4M78B

Crystal structure of lsm2-8 complex, space group p21
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
87
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 18
structure length 87
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78B00
4M7AF 5GMKh 3V8JA 4XQ3A 3JB9D 4N0AA 5LJ5j 5GANj 4M7AD 5LJ3f 4V2SA 4M78C 4C92B 4M75D 5GAN7 1LJOA 5GMKi 1D3BB 5GMKj 4NL2A 1B34A 4RCBA 5GAN2 4JRIA 3L1AA 4XTXA 4M78F 3JCMb 2DEQA 4F7UE 4J6XA 1N9RA 3HSBA 1BIAA 2EAYA 4DQ2A 4M77B 3V7CA 3QO3A 4X9CA 4EMKB 4EMKC 5GAMj 4HT8A 3GIBA 4F7UG 4X9DA 3V8LA 3BDUA 5GAMe 5GAN3 4PJOB 3QSUA 3BY7A 4M7AC 2JN0A 2CGHA 4M7AB 1HK9A 1WPYA 3V8KA 4C8QE 5LJ5g 3JCMc 1BIBA 5LJ5f 3JCMd 5GANg 2DTHA 4M75C 3JCMJ 3AHUA 3RERA 3JB9F 4NOYA 2DKGA 5DY9A 1KQ2A 4C8QG 2DVEA 3RKWA 5LJ3d 3JCMX 3EFRA 1U1SA 4M75F 4C92E 4C92A 5CAIA 3JCMe 4A54A 1D3BA 1N9SA 4M78B 3RKXA 4F7UF 1Y96B 4XU3A 4C92G 5GAMh 1LOJA 5GAN8 5GAMg 5GAOp 5GAOm 2VXFA 1JRIA 1I8FA 4M77E 4XTUA 4M77A 3RESA 3JB9J 4EMKA 5GANf 2RB6A 3JB9I 2E10A 2E64A 2YLCA 2DJZA 2Y90A 1KQ1A 2E1HA 2EJGA 4M77G 3V7SA 4PJOE 4PJOA 5I21A 2DXTA 1M5Q1 3JCMh 4PJOG 5LJ5d 3QUIA 5GANd 4M7AA 4M7DF 4J6WA 3JCMP 4NL3A 5GAN5 3BFMA 4M7AG 4M7DD 4MMKA 4M75B 3RUXA 3SB2A 2RD1A 3BW1A 4JRKA 4XU0A 5GMKm 4HT9A 5GAOl 3HFOA 4C8QD 4EMGA 1WQ7A 4XTVA 1I81A 4M78E 4M78A 1JBMA 2FYKA 1Y96A 5GAOr 3HFNA 1U1TA 3INZA 5LJ3j 4M78G 2QTXA 5GAMf 2DZ9A 4F7UB 5LJ3e 2K57A 4Y91A 2VC8A 1WQWA 2ZGWA 4HA8A 2EJ9A 3RIRA 3FIFA 1LNXA 3JCMV 1H641 3EFSA 4JUVA 2VXEA 3M4GA 1HXDA 4XU1A 2E65A 4M7DC 3L2ZA 4M7DB 5GMKl 4QVDA 3QHSA 1YCYA 2YLBA 2I2LA 3SWNC 3SWNB 4XTYA 3PGGA 2FB7A 3JCMf 4WF2A 4C8QC 3JCMg 4OP0A 3JCMQ 4M7AE 4PJOD 2EWNA 2DZCA 4J5YA 4M75E 3JB9G 4M75A 3JB9H 1M8VA 5LJ3h 4C8QF 4QVCA 5LJ3g 4N0AC 4M75G 2EJFA 4C92C 5GANe 5LJ5e 1I5LA 3FJPA 4MMLA 4XTZA 2E41A 4XU2A 5GAN6 2DTOA 4RCCA 2DXUA 4C92F 1X01A 1MGQA 1B34B 2HNIA 5GMKe 5GAMd 3RKYA 4F7UA 4M78D 4C92D 4M77C 3FB9A 4A53A 4EMHA 1WNLA 4JLIA 4J6YA 5GAOn 1TH7A 2DTIA 4M77F 1I4K1 4PJOC 3V7RA 4M7DE 4M7DA 4XTWA 4PNOA 2RA2A 4M77D 3SWNA 5GANh 5LJ5h 5GAN4 5GAOq 4M7DG 2YHTA 4C8QA 4PJOF 3JCMW 4C8QB 2RM4A 3VU3C
chains in the Genus database with same CATH superfamily
3ZL7C 1SSHA 4F14A 5C0MA 3A8MB 2L3RA 1VQPQ 2FZKB 2VGNA 5KCOA 3M5AA 2E4HA 3OYBA 2GFUA 2LQKA 2SEMA 2ZPFB 3RBBB 4HT8A 1Q7YC 2VASA 2LT1A 1X6GA 4R0KA 2EW3A 5LJ5f 3JSCA 3A8HB 3JCMc 4JS5A 1Y0MA 3L2UA 2QA4A 5LJ3d 3JCMX 4C92A 2DL4A 4BE0A 2ECZA 1OZ3A 2DFUA 5GAN8 1G3SA 2QAZA 3WVDB 4IIMA 4XTUA 2QA4T 1MMGA 2EJGA 3JV3A 1MNEA 4C5IA 1XJWB 3QYGB 4R55A 5KH6A 4PL6A 5GAN5 3PVQA 1DJ7B 3EFOA 2KYBA 5GAOl 4OB1B 4EMGA 2CP5A 1WQ7A 4M78E 1Y96A 2E70A 2ZPIB 4OB2B 3G71T 3MEWA 2DO3A 2DZ9A 3EHQA 4J7IA 1RAGB 2KYMA 2YT6A 3FIFA 3C95A 3JCMV 2CT4A 1H641 4J7FA 1K1ZA 4LD9K 1NPRA 1RAAB 2R58A 1QVPA 2ZAEA 4QQ6A 4C8QC 3UA6A 3ER0A 3THKA 2EWNA 3O8VA 2DIQA 4M75A 3JB9G 4JJNK 4KRTA 1T0JA 2EJFA 4C92C 4F17A 1IB8A 3OYJA 1GCQA 3LGFA 3CCLA 3CC4T 1X01A 5GAMd 2W10A 4J83A 1W2BS 3MP1A 1YBYA 1W70A 2BE9B 1Q81U 1ZSZB 2ABLA 4JLIA 2GQIA 3M0QA 3CCLT 3UF4A 2PTKA 2DLPA 5GAN4 4M7DG 2MCNA 3VU3C 2D8JA 2MWOA 1BI2A 3CXCS 1KHCA 2L3SA 5CKDA 3UPUA 5FU7C 5FU7B 2KT1A 1QQJA 1WJRA 2FZCB 5EG2A 2DF6A 1X43A 4M77B 4QT7A 4X9DA 3PT9A 2CP0A 1RAHB 3RMSA 4OB3B 4CRIA 2RQRA 2FEIA 2X3WD 3V8KA 5I2SA 3FJ5A 4M75C 3CMEA 3CPWS 4ZGJB 3Q1JA 1UFFA 3RKWA 1SEMA 2CKKA 3OYAA 4A54A 1R0BG 3NTHA 3E9GA 1AWOA 4C0DC 2MK5A 4C0ZA 3CMET 1PWTA 2LNVA 3GLXA 1FMVA 4LN2A 2E5QA 2OX7A 2QA4Q 4J9GA 2ESWA 1JJ2P 2H8HA 2VUBA 3EG1A 4KBMB 5GANd 4JJCA 2DRKA 1M90R 2BIVA 2PVGB 2Z0WA 1WHKA 1JJ2A 4D8KA 1ZUKA 5CQYA 2DYIA 1QWFA 4M78G 1UJ0A 2EYQA 2Y4YA 2EKOA 2K5FA 2V1RA 2ATCB 2VYTA 3TSWA 4JJDA 2JMCA 4CC7A 3KUFA 2HQXA 2XU8A 3EH1A 2QTVA 3H9NA 3M58A 4RCCA 2DXUA 3EGDA 3UDCA 1YN8A 1I07A 5KYUA 4A53A 2RQVA 1VA7A 2RA2A 1BI1A 3M4YA 3CCLQ 2DX1A 1Q95G 4DBRA 5FRMA 3KFVA 1XNIA 2KRNA 1OI1A 4A4EA 1Y7XA 1YITT 5CR2A 5CVIA 1KC8R 5ECAA 1YJ9A 3QO3A 2DL8A 3I5SA 3BY7A 1YJ9T 5LJ5g 5EC7A 2KRSA 1B7TA 2L0AA 2V26A 3AHUA 2OAWA 1I1JA 3OMGA 1O9SA 3TSZA 2JTEA 2WSFE 4HVWA 1OU9A 1YCSB 1WXBA 2HZYA 1I8FA 3CMEQ 2E10A 2E64A 2KE9A 3V7SA 3A5ZB 4XAXB 2JM9A 4E47A 5L8RE 1BYMA 2YRVA 1M90U 2OI3A 3SDZA 1K0XA 4ATOA 3MP6A 2O01E 3E19A 2BTTA 5KE3A 4BI8B 2QI2A 4J9EA 3C12A 1CKBA 1D0XA 1RACB 3BDLA 4PJJA 1JXOA 1WQWA 4HA8A 2EJ9A 3FEOA 4KUIA 4LUDA 4PJMA 4MDXA 3LH5A 3QPHA 1VQKA 1RADB 2FB7A 3D7SB 4WF2A 2AKLA 2F5TX 3U23A 2J06A 1D1AA 3C0CA 5LJ3h 2X51A 2XDBA 1RL2A 2YUOA 4E7JA 1I5LA 1IGQA 4RG2A 4MMLA 1ZX6A 2H3EB 1RLPC 1MGQA 1VQLA 2D8HA 3VRZA 3FB9A 4EMHA 1ABQA 8AT1B 3H0FA 4RUGA 4B9WA 2COZA 3DLMA 2P0KA 1V29B 3I5RA 2YRCA 2J6OA 3HP9A 4N0AA 4L59A 2LJ0A 1HYOA 2O2OA 2O88A 6AT1B 3X20B 2FVUA 1VQ6A 1ZLMA 4GLMA 1SSFA 2LC4A 4AT1B 3BE3A 1KC8U 4J6XA 3META 3V7CA 3GIBA 5I22A 2ED1A 1VQ6T 2FZGB 1HD3A 2OAUA 3QSUA 4M7AB 4M7AC 3M55A 1SHFA 1UGPB 2KNBB 2QQBA 3JB9F 4NOYA 3RERA 2EGCA 1YJ9Q 1CKAA 1E7OA 4B9XA 4M4ZA 4RTTA 3EFRA 4IURA 4GBQA 2FPEA 2AKKA 5FLXE 3OYLA 5GAMh 3H8ZA 5GAOp 5GAOm 3LH0A 5I2MA 4M77E 3JB9J 4YTLA 4E7HA 3PTAA 1UGQB 4E7LA 2GTOA 5I21A 2WSCE 1ZBJA 1M5Q1 4M7DF 2LRQA 5DLOA 4J6WA 1WFWA 5A0GA 8ATCB 2GF7A 4M7DD 4ZGDB 1AWWA 1AWJA 4HT9A 4DOVA 3OW2S 1D1CA 3QXEB 2J7IA 3INZA 1M1KU 1MV3A 2JTFA 2KRMA 1E6GA 4JLGA 2KEAA 2B8AA 5KYYB 2OTLA 1F1BB 3SWNC 3SWNB 1TS9A 1K8AR 4JJBA 1G3YA 2L3QA 2F2VA 4QVCA 2X35A 2X9HA 4L5GA 4II1A 2EYXA 4KT0E 3QWYA 1V76A 4A63B 1M2VB 2EYWA 1VQKQ 1PRMC 4FW1A 3CBPA 1N5ZA 2KY9A 1K9MR 1ZQ1A 3QYHB 4J6YA 4C5HA 4FYWB 1QCFA 4PLLA 2EIFA 1BK2A 2RF0A 2ZPGB 4HVVA 1LPLA 5GANh 2VB6A 1YIJT 2BE7D 1VQLQ 5HK3A 3IQLA 1M27C 2HSEB 1K9AA 3ASKA 2JNGA 2EYZA 3G4SA 1M9SA 3I35A 4JRIA 4M78F 4EMKB 4EMKC 3G4ST 2E3IA 5L23A 5HY6A 1HK9A 1VQ6Q 4ELZC 1VQPT 4XK8E 2H3JA 1U1SA 3JCMe 2RI3A 2MPXC 1RI9A 4FYYB 3OSVA 3CBMA 3OBYA 3X24B 1XQHA 2BZ8A 1D1BA 1M90C 3VS7A 4M77G 3GBQA 2QXFA 2VV5A 4PJOA 4IUVA 4RTYA 4Z8AA 4FT2A 2NUPB 4AFZC 1PG5B 5IXBA 1WDXA 2PVDB 1QLYA 2RI2A 4A4KA 2JXBA 3WXMB 4ZTFA 1KD1R 4A4FA 4F7UB 4OMNA 1RAEB 1I0CA 2QYZA 3KXTA 4N4IA 4QVDA 2EKHA 2R5AA 2I2LA 3CD6A 3EGUA 3JCMf 1LVKA 2ROLA 3JB9H 2DZCA 1K8AU 2M02A 5CKBA 2GBQA 3EGXA 2HMAA 2DM1A 3CD6T 2K6DA 3SEMA 2OTLQ 1UEBA 2DIGA 3CCEA 5KYXA 1YFNA 3HRSA 2G6FX 1SG5A 1OULA 1WZOA 5D6YA 3VKIA 2JJ9A 1G2BA 3L2WA 1K9MU 1IXDA 1VQ5A 4PJOC 5AT1B 3CCET 4ZTJA 3EH2A 1QWEA 4BB7A 1YNZA 1X69A 1Y71A 2LDMA 3GNGA 1VQ5T 2LX7A 5KCHA 5GANj 4OMLA 1KC8C 1OV3A 4J9FA 5GMKi 1W6XA 2VGMA 2SRCA 2D6FA 1KK7A 1WHGA 1WHJA 2COYA 3OYDA 4L6V5 1M3BA 2HL3A 1RUWA 3G4SQ 2A0FB 2PU9B 1BIBA 1BCOA 2DRMA 2Y4XA 1M1GA 1ZHIA 1TWBA 2EQJA 1S72A 1D3BA 3DKMA 2XK0A 5CKEA 2IG0A 3HTRA 1U5SA 1S72T 2E1HA 2L89A 2MOXA 1W2BP 5LJ5d 1AZGB 1M1KC 4AMCA 4Z89A 4BDZA 2VWFA 1C6VX 4E6RA 1W2BA 5D6WA 3ZEHA 2FRWA 4TVRA 1HSQA 4Z02A 2K57A 1KD1U 2ZZDA 