4M78B

Crystal structure of lsm2-8 complex, space group p21
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
87
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 18
structure length 87
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78B00
3INZA 3JCMJ 5LJ3d 5GMKj 4PJOD 4M7AB 5GMKh 4DQ2A 3JCMe 2DJZA 1LJOA 3JCMP 2EAYA 4XTXA 4M77A 1N9SA 4C92F 3EFSA 4M7AE 4XTUA 4C8QG 3HFOA 4HA8A 1YCYA 5GAN8 2RB6A 4NL2A 4M77C 3RESA 3SWNB 1N9RA 1WQ7A 3JCMh 1KQ2A 4QVCA 5I21A 5GAOp 5GANh 5GANj 5GAOn 5LJ5j 3BDUA 3RKWA 2DTIA 5GAN6 5GMKl 4C8QD 4XQ3A 4PJOF 4XU1A 3JCMQ 5GAOr 4MMLA 4EMGA 3BW1A 1Y96A 2DEQA 4C92A 3RIRA 4A54A 4M75B 4JRIA 1JBMA 3RKYA 4EMHA 4C92C 1MGQA 4M75E 4A53A 1H641 2DVEA 3QO3A 3JCMd 4M7DG 4M78B 1WNLA 5GANd 4JRKA 4XU2A 5LJ5f 5GAOq 2RM4A 4PJOA 5LJ5d 2EJ9A 2E41A 2EJGA 4M78E 1TH7A 2DTOA 4J6YA 4NOYA 4PJOC 3JB9H 4M7DD 3QSUA 4MMKA 2VXFA 2K57A 3JB9G 2YHTA 4M7AG 5GANe 3JCMX 4HT8A 5DY9A 3JCMV 5GMKm 5LJ5e 2E64A 2FB7A 2EJFA 4XTYA 5GAN3 3RKXA 1BIAA 4C8QA 2DXUA 3M4GA 3JB9D 4M7AD 3L2ZA 4C8QC 5LJ5h 1B34A 5GAMg 4HT9A 2ZGWA 3FJPA 1M8VA 3RUXA 1I5LA 1I81A 2E1HA 4M75G 4F7UF 3AHUA 1HK9A 1WQWA 3V8LA 5GAMf 2JN0A 3HFNA 4JLIA 4WF2A 4M77B 2VC8A 4J5YA 3V8KA 3JB9F 4M7AF 3HSBA 2VXEA 4M78G 1LOJA 3VU3C 3JCMW 4M77E 4M75D 4C8QF 1BIBA 4EMKA 3JCMc 3EFRA 4F7UA 2CGHA 2RD1A 4M78D 2E65A 1HXDA 4RCBA 1JRIA 4EMKC 1Y96B 4C92B 3JB9I 2DZCA 2RA2A 4M7AA 4RCCA 4X9DA 5GAMj 1D3BA 4C92E 4M7AC 4M75F 4QVDA 4XU3A 3V7RA 1U1SA 3SWNA 1X01A 5GAN5 2DKGA 5LJ3g 4M7DF 3BFMA 4PJOB 3FB9A 2EWNA 3SWNC 3V7CA 3SB2A 2I2LA 4PJOE 3V7SA 1I8FA 1I4K1 3QUIA 4F7UB 3L1AA 5GAOm 4V2SA 2YLBA 4J6XA 4M75A 1M5Q1 5LJ3f 5GAMd 4F7UE 3BY7A 5CAIA 4M77G 1LNXA 3GIBA 5GMKi 4PNOA 4M75C 4M7DA 1D3BB 2DTHA 4C8QB 5GAOl 4M78A 2QTXA 4XTVA 2FYKA 4XU0A 4M7DC 3JB9J 1KQ1A 5GAMe 4C8QE 1B34B 4J6WA 3FIFA 4M77D 4M78C 5LJ3e 2HNIA 5GAN2 4C92G 3JCMg 2DXTA 4X9CA 5GAMh 3QHSA 5GANg 5LJ3j 5LJ3h 1U1TA 4OP0A 4XTZA 2YLCA 5LJ5g 3JCMb 4NL3A 2DZ9A 2Y90A 4N0AA 3V8JA 5GAN7 2E10A 3RERA 3PGGA 4C92D 3JCMf 4M77F 4Y91A 4PJOG 4M78F 4N0AC 4M7DB 5GANf 5GMKe 5GAN4 4EMKB 4M7DE 1WPYA 4F7UG 4JUVA 4XTWA
chains in the Genus database with same CATH superfamily
3JCMJ 2BE7D 2LT4A 2F2WA 3UATA 5GMKj 1VQ7Q 2AIRB 5GAN8 4RG8A 2RB6A 3SWNB 2M0OA 3QJYA 2BTTA 2MCNA 2DMOA 1AWXA 2KAFA 3VS0A 4DOWA 2RF0A 3CCMT 4FW1A 4IUTA 1AEYA 3OYFA 1MGQA 3QO3A 3JCMd 3CCJQ 2K4YA 4J6YA 1NEGA 1VUBA 3L2QA 1IREB 2XMFA 1Q82C 3CD6T 5LJ5e 5A2QE 3E9GA 4XTYA 5L8RE 1ABOA 1BB9A 5FWBA 2QGFB 1GCQC 4IUQA 8ATCB 4QQGA 2EGCA 3HFNA 4JLIA 4J5YA 2HAXA 1LOJA 3X20B 1N27A 3UA6A 1U06A 3CC4T 4LDVA 2IG0A 1BI0A 3SD4A 1WHKA 2VKNA 2ZCFB 4C92B 2MAMA 3CCQT 1D3BA 2GTOA 3REBB 2O2OA 1G83A 1YWPA 1U1SA 1X01A 2CP2A 2EQIA 2E5KA 4GLKA 2EW3A 3LW5E 2E3HA 2PVOB 2RPNA 2YRVA 3QDFA 1H3ZA 1VQ8Q 4DBQA 1SSHA 4XTVA 4KGZB 3OS0A 1PKTA 1TOVA 4OB3B 3TSWA 4OP0A 3CPFA 1ZBJA 4YTLA 4EMKB 3CCUT 3EGXB 3U23A 1V1CA 4F7UG 4LD9K 5KYUA 1LJOA 4C5IA 1SRLA 1QP2A 2DL4A 2ZPBB 3MCAB 3X24B 3OMGA 1QMCA 3OBYA 3RKWA 4PJOF 1NJIU 1Y96A 1IO6A 4EMHA 4A53A 3OSVA 2MYSA 4IKFA 1WX6A 2MMPA 3CPWA 5GAOq 4Y92A 4BDYA 1C6VX 1S1NA 2J6OA 4C0DC 2QI2A 4PFPA 4Y28E 5FRMA 2OX7A 3EGDA 2Z0WA 4M7AD 3D7SB 1GCQA 3EG0A 1B34A 2DRMA 1Q82R 2OTJT 1I81A 2YUNA 2JN0A 2YUQA 2QQRA 4LDUA 3EGUA 2XI9A 1YJNA 2JVVA 3E19A 4E7JA 2RQWA 3RBBB 2HSPA 1M2VB 2E12A 1VQ5A 4E7SA 1VQOA 1YI2A 4AMCA 1NPRA 3CC7Q 2M9UA 1VQ7A 1Q7YR 3HTRA 4JPBW 2RI2A 4BUGA 2RJFA 3GNGA 1M1KC 2LQNA 2IPOB 2X4YA 5CKDA 2CDTA 4LUDA 2FHDA 5IH2A 1KJWA 1VQMT 3CCRQ 3I56Q 2EIFA 5HK0A 3JCMg 3NGPA 1JEGA 3NTIA 3CCJA 1U8RA 1MNDA 1I0CA 1LVKA 2BKDN 4Y91A 4BACA 2ZPIB 3INZA 3MKDA 1YFNA 2PNIA 2VYTA 4M7AE 2HDAA 1KSWA 1NLPC 4OB2B 1N9RA 2FRWA 3C95A 3VYHB 2MPXC 4KUIA 3HHTB 5GMKl 2YDLA 3OYGA 1EZZB 2VASA 1RLQC 1K0XA 3LH5A 2L3QA 1KD1R 2HCKA 5J39A 4KBMB 1X27A 4Z8AA 4HCBA 2QK0A 5LJ5f 5CKHA 1X2QA 2VVKA 4FW2A 4NOYA 1RI9A 2CH4W 4HT8A 5DY9A 2A0FB 2CZ7B 4RMOA 1VQNQ 2D8JA 2RH2A 2RHYA 1YIJT 2HD0A 2KXCA 1YJWT 1MMAA 1OPKA 1ZA2B 3E1SA 4E7ZA 4M75G 2F2XA 2F5TX 1R0BG 2A37A 4M78G 5IHNA 4LE9A 4RTXA 2V8KA 4A4KA 2QA4A 3EFOB 2CGHA 2E3IA 3E9FA 1N8RU 1ZSGA 2RJCA 4QKUA 1X6BA 1IZ6A 3UF4A 4PJLA 1RAGB 2EWNA 2RK2A 3NMZC 3V7SA 2DETA 2XDPA 1AWJA 1X6OA 4PLLA 4D6WA 3C12A 4XU0A 3QZ5B 3PVLA 1KQ1A 2R58A 2CP3A 5IN1A 1YJ9Q 1M1KR 3FIFA 3TSZA 5LJ3e 3CQTA 3GP8A 2J6KA 1H8KA 3H0FA 4X9CA 3LX7A 1ZX6A 2JUFA 3I55T 2RJDA 2JOYA 2O88A 3A8GB 3WXMB 3OSSC 4JZ3A 2YWWA 1X43A 1PC0A 2MWPA 4ATOA 1YITQ 1K8AR 2RMOA 4PJOD 4KH0B 5DLQE 2MF2A 2DJZA 2G3RA 1PG5B 3DB3A 4J9EA 2O31A 1K9AA 5FRNA 4C8QG 1YCYA 4J9DA 1JQQA 1M9SA 4X1VA 2CS7A 1NM7A 1YHQQ 2BIVA 2O9VA 2RQVA 1H641 1ZLMA 2GQVA 4XU2A 3KBGA 4KGVB 2KSSA 3H41A 2HZYA 2P84A 1CSKA 3CC7A 4ANJA 2GCXA 1M27C 4OMFB 1QKWA 1W1FA 3UDCA 3A8LB 2EYQA 2ZGWA 