4M77G

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77G00
5GAOp 4XU2A 3HFNA 4J6XA 5GAOq 3JCMc 4HT8A 3JCMb 4M7AD 1MGQA 4M7AA 1I4K1 2JN0A 3INZA 3RESA 4C8QC 5GMKh 3JCMP 4M7DB 1HK9A 2I2LA 1BIAA 3FB9A 3JB9J 1LJOA 4M77C 4C92G 3JCMJ 3SWNA 3BFMA 5LJ3g 2DVEA 3FIFA 3JCMV 4PJOF 4J5YA 1Y96A 4M77B 2DTHA 2E64A 4A53A 1X01A 2DTOA 1LOJA 4M75E 4M78C 4MMLA 4EMKA 5I21A 5GAOn 3JCMQ 4V2SA 4M75F 4QVCA 4F7UE 2CGHA 3JCMg 3JCMd 2DZCA 4XQ3A 2YLBA 5GANh 3RERA 2DXUA 2HNIA 4XTWA 4F7UB 1KQ1A 1WQWA 2VC8A 4N0AC 1N9RA 5GANf 4NL3A 2EJFA 1HXDA 5LJ5e 2DEQA 4M7AB 1KQ2A 2E41A 4X9DA 5GAOl 5GAMe 5GMKi 5LJ5j 3JB9F 3JB9G 4M7DC 5GANj 4M78A 3JCMW 1H641 4N0AA 1Y96B 1BIBA 4PJOA 2QTXA 2DJZA 4C8QF 1JBMA 5LJ5f 2EJ9A 5GAMd 3QSUA 5GAN5 1U1TA 1B34B 1YCYA 3SWNB 4M75C 5LJ5d 5LJ3d 5GMKe 4HA8A 4C8QD 4M7AC 4M7DF 4PJOG 3JB9D 1M5Q1 4M78G 4WF2A 5GAN3 3SWNC 4C92E 5GAN2 3GIBA 1N9SA 1WNLA 4NL2A 4C8QG 4XTZA 3JB9I 4A54A 4C92F 5LJ5g 4J6YA 2DTIA 4X9CA 3EFRA 4J6WA 5GAN4 5GAOm 4PJOB 3V7SA 3QHSA 2ZGWA 3JB9H 3V8JA 3V8KA 5GAOr 3JCMe 4JRIA 4M77E 5GAN8 1TH7A 5GMKl 4PJOE 2E65A 4M75B 2EAYA 4M78E 4XTVA 3SB2A 3V7CA 1WQ7A 2YHTA 3M4GA 4OP0A 4XTUA 5CAIA 4M78F 4XU3A 5GAMf 4M7DD 5GAMg 4M7DE 4M7DA 5LJ3f 3L2ZA 4EMGA 4EMHA 5GANe 4QVDA 2Y90A 4M7AF 4Y91A 3AHUA 4M78D 4C92D 4PNOA 4RCCA 4PJOC 4M77D 4M7AG 4JUVA 3RKYA 4PJOD 3RKWA 1B34A 3QUIA 2E1HA 3BDUA 3RKXA 4F7UG 3PGGA 2EJGA 2FB7A 2RB6A 4HT9A 2VXFA 2FYKA 3RUXA 4M77F 1U1SA 4EMKC 4XTYA 5LJ3e 2RA2A 4RCBA 2RD1A 4XTXA 4JRKA 4NOYA 4JLIA 3BW1A 2VXEA 4M77G 5LJ3h 4C92A 5LJ5h 1M8VA 3QO3A 2DZ9A 5GAN6 5GAMh 3BY7A 4F7UF 4XU0A 4M7AE 5GMKm 1D3BB 1D3BA 1I8FA 2EWNA 4XU1A 5DY9A 5GANg 1I5LA 2DKGA 3JCMX 3V8LA 4M75G 3HSBA 4C92B 1WPYA 1LNXA 1JRIA 1I81A 4M7DG 5GAN7 3V7RA 2E10A 3HFOA 4C8QE 5GAMj 2DXTA 4EMKB 2RM4A 5LJ3j 3FJPA 5GMKj 4F7UA 3VU3C 4C8QA 4M77A 4C8QB 4C92C 3JCMf 2YLCA 2K57A 4M75A 4MMKA 3L1AA 4M78B 3JCMh 3RIRA 5GANd 4M75D 3EFSA 4DQ2A
chains in the Genus database with same CATH superfamily
1BI2A 1NLOC 3HFNA 2COZA 3EFOB 3OYCA 1HK9A 2E6ZA 3UA6A 1G3SA 4LNPA 4M77C 2KK4A 3BFMA 2OI3A 4JJNK 1XOVA 2ESWA 4IKFA 1V1CA 2CGHA 1GBQA 4ZGDB 3JCMd 1YJWQ 1JB0E 1M30A 1I1JA 4M7AD 2XKOC 4Y28E 3GNGA 2C06A 3G4SQ 5GAOl 1FWZA 2FZCB 1YJ9A 3CC7T 4FSSA 1FX7A 2B86A 4WTOB 2G3RA 1OULA 1YIJT 5GAMd 4LD6A 4FYWB 4AFZC 2CREA 3MEWA 4WF2A 5FWCA 3SWNC 2M16A 1NJIU 4GLKA 3EH2A 3J80E 4C92F 4AFQC 3V7SA 4QQGA 2ZGWA 1PD1A 3G4SA 3H6ZA 4PLLA 2OTJT 3C4SA 4BE2A 2K2VA 3SB2A 1HD3A 2LP5A 1U8RA 3M4GA 4IIOA 2LQ8A 4E7JA 4BUGA 4C0ZA 2QQ9A 4M7DE 4QVDA 1UJ0A 3AHUA 4M78D 3HRUA 3PTAA 2JZ2A 3DB4A 3OMCA 3UATA 3CCRT 2V8IA 3CCVT 1IGUA 1Q81C 5IH2A 4XTYA 1X2KA 3J7AF 5CCAA 2KAFA 4JS4A 5HKCA 3NMZC 3PFSA 5FRMA 2FPFA 4C92B 1XJWB 4IURA 1VQKQ 1ZSGA 3C95A 4BY6C 1MMAA 4EDUA 3CCQQ 3OYDA 2AZSA 2RHIA 4E2FB 3CCVA 1OEBA 1X43A 2E6NA 4HCCA 4PJMA 1C6VX 2L3QA 3CCLQ 3OBYA 4QVZA 4C0DC 3M53A 3GNFB 1OI1A 1WIEA 4MMLA 5GAOn 3OB9A 1K9MC 4XTWA 3OMGA 4IUPA 5LJ5e 1N6AA 2XIDA 3LH0A 2RQRA 2AHJB 2C0OA 2DLPA 2DRMA 4DA4A 2DJZA 5CKHA 5KE3A 1U1TA 1UHCA 2J7IA 3TEEA 4C8QD 3WVEB 1QCNA 3CCQA 1M1KU 1OOTA 3UA7A 1SF9A 3UPUA 2RI5A 2AIRB 3VS2A 4X9CA 3EFRA 3LGLA 1TU0B 1VQ7T 5GAOr 1VQ5A 3A8LB 4OP0A 1S72A 3P8BB 1KSWA 1AT1B 1QCFA 4HVVA 2RJEA 4J9CA 1VQLT 3QXEB 2MK5A 1RI0A 3RKXA 1X6OA 2HSEB 1Q86U 2RB6A 4HT9A 3RMSA 1SSHA 4BE0A 2A36A 1VQMA 1ABOA 4KH1B 4Z89A 1N8RR 1M27C 2EKOA 4RG2A 3EGDB 4D8DA 4E47A 5CQXA 2F5KA 4KGZB 1UHFA 2D0QB 1JJ2S 1NE8A 3DB3A 3A8HB 1Q82C 1YJ9Q 3THKA 3P8HA 3CCMA 3OYBA 3UT1A 3C94A 2FO0A 1YWPA 1VQ4T 1NYGA 1U5SA 3CCEA 4A53A 1RI9A 1D09B 2DL7A 4PFOA 2NUTB 3CMEQ 1SKUB 2CDTA 2HNIA 2XDPA 3CPWP 4KT0E 1N9RA 4CC3A 5CKFA 4M7AB 2DF6A 2ROTA 4M4ZA 2CUBA 3JCMW 2DEUA 4N4HA 4FYYB 2ZPBB 5LJ5f 2EYZA 2GBQA 3H0HA 1IZ6A 2JOYA 2O88A 2HL3A 4ZN3A 3UWNA 4CC2A 1C0MA 4M78G 3QJ6A 4RTVA 4C92E 2OX7A 4A54A 1JO8A 3GBQA 1JU5C 2NUTA 2EQMA 2EYQA 4C5HA 1RADB 3EG9B 2NUZA 4ZTJA 2EYXA 2QQAA 3CQTA 2HQEA 2BE7D 4C0FA 2H8HA 2ZPEB 5L8RE 2F5TX 2JVVA 1KHCA 1YIJA 4A4GA 4BI3A 3M0SA 2LX7A 4PNOA 3GP8A 2P84A 1UGQB 1AOJA 4F7UG 3M0TA 5HK3A 3LYIA 3C12A 1WHGA 1R77A 1QVGS 1M8VA 2AKKA 2ZPGB 4UC4A 1PCXA 1VIEA 1D3BA 5FU6C 2AT1B 3V8LA 1GCPA 4J7FA 3G6ET 5A0DA 1M1KR 3QWXX 4A4HA 1ZHIA 2LT1A 1IO6A 4DOWA 3X24B 4MMKA 2GFAA 3RIRA 2KMTA 3A8MB 4HT8A 3VV0A 1MGQA 1VQMT 3RESA 2EYWA 2PNIA 4MDXA 1QVPA 3CXCA 3JCMV 2HZYA 4DEXA 4J5YA 1Y96A 2K3XA 2VYTA 1OPKA 5C0MA 2EQIA 3BE3A 2R5MA 1X2QA 1KQ2A 1K0SA 1ZUKA 4J9DA 2V1QA 1VQ5T 2KYMA 1VQ5Q 3A8GB 2K3YA 4PJOA 4ZGJB 3KBGA 3X20B 2QK0A 1YWOA 3I56A 2FRWA 2GF7A 1TG0A 2RI2A 4M7AC 4PJOG 3OW2P 4RUGA 1N9SA 3E9FA 4OMLA 3JRZA 5HK0A 1ZQ1A 3QYHB 4OGEA 1SRMA 4RMOA 5GMKl 5D7UA 2F1LA 5CAIA 1MHNA 2O01E 2CYZB 1TOVA 1SRLA 4M7DA 4JJDA 2DM1A 2MAMA 5J39A 1KK7A 1JJ2A 4GLMA 4RCCA 3RBBB 3RKYA 3RKWA 4IUQA 2DYIA 2K4YA 2DE0X 1CKBA 2LTOA 3CCMQ 2G6FX 2O9SA 3D7SB 2NWMA 2DYBA 2K5LA 4JRKA 1RL2A 1S72T 2X4YA 4M7AE 3OW2A 1Q7YR 2EWNA 3G71T 3QWYA 1RLQC 2J6OA 1JRIA 2CP7A 3CPWA 1IHVA 1M90U 1BCMA 4TVRA 2OTJQ 1M1GA 1Y0MA 4OB0B 2KY9A 1VQOQ 1KC8R 3PNWC 4M75D 1KQSS 2WACA 2X3XD 1OV3A 1BB9A 4O5VA 3H0IA 3MKDA 1QWFA 1VQ6T 2SEMA 1W70A 3EGUA 3CCRA 1X01A 5IXBA 2BZ8A 2KSSA 1KD1U 4F7UE 3CMAQ 2K5IA 2DZCA 1TUDA 3SHWA 2O9VA 2VC8A 1ZBXA 3MEVA 3VS3A 4NL3A 4II1A 1TXQA 1WLPB 5HCKA 5I22A 3OYFA 3S6WA 1PM3A 5GANj 4M78A 2KBTA 4J9GA 1RLPC 4QW2A 1T3SA 1EFNA 2A0FB 4PKCC 5GAN5 2QEXA 5KYNA 4L5GA 5KYYA 2W0ZA 3MEAA 1YI2T 1Q81R 1Y07A 2HD0A 2DMOA 1QKWA 1M5Q1 3H8ZA 4KH0B 4NL2A 2DD5A 2EPDA 4XTZA 4A4FA 2EFIA 4CRIA 4PJJA 2DL4A 3EGXA 4LDUA 2A28A 4GBQA 2L0AA 2EGAA 4OMPA 3TREA 4X34A 2MIOA 3CCEQ 3CCET 2KNBB 2D0NA 2IIMA 3VS6A 3G71A 5I2MA 2NYSA 4DBFA 4KUIA 2EJGA 1K8AC 2EKHA 3MPUB 3I5RA 4BB7A 1SPKA 4JLIA 2H3JA 3HRTA 4KBMB 3EG2A 4XU0A 2JM8A 1KIKA 4M75G 3HFOA 2A37A 4IIMA 3VKIA 1EZZB 1M3AA 2MWPA 5GAOq 1M2VA 4BDZA 3JB9J 1MV3A 1N27A 3VUZA 1VQ7A 1NEBA 2PUOB 2COWA 3FIFA 3CC7A 1YJ9T 2OAWA 3I56Q 3AT1B 3RDVA 2DTHA 4OMFB 1LOJA 5I21A 1ACMB 4V2SA 2K3BA 4LXCA 1AEYA 1UB4A 3EG3A 2OTLA 2M02A 3CD6Q 1IB8A 1KC8U 2LDMA 3JB9G 1W2BA 1MUZA 1S72Q 2WSEE 4LDVA 2I0NA 1ZUUA 2HEQA 3PMTA 3N5BB 6AT1B 4E7HA 2RI3A 5LJ5d 1VQNQ 1Y71A 1VQPA 3PT9A 2PU9B 3CBMA 1PKSA 2QGGA 3VS5A 1M1KC 2J05A 3GPLA 3RNJA 1Q86R 1RAGB 4HVUA 2AK5A 1VQOA 4CC7A 4C0GA 5FRNA 3T9NA 1LCKA 4FIBA 3V8JA 2E65A 4HCZA 1F1BB 2CSQA 1VQ6Q 4Z8AA 1QP2A 2BZYA 5GAMg 3VS4A 4OB3B 4LUDA 1K1ZA 4Y91A 4FU6A 2P0KA 3QZ9B 3M56A 1U1SA 2CP6A 1X27A 4N4GA 2HAXA 2VXEA 3E2UA 3QO3A 1QVGA 3OY9A 3A5ZB 2RPNA 4C8QB 2CP2A 3Q1JA 1YJNA 2IPOB 4R0KA 3SD4A 3PIPA 3L2VA 5KYXA 2JN0A 3INZA 3OQ5A 3GLXA 2KVQG 3SWNA 2R58A 1M90C 2DRKA 2E70A 4A4KA 1MMDA 2KXCA 2MI6A 4ELYC 2HQXA 4Y92A 4ATOA 3QDFA 4M77B 2ECZA 2LJ0A 5I2SA 1Q81U 1WHHA 1NEGA 2P0PA 1T3LA 4LUEA 4FT4A 1PSEA 3ZL7C 