QF 4C92F 1WXBA 1JB0E 2PVOB 4PJOF 2X4JA 1KHIA 1P92A 2GQVA 1R0CB 2EYZA 6AT1B 2KMTA 3OBYA 3FC3A 4IIMA 2DMOA 5FROA 4QQDA 3CBMA 4F7UB 1Y71A 2OTLA 4RUGA 2YUQA 5D7UA 1S1NA 3P8BB 4OMLA 3BE3A 4Z89A 1KC8R 4A63B 4EDUA 4WTOB 2DXCA 1YHQT 3CQTA 2LVMA 3JB9I 2CP7A 4AG2C 1LJOA 1X2QA 2JW4A 2QG9B 3QHSA 2EJGA 2CUDA 2EYXA 4C0FA 2FEIA 3NFCA 3TQ7P 1I07A 1VQLQ 4CC7A 5IT9E 5KYXA 1QCFA 1FXXA 5I21A 3CMAA 1N5ZA 4TVRA 1D1AA 1M1GA 4R55A 3GP8A 2D8JA 2FZGB 5LJ5h 4BE0A 1Q7YU 1MV3A 2DFUA 2RHUA 5GMKj 3A8MB 4A4HA 2KRSA 1UFFA 1YN8A 3CC4Q 3CMEA 1OU8A 2B86A 5GAMd 3IQLA 1WHKA 3PFSA 3G6EA 2BKDN 2CZ7B 4ME7A 2XG8D 1AWOA 3JCMd 4C8QC 4C92C 2JZ2A 1KK7A 5GANf 4GLMA 2QYZA 4PJOC 3RERA 3FRNA 4A4FA 3CCLA 1VQ6A 2RMOA 2EVRA 4LE9A 3CD6T 3CCUA 1F1BB 2O9VA 3META 1HJDA 3L2VA 1N8RU 1JQQA 1VQNT 5A0LA 4J8OA 2LCCA 4VUBA 1AEYA 3MKDA 4N4HA 1MNDA 3Q1JA 1N27A 1UJ0A 3MEAA 2HZYA 5IXFA 2CT3A 3OW2P 2EYQA 3GPLA 3O5ZA 4XK8E 3G71A 2JN0A 3A8OB 1SHGA 2DL3A 2QQAA 1QVGS 2EJFA 1VUBA 3A98A 2W0ZA 4AFZC 3FIFA 3QPHA 1M1FA 1PSEA 3OBWA 4FW1A 4XQ3A 1K76A 1V1CA 3MHXA 2DXTA 4J9BA 3M5AA 1QKWA 1D1CA 1B34B 1EZZB 2DBMA 3MP8A 2R5AA 1M1KC 3X20B 2PQWA 2RI5A 2AK5A 3V7RA 1BI1A 1LOJA 3KBGA 1VQKT 2NUZA 4EIKA 2LC4A 2YUPA 1FMWA 1KQ1A 2XIDA 4KBMB 3L2WA 1NBEB 4M77D 1G3WA 2DKGA 1NJIR 4ATOA 3HPWA 3A8HB 1X01A 4UC4A 2LMJA 2HL5C 3SEMA 4C5GA 5FRMA 4C8QA 4QT7A 4C92A 2GCXA 1VQ9A 4JJCA 2EQIA 3I55T 3QXEB 4PJOA 2F1LA 2PUKB 2RHXA 3RKWA 3VS2A 1YNZA 2BZYA 1IXDA 1D0ZA 3LW5E 2QA4Q 2EQJA 2EAYA 3R6OA 2XHCA 3GIBA 3JB9D 2DRMA 4HCZA 2KGTA 2RPNA 2V1QA 2LQNA 2HNIA 4C8QB 4C92B 1D3BA 1X2KA 2YRDA 4LDWA 1YIJA 4PJOB 2A0FB 2G6FX 4LDYA 4CRIA 2LJ1A 3OW2A 4J6WA 2NUPA 1TG0A 2OAUA 1VYVA 3GLXA 3QZ5B 2E70A 1AWJA 3VS1A 4PFPA 7AT1B 3PIPA 3WVEB 1D3BB 2FB7A 4A53A 3GF5A 3A5ZB 3TU4K 2V8JA 2K2VA 1M2VB 1WA7A 1Q95G 1TSFA 2F5TX 1VOMA 3NTHA 2FL7A 5LJ5f 2HEQA 1PSFA 2NUPB 5GANd 1VQLT 3LX7A 2HKNA 2G3RA 1YJWA 1ARKA 3EGUA 1K0SA 4R0KA 3VS5A 2YT6A 1YJNA 3OS1A 2X35A 1EX4A 2JS0A 1ZQ1A 2ZPIB 1Q82R 3CC4T 5FU6C 3EG1A 2OJ2A 3J80E 2HQHA 1UGPB 5GMKh 3AHUA 2EQKA 4XTVA 5KE3A 2DL4A 2QEXQ 1N6AA 4NS5A 5IH2A 1YBYA 5GAN2 3M54A 2EGEA 1KQSS 3PT9A 3OS5A 4N0AA 4NL3A 3JCMV 1K9AA 3THKA 2JMAA 1WQWA 4DQ2A 3N5BB 2DNUA 2HKQB 2ZZDA 3LLRA 3OYBA 2DXBA 1NEBA 2CREA 3RUXA 2NUTA 2CP2A 1AOJA 4J9DA 4ESRA 2P0KA 2AKLA 4OP0A 3OSSC 2DTOA 3VS6A 1UHFA 1SRLA 3VYHB 2D0NA 3M4GA 3NHNA 4LDXA 2ZCFB 1QVGA 4X9CA 1WHGA 1WHJA 2L2PA 3E1SA 3C95A 1XNIA 2ESWA 1WXTA 2NUTB 1RLPC 2KXDA 1T0JA 4DBFA 2NYSA 3ASKA 3V7CA 2DEQA 4HCKA 2K5FA 2A08A 2DYBA 1MMDA 2M02A 1RACB 3A8GB 4D8DA 3RDVA 2OTJA 3VS7A 5GAOr 1VQ4A 5LJ3h 1ZSZC 4AFQC 3CCSQ 3NTIA 3VUBA 5IAYA 3LWIA 2EFIA 1H8KA 1OX9A 5KH6A 2L89A 4X34A 5KYUB 1VQ8Q 1RLQC 4JLGA 3FDRA 1OI1A 4JRPA 1Q86C 1CKBA 1CSKA 4M7DF 2QXFA 1TXQA 2X9HA 1VIEA 2PZ1A 4J7FA 4L59A 4BDYA 5GMKl 1MV0B 2ENMA 2SEMA 1U06A 1U8RA 2HMAA 1W2BP 4JJBA 1BCOA 2E10A 3ZL7C 2RQWA 1YHQQ 2J7IA 2A28A 3A1PA 3HFOA 5HKCA 2QA4T 5FU6B 4II1A 5EC7A 1VQPQ 2EIFA 1TOVA 5LJ5d 3CPWP 3CCQA 3HRTA 2XD0A 1NPRA 1YI2A 2AZVA 4M75G 3QYHB 2H3EB 3OYGA 2MMPA 2XDPA 2JTMA 3VS0A 3BDUA 1HK9A 3CXCS 1YCYA 2X51A 2GNCA 4Z8AA 2MCNA 4JJDA 5CKBA 1K9MC 5KCOA 3E9GA 4PNOA 3DB4A 1NJIU 3E2UA 4F04B 1U1TA 2RI3A 2HL3A 5I22A 5CIUA 3HSBA 2XK0A 4JS4A 3UDCA 5KYNA 1LNXA 2QQRA 2DZCA 3GNGA 3MCAB 3OYLA 3DLMA 4BB7A 1GXIE 2DYIA 1RAEB 2EBPA
chains in the Genus database with same CATH topology
1N9RA 2DXCA 2QDYB 1YHQT 1FX7A 3CC2T 4XTUA 4HCCA 2LVMA 3JB9I 3CCEA 1LJOA 3QIIA 4FU6A 3OYDA 2KVQG 4JDSA 3L2RA 4OGCA 3QHSA 2EJGA 5CKFA 4FM4B 3RKYA 4JRQA 4MZTA 3HP9A 4C0FA 2O4XA 3HL8A 3NFCA 1BI2A 5FU7C 2M16A 4E7IA 4QVCA 2MF2A 3VV0A 4E7JA 1Q81U 3RESA 1VQOA 5IT9E 2K3XA 4ZGEB 5GAN7 1FXXA 2RO0A 4ZTFA 1VQLA 5I21A 1WNLA 3CMAA 4XAXB 4TVRA 1JBMA 4MDXA 1M1GA 2QEXT 4R55A 2ZPHB 4N0AC 3DB3A 4DOVA 2DPPB 3CEYA 4M75F 5LJ5g 3LWHA 3GP8A 3CCMT 4MDWA 2JTFA 5LJ5h 5J3BA 5GAOq 5HK3A 2RB6A 1NPPA 2E41A 4BE0A 1Q7YU 1M90C 4BY6C 3CCRT 2LCLA 5L8RE 3CCJA 3M55A 2RHUA 3QYGB 5GANe 3A8MB 5GMKj 3DKMA 4A4HA 1VQMT 4DA4A 2RH2A 2O4XB 4XU0A 4LDVA 2E65A 4BI3A 2LQ8A 3CMEA 5GAMd 4BI4A 5LL6S 2MI6A 1BIBA 2K4YA 5EG2A 4BUGA 3G6EA 3PFSA 3X24B 4ZGJB 3CC4A 2BKDN 1XOVA 1R8OB 2CZ7B 2E6NA 3CCVA 3WVDB 1M8VA 2JNGA 4OF1A 4ME7A 2XG8D 3V8LA 2ZGWA 3JCMd 3M59A 3ER0A 4M75D 4C8QC 5GAOl 4C92C 2JZ2A 2X4XA 4OB1B 1JJ2S 5GANf 4J7IA 3CPWA 1G3YA 2FHDA 3HKSA 4PJOC 2NLUA 1KD1C 4HCBA 4OGEA 2GFAA 3RERA 4RG8A 5CQYA 5LJ5e 3FRNA 4A4FA 5GAOm 4NOYA 1YJ9A 3CCLA 4M7AE 1VQ6A 2ZPFB 2DTIA 4J6YA 3CD6T 3CCUA 3META 3WXMB 4E7KA 2DAQA 4M77E 4RCCA 3L2VA 2QQBA 4OB3B 4PLIA 5LJ3e 2ZPEB 1N8RU 2YLBA 3S3MA 1Q82U 1VQ7T 4C0DB 1VQNT 2VXEA 5CKDA 4HKEA 5A0LA 4EMGA 3JCMJ 3GNFB 3L2UA 4J8OA 2LCCA 4VUBA 4M78G 2BIVA 3OMGA 2FVUA 2DVEA 4N4HA 2IG0A 4V2SA 4KUDK 3Q1JA 1N27A 2L5QA 3MEAA 3OB9A 2I2LA 1BI0A 4YTLA 4EMHA 3KXTA 5LJ3f 2EWNA 2EYQA 3GPLA 4ZN3A 4MZPA 1VQ5T 2OTJT 2KK4A 4WF2A 4XK8E 4J83A 2JN0A 3PIOA 3G71A 4A4KA 3A8OB 2QQAA 1OZ3A 3CBOA 1QVGS 1FWZA 2EJFA 1VUBA 1WGSA 1VQ4T 5CO7A 2ZPBB 3UPUA 3FIFA 4ZTJA 2QQ9A 3QPHA 4FL6A 3JCMc 3CCST 3MEUA 4FT4A 2CYZB 1NE8A 1M1FA 3P8HA 1PSEA 3OBWA 3L2QA 4OMFB 2M9UA 3E19A 4M7DA 3CC7T 4CI0C 2CZ1B 4M75C 4XQ3A 5LJ5j 1QVFS 2H3JA 1VQ8T 2JVVA 3BY7A 3MHXA 4OVAA 4M7AF 3L1AA 2E5QA 3HHTB 5GAMg 3KUFA 5FRNA 2DXTA 3M5AA 2E1HA 1B34B 1U1SA 5GAMh 1K73C 4M77F 1XQHA 5D6WA 3MP8A 1W2BS 3MP6A 