4II1A 2YXYA 1NJIC 1UECA 1HK9A 3QXEB 3UT1A 3I56A 3CCRA 3CCVQ 2GBQA 3OA6A 1MV3A 2L5QA 3RDVA 3QIIA 1UJ0A 1A0NB 4F17A 1K73R 2SEMA 1UB4A 1QLYA 1OZ3A 4RCBA 1SHFA 1UGPB 1WXTA 2C0OA 1SF9A 2F69A 5D6WA 2CZ6B 2PU9B 2HQXA 1MV0B 4RTVA 3CMEQ 2X35A 2COYA 4PJOE 3VKIA 1FMWA 4AG2C 4CI0C 1NYGA 3A8OB 3MEWA 4J6XA 2EYZA 1M90U 4M77G 1D3BB 3TCJA 3Q1JA 4OMPA 3G71Q 4OMOA 3VS6A 3CCST 5CVIA 1UHCA 5CCAA 2EGAA 2KYMA 3PNWC 1D09B 5D6YA 2P0QA 4OMLA 1ZHIA 2QYZA 3FRNA 1QKXA 3LLRA 1VYVA 4IUVA 2CT4A 2B8AA 5FU7C 4A4GA 2B86A 4NL2A 3CC2Q 4ZTFA 4CC3A 5GAOp 3EG9A 3X25B 2LTOA 3VS2A 2ZPFB 2LP5A 2DD4A 5FLXE 2LZ6B 1OV3A 4KGXB 2CT3A 4M7DG 1VA7A 2KDSA 2RK1A 2JS2A 2RM4A 4Q5WA 2EJ9A 5LJ5d 4PLIA 1W6XA 4FT4A 2M51A 2O4XA 3M0UA 2KT1A 1WGSA 2VWFA 5CR2A 2VXFA 2NUTA 2YHTA 4KT0E 3M5AA 2XK0A 1BIAA 2MWOA 2LJ0A 4FCYA 5LJ5h 1RAHB 5KYWB 1F1BB 5IXBA 2JXBA 1MUZA 4BDZA 1GFCA 3N5BB 3AHUA 4CRIA 5GAMf 1YJ9A 2L3RA 1RI0A 2DIQA 3HRSA 4B6MA 2CYZB 3BE3A 4JS4A 5CQXA 5EG2A 2F2VA 2KNBB 2QGGA 4OMQA 2CP6A 4BE1A 1X75C 1Q81R 3VS4A 2OTLQ 1ZUYA 5A0DA 1YITA 2D0NA 1BCOA 2CSIA 1EX4A 3SB2A 1I8FA 5C6SA 5KYYB 1GRIA 2V8JA 3GLXA 2XKOC 5LJ3f 4M75C 1RADB 2NYSA 3PT9A 1KFZA 4A4FA 3L2UA 1KIKA 4M78C 1AWOA 2QQBA 2LDMA 4C92G 1N8RC 1TTHB 3G6ET 2DILA 2K7AA 2ABLA 2DZ9A 4MZPA 2FEIA 1PD1A 3DLMA 3JSCA 4LD6A 5GANf 1C0MA 4RG2A 1AHJB 3VUZA 1QW1A 4L5GA 2EQJA 4M7AB 2R5MA 4DQ2A 2BZYA 4ELZC 1TUDA 2XIDA 3JCMP 2A08A 4F04B 2BE9B 3CD6Q 1AVZC 3VV0A 5ECAA 5LJ5j 1JJ2A 3CCVA 1UGSB 5KE3A 4E47A 2YRCA 1WLPB 2K3YA 4OGCA 2D0QB 2C0IA 4RTWA 1HYOA 2JTMA 4HVVA 5GJWB 1OYXA 4PL6A 3QYGB 4QT7A 3CC4Q 1BKBA 1TXQA 1QCNA 2C06A 5CIUA 2EJFA 1VQ9A 3CMEA 2K2MA 3CCQQ 1ZSZB 3M55A 1QQJA 4C8QC 1WFWA 2HKQB 1PHTA 3DLLA 3G71A 1WQWA 3V8KA 3CCET 2H3EB 4LDYA 1UGVA 1BIBA 1I5OB 1OX8A 3OYAA 1D1BA 1B07A 1M2OA 1NYFA 3FDRA 2O01E 2HMAA 1YWOA 4QVDA 4EDUA 2KI7A 3GPLA 3IQLA 2GF7A 2KY9A 2DX1A 4NS5A 5FROA 3V7CA 1J3TA 2PTKA 1TSFA 4V2SA 3CCUQ 3CC2A 4M75A 3GBQA 1B7TA 2E6NA 4M78A 1JB0E 2FYKA 4AFZC 5A0LA 3R6NA 1BI1A 3GNFB 2J06A 2KEAA 1VQKT 2XG8D 4HKEA 1SRMA 2L3PA 4D8KA 5LJ5g 3JCMb 2QEXT 2DYBA 2C0TA 3OYIA 3ER0A 5GMKe 3PMIA 3F70A 2CP5A 4L59A 2W10A 4EIKA 3RMQA 5DLOA 1M90C 1R8OB 5C0MA 4A4HA 4M77C 4J9IA 4O6JA 4E2FB 5GAN6 2DFUA 1D1AA 2EQMA 3UWNA 1YP5A 2A28A 3RIRA 1JBMA 2QA4Q 2OTJQ 1VQ4A 2JTFA 3G1JA 2OTLA 1TH7A 1I07A 3QSUA 3JB9G 1AWWA 1V76A 1UDLA 3ASKA 1WXUA 4C8QA 2GTJA 1I1JA 2DK3A 2P0PA 2DO3A 3MHXA 1VIFA 1WA7A 3MJXA 3CCLT 3RMSA 3CPWP 4J7IA 2J05A 1JU5C 1VQLT 2GFAA 2K3XA 4IUUA 4J9GA 2KRNA 3NFCA 3CCMA 1VQMQ 1WIEA 2KBTA 1AOJA 4XU3A 1LPLA 1OI1A 2A3LA 4PJOB 3PVQA 3SWNC 2DL5A 1EFNA 4PFOA 3CD6A 4DBRA 1UGRB 1UTIA 2E4HA 3PIOA 1VQ8T 1WJQA 3CBMA 4XAXB 2QTXA 1QVFA 2YT6A 2FZGB 1ZUKA 2ECZA 2F1LA 2HQEA 2HKNA 3FJ5A 3NHNA 3J81E 1SSFA 2COWA 3VS5A 2A7YA 1KC8U 5LJ3h 3HRUA 1K9MC 2CUBA 1Y71A 2V8IA 3I5RA 3CC4A 1VQ6T 2PQWA 1AZGB 2HBWA 4LDXA 2KT8A 3L42A 4EMGA 3CCQA 4XTWA 2EKHA 1QP3A 3HKSA 3JCMe 6AT1B 3M53A 3REAB 3QWYA 4M77A 3QWXX 4RTUA 4DBHA 1YIJQ 5GANh 1ZBXA 1YJWQ 3BW1A 4A54A 3RKYA 4FYYB 4C92C 4B9WA 3EH1A 1K0SA 1E6HA 3L2WA 3QG1A 1CKBA 1HSQA 5GAN3 1M1GA 1O9SA 2LQWA 4FM4B 3CCUA 2KE9A 3L2RA 2AKKA 2VGMA 1WHMA 3V8LA 1JXOA 4BB7A 4E7HA 4WF2A 1TS9A 2XU8A 1N5ZA 1RAIB 3HSBA 3VU3C 5D7UA 3ZL7C 1Y57A 5IAYA 3GF5A 2P0KA 2RI5A 2MOXA 3M9QA 3CPWS 1Q95G 1G3YA 1Q86C 4C0FA 4EMKC 1IHVA 1BCMA 1MMGA 1WHHA 3I55Q 5KYNA 1KQSA 3V7RA 1RAFB 3SWNA 5GAN5 3BFMA 1GFDA 4QQDA 4KH1B 4RUGA 1WHGA 2K2VA 4ESRA 1MMNA 1WXBA 2QG9B 2H3JA 4J7FA 1S72T 1SEMA 3UA7A 1P92A 3SEMA 5GAMe 1U3OA 2OTJA 4N4HA 3I5SA 1W2BA 1NPPA 3CMAT 2P4RA 1C1AA 1OQKA 1JXMA 4PFZA 1WHLA 1BU1A 5I2MA 1FX7A 2L8DA 3A8MB 4R56A 3A5ZB 4C5EA 2ZAEA 2DTIA 2H8HA 5FU6B 2PUOB 3VUBA 4CC7A 4C92A 4TVRA 1G3SA 1KG1A 1VQMA 2RN8A 1WNLA 1G3WA 4QW2A 2WSEE 3LWHA 3OYNA 3I9QA 2K57A 5GANe 2OAUA 1VQNT 2LCCA 3PMTA 2DF6A 2NUZA 3M4GA 1PCXA 3OYBA 4JRPA 2JW4A 2DVJA 5HK3A 2LRQA 5KCOA 5I22A 4JJCA 2EBPA 3M56A 4OF1A 2LQKA 4EMKA 1XQHA 1D0XA 2EYYA 3EGXA 3CCSQ 1B3QA 3G4ST 2XHCA 4AFUC 4ZN3A 4M75F 3VRYA 2FZKB 1IXDA 4J9BA 1BK2A 1M5Q1 1YIJA 2ED0A 2NWMA 2JTEA 3CBPA 1YJWA 3OS2A 2RNAA 2FO0A 1IGUA 2CP0A 3R6OA 1H92A 4HVUA 5DM7R 2DBMA 2ENMA 1U1TA 3TQ7P 2EGEA 1AD5A 1IHWA 5I2SA 1U5SA 3JCMf 4N0AC 1VQ9Q 5GAN4 1X6GA 4JUVA 4AG1C 2QAZA 4AT1B 2RI3A 1M3CA 2LC4A 2KROA 1MHNA 1WQ7A 3URGA 4E7LA 2AKLA 4XU1A 4DOVA 1YHQT 1KC8C 3OW2P 2E70A 3OW2A 2COZA 1HD3A 5KE2A 4D8DA 2DTOA 1YCSB 1PD0A 5FW9A 3I55A 3JB9H 4FYVB 3EG2A 4M7AG 3JCMX 1VQPT 1FMVA 5IHIA 4C5GA 1Y0MA 3VS1A 2SRCA 4ZTJA 4JDSA 1NBEB 2M02A 4LDWA 3SFMA 1M8VA 3FJPA 3OYJA 1QWEA 4ZGDB 4E7KA 3S6WA 2DXBA 5KYUB 1GXIE 2ZPGB 3MP1A 3QYHB 4FL6A 3JCMc 3EFRA 4F7UA 3PTAA 3NTKA 4BY6C 4AFQC 2DA9A 4DEXA 1Y96B 2DPPB 3G6EQ 5L23A 2DL3A 1D0ZA 1G2BA 2GGRA 3CEYA 2YLBA 3NPFA 1OX9A 4F7UE 2K5FA 1PRLC 