2PQWA 2CYZB 3CXCP 3UA7A 1PSEA 3MP8A 2O4XB 1R77A 2CZ6B 4VUBA 1G83A 3X26B 4IUTA 2EGEA 2MF2A 4NS5A 5KYWA 3CXCA 4DEXA 1QKWA 2EBPA 4LE9A 2KMTA 1WJSA 3M0PA 4CC2A 1OYXA 1WIEA 4BY6C 1AT1B 2M9UA 5GMKe 3RKYA 4OGCA 3CD6Q 2V8IA 2WSEE 2C06A 1MMNA 1TH7A 3HRTA 2RQTA 3MO8A 4BI3A 1YJWA 2RO0A 1AWXA 2EFIA 2KGTA 4A4GA 3CPWA 3OYGA 3VYGA 2HKQB 3CCEQ 4C8QB 1KQSP 2YSQA 5D6XA 2NUTB 4C92B 2CSQA 1VQ5Q 2GTJA 3JCMb 1KQSA 3CMAA 1B07A 1BIAA 2ZPHB 2MYSA 2CREA 4BUGA 1RABB 3CMAT 3J80E 1VYTA 2CZ1B 2DKGA 2HSPA 3EFOB 2ED0A 5D7UA 3M0TA 2F5KA 5CAIA 3OB9A 1YP5A 4PJLA 5A0LA 4E7ZA 1Y96B 2O31A 4ORZA 3LLRA 2OTJA 1VUBA 3H41A 2ZPBB 3LW5E 1S72Q 2L3PA 1JEGA 2OTJT 5FWCA 4KH0B 4OVAA 4M7AG 4M75B 2M16A 4C8QD 1RAFB 1GCQC 3HFNA 4C0FA 1NJIC 4C0DB 1MHNA 3O5ZA 1NEGA 4PLIA 2RI5A 2CP6A 1K8AC 2KAFA 4XU1A 1U8RA 2RJFA 3OMCA 2KK4A 2NLUA 4BDYA 3JCMg 4MZPA 3FLGA 3OS5A 3JRZA 4QW2A 2MI6A 5IH2A 2DYBA 1T3SA 1ABOA 4HCCA 7AT1B 2DTOA 4LDYA 1K9MC 4DEYA 4FYVB 1QVGS 3OYCA 1RAIB 2HAXA 3WVEB 5GAOn 2RK2A 4M77F 1N8RR 4M77D 5GAOq 4OMMA 3QG1A 1R8OB 1AZEA 2YWWA 1PM3A 4M75D 5GAN7 1EFNA 1YJWQ 4RCBA 1Y57A 1NYFA 2L5QA 4J8OA 3HSBA 1OQKA 1PHTA 2M51A 3M57A 3CCJA 2XKOC 4RMOA 3J7AF 3PNWC 4B6MA 2JN0A 1UG1A 3SFMA 4GLKA 3ZBDA 3CCJT 1EX4A 1ZUYA 3JCMJ 3CMAQ 1YHQA 4CC3A 3OYIA 3HKSA 2GCXA 1OPLA 3MEAA 4Y28E 1LOJA 4UC4A 1H3HA 3X28B 1YHQT 1QP3A 3OYHA 1B3QA 2RJEA 2YLCA 2DJZA 3R6NA 2XD0A 3E1SA 4RTVA 2A08A 1QCOA 4QQDA 2OTJQ 3M56A 1KD1C 2JVVA 4DA4A 2FYKA 1NG2A 1U1TA 1JJ2S 5HCKA 3EGDB 2K4YA 2QQAA 3RIRA 5KYUB 4JZ3A 1WYXA 1G8XA 2LVMA 2E65A 3VUBA 1SF9A 1JQQA 1YCYA 4FSSA 1Q82R 3OYEA 2FHDA 5LJ3g 2EQKA 1FMKA 3MEUA 2DXCA 5IHIA 4XU2A 1PD0A 1M1KR 2HNIA 4IIOA 3GP8A 1Z9ZA 3TVTA 1AVZC 2DAQA 2X4JA 2WACA 2HL5C 2M0OA 1I4K1 4M7DA 3OYMA 2XG8D 3CPFA 1N8RU 5LJ5h 3G6EA 4MZTA 1G3WA 3MKDA 2K5LA 2RM4A 3TCJA 3CCQA 4FSXA 2IPOB 4HVUA 2LNHB 1SRMA 2QEXA 3VS2A 1H8KA 3G6ET 1BKBA 3VV0A 1VQKT 1B34A 4RKUE 3DB3A 1BI3A 1NZ9A 3X25B 2YUPA 2M1HA 2R5MA 2IIMA 2AIRB 1VQLT 1I5OB 2LJ1A 3PMIA 1ZA2B 4C8QE 4O6JA 5M9OA 2DTHA 1MNDA 4D6WA 2JS0A 3F70A 3CCJQ 2D1XA 4C92E 3QJYA 2L8DA 2NYSA 1TOVA 3UT1A 4PJNA 5GAMg 2DERA 1BBZA 2JUFA 2RNAA 5IAYA 5IT9E 3JB9I 1ZUUA 1R0CB 2X4YA 1YHQQ 2CS7A 3MPUB 5KE2A 1ZBXA 3MEVA 4IKFA 1C1AA 1YWPA 1GFDA 1YJNA 3TQ7P 4R56A 4M78A 4LXCA 3VS5A 4PKCC 1MUZA 3PIPA 2FRYA 3VRYA 2RQUA 1PC0A 1TUCA 1WJQA 3MJXA 5FU6C 2K2VA 2KROA 1IGUA 1WXTA 1VQNA 3QZ5B 1X6BA 3AT1B 3EG9B 1D0ZA 4HCZA 1VQ8A 4F04B 4M75E 1Q82U 4HCBA 2DPPB 3NTIA 3P8DA 1VQNT 4N0AC 2DETA 4FYXB 1G3TA 1M3AA 1M2VA 1TUGB 3T9NA 2LZ6B 3S3OA 4RTWA 3LX7A 3CQTA 5A2QE 2F2XA 1K4US 1PSFA 5FRNA 3OA6A 4N4GA 2QGFB 2DTIA 2PUOB 2QDLA 3V7RA 2CP2A 1NJIR 4Q5WA 1GBQA 2RK1A 2LT4A 2YHTA 4JZ4A 4QVZA 4M7AF 5LJ5j 4M7AD 2OTLT 2W0ZA 1U3OA 4ANJA 4M78C 3OS0A 3I55A 2JTMA 2DD4A 4NL2A 1MMDA 3G6EQ 3PIOA 1VQOA 3CCQQ 1GL5A 1VIFA 2HBWA 2V8JA 1D0YA 2QEXQ 2JW4A 2DK3A 4PK4A 4DBFA 4BACA 2CUBA 1GXIE 3JAME 1KQ2A 4C8QG 2KXDA 1S1NA 3H6ZA 2XICA 4C92G 1UDLA 2K7AA 1PD1A 2A7YA 2F2WA 3CCVA 2DL3A 1E6HA 1NM7A 3GOXA 2RJCA 4E7SA 3PE0A 2C0TA 3CCVT 4Y92A 5CKFA 3RUXA 4F16A 2LTOA 3CCUA 2DL7A 1RI0A 2XDDA 1SPKA 1WI7A 1QKXA 2MAMA 3OBWA 3VYHB 5DM7R 1M30A 2C0IA 1VQMQ 2VC8A 4HCKA 3L42A 4JUVA 1YJNQ 3M4GA 2JT4A 3L2ZA 2FO0A 1VYVA 5CIUA 4IUPA 4M75G 2NUZA 2PVOB 3ZFJA 1PNJA 2OJ2A 1VQNQ 2E12A 3C4SA 1QVFP 1FXXA 4FT4A 3OY9A 1N8RC 1VQ8Q 3A8GB 1OU8A 3N5BB 2K3BA 2CUDA 1WGSA 1NJIU 1QVFA 2BUDA 4E7KA 3JCMW 2RQWA 3TU4K 2BKDN 5DLQE 3V8JA 4XQ3A 2MMPA 2J6KA 1PKSA 3QKJA 5FROA 4ZGEB 5C6SA 5GAN2 2P84A 4XTXA 4KGXB 2ENMA 3C94A 2CDTA 1TSFA 1N9RA 3G7ZA 2EAYA 3M0SA 2HD0A 4X9CA 2P4RA 1FWZA 4PJOB 2ZPEB 1OX8A 3I55Q 2RHXA 4RG8A 1VQOQ 5CK9A 2NWMA 4FL6A 3I56A 4D8DA 1N27A 1BCMA 3A8LB 3S6WA 1JRIA 3I56T 4ESRA 2P0QA 4F7UF 4CC4B 3M0RA 1JB0E 4OMQA 3SD4A 3REAB 4BE2A 3CCMA 3QUIA 4DBQA 2E3HA 1OEBA 1VQ9A 1X2QA 3CC2A 4E2FB 4JRKA 3VS6A 3CCVQ 4RTUA 5FW9A 4JDSA 3CCSA 3M53A 1IZ6A 3PMTA 1VQ9T 2QTXA 5LJ3e 1WX6A 1WXUA 1LNXA 3CCST 1Q82C 2RH2A 3EFSA 3CCUQ 2VXEA 2A36A 3OYKA 4A4HA 1RLQC 4K11A 2EQIA 1BI0A 3EG2A 4M7AE 3PGGA 2QQ9A 4OP0A 1UECA 4PJOD 4J5YA 3OYFA 2YXYA 4QQGA 2COWA 1WA7A 4C5EA 3EG0A 3VS3A 1N6AA 1WNLA 2RPNA 3S3NA 1IHWA 2KT8A 3VUZA 2J05A 4C8QA 5CO7A 4FCYA 4AG1C 2HBPA 2YUQA 1YWOA 3QZ9B 2RHIA 3ULRB 4QKUA 2NUTA 4ELYC 5LJ3f 5IHNA 4ZN3A 1JU5C 2XIDA 5CQXA 1LJOA 1D3BB 5IN1A 4BY6B 2DVJA 3CPWP 1ZSZA 1TTHB 1VIEA 3V8LA 5GAMe 3QDRB 2A37A 2CGHA 3QWXX 3G71A 1AHJB 4MZMA 4AFSC 1YJWT 1VQ7Q 2GQVA 3RKXA 3KBGA 3LWIA 5GJVB 2LP5A 1W1FA 4M77A 2PZ1A 3RESA 3L2QA 2DBMA 1T3LA 1KQ1A 2LQWA 2MIOA 1TG0A 1Y07A 3I56Q 1KHIA 3HRUA 3VJPA 1QVGP 2DXTA 3GPLA 5KYWB 3CC4A 3JCMP 1U06A 1SHGA 3SB2A 1K73U 3BW1A 1WHHA 2IVWA 3VS4A 4XTVA 1QVGA 3H0HA 1KSWA 3G1JA 2AZSA 3GNFB 3CCMQ 5GAMf 1M4ZA 1ZSZC 2ZGWA 1VQ9Q 3CC2Q 2DBKA 2EQUA 1NLPC 5GMKl 3HPWA 3CCSQ 3NHNA 1OPKA 2CP3A 1GRIA 2FG0A 4FM4B 4X1VA 1UGRB 4C8QF 2RHZA 5I11A 5GANe 3NGPA 4C92F 2E5KA 4WCIA 4C92D 1M1FA 2J6FA 4M77C 4RTZA 2HKNA 1P92A 4ZN1A 4XTWA 3ME9A 3RMQA 3CCRA 1QW1A 4PFZA 1MMAA 2P0PA 2A3LA 1Q86C 2A28A 1A0NB 5KYNA 1AD5A 3CCRT 2HQHA 4BD3A 2DEQA 4F7UE 3S3MA 1X27A 1YI2A 1KQSS 3FC3A 3L2RA 1AOJA 5GANf 1WPYA 5CCAA 1YI2T 1H3ZA 5AYFA 4DOWA 3PVLA 4GY5A 5HK0A 3FDRA 2D0NA 2R57A 4M75F 4PFOA 3TREA 3UATA 4PFPA 1M8VA 3G71Q 2RB6A 2Y90A 3CBOA 2LQNA 4PJOE 2EVRA 5LL6S 3JCMh 2YDLA 2FPFA 2QG9B 1HJDA 2RD1A 4JPBW 2MWPA 1NEBA 3QJ6A 1JXMA 4AG2C 3CC4Q 1IREB 4J9BA 3DB4A 4Z88A 2X4XA 2DJQA 3DLLA 3QHSA 1MV0B 1YITA 3JCMQ 3LGLA 1ACMB 1NYGA 3QBYA 2CH4W 2HEQA 3FJPA 5GAN6 1ZA1B 2KI7A 4KGZB 2F69A 3HHTB 3GF5A 2E6NA 2K3XA 4PNOA 3LYIA 4X34A 2PUKB 3OYYA 2LCCA 4EIKA 2DE0X 3M59A 2EPDA 5J3BA 1OZ2A 4BI4A 1KFZA 3OS2A 4JS4A 2KDSA 2JM8A 2LJ3A 2XMFA 1SRLA 4WTOB 2KR3A 1UGSB 3CCRQ 1VQ4A 2KQWA 3UWNA 4HKEA 4DQ2A 3M0UA 2V8KA 4F7UG 2DNUA 3VS1A 3BDUA 4LDUA 2DEUA 1VQ4T 1JO8A 1Q7YR 1PRLC 2G3RA 4FW2A 2ZCFB 2CT3A 1GBRA 2K2MA 3OQ5A 3L2VA 1YI2Q 1X2KA 1UTIA 4RTXA 2LX9A 4XU3A 2QQSA 3RR6A 2AK5A 4OMPA 3CCQT 4P5NA 1VYUA 3OW2P 2K79A 2QEXT 2B86A 1FMWA 1K73C 4FU6A 1BU1A 2QASA 4M7AA 4PJOG 4JRQA 3H0IA 4NL3A 3OW2A 4XU0A 1Q81C 3HFOA 2D0QB 3A1PA 1I81A 2EQMA 1JBMA 4J9HA 2DD5A 1O75A 3A8OB 2K9GA 1ZSGA 5GJWB 2DXBA 1HXDA 4M7DC 4M7DB 4MDWA 3EG9A 5J26A 2P4TA 3I9QA 2K3YA 2DILA 4XTYA 1VQMA 2LCSA 3MCAB 5J39A 2QQRA 1EZZB 4BE1A 2BZXA 4KGVB 5IHKA 1VQMT 1B34B 2I0NA 3QIIA 1YITQ 2X3XD 1Z9QA 1YJNT 5KYYA 5FU6B 9ATCB 2HQEA 1V1CA 2KVQG 3A98A 3SWNA 3NPFA 5GMKh 3JB9D 2LMJA 4V2SA 1C0MA 2BZYA 2XHCA 4JRPA 1VQ8T 3L1AA 1H92A 2JOYA 2K5IA 3CC7A 4OB0B 2JZ2A 4IUUA 2FL7A 5GAN3 1FYNA 1D09B 5GANg 1Q7YU 3M9QA 3CC7T 2CSIA 2FPDA 1VQ4Q 2LQ8A 2X4WA 4N4HA 2KXCA 3LWHA 1N9SA 1TXQA 4M78B 2GFAA 1WLPB 1Q86R 2VXFA 3VS0A 5IXFA 2AZVA 4O5VA 4EMKA 2O9SA 1CSKA 2L2PA 3EAEA 2CH4A 1KIKA 3I55T 1UGVA 1W4SA 1IRXA 2QGGA 1VQOT 1K0SA 