5CR2A 3OYCA 3JCMW 1KC8U 1VQ6T 2R5AA 3QBYA 3X20B 1Q86U 2GF7A 3JCMg 1M1KC 1ZHIA 2IVWA 2EJ9A 2PQWA 3JCMb 2RI5A 3JCMh 1BI1A 1LOJA 2D0QB 2DD5A 2XU8A 3KBGA 3V7RA 4F7UG 5C0MA 2HBPA 2P0QA 1QW1A 3JAME 4KULA 2RK1A 4M7DB 1Y7XA 1VQKT 5GAOn 5A0DA 2PU9B 4EMKC 4E7HA 2LC4A 2KY9A 3GOXA 1YITA 3G4SA 1DJ7B 2K5LA 4M7AD 5CQXA 1KQ1A 2XIDA 4KBMB 5IN1A 4HT9A 3L2WA 3FLGA 1VQPT 1S72A 4M77D 1G3WA 1O9SA 2DKGA 4QW2A 4C5EA 4D6WA 4F7UE 5FU7B 3TREA 3CPWS 4IUVA 2FYKA 3CCQT 5D6XA 3X26B 5CAIA 4M78F 2P4TA 4Z02A 1YI2T 4ATOA 3HPWA 3A8HB 3JB9F 4N4GA 4JLIA 1O75A 2LRQA 4OB2B 4IURA 1X01A 2R57A 4OB0B 4UC4A 1W4SA 4C5GA 5FRMA 4C8QA 3OYMA 4BDZA 4M7DE 3P8DA 4C92A 2GCXA 1VQ9A 2JOYA 2RJCA 3I55T 4L5GA 4BY6B 3QXEB 4BI8B 4C0ZA 4PJOA 2PUKB 2RHXA 3RKWA 2WACA 4BACA 4BD3A 2DXUA 4A4GA 3LW5E 3I56A 2EQJA 2C06A 2EAYA 5KCHA 1MHNA 2VYTA 3R6OA 4M78D 2XHCA 3CXCA 3JB9H 2QA4A 1KQSA 3GIBA 3JB9D 4HCZA 3BDLA 5GAN8 1YJNT 3OMCA 3FB9A 4IUTA 2HNIA 4C8QB 3V8KA 1H3ZA 5DLQE 2XICA 4C92B 1K8AC 2QQSA 1D3BA 1NZ9A 1WPYA 2OTLT 4M7AG 3BFMA 2D6FA 3OY9A 4LDWA 1YIJA 4PJOB 4LD6A 4HT8A 1UB4A 3M4YA 4RKUE 1K9MU 4LDYA 4M77G 3VKIA 2HD0A 2RJFA 3T9NA 4CRIA 1I81A 4O5VA 3OW2A 4J6WA 2XDBA 2OAUA 3O8VA 4JRKA 3E9FA 3CCET 4F7UF 4KT0E 3GLXA 3QZ5B 3PIPA 2E70A 2VGMA 3OYYA 4M7AC 3WVEB 3OYKA 2O01E 5GAMj 1D3BB 2DIQA 2FB7A 4C8QE 4A53A 3OYIA 3GF5A 1NJIC 3A5ZB 3TU4K 1G3TA 2RJDA 1WJRA 4MMLA 4M77C 4KUIA 1WJQA 2V8JA 1G5VA 5GAN5 2K2VA 4J6XA 2XKOC 2F5TX 2EQUA 2LNVA 3MO8A 3JB9J 2HQEA 3NTHA 2FL7A 2V8IA 1UGSB 4XU2A 3URGA 1VQOT 2L3RA 5LJ5f 1PSFA 5M9OA 5GANd 1H641 3ZBDA 3JB9G 2E12A 1KHCA 4QVDA 4M75A 3LX7A 2AHJB 2XDDA 1VQLT 3CMAT 3M56A 4Y28E 1G3SA 4RG2A 2VUBA 2G3RA 2RHYA 4JUVA 3MEWA 2V8KA 1YJWA 1N9SA 3JRZA 3EAEA 3OS0A 1YJNA 4GY5A 3CCJT 4JJNK 4MMKA 3OS1A 2X35A 2LX9A 4X9DA 1BKBA 5CCAA 2RI2A 1B34A 3CC2A 2Y90A 1ZQ1A 2E64A 2X4WA 2VGNA 2ZPGB 4M78C 4DOWA 2ZPIB 3CMET 4IUPA 3S3NA 3G6ET 3CC4T 2KAFA 5FU6C 3PNWC 4C5IA 3C94A 4BE1A 3J80E 3JCMP 3CCVT 1Q81C 1M90U 1IREB 4M75B 5CKEA 4EMKA 3DLLA 3ZFJA 5HY6A 3M57A 5GAN3 1UGPB 3OYEA 5GMKh 4IUUA 1M4ZA 3HRUA 3AHUA 2EQKA 2DD4A 4JS5A 4XTVA 5KE3A 5C6SA 1Q7YC 5LJ3d 5J26A 1K8AU 4ELZC 3JSCA 4IUQA 1N6AA 3MEVA 3H8ZA 3C4SA 2LTOA 3ME9A 3PMTA 5D6YA 3CCLT 1YJ9T 2K3YA 3RIRA 2QEXA 4NS5A 3CCMA 1YBYA 5GAN2 3ZEHA 3CCUT 3M54A 2R58A 2A3LA 2RK2A 4EMKB 1KQSS 3PT9A 4N4IA 4PLLA 1KD1U 3CCRA 5CK9A 2Y4YA 2HQXA 3OS5A 3F70A 2PUOB 1XTDA 2L8DA 2DIGA 2WSFE 3QKJA 4N0AA 3JCMV 3UT1A 4NL3A 1VQMA 4R56A 1WQWA 3SWNC 3PTAA 3RMQA 2DJZA 3HRSA 3HFNA 4IKFA 4DQ2A 3BW1A 3N5BB 3OSVA 2RA2A 2ZZDA 3FEOA 5A2QE 4M7DG 3VU3C 1M5Q1 1X75C 2DO3A 2LT1A 3LLRA 4HA8A 2DXBA 2F69A 4O6JA 3LH0A 4QVZA 3QUIA 1I8FA 3OYBA 4LDUA 3CBPA 2X4YA 3RUXA 3OW2S 4JRIA 1WQ7A 1QP2A 4ZGDB 5GAMe 3OYAA 2P0KA 4B9WA 5FLXE 5DM7R 3OYHA 5A0GA 4OP0A 3OSSC 3G71T 2DTOA 1N8RC 3QJYA 1Q82C 2F5KA 3VYHB 5GANg 3JCMe 3TCJA 4PL6A 5CVIA 4M7DC 3OA6A 5GANh 3M4GA 3CD6A 2LDMA 2B8AA 1I4K1 1RI0A 1QP3A 2A7YA 2ZCFB 4XTZA 3JCMX 1QVGA 4X9CA 4LDXA 4EPCA 5I2SA 3J7AF 1Y96A 4XU3A 2CZ6B 2YRVA 2E6ZA 3QDRB 2MAMA 3E1SA 5GAMf 4FIBA 2K57A 2CS7A 1XNIA 2M1HA 3C95A 3OS2A 3S3OA 1VQNA 2MWOA 4M7AA 3INZA 3RKXA 2VC8A 5DY9A 3FJPA 5HK0A 3ASKA 5CKHA 4A4EA 3L42A 3JCMf 4M77A 1QVFA 3SB2A 5AYFA 2BUDA 3V7CA 2DEQA 3MP1A 3NTKA 2K5FA 4QQ6A 1ZBXA 4FT2A 3LGLA 3LGFA 3EFSA 4C8QG 1W2BA 1Y96B 3V8JA 4C92G 4RCBA 3A8GB 1BIAA 5GAN4 1VQ5A 2DZ9A 3PGGA 2OTJA 2XI9A 3QO3A 3A8LB 1SSFA 1K73U 4XU1A 5LJ3g 4PJOG 4M7AB 2YLCA 2KSSA 2D9TA 5LJ3h 5GAOr 1VQ4A 1YITT 1M1KU 3G4ST 4XTYA 2PVDB 2QTXA 2RM4A 3NTIA 3VUBA 4BE2A 4Y91A 4L6V5 4M77B 5IAYA 2EFIA 3LWIA 1KG1A 3JCMQ 3CCSA 1S72T 2KDSA 5KH6A 1JRIA 2L89A 2QI2A 3EFRA 3QZ9B 4X34A 3SFMA 1TH7A 4C5HA 4C92E 2WSCE 4M78A 4ZN1A 4JLGA 3QSUA 3FDRA 3L2ZA 1OI1A 3CC7A 2RHZA 4ELYC 4JRPA 1KC8C 1VQ7A 1Q86C 1OZ2A 4PJOE 2CKKA 2QXFA 2JUFA 4M7DF 1VQ8A 2KQWA 1VIEA 4J7FA 5J39A 2EKOA 4L59A 3S6WA 4BDYA 5GMKl 1OYXA 2M0OA 2VV5A 2EQMA 2LT4A 1VQ9T 1U8RA 1VIFA 3QJ6A 3QG1A 4GLKA 1V29B 2PVGB 4B9XA 2RJEA 2E10A 2VXFA 1EIFA 3UWNA 5GMKm 4A54A 3I56T 3M53A 3HFOA 4M78B 3PMIA 5HKCA 1VQKA 3G7ZA 5GAOp 1YHQA 2Y4XA 4M7DD 2QA4T 5FU6B 4II1A 5GAN6 4E47A 5KE2A 3C12A 1QVPA 1BI3A 3X25B 4C0DC 3SDZA 1HXDA 4P5NA 4QQGA 1VQPA 2EIFA 3H6ZA 3RMSA 3SWNA 4C0GA 1X6OA 5LJ5d 2GFUA 2LQKA 1AHJB 3CCQA 3HRTA 1M9SA 1NPRA 4MZMA 1MGQA 4NL2A 1YIJT 2XD0A 3OQ5A 5DLOA 4XTXA 1Y07A 1YI2A 3CPFA 2R5MA 5GMKi 3X28B 3OYJA 1RL2A 4PKCC 4J5YA 4M75G 3V7SA 3J81E 1UGRB 3M58A 4Q5WA 3SD4A 1JJ2A 4M78E 2HAXA 1UEBA 4FSXA 4F7UA 3LYIA 3QYHB 4C8QF 2RD1A 3OYGA 2MMPA 1KQ2A 4C92F 3I55A 2XDPA 2WSEE 2JTMA 4RMOA 2RHIA 3BDUA 1JB0E 2CGHA 1HK9A 2PVOB 3CXCS 4XTWA 4PJOF 1YCYA 2X4JA 1KHIA 3SWNB 1P92A 2YHTA 4M75E 2GQVA 1IZ6A 2DTHA 2KMTA 5CKBA 3OBYA 3VUZA 5KCOA 3FC3A 1K9MC 3E9GA 4PNOA 1BYMA 3DB4A 5FROA 4QQDA 1NJIU 5GMKe 1U1TA 2MWPA 3CBMA 4F7UB 1Y71A 4C8QD 5LJ3j 4E7LA 2RI3A 2OTLA 4C92D 1I5LA 3TEEA 5CIUA 3VYGA 3HSBA 2DK3A 2XK0A 5GANj 4JS4A 1YJWT 1WJSA 3UDCA 3OYNA 3VJPA 2CZ0B 4LD9K 1LNXA 2QQRA 3P8BB 2DZCA 3OYFA 4PJOD 2P0PA 3GNGA 3MCAB 3DLMA 4BB7A 2K5IA 3OYLA 1GXIE 3M9QA 5I2MA 4EDUA 1UGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9R A;  3JB9 J;  3JCM c;  4XU2 A;  4XTU A;  3EFS A;  5LJ5 f;  4C8Q G;  3JB9 I;  4M7D A;  5GAN d;  1H64 1;  1Y96 B;  3V8J A;  4RCB A;  4C92 G;  3JB9 G;  1BIA A;  4M75 A;  4M75 C;  4XQ3 A;  4QVD A;  