1OPLA 1NJIR 2KVQG 3EGDB 4LNPA 5KH6A 2HL5C 1KHCA 1VQ4Q 3JB9J 1B34B 2EQUA 4GBQA 4J6WA 3LWIA 1M3BA 1K9MU 1ACMB 2CZ1B 2FPFA 4N0AA 1WI7A 1GBRA 4LN2A 3FEOA 4M77F 1OU8A 2PZ1A 4AFSC 1PWTA 1UG1A 2FPDA 1M4ZA 3QKJA 2D6FA 1AZEA 5GMKh 2O9SA 1YBYA 2EAYA 4X34A 2R5AA 1K76A 1PSFA 2M0YA 4N4GA 2WACA 3C94A 5I21A 4BE0A 3M0RA 1UHFA 1X2KA 1M3AA 1MNEA 3CCMQ 3T9NA 5KYXA 3S3OA 2EFIA 4F14A 1FXXA 3VS7A 3CCSA 1WDXA 1Z9QA 3CCEQ 3OMCA 3OW2S 3I35A 2DAQA 1IB8A 2ATCB 2GNCA 1KC8R 2P4TA 3X28B 5CO7A 3QPHA 3JCMV 5J26A 5GMKm 2K5LA 2OJ2A 5M9OA 1JJ2P 3QBYA 3E2UA 3TEEA 2JMCA 3LGLA 4PJNA 1O75A 3HL8A 4E6RA 3JAME 2BZXA 3P8HA 1QVGP 2WSFE 2YRDA 3JRZA 4KULA 1QVGA 2IIMA 4M75D 1D1CA 3J80E 1Q86U 3OYEA 1W70A 2RO0A 4M78D 1M1FA 2ESWA 1VQKQ 4BE2A 4MDXA 1FWZA 2DD5A 2E5QA 2QEXQ 2DKGA 4EPCA 2NUPA 2I0NA 4C0DB 4R55A 1GL5A 4Z89A 1EIFA 3S3MA 1VYTA 1TWBA 1QWFA 1WHJA 2MK5A 1K1ZA 3J7AF 3WVEB 4A63B 4J9HA 2DNUA 4KRTA 1GBQA 2YLCA 2LCSA 1K73U 3DKMA 1WZOA 4PJOG 1E6GA 2K6DA 2CSQA 1FMKA 8AT1B 1WJRA 3M58A 1CKAA 2QQSA 1T3LA 2HSEB 4C92F 3MEAA 4ZGEB 9ATCB 5GJVB 3RESA 3JCMh 2HEQA 4VUBA 4O5VA 4R0KA 1MMDA 4PKCC 1YJNT 2AZSA 4C8QD 3P8DA 3KFVA 3BDLA 1NG2A 4MDWA 2DEQA 2HQHA 4J8OA 4M75E 1VQ5T 4OMMA 3CCLQ 2DVEA 2LNVA 2W0ZA 1N8RR 1VQOT 5IHKA 4JRKA 2RHZA 3C0CA 3NTHA 3OQ5A 1QCFA 3M0TA 1OU9A 1YI2T 4M78E 1VQLQ 5CKFA 3G6EA 1VQ7T 2ROLA 2RJEA 1Q7YC 1XJWB 1T3SA 2QXFA 2QDLA 4HT9A 2J6FA 1PKSA 4XK8E 2AHJB 1JJ2S 4J9CA 1I5LA 2E1HA 1G5VA 2YSQA 3VS3A 2F5KA 1M8MA 2LJ3A 4CC2A 3JCMW 3CCJT 2LMJA 3MP8A 1TU0B 2D1XA 1QVGS 4ORZA 2RQRA 4CC4B 1JRIA 1BI2A 3JB9I 2DZCA 2LQ8A 4JLGA 4M7AC 1ARKA 3H0IA 1K8AU 1QCOA 2JJ9A 3FB9A 1VQ6Q 5IXFA 3DB4A 2EYXA 1NEBA 2I2LA 3ME9A 2X3WD 5A0GA 1QVPA 1NE8A 4Z88A 5GAMd 3PIPA 5CAIA 2IVWA 1LNXA 2JT4A 5GMKi 2AZVA 1PSEA 4M7DC 3SDZA 2FVUA 4C8QE 4M77D 4FSXA 3H6ZA 2HNIA 5GAN2 1KD1C 2CH4A 2CUDA 1PM3A 2DXTA 2KRSA 5GAMh 3CCEA 2XD0A 2L2PA 2K3BA 5CQYA 5GAN7 2RQTA 1Q81U 4IIMA 1ZSZC 5KYWA 3OYCA 1UJYA 5J3BA 5LJ3d 4XTXA 1QVFP 1TUCA 3HFOA 4HA8A 4LUEA 3ZBDA 3TVTA 5HY6A 2KQWA 3M4YA 3AT1B 5GAOn 4JJBA 3LH0A 5GAOr 3GOXA 2QA4T 1JO8A 2KRMA 2DXCA 2D9TA 4N4IA 4IUPA 3QZ9B 1LCKA 5CKEA 1DJ7B 2YUOA 2V1RA 5GANd 2JNGA 4C5HA 1VQKA 2YUPA 4M7DD 3TREA 5KYYA 3FLGA 2KMTA 2QEXA 2RHUA 2E64A 5LL6S 3RKXA 3EG3A 4ZGJB 2FG0A 1M90R 1BI3A 2KK4A 2JMAA 1ZQ1A 2X4XA 3RUXA 4F7UF 3PE0A 3M54A 2CP7A 1TG0A 2LT1A 3JB9F 1KK7A 3HP9A 2V1QA 4M77E 3EG9B 1S72Q 3WVDB 1SHGA 3UPUA 1M30A 2RD1A 1HXDA 4MZTA 4M7AA 4WCIA 3M57A 4RCCA 5GAMj 2DM1A 4RTTA 1PNJA 4BD3A 1R77A 3EAEA 3CMAQ 2M1HA 2KR3A 2K79A 2O4XB 4F7UB 2HBPA 2NUTB 2A36A 2DIGA 2JM8A 4PNOA 4M7DA 1BBZA 2JZ2A 5GAOl 4OGEA 4DEYA 1WYXA 2DYIA 4GLMA 2DJQA 3CCLA 1KQSP 5LJ3j 4XTZA 2AK5A 3CC7T 1VQLA 1YNZA 3EG1A 1ZSZA 1ZA1B 2PVDB 4C92D 3QDRB 4HXJA 4BI4A 1XNIA 3MEVA 4M7DE 4DA4A 2R57A 4C0GA 3CXCP 1UFFA 3CXCA 1ABQA 1G8XA 3OS5A 1OULA 4MZMA 3EFSA 5FWCA 4XTUA 3CCRT 5I11A 3I56T 3LGFA 1KQ2A 4B9XA 4QVCA 5GANj 4RTZA 2LX7A 1QVFS 2RQUA 3HRTA 1HJDA 4XQ3A 1W2BP 3EHQA 1OEBA 1VQ8A 4ELYC 2CREA 4PJMA 3ZFJA 1K73C 2EPDA 3G7ZA 4FU6A 4QQ6A 1K9MR 3META 2EJGA 3KUFA 3OYMA 4WTOB 4PJOC 3OYYA 2V26A 1BYMA 2QQAA 2J7IA 4K11A 2ZPHB 5EC7A 3G4SQ 3LYIA 1Y07A 4GY5A 2LX9A 1VQ6A 5KYXB 2DXUA 2XICA 5GAMg 4KUDK 4OB1B 1ZUUA 2WSCE 4J83A 3M0SA 4HVWA 5FU7B 5D6XA 1RABB 2VC8A 2VXEA 2K5IA 2PUKB 3M59A 1YN8A 1H3HA 3VJPA 2L89A 2DL7A 2M16A 2FRYA 2XDDA 4C92E 2X4JA 5HKCA 5LJ3g 1OOTA 4BY6B 1NZ9A 1AT1B 3PFSA 2CZ0B 1KHIA 2ZZDA 3OYDA 2DTHA 5KCHA 2NUPB 2MIOA 2KYBA 5GANg 1UE9A 4NL3A 3A98A 4P5NA 3V8JA 1Q86R 1K8AC 2E10A 3RERA 1KQSS 4M78F 4HCKA 4JJDA 3HPWA 2DBKA 3P8BB 1Q82U 1K4US 1Z9ZA 1VQPQ 3CXCS 4HCCA 1GCPA 2FZCB 3L2VA 1YJ9T 2MI6A 3ULRB 3BDUA 2OI3A 2DEUA 2RHIA 3JCMQ 4JZ4A 3OBWA 5HCKA 4M75B 1N6AA 1IRXA 2X9HA 4ME7A 1S72A 1W2BS 2RHXA 4M78B 4E7IA 1Q81C 2VB6A 4PJOA 1YITT 2LCLA 2E41A 2EVRA 2L0AA 3ZEHA 4UC4A 4LXCA 3JV3A 4IURA 3CMAA 1Q7YU 4FYXB 2X51A 2PVGB 3JB9D 3L2ZA 4ZNXA 1RL2A 1SG5A 1W4SA 1M2VA 1IGQA 3OYKA 3C4SA 1PRMC 4F16A 1G3TA 4FYWB 2AT1B 4BI3A 4C8QF 3H0HA 2CKKA 3H8ZA 2K9GA 3RNJA 2JS0A 2HL3A 1T0JA 2E65A 4FIBA 1V29B 1VYUA 4JRQA 3TU4K 3EHRA 2LJ1A 2LNHB 4DBFA 2FPEA 2GQIA 2G6FX 1OZ2A 1RAEB 3OB9A 3O8VA 1I4K1 3QUIA 1VQNA 3CCVT 5FU6C 1TUGB 2QASA 3GIBA 1FYNA 2GFUA 4A4EA 2DRKA 2D8HA 3X26B 4C8QB 2EQKA 4Z02A 4ZN1A 1SKUB 2EKOA 1VIEA 2KXDA 1UUEA 1KD1U 3MO8A 4OMNA 3H9NA 2QQ9A 2BZ8A 1E7OA 4IIOA 3PGGA 1VQ9T 3CMET 3VYGA 3G4SA 1SPKA 1WPYA 1UEBA 2X3XD 1XTDA 5AT1B 4PJJA 5CK9A 3OS1A 3SHWA 3G71T 1N9SA 3OYLA 3OYHA 4HCZA 4MMLA 1Y7XA 2ZPEB 2DERA 2KGTA 3A1PA 3CBOA 2VUBA 4JRIA 1VOMA 2Y4YA 3M0PA 2DE0X 3MEUA 2EYWA 3S3NA 4QVZA 2LVMA 5AYFA 2E6ZA 2X4WA 2FL7A 4PK4A 1RAAB 4M4ZA 4MMKA 2FB7A 3VRZA 3FC3A 3CC2T 3KXTA 3EH2A 1RLPC 7AT1B 2L3SA 3EFOA 1UGQB 2BUDA 3MPUB 2DLPA 1M1KU 4RTYA 2XDBA 4M77B 1D0YA 4M7AF 4RKUE 3O5ZA 4FT2A 3OY9A 1YHQA 1T0HA 2QDYB 4OB0B 5CKBA 2RA2A 4X9DA 2DL8A 2VV5A 1RACB 3THKA 2ED1A 4M7DF 3MP6A 4FSSA 5IT9E 2ROTA 3QJ6A 1NLOC 1R0CB 1VQPA 2JM9A 3L1AA 5GAOm 4L6V5 2VGNA 3BY7A 2Y4XA 1X69A 1VQ4T 1XOVA 2QTVA 3A8HB 1RUWA 3M0QA 4JS5A 2OTLT 2NLUA 4C0ZA 1YJNQ 3QHSA 4BI8B 2Y90A 4JJNK 4M7DB 4OVAA 3RR6A 1VQ5Q 1VQOQ 1YI2Q 4J9FA 1WJSA 2OAWA