1LVKA 5GANh 3OSSC 1FMVA 3REAB 1HXDA 5M9OA 3CC4Q 4KGVB 3MCAB 5LJ5j 2DL5A 2JTEA 3QYGB 1BCOA 1RAHB 2PUKB 2RHZA 4F04B 2H3EB 2LMJA 5GAN3 1FYNA 1RACB 1H92A 3LGFA 4LDWA 3H0FA 3CEYA 2CZ6B 1M2VB 2QQRA 5GAOm 2RN8A 5EC7A 1QCOA 3EG9A 2EYYA 3I9QA 3OBWA 2KYBA 4FYXB 3L2ZA 3TCJA 3CMEA 2RK2A 4M7AG 1WXUA 2FEIA 2YUPA 1E7OA 2X4WA 2YDLA 4NOYA 1TS9A 1AZGB 4J9BA 4O6JA 4C5IA 5IT9E 4DOVA 2SRCA 2EGCA 1ARKA 4J9HA 3JV3A 4XU1A 1YN8A 1WHKA 2E3HA 3V7RA 1K0XA 1M90R 1R0BG 3M57A 4C92C 2LCLA 2MOXA 2KGTA 4ZNXA 3CBPA 3KUFA 3FDRA 4E7KA 2QQSA 4M7DB 3CCSA 2HKNA 1OPLA 1UUEA 4JDSA 4N4IA 1VQ4A 1XQHA 3CCMT 1NZ9A 2FVUA 4M75E 4EMKA 2FZKB 2K5FA 5FLXE 3JCMQ 4E7ZA 3EGDA 1KJWA 1K9MU 2JTMA 2QTVA 5DLQE 1K4US 2XI9A 4JJCA 4AG2C 1YITA 3WVDB 2RH2A 1H641 5IHKA 2L89A 1G3TA 4C5EA 2D9TA 1WGSA 2QTXA 1WHJA 3QKJA 5FWBA 3HPWA 5AYFA 4JRPA 1B34B 4HA8A 1AWOA 3H41A 1Z9ZA 3JB9D 1M3CA 2HBPA 3HTRA 4E6RA 3LWIA 1WNLA 5CO7A 1E6HA 1ZA1B 4J6YA 2DTIA 1YJNQ 1BKBA 1YITT 3A98A 1YITQ 1AWJA 1TH7A 2YUQA 2ED0A 3QPHA 4XTVA 2X4JA 1WQ7A 2YHTA 1T0JA 4M78F 3RR6A 2M51A 1X75C 2JTFA 1MNEA 1P92A 3HP9A 3URGA 1W6XA 2HCKA 3BDUA 1BK2A 1R8OB 3ZFJA 2DILA 1K73U 2XDDA 3RUXA 4J9EA 2JMAA 4WCIA 2RD1A 2RQVA 3EHRA 2QA4Q 2YRVA 1QMCA 3EHQA 4AMCA 1I5LA 5AT1B 4OB2B 5IAYA 4PL6A 1WJSA 1I81A 2K7AA 5GAN7 3OYJA 4R55A 1W4SA 4PK4A 1Y7XA 1UJYA 1KD1R 5CQYA 2XU8A 3SFMA 4M78B 1Q82U 3EFSA 1RUWA 4DQ2A 5GAOp 2Y4YA 2F2VA 2CT4A 3M0QA 4C92G 1VQ6A 2QDLA 2LJ3A 2WSFE 2BZXA 4DBQA 3HHTB 2E64A 4PJLA 2LZ6B 4OMMA 3M59A 1AVZC 1UTIA 3CPWS 4XQ3A 3PVQA 4M7DC 1I07A 2V1RA 3I56T 2MF2A 1PG5B 1KQSP 3FJ5A 1I0CA 4J9FA 3NTHA 3X26B 1BIBA 2J6FA 1I5OB 2FRYA 2EJ9A 1YIJQ 2ENMA 1OZ3A 1VQ9T 4MDWA 3MJXA 3QSUA 3MP6A 4M75C 4RG8A 2R5AA 3CC2T 3VS7A 2JM9A 2YUNA 1JJ2P 1B3QA 1NM7A 4ESRA 4DEYA 1HJDA 4C8QG 3L2WA 2K2MA 2YT6A 4FL6A 1H3HA 2P0QA 2COYA 3V8KA 1WHLA 3MO8A 4HXJA 2B8AA 4XU3A 1M3BA 4M7AF 1D1CA 1O9SA 2RO0A 1ZX6A 4L59A 3CD6T 2JW4A 1W2BS 3VYGA 3CCJQ 3DLLA 1SSFA 2HBWA 2DX1A 1RAFB 4J7IA 3CCVQ 2DBMA 4EMKC 2GGRA 5CKBA 2J06A 2DXCA 5LJ3e 1WHMA 1VQ9A 3DLMA 3CBOA 1MV0B 1FMWA 5KCHA 3S3NA 1I8FA 4OMOA 2FL7A 1H8KA 1JXMA 2YRDA 2ED1A 2K6DA 1VQNA 5FU6B 5IN1A 4F7UA 2KT8A 3CCQT 1VYTA 5KYWA 2CP5A 3JCMh 1K73R 3R6OA 2QEXT 2Y4XA 2KRNA 2KDSA 2LC4A 4EPCA 1Q82R 1ZA2B 1BI0A 1LJOA 1OU9A 4OMNA 3OYAA 3CMAT 2CSIA 1VQ8T 2XDBA 5LJ3g 1IXDA 1N5ZA 4PJOF 3CCUT 1G3WA 4M78C 4M75F 1IREB 3X25B 4D6WA 2HDAA 2DBKA 2L5QA 1KQ1A 5D6WA 3OS1A 1WFWA 2KRMA 5GMKi 2X4XA 1TWBA 3NHNA 3ZBDA 1ABQA 2YWWA 2VASA 4QT7A 3I35A 1S1NA 2LCSA 4R56A 1NJIC 1GCQC 5GAN2 1QVGP 1BYMA 2QYZA 1WI7A 4PJOB 2PVDB 4J6WA 3R6NA 8ATCB 2OTLT 1VQMQ 2OTLQ 1YBYA 1UEBA 2ABLA 2RQWA 3I55T 1VQ7Q 4PJOE 4M75B 3OYHA 4M78E 4AG1C 1M4ZA 3S3MA 3META 4M7DD 1UFFA 1RABB 5LJ3f 2LQWA 2C0IA 4M77D 3KFVA 3QUIA 4RTXA 3GOXA 2JS2A 1BI3A 3CD6A 1K8AU 1GL5A 2DERA 1G2BA 4C92A 2JT4A 1ZUYA 1WDXA 3WXMB 1YHQA 1X69A 4D8KA 3HRSA 5LL6S 2D8JA 2EQKA 2JXBA 4JZ4A 2JNGA 4M7DG 1D0YA 5KH6A 1VQ8A 1BU1A 3UF4A 4EMKB 5LJ3j 1G5VA 3G6EA 3CC2Q 1Q95G 4C8QA 2XICA 3SDZA 4JS5A 2FZGB 1GFCA 2VWFA 1B7TA 2ATCB 2GQIA 1GCQA 2YSQA 2EW3A 3H9NA 5GMKh 3ASKA 2RJCA 1VIFA 2EQUA 1XNIA 3REBB 3U23A 1VYVA 2EVRA 2VVKA 5ECAA 1K73C 3QDRB 5DM7R 1WQWA 5EG2A 2VB6A 2D1XA 1GBRA 2GTOA 4X9DA 5FU7C 5GAMe 2BIVA 1PNJA 1N8RU 4N0AA 1XTDA 3KXTA 2DK3A 3SWNB 2X3WD 4RTUA 4ZGEB 2PZ1A 3M0PA 1ZSZA 4A4EA 1VQOT 4RTYA 3CCUA 1NPPA 2LQKA 1QP3A 1T0HA 4B9XA 2LVMA 4DBRA 1QKXA 2KXDA 1ZLMA 2PVGB 3OYIA 2DO3A 4Z02A 1E6GA 1PRMC 4XTUA 1VQPT 2FPDA 4Z88A 1V29B 4QKUA 4EMHA 5CK9A 1R0CB 2O31A 1UECA 4PJOC 1D0ZA 2RHXA 2YRCA 1KD1C 2FB7A 4FYVB 1MNDA 4RCBA 2DXBA 5HY6A 4PFZA 2OJ2A 4LN2A 4BY6B 5GMKm 1D3BB 1SG5A 2KEAA 3M5AA 1M1FA 3L2QA 2BKDN 2HKQB 1YI2Q 2V26A 4IUVA 2RM4A 3CCJA 3E19A 3M4YA 4B6MA 3EG1A 3L1AA 3OYGA 3ZEHA 2VV5A 1Z9QA 1QW1A 4JLGA 3JCMP 2KI7A 5KE2A 2LT4A 1AZEA 2IVWA 2EIFA 4DBHA 2DTOA 2CS7A 1M9SA 3QZ5B 1RAAB 2V8JA 1FMKA 2GTJA 2PVOB 1U06A 2QA4T 1IHWA 2EQJA 2YLBA 2O4XA 2IG0A 4ZTFA 2BE9B 3FEOA 3JB9F 3CPFA 5CR2A 3EGXB 1NLPC 1TUCA 4PLIA 3CCST 3CCSQ 2AZVA 2VGMA 2MPXC 3CC7Q 5LJ3d 3LLRA 1VOMA 5CKEA 2CKKA 2M9UA 3G7ZA 4QQ6A 4MZTA 5FU7B 4OF1A 3MEUA 4Q5WA 5LJ5g 4HCBA 2MWOA 3NTIA 1U3OA 1WXTA 1YHQT 1YHQQ 2DAQA 4QQDA 3JAME 1VQ4Q 4XAXB 1Q7YU 3VS0A 2L3RA 2CH4W 5GANe 2CH4A 3OYEA 2OTJA 4NS5A 1QVFP 2F2WA 2LQNA 1D1BA 3C0CA 3CMET 3PGGA 5A0GA 2VXFA 5KYWB 2GNCA 1QWEA 2GFUA 3GF5A 4XTXA 1TUGB 1WA7A 3PE0A 3BW1A 5LJ5h 2FHDA 3VJPA 5FROA 3CCRQ 2ZPIB 1UE9A 1ZBJA 2ZZDA 4KULA 5C6SA 3ME9A 4F16A 1OQKA 5GMKj 1SHFA 2QDYB 1WYXA 2D8HA 2YLCA 3F70A 4CC4B 1I4K1 4C8QC 4ELZC 2HL5C 3NPFA 5KYYB 4YTLA 1G3YA 1M8MA 5A2QE 3NGPA 5CVIA 1WJRA 2RK1A 1HYOA 1HSQA 3PIOA 1VQ8Q 3L42A 3M0UA 4BI4A 3CCLT 2DETA 4N0AC 2EJFA 1CSKA 2L2PA 4ZN1A 2BUDA 1NYFA 1GXIE 1PWTA 5CIUA 4BE1A 4LDXA 2QI2A 5DLOA 4FW1A 4C8QF 4GY5A 2XK0A 4FW2A 1W1FA 1UGVA 2CP0A 2AKLA 1YJNT 3G6EQ 3CC2A 2KR3A 2CT3A 3CMAA 3GIBA 3TSWA 4MZMA 5GAN4 3JB9H 1KG1A 2W10A 5GAN8 4M77E 1AHJB 4EIKA 2R57A 1PRLC 2Z0WA 4FM4B 2DFUA 4B9WA 2Y90A 1GFDA 2JUFA 3S3OA 4RTTA 4C92D 2DVJA 3OS0A 4PJOD 5I11A 1KC8C 4P5NA 2M0OA 1IRXA 1Q86C 3OS2A 4M77G 1UGPB 1NBEB 3LW5E 3G4ST 3PMIA 2DKGA 1SEMA 3A1PA 1WPYA 3J81E 4RTWA 2ZAEA 1AD5A 5GAMj 1TTHB 2M0YA 3I55Q 1YP5A 3OYLA 3BDLA 2JJ9A 4M75A 5GANg 2KRSA 3JCMc 4M7AA 4RTZA 4ANJA 2I2LA 3FB9A 5A0LA 1UDLA 1VQLQ 1K76A 1YNZA 4LD9K 3QBYA 2QAZA 4XK8E 1MMNA 2DL8A 1PHTA 5GJVB 1K9MR 2DPPB 1JQQA 2F2XA 2NUPA 3RERA 2E12A 3I55A 1DJ7B 2VKNA 4FT2A 5GANf 2YXYA 3DKMA 3RMQA 2DEQA 2E41A 1VQ9Q 2QQBA 1WXBA 2X51A 3A8OB 4OVAA 3UDCA 3M58A 1KHIA 1Y96B 3FRNA 2QA4A 1AWXA 1JBMA 1Y57A 2LJ1A 3OYMA 1YI2A 2QASA 2GQVA 3QJYA 4IUTA 3CXCP 3TVTA 4M7DF 1PKTA 4OMQA 4AFUC 5D6XA 5CKDA 2DNUA 4E7SA 2RMOA 3JB9I 2L3PA 2NUPB 4KGXB 1H3ZA 3O5ZA 1OX8A 2RHUA 3EH1A 3JCMe 4LE9A 2HSPA 3OYYA 3CCLA 2EAYA 3CCJT 1X6BA 2LNHB 2ZPFB 5KYUB 2VGNA 5IHIA 3OA6A 4EMGA 3VUBA 2P4TA 5J26A 1W2BP 4A63B 1VQPQ 4AT1B 2V8KA 1OYXA 1B07A 4F14A 1NJIR 1QLYA 1RAEB 2JMCA 2XG8D 2OAUA 3JSCA 2E4HA 1VQKT 2RJFA 2XHCA 2DZ9A 2RJDA 5GAN6 4F7UF 2LRQA 3VS1A 3CXCS 3OYNA 2FG0A 3I5SA 2QEXQ 2JS0A 2DXTA 1WJQA 2L8DA 2CP3A 1D1AA 2A7YA 3MP8A 3PVLA 3CC4A 1QVFA 5J3BA 1EIFA 4X1VA 4KUDK 4JZ3A 4XU2A 5L23A 4J6XA 3CCUQ 3NFCA 3JCMb 2ROLA 2K9GA 1VUBA 2MYSA 1UGSB 1N8RC 1X6GA 4OB1B 1IGQA 1OX9A 2X9HA 3EG0A 3FLGA 3LX7A 3TU4K 1BBZA 2PTKA 2NLUA 4QVCA 5FW9A 4PJNA 1SHGA 4HKEA 2XMFA 4F7UB 3EAEA 2PQWA 3CC4T 1RAIB 2ZCFB 1EX4A 3L2UA 2XD0A 1JXOA 5D6YA 2K79A 2O4XB 3G1JA 1BI1A 3TSZA 1M2OA 2EBPA 3IQLA 2MCNA 3LWHA 3L2RA 1Q7YC 2RNAA 5GMKe 2GCXA 1VQKA 1QVFS 2LX9A 2RQTA 2E3IA 2QG9B 3QG1A 2VUBA 1C1AA 1KFZA 2ZPHB 3QHSA 2YUOA 1ZSZC 4JRIA 1A0NB 2A08A 3NTKA 1YCSB 4CI0C 1OU8A 2DJQA 2CZ1B 5GAMf 2P4RA 3E9GA 1PSFA 4VUBA 3VYHB 3OS5A 1YJWT 3TQ7P 2WSCE 4IUUA 1K9AA 9ATCB 