2RN8A 5GMKm 2C0OA 1XTDA 3REBB 1X75C 2AT1B 1WHLA 1AEYA 3MHXA 5LJ3j 4KUDK 1QCNA 1YIJA 1NLOC 4IUQA 3R6OA 4LNPA 2VKNA 1T0HA 1WHMA 2CZ0B 1TUDA 3URGA 5FWBA 2YLBA 2NUPA 2GNCA 1QMCA 1K76A 4EDUA 4DBHA 3QDFA 1KJWA 2QDYB 2YRDA 3RNJA 2XDPA 4F7UA 1UHCA 4M78D 4AFUC 3NMZC 1G5VA 2M0YA 3CCUT 5CKHA 1VQPA 2E6ZA 2HCKA 3SHWA 1X6OA 3E9FA 1IO6A 4C5GA 1SKUB 2CZ7B 1J3TA 1TU0B 2O9VA 1UJYA 2YUNA 2RHUA 4EPCA 1IHVA 3RDVA 1GCPA 5GMKj 2GGRA 4FIBA 4C0GA 3HL8A 3E2UA 2QK0A 4OMFB 2DL5A 5GAMj 4AFQC 3NFCA 1KG1A 2RHYA 4ZNXA 2KBTA 3JCMd 1NBEB 4CI0C 5A0DA 5DY9A 2DVEA 4E7IA 4KULA 3CC7Q 1M3CA 1XOVA 1BB9A 2HDAA 1VOMA 3EG3A 1OX9A 3M54A 1LCKA 1Q86U 3FRNA 1M8MA 1ARKA 1VQ7A 2ROTA 1FX7A 4J9CA 2LCLA 1PCXA 3OS1A 1GFCA 1OOTA 4HXJA 2JMAA 2V1QA 3BFMA 4LDWA 3PFSA 3CEYA 4MMKA 4LDVA 1VQ7T 2F1LA 2D9TA 2RMOA 4KH1B 5GAOr 2JS2A 4Y91A 5HKCA 2AHJB 4J9IA 2CP7A 2EGAA 4ME7A 1UHFA 2EYYA 1EIFA 2DMOA 4LUEA 1YIJQ 1NE8A 1K73R 4J9DA 4OGEA 1NPPA 3J81E 2DA9A 2RJDA 3EHRA 3EGXB 5LJ5e 4XTZA 3CCMT 1UUEA 2E41A 3P8BB 2VVKA 3CC2T 2XI9A 5KYXB 1Q81R 4LD6A 1QP2A 2O4XA 1PKTA 4OF1A 3OYNA 3NTKA 4OMOA 1M2OA 2KSSA 4M7DE 1UB4A 3P8HA 1UE9A 3OSSC 3TEEA 4LDXA 4PJOF 2PNIA 1QVFS
chains in the Genus database with same CATH topology
2A3LA 3TCJA 5C0MA 5HK3A 3A8MB 2L3RA 4FSXA 3OYNA 3CCQA 1Q86C 3ASKA 2JNGA 2QEXA 3G6ET 1BKBA 3VV0A 2VGNA 3CCRT 3G4SA 5KCOA 3M5AA 1M9SA 1VQKT 4BD3A 1B34A 4RKUE 3OYBA 4JRIA 4M78F 2GFUA 3DB3A 1BI3A 2DEQA 2LQKA 4F7UE 1NZ9A 3X25B 3S3MA 2ZPFB 4EMKB 4EMKC 1YI2A 2M1HA 2R5MA 1Q7YC 1KQSS 4HT8A 3FC3A 2LT1A 3G4ST 1VQLT 5HY6A 3L2RA 3PMIA 5GANf 1HK9A 1WPYA 5LJ5f 4C8QE 5CCAA 3JSCA 3A8HB 3JCMc 4JS5A 4O6JA 5M9OA 2DTHA 4ELZC 5AYFA 1YI2T 1VQPT 1H3ZA 4XK8E 4DOWA 2H3JA 4D6WA 3L2UA 4GY5A 5LJ3d 5HK0A 3JCMX 3F70A 3FDRA 2R57A 1U1SA 4M75F 4C92E 4C92A 3JCMe 4BE0A 2RI3A 3QJYA 2L8DA 1OZ3A 3UT1A 3OSVA 5GAN8 1G3SA 5GAMg 3CBMA 3OBYA 2JUFA 3WVDB 3TREA 1M8VA 3X24B 1XQHA 4XTUA 5IAYA 2QA4T 5IT9E 2RB6A 3JB9I 2Y90A 1M90C 2X4YA 3CBOA 2EJGA 4M77G 2CS7A 4C5IA 2QXFA 2VV5A 3QYGB 4PJOA 4IUVA 4PJOE 5LL6S 5KE2A 4FT2A 1ZBXA 3MEVA 3JCMh 5KH6A 4R55A 4PL6A 5GAN5 4IKFA 1DJ7B 2RD1A 5GAOl 4OB1B 1YJNA 2PVDB 2MWPA 4EMGA 1WQ7A 4R56A 2RI2A 4M78E 4A4KA 4M78A 1Y96A 4PKCC 2E70A 3PIPA 3QJ6A 2ZPIB 4OB2B 3WXMB 3G71T 4ZTFA 3MEWA 2DO3A 2DZ9A 4A4FA 4F7UB 4J7IA 1WJQA 5FU6C 3FIFA 2K2VA 1IREB 3C95A 3JCMV 1H641 3KXTA 3DB4A 4N4IA 2X4XA 4J7FA 4LD9K 1VQNA 3DLLA 1NPRA 4QVDA 3QZ5B 3QHSA 2R5AA 2R58A 2I2LA 1QVPA 3CD6A 1YITA 4HCZA 1VQ8A 4QQ6A 3JCMf 4C8QC 3JCMQ 3ER0A 3LGLA 2EWNA 2DZCA 3O8VA 4M75E 2DIQA 4M75A 3JB9G 1Q82U 3JB9H 4JJNK 1K8AU 4HCBA 5CKBA 2DPPB 3NTIA 3P8DA 1VQNT 3QBYA 4N0AC 2EJFA 4C92C 1G3TA 3FJPA 3CD6T 3T9NA 3OYJA 3LGFA 5GAN6 3CCLA 3S3OA 3CC4T 1X01A 1UEBA 2DIGA 5GAMd 3LX7A 4J83A 3CCEA 5A2QE 1W2BS 3MP1A 1YBYA 3HRSA 2F69A 3HHTB 1PSFA 3GF5A 5D6YA 3VKIA 1Q81U 3OA6A 5FRNA 4JLIA 4N4GA 2E6NA 3L2WA 2DTIA 2PUOB 3CCLT 1K9MU 1VQ5A 3V7RA 2K3XA 4PJOC 4PNOA 3LYIA 4Q5WA 4X34A 2RK1A 2PUKB 4ZTJA 3CCET 2LT4A 4BB7A 5GAN4 3OYYA 2LCCA 2YHTA 4M7DG 3M59A 1Y71A 2LDMA 3GNGA 4QVZA 5J3BA 3VU3C 4M7AF 2MWOA 1OZ2A 1VQ5T 1BI2A 4BI4A 5KCHA 1KHCA 3CXCS 5LJ5j 5GANj 1KC8C 4M7AD 5CKDA 2OTLT 4M78C 3OS0A 3I55A 2JTMA 3OS2A 2DD4A 3UPUA 5GMKi 4JS4A 5FU7C 5FU7B 4NL2A 2KDSA 2VGMA 2D6FA 1WJRA 3PIOA 1VQOA 5EG2A 1UGSB 1VQ4A 3OYDA 2KQWA 3UWNA 4HKEA 4DQ2A 4L6V5 4M77B 2V8KA 4F7UG 4X9DA 1VIFA 3PT9A 3BDUA 3RMSA 4OB3B 2V8JA 4LDUA 4CRIA 2DK3A 1VQ4T 3V8KA 2PU9B 5I2SA 1BIBA 2G3RA 4BACA 2ZCFB 4M75C 3CMEA 1GXIE 2Y4XA 3CPWS 3OQ5A 1M1GA 3Q1JA 4C8QG 4ZGJB 3JAME 1ZHIA 1KQ2A 3L2VA 3RKWA 2CKKA 3OYAA 2EQJA 1S72A 3H6ZA 4A54A 1D3BA 3DKMA 2XK0A 3NTHA 2XICA 3E9GA 2IG0A 5CKEA 2LX9A 4XU3A 4C0DC 4C92G 4C0ZA 3CMET 2QQSA 3GLXA 2LNVA 3CCQT 2A7YA 4P5NA 2E5QA 3CCVA 1S72T 2E1HA 2L89A 2QEXT 1K73C 4FU6A 3GOXA 2RJCA 2VUBA 4KBMB 4M7AA 5GANd 4PJOG 5LJ5d 4JRQA 4NL3A 3CCVT 2BIVA 5CKFA 1M1KC 3RUXA 3OW2A 4BDZA 2PVGB 4XU0A 2LTOA 3CCUA 1Q81C 3HFOA 2D0QB 1RI0A 1JJ2A 1I81A 2EQMA 1JBMA 2XDDA 1W2BA 5CQYA 5D6WA 3ZEHA 2MAMA 3OBWA 3VYHB 4TVRA 4M78G 5DM7R 2DD5A 2EYQA 2K57A 2Y4YA 2EKOA 2PQWA 2CYZB 2VC8A 1O75A 2ZZDA 2K5FA 3A8OB 1PSEA 3MP8A 2O4XB 2CZ6B 3L42A 2VYTA 4VUBA 2DXBA 4JUVA 3M4GA 1HXDA 4IUTA 3X26B 4M7DC 3L2ZA 4M7DB 4MDWA 5J26A 2MF2A 2P4TA 4NS5A 2K3YA 4XTYA 3CXCA 3KUFA 1VQMA 3MCAB 5CIUA 4IUPA 2HQXA 2XU8A 5J39A 2KMTA 4M75G 1WJSA 2QQRA 4BE1A 3M58A 2PVOB 1OYXA 3ZFJA 4RCCA 2E12A 2DXUA 4BY6C 3C4SA 2M9UA 1VQMT 1B34B 5GMKe 3RKYA 1FXXA 4FT4A 4OGCA 3QIIA 3UDCA 3OY9A 1N8RC 2V8IA 2WSEE 3A8GB 2C06A 3N5BB 1YJNT 4A53A 5FU6B 2HQEA 1TH7A 1WGSA 3HRTA 3MO8A 2KVQG 4BI3A 2RA2A 1BI1A 1YJWA 3M4YA 1NJIU 2RO0A 3SWNA 1QVFA 2BUDA 2EFIA 4A4GA 3CPWA 4E7KA 3JCMW 3OYGA 3VYGA 3TU4K 4C8QB 2BKDN 5GMKh 5DLQE 3V8JA 4XQ3A 2MMPA 3JB9D 5FRMA 1XNIA 4V2SA 5D6XA 1OI1A 4C92B 4A4EA 2XHCA 3QKJA 4JRPA 1Y7XA 5FROA 4ZGEB 5CVIA 5C6SA 5CR2A 5GAN2 1YITT 1VQ8T 3L1AA 4XTXA 3JCMb 1KQSA 3C94A 3CMAA 1N9RA 1YJ9A 1BIAA 2EAYA 2JOYA 3G7ZA 2HD0A 3QO3A 4X9CA 2K5IA 3CC7A 4OB0B 5LJ3g 2ZPHB 1FWZA 2JZ2A 4IUUA 2FL7A 4BUGA 2ZPEB 5GAN3 4PJOB 2RHXA 3BY7A 4RG8A 3CMAT 1YJ9T 3J80E 5GANg 5LJ5g 1Q7YU 3M9QA 3CC7T 3AHUA 5CK9A 3OMGA 2DKGA 1O9SA 2CZ1B 4FL6A 3I56A 2LQ8A 2X4WA 4N4HA 2WSFE 3LWHA 1N27A 2F5KA 5CAIA 3OB9A 3A8LB 1N9SA 4M78B 5A0LA 1Y96B 3S6WA 2GFAA 2VXFA 1JRIA 1I8FA 3I56T 4O5VA 3LLRA 2OTJA 4EMKA 1VUBA 2E10A 2E64A 2P0QA 3EAEA 4F7UF 2ZPBB 3V7SA 3I55T 3LW5E 3A5ZB 1W4SA 1JB0E 3SD4A 4XAXB 4BE2A 3CCMA 4E47A 5L8RE 1VQOT 3QUIA 2OTJT 1BYMA 4OVAA 2YRVA 1M90U 4M7AG 1VQ9A 3CC2A 4M75B 3SDZA 2M16A 4JRKA 5GMKm 4ATOA 3MP6A 1XTDA 2O01E 1X75C 3E19A 4C8QD 5KE3A 4BI8B 2QI2A 4JDSA 3CCSA 3M53A 3MHXA 3C12A 3HFNA 5LJ3j 1IZ6A 4C0FA 3BDLA 3PMTA 1VQ9T 1NJIC 2QTXA 4C0DB 4KUDK 1MHNA 5LJ3e 1YIJA 4IUQA 3R6OA 1WQWA 4HA8A 4PLIA 2EJ9A 2RI5A 1LNXA 3FEOA 3CCST 1Q82C 2RH2A 3EFSA 2CZ0B 2KAFA 2VXEA 4KUIA 4XU1A 3OYKA 1K8AC 3URGA 1U8RA 2RJFA 4A4HA 3OMCA 4MDXA 2KK4A 2YLBA 2NLUA 1BI0A 3QPHA 4BDYA 1VQKA 4M7AE 3PGGA 2FB7A 2QQ9A 4WF2A 3JCMg 4OP0A 4PJOD 4EDUA 2F5TX 3FLGA 4J5YA 4MZPA 3OS5A 3OYFA 3JRZA 4QW2A 5LJ3h 2MI6A 4QQGA 1KD1U 1RL2A 2XDBA 4E7JA 1I5LA 4RG2A 4C5EA 4MMLA 4HCCA 2DTOA 4LDYA 1K9MC 2QDYB 1MGQA 1VQLA 2XDPA 1QVGS 4F7UA 4M78D 3OYCA 1G5VA 3CCUT 5CKHA 3FB9A 1VQPA 2HAXA 1N6AA 2E6ZA 1WNLA 3WVEB 4EMHA 5GAOn 3S3NA 2RK2A 1X6OA 4M77F 3E9FA 3VUZA 4M77D 4C5GA 2CZ7B 4B9WA 5GAOq 4C8QA 3DLMA 5CO7A 2P0KA 3QG1A 1V29B 2HBPA 3QZ9B 2RHIA 1R8OB 2RHUA 3HP9A 4N0AA 4ELYC 4EPCA 5LJ3f 4L59A 4ZN3A 2XIDA 4M75D 5CQXA 5GAN7 1LJOA 1D3BB 5GMKj 5IN1A 3X20B 2FVUA 4FIBA 4RCBA 1VQ6A 4BY6B 1SSFA 2LC4A 3HL8A 4C0GA 1KC8U 2L5QA 4J6XA 4J8OA 3HSBA 3META 4OMFB 3V7CA 3GIBA 3M57A 5GAMj 3CCJA 2XKOC 1VIEA 3V8LA 4RMOA 3PNWC 3J7AF 5GAMe 1VQ6T 3QDRB 2OAUA 3NFCA 3QSUA 1KG1A 2JN0A 2RHYA 2CGHA 