chains in the Genus database with same CATH topology
3LLRA 4IUVA 3JCMJ 1FX7A 2LT4A 5LJ3d 5GMKj 2L8DA 3A8MB 4R56A 4XTXA 2B8AA 5FU7C 3HFOA 3A5ZB 4HA8A 4RG8A 4A4GA 2RB6A 4NL2A 3SWNB 4C5EA 3ZBDA 5GAN8 4ZTFA 5HY6A 5GAOp 2M0OA 2KQWA 3M4YA 3QJYA 5GAOn 3LH0A 3X25B 2DTIA 2LTOA 5GAOr 2ZPFB 5FU6B 3GOXA 2DD4A 2PUOB 2KAFA 3VUBA 4DOWA 4C92A 5FLXE 3CCMT 2QA4T 2DXCA 2D9TA 5I2MA 4IUTA 4N4IA 3OYFA 4IUPA 3QZ9B 1MGQA 4TVRA 1G3SA 5CKEA 1KG1A 3QO3A 1VQMA 3JCMd 4M7DG 1DJ7B 1WNLA 2KDSA 5GANd 2JNGA 2RK1A 4C5HA 1G3WA 2RM4A 4QW2A 2WSEE 4Q5WA 2EJ9A 2K4YA 4PLIA 5LJ5d 4J6YA 1VQKA 3LWHA 3OYNA 1VUBA 4FT4A 2O4XA 4M7DD 1WGSA 5CR2A 2VXFA 2K57A 3TREA 2YHTA 3L2QA 5GANe 3FLGA 1IREB 2KMTA 2OAUA 4KT0E 2QEXA 1Q82C 2RHUA 3M5AA 2LCCA 1VQNT 5LJ5e 2E64A 5A2QE 3CD6T 3E9GA 4XTYA 5LL6S 3PMTA 2XK0A 1BIAA 5L8RE 2MWOA 3RKXA 4ZGJB 3M4GA 3OYBA 4JRPA 5LJ5h 1BI3A 5HK3A 2KK4A 1ZQ1A 2X4XA 4IUQA 3RUXA 2LRQA 4F7UF 4BDZA 4QQGA 3N5BB 3AHUA 4CRIA 3M54A 5GAMf 3HFNA 4JLIA 5KCOA 1YJ9A 4J5YA 2LT1A 3JB9F 2HAXA 2L3RA 1LOJA 3HP9A 1N27A 3X20B 3M56A 4M77E 1RI0A 4OF1A 2DIQA 3HRSA 4JS4A 2CYZB 2LQKA 5CQXA 5EG2A 3WVDB 1XQHA 4LDVA 4EMKA 2IG0A 3CC4T 1BI0A 3UPUA 3SD4A 2RD1A 1HXDA 4MZTA 3G4ST 2ZCFB 4BE1A 1X75C 2XHCA 4C92B 4M7AA 2MAMA 3M57A 4RCCA 5GAMj 3CCQT 1D3BA 5A0DA 4ZN3A 4M75F 1YITA 1U1SA 4BD3A 1X01A 3EAEA 2M1HA 4GLKA 3SB2A 3LW5E 2O4XB 4F7UB 1I8FA 2PVOB 2HBPA 2YRVA 5C6SA 2V8JA 1M5Q1 2XKOC 3GLXA 2DIGA 5LJ3f 1YIJA 1H3ZA 4PNOA 4M75C 3CBPA 1YJWA 4M7DA 3OS2A 2JZ2A 3PT9A 5GAOl 4OGEA 4XTVA 4A4FA 3L2UA 3OS0A 3R6OA 4M78C 2QQBA 4OB3B 5DM7R 3CCLA 2LDMA 4C92G 1N8RC 3G6ET 5LJ3j 1U1TA 4OP0A 4XTZA 3CPFA 5I2SA 3CC7T 1VQLA 2DZ9A 4YTLA 4MZPA 2PVDB 4C92D 3QDRB 3DLMA 3JCMf 3JSCA 4LD6A 4N0AC 4BI4A 5GANf 4RG2A 1XNIA 5GAN4 3MEVA 4EMKB 4M7DE 1AHJB 3VUZA 3CCUT 2R57A 4DA4A 4F7UG 1QW1A 4JUVA 4C0GA 4L5GA 2EQJA 3CXCA 4M7AB 4LD9K 2R5MA 2RI3A 4DQ2A 4ELZC 1LJOA 2XIDA 3OS5A 3JCMP 4C5IA 2LC4A 4MZMA 3EFSA 1QP2A 4XTUA 1MHNA 2ZPBB 3MCAB 3X24B 3OMGA 3I56T 3LGFA 3CCRT 1KQ2A 4B9XA 1WQ7A 3URGA 4E7LA 4QVCA 5GANj 3VV0A 3OBYA 1QVFS 3HRTA 5LJ5j 1JJ2A 3RKWA 1UGSB 5KE3A 4E47A 3CCVA 4XQ3A 4PJOF 2K3YA 4XU1A 1NJIU 4DOVA 1Y96A 1YHQT 1KC8C 4EMHA 1VQ8A 4ELYC 3ZFJA 4OGCA 2D0QB 2E70A 1K73C 3OW2A 4A53A 3OSVA 3G7ZA 4IKFA 2JTMA 1OYXA 2MMPA 4FU6A 4QQ6A 5KE2A 4PL6A 5GAOq 3CPWA 3META 3QYGB 2EJGA 2DTOA 3KUFA 3OYMA 4BDYA 4PJOC 3I55A 3OYYA 4C0DC 3JB9H 1BYMA 2QI2A 4M7AG 1BKBA 2QQAA 3JCMX 1VQPT 2ZPHB 2C06A 3LYIA 1Y07A 4GY5A 5CIUA 2EJFA 4C5GA 3CMEA 2LX9A 1VQ9A 1VQ6A 4Y28E 5FRMA 4ZTJA 2DXUA 4ZN1A 4JDSA 2XICA 3M55A 4M7AD 4LDWA 4C8QC 5GAMg 1B34A 3SFMA 4KUDK 3FJPA 1M8VA 3DLLA 4OB1B 3OYJA 2WSCE 2OTJT 1I81A 4ZGDB 4E7KA 3G71A 3S6WA 4J83A 2DXBA 1WQWA 5FU7B 2JN0A 4D6WA 5D6XA 1GXIE 2QQRA 2VC8A 4LDUA 3V8KA 3CCET 2VXEA 2K5IA 2PUKB 2XI9A 3M59A 1YJNA 2JVVA 2ZPGB 3E19A 3MP1A 4LDYA 3QYHB 4E7JA 1BIBA 3VJPA 4FL6A 3JCMc 3EFRA 4F7UA 2L89A 3PTAA 3NTKA 3OYAA 4BY6C 2M16A 3FDRA 2E12A 1Y96B 2O01E 2DPPB 1VQ5A 2XDDA 4C92E 1VQOA 1YI2A 2X4JA 4QVDA 4EDUA 1NPRA 5HKCA 3GPLA 2M9UA 5LJ3g 2GF7A 2KY9A 4NS5A 1VQ7A 5FROA 3V7CA 4BY6B 2RI2A 4BUGA 1NZ9A 2RJFA 3CEYA 3GNGA 3PFSA 2CZ0B 1M1KC 4V2SA 2YLBA 3CC2A 4M75A 4F7UE 2K5FA 2E6NA 1KHIA 2ZZDA 3OYDA 2DTHA 2X4YA 5CKDA 2KVQG 4M78A 1JB0E 5KH6A 2FHDA 1KHCA 2FYKA 3JB9J 5A0LA 1VQMT 5KCHA 1B34B 1BI1A 2EQUA 3GNFB 4J6WA 2EIFA 1VQKT 2XG8D 4HKEA 3LWIA 5HK0A 3JCMg 1K9MU 2CZ1B 3NTIA 5GANg 5LJ5g 3CCJA 3JCMb 4NL3A 4N0AA 4P5NA 3V8JA 2QEXT 1U8RA 2E10A 1K8AC 3RERA 2BKDN 1KQSS 3FEOA 4M77F 4Y91A 4M78F 3OYIA 4BACA 3ER0A 5GMKe 3PMIA 3F70A 3HPWA 2ZPIB 1M4ZA 3INZA 3QKJA 4L59A 2D6FA 3RMQA 5DLOA 5GMKh 3P8BB 1Q82U 1M90C 1YBYA 2EAYA 4X34A 1R8OB 2R5AA 2VYTA 3FRNA 5C0MA 4M7AE 3CXCS 1PSFA 3L2VA 4HCCA 1YJ9T 4A4HA 2MI6A 4M77C 4OB2B 4N4GA 1N9RA 3C95A 2WACA 3C94A 3VYHB 5I21A 4BE0A 4O6JA 3BDUA 4KUIA 3HHTB 5GAN6 5GMKl 3OYGA 2RHIA 3JCMQ 3OBWA 2EQMA 3UWNA 3RIRA 4M75B 1JBMA 1N6AA 4ME7A 1VQ4A 1S72A 3T9NA 3S3OA 2EFIA 1W2BS 5J39A 1FXXA 4KBMB 3CCSA 2JTFA 2RHXA 4M78B 4E7IA 4HCBA 1Q81C 3OMCA 5LJ5f 3OW2S 1YITT 5CKHA 2LCLA 4PJOA 2DAQA 2E41A 2OTLA 1TH7A 4NOYA 2P4TA 3ZEHA 4UC4A 3X28B 5CO7A 3QSUA 3QPHA 3JB9G 4IURA 3CMAA 4HT8A 5DY9A 3JCMV 1Q7YU 5J26A 2CZ7B 3ASKA 5GMKm 4RMOA 2K5LA 2RH2A 2PVGB 5M9OA 2RHYA 1YIJT 2HD0A 4C8QA 3JB9D 3L2ZA 2DK3A 2P0PA 1YJWT 2DO3A 3QBYA 1RL2A 3TEEA 1W4SA 3LGLA 3MHXA 1VIFA 3E1SA 1O75A 3OYKA 4M75G 3C4SA 3HL8A 