1LJO A;  2DZ9 A;  3PGG A;  3QO3 A;  5LJ5 j;  4XU1 A;  4JUV A;  5LJ3 g;  3BY7 A;  4PJO G;  3QHS A;  2EJG A;  2YLC A;  3L1A A;  4M7A B;  5GAO r;  4M7A F;  5LJ3 h;  3RKY A;  5GAM g;  1N9S A;  2DXT A;  4XTY A;  2E1H A;  2QTX A;  2RM4 A;  1B34 B;  1U1S A;  5GAM h;  4Y91 A;  4M77 F;  4M77 B;  4MMK A;  3JCM W;  3JCM Q;  4X9D A;  3JCM g;  4QVC A;  1JRI A;  4C92 E;  1B34 A;  2EJ9 A;  3EFR A;  3RES A;  2Y90 A;  1TH7 A;  2E64 A;  3JCM b;  4M78 A;  4M78 C;  3JCM h;  1LOJ A;  3V7R A;  3L2Z A;  3QSU A;  5GAN 7;  4F7U G;  5I21 A;  1WNL A;  4PJO E;  4M7D F;  4M7D B;  1JBM A;  3JCM P;  5GAO n;  4N0A C;  4M75 F;  4M75 B;  4EMK A;  4EMK C;  5LJ5 g;  5GMK l;  5LJ5 h;  5GAN 3;  5GAO q;  4M7A D;  2RB6 A;  2E41 A;  5GMK h;  1KQ1 A;  4HT9 A;  4M7A C;  3AHU A;  5GAN e;  5GMK j;  4M77 D;  2DKG A;  4XTV A;  4F7U E;  5LJ3 d;  4XU0 A;  2E10 A;  2VXF A;  2FYK A;  2E65 A;  5CAI A;  5GMK m;  5GAM d;  4A54 A;  1BIB A;  4M78 F;  3HFO A;  4M78 B;  3RIR A;  3JB9 F;  1M8V A;  4JLI A;  5GAO p;  1X01 A;  4M7D D;  5GAN 2;  3V8L A;  2ZGW A;  5GAN 6;  3JCM d;  4C8Q A;  4M75 D;  4C8Q C;  5GAO l;  4EMK B;  4M7D E;  4C92 A;  4C92 C;  1HXD A;  5GAN f;  4N0A A;  4NL3 A;  3JCM V;  4PJO A;  4PJO C;  1WQW A;  3SWN C;  3SWN A;  5GAN j;  3RKW A;  2DJZ A;  5LJ5 d;  3HFN A;  5GAN 4;  2DXU A;  4NL2 A;  1MGQ A;  4DQ2 A;  3RER A;  3BW1 A;  4XTX A;  5LJ5 e;  2RA2 A;  5GAO m;  2EAY A;  4NOY A;  4M7A E;  4M7D G;  3VU3 C;  1M5Q 1;  4HA8 A;  5GMK i;  4M78 D;  3JB9 H;  2DTI A;  4J5Y A;  4J6Y A;  4M75 G;  3QUI A;  1I8F A;  3V7S A;  3JB9 D;  3GIB A;  5GAN 8;  4M77 E;  4M78 E;  4RCC A;  3RUX A;  3FB9 A;  4F7U A;  5LJ3 e;  4JRI A;  1WQ7 A;  2HNI A;  2RD1 A;  3V8K A;  2YLB A;  4C8Q B;  4C8Q F;  1KQ2 A;  4C92 F;  4C92 B;  5GAM e;  1D3B A;  1WPY A;  2VXE A;  4M7A G;  3BFM A;  3BDU A;  2CGH A;  4OP0 A;  1HK9 A;  2DTO A;  4EMG A;  3JCM J;  4XTW A;  4PJO F;  1YCY A;  4PJO B;  3SWN B;  4HT8 A;  5GAN g;  2YHT A;  3JCM e;  4M75 E;  4M77 G;  4M78 G;  4M7D C;  5GAN h;  2DTH A;  3M4G A;  1I81 A;  2DVE A;  1I4K 1;  4XTZ A;  3JCM X;  4V2S A;  4J6W A;  4X9C A;  2I2L A;  4EMH A;  4JRK A;  1Y96 A;  4XU3 A;  4PNO A;  5LJ3 f;  2EWN A;  5GMK e;  4F7U F;  1U1T A;  2K57 A;  4F7U B;  5GAM f;  4C8Q D;  5LJ3 j;  4M7A A;  4C92 D;  3INZ A;  4WF2 A;  3RKX A;  1I5L A;  3HSB A;  2JN0 A;  5GAM j;  1D3B B;  2VC8 A;  2FB7 A;  3FJP A;  5DY9 A;  4A53 A;  4C8Q E;  3JCM f;  2EJF A;  4M77 A;  1LNX A;  4M77 C;  4MML A;  2DZC A;  4PJO D;  3SB2 A;  5GAN 5;  3V7C A;  4J6X A;  3FIF A;  2DEQ A; 
#chains in the Genus database with same CATH topology
 3CCE Q;  1UDL A;  3D7S B;  4RTW A;  4FU6 A;  3QII A;  3OYD A;  3L2R A;  4OGC A;  2FRY A;  4FM4 B;  4MZT A;  3HP9 A;  1D09 B;  4E7I A;  1BI2 A;  4QVC A;  1TWB A;  1VQO A;  2K3X A;  4J9I A;  4ZGE B;  1X43 A;  1X27 A;  4MDX A;  1YFN A;  2I0N A;  4F16 A;  2QEX T;  4DOV A;  2JTF A;  4HCB A;  4JZ4 A;  1M90 C;  5L8R E;  3CCJ A;  1UJY A;  3QYG B;  4DA4 A;  2D8H A;  4XU0 A;  3CCV Q;  5IHK A;  5LL6 S;  4BUG A;  2K4Y A;  5EG2 A;  1PHT A;  3X24 B;  4ZGJ B;  3M0S A;  2JNG A;  5IHN A;  1NEG A;  3ER0 A;  4M75 D;  2AIR B;  4AT1 B;  2X4X A;  4J7I A;  3CPW A;  2LQW A;  3HKS A;  1KD1 C;  1D0X A;  5CQY A;  5LJ5 e;  1YJ9 A;  2OI3 A;  2ZPF B;  1FMV A;  1GFD A;  3WXM B;  3M0Q A;  4PLI A;  1QCN A;  1Q82 U;  1U5S A;  4HKE A;  1QWF A;  3JCM J;  2DET A;  3L2U A;  4M78 G;  1SKU B;  1ZLM A;  2L5Q A;  3MPU B;  2I2L A;  3OB9 A;  4YTL A;  3KXT A;  5LJ3 f;  4WCI A;  1XJW B;  2EWN A;  4ANJ A;  1Y57 A;  3EGD A;  4ZN3 A;  1OU9 A;  1KSW A;  3TSW A;  2MPX C;  3UPU A;  4ZTJ A;  1WX6 A;  1PM3 A;  4FL6 A;  3CCS T;  2CYZ B;  1G83 A;  4M7D A;  2DL7 A;  2M9U A;  2FPE A;  4CI0 C;  2CZ1 B;  2P84 A;  1BCM A;  3REB B;  1QVF S;  2DF6 A;  2H3J A;  1VQ8 T;  3EGD B;  3HHT B;  1K73 C;  1M30 A;  1XQH A;  4J9C A;  3OYC A;  1VQ6 T;  3QBY A;  2GF7 A;  2L3S A;  1YP5 A;  1NG2 A;  4FCY A;  1JEG A;  2DD5 A;  4F7U G;  3JAM E;  2P0Q A;  4M7D B;  1Y7X A;  5GAO n;  5A0D A;  1YIT A;  2XMF A;  3G4S A;  2K5L A;  4M7A D;  1UUE A;  4HT9 A;  1RAH B;  5IN1 A;  1VQP T;  3G1J A;  1S72 A;  2ECZ A;  4IUV A;  2GTO A;  2P4R A;  5CAI A;  3FJ5 A;  4OB2 B;  2LRQ A;  2R57 A;  1W4S A;  4J9F A;  3P8D A;  1B3Q A;  2VVK A;  2JOY A;  4LUE A;  2L3Q A;  4L5G A;  2DRK A;  3I56 Q;  1M3B A;  2WAC A;  4BD3 A;  2VAS A;  2X3W D;  2DM1 A;  2VYT A;  4M78 D;  3CXC A;  3FB9 A;  4IUT A;  4LN2 A;  3V8K A;  1K8A C;  2QQS A;  1JXM A;  4LD6 A;  4HT8 A;  1UB4 A;  4M77 G;  2HD0 A;  2RJF A;  1I81 A;  2K9G A;  2XDB A;  1IRX A;  2LCS A;  3CCE T;  2K3B A;  4LUD A;  1IHV A;  2FG0 A;  2YDL A;  3I9Q A;  4OMO A;  5GAM j;  4KGZ B;  1WJR A;  3GBQ A;  1WJQ A;  5GAN 5;  2MYS A;  2XKO C;  1C1A A;  1YWP A;  2HQE A;  4KGX B;  2EYY A;  3ZBD A;  3JB9 G;  2ZAE A;  2AHJ B;  4RG2 A;  2RHY A;  1KIK A;  2V8K A;  1N9S A;  3PVQ A;  3CC2 Q;  4MMK A;  2LX9 A;  1BKB A;  5CCA A;  2RI2 A;  1B34 A;  2VGN A;  2KR3 A;  2KAF A;  1Q81 C;  3PNW C;  4C5I A;  3JCM P;  3CCV T;  1IRE B;  1PD0 A;  2M51 A;  5HY6 A;  3H9N A;  4IUU A;  1M4Z A;  1ABO A;  4JS5 A;  5LJ3 d;  5J26 A;  1K8A U;  3CCM Q;  1U3O A;  4PFZ A;  1K0X A;  3RIR A;  4Z88 A;  3CCR Q;  3ZEH A;  1TUG B;  2E5K A;  1VQM Q;  3VRZ A;  4X1V A;  1GBQ A;  2OX7 A;  