4M7AB 3SFMA 4GLKA 4M7AC 3M55A 3ZBDA 3JCMd 3G71A 4CI0C 3CCJT 1AHJB 1UGPB 4MZMA 3JCMJ 3RERA 2QQBA 3JB9F 4NOYA 4Z02A 5DY9A 5A0DA 1YHQA 2DVEA 4B9XA 4E7IA 4KULA 3EFRA 4IURA 3HKSA 3OYIA 1YJWT 1XOVA 2GCXA 2GQVA 3MEAA 3RKXA 5FLXE 3OYLA 4Y28E 5GAMh 1LOJA 3H8ZA 3M54A 4UC4A 3X28B 3KBGA 5GAOp 5GAOm 3LWIA 1YHQT 3LH0A 1Q86U 1QP3A 5I2MA 4M77E 4M77A 3RESA 4YTLA 3OYHA 3L2QA 3JB9J 2RJEA 3FRNA 4E7HA 2YLCA 2DJZA 3PTAA 1KQ1A 2QA4A 1Y07A 1VQ7A 1KHIA 2XD0A 3HRUA 3VJPA 1FX7A 1UGQB 4E7LA 2LCLA 3E1SA 2WSCE 5I21A 3OS1A 2DXTA 1M5Q1 3GPLA 4M7DF 2LRQA 5DLOA 4J6WA 3JCMP 3CC4A 5A0GA 4LDWA 3BFMA 4QQDA 2GF7A 3PFSA 3CEYA 4ZGDB 4MMKA 4M7DD 3SB2A 4LDVA 1K73U 3BW1A 1VQ7T 4HT9A 4DOVA 3M56A 1KD1C 2JVVA 2IVWA 3OW2S 4XTVA 4DA4A 1QVGA 2D9TA 3QXEB 2FYKA 5GAOr 1U1TA 3INZA 1JJ2S 3GNFB 1M1KU 5GAMf 2JTFA 4Y91A 1M4ZA 2K4YA 5HKCA 2QQAA 2AHJB 2ZGWA 3RIRA 4JLGA 2B8AA 2LVMA 4ME7A 2OTLA 2E65A 3VUBA 2EQUA 5GMKl 3HPWA 1YCYA 1EIFA 3SWNC 3SWNB 3OYEA 4FM4B 1G3YA 1NE8A 1UGRB 4C8QF 2FHDA 1NPPA 2X35A 2RHZA 4II1A 4L5GA 4OGEA 2RJDA 4QVCA 2EQKA 4KT0E 5GANe 3MEUA 2DXCA 5LJ5e 4XTZA 3CCMT 2E41A 4XU2A 3P8BB 4C92F 2HNIA 3GP8A 2P0PA 4C92D 3CC2T 1M1FA 2XI9A 4M77C 3CBPA 1QP2A 2KY9A 2O4XA 2DAQA 4LD6A 2X4JA 4OF1A 1ZQ1A 2WACA 3NTKA 1P92A 3QYHB 4J6YA 3J81E 4C5HA 4ZN1A 2M0OA 1I4K1 2KSSA 4PLLA 4M7DE 4M7DA 4XTWA 2EIFA 3OYMA 1UB4A 2XG8D 3ME9A 2ZPGB 3CPFA 3P8HA 3RMQA 1N8RU 5GANh 5LJ5h 3G6EA 3OSSC 3TEEA 4MZTA 4LDXA 1G3WA 4PJOF 3CCRA 1YIJT 1QW1A 2K5LA 1QVFS 2RM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A F;  5GMK h;  3V8J A;  4XQ3 A;  3JB9 D;  4N0A A;  5LJ5 j;  5GAN j;  4M7A D;  5LJ3 f;  4V2S A;  4M78 C;  4C92 B;  4M75 D;  5GAN 7;  1LJO A;  5GMK i;  1D3B B;  5GMK j;  4NL2 A;  1B34 A;  4RCB A;  5GAN 2;  4JRI A;  3L1A A;  4XTX A;  4M78 F;  3JCM b;  2DEQ A;  4F7U E;  4J6X A;  1N9R A;  3HSB A;  1BIA A;  2EAY A;  4DQ2 A;  4M77 B;  3V7C A;  3QO3 A;  4X9C A;  4EMK B;  4EMK C;  5GAM j;  4HT8 A;  3GIB A;  4F7U G;  4X9D A;  3V8L A;  3BDU A;  5GAM e;  5GAN 3;  4PJO B;  3QSU A;  3BY7 A;  4M7A C;  2JN0 A;  2CGH A;  4M7A B;  1HK9 A;  1WPY A;  3V8K A;  4C8Q E;  5LJ5 g;  3JCM c;  1BIB A;  5LJ5 f;  3JCM d;  5GAN g;  2DTH A;  4M75 C;  3JCM J;  3AHU A;  3RER A;  3JB9 F;  4NOY A;  2DKG A;  5DY9 A;  1KQ2 A;  4C8Q G;  2DVE A;  3RKW A;  5LJ3 d;  3JCM X;  3EFR A;  1U1S A;  4M75 F;  4C92 E;  4C92 A;  5CAI A;  3JCM e;  4A54 A;  1D3B A;  1N9S A;  4M78 B;  3RKX A;  4F7U F;  1Y96 B;  4XU3 A;  4C92 G;  5GAM h;  1LOJ A;  5GAN 8;  5GAM g;  5GAO p;  5GAO m;  2VXF A;  1JRI A;  1I8F A;  4M77 E;  4XTU A;  4M77 A;  3RES A;  3JB9 J;  4EMK A;  5GAN f;  2RB6 A;  3JB9 I;  2E10 A;  2E64 A;  2YLC A;  2DJZ A;  2Y90 A;  1KQ1 A;  2E1H A;  2EJG A;  4M77 G;  3V7S A;  4PJO E;  4PJO A;  5I21 A;  2DXT A;  1M5Q 1;  3JCM h;  4PJO G;  5LJ5 d;  3QUI A;  5GAN d;  4M7A A;  4M7D F;  4J6W A;  3JCM P;  4NL3 A;  5GAN 5;  3BFM A;  4M7A G;  4M7D D;  4MMK A;  4M75 B;  3RUX A;  3SB2 A;  2RD1 A;  3BW1 A;  4JRK A;  4XU0 A;  5GMK m;  4HT9 A;  5GAO l;  3HFO A;  4C8Q D;  4EMG A;  1WQ7 A;  4XTV A;  1I81 A;  4M78 E;  4M78 A;  1JBM A;  2FYK A;  1Y96 A;  5GAO r;  3HFN A;  1U1T A;  3INZ A;  5LJ3 j;  4M78 G;  2QTX A;  5GAM f;  2DZ9 A;  4F7U B;  5LJ3 e;  2K57 A;  4Y91 A;  2VC8 A;  1WQW A;  2ZGW A;  4HA8 A;  2EJ9 A;  3RIR A;  3FIF A;  1LNX A;  3JCM V;  1H64 1;  3EFS A;  4JUV A;  2VXE A;  3M4G A;  1HXD A;  4XU1 A;  2E65 A;  4M7D C;  3L2Z A;  4M7D B;  5GMK l;  4QVD A;  3QHS A;  1YCY A;  2YLB A;  2I2L A;  3SWN C;  3SWN B;  4XTY A;  3PGG A;  2FB7 A;  3JCM f;  4WF2 A;  4C8Q C;  3JCM g;  4OP0 A;  3JCM Q;  4M7A E;  4PJO D;  2EWN A;  2DZC A;  4J5Y A;  4M75 E;  3JB9 G;  4M75 A;  3JB9 H;  1M8V A;  5LJ3 h;  4C8Q F;  4QVC A;  5LJ3 g;  4N0A C;  4M75 G;  2EJF A;  4C92 C;  5GAN e;  5LJ5 e;  1I5L A;  3FJP A;  4MML A;  4XTZ A;  2E41 A;  4XU2 A;  5GAN 6;  2DTO A;  4RCC A;  2DXU A;  4C92 F;  1X01 A;  1MGQ A;  1B34 B;  2HNI A;  5GMK e;  5GAM d;  3RKY A;  4F7U A;  4M78 D;  4C92 D;  4M77 C;  3FB9 A;  4A53 A;  4EMH A;  1WNL A;  4JLI A;  4J6Y A;  5GAO n;  1TH7 A;  2DTI A;  4M77 F;  1I4K 1;  4PJO C;  3V7R A;  4M7D E;  4M7D A;  4XTW A;  4PNO A;  2RA2 A;  4M77 D;  3SWN A;  5GAN h;  5LJ5 h;  5GAN 4;  5GAO q;  4M7D G;  2YHT A;  4C8Q A;  4PJO F;  3JCM W;  4C8Q B;  2RM4 A;  3VU3 C; 
#chains in the Genus database with same CATH topology
 3ZL7 C;  1SSH A;  4F14 A;  5C0M A;  3A8M B;  2L3R A;  1VQP Q;  2FZK B;  2VGN A;  5KCO A;  3M5A A;  2E4H A;  3OYB A;  2GFU A;  2LQK A;  2SEM A;  2ZPF B;  3RBB B;  4HT8 A;  1Q7Y C;  2VAS A;  2LT1 A;  1X6G A;  4R0K A;  2EW3 A;  5LJ5 f;  3JSC A;  3A8H B;  3JCM c;  4JS5 A;  1Y0M A;  3L2U A;  2QA4 A;  5LJ3 d;  3JCM X;  4C92 A;  2DL4 A;  4BE0 A;  2ECZ A;  1OZ3 A;  2DFU A;  5GAN 8;  1G3S A;  2QAZ A;  3WVD B;  4IIM A;  4XTU A;  2QA4 T;  1MMG A;  2EJG A;  3JV3 A;  1MNE A;  4C5I A;  1XJW B;  3QYG B;  4R55 A;  5KH6 A;  4PL6 A;  5GAN 5;  3PVQ A;  1DJ7 B;  3EFO A;  2KYB A;  5GAO l;  4OB1 B;  4EMG A;  2CP5 A;  1WQ7 A;  4M78 E;  1Y96 A;  2E70 A;  2ZPI B;  4OB2 B;  3G71 T;  3MEW A;  2DO3 A;  2DZ9 A;  3EHQ A;  4J7I A;  1RAG B;  2KYM A;  2YT6 A;  3FIF A;  3C95 A;  3JCM V;  2CT4 A;  1H64 1;  4J7F A;  1K1Z A;  4LD9 K;  1NPR A;  1RAA B;  2R58 A;  1QVP A;  2ZAE A;  4QQ6 A;  4C8Q C;  3UA6 A;  3ER0 A;  3THK A;  2EWN A;  3O8V A;  2DIQ A;  4M75 A;  3JB9 G;  4JJN K;  4KRT A;  1T0J A;  2EJF A;  4C92 C;  4F17 A;  1IB8 A;  3OYJ A;  1GCQ A;  3LGF A;  3CCL A;  3CC4 T;  1X01 A;  5GAM d;  2W10 A;  4J83 A;  1W2B S;  3MP1 A;  1YBY A;  1W70 A;  2BE9 B;  1Q81 U;  1ZSZ B;  2ABL A;  4JLI A;  2GQI A;  3M0Q A;  3CCL T;  3UF4 A;  2PTK A;  2DLP A;  5GAN 4;  4M7D G;  2MCN A;  3VU3 C;  2D8J A;  2MWO A;  1BI2 A;  3CXC S;  1KHC A;  2L3S A;  5CKD A;  3UPU A;  5FU7 C;  5FU7 B;  2KT1 A;  1QQJ A;  1WJR A;  2FZC B;  5EG2 A;  2DF6 A;  1X43 A;  4M77 B;  4QT7 A;  4X9D A;  3PT9 A;  2CP0 A;  1RAH B;  3RMS A;  4OB3 B;  4CRI A;  2RQR A;  2FEI A;  2X3W D;  3V8K A;  5I2S A;  3FJ5 A;  4M75 C;  3CME A;  3CPW S;  4ZGJ B;  3Q1J A;  1UFF A;  3RKW A;  1SEM A;  2CKK A;  3OYA A;  4A54 A;  1R0B G;  3NTH A;  3E9G A;  1AWO A;  4C0D C;  2MK5 A;  4C0Z A;  3CME T;  1PWT A;  2LNV A;  3GLX A;  1FMV A;  4LN2 A;  2E5Q A;  2OX7 A;  2QA4 Q;  4J9G A;  2ESW A;  1JJ2 P;  2H8H A;  2VUB A;  3EG1 A;  4KBM B;  5GAN d;  4JJC A;  2DRK A;  1M90 R;  2BIV A;  2PVG B;  2Z0W A;  1WHK A;  1JJ2 A;  4D8K A;  1ZUK A;  5CQY A;  2DYI A;  1QWF A;  4M78 G;  1UJ0 A;  2EYQ A;  2Y4Y A;  2EKO A;  2K5F A;  2V1R A;  2ATC B;  2VYT A;  3TSW A;  4JJD A;  2JMC A;  4CC7 A;  3KUF A;  2HQX A;  2XU8 A;  3EH1 A;  2QTV A;  3H9N A;  3M58 A;  4RCC A;  2DXU A;  3EGD A;  3UDC A;  1YN8 A;  