3JAME 1G3TA 3CCLT 3RMSA 2F5TX 3P8HA 2WSFE 4J7IA 3JRZA 4M78G 4KULA 1QVGA 4C8QF 4M75D 4BI3A 1VQLT 2GFAA 2CKKA 2K3XA 3H8ZA 4IUUA 3J80E 1Q86U 2V8KA 3OYEA 4A4KA 2RO0A 3NFCA 3CCMA 2QA4A 2CGHA 4M78D 2E65A 3E9FA 4FIBA 1V29B 1M1FA 1N8RU 2RJCA 4JRQA 4BE2A 4MDXA 1FWZA 3TU4K 1IZ6A 2DD5A 2E5QA 4XU3A 1OI1A 2DKGA 4EPCA 2A3LA 4PJOB 4C0DB 2EWNA 2RK2A 1OZ2A 3SWNC 4R55A 3OB9A 3V7SA 3O8VA 1I4K1 3QUIA 1VQNA 3CD6A 3CCVT 1UGRB 3PIOA 5FU6C 3GIBA 2XDPA 1EIFA 2GFUA 4A4EA 3S3MA 1X6OA 1VQ8T 4PLLA 1WJQA 3X26B 4C8QB 2EQKA 3C12A 3CBMA 2QTXA 4XAXB 4Z02A 2EKOA 4XU0A 3QZ5B 1VIEA 1QVFA 1KQ1A 2R58A 5IN1A 3J7AF 3WVEB 3FIFA 5LJ3e 3GP8A 1KD1U 3MO8A 2HQEA 3J81E 2QQ9A 4X9CA 3LX7A 1SSFA 1KC8U 2JUFA 2A7YA 2RJDA 2JOYA 3HRUA 5LJ3h 3I55T 1K9MC 2YLCA 1K73U 1Y71A 2V8IA 3DKMA 3CC4A 3PGGA 1VQ9T 3CMET 1VQ6T 4PJOG 3A8GB 3WXMB 2PQWA 3OSSC 3VYGA 3G4SA 4LDXA 1WPYA 1UEBA 2MWPA 3L42A 4EMGA 4ATOA 1WJRA 3CCQA 4XTWA 3M58A 1XTDA 1QP3A 3HKSA 4PJOD 2QQSA 5DLQE 2MF2A 2DJZA 5CK9A 3JCMe 2G3RA 3M53A 3DB3A 3OS1A 4M77A 3G71T 1N9SA 4C92F 3MEAA 4ZGEB 4C8QG 5FRNA 1YCYA 3RESA 3JCMh 3OYLA 3OYHA 4VUBA 4HCZA 4O5VA 5GANh 4PKCC 1YJNT 1ZBXA 1M9SA 4C8QD 3P8DA 4MMLA 1Y7XA 2ZPEB 3BW1A 3BDLA 2DEQA 4MDWA 3CBOA 2VUBA 4A54A 4JRIA 2CS7A 4J8OA 3RKYA 2BIVA 2Y4YA 4C92C 3MEUA 4B9WA 4M75E 1VQ5T 1H641 2DVEA 2LNVA 3S3NA 1VQOT 2GQVA 2LVMA 2RHZA 3NTHA 3OQ5A 3KBGA 4JRKA 4QVZA 4XU2A 5AYFA 2E6ZA 4M78E 3L2WA 2X4WA 2KSSA 5CKFA 2FL7A 3G6EA 1VQ7T 4MMKA 3QG1A 3CC7A 2FB7A 2GCXA 2RJEA 4OMFB 3FC3A 1Q7YC 5GAN3 3CC2T 3KXTA 1M1GA 1O9SA 4FM4B 3UDCA 2QXFA 3CCUA 3A8LB 3L2RA 4HT9A 2EYQA 4XK8E 2ZGWA 1UGQB 4II1A 2BUDA 2AHJB 1JJ2S 1NJIC 2VGMA 1I5LA 2E1HA 1M1KU 1G5VA 1HK9A 3V8LA 2XDBA 4BB7A 4E7HA 3QXEB 2F5KA 4WF2A 3UT1A 2XU8A 4M77B 3I56A 3CCRA 1YI2T 4M7AF 3HSBA 3VU3C 3OA6A 3JCMW 3CCJT 2L5QA 4RKUE 5IAYA 3MP8A 3GF5A 2P0KA 3QIIA 4FT2A 2RI5A 1QVGS 3M9QA 3CPWS 3OY9A 1UB4A 1YHQA 1G3YA 2QDYB 4OB0B 1OZ3A 4RCBA 4C0FA 4EMKC 1Q86C 1JRIA 1UGPB 1BI2A 5CKBA 3JB9I 2DZCA 2RA2A 2LQ8A 4X9DA 4JLGA 2F69A 4M7AC 2VV5A 1KQSA 5D6WA 1K8AU 2CZ6B 3V7RA 3SWNA 2PU9B 2HQXA 5GAN5 4M7DF 3BFMA 3MP6A 5IT9E 3FB9A 4QQDA 2X35A 3QJ6A 3DB4A 1VQPA 2I2LA 4PJOE 3ME9A 3VKIA 5A0GA 1QVPA 3L1AA 5GAOm 1NE8A 4L6V5 4CI0C 3A8OB 3MEWA 4J6XA 5GAMd 2VGNA 3BY7A 5CAIA 2IVWA 1LNXA 2K2VA 2Y4XA 4M77G 5GMKi 3PIPA 1M90U 1D3BB 3TCJA 2H3JA 1VQ4T 4J7FA 1S72T 3Q1JA 1PSEA 1XOVA 3A8HB 4M7DC 1P92A 3SDZA 2FVUA 5GAMe 5CVIA 3CCST 4C8QE 4M77D 4FSXA 3H6ZA 5CCAA 2OTJA 4JS5A 2HNIA 5GAN2 1KD1C 4N4HA 2OTLT 2NLUA 4C0ZA 2DXTA 3PNWC 3QHSA 5GAMh 3CCEA 1W2BA 1NPPA 3CMAT 2XD0A 4BI8B 5D6YA 2Y90A 5CQYA 5GAN7 4JJNK 2P0QA 4M7DB 1ZHIA 4OVAA 1Q81U 3OYCA 1WJSA 5J3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3INZ A;  3JCM J;  5LJ3 d;  5GMK j;  4PJO D;  4M7A B;  5GMK h;  4DQ2 A;  3JCM e;  2DJZ A;  1LJO A;  3JCM P;  2EAY A;  4XTX A;  4M77 A;  1N9S A;  4C92 F;  3EFS A;  4M7A E;  4XTU A;  4C8Q G;  3HFO A;  4HA8 A;  1YCY A;  5GAN 8;  2RB6 A;  4NL2 A;  4M77 C;  3RES A;  3SWN B;  1N9R A;  1WQ7 A;  3JCM h;  1KQ2 A;  4QVC A;  5I21 A;  5GAO p;  5GAN h;  5GAN j;  5GAO n;  5LJ5 j;  3BDU A;  3RKW A;  2DTI A;  5GAN 6;  5GMK l;  4C8Q D;  4XQ3 A;  4PJO F;  4XU1 A;  3JCM Q;  5GAO r;  4MML A;  4EMG A;  3BW1 A;  1Y96 A;  2DEQ A;  4C92 A;  3RIR A;  4A54 A;  4M75 B;  4JRI A;  1JBM A;  3RKY A;  4EMH A;  4C92 C;  1MGQ A;  4M75 E;  4A53 A;  1H64 1;  2DVE A;  3QO3 A;  3JCM d;  4M7D G;  4M78 B;  1WNL A;  5GAN d;  4JRK A;  4XU2 A;  5LJ5 f;  5GAO q;  2RM4 A;  4PJO A;  5LJ5 d;  2EJ9 A;  2E41 A;  2EJG A;  4M78 E;  1TH7 A;  2DTO A;  4J6Y A;  4NOY A;  4PJO C;  3JB9 H;  4M7D D;  3QSU A;  4MMK A;  2VXF A;  2K57 A;  3JB9 G;  2YHT A;  4M7A G;  5GAN e;  3JCM X;  4HT8 A;  5DY9 A;  3JCM V;  5GMK m;  5LJ5 e;  2E64 A;  2FB7 A;  2EJF A;  4XTY A;  5GAN 3;  3RKX A;  1BIA A;  4C8Q A;  2DXU A;  3M4G A;  3JB9 D;  4M7A D;  3L2Z A;  4C8Q C;  5LJ5 h;  1B34 A;  5GAM g;  4HT9 A;  2ZGW A;  3FJP A;  1M8V A;  3RUX A;  1I5L A;  1I81 A;  2E1H A;  4M75 G;  4F7U F;  3AHU A;  1HK9 A;  1WQW A;  3V8L A;  5GAM f;  2JN0 A;  3HFN A;  4JLI A;  4WF2 A;  4M77 B;  2VC8 A;  4J5Y A;  3V8K A;  3JB9 F;  4M7A F;  3HSB A;  2VXE A;  4M78 G;  1LOJ A;  3VU3 C;  3JCM W;  4M77 E;  4M75 D;  4C8Q F;  1BIB A;  4EMK A;  3JCM c;  3EFR A;  4F7U A;  2CGH A;  2RD1 A;  4M78 D;  2E65 A;  1HXD A;  4RCB A;  1JRI A;  4EMK C;  1Y96 B;  4C92 B;  3JB9 I;  2DZC A;  2RA2 A;  4M7A A;  4RCC A;  4X9D A;  5GAM j;  1D3B A;  4C92 E;  4M7A C;  4M75 F;  4QVD A;  4XU3 A;  3V7R A;  1U1S A;  3SWN A;  1X01 A;  5GAN 5;  2DKG A;  5LJ3 g;  4M7D F;  3BFM A;  4PJO B;  3FB9 A;  2EWN A;  3SWN C;  3V7C A;  3SB2 A;  2I2L A;  4PJO E;  3V7S A;  1I8F A;  1I4K 1;  3QUI A;  4F7U B;  3L1A A;  5GAO m;  4V2S A;  2YLB