2Y4Y A;  2HQX A;  3QKJ A;  2WSF E;  2L8D A;  1I1J A;  4HVU A;  1ZSG A;  3SWN C;  1CKA A;  2DJZ A;  2ED1 A;  4IKF A;  2RA2 A;  1X75 C;  4HA8 A;  3NPF A;  1I8F A;  2X4Y A;  5GAM e;  3OYA A;  5FLX E;  5DM7 R;  1Q86 R;  2EPD A;  3JCM e;  2H8H A;  2DER A;  3AT1 B;  2FO0 A;  3CD6 A;  2LDM A;  1QP3 A;  3JCM X;  1H3Z A;  2A7Y A;  1VQ7 Q;  5I2S A;  2CZ6 B;  4CC4 B;  4AG1 C;  1VQN A;  3RKX A;  5HK0 A;  1I5O B;  3QWY A;  4A4E A;  1QVF A;  5AYF A;  2BUD A;  3ULR B;  3TSZ A;  3NTK A;  5FWB A;  1UGV A;  3LGL A;  1VQ5 Q;  1M2V A;  4CC2 A;  4C8Q G;  3V8J A;  4C92 G;  1W6X A;  4RCB A;  1BIA A;  2XI9 A;  2RQV A;  4PJO G;  2D9T A;  2O2O A;  1QVG P;  1M1K U;  4XTY A;  1K4U S;  2QTX A;  4BE2 A;  4L6V 5;  4HVW A;  4FYV B;  3CC7 Q;  1AZE A;  2XDD A;  3EFR A;  2IPO B;  1TH7 A;  1KC8 C;  1C6V X;  1ABQ A;  2CKK A;  3RNJ A;  2JUF A;  1B7T A;  2BE7 D;  4J9E A;  4CC3 A;  1FMK A;  2CH4 A;  1LCK A;  5ECA A;  1GRI A;  2M0O A;  4PJL A;  1K9M R;  2O9S A;  1VIF A;  4GLK A;  1OQK A;  8AT1 B;  2VXF A;  1GCQ C;  3PE0 A;  1I0C A;  5GMK m;  3UWN A;  4A54 A;  3I56 T;  3M53 A;  1OUL A;  1VQK A;  3H0I A;  2V26 A;  4D8K A;  2Y4X A;  5GAN 6;  3C12 A;  1BI3 A;  1QVP A;  1OPK A;  3SDZ A;  1OV3 A;  2FZK B;  2CUB A;  3SWN A;  1X6O A;  5GAN j;  2LQK A;  1AHJ B;  4MZM A;  5GJW B;  5DLO A;  4XTX A;  3CPF A;  5IHI A;  5GMK i;  2QDL A;  3SD4 A;  4M78 E;  1RAA B;  3LYI A;  2RD1 A;  3EFO A;  5HCK A;  4AFS C;  1KQ2 A;  3I55 A;  2WSE E;  2RHI A;  2CGH A;  4F14 A;  3SWN B;  2YHT A;  2KXC A;  2LP5 A;  2J06 A;  3NMZ C;  4OMQ A;  3EH1 A;  2OTL Q;  2BTT A;  2MWP A;  4C8Q D;  4E7L A;  3EFO B;  3C0C A;  3UAT A;  4C92 D;  3VYG A;  1V76 A;  1KFZ A;  2DK3 A;  1WJS A;  3VJP A;  5AT1 B;  2RNA A;  4PJO D;  1PRL C;  1ZA1 B;  2JS2 A;  2K5I A;  1GBR A;  3M9Q A;  1WIE A;  2QDY B;  3CC2 T;  4HCC A;  1K1Z A;  2KVQ G;  2EGC A;  5CKF A;  4RTV A;  1R77 A;  3EG3 A;  2J6F A;  2O4X A;  2M16 A;  2MF2 A;  3CMA Q;  1AWW A;  1X69 A;  1WLP B;  5GAN 7;  2RO0 A;  1VQL A;  2KI7 A;  1JBM A;  5KYU A;  3DB3 A;  3CEY A;  3CCM T;  3UA6 A;  5J3B A;  4BY6 C;  3CCR T;  2LCL A;  2RN8 A;  3M55 A;  5GAN e;  1QLY A;  3CME Q;  3DKM A;  3I5S A;  1VQM T;  3I35 A;  2RH2 A;  2O4X B;  3G6E Q;  3VS4 A;  1GCQ A;  4BI3 A;  1MNE A;  2LQ8 A;  2KEA A;  1BIB A;  2MI6 A;  3CC4 A;  2MK5 A;  1XOV A;  1M8V A;  1H92 A;  4OF1 A;  1X6G A;  2ZGW A;  3M59 A;  5GAO l;  1JJ2 S;  4FSS A;  3CCL Q;  1VQ6 Q;  1B07 A;  5GJV B;  3CCU Q;  1K73 R;  4M77 E;  4OB3 B;  1KQS P;  2ZPE B;  1X6B A;  3S3M A;  1VQ7 T;  1QCO A;  1WHH A;  2YUN A;  4KH0 B;  2BIV A;  2FVU A;  1ZUK A;  1RAI B;  4V2S A;  1BI0 A;  3G71 Q;  4MZP A;  1VQ5 T;  2KK4 A;  4WF2 A;  3PIO A;  2CSQ A;  1FWZ A;  1WGS A;  4Y92 A;  2C0I A;  2QQ9 A;  2SRC A;  3JCM c;  3EG2 A;  3L2Q A;  4OMF B;  3CC7 T;  2J6O A;  5LJ5 j;  2JVV A;  2E5Q A;  5GAM g;  1OEB A;  2E1H A;  3M0R A;  4M77 F;  5D6W A;  3MP6 A;  5CR2 A;  2HBW A;  3JCM W;  4J9H A;  1TU0 B;  2QK0 A;  1K8A R;  1Q86 U;  1QKX A;  3JCM g;  1ZHI A;  2IVW A;  2EJ9 A;  2D0Q B;  1TS9 A;  2CH4 W;  4KUL A;  2RK1 A;  3UF4 A;  4EMK C;  2KY9 A;  4RTT A;  3GOX A;  3VRY A;  1DJ7 B;  3MJX A;  1GCP A;  4DBQ A;  4QW2 A;  1ZSZ A;  2FYK A;  2VB6 A;  4K11 A;  5KYW A;  2DL5 A;  2ATC B;  4Z02 A;  3JB9 F;  4N4G A;  4JLI A;  1VQ9 Q;  1C0M A;  2CP5 A;  3OYM A;  4BDZ A;  1T3L A;  1ACM B;  2RJC A;  2E3I A;  4BY6 B;  4BI8 B;  4C0Z A;  4E7Z A;  4BAC A;  2DXU A;  2MIO A;  1PKS A;  1ZSZ B;  1NLP C;  2C06 A;  5KYW B;  5KCH A;  3JB9 H;  2MOX A;  2QA4 A;  1KQS A;  5GAN 8;  1LVK A;  2L0A A;  4LNP A;  1YIJ Q;  1SHF A;  1NZ9 A;  1WPY A;  2OTL T;  4M7A G;  2D6F A;  1GL5 A;  3M4Y A;  4RKU E;  1K9M U;  3TVT A;  3VKI A;  1BBZ A;  1M27 C;  1D0Y A;  4O5V A;  2A37 A;  3O8V A;  4JRK A;  4F17 A;  1SPK A;  4KT0 E;  2JM8 A;  2VGM A;  3OYY A;  3OYK A;  4C8Q E;  3CXC P;  1M1K R;  1E6H A;  1G3T A;  2RJD A;  4M77 C;  1Z9Z A;  4J6X A;  2RQR A;  4FYX B;  4XU2 A;  1J3T A;  1H64 1;  1YJW Q;  3HTR A;  3CMA T;  1M2O A;  1NYF A;  2HSP A;  2KYM A;  2VUB A;  4JUV A;  1YJN Q;  2J6K A;  2BZX A;  1TUC A;  1OOT A;  4JJN K;  4X9D A;  2Y90 A;  2X4W A;  2ZPG B;  3CME T;  1HD3 A;  1JU5 C;  3G6E T;  3C94 A;  4KRT A;  1M90 U;  3U23 A;  4EMK A;  1BB9 A;  3QWX X;  3ZFJ A;  3UA7 A;  3OYE A;  1PWT A;  1QMC A;  3HRU A;  2K7A A;  1RI9 A;  2HDA A;  1AVZ C;  4GBQ A;  1VA7 A;  1Q7Y C;  2DJQ A;  1UE9 A;  4ELZ C;  3H8Z A;  3C4S A;  2LTO A;  3CCL T;  2K3Y A;  2QEX A;  4PJM A;  3CCU T;  2PNI A;  2KT1 A;  2RK2 A;  4EMK B;  4N4I A;  1KD1 U;  5CK9 A;  3F70 A;  2PUO B;  2DIG A;  3UT1 A;  2L3P A;  2Z0W A;  1PCX A;  3PTA A;  3RMQ A;  2J05 A;  2RF0 A;  3HFN A;  3H41 A;  3BW1 A;  1ZX6 A;  4M7D G;  2DO3 A;  2JM9 A;  3LH0 A;  1G8X A;  3OW2 S;  4JRI A;  1QP2 A;  2EW3 A;  4ORZ A;  1N8R C;  3G71 T;  2F5K A;  5GAN g;  2GTJ A;  3TCJ A;  4PL6 A;  5CVI A;  3OA6 A;  2KRO A;  1I4K 1;  1RI0 A;  2YXY A;  3RBB B;  4E2F B;  4EPC A;  1W1F A;  1Y96 A;  4XU3 A;  2YRV A;  3QDR B;  2MAM A;  2CP6 A;  2K57 A;  2M1H A;  3OS2 A;  5DY9 A;  3FJP A;  5CKH A;  3L42 A;  2F2W A;  4M77 A;  1T0H A;  2NWM A;  2VWF A;  3MP1 A;  4QQ6 A;  4FT2 A;  4AMC A;  2OTJ Q;  3LGF A;  2QTV A;  1Y96 B;  1M8M A;  5GAN 4;  1VQ4 Q;  3PGG A;  3A8L B;  1K73 U;  4XU1 A;  2YLC A;  