4JPBW 2F69A 1NG2A 1MMGA 2QGFB 4JRQA 3HL8A 5GAMh 3BY7A 3ER0A 4BI8B 1VA7A 3P8DA 1AWWA 5DY9A 2QXFA 5KYUA 1PD0A 4J9IA 3HSBA 1G83A 1D0XA 2CZ0B 2DA9A 1VQNT 3M0RA 2E10A 2KROA 3FJPA 1CKAA 1V76A 2CUDA 4K11A 3G71Q 3JCMf 4OGCA 3M54A 5GANd 2M1HA 4FSXA 5GJWB 4RKUE 3FC3A 3QIIA 4ME7A 1BIAA 4KRTA 3JCMJ 2HMAA 2FPEA 2MMPA 2DVEA 2L3SA 2X35A 2LNVA 5KCOA 1GRIA 4BACA 3O8VA 5IXFA 1OZ2A 1YFNA 4C5GA 2DL3A 3JCMg 4BDYA 2DD4A 3OW2S 1LPLA 2DXUA 7AT1B 4FCYA 2D6FA 5KYXB 3ULRB 3E1SA 4MZPA 3MHXA 3OYKA 3MP1A 1JEGA 1YCYA 1QQJA 2KE9A 2DIQA 2J6KA 3HKSA 4E7IA 3EFOA 3OSVA 1FXXA 2O2OA 4J83A 1K8AR 2LCCA 1PC0A 1J3TA 1VQLA 5IHNA 2EGEA 2RHYA 2E5KA 1WX6A 3V7CA 4BD3A 4HCKA 1UGRB 3M9QA 4AFSC 4L6V5 2CZ7B 3LH5A 3SEMA 4JUVA 1B34A 2BTTA 2E1HA 2RQUA 4E7LA 1ZSZB 2RF0A 2FYKA 2KT1A 3VRYA 4M77F 2C0TA 1WZOA 4JJBA 2RA2A 4J8OA 5LJ3h 4HVWA 2E5QA 4ORZA 1NPRA 3VRZA 1KQSA 2KQWA 8AT1B 1G8XA 3JCMX 2DIGA 3X28B 1TSFA 1LNXA 4PFPA 4LDYA 1O75A 4C8QE 1YJWA 1UG1A 2A3LA 3VU3C 4C0DB 1VYUA 4M77A 2HQHA 2K57A 4F17A 3M55A
chains in the Genus database with same CATH topology
5GAOp 1BI2A 2Y4YA 3HFNA 2WACA 3OYCA 1I4K1 4C8QC 4ELZC 1HK9A 2E6ZA 1G3SA 4C92G 4M77C 2KK4A 4O5VA 1VQ6A 4YTLA 3BFMA 2WSFE 1VQ6T 1G3YA 5A2QE 4JJNK 3CCRA 1XOVA 5CVIA 1WJRA 2RK1A 3HHTB 2E64A 4IKFA 1X01A 2KSSA 1KD1U 3M59A 3PIOA 4F7UE 2CGHA 4ZGDB 3L42A 4BI4A 3CCLT 2K5IA 2DZCA 4XQ3A 3JCMd 1JB0E 3CPWS 4M7DC 3CCLA 4M7AD 3I56T 2VC8A 2MF2A 1ZBXA 2XKOC 3MEVA 4N0AC 2EJFA 4II1A 4Y28E 4NL3A 3GNGA 2C06A 5GAOl 4ZN1A 2BUDA 1FWZA 3S6WA 3OYFA 1YJ9A 3CC7T 1GXIE 5CIUA 5GANj 4M78A 4BE1A 4LDXA 3NTHA 2QI2A 3X26B 5DLOA 1BIBA 1FX7A 2G3RA 4QW2A 4C8QF 1YIJT 2EJ9A 4GY5A 2XK0A 5GAMd 1OZ3A 1VQ9T 4MDWA 4PKCC 5GAN5 2QEXA 3QSUA 4L5GA 3MP6A 4M75C 4RG8A 4LD6A 3MEAA 1YI2T 1YJNT 3CC2A 1Y07A 2R5AA 3CC2T 3MEWA 2HD0A 1M5Q1 4WF2A 3CMAA 3SWNC 2M16A 3H8ZA 1NJIU 3GIBA 4GLKA 4NL2A 2DD5A 4XTZA 4A4FA 4C8QG 3J80E 4C92F 3L2WA 2EFIA 4MZMA 4FL6A 4CRIA 5GAN4 3V7SA 4QQGA 2P0QA 2ZGWA 3G4SA 4LDUA 3JB9H 3V8KA 1KG1A 3H6ZA 4M77E 4PLLA 5GAN8 2OTJT 3C4SA 4BE2A 1AHJB 2K2VA 3MO8A 3SB2A 3TREA 4X34A 1U8RA 3M4GA 2R57A 2LQ8A 2B8AA 4E7JA 4XU3A 1W2BS 4BUGA 4C0ZA 4FM4B 3CCET 2QQ9A 4M7DE 4B9WA 4QVDA 4M7AF 2Y90A 1O9SA 2RO0A 4L59A 3AHUA 2JUFA 3CD6T 4M78D 3HRUA 3S3OA 3PTAA 4C92D 3OS0A 3VYGA 3G71A 5I2MA 3DLLA 2JZ2A 3DB4A 1SSFA 4PJOD 3OMCA 1KC8C 4P5NA 4J7IA 4KUIA 2M0OA 2EJGA 3CCRT 2V8IA 1K8AC 3CCVT 1Q86C 1Q81C 4EMKC 4XTYA 5CKBA 3OS2A 3J7AF 2DXCA 5CCAA 5LJ3e 4BB7A 1VQ9A 4JLIA 3DLMA 4M77G 2H3JA 2KAFA 3CBOA 1UGPB 3HRTA 4KBMB 5KCHA 4JS4A 3S3NA 4XU0A 5HKCA 3LW5E 3PFSA 1I8FA 3G4ST 2FL7A 3PMIA 5FRMA 2DKGA 4M75G 4C92B 1WPYA 3J81E 4IURA 3HFOA 3C95A 4BY6C 5GAMj 1VQNA 4EDUA 5FU6B 5IN1A 4F7UA 3OYLA 3CCQT 3BDLA 4M75A 3VKIA 3OYDA 3JCMh 5GANg 2MWPA 3R6OA 2QEXT 2RHIA 2Y4XA 5GAOq 3JCMc 3CCVA 2KDSA 2LC4A 4EPCA 4M7AA 2E6NA 4HCCA 4BDZA 2I2LA 3FB9A 1BI0A 1N27A 1LJOA 3VUZA 5A0LA 3JB9J 3OYAA 3CMAT 1VQ7A 1VQ8T 2XDBA 5LJ3g 2PUOB 3FIFA 3CC7A 1YJ9T 4LD9K 3QBYA 3OBYA 4QVZA 4PJOF 3M53A 4XK8E 4C0DC 3CCUT 2DTHA 3GNFB 1OI1A 4OMFB 1LOJA 5I21A 1G3WA 4M78C 4MMLA 2DPPB 5GAOn 4V2SA 4M75F 3OB9A 1IREB 3X25B 1Q82U 4D6WA 1K9MC 3RERA 2E12A 2L5QA 4XTWA 1KQ1A 1DJ7B 3OMGA 4FT2A 4IUPA 5GANf 3DKMA 5D6WA 3RMQA 5LJ5e 1UB4A 2OTLA 3OS1A 1N6AA 2DEQA 2E41A 5GMKi 2QQBA 2X4XA 1KC8U 2LDMA 3JB9G 1W2BA 2XIDA 3A8OB 3LH0A 4OVAA 3UDCA 3M58A 1KHIA 2AHJB 1Y96B 3FRNA 2WSEE 4LDVA 3ZBDA 2QA4A 4DA4A 2DJZA 1JBMA 3PMTA 5CKHA 3OYMA 3N5BB 1YI2A 4E7HA 5KE3A 1U1TA 2RI3A 5LJ5d 3TEEA 2GQVA 3QJYA 1Y71A 4IUTA 1VQPA 4C8QD 3PT9A 2PU9B 3CBMA 4R56A 3WVEB 1NJIC 4M7DF 3CCQA 1M1KU 5D6XA 5CKDA 1M1KC 5GAN2 3GPLA 3UPUA 2RI5A 1BYMA 3JB9I 4PJOB 4X9CA 2PVDB 3EFRA 3LGLA 4J6WA 1VQOA 2OTLT 1H3ZA 4C0GA 5FRNA 3T9NA 1VQ7T 1YBYA 1UEBA 2RHUA 4FIBA 3V8JA 3JCMe 3I55T 5GAOr 4PJOE 2E65A 3OYYA 4HCZA 3A8LB 2EAYA 4M78E 4M75B 3OYHA 3CCJT 4OP0A 1VQ5A 2ZPFB 1M4ZA 1S72A 3S3MA 2VGNA 3META 3P8BB 4M7DD 3OA6A 1QP2A 5GAMg 5LJ3f 4EMGA 4OB3B 2RJEA 3VUBA 4Y91A 4FU6A 2P4TA 5J26A 1VQLT 2P0KA 4M77D 3QXEB 3QZ9B 2V8KA 1OYXA 3QUIA 1RI0A 3RKXA 1X6OA 3GOXA 1BI3A 3CD6A 1Q86U 2RB6A 4HT9A 3RMSA 3M56A 1K8AU 2XG8D 1U1SA 4BE0A 2OAUA 3JSCA 4N4GA 2HAXA 4C92A 1VQKT 2RJFA 2VXEA 1VQMA 2XHCA 3QO3A 2DZ9A 2RJDA 5GAN6 4F7UF 3WXMB 1YHQA 2LRQA 3CXCS 3HRSA 5LL6S 3OYNA 1QVGA 3OY9A 2EQKA 2JNGA 2EKOA 4M7DG 4RG2A 5KH6A 3A5ZB 1VQ8A 4E47A 5CQXA 2DXTA 1WJQA 2F5KA 2L8DA 4EMKB 5LJ3j 1G5VA 3G6EA 2D0QB 1JJ2S 4C8QA 1NE8A 2A7YA 2XICA 3SDZA 4C8QB 3DB3A 4JS5A 3MP8A 3CC4A 3Q1JA 1YJNA 1QVFA 3A8HB 5J3BA 1EIFA 1Q82C 4KUDK 3SD4A 4XU2A 3PIPA 4J6XA 3P8HA 3NFCA 3JCMb 3L2VA 3CCMA 2JN0A 3INZA 5GMKh 3ASKA 3OQ5A 3OYBA 2RJCA 3GLXA 3UT1A 1VIFA 2KVQG 1VUBA 2EQUA 3C94A 2R58A 3SWNA 1XNIA 1M90C 2E70A 4A4KA 1VQ4T 1UGSB 1N8RC 2MI6A 4ELYC 2HQXA 4OB1B 4ATOA 4M77B 5I2SA 3CCEA 3FLGA 4A53A 1Q81U 3LX7A 3TU4K 1K73C 2P0PA 2NLUA 4QVCA 3QDRB 5DM7R 4FT4A 1PSEA 4HKEA 5GANh 2XDPA 2HNIA 4F7UB 1WQWA 3EAEA 3OSSC 4KT0E 1N9RA 2PQWA 1HXDA 5EG2A 3CC4T 5CKFA 5M9OA 4M7AB 2ZCFB 4X9DA 5FU7C 5GAMe 2BIVA 3MCAB 5LJ5j 3L2UA 2XD0A 5D6YA 1N8RU 3JCMW 3QYGB 4N0AA 4N4HA 2O4XB 2ZPBB 1BI1A 1XTDA 5LJ5f 2PUKB 3KXTA 3LWHA 2DK3A 3L2RA 1Q7YC 3SWNB 1IZ6A 5GMKe 2JOYA 2RHZA 4ZGEB 2GCXA 1VQKA 4ZN3A 3UWNA 1QVFS 2LX9A 4M78G 3QJ6A 5GAN3 3QG1A 4A4EA 4C92E 1VQOT 4A54A 1NPPA 2LQKA 1QP3A 3LGFA 4B9XA 2LVMA 3CCUA 2VUBA 4LDWA 3CEYA 2CZ6B 2EQMA 2QQRA 5GAOm 2ZPHB 2EYQA 3QHSA 2PVGB 4C5HA 3OYIA 2DO3A 4JRIA 4Z02A 4ZTJA 3NTKA 3OBWA 2QQAA 2HQEA 4XTUA 4CI0C 1VQPT 4C0FA 2CZ1B 5GAMf 2ZPEB 1V29B 5L8RE 2F5TX 2JVVA 1KHCA 3E9GA 3L2ZA 4EMHA 5CK9A 1YIJA 1PSFA 4A4GA 3TCJA 4VUBA 4BI3A 3VYHB 3CMEA 2RK2A 4PNOA 4PJOC 4M7AG 3OS5A 3GP8A 1UGQB 1YJWT 2RHXA 2WSCE 4IUUA 4F7UG 1KD1C 2F69A 2FB7A 4DQ2A 5HK3A 3LYIA 2X4WA 3C12A 1QVGS 4RCBA 4JRQA 2DXBA 4NOYA 5HY6A 1M8VA 4O6JA 2ZPGB 4UC4A 4C5IA 5IT9E 4DOVA 3HL8A 5GAMh 3BY7A 3ER0A 1VIEA 4BY6B 5GMKm 4BI8B 1D3BB 1D3BA 3P8DA 4XU1A 5DY9A 5FU6C 3M5AA 1M1FA 2QXFA 3V8LA 3HSBA 3L2QA 2BKDN 4J7FA 3G6ET 2CZ0B 5A0DA 1VQNT 3V7RA 2E10A 4IUVA 2RM4A 3FJPA 4A4HA 1ZHIA 2LT1A 3M57A 4DOWA 4C92C 2LCLA 3CCJA 3JCMf 3X24B 3E19A 3M4YA 4MMKA 2GFAA 4OGCA 3L1AA 3M54A 5GANd 3RIRA 3OYGA 2KMTA 3ZEHA 3A8MB 3CBPA 3KUFA 2M1HA 2VV5A 3FDRA 4FSXA 1QW1A 4E7KA 4HT8A 4JLGA 4RKUE 1MGQA 3VV0A 3FC3A 2QQSA 3JCMP 3RESA 3QIIA 1VQMT 4M7DB 4ME7A 1BIAA 5KE2A 3CCSA 3JCMJ 2MMPA 4MDXA 1QVPA 4JDSA 2DVEA 3CXCA 3JCMV 2X35A 2LT4A 4N4IA 2LNVA 2IVWA 2EIFA 5KCOA 1VQ4A 1XQHA 1Y96A 4J5YA 1NZ9A 3CCMT 2FVUA 4BACA 2K3XA 2DTOA 4M75E 2CS7A 2K5FA 2VYTA 3O8VA 5FLXE 4EMKA 1M9SA 1OZ2A 3QZ5B 5C0MA 3JCMQ 2V8JA 4C5GA 2PVOB 3JCMg 1K9MU 4BDYA 2DD4A 2QA4T 3OW2S 2EQJA 2YLBA 2DXUA 2JTMA 5DLQE 2O4XA 2IG0A 2XI9A 2R5MA 2D6FA 4ZTFA 1YITA 3FEOA 3WVDB 1KQ2A 3JB9F 1VQ5T 