A;  4J6X A;  4M75 A;  1M5Q 1;  5LJ3 f;  5GAM d;  4F7U E;  3BY7 A;  5CAI A;  4M77 G;  1LNX A;  3GIB A;  5GMK i;  4PNO A;  4M75 C;  4M7D A;  1D3B B;  2DTH A;  4C8Q B;  5GAO l;  4M78 A;  2QTX A;  4XTV A;  2FYK A;  4XU0 A;  4M7D C;  3JB9 J;  1KQ1 A;  5GAM e;  4C8Q E;  1B34 B;  4J6W A;  3FIF A;  4M77 D;  4M78 C;  5LJ3 e;  2HNI A;  5GAN 2;  4C92 G;  3JCM g;  2DXT A;  4X9C A;  5GAM h;  3QHS A;  5GAN g;  5LJ3 j;  5LJ3 h;  1U1T A;  4OP0 A;  4XTZ A;  2YLC A;  5LJ5 g;  3JCM b;  4NL3 A;  2DZ9 A;  2Y90 A;  4N0A A;  3V8J A;  5GAN 7;  2E10 A;  3RER A;  3PGG A;  4C92 D;  3JCM f;  4M77 F;  4Y91 A;  4PJO G;  4M78 F;  4N0A C;  4M7D B;  5GAN f;  5GMK e;  5GAN 4;  4EMK B;  4M7D E;  1WPY A;  4F7U G;  4JUV A;  4XTW A; 
#chains in the Genus database with same CATH topology
 3JCM J;  2BE7 D;  2LT4 A;  2F2W A;  3UAT A;  5GMK j;  1VQ7 Q;  2AIR B;  5GAN 8;  4RG8 A;  2RB6 A;  3SWN B;  2M0O A;  3QJY A;  2BTT A;  2MCN A;  2DMO A;  1AWX A;  2KAF A;  3VS0 A;  4DOW A;  2RF0 A;  3CCM T;  4FW1 A;  4IUT A;  1AEY A;  3OYF A;  1MGQ A;  3QO3 A;  3JCM d;  3CCJ Q;  2K4Y A;  4J6Y A;  1NEG A;  1VUB A;  3L2Q A;  1IRE B;  2XMF A;  1Q82 C;  3CD6 T;  5LJ5 e;  5A2Q E;  3E9G A;  4XTY A;  5L8R E;  1ABO A;  1BB9 A;  5FWB A;  2QGF B;  1GCQ C;  4IUQ A;  8ATC B;  4QQG A;  2EGC A;  3HFN A;  4JLI A;  4J5Y A;  2HAX A;  1LOJ A;  3X20 B;  1N27 A;  3UA6 A;  1U06 A;  3CC4 T;  4LDV A;  2IG0 A;  1BI0 A;  3SD4 A;  1WHK A;  2VKN A;  2ZCF B;  4C92 B;  2MAM A;  3CCQ T;  1D3B A;  2GTO A;  3REB B;  2O2O A;  1G83 A;  1YWP A;  1U1S A;  1X01 A;  2CP2 A;  2EQI A;  2E5K A;  4GLK A;  2EW3 A;  3LW5 E;  2E3H A;  2PVO B;  2RPN A;  2YRV A;  3QDF A;  1H3Z A;  1VQ8 Q;  4DBQ A;  1SSH A;  4XTV A;  4KGZ B;  3OS0 A;  1PKT A;  1TOV A;  4OB3 B;  3TSW A;  4OP0 A;  3CPF A;  1ZBJ A;  4YTL A;  4EMK B;  3CCU T;  3EGX B;  3U23 A;  1V1C A;  4F7U G;  4LD9 K;  5KYU A;  1LJO A;  4C5I A;  1SRL A;  1QP2 A;  2DL4 A;  2ZPB B;  3MCA B;  3X24 B;  3OMG A;  1QMC A;  3OBY A;  3RKW A;  4PJO F;  1NJI U;  1Y96 A;  1IO6 A;  4EMH A;  4A53 A;  3OSV A;  2MYS A;  4IKF A;  1WX6 A;  2MMP A;  3CPW A;  5GAO q;  4Y92 A;  4BDY A;  1C6V X;  1S1N A;  2J6O A;  4C0D C;  2QI2 A;  4PFP A;  4Y28 E;  5FRM A;  2OX7 A;  3EGD A;  2Z0W A;  4M7A D;  3D7S B;  1GCQ A;  3EG0 A;  1B34 A;  2DRM A;  1Q82 R;  2OTJ T;  1I81 A;  2YUN A;  2JN0 A;  2YUQ A;  2QQR A;  4LDU A;  3EGU A;  2XI9 A;  1YJN A;  2JVV A;  3E19 A;  4E7J A;  2RQW A;  3RBB B;  2HSP A;  1M2V B;  2E12 A;  1VQ5 A;  4E7S A;  1VQO A;  1YI2 A;  4AMC A;  1NPR A;  3CC7 Q;  2M9U A;  1VQ7 A;  1Q7Y R;  3HTR A;  4JPB W;  2RI2 A;  4BUG A;  2RJF A;  3GNG A;  1M1K C;  2LQN A;  2IPO B;  2X4Y A;  5CKD A;  2CDT A;  4LUD A;  2FHD A;  5IH2 A;  1KJW A;  1VQM T;  3CCR Q;  3I56 Q;  2EIF A;  5HK0 A;  3JCM g;  3NGP A;  1JEG A;  3NTI A;  3CCJ A;  1U8R A;  1MND A;  1I0C A;  1LVK A;  2BKD N;  4Y91 A;  4BAC A;  2ZPI B;  3INZ A;  3MKD A;  1YFN A;  2PNI A;  2VYT A;  4M7A E;  2HDA A;  1KSW A;  1NLP C;  4OB2 B;  1N9R A;  2FRW A;  3C95 A;  3VYH B;  2MPX C;  4KUI A;  3HHT B;  5GMK l;  2YDL A;  3OYG A;  1EZZ B;  2VAS A;  1RLQ C;  1K0X A;  3LH5 A;  2L3Q A;  1KD1 R;  2HCK A;  5J39 A;  4KBM B;  1X27 A;  4Z8A A;  4HCB A;  2QK0 A;  5LJ5 f;  5CKH A;  1X2Q A;  2VVK A;  4FW2 A;  4NOY A;  1RI9 A;  2CH4 W;  4HT8 A;  5DY9 A;  2A0F B;  2CZ7 B;  4RMO A;  1VQN Q;  2D8J A;  2RH2 A;  2RHY A;  1YIJ T;  2HD0 A;  2KXC A;  1YJW T;  1MMA A;  1OPK A;  1ZA2 B;  3E1S A;  4E7Z A;  4M75 G;  2F2X A;  2F5T X;  1R0B G;  2A37 A;  4M78 G;  5IHN A;  4LE9 A;  4RTX A;  2V8K A;  4A4K A;  2QA4 A;  3EFO B;  2CGH A;  2E3I A;  3E9F A;  1N8R U;  1ZSG A;  2RJC A;  4QKU A;  1X6B A;  1IZ6 A;  3UF4 A;  4PJL A;  1RAG B;  2EWN A;  2RK2 A;  3NMZ C;  3V7S A;  2DET A;  2XDP A;  1AWJ A;  1X6O A;  4PLL A;  4D6W A;  3C12 A;  4XU0 A;  3QZ5 B;  3PVL A;  1KQ1 A;  2R58 A;  2CP3 A;  5IN1 A;  1YJ9 Q;  1M1K R;  3FIF A;  3TSZ A;  5LJ3 e;  3CQT A;  3GP8 A;  2J6K A;  1H8K A;  3H0F A;  4X9C A;  3LX7 A;  1ZX6 A;  2JUF A;  3I55 T;  2RJD A;  2JOY A;  2O88 A;  3A8G B;  3WXM B;  3OSS C;  4JZ3 A;  2YWW A;  1X43 A;  1PC0 A;  2MWP A;  4ATO A;  1YIT Q;  1K8A R;  2RMO A;  4PJO D;  4KH0 B;  5DLQ E;  2MF2 A;  2DJZ A;  2G3R A;  1PG5 B;  3DB3 A;  4J9E A;  2O31 A;  1K9A A;  5FRN A;  4C8Q G;  1YCY A;  4J9D A;  1JQQ A;  1M9S A;  4X1V A;  2CS7 A;  1NM7 A;  1YHQ Q;  2BIV A;  2O9V A;  2RQV A;  1H64 1;  1ZLM A;  2GQV A;  4XU2 A;  3KBG A;  4KGV B;  2KSS A;  3H41 A;  2HZY A;  2P84 A;  1CSK A;  3CC7 A;  4ANJ A;  2GCX A;  1M27 C;  4OMF B;  1QKW A;  1W1F A;  3UDC A;  3A8L B;  2EYQ A;  2ZGW A;  4II1 A;  2YXY A;  1NJI C;  1UEC A;  1HK9 A;  3QXE B;  3UT1 A;  3I56 A;  3CCR A;  3CCV Q;  2GBQ A;  3OA6 A;  1MV3 A;  2L5Q A;  3RDV A;  3QII A;  1UJ0 A;  1A0N B;  4F17 A;  1K73 R;  2SEM A;  1UB4 A;  1QLY A;  1OZ3 A;  4RCB A;  1SHF A;  1UGP B;  1WXT A;  2C0O A;  1SF9 A;  2F69 A;  5D6W A;  2CZ6 B;  2PU9 B;  2HQX A;  1MV0 B;  4RTV A;  3CME Q;  2X35 A;  2COY A;  4PJO E;  3VKI A;  1FMW A;  4AG2 C;  4CI0 C;  1NYG A;  3A8O B;  3MEW A;  4J6X A;  2EYZ A;  1M90 U;  4M77 G;  1D3B B;  3TCJ A;  3Q1J A;  4OMP A;  3G71 Q;  4OMO A;  3VS6 A;  3CCS T;  5CVI A;  1UHC A;  5CCA A;  2EGA A;  2KYM A;  3PNW C;  1D09 B;  5D6Y A;  2P0Q A;  4OML A;  1ZHI A;  2QYZ A;  3FRN A;  1QKX A;  3LLR A;  1VYV A;  4IUV A;  2CT4 A;  2B8A A;  5FU7 C;  4A4G A;  2B86 A;  4NL2 A;  3CC2 Q;  4ZTF A;  4CC3 A;  5GAO p;  3EG9 A;  3X25 B;  2LTO A;  3VS2 A;  2ZPF B;  2LP5 A;  2DD4 A;  5FLX E;  2LZ6 B;  1OV3 A;  4KGX B;  2CT3 A;  4M7D G;  1VA7 A;  2KDS A;  2RK1 A;  2JS2 A;  2RM4 A;  4Q5W A;  2EJ9 A;  5LJ5 d;  4PLI A;  1W6X A;  4FT4 A;  2M51 A;  2O4X A;  3M0U A;  2KT1 A;  1WGS A;  2VWF A;  5CR2 A;  2VXF A;  2NUT A;  2YHT A;  4KT0 E;  3M5A A;  2XK0 A;  1BIA A;  2MWO A;  2LJ0 A;  4FCY A;  5LJ5 h;  1RAH B;  5KYW B;  1F1B B;  5IXB A;  2JXB A;  1MUZ A;  4BDZ A;  1GFC A;  3N5B B;  3AHU A;  4CRI A;  5GAM f;  1YJ9 A;  2L3R A;  1RI0 A;  2DIQ A;  3HRS A;  4B6M A;  2CYZ B;  3BE3 A;  4JS4 A;  5CQX A;  5EG2 A;  2F2V A;  2KNB B;  2QGG A;  4OMQ A;  2CP6 A;  4BE1 A;  1X75 C;  1Q81 R;  3VS4 A;  2OTL Q;  1ZUY A;  5A0D A;  1YIT A;  2D0N A;  1BCO A;  2CSI A;  1EX4 A;  3SB2 A;  1I8F A;  5C6S A;  5KYY B;  1GRI A;  2V8J A;  3GLX A;  2XKO C;  5LJ3 f;  4M75 C;  1RAD B;  2NYS A;  3PT9 A;  1KFZ A;  4A4F A;  3L2U A;  1KIK A;  4M78 C;  1AWO A;  2QQB A;  2LDM A;  4C92 G;  1N8R C;  1TTH B;  3G6E T;  2DIL A;  2K7A A;  2ABL A;  2DZ9 A;  4MZP A;  2FEI A;  1PD1 A;  3DLM A;  3JSC A;  4LD6 A;  5GAN f;  1C0M A;  4RG2 A;  1AHJ B;  3VUZ A;  1QW1 A;  4L5G A;  2EQJ A;  4M7A B;  2R5M A;  4DQ2 A;  2BZY A;  4ELZ C;  1TUD A;  2XID A;  3JCM P;  2A08 A;  4F04 B;  2BE9 B;  3CD6 Q;  1AVZ C;  3VV0 A;  5ECA A;  5LJ5 j;  1JJ2 A;  3CCV A;  1UGS B;  5KE3 A;  4E47 A;  2YRC A;  1WLP B;  2K3Y A;  4OGC A;  2D0Q B;  2C0I A;  4RTW A;  1HYO A;  2JTM A;  4HVV A;  5GJW B;  1OYX A;  4PL6 A;  3QYG B;  4QT7 A;  3CC4 Q;  1BKB A;  1TXQ A;  1QCN A;  2C06 A;  5CIU A;  2EJF A;  1VQ9 A;  3CME A;  2K2M A;  3CCQ Q;  1ZSZ B;  3M55 A;  1QQJ A;  4C8Q C;  1WFW A;  2HKQ B;  1PHT A;  3DLL A;  3G71 A;  1WQW A;  3V8K A;  3CCE T;  2H3E B;  4LDY A;  1UGV A;  1BIB A;  1I5O B;  1OX8 A;  3OYA A;  1D1B A;  1B07 A;  1M2O A;  1NYF A;  3FDR A;  2O01 E;  2HMA A;  1YWO A;  4QVD A;  4EDU A;  2KI7 A;  3GPL A;  3IQL A;  2GF7 A;  2KY9 A;  2DX1 A;  4NS5 A;  5FRO A;  3V7C A;  1J3T A;  2PTK A;  1TSF A;  4V2S A;  3CCU Q;  3CC2 A;  4M75 A;  3GBQ A;  1B7T A;  2E6N A;  4M78 A;  1JB0 E;  2FYK A;  4AFZ C;  5A0L A;  3R6N A;  1BI1 A;  3GNF B;  2J06 A;  2KEA A;  1VQK T;  2XG8 D;  4HKE A;  1SRM A;  2L3P A;  4D8K A;  5LJ5 g;  3JCM b;  2QEX T;  2DYB A;  2C0T A;  3OYI A;  3ER0 A;  5GMK e;  3PMI A;  3F70 A;  2CP5 A;  4L59 A;  2W10 A;  4EIK A;  3RMQ A;  5DLO A;  1M90 C;  1R8O B;  5C0M A;  4A4H A;  4M77 C;  4J9I A;  4O6J A;  4E2F B;  5GAN 6;  2DFU A;  1D1A A;  2EQM A;  3UWN A;  1YP5 A;  2A28 A;  3RIR A;  1JBM A;  2QA4 Q;  2OTJ Q;  1VQ4 A;  2JTF A;  3G1J A;  2OTL A;  1TH7 A;  1I07 A;  3QSU A;  3JB9 G;  1AWW A;  1V76 A;  1UDL A;  3ASK A;  1WXU A;  4C8Q A;  2GTJ A;  1I1J A;  2DK3 A;  2P0P A;  2DO3 A;  3MHX A;  1VIF A;  1WA7 A;  3MJX A;  3CCL T;  3RMS A;  3CPW P;  4J7I A;  2J05 A;  1JU5 C;  1VQL T;  2GFA A;  2K3X A;  4IUU A;  4J9G A;  2KRN A;  3NFC A;  3CCM A;  1VQM Q;  1WIE A;  2KBT A;  1AOJ A;  4XU3 A;  1LPL A;  1OI1 A;  2A3L A;  4PJO B;  3PVQ A;  3SWN C;  2DL5 A;  1EFN A;  4PFO A;  3CD6 A;  4DBR A;  1UGR B;  1UTI A;  2E4H A;  3PIO A;  1VQ8 T;  1WJQ A;  3CBM A;  4XAX B;  2QTX A;  1QVF A;  2YT6 A;  2FZG B;  1ZUK A;  2ECZ A;  2F1L A;  2HQE A;  2HKN A;  3FJ5 A;  3NHN A;  3J81 E;  1SSF A;  2COW A;  3VS5 A;  2A7Y A;  1KC8 U;  5LJ3 h;  3HRU A;  1K9M C;  2CUB A;  1Y71 A;  2V8I A;  3I5R A;  3CC4 A;  1VQ6 T;  2PQW A;  1AZG B;  2HBW A;  4LDX A;  2KT8 A;  3L42 A;  4EMG A;  3CCQ A;  4XTW A;  2EKH A;  1QP3 A;  3HKS A;  3JCM e;  6AT1 B;  3M53 A;  3REA B;  3QWY A;  4M77 A;  3QWX X;  4RTU A;  4DBH A;  1YIJ Q;  5GAN h;  1ZBX A;  1YJW Q;  3BW1 A;  4A54 A;  3RKY A;  4FYY B;  4C92 C;  4B9W A;  3EH1 A;  1K0S A;  1E6H A;  3L2W A;  3QG1 A;  1CKB A;  1HSQ A;  5GAN 3;  1M1G A;  1O9S A;  2LQW A;  4FM4 B;  3CCU A;  2KE9 A;  3L2R A;  2AKK A;  2VGM A;  1WHM A;  3V8L A;  1JXO A;  4BB7 A;  4E7H A;  4WF2 A;  1TS9 A;  2XU8 A;  1N5Z A;  1RAI B;  3HSB A;  3VU3 C;  5D7U A;  3ZL7 C;  1Y57 A;  