2PVD B;  1YWO A;  4M77 B;  5KYX B;  2JXB A;  3CCS A;  2JMC A;  2KDS A;  2QI2 A;  2ROL A;  3H0H A;  3QSU A;  1VYU A;  2WSC E;  4KGV B;  3L2Z A;  3VS3 A;  1UG1 A;  1QVF P;  2CSI A;  1VQ8 A;  2KQW A;  2EKO A;  4HXJ A;  2FPD A;  4PK4 A;  4DEY A;  2EQM A;  2DA9 A;  1VQ9 T;  5KYY A;  2PVG B;  1EIF A;  1HSQ A;  3M0U A;  1WDX A;  2RQU A;  5GAO p;  1YHQ A;  1T3S A;  4M7D D;  5KE2 A;  4E47 A;  1WZO A;  4C0D C;  1HXD A;  4P5N A;  4QQG A;  1RAG B;  3CCQ Q;  1VQP A;  1QWE A;  4C0G A;  1PKT A;  2BZ8 A;  1YI2 Q;  5KYY B;  1YIJ T;  1Y07 A;  1MMA A;  3X28 B;  4DBR A;  2QAS A;  1RL2 A;  1UGR B;  2RQT A;  2DX1 A;  2HAX A;  2KYB A;  1TTH B;  1IO6 A;  4RMO A;  1W70 A;  4XTW A;  4M75 E;  4FW2 A;  1IZ6 A;  2DTH A;  1E6G A;  3VUZ A;  2DLP A;  1BYM A;  9ATC B;  5GMK e;  5LJ3 j;  1I5L A;  3TEE A;  1YJW T;  1AWX A;  3OYN A;  2CZ0 B;  2DVJ A;  4LD9 K;  3OYF A;  2P0P A;  3SHW A;  1YJN T;  5I2M A;  2F2V A;  1N9R A;  1FX7 A;  4XTU A;  3CCE A;  1FYN A;  1GFC A;  2HCK A;  1NM7 A;  4JDS A;  2COZ A;  4AFU C;  3RKY A;  4JRQ A;  4DBH A;  1VQO Q;  3HL8 A;  5FU7 C;  3EHR A;  3VV0 A;  2ROT A;  4E7J A;  1Q81 U;  3RES A;  2COY A;  1SF9 A;  1BU1 A;  2LZ6 B;  3KFV A;  4ZTF A;  2BE9 B;  1WNL A;  4XAX B;  2ZPH B;  4N0A C;  2DPP B;  4M75 F;  5LJ5 g;  3LWH A;  3CCJ Q;  2YWW A;  4MDW A;  5GAO q;  5HK3 A;  2RB6 A;  1NPP A;  2E41 A;  2KBT A;  1MUZ A;  4LDV A;  2E65 A;  5FWC A;  4BI4 A;  1RAF B;  2A36 A;  1R8O B;  2E6N A;  2AKK A;  3CCV A;  2YSQ A;  3WVD B;  1PRM C;  3V8L A;  4OB1 B;  1WXU A;  1G3Y A;  2FHD A;  2NLU A;  1YJ9 Q;  4OGE A;  1MMG A;  2ED0 A;  2GFA A;  4RG8 A;  5GAO m;  4NOY A;  2KRM A;  4M7A E;  1SEM A;  2DTI A;  4J6Y A;  4ZNX A;  4E7K A;  2DAQ A;  4RCC A;  2QQB A;  5LJ3 e;  2YLB A;  8ATC B;  1M3A A;  1Y0M A;  4C0D B;  4LXC A;  3JV3 A;  2VXE A;  2EGA A;  5CKD A;  4EMG A;  3GNF B;  3OMG A;  2DVE A;  2IG0 A;  4KUD K;  4EMH A;  1PD1 A;  2OTJ T;  2LJ0 A;  3EGX A;  4J83 A;  1NYG A;  1VYT A;  4A4K A;  2DE0 X;  1OZ3 A;  3CBO A;  1VQ4 T;  5CO7 A;  2ZPB B;  2CDT A;  2CT4 A;  3MEU A;  4FT4 A;  1NE8 A;  2GQI A;  3P8H A;  4IIO A;  2KRN A;  3E19 A;  3M0T A;  1M90 R;  4M75 C;  5L23 A;  3BY7 A;  1H3H A;  4OVA A;  4M7A F;  3L1A A;  2OAW A;  3EGX B;  1LPL A;  1ZA2 B;  3KUF A;  5FRN A;  2YRC A;  2DIL A;  1U1S A;  5GAM h;  2V1R A;  1W2B S;  2HSE B;  1KC8 U;  4OMN A;  1AZG B;  1JO8 A;  3PVL A;  3JCM b;  3JCM h;  4RTY A;  2XU8 A;  5C0M A;  2HBP A;  1QW1 A;  2PTK A;  1YIT Q;  1EFN A;  2FZC B;  3G4S Q;  2PU9 B;  2O31 A;  4E7H A;  2D1X A;  2EKH A;  2X3X D;  1KD1 R;  1A0N B;  1S72 Q;  5CQX A;  3FLG A;  1WHL A;  2COW A;  4JZ3 A;  1O9S A;  4C5E A;  4D6W A;  4F7U E;  5FU7 B;  3TRE A;  3CPW S;  3CCQ T;  5D6X A;  3X26 B;  4M78 F;  2P4T A;  1HYO A;  1YI2 T;  2M0Y A;  1O75 A;  2KT8 A;  4IUR A;  4OB0 B;  4PJJ A;  1UHC A;  4M7D E;  1G2B A;  4B6M A;  3REA B;  2YUO A;  4A4G A;  3I56 A;  1IHW A;  2QAZ A;  1MHN A;  1RAD B;  3BDL A;  3OMC A;  3EH2 A;  4HVV A;  2XIC A;  5DLQ E;  1BK2 A;  1SSH A;  3BFM A;  4FYY B;  3OY9 A;  4OMP A;  2FRW A;  3T9N A;  2K6D A;  1IB8 A;  1UEC A;  3E9F A;  1Q7Y R;  4F7U F;  4M7A C;  2O01 E;  1NJI C;  2ABL A;  2DIQ A;  3OYI A;  4MML A;  4KUI A;  1G5V A;  2EQU A;  2LNV A;  3MO8 A;  3JB9 J;  2JTE A;  2V8I A;  1UGS B;  3URG A;  1VQO T;  2L3R A;  2DL8 A;  5M9O A;  2E12 A;  1KHC A;  4QVD A;  1E7O A;  4M75 A;  2K79 A;  3M56 A;  4Y28 E;  1G3S A;  3MEW A;  3RR6 A;  3JRZ A;  3EAE A;  3OS0 A;  4RTU A;  4GY5 A;  4PFO A;  3CCJ T;  4M4Z A;  2VKN A;  4KH1 B;  3CC2 A;  1PG5 B;  2E64 A;  4M78 C;  4RTZ A;  4DOW A;  1M3C A;  1N8R R;  4IUP A;  1MMN A;  3S3N A;  2DEU A;  1OX8 A;  4BE1 A;  2JT4 A;  4M75 B;  5CKE A;  1NLO C;  3DLL A;  2JJ9 A;  5I11 A;  1JXO A;  1PNJ A;  3M57 A;  5GAN 3;  1IGU A;  2E4H A;  3NGP A;  2DD4 A;  1D1B A;  5C6S A;  1AD5 A;  1R0B G;  2LNH B;  3JSC A;  4IUQ A;  3MEV A;  3I5R A;  3LH5 A;  2C0O A;  3ME9 A;  3PMT A;  5D6Y A;  1YJ9 T;  1YCS B;  3CCM A;  1UTI A;  4J9G A;  2EYW A;  2LJ3 A;  2R58 A;  2A3L A;  4PLL A;  2GBQ A;  3CCR A;  1XTD A;  1VQM A;  4R56 A;  3HRS A;  3OSV A;  3FEO A;  5A2Q E;  3VU3 C;  1M5Q 1;  4O6J A;  2LT1 A;  4QVZ A;  2F69 A;  3QUI A;  4LDU A;  3CBP A;  1WQ7 A;  1JJ2 P;  4ZGD B;  1ZUU A;  4E7S A;  1OPL A;  4B9W A;  1RAB B;  3OYH A;  5A0G A;  2F2X A;  4DEX A;  2C0T A;  2DBK A;  3QJY A;  1Q82 C;  3CD6 Q;  1WYX A;  4M7D C;  5GAN h;  2AZS A;  3R6N A;  2B8A A;  1WFW A;  4XTZ A;  2O88 A;  3J7A F;  1VQN Q;  3EHQ A;  2E6Z A;  1VQ7 A;  5GAM f;  4FIB A;  2CS7 A;  3S3O A;  3M0P A;  2MWO A;  4RTX A;  4M7A A;  4E6R A;  2KNB B;  3INZ A;  3EG9 A;  2VC8 A;  2LX7 A;  2QGF B;  3JCM f;  5IXB A;  3SB2 A;  1UGQ B;  1WI7 A;  1Q81 R;  1ZBX A;  3EFS A;  2IIM A;  1W2B A;  1VQ5 A;  2DZ9 A;  3QO3 A;  1SSF A;  5LJ3 g;  4M7A B;  2KSS A;  3EG9 B;  1YIT T;  3G4S T;  4QKU A;  2RM4 A;  1KJW A;  4Y91 A;  2E3H A;  1PC0 A;  1KG1 A;  3JCM Q;  1S72 T;  1SRM A;  1JRI A;  3QZ9 B;  4C5H A;  3SFM A;  4C92 E;  1WHM A;  4ZN1 A;  4M78 A;  3CC7 A;  2RHZ A;  4ELY C;  1OZ2 A;  4PJO E;  3EG0 A;  2QGG A;  5J39 A;  3S6W A;  2CP3 A;  2FPF A;  1IGQ A;  1OYX A;  2VV5 A;  1SG5 A;  2LT4 A;  1AT1 B;  2GGR A;  3QJ6 A;  3QG1 A;  1TUD A;  2W10 A;  1V29 B;  4JPB W;  4B9X A;  2RJE A;  1VQK Q;  1RUW A;  1Z9Q