3E1SA 2RH2A 3A8GB 3CPFA 5CR2A 1H641 2L89A 1G3TA 2K3YA 2D9TA 1WGSA 4PLIA 4MZPA 4C5EA 2QTXA 3CCST 4PJOA 3MHXA 2VGMA 3MP1A 3QKJA 3OYKA 3HPWA 5AYFA 4ZGJB 4JRPA 3KBGA 3X20B 1B34B 1YCYA 3I56A 5LJ3d 3LLRA 2GF7A 2DIQA 4HA8A 2RI2A 5CKEA 3HKSA 4M7AC 2CKKA 2M9UA 3G7ZA 4QQ6A 4MZTA 5FU7B 4PJOG 4E7IA 3OSVA 3JB9D 1FXXA 4OF1A 2HBPA 3LWIA 1N9SA 1WNLA 3E9FA 5CO7A 3MEUA 4J83A 3JRZA 4Q5WA 5LJ5g 4J6YA 2DTIA 5HK0A 1BKBA 1ZQ1A 2LCCA 3QYHB 1YITT 2MWOA 4OGEA 4HCBA 3NTIA 1VQLA 1YHQT 4RMOA 2RHYA 1TH7A 5GMKl 3QPHA 2DAQA 3V7CA 4XTVA 4BD3A 2X4JA 2YHTA 1WQ7A 1MHNA 5CAIA 4QQDA 2O01E 1UGRB 3M9QA 2CYZB 4M78F 3JAME 4XAXB 1Q7YU 4L6V5 1X75C 2JTFA 4M7DA 2L3RA 5GANe 2CZ7B 2MAMA 5J39A 1JJ2A 3OYEA 2OTJA 4NS5A 4RCCA 1P92A 3HP9A 4JUVA 3RKYA 3URGA 3RKWA 1B34A 4IUQA 2E1HA 3BDUA 4E7LA 3CMET 1R8OB 2K4YA 3PGGA 3ZFJA 5A0GA 1K73U 2LTOA 2XDDA 2VXFA 2FYKA 3RUXA 4M77F 2GFUA 2RA2A 3GF5A 4J8OA 2RD1A 2K5LA 1RL2A 2E5QA 4JRKA 3BW1A 1NPRA 4XTXA 2X4YA 5LJ3h 5LJ5h 1S72T 2FHDA 2YRVA 3VJPA 5FROA 1KQSA 2ZPIB 3OW2A 4M7AE 2KQWA 2EWNA 3G71T 1I5LA 4OB2B 5IAYA 3JCMX 2DIGA 3X28B 2ZZDA 1LNXA 4KULA 4PL6A 1JRIA 1WJSA 3ME9A 1I81A 5C6SA 5GAN7 3CPWA 4LDYA 3OYJA 1M90U 1O75A 4C8QE 4R55A 1W4SA 4TVRA 1YJWA 2A3LA 1Y7XA 5GMKj 3VU3C 1M1GA 2QDYB 4C0DB 4M77A 5CQYA 2XU8A 2K57A 2YLCA 3F70A 3SFMA 4M78B 2KY9A 4OB0B 3I55A 3PNWC 4M75D 1KQSS 3EFSA 3M55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO p;  4XU2 A;  3HFN A;  4J6X A;  5GAO q;  3JCM c;  4HT8 A;  3JCM b;  4M7A D;  1MGQ A;  4M7A A;  1I4K 1;  2JN0 A;  3INZ A;  3RES A;  4C8Q C;  5GMK h;  3JCM P;  4M7D B;  1HK9 A;  2I2L A;  1BIA A;  3FB9 A;  3JB9 J;  1LJO A;  4M77 C;  4C92 G;  3JCM J;  3SWN A;  3BFM A;  5LJ3 g;  2DVE A;  3FIF A;  3JCM V;  4PJO F;  4J5Y A;  1Y96 A;  4M77 B;  2DTH A;  2E64 A;  4A53 A;  1X01 A;  2DTO A;  1LOJ A;  4M75 E;  4M78 C;  4MML A;  4EMK A;  5I21 A;  5GAO n;  3JCM Q;  4V2S A;  4M75 F;  4QVC A;  4F7U E;  2CGH A;  3JCM g;  3JCM d;  2DZC A;  4XQ3 A;  2YLB A;  5GAN h;  3RER A;  2DXU A;  2HNI A;  4XTW A;  4F7U B;  1KQ1 A;  1WQW A;  2VC8 A;  4N0A C;  1N9R A;  5GAN f;  4NL3 A;  2EJF A;  1HXD A;  5LJ5 e;  2DEQ A;  4M7A B;  1KQ2 A;  2E41 A;  4X9D A;  5GAO l;  5GAM e;  5GMK i;  5LJ5 j;  3JB9 F;  3JB9 G;  4M7D C;  5GAN j;  4M78 A;  3JCM W;  1H64 1;  4N0A A;  1Y96 B;  1BIB A;  4PJO A;  2QTX A;  2DJZ A;  4C8Q F;  1JBM A;  5LJ5 f;  2EJ9 A;  5GAM d;  3QSU A;  5GAN 5;  1U1T A;  1B34 B;  1YCY A;  3SWN B;  4M75 C;  5LJ5 d;  5LJ3 d;  5GMK e;  4HA8 A;  4C8Q D;  4M7A C;  4M7D F;  4PJO G;  3JB9 D;  1M5Q 1;  4M78 G;  4WF2 A;  5GAN 3;  3SWN C;  4C92 E;  5GAN 2;  3GIB A;  1N9S A;  1WNL A;  4NL2 A;  4C8Q G;  4XTZ A;  3JB9 I;  4A54 A;  4C92 F;  5LJ5 g;  4J6Y A;  2DTI A;  4X9C A;  3EFR A;  4J6W A;  5GAN 4;  5GAO m;  4PJO B;  3V7S A;  3QHS A;  2ZGW A;  3JB9 H;  3V8J A;  3V8K A;  5GAO r;  3JCM e;  4JRI A;  4M77 E;  5GAN 8;  1TH7 A;  5GMK l;  4PJO E;  2E65 A;  4M75 B;  2EAY A;  4M78 E;  4XTV A;  3SB2 A;  3V7C A;  1WQ7 A;  2YHT A;  3M4G A;  4OP0 A;  4XTU A;  5CAI A;  4M78 F;  4XU3 A;  5GAM f;  4M7D D;  5GAM g;  4M7D E;  4M7D A;  5LJ3 f;  3L2Z A;  4EMG A;  4EMH A;  5GAN e;  4QVD A;  2Y90 A;  4M7A F;  4Y91 A;  3AHU A;  4M78 D;  4C92 D;  4PNO A;  4RCC A;  4PJO C;  4M77 D;  4M7A G;  4JUV A;  3RKY A;  4PJO D;  3RKW A;  1B34 A;  3QUI A;  2E1H A;  3BDU A;  3RKX A;  4F7U G;  3PGG A;  2EJG A;  2FB7 A;  2RB6 A;  4HT9 A;  2VXF A;  2FYK A;  3RUX A;  4M77 F;  1U1S A;  4EMK C;  4XTY A;  5LJ3 e;  2RA2 A;  4RCB A;  2RD1 A;  4XTX A;  4JRK A;  4NOY A;  4JLI A;  3BW1 A;  2VXE A;  4M77 G;  5LJ3 h;  4C92 A;  5LJ5 h;  1M8V A;  3QO3 A;  2DZ9 A;  5GAN 6;  5GAM h;  3BY7 A;  4F7U F;  4XU0 A;  4M7A E;  5GMK m;  1D3B B;  1D3B A;  1I8F A;  2EWN A;  4XU1 A;  5DY9 A;  5GAN g;  1I5L A;  2DKG A;  3JCM X;  3V8L A;  4M75 G;  3HSB A;  4C92 B;  1WPY A;  1LNX A;  1JRI A;  1I81 A;  4M7D G;  5GAN 7;  3V7R A;  2E10 A;  3HFO A;  4C8Q E;  5GAM j;  2DXT A;  4EMK B;  2RM4 A;  5LJ3 j;  3FJP A;  5GMK j;  4F7U A;  3VU3 C;  4C8Q A;  4M77 A;  4C8Q B;  4C92 C;  3JCM f;  2YLC A;  2K57 A;  4M75 A;  4MMK A;  3L1A A;  4M78 B;  3JCM h;  3RIR A;  5GAN d;  4M75 D;  3EFS A;  4DQ2 A; 
#chains in the Genus database with same CATH topology
 1BI2 A;  1NLO C;  3HFN A;  2COZ A;  3EFO B;  3OYC A;  1HK9 A;  2E6Z A;  3UA6 A;  1G3S A;  4LNP A;  4M77 C;  2KK4 A;  3BFM A;  2OI3 A;  4JJN K;  1XOV A;  2ESW A;  4IKF A;  1V1C A;  2CGH A;  1GBQ A;  4ZGD B;  3JCM d;  1YJW Q;  1JB0 E;  1M30 A;  1I1J A;  4M7A D;  2XKO C;  4Y28 E;  3GNG A;  2C06 A;  3G4S Q;  5GAO l;  1FWZ A;  2FZC B;  1YJ9 A;  3CC7 T;  4FSS A;  1FX7 A;  2B86 A;  4WTO B;  2G3R A;  1OUL A;  1YIJ T;  5GAM d;  4LD6 A;  4FYW B;  4AFZ C;  2CRE A;  3MEW A;  4WF2 A;  5FWC A;  3SWN C;  2M16 A;  1NJI U;  4GLK A;  3EH2 A;  3J80 E;  4C92 F;  4AFQ C;  3V7S A;  4QQG A;  2ZGW A;  1PD1 A;  3G4S A;  3H6Z A;  4PLL A;  2OTJ T;  3C4S A;  4BE2 A;  2K2V A;  3SB2 A;  1HD3 A;  2LP5 A;  1U8R A;  3M4G A;  4IIO A;  2LQ8 A;  4E7J A;  4BUG A;  4C0Z A;  2QQ9 A;  4M7D E;  4QVD A;  1UJ0 A;  3AHU A;  4M78 D;  3HRU A;  3PTA A;  2JZ2 A;  3DB4 A;  3OMC A;  3UAT A;  3CCR T;  2V8I A;  3CCV T;  1IGU A;  1Q81 C;  5IH2 A;  4XTY A;  1X2K A;  3J7A F;  5CCA A;  2KAF A;  4JS4 A;  5HKC A;  3NMZ C;  3PFS A;  5FRM A;  2FPF A;  4C92 B;  1XJW B;  4IUR A;  1VQK Q;  1ZSG A;  3C95 A;  4BY6 C;  1MMA A;  4EDU A;  3CCQ Q;  3OYD A;  2AZS A;  2RHI A;  4E2F B;  3CCV A;  1OEB A;  1X43 A;  2E6N A;  4HCC A;  4PJM A;  1C6V X;  2L3Q A;  3CCL Q;  3OBY A;  4QVZ A;  4C0D C;  3M53 A;  3GNF B;  1OI1 A;  1WIE A;  4MML A;  5GAO n;  3OB9 A;  1K9M C;  4XTW A;  3OMG A;  4IUP A;  5LJ5 e;  1N6A A;  2XID A;  3LH0 A;  2RQR A;  2AHJ B;  2C0O A;  2DLP A;  2DRM A;  4DA4 A;  2DJZ A;  5CKH A;  5KE3 A;  1U1T A;  1UHC A;  2J7I A;  3TEE A;  4C8Q D;  3WVE B;  1QCN A;  3CCQ A;  1M1K U;  1OOT A;  3UA7 A;  1SF9 A;  3UPU A;  2RI5 A;  2AIR B;  3VS2 A;  4X9C A;  3EFR A;  3LGL A;  1TU0 B;  1VQ7 T;  5GAO r;  1VQ5 A;  3A8L B;  4OP0 A;  1S72 A;  3P8B B;  1KSW A;  1AT1 B;  1QCF A;  4HVV A;  2RJE A;  4J9C A;  1VQL T;  3QXE B;  2MK5 A;  1RI0 A;  3RKX A;  1X6O A;  2HSE B;  1Q86 U;  2RB6 A;  4HT9 A;  3RMS A;  1SSH A;  4BE0 A;  2A36 A;  1VQM A;  1ABO A;  4KH1 B;  4Z89 A;  1N8R R;  1M27 C;  2EKO A;  4RG2 A;  3EGD B;  4D8D A;  4E47 A;  5CQX A;  2F5K A;  4KGZ B;  1UHF A;  2D0Q B;  1JJ2 S;  1NE8 A;  3DB3 A;  3A8H B;  1Q82 C;  1YJ9 Q;  3THK A;  3P8H A;  3CCM A;  3OYB A;  3UT1 A;  3C94 A;  2FO0 A;  1YWP A;  1VQ4 T;  1NYG A;  1U5S A;  3CCE A;  4A53 A;  1RI9 A;  1D09 B;  2DL7 A;  4PFO A;  2NUT B;  3CME Q;  1SKU B;  2CDT A;  2HNI A;  2XDP A;  3CPW P;  4KT0 E;  1N9R A;  4CC3 A;  5CKF A;  4M7A B;  2DF6 A;  2ROT A;  4M4Z A;  2CUB A;  3JCM W;  2DEU A;  4N4H A;  4FYY B;  2ZPB B;  5LJ5 f;  2EYZ A;  2GBQ A;  3H0H A;  1IZ6 A;  2JOY A;  2O88 A;  2HL3 A;  4ZN3 A;  3UWN A;  4CC2 A;  1C0M A;  4M78 G;  3QJ6 A;  4RTV A;  4C92 E;  2OX7 A;  4A54 A;  1JO8 A;  3GBQ A;  1JU5 C;  2NUT A;  2EQM A;  2EYQ A;  4C5H A;  1RAD B;  3EG9 B;  2NUZ A;  4ZTJ A;  2EYX A;  2QQA A;  3CQT A;  2HQE A;  2BE7 D;  4C0F A;  2H8H A;  2ZPE B;  5L8R E;  2F5T X;  2JVV A;  1KHC A;  1YIJ A;  4A4G A;  4BI3 A;  3M0S A;  2LX7 A;  4PNO A;  3GP8 A;  2P84 A;  1UGQ B;  1AOJ A;  4F7U G;  3M0T A;  5HK3 A;  3LYI A;  3C12 A;  1WHG A;  1R77 A;  1QVG S;  1M8V A;  2AKK A;  2ZPG B;  4UC4 A;  1PCX A;  1VIE A;  1D3B A;  5FU6 C;  2AT1 B;  3V8L A;  1GCP A;  4J7F A;  3G6E T;  5A0D A;  1M1K R;  3QWX X;  4A4H A;  1ZHI A;  2LT1 A;  1IO6 A;  4DOW A;  3X24 B;  4MMK A;  2GFA A;  3RIR A;  2KMT A;  3A8M B;  4HT8 A;  3VV0 A;  1MGQ A;  1VQM T;  3RES A;  2EYW A;  2PNI A;  4MDX A;  1QVP A;  3CXC A;  3JCM V;  2HZY A;  4DEX A;  4J5Y A;  1Y96 A;  2K3X A;  2VYT A;  1OPK A;  5C0M A;  2EQI A;  3BE3 A;  2R5M A;  1X2Q A;  1KQ2 A;  1K0S A;  1ZUK A;  4J9D A;  2V1Q A;  1VQ5 T;  2KYM A;  1VQ5 Q;  3A8G B;  2K3Y A;  4PJO A;  4ZGJ B;  3KBG A;  3X20 B;  2QK0 A;  1YWO A;  3I56 A;  2FRW A;  2GF7 A;  1TG0 A;  2RI2 A;  4M7A C;  4PJO G;  3OW2 P;  4RUG A;  1N9S A;  3E9F A;  4OML A;  3JRZ A;  5HK0 A;  1ZQ1 A;  3QYH B;  4OGE A;  1SRM A;  4RMO A;  5GMK l;  5D7U A;  2F1L A;  5CAI A;  1MHN A;  2O01 E;  2CYZ B;  1TOV A;  1SRL A;  4M7D A;  4JJD A;  2DM1 A;  2MAM A;  5J39 A;  1KK7 A;  1JJ2 A;  4GLM A;  4RCC A;  3RBB B;  3RKY A;  3RKW A;  4IUQ A;  2DYI A;  2K4Y A;  2DE0 X;  1CKB A;  2LTO A;  3CCM Q;  2G6F X;  2O9S A;  3D7S B;  2NWM A;  2DYB A;  2K5L A;  4JRK A;  1RL2 A;  1S72 T;  2X4Y A;  4M7A E;  3OW2 A;  1Q7Y R;  2EWN A;  3G71 T;  3QWY A;  1RLQ C;  2J6O A;  1JRI A;  2CP7 A;  3CPW A;  1IHV A;  1M90 U;  1BCM A;  4TVR A;  2OTJ Q;  1M1G A;  1Y0M A;  4OB0 B;  2KY9 A;  1VQO Q;  1KC8 R;  3PNW C;  4M75 D;  1KQS S;  2WAC A;  2X3X D;  1OV3 A;  1BB9 A;  4O5V A;  3H0I A;  3MKD A;  1QWF A;  1VQ6 T;  2SEM A;  1W70 A;  3EGU A;  3CCR A;  1X01 A;  5IXB A;  2BZ8 A;  2KSS A;  1KD1 U;  4F7U E;  3CMA Q;  2K5I A;  2DZC A;  1TUD A;  3SHW A;  2O9V A;  2VC8 A;  1ZBX A;  3MEV A;  3VS3 A;  4NL3 A;  4II1 A;  1TXQ A;  1WLP B;  5HCK A;  5I22 A;  3OYF A;  3S6W A;  1PM3 A;  5GAN j;  4M78 A;  2KBT A;  4J9G A;  1RLP C;  4QW2 A;  1T3S A;  1EFN A;  2A0F B;  4PKC C;  5GAN 5;  2QEX A;  5KYN A;  4L5G A;  5KYY A;  2W0Z A;  3MEA A;  1YI2 T;  1Q81 R;  1Y07 A;  2HD0 A;  2DMO A;  1QKW A;  1M5Q 1;  3H8Z A;  4KH0 B;  4NL2 A;  2DD5 A;  2EPD A;  4XTZ A;  4A4F A;  2EFI A;  4CRI A;  4PJJ A;  2DL4 A;  3EGX A;  4LDU A;  2A28 A;  4GBQ A;  2L0A A;  2EGA A;  4OMP A;  3TRE A;  4X34 A;  2MIO A;  3CCE Q;  3CCE T;  2KNB B;  2D0N A;  2IIM A;  3VS6 A;  3G71 A;  5I2M A;  2NYS A;  4DBF A;  4KUI A;  2EJG A;  1K8A C;  2EKH A;  3MPU B;  3I5R A;  4BB7 A;  1SPK A;  4JLI A;  2H3J A;  3HRT A;  4KBM B;  3EG2 A;  4XU0 A;  2JM8 A;  1KIK A;  4M75 G;  3HFO A;  2A37 A;  4IIM A;  3VKI A;  1EZZ B;  1M3A A;  2MWP A;  5GAO q;  1M2V A;  4BDZ A;  3JB9 J;  1MV3 A;  1N27 A;  3VUZ A;  1VQ7 A;  1NEB A;  2PUO B;  2COW A;  3FIF A;  3CC7 A;  1YJ9 T;  2OAW A;  3I56 Q;  3AT1 B;  3RDV A;  2DTH A;  4OMF B;  1LOJ A;  5I21 A;  1ACM B;  4V2S A;  2K3B A;  4LXC A;  1AEY A;  1UB4 A;  3EG3 A;  2OTL A;  2M02 A;  3CD6 Q;  1IB8 A;  1KC8 U;  2LDM A;  3JB9 G;  1W2B A;  1MUZ A;  1S72 Q;  2WSE E;  4LDV A;  2I0N A;  1ZUU A;  2HEQ A;  3PMT A;  3N5B B;  6AT1 B;  4E7H A;  2RI3 A;  5LJ5 d;  1VQN Q;  1Y71 A;  1VQP A;  3PT9 A;  2PU9 B;  3CBM A;  1PKS A;  2QGG A;  3VS5 A;  1M1K C;  2J05 A;  3GPL A;  3RNJ A;  1Q86 R;  1RAG B;  4HVU A;  2AK5 A;  1VQO A;  4CC7 A;  4C0G A;  5FRN A;  3T9N A;  1LCK A;  4FIB A;  3V8J A;  2E65 A;  4HCZ A;  1F1B B;  2CSQ A;  1VQ6 Q;  4Z8A A;  1QP2 A;  2BZY A;  5GAM g;  3VS4 A;  4OB3 B;  4LUD A;  1K1Z A;  4Y91 A;  4FU6 A;  2P0K A;  3QZ9 B;  3M56 A;  1U1S A;  2CP6 A;  1X27 A;  4N4G A;  2HAX A;  2VXE A;  3E2U A;  3QO3 A;  1QVG A;  3OY9 A;  3A5Z B;  2RPN A;  4C8Q B;  2CP2 A;  3Q1J A;  1YJN A;  2IPO B;  4R0K A;  3SD4 A;  3PIP A;  3L2V A;  5KYX A;  2JN0 A;  3INZ A;  3OQ5 A;  3GLX A;  2KVQ G;  3SWN A;  2R58 A;  1M90 C;  2DRK A;  2E70 A;  4A4K A;  1MMD A;  2KXC A;  2MI6 A;  4ELY C;  2HQX A;  4Y92 A;  4ATO A;  3QDF A;  4M77 B;  2ECZ A;  2LJ0 A;  5I2S A;  1Q81 U;  1WHH A;  1NEG A;  2P0P A;  1T3L A;  4LUE A;  4FT4 A;  1PSE A;  3ZL7 C;  1LVK A;  5GAN h;  3OSS C;  1FMV A;  3REA B;  1HXD A;  5M9O A;  3CC4 Q;  4KGV B;  3MCA B;  5LJ5 j;  2DL5 A;  2JTE A;  3QYG B;  1BCO A;  1RAH B;  2PUK B;  2RHZ A;  4F04 B;  2H3E B;  2LMJ A;  5GAN 3;  1FYN A;  1RAC B;  1H92 A;  3LGF A;  4LDW A;  3H0F A;  3CEY A;  2CZ6 B;  1M2V B;  2QQR A;  5GAO m;  2RN8 A;  5EC7 A;  1QCO A;  3EG9 A;  2EYY A;  3I9Q A;  3OBW A;  2KYB A;  4FYX B;  3L2Z A;  3TCJ A;  3CME A;  2RK2 A;  4M7A G;  1WXU A;  2FEI A;  2YUP A;  1E7O A;  2X4W A;  2YDL A;  4NOY A;  1TS9 A;  1AZG B;  4J9B A;  4O6J A;  4C5I A;  5IT9 E;  4DOV A;  2SRC A;  2EGC A;  1ARK A;  4J9H A;  3JV3 A;  4XU1 A;  1YN8 A;  1WHK A;  2E3H A;  3V7R A;  1K0X A;  1M90 R;  1R0B G;  3M57 A;  4C92 C;  2LCL A;  2MOX A;  2KGT A;  4ZNX A;  3CBP A;  3KUF A;  3FDR A;  4E7K A;  2QQS A;  4M7D B;  3CCS A;  2HKN A;  1OPL A;  1UUE A;  4JDS A;  4N4I A;  1VQ4 A;  1XQH A;  3CCM T;  1NZ9 A;  2FVU A;  4M75 E;  4EMK A;  2FZK B;  2K5F A;  5FLX E;  3JCM Q;  4E7Z A;  3EGD A;  1KJW A;  1K9M U;  2JTM A;  2QTV A;  5DLQ E;  1K4U S;  2XI9 A;  4JJC A;  4AG2 C;  1YIT A;  3WVD B;  2RH2 A;  1H64 1;  5IHK A;  2L89 A;  1G3T A;  4C5E A;  2D9T A;  1WGS A;  2QTX A;  1WHJ A;  3QKJ A;  5FWB A;  3HPW A;  5AYF A;  4JRP A;  1B34 B;  4HA8 A;  1AWO A;  3H41 A;  1Z9Z A;  3JB9 D;  1M3C A;  2HBP A;  3HTR A;  4E6R A;  3LWI A;  1WNL A;  5CO7 A;  1E6H A;  1ZA1 B;  4J6Y A;  2DTI A;  1YJN Q;  1BKB A;  1YIT T;  3A98 A;  1YIT Q;  1AWJ A;  1TH7 A;  2YUQ A;  2ED0 A;  3QPH A;  4XTV A;  2X4J A;  1WQ7 A;  2YHT A;  1T0J A;  4M78 F;  3RR6 A;  2M51 A;  1X75 C;  2JTF A;  1MNE A;  1P92 A;  3HP9 A;  3URG A;  1W6X A;  2HCK A;  3BDU A;  1BK2 A;  1R8O B;  3ZFJ A;  2DIL A;  1K73 U;  2XDD A;  3RUX A;  4J9E A;  2JMA A;  4WCI A;  2RD1 A;  2RQV A;  3EHR A;  2QA4 Q;  2YRV A;  1QMC A;  3EHQ A;  4AMC A;  1I5L A;  5AT1 B;  4OB2 B;  5IAY A;  4PL6 A;  1WJS A;  1I81 A;  2K7A A;  5GAN 7;  3OYJ A;  4R55 A;  1W4S A;  4PK4 A;  1Y7X A;  1UJY A;  1KD1 R;  5CQY A;  2XU8 A;  3SFM A;  4M78 B;  1Q82 U;  3EFS A;  1RUW A;  4DQ2 