1I07 A;  5KYU A;  4A53 A;  2RQV A;  1VA7 A;  2RA2 A;  1BI1 A;  3M4Y A;  3CCL Q;  2DX1 A;  1Q95 G;  4DBR A;  5FRM A;  3KFV A;  1XNI A;  2KRN A;  1OI1 A;  4A4E A;  1Y7X A;  1YIT T;  5CR2 A;  5CVI A;  1KC8 R;  5ECA A;  1YJ9 A;  3QO3 A;  2DL8 A;  3I5S A;  3BY7 A;  1YJ9 T;  5LJ5 g;  5EC7 A;  2KRS A;  1B7T A;  2L0A A;  2V26 A;  3AHU A;  2OAW A;  1I1J A;  3OMG A;  1O9S A;  3TSZ A;  2JTE A;  2WSF E;  4HVW A;  1OU9 A;  1YCS B;  1WXB A;  2HZY A;  1I8F A;  3CME Q;  2E10 A;  2E64 A;  2KE9 A;  3V7S A;  3A5Z B;  4XAX B;  2JM9 A;  4E47 A;  5L8R E;  1BYM A;  2YRV A;  1M90 U;  2OI3 A;  3SDZ A;  1K0X A;  4ATO A;  3MP6 A;  2O01 E;  3E19 A;  2BTT A;  5KE3 A;  4BI8 B;  2QI2 A;  4J9E A;  3C12 A;  1CKB A;  1D0X A;  1RAC B;  3BDL A;  4PJJ A;  1JXO A;  1WQW A;  4HA8 A;  2EJ9 A;  3FEO A;  4KUI A;  4LUD A;  4PJM A;  4MDX A;  3LH5 A;  3QPH A;  1VQK A;  1RAD B;  2FB7 A;  3D7S B;  4WF2 A;  2AKL A;  2F5T X;  3U23 A;  2J06 A;  1D1A A;  3C0C A;  5LJ3 h;  2X51 A;  2XDB A;  1RL2 A;  2YUO A;  4E7J A;  1I5L A;  1IGQ A;  4RG2 A;  4MML A;  1ZX6 A;  2H3E B;  1RLP C;  1MGQ A;  1VQL A;  2D8H A;  3VRZ A;  3FB9 A;  4EMH A;  1ABQ A;  8AT1 B;  3H0F A;  4RUG A;  4B9W A;  2COZ A;  3DLM A;  2P0K A;  1V29 B;  3I5R A;  2YRC A;  2J6O A;  3HP9 A;  4N0A A;  4L59 A;  2LJ0 A;  1HYO A;  2O2O A;  2O88 A;  6AT1 B;  3X20 B;  2FVU A;  1VQ6 A;  1ZLM A;  4GLM A;  1SSF A;  2LC4 A;  4AT1 B;  3BE3 A;  1KC8 U;  4J6X A;  3MET A;  3V7C A;  3GIB A;  5I22 A;  2ED1 A;  1VQ6 T;  2FZG B;  1HD3 A;  2OAU A;  3QSU A;  4M7A B;  4M7A C;  3M55 A;  1SHF A;  1UGP B;  2KNB B;  2QQB A;  3JB9 F;  4NOY A;  3RER A;  2EGC A;  1YJ9 Q;  1CKA A;  1E7O A;  4B9X A;  4M4Z A;  4RTT A;  3EFR A;  4IUR A;  4GBQ A;  2FPE A;  2AKK A;  5FLX E;  3OYL A;  5GAM h;  3H8Z A;  5GAO p;  5GAO m;  3LH0 A;  5I2M A;  4M77 E;  3JB9 J;  4YTL A;  4E7H A;  3PTA A;  1UGQ B;  4E7L A;  2GTO A;  5I21 A;  2WSC E;  1ZBJ A;  1M5Q 1;  4M7D F;  2LRQ A;  5DLO A;  4J6W A;  1WFW A;  5A0G A;  8ATC B;  2GF7 A;  4M7D D;  4ZGD B;  1AWW A;  1AWJ A;  4HT9 A;  4DOV A;  3OW2 S;  1D1C A;  3QXE B;  2J7I A;  3INZ A;  1M1K U;  1MV3 A;  2JTF A;  2KRM A;  1E6G A;  4JLG A;  2KEA A;  2B8A A;  5KYY B;  2OTL A;  1F1B B;  3SWN C;  3SWN B;  1TS9 A;  1K8A R;  4JJB A;  1G3Y A;  2L3Q A;  2F2V A;  4QVC A;  2X35 A;  2X9H A;  4L5G A;  4II1 A;  2EYX A;  4KT0 E;  3QWY A;  1V76 A;  4A63 B;  1M2V B;  2EYW A;  1VQK Q;  1PRM C;  4FW1 A;  3CBP A;  1N5Z A;  2KY9 A;  1K9M R;  1ZQ1 A;  3QYH B;  4J6Y A;  4C5H A;  4FYW B;  1QCF A;  4PLL A;  2EIF A;  1BK2 A;  2RF0 A;  2ZPG B;  4HVV A;  1LPL A;  5GAN h;  2VB6 A;  1YIJ T;  2BE7 D;  1VQL Q;  5HK3 A;  3IQL A;  1M27 C;  2HSE B;  1K9A A;  3ASK A;  2JNG A;  2EYZ A;  3G4S A;  1M9S A;  3I35 A;  4JRI A;  4M78 F;  4EMK B;  4EMK C;  3G4S T;  2E3I A;  5L23 A;  5HY6 A;  1HK9 A;  1VQ6 Q;  4ELZ C;  1VQP T;  4XK8 E;  2H3J A;  1U1S A;  3JCM e;  2RI3 A;  2MPX C;  1RI9 A;  4FYY B;  3OSV A;  3CBM A;  3OBY A;  3X24 B;  1XQH A;  2BZ8 A;  1D1B A;  1M90 C;  3VS7 A;  4M77 G;  3GBQ A;  2QXF A;  2VV5 A;  4PJO A;  4IUV A;  4RTY A;  4Z8A A;  4FT2 A;  2NUP B;  4AFZ C;  1PG5 B;  5IXB A;  1WDX A;  2PVD B;  1QLY A;  2RI2 A;  4A4K A;  2JXB A;  3WXM B;  4ZTF A;  1KD1 R;  4A4F A;  4F7U B;  4OMN A;  1RAE B;  1I0C A;  2QYZ A;  3KXT A;  4N4I A;  4QVD A;  2EKH A;  2R5A A;  2I2L A;  3CD6 A;  3EGU A;  3JCM f;  1LVK A;  2ROL A;  3JB9 H;  2DZC A;  1K8A U;  2M02 A;  5CKB A;  2GBQ A;  3EGX A;  2HMA A;  2DM1 A;  3CD6 T;  2K6D A;  3SEM A;  2OTL Q;  1UEB A;  2DIG A;  3CCE A;  5KYX A;  1YFN A;  3HRS A;  2G6F X;  1SG5 A;  1OUL A;  1WZO A;  5D6Y A;  3VKI A;  2JJ9 A;  1G2B A;  3L2W A;  1K9M U;  1IXD A;  1VQ5 A;  4PJO C;  5AT1 B;  3CCE T;  4ZTJ A;  3EH2 A;  1QWE A;  4BB7 A;  1YNZ A;  1X69 A;  1Y71 A;  2LDM A;  3GNG A;  1VQ5 T;  2LX7 A;  5KCH A;  5GAN j;  4OML A;  1KC8 C;  1OV3 A;  4J9F A;  5GMK i;  1W6X A;  2VGM A;  2SRC A;  2D6F A;  1KK7 A;  1WHG A;  1WHJ A;  2COY A;  3OYD A;  4L6V 5;  1M3B A;  2HL3 A;  1RUW A;  3G4S Q;  2A0F B;  2PU9 B;  1BIB A;  1BCO A;  2DRM A;  2Y4X A;  1M1G A;  1ZHI A;  1TWB A;  2EQJ A;  1S72 A;  1D3B A;  3DKM A;  2XK0 A;  5CKE A;  2IG0 A;  3HTR A;  1U5S A;  1S72 T;  2E1H A;  2L89 A;  2MOX A;  1W2B P;  5LJ5 d;  1AZG B;  1M1K C;  4AMC A;  4Z89 A;  4BDZ A;  2VWF A;  1C6V X;  4E6R A;  1W2B A;  5D6W A;  3ZEH A;  2FRW A;  4TVR A;  1HSQ A;  4Z02 A;  2K57 A;  1KD1 U;  2ZZD A;  2PQW A;  2CYZ B;  3CXC P;  3UA7 A;  1PSE A;  3MP8 A;  2O4X B;  1R77 A;  2CZ6 B;  4VUB A;  1G83 A;  3X26 B;  4IUT A;  2EGE A;  2MF2 A;  4NS5 A;  5KYW A;  3CXC A;  4DEX A;  1QKW A;  2EBP A;  4LE9 A;  2KMT A;  1WJS A;  3M0P A;  4CC2 A;  1OYX A;  1WIE A;  4BY6 C;  1AT1 B;  2M9U A;  5GMK e;  3RKY A;  4OGC A;  3CD6 Q;  2V8I A;  2WSE E;  2C06 A;  1MMN A;  1TH7 A;  3HRT A;  2RQT A;  3MO8 A;  4BI3 A;  1YJW A;  2RO0 A;  1AWX A;  2EFI A;  2KGT A;  4A4G A;  3CPW A;  3OYG A;  3VYG A;  2HKQ B;  3CCE Q;  4C8Q B;  1KQS P;  2YSQ A;  5D6X A;  2NUT B;  4C92 B;  2CSQ A;  1VQ5 Q;  2GTJ A;  3JCM b;  1KQS A;  3CMA A;  1B07 A;  1BIA A;  2ZPH B;  2MYS A;  2CRE A;  4BUG A;  1RAB B;  3CMA T;  3J80 E;  1VYT A;  2CZ1 B;  2DKG A;  2HSP A;  3EFO B;  2ED0 A;  5D7U A;  3M0T A;  2F5K A;  5CAI A;  3OB9 A;  1YP5 A;  4PJL A;  5A0L A;  4E7Z A;  1Y96 B;  2O31 A;  4ORZ A;  3LLR A;  2OTJ A;  1VUB A;  3H41 A;  2ZPB B;  3LW5 E;  1S72 Q;  2L3P A;  1JEG A;  2OTJ T;  5FWC A;  4KH0 B;  4OVA A;  4M7A G;  4M75 B;  2M16 A;  4C8Q D;  1RAF B;  1GCQ C;  3HFN A;  4C0F A;  1NJI C;  4C0D B;  1MHN A;  3O5Z A;  1NEG A;  4PLI A;  2RI5 A;  2CP6 A;  1K8A C;  2KAF A;  4XU1 A;  1U8R A;  2RJF A;  3OMC A;  2KK4 A;  2NLU A;  4BDY A;  3JCM g;  4MZP A;  3FLG A;  3OS5 A;  3JRZ A;  4QW2 A;  2MI6 A;  5IH2 A;  2DYB A;  1T3S A;  1ABO A;  4HCC A;  7AT1 B;  2DTO A;  4LDY A;  1K9M C;  4DEY A;  4FYV B;  1QVG S;  3OYC A;  1RAI B;  2HAX A;  3WVE B;  5GAO n;  2RK2 A;  4M77 F;  1N8R R;  4M77 D;  5GAO q;  4OMM A;  3QG1 A;  1R8O B;  1AZE A;  2YWW A;  1PM3 A;  4M75 D;  5GAN 7;  1EFN A;  1YJW Q;  4RCB A;  1Y57 A;  1NYF A;  2L5Q A;  4J8O A;  3HSB A;  1OQK A;  1PHT A;  2M51 A;  3M57 A;  3CCJ A;  2XKO C;  4RMO A;  3J7A F;  3PNW C;  4B6M A;  2JN0 A;  1UG1 A;  3SFM A;  4GLK A;  3ZBD A;  3CCJ T;  1EX4 A;  1ZUY A;  3JCM J;  3CMA Q;  1YHQ A;  4CC3 A;  3OYI A;  3HKS A;  2GCX A;  1OPL A;  3MEA A;  4Y28 E;  1LOJ A;  4UC4 A;  1H3H A;  3X28 B;  1YHQ T;  1QP3 A;  3OYH A;  1B3Q A;  2RJE A;  2YLC A;  2DJZ A;  3R6N A;  2XD0 A;  3E1S A;  4RTV A;  2A08 A;  1QCO A;  4QQD A;  2OTJ Q;  3M56 A;  1KD1 C;  2JVV A;  4DA4 A;  2FYK A;  1NG2 A;  1U1T A;  1JJ2 S;  5HCK A;  3EGD B;  2K4Y A;  2QQA A;  3RIR A;  