A;  5FW9 A;  4M78 B;  3PMI A;  1ZUY A;  2CP0 A;  3G7Z A;  1QQJ A;  2KE9 A;  3QDF A;  4PJN A;  3X25 B;  4FYW B;  1ZBJ A;  3H6Z A;  3RMS A;  2GFU A;  1M9S A;  4NL2 A;  1MGQ A;  2K2M A;  4OMM A;  3OQ5 A;  2R5M A;  3OYJ A;  4PKC C;  4J5Y A;  3V7S A;  2AT1 B;  3J81 E;  3M58 A;  4Q5W A;  3H0F A;  3I55 Q;  1JJ2 A;  1UEB A;  4FSX A;  4F7U A;  4C8Q F;  4C92 F;  1WXB A;  1JB0 E;  2PVO B;  4PJO F;  2X4J A;  1KHI A;  1P92 A;  2GQV A;  1R0C B;  2EYZ A;  6AT1 B;  2KMT A;  3OBY A;  3FC3 A;  4IIM A;  2DMO A;  5FRO A;  4QQD A;  3CBM A;  4F7U B;  1Y71 A;  2OTL A;  4RUG A;  2YUQ A;  5D7U A;  1S1N A;  3P8B B;  4OML A;  3BE3 A;  4Z89 A;  1KC8 R;  4A63 B;  4EDU A;  4WTO B;  2DXC A;  1YHQ T;  3CQT A;  2LVM A;  3JB9 I;  2CP7 A;  4AG2 C;  1LJO A;  1X2Q A;  2JW4 A;  2QG9 B;  3QHS A;  2EJG A;  2CUD A;  2EYX A;  4C0F A;  2FEI A;  3NFC A;  3TQ7 P;  1I07 A;  1VQL Q;  4CC7 A;  5IT9 E;  5KYX A;  1QCF A;  1FXX A;  5I21 A;  3CMA A;  1N5Z A;  4TVR A;  1D1A A;  1M1G A;  4R55 A;  3GP8 A;  2D8J A;  2FZG B;  5LJ5 h;  4BE0 A;  1Q7Y U;  1MV3 A;  2DFU A;  2RHU A;  5GMK j;  3A8M B;  4A4H A;  2KRS A;  1UFF A;  1YN8 A;  3CC4 Q;  3CME A;  1OU8 A;  2B86 A;  5GAM d;  3IQL A;  1WHK A;  3PFS A;  3G6E A;  2BKD N;  2CZ7 B;  4ME7 A;  2XG8 D;  1AWO A;  3JCM d;  4C8Q C;  4C92 C;  2JZ2 A;  1KK7 A;  5GAN f;  4GLM A;  2QYZ A;  4PJO C;  3RER A;  3FRN A;  4A4F A;  3CCL A;  1VQ6 A;  2RMO A;  2EVR A;  4LE9 A;  3CD6 T;  3CCU A;  1F1B B;  2O9V A;  3MET A;  1HJD A;  3L2V A;  1N8R U;  1JQQ A;  1VQN T;  5A0L A;  4J8O A;  2LCC A;  4VUB A;  1AEY A;  3MKD A;  4N4H A;  1MND A;  3Q1J A;  1N27 A;  1UJ0 A;  3MEA A;  2HZY A;  5IXF A;  2CT3 A;  3OW2 P;  2EYQ A;  3GPL A;  3O5Z A;  4XK8 E;  3G71 A;  2JN0 A;  3A8O B;  1SHG A;  2DL3 A;  2QQA A;  1QVG S;  2EJF A;  1VUB A;  3A98 A;  2W0Z A;  4AFZ C;  3FIF A;  3QPH A;  1M1F A;  1PSE A;  3OBW A;  4FW1 A;  4XQ3 A;  1K76 A;  1V1C A;  3MHX A;  2DXT A;  4J9B A;  3M5A A;  1QKW A;  1D1C A;  1B34 B;  1EZZ B;  2DBM A;  3MP8 A;  2R5A A;  1M1K C;  3X20 B;  2PQW A;  2RI5 A;  2AK5 A;  3V7R A;  1BI1 A;  1LOJ A;  3KBG A;  1VQK T;  2NUZ A;  4EIK A;  2LC4 A;  2YUP A;  1FMW A;  1KQ1 A;  2XID A;  4KBM B;  3L2W A;  1NBE B;  4M77 D;  1G3W A;  2DKG A;  1NJI R;  4ATO A;  3HPW A;  3A8H B;  1X01 A;  4UC4 A;  2LMJ A;  2HL5 C;  3SEM A;  4C5G A;  5FRM A;  4C8Q A;  4QT7 A;  4C92 A;  2GCX A;  1VQ9 A;  4JJC A;  2EQI A;  3I55 T;  3QXE B;  4PJO A;  2F1L A;  2PUK B;  2RHX A;  3RKW A;  3VS2 A;  1YNZ A;  2BZY A;  1IXD A;  1D0Z A;  3LW5 E;  2QA4 Q;  2EQJ A;  2EAY A;  3R6O A;  2XHC A;  3GIB A;  3JB9 D;  2DRM A;  4HCZ A;  2KGT A;  2RPN A;  2V1Q A;  2LQN A;  2HNI A;  4C8Q B;  4C92 B;  1D3B A;  1X2K A;  2YRD A;  4LDW A;  1YIJ A;  4PJO B;  2A0F B;  2G6F X;  4LDY A;  4CRI A;  2LJ1 A;  3OW2 A;  4J6W A;  2NUP A;  1TG0 A;  2OAU A;  1VYV A;  3GLX A;  3QZ5 B;  2E70 A;  1AWJ A;  3VS1 A;  4PFP A;  7AT1 B;  3PIP A;  3WVE B;  1D3B B;  2FB7 A;  4A53 A;  3GF5 A;  3A5Z B;  3TU4 K;  2V8J A;  2K2V A;  1M2V B;  1WA7 A;  1Q95 G;  1TSF A;  2F5T X;  1VOM A;  3NTH A;  2FL7 A;  5LJ5 f;  2HEQ A;  1PSF A;  2NUP B;  5GAN d;  1VQL T;  3LX7 A;  2HKN A;  2G3R A;  1YJW A;  1ARK A;  3EGU A;  1K0S A;  4R0K A;  3VS5 A;  2YT6 A;  1YJN A;  3OS1 A;  2X35 A;  1EX4 A;  2JS0 A;  1ZQ1 A;  2ZPI B;  1Q82 R;  3CC4 T;  5FU6 C;  3EG1 A;  2OJ2 A;  3J80 E;  2HQH A;  1UGP B;  5GMK h;  3AHU A;  2EQK A;  4XTV A;  5KE3 A;  2DL4 A;  2QEX Q;  1N6A A;  4NS5 A;  5IH2 A;  1YBY A;  5GAN 2;  3M54 A;  2EGE A;  1KQS S;  3PT9 A;  3OS5 A;  4N0A A;  4NL3 A;  3JCM V;  1K9A A;  3THK A;  2JMA A;  1WQW A;  4DQ2 A;  3N5B B;  2DNU A;  2HKQ B;  2ZZD A;  3LLR A;  3OYB A;  2DXB A;  1NEB A;  2CRE A;  3RUX A;  2NUT A;  2CP2 A;  1AOJ A;  4J9D A;  4ESR A;  2P0K A;  2AKL A;  4OP0 A;  3OSS C;  2DTO A;  3VS6 A;  1UHF A;  1SRL A;  3VYH B;  2D0N A;  3M4G A;  3NHN A;  4LDX A;  2ZCF B;  1QVG A;  4X9C A;  1WHG A;  1WHJ A;  2L2P A;  3E1S A;  3C95 A;  1XNI A;  2ESW A;  1WXT A;  2NUT B;  1RLP C;  2KXD A;  1T0J A;  4DBF A;  2NYS A;  3ASK A;  3V7C A;  2DEQ A;  4HCK A;  2K5F A;  2A08 A;  2DYB A;  1MMD A;  2M02 A;  1RAC B;  3A8G B;  4D8D A;  3RDV A;  2OTJ A;  3VS7 A;  5GAO r;  1VQ4 A;  5LJ3 h;  1ZSZ C;  4AFQ C;  3CCS Q;  3NTI A;  3VUB A;  5IAY A;  3LWI A;  2EFI A;  1H8K A;  1OX9 A;  5KH6 A;  2L89 A;  4X34 A;  5KYU B;  1VQ8 Q;  1RLQ C;  4JLG A;  3FDR A;  1OI1 A;  4JRP A;  1Q86 C;  1CKB A;  1CSK A;  4M7D F;  2QXF A;  1TXQ A;  2X9H A;  1VIE A;  2PZ1 A;  4J7F A;  4L59 A;  4BDY A;  5GMK l;  1MV0 B;  2ENM A;  2SEM A;  1U06 A;  1U8R A;  2HMA A;  1W2B P;  4JJB A;  1BCO A;  2E10 A;  3ZL7 C;  2RQW A;  1YHQ Q;  2J7I A;  2A28 A;  3A1P A;  3HFO A;  5HKC A;  2QA4 T;  5FU6 B;  4II1 A;  5EC7 A;  1VQP Q;  2EIF A;  1TOV A;  5LJ5 d;  3CPW P;  3CCQ A;  3HRT A;  2XD0 A;  1NPR A;  1YI2 A;  2AZV A;  4M75 G;  3QYH B;  2H3E B;  3OYG A;  2MMP A;  2XDP A;  2JTM A;  3VS0 A;  3BDU A;  1HK9 A;  3CXC S;  1YCY A;  2X51 A;  2GNC A;  4Z8A A;  2MCN A;  4JJD A;  5CKB A;  1K9M C;  5KCO A;  3E9G A;  4PNO A;  3DB4 A;  1NJI U;  3E2U A;  4F04 B;  1U1T A;  2RI3 A;  2HL3 A;  5I22 A;  5CIU A;  3HSB A;  2XK0 A;  4JS4 A;  3UDC A;  5KYN A;  1LNX A;  2QQR A;  2DZC A;  3GNG A;  3MCA B;  3OYL A;  3DLM A;  4BB7 A;  1GXI E;  2DYI A;  1RAE B;  2EBP A; 