A;  5GAO p;  2Y4Y A;  2F2V A;  2CT4 A;  3M0Q A;  4C92 G;  1VQ6 A;  2QDL A;  2LJ3 A;  2WSF E;  2BZX A;  4DBQ A;  3HHT B;  2E64 A;  4PJL A;  2LZ6 B;  4OMM A;  3M59 A;  1AVZ C;  1UTI A;  3CPW S;  4XQ3 A;  3PVQ A;  4M7D C;  1I07 A;  2V1R A;  3I56 T;  2MF2 A;  1PG5 B;  1KQS P;  3FJ5 A;  1I0C A;  4J9F A;  3NTH A;  3X26 B;  1BIB A;  2J6F A;  1I5O B;  2FRY A;  2EJ9 A;  1YIJ Q;  2ENM A;  1OZ3 A;  1VQ9 T;  4MDW A;  3MJX A;  3QSU A;  3MP6 A;  4M75 C;  4RG8 A;  2R5A A;  3CC2 T;  3VS7 A;  2JM9 A;  2YUN A;  1JJ2 P;  1B3Q A;  1NM7 A;  4ESR A;  4DEY A;  1HJD A;  4C8Q G;  3L2W A;  2K2M A;  2YT6 A;  4FL6 A;  1H3H A;  2P0Q A;  2COY A;  3V8K A;  1WHL A;  3MO8 A;  4HXJ A;  2B8A A;  4XU3 A;  1M3B A;  4M7A F;  1D1C A;  1O9S A;  2RO0 A;  1ZX6 A;  4L59 A;  3CD6 T;  2JW4 A;  1W2B S;  3VYG A;  3CCJ Q;  3DLL A;  1SSF A;  2HBW A;  2DX1 A;  1RAF B;  4J7I A;  3CCV Q;  2DBM A;  4EMK C;  2GGR A;  5CKB A;  2J06 A;  2DXC A;  5LJ3 e;  1WHM A;  1VQ9 A;  3DLM A;  3CBO A;  1MV0 B;  1FMW A;  5KCH A;  3S3N A;  1I8F A;  4OMO A;  2FL7 A;  1H8K A;  1JXM A;  2YRD A;  2ED1 A;  2K6D A;  1VQN A;  5FU6 B;  5IN1 A;  4F7U A;  2KT8 A;  3CCQ T;  1VYT A;  5KYW A;  2CP5 A;  3JCM h;  1K73 R;  3R6O A;  2QEX T;  2Y4X A;  2KRN A;  2KDS A;  2LC4 A;  4EPC A;  1Q82 R;  1ZA2 B;  1BI0 A;  1LJO A;  1OU9 A;  4OMN A;  3OYA A;  3CMA T;  2CSI A;  1VQ8 T;  2XDB A;  5LJ3 g;  1IXD A;  1N5Z A;  4PJO F;  3CCU T;  1G3W A;  4M78 C;  4M75 F;  1IRE B;  3X25 B;  4D6W A;  2HDA A;  2DBK A;  2L5Q A;  1KQ1 A;  5D6W A;  3OS1 A;  1WFW A;  2KRM A;  5GMK i;  2X4X A;  1TWB A;  3NHN A;  3ZBD A;  1ABQ A;  2YWW A;  2VAS A;  4QT7 A;  3I35 A;  1S1N A;  2LCS A;  4R56 A;  1NJI C;  1GCQ C;  5GAN 2;  1QVG P;  1BYM A;  2QYZ A;  1WI7 A;  4PJO B;  2PVD B;  4J6W A;  3R6N A;  8ATC B;  2OTL T;  1VQM Q;  2OTL Q;  1YBY A;  1UEB A;  2ABL A;  2RQW A;  3I55 T;  1VQ7 Q;  4PJO E;  4M75 B;  3OYH A;  4M78 E;  4AG1 C;  1M4Z A;  3S3M A;  3MET A;  4M7D D;  1UFF A;  1RAB B;  5LJ3 f;  2LQW A;  2C0I A;  4M77 D;  3KFV A;  3QUI A;  4RTX A;  3GOX A;  2JS2 A;  1BI3 A;  3CD6 A;  1K8A U;  1GL5 A;  2DER A;  1G2B A;  4C92 A;  2JT4 A;  1ZUY A;  1WDX A;  3WXM B;  1YHQ A;  1X69 A;  4D8K A;  3HRS A;  5LL6 S;  2D8J A;  2EQK A;  2JXB A;  4JZ4 A;  2JNG A;  4M7D G;  1D0Y A;  5KH6 A;  1VQ8 A;  1BU1 A;  3UF4 A;  4EMK B;  5LJ3 j;  1G5V A;  3G6E A;  3CC2 Q;  1Q95 G;  4C8Q A;  2XIC A;  3SDZ A;  4JS5 A;  2FZG B;  1GFC A;  2VWF A;  1B7T A;  2ATC B;  2GQI A;  1GCQ A;  2YSQ A;  2EW3 A;  3H9N A;  5GMK h;  3ASK A;  2RJC A;  1VIF A;  2EQU A;  1XNI A;  3REB B;  3U23 A;  1VYV A;  2EVR A;  2VVK A;  5ECA A;  1K73 C;  3QDR B;  5DM7 R;  1WQW A;  5EG2 A;  2VB6 A;  2D1X A;  1GBR A;  2GTO A;  4X9D A;  5FU7 C;  5GAM e;  2BIV A;  1PNJ A;  1N8R U;  4N0A A;  1XTD A;  3KXT A;  2DK3 A;  3SWN B;  2X3W D;  4RTU A;  4ZGE B;  2PZ1 A;  3M0P A;  1ZSZ A;  4A4E A;  1VQO T;  4RTY A;  3CCU A;  1NPP A;  2LQK A;  1QP3 A;  1T0H A;  4B9X A;  2LVM A;  4DBR A;  1QKX A;  2KXD A;  1ZLM A;  2PVG B;  3OYI A;  2DO3 A;  4Z02 A;  1E6G A;  1PRM C;  4XTU A;  1VQP T;  2FPD A;  4Z88 A;  1V29 B;  4QKU A;  4EMH A;  5CK9 A;  1R0C B;  2O31 A;  1UEC A;  4PJO C;  1D0Z A;  2RHX A;  2YRC A;  1KD1 C;  2FB7 A;  4FYV B;  1MND A;  4RCB A;  2DXB A;  5HY6 A;  4PFZ A;  2OJ2 A;  4LN2 A;  4BY6 B;  5GMK m;  1D3B B;  1SG5 A;  2KEA A;  3M5A A;  1M1F A;  3L2Q A;  2BKD N;  2HKQ B;  1YI2 Q;  2V26 A;  4IUV A;  2RM4 A;  3CCJ A;  3E19 A;  3M4Y A;  4B6M A;  3EG1 A;  3L1A A;  3OYG A;  3ZEH A;  2VV5 A;  1Z9Q A;  1QW1 A;  4JLG A;  3JCM P;  2KI7 A;  5KE2 A;  2LT4 A;  1AZE A;  2IVW A;  2EIF A;  4DBH A;  2DTO A;  2CS7 A;  1M9S A;  3QZ5 B;  1RAA B;  2V8J A;  1FMK A;  2GTJ A;  2PVO B;  1U06 A;  2QA4 T;  1IHW A;  2EQJ A;  2YLB A;  2O4X A;  2IG0 A;  4ZTF A;  2BE9 B;  3FEO A;  3JB9 F;  3CPF A;  5CR2 A;  3EGX B;  1NLP C;  1TUC A;  4PLI A;  3CCS T;  3CCS Q;  2AZV A;  2VGM A;  2MPX C;  3CC7 Q;  5LJ3 d;  3LLR A;  1VOM A;  5CKE A;  2CKK A;  2M9U A;  3G7Z A;  4QQ6 A;  4MZT A;  5FU7 B;  4OF1 A;  3MEU A;  4Q5W A;  5LJ5 g;  4HCB A;  2MWO A;  3NTI A;  1U3O A;  1WXT A;  1YHQ T;  1YHQ Q;  2DAQ A;  4QQD A;  3JAM E;  1VQ4 Q;  4XAX B;  1Q7Y U;  3VS0 A;  2L3R A;  2CH4 W;  5GAN e;  2CH4 A;  3OYE A;  2OTJ A;  4NS5 A;  1QVF P;  2F2W A;  2LQN A;  1D1B A;  3C0C A;  3CME T;  3PGG A;  5A0G A;  2VXF A;  5KYW B;  2GNC A;  1QWE A;  2GFU A;  3GF5 A;  4XTX A;  1TUG B;  1WA7 A;  3PE0 A;  3BW1 A;  5LJ5 h;  2FHD A;  3VJP A;  5FRO A;  3CCR Q;  2ZPI B;  1UE9 A;  1ZBJ A;  2ZZD A;  4KUL A;  5C6S A;  3ME9 A;  4F16 A;  1OQK A;  5GMK j;  1SHF A;  2QDY B;  1WYX A;  2D8H A;  2YLC A;  3F70 A;  4CC4 B;  1I4K 1;  4C8Q C;  4ELZ C;  2HL5 C;  3NPF A;  5KYY B;  4YTL A;  1G3Y A;  1M8M A;  5A2Q E;  3NGP A;  5CVI A;  1WJR A;  2RK1 A;  1HYO A;  1HSQ A;  3PIO A;  1VQ8 Q;  3L42 A;  3M0U A;  4BI4 A;  3CCL T;  2DET A;  4N0A C;  2EJF A;  1CSK A;  2L2P A;  4ZN1 A;  2BUD A;  1NYF A;  1GXI E;  1PWT A;  5CIU A;  4BE1 A;  4LDX A;  2QI2 A;  5DLO A;  4FW1 A;  4C8Q F;  4GY5 A;  2XK0 A;  4FW2 A;  1W1F A;  1UGV A;  2CP0 A;  2AKL A;  1YJN T;  3G6E Q;  3CC2 A;  2KR3 A;  2CT3 A;  3CMA A;  3GIB A;  3TSW A;  4MZM A;  5GAN 4;  3JB9 H;  1KG1 A;  2W10 A;  5GAN 8;  4M77 E;  1AHJ B;  4EIK A;  2R57 A;  1PRL C;  2Z0W A;  4FM4 B;  2DFU A;  4B9W A;  2Y90 A;  1GFD A;  2JUF A;  3S3O A;  4RTT A;  4C92 D;  2DVJ A;  3OS0 A;  4PJO D;  5I11 A;  1KC8 C;  4P5N A;  2M0O A;  1IRX A;  1Q86 C;  3OS2 A;  4M77 G;  1UGP B;  1NBE B;  3LW5 E;  3G4S T;  3PMI A;  2DKG A;  1SEM A;  3A1P A;  1WPY A;  3J81 E;  4RTW A;  2ZAE A;  1AD5 A;  5GAM j;  1TTH B;  2M0Y A;  3I55 Q;  1YP5 A;  3OYL A;  3BDL A;  2JJ9 A;  4M75 A;  5GAN g;  2KRS A;  3JCM c;  4M7A A;  4RTZ A;  4ANJ A;  2I2L A;  3FB9 A;  5A0L A;  1UDL A;  1VQL Q;  1K76 A;  1YNZ A;  4LD9 K;  3QBY A;  2QAZ A;  4XK8 E;  1MMN A;  2DL8 A;  1PHT A;  5GJV B;  1K9M R;  2DPP B;  1JQQ A;  2F2X A;  2NUP A;  3RER A;  2E12 A;  3I55 A;  1DJ7 B;  2VKN A;  4FT2 A;  5GAN f;  2YXY A;  3DKM A;  3RMQ A;  2DEQ A;  2E41 A;  1VQ9 Q;  2QQB A;  1WXB A;  2X51 A;  3A8O B;  4OVA A;  3UDC A;  3M58 A;  1KHI A;  1Y96 B;  3FRN A;  2QA4 A;  1AWX A;  1JBM A;  1Y57 A;  2LJ1 A;  3OYM A;  1YI2 A;  2QAS A;  2GQV A;  3QJY A;  4IUT A;  3CXC P;  3TVT A;  4M7D F;  1PKT A;  4OMQ A;  4AFU C;  5D6X A;  5CKD A;  2DNU A;  4E7S A;  2RMO A;  3JB9 I;  2L3P A;  2NUP B;  4KGX B;  1H3Z A;  3O5Z A;  1OX8 A;  2RHU A;  3EH1 A;  3JCM e;  4LE9 A;  2HSP A;  3OYY A;  3CCL A;  2EAY A;  3CCJ T;  1X6B A;  2LNH B;  2ZPF B;  5KYU B;  2VGN A;  5IHI A;  3OA6 A;  4EMG A;  3VUB A;  2P4T A;  5J26 A;  1W2B P;  4A63 B;  1VQP Q;  4AT1 B;  