5KYU B;  4JZ3 A;  1WYX A;  1G8X A;  2LVM A;  2E65 A;  3VUB A;  1SF9 A;  1JQQ A;  1YCY A;  4FSS A;  1Q82 R;  3OYE A;  2FHD A;  5LJ3 g;  2EQK A;  1FMK A;  3MEU A;  2DXC A;  5IHI A;  4XU2 A;  1PD0 A;  1M1K R;  2HNI A;  4IIO A;  3GP8 A;  1Z9Z A;  3TVT A;  1AVZ C;  2DAQ A;  2X4J A;  2WAC A;  2HL5 C;  2M0O A;  1I4K 1;  4M7D A;  3OYM A;  2XG8 D;  3CPF A;  1N8R U;  5LJ5 h;  3G6E A;  4MZT A;  1G3W A;  3MKD A;  2K5L A;  2RM4 A;  3TCJ A;  3CCQ A;  4FSX A;  2IPO B;  4HVU A;  2LNH B;  1SRM A;  2QEX A;  3VS2 A;  1H8K A;  3G6E T;  1BKB A;  3VV0 A;  1VQK T;  1B34 A;  4RKU E;  3DB3 A;  1BI3 A;  1NZ9 A;  3X25 B;  2YUP A;  2M1H A;  2R5M A;  2IIM A;  2AIR B;  1VQL T;  1I5O B;  2LJ1 A;  3PMI A;  1ZA2 B;  4C8Q E;  4O6J A;  5M9O A;  2DTH A;  1MND A;  4D6W A;  2JS0 A;  3F70 A;  3CCJ Q;  2D1X A;  4C92 E;  3QJY A;  2L8D A;  2NYS A;  1TOV A;  3UT1 A;  4PJN A;  5GAM g;  2DER A;  1BBZ A;  2JUF A;  2RNA A;  5IAY A;  5IT9 E;  3JB9 I;  1ZUU A;  1R0C B;  2X4Y A;  1YHQ Q;  2CS7 A;  3MPU B;  5KE2 A;  1ZBX A;  3MEV A;  4IKF A;  1C1A A;  1YWP A;  1GFD A;  1YJN A;  3TQ7 P;  4R56 A;  4M78 A;  4LXC A;  3VS5 A;  4PKC C;  1MUZ A;  3PIP A;  2FRY A;  3VRY A;  2RQU A;  1PC0 A;  1TUC A;  1WJQ A;  3MJX A;  5FU6 C;  2K2V A;  2KRO A;  1IGU A;  1WXT A;  1VQN A;  3QZ5 B;  1X6B A;  3AT1 B;  3EG9 B;  1D0Z A;  4HCZ A;  1VQ8 A;  4F04 B;  4M75 E;  1Q82 U;  4HCB A;  2DPP B;  3NTI A;  3P8D A;  1VQN T;  4N0A C;  2DET A;  4FYX B;  1G3T A;  1M3A A;  1M2V A;  1TUG B;  3T9N A;  2LZ6 B;  3S3O A;  4RTW A;  3LX7 A;  3CQT A;  5A2Q E;  2F2X A;  1K4U S;  1PSF A;  5FRN A;  3OA6 A;  4N4G A;  2QGF B;  2DTI A;  2PUO B;  2QDL A;  3V7R A;  2CP2 A;  1NJI R;  4Q5W A;  1GBQ A;  2RK1 A;  2LT4 A;  2YHT A;  4JZ4 A;  4QVZ A;  4M7A F;  5LJ5 j;  4M7A D;  2OTL T;  2W0Z A;  1U3O A;  4ANJ A;  4M78 C;  3OS0 A;  3I55 A;  2JTM A;  2DD4 A;  4NL2 A;  1MMD A;  3G6E Q;  3PIO A;  1VQO A;  3CCQ Q;  1GL5 A;  1VIF A;  2HBW A;  2V8J A;  1D0Y A;  2QEX Q;  2JW4 A;  2DK3 A;  4PK4 A;  4DBF A;  4BAC A;  2CUB A;  1GXI E;  3JAM E;  1KQ2 A;  4C8Q G;  2KXD A;  1S1N A;  3H6Z A;  2XIC A;  4C92 G;  1UDL A;  2K7A A;  1PD1 A;  2A7Y A;  2F2W A;  3CCV A;  2DL3 A;  1E6H A;  1NM7 A;  3GOX A;  2RJC A;  4E7S A;  3PE0 A;  2C0T A;  3CCV T;  4Y92 A;  5CKF A;  3RUX A;  4F16 A;  2LTO A;  3CCU A;  2DL7 A;  1RI0 A;  2XDD A;  1SPK A;  1WI7 A;  1QKX A;  2MAM A;  3OBW A;  3VYH B;  5DM7 R;  1M30 A;  2C0I A;  1VQM Q;  2VC8 A;  4HCK A;  3L42 A;  4JUV A;  1YJN Q;  3M4G A;  2JT4 A;  3L2Z A;  2FO0 A;  1VYV A;  5CIU A;  4IUP A;  4M75 G;  2NUZ A;  2PVO B;  3ZFJ A;  1PNJ A;  2OJ2 A;  1VQN Q;  2E12 A;  3C4S A;  1QVF P;  1FXX A;  4FT4 A;  3OY9 A;  1N8R C;  1VQ8 Q;  3A8G B;  1OU8 A;  3N5B B;  2K3B A;  2CUD A;  1WGS A;  1NJI U;  1QVF A;  2BUD A;  4E7K A;  3JCM W;  2RQW A;  3TU4 K;  2BKD N;  5DLQ E;  3V8J A;  4XQ3 A;  2MMP A;  2J6K A;  1PKS A;  3QKJ A;  5FRO A;  4ZGE B;  5C6S A;  5GAN 2;  2P84 A;  4XTX A;  4KGX B;  2ENM A;  3C94 A;  2CDT A;  1TSF A;  1N9R A;  3G7Z A;  2EAY A;  3M0S A;  2HD0 A;  4X9C A;  2P4R A;  1FWZ A;  4PJO B;  2ZPE B;  1OX8 A;  3I55 Q;  2RHX A;  4RG8 A;  1VQO Q;  5CK9 A;  2NWM A;  4FL6 A;  3I56 A;  4D8D A;  1N27 A;  1BCM A;  3A8L B;  3S6W A;  1JRI A;  3I56 T;  4ESR A;  2P0Q A;  4F7U F;  4CC4 B;  3M0R A;  1JB0 E;  4OMQ A;  3SD4 A;  3REA B;  4BE2 A;  3CCM A;  3QUI A;  4DBQ A;  2E3H A;  1OEB A;  1VQ9 A;  1X2Q A;  3CC2 A;  4E2F B;  4JRK A;  3VS6 A;  3CCV Q;  4RTU A;  5FW9 A;  4JDS A;  3CCS A;  3M53 A;  1IZ6 A;  3PMT A;  1VQ9 T;  2QTX A;  5LJ3 e;  1WX6 A;  1WXU A;  1LNX A;  3CCS T;  1Q82 C;  2RH2 A;  3EFS A;  3CCU Q;  2VXE A;  2A36 A;  3OYK A;  4A4H A;  1RLQ C;  4K11 A;  2EQI A;  1BI0 A;  3EG2 A;  4M7A E;  3PGG A;  2QQ9 A;  4OP0 A;  1UEC A;  4PJO D;  4J5Y A;  3OYF A;  2YXY A;  4QQG A;  2COW A;  1WA7 A;  4C5E A;  3EG0 A;  3VS3 A;  1N6A A;  1WNL A;  2RPN A;  3S3N A;  1IHW A;  2KT8 A;  3VUZ A;  2J05 A;  4C8Q A;  5CO7 A;  4FCY A;  4AG1 C;  2HBP A;  2YUQ A;  1YWO A;  3QZ9 B;  2RHI A;  3ULR B;  4QKU A;  2NUT A;  4ELY C;  5LJ3 f;  5IHN A;  4ZN3 A;  1JU5 C;  2XID A;  5CQX A;  1LJO A;  1D3B B;  5IN1 A;  4BY6 B;  2DVJ A;  3CPW P;  1ZSZ A;  1TTH B;  1VIE A;  3V8L A;  5GAM e;  3QDR B;  2A37 A;  2CGH A;  3QWX X;  3G71 A;  1AHJ B;  4MZM A;  4AFS C;  1YJW T;  1VQ7 Q;  2GQV A;  3RKX A;  3KBG A;  3LWI A;  5GJV B;  2LP5 A;  1W1F A;  4M77 A;  2PZ1 A;  3RES A;  3L2Q A;  2DBM A;  1T3L A;  1KQ1 A;  2LQW A;  2MIO A;  1TG0 A;  1Y07 A;  3I56 Q;  1KHI A;  3HRU A;  3VJP A;  1QVG P;  2DXT A;  3GPL A;  5KYW B;  3CC4 A;  3JCM P;  1U06 A;  1SHG A;  3SB2 A;  1K73 U;  3BW1 A;  1WHH A;  2IVW A;  3VS4 A;  4XTV A;  1QVG A;  3H0H A;  1KSW A;  3G1J A;  2AZS A;  3GNF B;  3CCM Q;  5GAM f;  1M4Z A;  1ZSZ C;  2ZGW A;  1VQ9 Q;  3CC2 Q;  2DBK A;  2EQU A;  1NLP C;  5GMK l;  3HPW A;  3CCS Q;  3NHN A;  1OPK A;  2CP3 A;  1GRI A;  2FG0 A;  4FM4 B;  4X1V A;  1UGR B;  4C8Q F;  2RHZ A;  5I11 A;  5GAN e;  3NGP A;  4C92 F;  2E5K A;  4WCI A;  4C92 D;  1M1F A;  2J6F A;  4M77 C;  4RTZ A;  2HKN A;  1P92 A;  4ZN1 A;  4XTW A;  3ME9 A;  3RMQ A;  3CCR A;  1QW1 A;  4PFZ A;  1MMA A;  2P0P A;  2A3L A;  1Q86 C;  2A28 A;  1A0N B;  5KYN A;  1AD5 A;  3CCR T;  2HQH A;  4BD3 A;  2DEQ A;  4F7U E;  3S3M A;  1X27 A;  1YI2 A;  1KQS S;  3FC3 A;  3L2R A;  1AOJ A;  5GAN f;  1WPY A;  5CCA A;  1YI2 T;  1H3Z A;  5AYF A;  4DOW A;  3PVL A;  4GY5 A;  5HK0 A;  3FDR A;  2D0N A;  2R57 A;  4M75 F;  4PFO A;  3TRE A;  3UAT A;  4PFP A;  1M8V A;  3G71 Q;  2RB6 A;  2Y90 A;  3CBO A;  2LQN A;  4PJO E;  2EVR A;  5LL6 S;  3JCM h;  2YDL A;  2FPF A;  2QG9 B;  1HJD A;  2RD1 A;  4JPB W;  2MWP A;  1NEB A;  3QJ6 A;  1JXM A;  4AG2 C;  3CC4 Q;  1IRE B;  4J9B A;  3DB4 A;  4Z88 A;  2X4X A;  2DJQ A;  3DLL A;  3QHS A;  1MV0 B;  1YIT A;  3JCM Q;  3LGL A;  1ACM B;  1NYG A;  3QBY A;  2CH4 W;  2HEQ A;  3FJP A;  5GAN 6;  1ZA1 B;  2KI7 A;  4KGZ B;  2F69 A;  3HHT B;  3GF5 A;  2E6N A;  2K3X A;  4PNO A;  3LYI A;  4X34 A;  2PUK B;  3OYY A;  2LCC A;  4EIK A;  2DE0 X;  3M59 A;  2EPD A;  5J3B A;  1OZ2 A;  4BI4 A;  1KFZ A;  3OS2 A;  4JS4 A;  2KDS A;  2JM8 A;  2LJ3 A;  2XMF A;  1SRL A;  4WTO B;  2KR3 A;  1UGS B;  3CCR Q;  1VQ4 A;  2KQW A;  3UWN A;  4HKE A;  4DQ2 A;  3M0U A;  2V8K A;  4F7U G;  2DNU A;  3VS1 A;  3BDU A;  4LDU A;  2DEU A;  1VQ4 T;  1JO8 A;  1Q7Y R;  1PRL C;  2G3R A;  4FW2 A;  2ZCF B;  2CT3 A;  1GBR A;  2K2M A;  3OQ5 A;  3L2V A;  1YI2 Q;  1X2K A;  1UTI A;  4RTX A;  2LX9 A;  4XU3 A;  2QQS A;  3RR6 A;  2AK5 A;  4OMP A;  3CCQ T;  4P5N A;  1VYU A;  3OW2 P;  2K79 A;  2QEX T;  2B86 A;  1FMW A;  1K73 C;  4FU6 A;  1BU1 A;  2QAS A;  4M7A A;  4PJO G;  4JRQ A;  3H0I A;  4NL3 A;  3OW2 A;  4XU0 A;  1Q81 C;  3HFO A;  2D0Q B;  3A1P A;  1I81 A;  2EQM A;  1JBM A;  4J9H A;  2DD5 A;  1O75 A;  3A8O B;  2K9G A;  1ZSG A;  5GJW B;  2DXB A;  1HXD A;  4M7D C;  4M7D B;  4MDW A;  3EG9 A;  5J26 A;  2P4T A;  3I9Q A;  2K3Y A;  2DIL A;  4XTY A;  1VQM A;  2LCS A;  3MCA B;  5J39 A;  2QQR A;  1EZZ B;  4BE1 A;  2BZX A;  4KGV B;  5IHK A;  1VQM T;  1B34 B;  2I0N A;  3QII A;  1YIT Q;  2X3X D;  1Z9Q A;  1YJN T;  5KYY A;  5FU6 B;  9ATC B;  2HQE A;  1V1C A;  2KVQ G;  3A98 A;  3SWN A;  3NPF A;  5GMK h;  3JB9 D;  2LMJ A;  4V2S A;  1C0M A;  2BZY A;  2XHC A;  4JRP A;  1VQ8 T;  3L1A A;  1H92 A;  2JOY A;  2K5I A;  3CC7 A;  4OB0 B;  2JZ2 A;  4IUU A;  2FL7 A;  5GAN 3;  1FYN A;  1D09 B;  5GAN g;  1Q7Y U;  3M9Q A;  3CC7 T;  2CSI A;  2FPD A;  1VQ4 Q;  2LQ8 A;  2X4W A;  4N4H A;  2KXC A;  3LWH A;  1N9S A;  1TXQ A;  4M78 B;  2GFA A;  1WLP B;  1Q86 R;  2VXF A;  3VS0 A;  5IXF A;  2AZV A;  4O5V A;  4EMK A;  2O9S A;  1CSK A;  2L2P A;  3EAE A;  2CH4 A;  1KIK A;  3I55 T;  1UGV A;  1W4S A;  1IRX A;  2QGG A;  1VQO T;  1K0S A;  2RN8 A;  5GMK m;  2C0O A;  1XTD A;  3REB B;  1X75 C;  2AT1 B;  1WHL A;  1AEY A;  3MHX A;  5LJ3 j;  4KUD K;  1QCN A;  1YIJ A;  1NLO C;  4IUQ A;  3R6O A;  4LNP A;  2VKN A;  1T0H A;  1WHM A;  2CZ0 B;  1TUD A;  3URG A;  5FWB A;  2YLB A;  2NUP A;  2GNC A;  1QMC A;  1K76 A;  4EDU A;  4DBH A;  3QDF A;  1KJW A;  2QDY B;  2YRD A;  3RNJ A;  2XDP A;  4F7U A;  1UHC A;  4M78 D;  4AFU C;  3NMZ C;  1G5V A;  2M0Y A;  3CCU T;  5CKH A;  1VQP A;  2E6Z A;  2HCK A;  3SHW A;  1X6O A;  3E9F A;  1IO6 A;  4C5G A;  1SKU B;  2CZ7 B;  1J3T A;  1TU0 B;  2O9V A;  1UJY A;  2YUN A;  2RHU A;  4EPC A;  1IHV A;  3RDV A;  1GCP A;  5GMK j;  2GGR A;  4FIB A;  4C0G A;  3HL8 A;  3E2U A;  2QK0 A;  4OMF B;  2DL5 A;  5GAM j;  4AFQ C;  3NFC A;  1KG1 A;  2RHY A;  4ZNX A;  2KBT A;  3JCM d;  1NBE B;  4CI0 C;  5A0D A;  5DY9 A;  2DVE A;  4E7I A;  4KUL A;  3CC7 Q;  1M3C A;  1XOV A;  1BB9 A;  2HDA A;  1VOM A;  3EG3 A;  1OX9 A;  3M54 A;  1LCK A;  1Q86 U;  3FRN A;  1M8M A;  1ARK A;  1VQ7 A;  2ROT A;  1FX7 A;  4J9C A;  2LCL A;  1PCX A;  3OS1 A;  1GFC A;  1OOT A;  4HXJ A;  2JMA A;  2V1Q A;  3BFM A;  4LDW A;  3PFS A;  3CEY A;  4MMK A;  4LDV A;  1VQ7 T;  2F1L A;  2D9T A;  2RMO A;  4KH1 B;  5GAO r;  2JS2 A;  4Y91 A;  5HKC A;  2AHJ B;  4J9I A;  2CP7 A;  2EGA A;  4ME7 A;  1UHF A;  2EYY A;  1EIF A;  2DMO A;  4LUE A;  1YIJ Q;  1NE8 A;  1K73 R;  4J9D A;  4OGE A;  1NPP A;  3J81 E;  2DA9 A;  2RJD A;  3EHR A;  3EGX B;  5LJ5 e;  4XTZ A;  3CCM T;  1UUE A;  2E41 A;  3P8B B;  2VVK A;  3CC2 T;  2XI9 A;  5KYX B;  1Q81 R;  4LD6 A;  1QP2 A;  2O4X A;  1PKT A;  4OF1 A;  3OYN A;  3NTK A;  4OMO A;  1M2O A;  2KSS A;  4M7D E;  1UB4 A;  3P8H A;  1UE9 A;  3OSS C;  3TEE A;  4LDX A;  4PJO F;  2PNI A;  1QVF S; 
#chains in the Genus database with same CATH homology
 2A3L A;  3TCJ A;  5C0M A;  5HK3 A;  3A8M B;  2L3R A;  4FSX A;  3OYN A;  3CCQ A;  1Q86 C;  3ASK A;  2JNG A;  2QEX A;  3G6E T;  1BKB A;  3VV0 A;  2VGN A;  3CCR T;  3G4S A;  5KCO A;  3M5A A;  1M9S A;  1VQK T;  4BD3 A;  1B34 A;  4RKU E;  3OYB A;  4JRI A;  4M78 F;  2GFU A;  3DB3 A;  1BI3 A;  2DEQ A;  2LQK A;  4F7U E;  1NZ9 A;  3X25 B;  3S3M A;  2ZPF B;  4EMK B;  4EMK C;  1YI2 A;  2M1H A;  2R5M A;  1Q7Y C;  1KQS S;  4HT8 A;  3FC3 A;  2LT1 A;  3G4S T;  1VQL T;  5HY6 A;  3L2R A;  3PMI A;  5GAN f;  1HK9 A;  1WPY A;  5LJ5 f;  4C8Q E;  5CCA A;  3JSC A;  3A8H B;  3JCM c;  4JS5 A;  4O6J A;  5M9O A;  2DTH A;  4ELZ C;  5AYF A;  1YI2 T;  1VQP T;  1H3Z A;  4XK8 E;  4DOW A;  2H3J A;  4D6W A;  3L2U A;  4GY5 A;  5LJ3 d;  5HK0 A;  3JCM X;  3F70 A;  3FDR A;  2R57 A;  1U1S A;  4M75 F;  4C92 E;  4C92 A;  3JCM e;  4BE0 A;  2RI3 A;  3QJY A;  2L8D A;  1OZ3 A;  3UT1 A;  3OSV A;  5GAN 8;  1G3S A;  5GAM g;  3CBM A;  3OBY A;  2JUF A;  3WVD B;  3TRE A;  1M8V A;  3X24 B;  1XQH A;  4XTU A;  5IAY A;  2QA4 T;  5IT9 E;  2RB6 A;  3JB9 I;  2Y90 A;  1M90 C;  2X4Y A;  3CBO A;  2EJG A;  4M77 G;  2CS7 A;  4C5I A;  2QXF A;  2VV5 A;  3QYG B;  4PJO A;  4IUV A;  4PJO E;  5LL6 S;  5KE2 A;  4FT2 A;  1ZBX A;  3MEV A;  3JCM h;  5KH6 A;  4R55 A;  4PL6 A;  5GAN 5;  4IKF A;  1DJ7 B;  2RD1 A;  5GAO l;  4OB1 B;  1YJN A;  2PVD B;  2MWP A;  4EMG A;  1WQ7 A;  4R56 A;  2RI2 A;  4M78 E;  4A4K A;  4M78 A;  1Y96 A;  4PKC C;  2E70 A;  3PIP A;  3QJ6 A;  2ZPI B;  4OB2 B;  3WXM B;  3G71 T;  4ZTF A;  3MEW A;  2DO3 A;  2DZ9 A;  4A4F A;  4F7U B;  4J7I A;  1WJQ A;  5FU6 C;  3FIF A;  2K2V A;  1IRE B;  3C95 A;  3JCM V;  1H64 1;  3KXT A;  3DB4 A;  4N4I A;  2X4X A;  4J7F A;  4LD9 K;  1VQN A;  3DLL A;  1NPR A;  4QVD A;  3QZ5 B;  3QHS A;  2R5A A;  2R58 A;  2I2L A;  1QVP A;  3CD6 A;  1YIT A;  4HCZ A;  1VQ8 A;  4QQ6 A;  3JCM f;  4C8Q C;  3JCM Q;  3ER0 A;  3LGL A;  2EWN A;  2DZC A;  3O8V A;  4M75 E;  2DIQ A;  4M75 A;  3JB9 G;  1Q82 U;  3JB9 H;  4JJN K;  1K8A U;  4HCB A;  5CKB A;  2DPP B;  3NTI A;  3P8D A;  1VQN T;  3QBY A;  4N0A C;  2EJF A;  4C92 C;  1G3T A;  3FJP A;  3CD6 T;  3T9N A;  3OYJ A;  3LGF A;  5GAN 6;  3CCL A;  3S3O A;  3CC4 T;  1X01 A;  1UEB A;  2DIG A;  5GAM d;  3LX7 A;  4J83 A;  3CCE A;  5A2Q E;  1W2B S;  3MP1 A;  1YBY A;  3HRS A;  2F69 A;  3HHT B;  1PSF A;  3GF5 A;  5D6Y A;  3VKI A;  1Q81 U;  3OA6 A;  5FRN A;  4JLI A;  4N4G A;  2E6N A;  3L2W A;  2DTI A;  2PUO B;  3CCL T;  1K9M U;  1VQ5 A;  3V7R A;  2K3X A;  4PJO C;  4PNO A;  3LYI A;  4Q5W A;  4X34 A;  2RK1 A;  2PUK B;  4ZTJ A;  3CCE T;  2LT4 A;  4BB7 A;  5GAN 4;  3OYY A;  2LCC A;  2YHT A;  4M7D G;  3M59 A;  1Y71 A;  2LDM A;  3GNG A;  4QVZ A;  5J3B A;  3VU3 C;  4M7A F;  2MWO A;  1OZ2 A;  1VQ5 T;  1BI2 A;  4BI4 A;  5KCH A;  1KHC A;  3CXC S;  5LJ5 j;  5GAN j;  1KC8 C;  4M7A D;  5CKD A;  2OTL T;  4M78 C;  3OS0 A;  3I55 A;  2JTM A;  3OS2 A;  2DD4 A;  3UPU A;  5GMK i;  4JS4 A;  5FU7 C;  5FU7 B;  4NL2 A;  2KDS A;  2VGM A;  2D6F A;  1WJR A;  3PIO A;  1VQO A;  5EG2 A;  1UGS B;  1VQ4 A;  3OYD A;  2KQW A;  3UWN A;  4HKE A;  4DQ2 A;  4L6V 5;  4M77 B;  2V8K A;  4F7U G;  4X9D A;  1VIF A;  3PT9 A;  3BDU A;  3RMS A;  4OB3 B;  2V8J A;  4LDU A;  4CRI A;  2DK3 A;  1VQ4 T;  3V8K A;  2PU9 B;  5I2S A;  1BIB A;  2G3R A;  4BAC A;  2ZCF B;  4M75 C;  3CME A;  1GXI E;  2Y4X A;  3CPW S;  3OQ5 A;  1M1G A;  3Q1J A;  4C8Q G;  4ZGJ B;  3JAM E;  1ZHI A;  1KQ2 A;  3L2V A;  3RKW A;  2CKK A;  3OYA A;  2EQJ A;  1S72 A;  3H6Z A;  4A54 A;  1D3B A;  3DKM A;  2XK0 A;  3NTH A;  2XIC A;  3E9G A;  2IG0 A;  5CKE A;  2LX9 A;  4XU3 A;  4C0D C;  4C92 G;  4C0Z A;  3CME T;  2QQS A;  3GLX A;  2LNV A;  3CCQ T;  2A7Y A;  4P5N A;  2E5Q A;  3CCV A;  1S72 T;  2E1H A;  2L89 A;  2QEX T;  1K73 