#chains in the Genus database with same CATH homology
 1N9R A;  2DXC A;  2QDY B;  1YHQ T;  1FX7 A;  3CC2 T;  4XTU A;  4HCC A;  2LVM A;  3JB9 I;  3CCE A;  1LJO A;  3QII A;  4FU6 A;  3OYD A;  2KVQ G;  4JDS A;  3L2R A;  4OGC A;  3QHS A;  2EJG A;  5CKF A;  4FM4 B;  3RKY A;  4JRQ A;  4MZT A;  3HP9 A;  4C0F A;  2O4X A;  3HL8 A;  3NFC A;  1BI2 A;  5FU7 C;  2M16 A;  4E7I A;  4QVC A;  2MF2 A;  3VV0 A;  4E7J A;  1Q81 U;  3RES A;  1VQO A;  5IT9 E;  2K3X A;  4ZGE B;  5GAN 7;  1FXX A;  2RO0 A;  4ZTF A;  1VQL A;  5I21 A;  1WNL A;  3CMA A;  4XAX B;  4TVR A;  1JBM A;  4MDX A;  1M1G A;  2QEX T;  4R55 A;  2ZPH B;  4N0A C;  3DB3 A;  4DOV A;  2DPP B;  3CEY A;  4M75 F;  5LJ5 g;  3LWH A;  3GP8 A;  3CCM T;  4MDW A;  2JTF A;  5LJ5 h;  5J3B A;  5GAO q;  5HK3 A;  2RB6 A;  1NPP A;  2E41 A;  4BE0 A;  1Q7Y U;  1M90 C;  4BY6 C;  3CCR T;  2LCL A;  5L8R E;  3CCJ A;  3M55 A;  2RHU A;  3QYG B;  5GAN e;  3A8M B;  5GMK j;  3DKM A;  4A4H A;  1VQM T;  4DA4 A;  2RH2 A;  2O4X B;  4XU0 A;  4LDV A;  2E65 A;  4BI3 A;  2LQ8 A;  3CME A;  5GAM d;  4BI4 A;  5LL6 S;  2MI6 A;  1BIB A;  2K4Y A;  5EG2 A;  4BUG A;  3G6E A;  3PFS A;  3X24 B;  4ZGJ B;  3CC4 A;  2BKD N;  1XOV A;  1R8O B;  2CZ7 B;  2E6N A;  3CCV A;  3WVD B;  1M8V A;  2JNG A;  4OF1 A;  4ME7 A;  2XG8 D;  3V8L A;  2ZGW A;  3JCM d;  3M59 A;  3ER0 A;  4M75 D;  4C8Q C;  5GAO l;  4C92 C;  2JZ2 A;  2X4X A;  4OB1 B;  1JJ2 S;  5GAN f;  4J7I A;  3CPW A;  1G3Y A;  2FHD A;  3HKS A;  4PJO C;  2NLU A;  1KD1 C;  4HCB A;  4OGE A;  2GFA A;  3RER A;  4RG8 A;  5CQY A;  5LJ5 e;  3FRN A;  4A4F A;  5GAO m;  4NOY A;  1YJ9 A;  3CCL A;  4M7A E;  1VQ6 A;  2ZPF B;  2DTI A;  4J6Y A;  3CD6 T;  3CCU A;  3MET A;  3WXM B;  4E7K A;  2DAQ A;  4M77 E;  4RCC A;  3L2V A;  2QQB A;  4OB3 B;  4PLI A;  5LJ3 e;  2ZPE B;  1N8R U;  2YLB A;  3S3M A;  1Q82 U;  1VQ7 T;  4C0D B;  1VQN T;  2VXE A;  5CKD A;  4HKE A;  5A0L A;  4EMG A;  3JCM J;  3GNF B;  3L2U A;  4J8O A;  2LCC A;  4VUB A;  4M78 G;  2BIV A;  3OMG A;  2FVU A;  2DVE A;  4N4H A;  2IG0 A;  4V2S A;  4KUD K;  3Q1J A;  1N27 A;  2L5Q A;  3MEA A;  3OB9 A;  2I2L A;  1BI0 A;  4YTL A;  4EMH A;  3KXT A;  5LJ3 f;  2EWN A;  2EYQ A;  3GPL A;  4ZN3 A;  4MZP A;  1VQ5 T;  2OTJ T;  2KK4 A;  4WF2 A;  4XK8 E;  4J83 A;  2JN0 A;  3PIO A;  3G71 A;  4A4K A;  3A8O B;  2QQA A;  1OZ3 A;  3CBO A;  1QVG S;  1FWZ A;  2EJF A;  1VUB A;  1WGS A;  1VQ4 T;  5CO7 A;  2ZPB B;  3UPU A;  3FIF A;  4ZTJ A;  2QQ9 A;  3QPH A;  4FL6 A;  3JCM c;  3CCS T;  3MEU A;  4FT4 A;  2CYZ B;  1NE8 A;  1M1F A;  3P8H A;  1PSE A;  3OBW A;  3L2Q A;  4OMF B;  2M9U A;  3E19 A;  4M7D A;  3CC7 T;  4CI0 C;  2CZ1 B;  4M75 C;  4XQ3 A;  5LJ5 j;  1QVF S;  2H3J A;  1VQ8 T;  2JVV A;  3BY7 A;  3MHX A;  4OVA A;  4M7A F;  3L1A A;  2E5Q A;  3HHT B;  5GAM g;  3KUF A;  5FRN A;  2DXT A;  3M5A A;  2E1H A;  1B34 B;  1U1S A;  5GAM h;  1K73 C;  4M77 F;  1XQH A;  5D6W A;  3MP8 A;  1W2B S;  3MP6 A;  5CR2 A;  3OYC A;  3JCM W;  1KC8 U;  1VQ6 T;  2R5A A;  3QBY A;  3X20 B;  1Q86 U;  2GF7 A;  3JCM g;  1M1K C;  1ZHI A;  2IVW A;  2EJ9 A;  2PQW A;  3JCM b;  2RI5 A;  3JCM h;  1BI1 A;  1LOJ A;  2D0Q B;  2DD5 A;  2XU8 A;  3KBG A;  3V7R A;  4F7U G;  5C0M A;  2HBP A;  2P0Q A;  1QW1 A;  3JAM E;  4KUL A;  2RK1 A;  4M7D B;  1Y7X A;  1VQK T;  5GAO n;  5A0D A;  2PU9 B;  4EMK C;  4E7H A;  2LC4 A;  2KY9 A;  3GOX A;  1YIT A;  3G4S A;  1DJ7 B;  2K5L A;  4M7A D;  5CQX A;  1KQ1 A;  2XID A;  4KBM B;  5IN1 A;  4HT9 A;  3L2W A;  3FLG A;  1VQP T;  1S72 A;  4M77 D;  1G3W A;  1O9S A;  2DKG A;  4QW2 A;  4C5E A;  4D6W A;  4F7U E;  5FU7 B;  3TRE A;  3CPW S;  4IUV A;  2FYK A;  3CCQ T;  5D6X A;  3X26 B;  5CAI A;  4M78 F;  2P4T A;  4Z02 A;  1YI2 T;  4ATO A;  3HPW A;  3A8H B;  3JB9 F;  4N4G A;  4JLI A;  1O75 A;  2LRQ A;  4OB2 B;  4IUR A;  1X01 A;  2R57 A;  4OB0 B;  4UC4 A;  1W4S A;  4C5G A;  5FRM A;  4C8Q A;  3OYM A;  4BDZ A;  4M7D E;  3P8D A;  4C92 A;  2GCX A;  1VQ9 A;  2JOY A;  2RJC A;  3I55 T;  4L5G A;  4BY6 B;  3QXE B;  4BI8 B;  4C0Z A;  4PJO A;  2PUK B;  2RHX A;  3RKW A;  2WAC A;  4BAC A;  4BD3 A;  2DXU A;  4A4G A;  3LW5 E;  3I56 A;  2EQJ A;  2C06 A;  2EAY A;  5KCH A;  1MHN A;  2VYT A;  3R6O A;  4M78 D;  2XHC A;  3CXC A;  3JB9 H;  2QA4 A;  1KQS A;  3GIB A;  3JB9 D;  4HCZ A;  3BDL A;  5GAN 8;  1YJN T;  3OMC A;  3FB9 A;  4IUT A;  2HNI A;  4C8Q B;  3V8K A;  1H3Z A;  5DLQ E;  2XIC A;  4C92 B;  1K8A C;  2QQS A;  1D3B A;  1NZ9 A;  1WPY A;  2OTL T;  4M7A G;  3BFM A;  2D6F A;  3OY9 A;  4LDW A;  1YIJ A;  4PJO B;  4LD6 A;  4HT8 A;  1UB4 A;  3M4Y A;  4RKU E;  1K9M U;  4LDY A;  4M77 G;  3VKI A;  2HD0 A;  2RJF A;  3T9N A;  4CRI A;  1I81 A;  4O5V A;  3OW2 A;  4J6W A;  2XDB A;  2OAU A;  3O8V A;  4JRK A;  3E9F A;  3CCE T;  4F7U F;  4KT0 E;  3GLX A;  3QZ5 B;  3PIP A;  2E70 A;  2VGM A;  3OYY A;  4M7A C;  3WVE B;  3OYK A;  2O01 E;  5GAM j;  1D3B B;  2DIQ A;  2FB7 A;  4C8Q E;  4A53 A;  3OYI A;  3GF5 A;  1NJI C;  3A5Z B;  3TU4 K;  1G3T A;  2RJD A;  1WJR A;  4MML A;  4M77 C;  4KUI A;  1WJQ A;  2V8J A;  1G5V A;  5GAN 5;  2K2V A;  4J6X A;  2XKO C;  2F5T X;  2EQU A;  2LNV A;  3MO8 A;  3JB9 J;  2HQE A;  3NTH A;  2FL7 A;  2V8I A;  1UGS B;  4XU2 A;  3URG A;  1VQO T;  2L3R A;  5LJ5 f;  1PSF A;  5M9O A;  5GAN d;  1H64 1;  3ZBD A;  3JB9 G;  2E12 A;  1KHC A;  4QVD A;  4M75 A;  3LX7 A;  2AHJ B;  2XDD A;  1VQL T;  3CMA T;  3M56 A;  4Y28 E;  1G3S A;  4RG2 A;  2VUB A;  2G3R A;  2RHY A;  4JUV A;  3MEW A;  2V8K A;  1YJW A;  1N9S A;  3JRZ A;  3EAE A;  3OS0 A;  1YJN A;  4GY5 A;  3CCJ T;  4JJN K;  4MMK A;  3OS1 A;  2X35 A;  2LX9 A;  4X9D A;  1BKB A;  5CCA A;  2RI2 A;  1B34 A;  3CC2 A;  2Y90 A;  1ZQ1 A;  2E64 A;  2X4W A;  2VGN A;  2ZPG B;  4M78 C;  4DOW A;  2ZPI B;  3CME T;  4IUP A;  3S3N A;  3G6E T;  3CC4 T;  2KAF A;  5FU6 C;  3PNW C;  4C5I A;  3C94 A;  4BE1 A;  3J80 E;  3JCM P;  3CCV T;  1Q81 C;  1M90 U;  1IRE B;  4M75 B;  5CKE A;  4EMK A;  3DLL A;  3ZFJ A;  5HY6 A;  3M57 A;  5GAN 3;  1UGP B;  3OYE A;  5GMK h;  4IUU A;  1M4Z A;  3HRU A;  3AHU A;  2EQK A;  2DD4 A;  4JS5 A;  4XTV A;  5KE3 A;  5C6S A;  1Q7Y C;  5LJ3 d;  5J26 A;  1K8A U;  4ELZ C;  3JSC A;  4IUQ A;  1N6A A;  3MEV A;  3H8Z A;  3C4S A;  2LTO A;  3ME9 A;  3PMT A;  5D6Y A;  3CCL T;  1YJ9 T;  2K3Y A;  3RIR A;  2QEX A;  4NS5 A;  3CCM A;  1YBY A;  5GAN 2;  3ZEH A;  3CCU T;  3M54 A;  2R58 A;  2A3L A;  2RK2 A;  4EMK B;  1KQS S;  3PT9 A;  4N4I A;  4PLL A;  1KD1 U;  3CCR A;  5CK9 A;  2Y4Y A;  2HQX A;  3OS5 A;  3F70 A;  2PUO B;  1XTD A;  2L8D A;  2DIG A;  2WSF E;  3QKJ A;  4N0A A;  3JCM V;  3UT1 A;  4NL3 A;  1VQM A;  4R56 A;  1WQW A;  3SWN C;  3PTA A;  3RMQ A;  2DJZ A;  3HRS A;  3HFN A;  4IKF A;  4DQ2 A;  3BW1 A;  3N5B B;  3OSV A;  2RA2 A;  2ZZD A;  3FEO A;  5A2Q E;  4M7D G;  3VU3 C;  1M5Q 1;  1X75 C;  2DO3 A;  2LT1 A;  3LLR A;  4HA8 A;  2DXB A;  2F69 A;  4O6J A;  3LH0 A;  4QVZ A;  3QUI A;  1I8F A;  3OYB A;  4LDU A;  3CBP A;  2X4Y A;  3RUX A;  3OW2 S;  4JRI A;  1WQ7 A;  1QP2 A;  4ZGD B;  5GAM e;  3OYA A;  2P0K A;  4B9W A;  5FLX E;  5DM7 R;  3OYH A;  5A0G A;  4OP0 A;  3OSS C;  3G71 T;  2DTO A;  1N8R C;  3QJY A;  1Q82 C;  2F5K A;  3VYH B;  5GAN g;  3JCM e;  3TCJ A;  4PL6 A;  5CVI A;  4M7D C;  3OA6 A;  5GAN h;  3M4G A;  3CD6 A;  2LDM A;  2B8A A;  1I4K 1;  1RI0 A;  1QP3 A;  2A7Y A;  2ZCF B;  4XTZ A;  3JCM X;  1QVG A;  4X9C A;  4LDX A;  4EPC A;  5I2S A;  3J7A F;  1Y96 A;  4XU3 A;  2CZ6 B;  2YRV A;  2E6Z A;  3QDR B;  2MAM A;  3E1S A;  5GAM f;  4FIB A;  2K57 A;  2CS7 A;  1XNI A;  2M1H A;  3C95 A;  3OS2 A;  3S3O A;  1VQN A;  2MWO A;  4M7A A;  3INZ A;  3RKX A;  2VC8 A;  5DY9 A;  3FJP A;  5HK0 A;  3ASK A;  5CKH A;  4A4E A;  3L42 A;  3JCM f;  4M77 A;  1QVF A;  3SB2 A;  5AYF A;  2BUD A;  3V7C A;  2DEQ A;  3MP1 A;  3NTK A;  2K5F A;  4QQ6 A;  1ZBX A;  4FT2 A;  3LGL A;  3LGF A;  3EFS A;  4C8Q G;  1W2B A;  1Y96 B;  3V8J A;  4C92 G;  4RCB A;  3A8G B;  1BIA A;  5GAN 4;  1VQ5 A;  2DZ9 A;  3PGG A;  2OTJ A;  2XI9 A;  3QO3 A;  3A8L B;  1SSF A;  1K73 U;  4XU1 A;  5LJ3 g;  4PJO G;  4M7A B;  2YLC A;  2KSS A;  2D9T A;  5LJ3 h;  5GAO r;  1VQ4 A;  1YIT T;  1M1K U;  3G4S T;  4XTY A;  2PVD B;  2QTX A;  2RM4 A;  3NTI A;  3VUB A;  4BE2 A;  4Y91 A;  4L6V 5;  4M77 B;  5IAY A;  2EFI A;  3LWI A;  1KG1 A;  3JCM Q;  3CCS A;  1S72 T;  2KDS A;  5KH6 A;  1JRI A;  2L89 A;  2QI2 A;  3EFR A;  3QZ9 B;  4X34 A;  3SFM A;  1TH7 A;  4C5H A;  4C92 E;  2WSC E;  4M78 A;  4ZN1 A;  4JLG A;  3QSU A;  3FDR A;  3L2Z A;  1OI1 A;  3CC7 A;  2RHZ A;  4ELY C;  4JRP A;  1KC8 C;  1VQ7 A;  1Q86 C;  1OZ2 A;  4PJO E;  2CKK A;  2QXF A;  2JUF A;  4M7D F;  1VQ8 A;  2KQW A;  1VIE A;  4J7F A;  5J39 A;  2EKO A;  4L59 A;  3S6W A;  4BDY A;  5GMK l;  1OYX A;  2M0O A;  2VV5 A;  2EQM A;  2LT4 A;  1VQ9 T;  1U8R A;  1VIF A;  3QJ6 A;  3QG1 A;  4GLK A;  1V29 B;  2PVG B;  4B9X A;  2RJE A;  2E10 A;  2VXF A;  1EIF A;  3UWN A;  5GMK m;  4A54 A;  3I56 T;  3M53 A;  3HFO A;  4M78 B;  3PMI A;  5HKC A;  1VQK A;  3G7Z A;  5GAO p;  1YHQ A;  2Y4X A;  4M7D D;  2QA4 T;  5FU6 B;  4II1 A;  5GAN 6;  4E47 A;  5KE2 A;  3C12 A;  1QVP A;  1BI3 A;  3X25 B;  4C0D C;  3SDZ A;  1HXD A;  4P5N A;  4QQG A;  1VQP A;  2EIF A;  3H6Z A;  3RMS A;  3SWN A;  4C0G A;  1X6O A;  5LJ5 d;  2GFU A;  2LQK A;  1AHJ B;  3CCQ A;  3HRT A;  1M9S A;  1NPR A;  4MZM A;  1MGQ A;  4NL2 A;  1YIJ T;  2XD0 A;  3OQ5 A;  5DLO A;  4XTX A;  1Y07 A;  1YI2 A;  3CPF A;  2R5M A;  5GMK i;  3X28 B;  3OYJ A;  1RL2 A;  4PKC C;  4J5Y A;  4M75 G;  3V7S A;  3J81 E;  1UGR B;  3M58 A;  4Q5W A;  3SD4 A;  1JJ2 A;  4M78 E;  2HAX A;  1UEB A;  4FSX A;  4F7U A;  3LYI A;  3QYH B;  4C8Q F;  2RD1 A;  3OYG A;  2MMP A;  1KQ2 A;  4C92 F;  3I55 A;  2XDP A;  2WSE E;  2JTM A;  4RMO A;  2RHI A;  3BDU A;  1JB0 E;  2CGH A;  1HK9 A;  2PVO B;  3CXC S;  4XTW A;  4PJO F;  1YCY A;  2X4J A;  1KHI A;  3SWN B;  1P92 A;  2YHT A;  4M75 E;  2GQV A;  1IZ6 A;  2DTH A;  2KMT A;  5CKB A;  3OBY A;  3VUZ A;  5KCO A;  3FC3 A;  1K9M C;  3E9G A;  4PNO A;  1BYM A;  3DB4 A;  5FRO A;  4QQD A;  1NJI U;  5GMK e;  1U1T A;  2MWP A;  3CBM A;  4F7U B;  1Y71 A;  4C8Q D;  5LJ3 j;  4E7L A;  2RI3 A;  2OTL A;  4C92 D;  1I5L A;  3TEE A;  5CIU A;  3VYG A;  3HSB A;  2DK3 A;  2XK0 A;  5GAN j;  4JS4 A;  1YJW T;  1WJS A;  3UDC A;  3OYN A;  3VJP A;  2CZ0 B;  4LD9 K;  1LNX A;  2QQR A;  3P8B B;  2DZC A;  3OYF A;  4PJO D;  2P0P A;  3GNG A;  3MCA B;  3DLM A;  4BB7 A;  2K5I A;  3OYL A;  1GXI E;  3M9Q A;  5I2M A;  4EDU A;  1UGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...