2V8K A;  1OYX A;  1B07 A;  4F14 A;  1NJI R;  1QLY A;  1RAE B;  2JMC A;  2XG8 D;  2OAU A;  3JSC A;  2E4H A;  1VQK T;  2RJF A;  2XHC A;  2DZ9 A;  2RJD A;  5GAN 6;  4F7U F;  2LRQ A;  3VS1 A;  3CXC S;  3OYN A;  2FG0 A;  3I5S A;  2QEX Q;  2JS0 A;  2DXT A;  1WJQ A;  2L8D A;  2CP3 A;  1D1A A;  2A7Y A;  3MP8 A;  3PVL A;  3CC4 A;  1QVF A;  5J3B A;  1EIF A;  4X1V A;  4KUD K;  4JZ3 A;  4XU2 A;  5L23 A;  4J6X A;  3CCU Q;  3NFC A;  3JCM b;  2ROL A;  2K9G A;  1VUB A;  2MYS A;  1UGS B;  1N8R C;  1X6G A;  4OB1 B;  1IGQ A;  1OX9 A;  2X9H A;  3EG0 A;  3FLG A;  3LX7 A;  3TU4 K;  1BBZ A;  2PTK A;  2NLU A;  4QVC A;  5FW9 A;  4PJN A;  1SHG A;  4HKE A;  2XMF A;  4F7U B;  3EAE A;  2PQW A;  3CC4 T;  1RAI B;  2ZCF B;  1EX4 A;  3L2U A;  2XD0 A;  1JXO A;  5D6Y A;  2K79 A;  2O4X B;  3G1J A;  1BI1 A;  3TSZ A;  1M2O A;  2EBP A;  3IQL A;  2MCN A;  3LWH A;  3L2R A;  1Q7Y C;  2RNA A;  5GMK e;  2GCX A;  1VQK A;  1QVF S;  2LX9 A;  2RQT A;  2E3I A;  2QG9 B;  3QG1 A;  2VUB A;  1C1A A;  1KFZ A;  2ZPH B;  3QHS A;  2YUO A;  1ZSZ C;  4JRI A;  1A0N B;  2A08 A;  3NTK A;  1YCS B;  4CI0 C;  1OU8 A;  2DJQ A;  2CZ1 B;  5GAM f;  2P4R A;  3E9G A;  1PSF A;  4VUB A;  3VYH B;  3OS5 A;  1YJW T;  3TQ7 P;  2WSC E;  4IUU A;  1K9A A;  9ATC B;  4JPB W;  2F69 A;  1NG2 A;  1MMG A;  2QGF B;  4JRQ A;  3HL8 A;  5GAM h;  3BY7 A;  3ER0 A;  4BI8 B;  1VA7 A;  3P8D A;  1AWW A;  5DY9 A;  2QXF A;  5KYU A;  1PD0 A;  4J9I A;  3HSB A;  1G83 A;  1D0X A;  2CZ0 B;  2DA9 A;  1VQN T;  3M0R A;  2E10 A;  2KRO A;  3FJP A;  1CKA A;  1V76 A;  2CUD A;  4K11 A;  3G71 Q;  3JCM f;  4OGC A;  3M54 A;  5GAN d;  2M1H A;  4FSX A;  5GJW B;  4RKU E;  3FC3 A;  3QII A;  4ME7 A;  1BIA A;  4KRT A;  3JCM J;  2HMA A;  2FPE A;  2MMP A;  2DVE A;  2L3S A;  2X35 A;  2LNV A;  5KCO A;  1GRI A;  4BAC A;  3O8V A;  5IXF A;  1OZ2 A;  1YFN A;  4C5G A;  2DL3 A;  3JCM g;  4BDY A;  2DD4 A;  3OW2 S;  1LPL A;  2DXU A;  7AT1 B;  4FCY A;  2D6F A;  5KYX B;  3ULR B;  3E1S A;  4MZP A;  3MHX A;  3OYK A;  3MP1 A;  1JEG A;  1YCY A;  1QQJ A;  2KE9 A;  2DIQ A;  2J6K A;  3HKS A;  4E7I A;  3EFO A;  3OSV A;  1FXX A;  2O2O A;  4J83 A;  1K8A R;  2LCC A;  1PC0 A;  1J3T A;  1VQL A;  5IHN A;  2EGE A;  2RHY A;  2E5K A;  1WX6 A;  3V7C A;  4BD3 A;  4HCK A;  1UGR B;  3M9Q A;  4AFS C;  4L6V 5;  2CZ7 B;  3LH5 A;  3SEM A;  4JUV A;  1B34 A;  2BTT A;  2E1H A;  2RQU A;  4E7L A;  1ZSZ B;  2RF0 A;  2FYK A;  2KT1 A;  3VRY A;  4M77 F;  2C0T A;  1WZO A;  4JJB A;  2RA2 A;  4J8O A;  5LJ3 h;  4HVW A;  2E5Q A;  4ORZ A;  1NPR A;  3VRZ A;  1KQS A;  2KQW A;  8AT1 B;  1G8X A;  3JCM X;  2DIG A;  3X28 B;  1TSF A;  1LNX A;  4PFP A;  4LDY A;  1O75 A;  4C8Q E;  1YJW A;  1UG1 A;  2A3L A;  3VU3 C;  4C0D B;  1VYU A;  4M77 A;  2HQH A;  2K57 A;  4F17 A;  3M55 A; 
#chains in the Genus database with same CATH homology
 5GAO p;  1BI2 A;  2Y4Y A;  3HFN A;  2WAC A;  3OYC A;  1I4K 1;  4C8Q C;  4ELZ C;  1HK9 A;  2E6Z A;  1G3S A;  4C92 G;  4M77 C;  2KK4 A;  4O5V A;  1VQ6 A;  4YTL A;  3BFM A;  2WSF E;  1VQ6 T;  1G3Y A;  5A2Q E;  4JJN K;  3CCR A;  1XOV A;  5CVI A;  1WJR A;  2RK1 A;  3HHT B;  2E64 A;  4IKF A;  1X01 A;  2KSS A;  1KD1 U;  3M59 A;  3PIO A;  4F7U E;  2CGH A;  4ZGD B;  3L42 A;  4BI4 A;  3CCL T;  2K5I A;  2DZC A;  4XQ3 A;  3JCM d;  1JB0 E;  3CPW S;  4M7D C;  3CCL A;  4M7A D;  3I56 T;  2VC8 A;  2MF2 A;  1ZBX A;  2XKO C;  3MEV A;  4N0A C;  2EJF A;  4II1 A;  4Y28 E;  4NL3 A;  3GNG A;  2C06 A;  5GAO l;  4ZN1 A;  2BUD A;  1FWZ A;  3S6W A;  3OYF A;  1YJ9 A;  3CC7 T;  1GXI E;  5CIU A;  5GAN j;  4M78 A;  4BE1 A;  4LDX A;  3NTH A;  2QI2 A;  3X26 B;  5DLO A;  1BIB A;  1FX7 A;  2G3R A;  4QW2 A;  4C8Q F;  1YIJ T;  2EJ9 A;  4GY5 A;  2XK0 A;  5GAM d;  1OZ3 A;  1VQ9 T;  4MDW A;  4PKC C;  5GAN 5;  2QEX A;  3QSU A;  4L5G A;  3MP6 A;  4M75 C;  4RG8 A;  4LD6 A;  3MEA A;  1YI2 T;  1YJN T;  3CC2 A;  1Y07 A;  2R5A A;  3CC2 T;  3MEW A;  2HD0 A;  1M5Q 1;  4WF2 A;  3CMA A;  3SWN C;  2M16 A;  3H8Z A;  1NJI U;  3GIB A;  4GLK A;  4NL2 A;  2DD5 A;  4XTZ A;  4A4F A;  4C8Q G;  3J80 E;  4C92 F;  3L2W A;  2EFI A;  4MZM A;  4FL6 A;  4CRI A;  5GAN 4;  3V7S A;  4QQG A;  2P0Q A;  2ZGW A;  3G4S A;  4LDU A;  3JB9 H;  3V8K A;  1KG1 A;  3H6Z A;  4M77 E;  4PLL A;  5GAN 8;  2OTJ T;  3C4S A;  4BE2 A;  1AHJ B;  2K2V A;  3MO8 A;  3SB2 A;  3TRE A;  4X34 A;  1U8R A;  3M4G A;  2R57 A;  2LQ8 A;  2B8A A;  4E7J A;  4XU3 A;  1W2B S;  4BUG A;  4C0Z A;  4FM4 B;  3CCE T;  2QQ9 A;  4M7D E;  4B9W A;  4QVD A;  4M7A F;  2Y90 A;  1O9S A;  2RO0 A;  4L59 A;  3AHU A;  2JUF A;  3CD6 T;  4M78 D;  3HRU A;  3S3O A;  3PTA A;  4C92 D;  3OS0 A;  3VYG A;  3G71 A;  5I2M A;  3DLL A;  2JZ2 A;  3DB4 A;  1SSF A;  4PJO D;  3OMC A;  1KC8 C;  4P5N A;  4J7I A;  4KUI A;  2M0O A;  2EJG A;  3CCR T;  2V8I A;  1K8A C;  3CCV T;  1Q86 C;  1Q81 C;  4EMK C;  4XTY A;  5CKB A;  3OS2 A;  3J7A F;  2DXC A;  5CCA A;  5LJ3 e;  4BB7 A;  1VQ9 A;  4JLI A;  3DLM A;  4M77 G;  2H3J A;  2KAF A;  3CBO A;  1UGP B;  3HRT A;  4KBM B;  5KCH A;  4JS4 A;  3S3N A;  4XU0 A;  5HKC A;  3LW5 E;  3PFS A;  1I8F A;  3G4S T;  2FL7 A;  3PMI A;  5FRM A;  2DKG A;  4M75 G;  4C92 B;  1WPY A;  3J81 E;  4IUR A;  3HFO A;  3C95 A;  4BY6 C;  5GAM j;  1VQN A;  4EDU A;  5FU6 B;  5IN1 A;  4F7U A;  3OYL A;  3CCQ T;  3BDL A;  4M75 A;  3VKI A;  3OYD A;  3JCM h;  5GAN g;  2MWP A;  3R6O A;  2QEX T;  2RHI A;  2Y4X A;  5GAO q;  3JCM c;  3CCV A;  2KDS A;  2LC4 A;  4EPC A;  4M7A A;  2E6N A;  4HCC A;  4BDZ A;  2I2L A;  3FB9 A;  1BI0 A;  1N27 A;  1LJO A;  3VUZ A;  5A0L A;  3JB9 J;  3OYA A;  3CMA T;  1VQ7 A;  1VQ8 T;  2XDB A;  5LJ3 g;  2PUO B;  3FIF A;  3CC7 A;  1YJ9 T;  4LD9 K;  3QBY A;  3OBY A;  4QVZ A;  4PJO F;  3M53 A;  4XK8 E;  4C0D C;  3CCU T;  2DTH A;  3GNF B;  1OI1 A;  4OMF B;  1LOJ A;  5I21 A;  1G3W A;  4M78 C;  4MML A;  2DPP B;  5GAO n;  4V2S A;  4M75 F;  3OB9 A;  1IRE B;  3X25 B;  1Q82 U;  4D6W A;  1K9M C;  3RER A;  2E12 A;  2L5Q A;  4XTW A;  1KQ1 A;  1DJ7 B;  3OMG A;  4FT2 A;  4IUP A;  5GAN f;  3DKM A;  5D6W A;  3RMQ A;  5LJ5 e;  1UB4 A;  2OTL A;  3OS1 A;  1N6A A;  2DEQ A;  2E41 A;  5GMK i;  2QQB A;  2X4X A;  1KC8 U;  2LDM A;  3JB9 G;  1W2B A;  2XID A;  3A8O B;  3LH0 A;  4OVA A;  3UDC A;  3M58 A;  1KHI A;  2AHJ B;  1Y96 B;  3FRN A;  2WSE E;  4LDV A;  3ZBD A;  2QA4 A;  4DA4 A;  2DJZ A;  1JBM A;  3PMT A;  5CKH A;  3OYM A;  3N5B B;  1YI2 A;  4E7H A;  5KE3 A;  1U1T A;  2RI3 A;  5LJ5 d;  3TEE A;  2GQV A;  3QJY A;  1Y71 A;  4IUT A;  1VQP A;  4C8Q D;  3PT9 A;  2PU9 B;  3CBM A;  4R56 A;  3WVE B;  1NJI C;  4M7D F;  3CCQ A;  1M1K U;  5D6X A;  5CKD A;  1M1K C;  5GAN 2;  3GPL A;  3UPU A;  2RI5 A;  1BYM