C;  4FU6 A;  3GOX A;  2RJC A;  2VUB A;  4KBM B;  4M7A A;  5GAN d;  4PJO G;  5LJ5 d;  4JRQ A;  4NL3 A;  3CCV T;  2BIV A;  5CKF A;  1M1K C;  3RUX A;  3OW2 A;  4BDZ A;  2PVG B;  4XU0 A;  2LTO A;  3CCU A;  1Q81 C;  3HFO A;  2D0Q B;  1RI0 A;  1JJ2 A;  1I81 A;  2EQM A;  1JBM A;  2XDD A;  1W2B A;  5CQY A;  5D6W A;  3ZEH A;  2MAM A;  3OBW A;  3VYH B;  4TVR A;  4M78 G;  5DM7 R;  2DD5 A;  2EYQ A;  2K57 A;  2Y4Y A;  2EKO A;  2PQW A;  2CYZ B;  2VC8 A;  1O75 A;  2ZZD A;  2K5F A;  3A8O B;  1PSE A;  3MP8 A;  2O4X B;  2CZ6 B;  3L42 A;  2VYT A;  4VUB A;  2DXB A;  4JUV A;  3M4G A;  1HXD A;  4IUT A;  3X26 B;  4M7D C;  3L2Z A;  4M7D B;  4MDW A;  5J26 A;  2MF2 A;  2P4T A;  4NS5 A;  2K3Y A;  4XTY A;  3CXC A;  3KUF A;  1VQM A;  3MCA B;  5CIU A;  4IUP A;  2HQX A;  2XU8 A;  5J39 A;  2KMT A;  4M75 G;  1WJS A;  2QQR A;  4BE1 A;  3M58 A;  2PVO B;  1OYX A;  3ZFJ A;  4RCC A;  2E12 A;  2DXU A;  4BY6 C;  3C4S A;  2M9U A;  1VQM T;  1B34 B;  5GMK e;  3RKY A;  1FXX A;  4FT4 A;  4OGC A;  3QII A;  3UDC A;  3OY9 A;  1N8R C;  2V8I A;  2WSE E;  3A8G B;  2C06 A;  3N5B B;  1YJN T;  4A53 A;  5FU6 B;  2HQE A;  1TH7 A;  1WGS A;  3HRT A;  3MO8 A;  2KVQ G;  4BI3 A;  2RA2 A;  1BI1 A;  1YJW A;  3M4Y A;  1NJI U;  2RO0 A;  3SWN A;  1QVF A;  2BUD A;  2EFI A;  4A4G A;  3CPW A;  4E7K A;  3JCM W;  3OYG A;  3VYG A;  3TU4 K;  4C8Q B;  2BKD N;  5GMK h;  5DLQ E;  3V8J A;  4XQ3 A;  2MMP A;  3JB9 D;  5FRM A;  1XNI A;  4V2S A;  5D6X A;  1OI1 A;  4C92 B;  4A4E A;  2XHC A;  3QKJ A;  4JRP A;  1Y7X A;  5FRO A;  4ZGE B;  5CVI A;  5C6S A;  5CR2 A;  5GAN 2;  1YIT T;  1VQ8 T;  3L1A A;  4XTX A;  3JCM b;  1KQS A;  3C94 A;  3CMA A;  1N9R A;  1YJ9 A;  1BIA A;  2EAY A;  2JOY A;  3G7Z A;  2HD0 A;  3QO3 A;  4X9C A;  2K5I A;  3CC7 A;  4OB0 B;  5LJ3 g;  2ZPH B;  1FWZ A;  2JZ2 A;  4IUU A;  2FL7 A;  4BUG A;  2ZPE B;  5GAN 3;  4PJO B;  2RHX A;  3BY7 A;  4RG8 A;  3CMA T;  1YJ9 T;  3J80 E;  5GAN g;  5LJ5 g;  1Q7Y U;  3M9Q A;  3CC7 T;  3AHU A;  5CK9 A;  3OMG A;  2DKG A;  1O9S A;  2CZ1 B;  4FL6 A;  3I56 A;  2LQ8 A;  2X4W A;  4N4H A;  2WSF E;  3LWH A;  1N27 A;  2F5K A;  5CAI A;  3OB9 A;  3A8L B;  1N9S A;  4M78 B;  5A0L A;  1Y96 B;  3S6W A;  2GFA A;  2VXF A;  1JRI A;  1I8F A;  3I56 T;  4O5V A;  3LLR A;  2OTJ A;  4EMK A;  1VUB A;  2E10 A;  2E64 A;  2P0Q A;  3EAE A;  4F7U F;  2ZPB B;  3V7S A;  3I55 T;  3LW5 E;  3A5Z B;  1W4S A;  1JB0 E;  3SD4 A;  4XAX B;  4BE2 A;  3CCM A;  4E47 A;  5L8R E;  1VQO T;  3QUI A;  2OTJ T;  1BYM A;  4OVA A;  2YRV A;  1M90 U;  4M7A G;  1VQ9 A;  3CC2 A;  4M75 B;  3SDZ A;  2M16 A;  4JRK A;  5GMK m;  4ATO A;  3MP6 A;  1XTD A;  2O01 E;  1X75 C;  3E19 A;  4C8Q D;  5KE3 A;  4BI8 B;  2QI2 A;  4JDS A;  3CCS A;  3M53 A;  3MHX A;  3C12 A;  3HFN A;  5LJ3 j;  1IZ6 A;  4C0F A;  3BDL A;  3PMT A;  1VQ9 T;  1NJI C;  2QTX A;  4C0D B;  4KUD K;  1MHN A;  5LJ3 e;  1YIJ A;  4IUQ A;  3R6O A;  1WQW A;  4HA8 A;  4PLI A;  2EJ9 A;  2RI5 A;  1LNX A;  3FEO A;  3CCS T;  1Q82 C;  2RH2 A;  3EFS A;  2CZ0 B;  2KAF A;  2VXE A;  4KUI A;  4XU1 A;  3OYK A;  1K8A C;  3URG A;  1U8R A;  2RJF A;  4A4H A;  3OMC A;  4MDX A;  2KK4 A;  2YLB A;  2NLU A;  1BI0 A;  3QPH A;  4BDY A;  1VQK A;  4M7A E;  3PGG A;  2FB7 A;  2QQ9 A;  4WF2 A;  3JCM g;  4OP0 A;  4PJO D;  4EDU A;  2F5T X;  3FLG A;  4J5Y A;  4MZP A;  3OS5 A;  3OYF A;  3JRZ A;  4QW2 A;  5LJ3 h;  2MI6 A;  4QQG A;  1KD1 U;  1RL2 A;  2XDB A;  4E7J A;  1I5L A;  4RG2 A;  4C5E A;  4MML A;  4HCC A;  2DTO A;  4LDY A;  1K9M C;  2QDY B;  1MGQ A;  1VQL A;  2XDP A;  1QVG S;  4F7U A;  4M78 D;  3OYC A;  1G5V A;  3CCU T;  5CKH A;  3FB9 A;  1VQP A;  2HAX A;  1N6A A;  2E6Z A;  1WNL A;  3WVE B;  4EMH A;  5GAO n;  3S3N A;  2RK2 A;  1X6O A;  4M77 F;  3E9F A;  3VUZ A;  4M77 D;  4C5G A;  2CZ7 B;  4B9W A;  5GAO q;  4C8Q A;  3DLM A;  5CO7 A;  2P0K A;  3QG1 A;  1V29 B;  2HBP A;  3QZ9 B;  2RHI A;  1R8O B;  2RHU A;  3HP9 A;  4N0A A;  4ELY C;  4EPC A;  5LJ3 f;  4L59 A;  4ZN3 A;  2XID A;  4M75 D;  5CQX A;  5GAN 7;  1LJO A;  1D3B B;  5GMK j;  5IN1 A;  3X20 B;  2FVU A;  4FIB A;  4RCB A;  1VQ6 A;  4BY6 B;  1SSF A;  2LC4 A;  3HL8 A;  4C0G A;  1KC8 U;  2L5Q A;  4J6X A;  4J8O A;  3HSB A;  3MET A;  4OMF B;  3V7C A;  3GIB A;  3M57 A;  5GAM j;  3CCJ A;  2XKO C;  1VIE A;  3V8L A;  4RMO A;  3PNW C;  3J7A F;  5GAM e;  1VQ6 T;  3QDR B;  2OAU A;  3NFC A;  3QSU A;  1KG1 A;  2JN0 A;  2RHY A;  2CGH A;  4M7A B;  3SFM A;  4GLK A;  4M7A C;  3M55 A;  3ZBD A;  3JCM d;  3G71 A;  4CI0 C;  3CCJ T;  1AHJ B;  1UGP B;  4MZM A;  3JCM J;  3RER A;  2QQB A;  3JB9 F;  4NOY A;  4Z02 A;  5DY9 A;  5A0D A;  1YHQ A;  2DVE A;  4B9X A;  4E7I A;  4KUL A;  3EFR A;  4IUR A;  3HKS A;  3OYI A;  1YJW T;  1XOV A;  2GCX A;  2GQV A;  3MEA A;  3RKX A;  5FLX E;  3OYL A;  4Y28 E;  5GAM h;  1LOJ A;  3H8Z A;  3M54 A;  4UC4 A;  3X28 B;  3KBG A;  5GAO p;  5GAO m;  3LWI A;  1YHQ T;  3LH0 A;  1Q86 U;  1QP3 A;  5I2M A;  4M77 E;  4M77 A;  3RES A;  4YTL A;  3OYH A;  3L2Q A;  3JB9 J;  2RJE A;  3FRN A;  4E7H A;  2YLC A;  2DJZ A;  3PTA A;  1KQ1 A;  2QA4 A;  1Y07 A;  1VQ7 A;  1KHI A;  2XD0 A;  3HRU A;  3VJP A;  1FX7 A;  1UGQ B;  4E7L A;  2LCL A;  3E1S A;  2WSC E;  5I21 A;  3OS1 A;  2DXT A;  1M5Q 1;  3GPL A;  4M7D F;  2LRQ A;  5DLO A;  4J6W A;  3JCM P;  3CC4 A;  5A0G A;  4LDW A;  3BFM A;  4QQD A;  2GF7 A;  3PFS A;  3CEY A;  4ZGD B;  4MMK A;  4M7D D;  3SB2 A;  4LDV A;  1K73 U;  3BW1 A;  1VQ7 T;  4HT9 A;  4DOV A;  3M56 A;  1KD1 C;  2JVV A;  2IVW A;  3OW2 S;  4XTV A;  4DA4 A;  1QVG A;  2D9T A;  3QXE B;  2FYK A;  5GAO r;  1U1T A;  3INZ A;  1JJ2 S;  3GNF B;  1M1K U;  5GAM f;  2JTF A;  4Y91 A;  1M4Z A;  2K4Y A;  5HKC A;  2QQA A;  2AHJ B;  2ZGW A;  3RIR A;  4JLG A;  2B8A A;  2LVM A;  4ME7 A;  2OTL A;  2E65 A;  3VUB A;  2EQU A;  5GMK l;  3HPW A;  1YCY A;  1EIF A;  3SWN C;  3SWN B;  3OYE A;  4FM4 B;  1G3Y A;  1NE8 A;  1UGR B;  4C8Q F;  2FHD A;  1NPP A;  2X35 A;  2RHZ A;  4II1 A;  4L5G A;  4OGE A;  2RJD A;  4QVC A;  2EQK A;  4KT0 E;  5GAN e;  3MEU A;  2DXC A;  5LJ5 e;  4XTZ A;  3CCM T;  2E41 A;  4XU2 A;  3P8B B;  4C92 F;  2HNI A;  3GP8 A;  2P0P A;  4C92 D;  3CC2 T;  1M1F A;  2XI9 A;  4M77 C;  3CBP A;  1QP2 A;  2KY9 A;  2O4X A;  2DAQ A;  4LD6 A;  2X4J A;  4OF1 A;  1ZQ1 A;  2WAC A;  3NTK A;  1P92 A;  3QYH B;  4J6Y A;  3J81 E;  4C5H A;  4ZN1 A;  2M0O A;  1I4K 1;  2KSS A;  4PLL A;  4M7D E;  4M7D A;  4XTW A;  2EIF A;  3OYM A;  1UB4 A;  2XG8 D;  3ME9 A;  2ZPG B;  3CPF A;  3P8H A;  3RMQ A;  1N8R U;  5GAN h;  5LJ5 h;  3G6E A;  3OSS C;  3TEE A;  4MZT A;  4LDX A;  1G3W A;  4PJO F;  3CCR A;  1YIJ T;  1QW1 A;  2K5L A;  1QVF S;  2RM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...