A;  3JB9 I;  4PJO B;  4X9C A;  2PVD B;  3EFR A;  3LGL A;  4J6W A;  1VQO A;  2OTL T;  1H3Z A;  4C0G A;  5FRN A;  3T9N A;  1VQ7 T;  1YBY A;  1UEB A;  2RHU A;  4FIB A;  3V8J A;  3JCM e;  3I55 T;  5GAO r;  4PJO E;  2E65 A;  3OYY A;  4HCZ A;  3A8L B;  2EAY A;  4M78 E;  4M75 B;  3OYH A;  3CCJ T;  4OP0 A;  1VQ5 A;  2ZPF B;  1M4Z A;  1S72 A;  3S3M A;  2VGN A;  3MET A;  3P8B B;  4M7D D;  3OA6 A;  1QP2 A;  5GAM g;  5LJ3 f;  4EMG A;  4OB3 B;  2RJE A;  3VUB A;  4Y91 A;  4FU6 A;  2P4T A;  5J26 A;  1VQL T;  2P0K A;  4M77 D;  3QXE B;  3QZ9 B;  2V8K A;  1OYX A;  3QUI A;  1RI0 A;  3RKX A;  1X6O A;  3GOX A;  1BI3 A;  3CD6 A;  1Q86 U;  2RB6 A;  4HT9 A;  3RMS A;  3M56 A;  1K8A U;  2XG8 D;  1U1S A;  4BE0 A;  2OAU A;  3JSC A;  4N4G A;  2HAX A;  4C92 A;  1VQK T;  2RJF A;  2VXE A;  1VQM A;  2XHC A;  3QO3 A;  2DZ9 A;  2RJD A;  5GAN 6;  4F7U F;  3WXM B;  1YHQ A;  2LRQ A;  3CXC S;  3HRS A;  5LL6 S;  3OYN A;  1QVG A;  3OY9 A;  2EQK A;  2JNG A;  2EKO A;  4M7D G;  4RG2 A;  5KH6 A;  3A5Z B;  1VQ8 A;  4E47 A;  5CQX A;  2DXT A;  1WJQ A;  2F5K A;  2L8D A;  4EMK B;  5LJ3 j;  1G5V A;  3G6E A;  2D0Q B;  1JJ2 S;  4C8Q A;  1NE8 A;  2A7Y A;  2XIC A;  3SDZ A;  4C8Q B;  3DB3 A;  4JS5 A;  3MP8 A;  3CC4 A;  3Q1J A;  1YJN A;  1QVF A;  3A8H B;  5J3B A;  1EIF A;  1Q82 C;  4KUD K;  3SD4 A;  4XU2 A;  3PIP A;  4J6X A;  3P8H A;  3NFC A;  3JCM b;  3L2V A;  3CCM A;  2JN0 A;  3INZ A;  5GMK h;  3ASK A;  3OQ5 A;  3OYB A;  2RJC A;  3GLX A;  3UT1 A;  1VIF A;  2KVQ G;  1VUB A;  2EQU A;  3C94 A;  2R58 A;  3SWN A;  1XNI A;  1M90 C;  2E70 A;  4A4K A;  1VQ4 T;  1UGS B;  1N8R C;  2MI6 A;  4ELY C;  2HQX A;  4OB1 B;  4ATO A;  4M77 B;  5I2S A;  3CCE A;  3FLG A;  4A53 A;  1Q81 U;  3LX7 A;  3TU4 K;  1K73 C;  2P0P A;  2NLU A;  4QVC A;  3QDR B;  5DM7 R;  4FT4 A;  1PSE A;  4HKE A;  5GAN h;  2XDP A;  2HNI A;  4F7U B;  1WQW A;  3EAE A;  3OSS C;  4KT0 E;  1N9R A;  2PQW A;  1HXD A;  5EG2 A;  3CC4 T;  5CKF A;  5M9O A;  4M7A B;  2ZCF B;  4X9D A;  5FU7 C;  5GAM e;  2BIV A;  3MCA B;  5LJ5 j;  3L2U A;  2XD0 A;  5D6Y A;  1N8R U;  3JCM W;  3QYG B;  4N0A A;  4N4H A;  2O4X B;  2ZPB B;  1BI1 A;  1XTD A;  5LJ5 f;  2PUK B;  3KXT A;  3LWH A;  2DK3 A;  3L2R A;  1Q7Y C;  3SWN B;  1IZ6 A;  5GMK e;  2JOY A;  2RHZ A;  4ZGE B;  2GCX A;  1VQK A;  4ZN3 A;  3UWN A;  1QVF S;  2LX9 A;  4M78 G;  3QJ6 A;  5GAN 3;  3QG1 A;  4A4E A;  4C92 E;  1VQO T;  4A54 A;  1NPP A;  2LQK A;  1QP3 A;  3LGF A;  4B9X A;  2LVM A;  3CCU A;  2VUB A;  4LDW A;  3CEY A;  2CZ6 B;  2EQM A;  2QQR A;  5GAO m;  2ZPH B;  2EYQ A;  3QHS A;  2PVG B;  4C5H A;  3OYI A;  2DO3 A;  4JRI A;  4Z02 A;  4ZTJ A;  3NTK A;  3OBW A;  2QQA A;  2HQE A;  4XTU A;  4CI0 C;  1VQP T;  4C0F A;  2CZ1 B;  5GAM f;  2ZPE B;  1V29 B;  5L8R E;  2F5T X;  2JVV A;  1KHC A;  3E9G A;  3L2Z A;  4EMH A;  5CK9 A;  1YIJ A;  1PSF A;  4A4G A;  3TCJ A;  4VUB A;  4BI3 A;  3VYH B;  3CME A;  2RK2 A;  4PNO A;  4PJO C;  4M7A G;  3OS5 A;  3GP8 A;  1UGQ B;  1YJW T;  2RHX A;  2WSC E;  4IUU A;  4F7U G;  1KD1 C;  2F69 A;  2FB7 A;  4DQ2 A;  5HK3 A;  3LYI A;  2X4W A;  3C12 A;  1QVG S;  4RCB A;  4JRQ A;  2DXB A;  4NOY A;  5HY6 A;  1M8V A;  4O6J A;  2ZPG B;  4UC4 A;  4C5I A;  5IT9 E;  4DOV A;  3HL8 A;  5GAM h;  3BY7 A;  3ER0 A;  1VIE A;  4BY6 B;  5GMK m;  4BI8 B;  1D3B B;  1D3B A;  3P8D A;  4XU1 A;  5DY9 A;  5FU6 C;  3M5A A;  1M1F A;  2QXF A;  3V8L A;  3HSB A;  3L2Q A;  2BKD N;  4J7F A;  3G6E T;  2CZ0 B;  5A0D A;  1VQN T;  3V7R A;  2E10 A;  4IUV A;  2RM4 A;  3FJP A;  4A4H A;  1ZHI A;  2LT1 A;  3M57 A;  4DOW A;  4C92 C;  2LCL A;  3CCJ A;  3JCM f;  3X24 B;  3E19 A;  3M4Y A;  4MMK A;  2GFA A;  4OGC A;  3L1A A;  3M54 A;  5GAN d;  3RIR A;  3OYG A;  2KMT A;  3ZEH A;  3A8M B;  3CBP A;  3KUF A;  2M1H A;  2VV5 A;  3FDR A;  4FSX A;  1QW1 A;  4E7K A;  4HT8 A;  4JLG A;  4RKU E;  1MGQ A;  3VV0 A;  3FC3 A;  2QQS A;  3JCM P;  3RES A;  3QII A;  1VQM T;  4M7D B;  4ME7 A;  1BIA A;  5KE2 A;  3CCS A;  3JCM J;  2MMP A;  4MDX A;  1QVP A;  4JDS A;  2DVE A;  3CXC A;  3JCM V;  2X35 A;  2LT4 A;  4N4I A;  2LNV A;  2IVW A;  2EIF A;  5KCO A;  1VQ4 A;  1XQH A;  1Y96 A;  4J5Y A;  1NZ9 A;  3CCM T;  2FVU A;  4BAC A;  2K3X A;  2DTO A;  4M75 E;  2CS7 A;  2K5F A;  2VYT A;  3O8V A;  5FLX E;  4EMK A;  1M9S A;  1OZ2 A;  3QZ5 B;  5C0M A;  3JCM Q;  2V8J A;  4C5G A;  2PVO B;  3JCM g;  1K9M U;  4BDY A;  2DD4 A;  2QA4 T;  3OW2 S;  2EQJ A;  2YLB A;  2DXU A;  2JTM A;  5DLQ E;  2O4X A;  2IG0 A;  2XI9 A;  2R5M A;  2D6F A;  4ZTF A;  1YIT A;  3FEO A;  3WVD B;  1KQ2 A;  3JB9 F;  1VQ5 T;  3E1S A;  2RH2 A;  3A8G B;  3CPF A;  5CR2 A;  1H64 1;  2L89 A;  1G3T A;  2K3Y A;  2D9T A;  1WGS A;  4PLI A;  4MZP A;  4C5E A;  2QTX A;  3CCS T;  4PJO A;  3MHX A;  2VGM A;  3MP1 A;  3QKJ A;  3OYK A;  3HPW A;  5AYF A;  4ZGJ B;  4JRP A;  3KBG A;  3X20 B;  1B34 B;  1YCY A;  3I56 A;  5LJ3 d;  3LLR A;  2GF7 A;  2DIQ A;  4HA8 A;  2RI2 A;  5CKE A;  3HKS A;  4M7A C;  2CKK A;  2M9U A;  3G7Z A;  4QQ6 A;  4MZT A;  5FU7 B;  4PJO G;  4E7I A;  3OSV A;  3JB9 D;  1FXX A;  4OF1 A;  2HBP A;  3LWI A;  1N9S A;  1WNL A;  3E9F A;  5CO7 A;  3MEU A;  4J83 A;  3JRZ A;  4Q5W A;  5LJ5 g;  4J6Y A;  2DTI A;  5HK0 A;  1BKB A;  1ZQ1 A;  2LCC A;  3QYH B;  1YIT T;  2MWO A;  4OGE A;  4HCB A;  3NTI A;  1VQL A;  1YHQ T;  4RMO A;  2RHY A;  1TH7 A;  5GMK l;  3QPH A;  2DAQ A;  3V7C A;  4XTV A;  4BD3 A;  2X4J A;  2YHT A;  1WQ7 A;  1MHN A;  5CAI A;  4QQD A;  2O01 E;  1UGR B;  3M9Q A;  2CYZ B;  4M78 F;  3JAM E;  4XAX B;  1Q7Y U;  4L6V 5;  1X75 C;  2JTF A;  4M7D A;  2L3R A;  5GAN e;  2CZ7 B;  2MAM A;  5J39 A;  1JJ2 A;  3OYE A;  2OTJ A;  4NS5 A;  4RCC A;  1P92 A;  3HP9 A;  4JUV A;  3RKY A;  3URG A;  3RKW A;  1B34 A;  4IUQ A;  2E1H A;  3BDU A;  4E7L A;  3CME T;  1R8O B;  2K4Y A;  3PGG A;  3ZFJ A;  5A0G A;  1K73 U;  2LTO A;  2XDD A;  2VXF A;  2FYK A;  3RUX A;  4M77 F;  2GFU A;  2RA2 A;  3GF5 A;  4J8O A;  2RD1 A;  2K5L A;  1RL2 A;  2E5Q A;  4JRK A;  3BW1 A;  1NPR A;  4XTX A;  2X4Y A;  5LJ3 h;  5LJ5 h;  1S72 T;  2FHD A;  2YRV A;  3VJP A;  5FRO A;  1KQS A;  2ZPI B;  3OW2 A;  4M7A E;  2KQW A;  2EWN A;  3G71 T;  1I5L A;  4OB2 B;  5IAY A;  3JCM X;  2DIG A;  3X28 B;  2ZZD A;  1LNX A;  4KUL A;  4PL6 A;  1JRI A;  1WJS A;  3ME9 A;  1I81 A;  5C6S A;  5GAN 7;  3CPW A;  4LDY A;  3OYJ A;  1M90 U;  1O75 A;  4C8Q E;  4R55 A;  1W4S A;  4TVR A;  1YJW A;  2A3L A;  1Y7X A;  5GMK j;  3VU3 C;  1M1G A;  2QDY B;  4C0D B;  4M77 A;  5CQY A;  2XU8 A;  2K57 A;  2YLC A;  3F70 A;  3SFM A;  4M78 B;  2KY9 A;  4OB0 B;  3I55 A;  3PNW C;  4M75 D;  1KQS S;  3EFS A;  3M55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...