5IAY A;  3GF5 A;  2P0K A;  2RI5 A;  2MOX A;  3M9Q A;  3CPW S;  1Q95 G;  1G3Y A;  1Q86 C;  4C0F A;  4EMK C;  1IHV A;  1BCM A;  1MMG A;  1WHH A;  3I55 Q;  5KYN A;  1KQS A;  3V7R A;  1RAF B;  3SWN A;  5GAN 5;  3BFM A;  1GFD A;  4QQD A;  4KH1 B;  4RUG A;  1WHG A;  2K2V A;  4ESR A;  1MMN A;  1WXB A;  2QG9 B;  2H3J A;  4J7F A;  1S72 T;  1SEM A;  3UA7 A;  1P92 A;  3SEM A;  5GAM e;  1U3O A;  2OTJ A;  4N4H A;  3I5S A;  1W2B A;  1NPP A;  3CMA T;  2P4R A;  1C1A A;  1OQK A;  1JXM A;  4PFZ A;  1WHL A;  1BU1 A;  5I2M A;  1FX7 A;  2L8D A;  3A8M B;  4R56 A;  3A5Z B;  4C5E A;  2ZAE A;  2DTI A;  2H8H A;  5FU6 B;  2PUO B;  3VUB A;  4CC7 A;  4C92 A;  4TVR A;  1G3S A;  1KG1 A;  1VQM A;  2RN8 A;  1WNL A;  1G3W A;  4QW2 A;  2WSE E;  3LWH A;  3OYN A;  3I9Q A;  2K57 A;  5GAN e;  2OAU A;  1VQN T;  2LCC A;  3PMT A;  2DF6 A;  2NUZ A;  3M4G A;  1PCX A;  3OYB A;  4JRP A;  2JW4 A;  2DVJ A;  5HK3 A;  2LRQ A;  5KCO A;  5I22 A;  4JJC A;  2EBP A;  3M56 A;  4OF1 A;  2LQK A;  4EMK A;  1XQH A;  1D0X A;  2EYY A;  3EGX A;  3CCS Q;  1B3Q A;  3G4S T;  2XHC A;  4AFU C;  4ZN3 A;  4M75 F;  3VRY A;  2FZK B;  1IXD A;  4J9B A;  1BK2 A;  1M5Q 1;  1YIJ A;  2ED0 A;  2NWM A;  2JTE A;  3CBP A;  1YJW A;  3OS2 A;  2RNA A;  2FO0 A;  1IGU A;  2CP0 A;  3R6O A;  1H92 A;  4HVU A;  5DM7 R;  2DBM A;  2ENM A;  1U1T A;  3TQ7 P;  2EGE A;  1AD5 A;  1IHW A;  5I2S A;  1U5S A;  3JCM f;  4N0A C;  1VQ9 Q;  5GAN 4;  1X6G A;  4JUV A;  4AG1 C;  2QAZ A;  4AT1 B;  2RI3 A;  1M3C A;  2LC4 A;  2KRO A;  1MHN A;  1WQ7 A;  3URG A;  4E7L A;  2AKL A;  4XU1 A;  4DOV A;  1YHQ T;  1KC8 C;  3OW2 P;  2E70 A;  3OW2 A;  2COZ A;  1HD3 A;  5KE2 A;  4D8D A;  2DTO A;  1YCS B;  1PD0 A;  5FW9 A;  3I55 A;  3JB9 H;  4FYV B;  3EG2 A;  4M7A G;  3JCM X;  1VQP T;  1FMV A;  5IHI A;  4C5G A;  1Y0M A;  3VS1 A;  2SRC A;  4ZTJ A;  4JDS A;  1NBE B;  2M02 A;  4LDW A;  3SFM A;  1M8V A;  3FJP A;  3OYJ A;  1QWE A;  4ZGD B;  4E7K A;  3S6W A;  2DXB A;  5KYU B;  1GXI E;  2ZPG B;  3MP1 A;  3QYH B;  4FL6 A;  3JCM c;  3EFR A;  4F7U A;  3PTA A;  3NTK A;  4BY6 C;  4AFQ C;  2DA9 A;  4DEX A;  1Y96 B;  2DPP B;  3G6E Q;  5L23 A;  2DL3 A;  1D0Z A;  1G2B A;  2GGR A;  3CEY A;  2YLB A;  3NPF A;  1OX9 A;  4F7U E;  2K5F A;  1PRL C;  1OPL A;  1NJI R;  2KVQ G;  3EGD B;  4LNP A;  5KH6 A;  2HL5 C;  1KHC A;  1VQ4 Q;  3JB9 J;  1B34 B;  2EQU A;  4GBQ A;  4J6W A;  3LWI A;  1M3B A;  1K9M U;  1ACM B;  2CZ1 B;  2FPF A;  4N0A A;  1WI7 A;  1GBR A;  4LN2 A;  3FEO A;  4M77 F;  1OU8 A;  2PZ1 A;  4AFS C;  1PWT A;  1UG1 A;  2FPD A;  1M4Z A;  3QKJ A;  2D6F A;  1AZE A;  5GMK h;  2O9S A;  1YBY A;  2EAY A;  4X34 A;  2R5A A;  1K76 A;  1PSF A;  2M0Y A;  4N4G A;  2WAC A;  3C94 A;  5I21 A;  4BE0 A;  3M0R A;  1UHF A;  1X2K A;  1M3A A;  1MNE A;  3CCM Q;  3T9N A;  5KYX A;  3S3O A;  2EFI A;  4F14 A;  1FXX A;  3VS7 A;  3CCS A;  1WDX A;  1Z9Q A;  3CCE Q;  3OMC A;  3OW2 S;  3I35 A;  2DAQ A;  1IB8 A;  2ATC B;  2GNC A;  1KC8 R;  2P4T A;  3X28 B;  5CO7 A;  3QPH A;  3JCM V;  5J26 A;  5GMK m;  2K5L A;  2OJ2 A;  5M9O A;  1JJ2 P;  3QBY A;  3E2U A;  3TEE A;  2JMC A;  3LGL A;  4PJN A;  1O75 A;  3HL8 A;  4E6R A;  3JAM E;  2BZX A;  3P8H A;  1QVG P;  2WSF E;  2YRD A;  3JRZ A;  4KUL A;  1QVG A;  2IIM A;  4M75 D;  1D1C A;  3J80 E;  1Q86 U;  3OYE A;  1W70 A;  2RO0 A;  4M78 D;  1M1F A;  2ESW A;  1VQK Q;  4BE2 A;  4MDX A;  1FWZ A;  2DD5 A;  2E5Q A;  2QEX Q;  2DKG A;  4EPC A;  2NUP A;  2I0N A;  4C0D B;  4R55 A;  1GL5 A;  4Z89 A;  1EIF A;  3S3M A;  1VYT A;  1TWB A;  1QWF A;  1WHJ A;  2MK5 A;  1K1Z A;  3J7A F;  3WVE B;  4A63 B;  4J9H A;  2DNU A;  4KRT A;  1GBQ A;  2YLC A;  2LCS A;  1K73 U;  3DKM A;  1WZO A;  4PJO G;  1E6G A;  2K6D A;  2CSQ A;  1FMK A;  8AT1 B;  1WJR A;  3M58 A;  1CKA A;  2QQS A;  1T3L A;  2HSE B;  4C92 F;  3MEA A;  4ZGE B;  9ATC B;  5GJV B;  3RES A;  3JCM h;  2HEQ A;  4VUB A;  4O5V A;  4R0K A;  1MMD A;  4PKC C;  1YJN T;  2AZS A;  4C8Q D;  3P8D A;  3KFV A;  3BDL A;  1NG2 A;  4MDW A;  2DEQ A;  2HQH A;  4J8O A;  4M75 E;  1VQ5 T;  4OMM A;  3CCL Q;  2DVE A;  2LNV A;  2W0Z A;  1N8R R;  1VQO T;  5IHK A;  4JRK A;  2RHZ A;  3C0C A;  3NTH A;  3OQ5 A;  1QCF A;  3M0T A;  1OU9 A;  1YI2 T;  4M78 E;  1VQL Q;  5CKF A;  3G6E A;  1VQ7 T;  2ROL A;  2RJE A;  1Q7Y C;  1XJW B;  1T3S A;  2QXF A;  2QDL A;  4HT9 A;  2J6F A;  1PKS A;  4XK8 E;  2AHJ B;  1JJ2 S;  4J9C A;  1I5L A;  2E1H A;  1G5V A;  2YSQ A;  3VS3 A;  2F5K A;  1M8M A;  2LJ3 A;  4CC2 A;  3JCM W;  3CCJ T;  2LMJ A;  3MP8 A;  1TU0 B;  2D1X A;  1QVG S;  4ORZ A;  2RQR A;  4CC4 B;  1JRI A;  1BI2 A;  3JB9 I;  2DZC A;  2LQ8 A;  4JLG A;  4M7A C;  1ARK A;  3H0I A;  1K8A U;  1QCO A;  2JJ9 A;  3FB9 A;  1VQ6 Q;  5IXF A;  3DB4 A;  2EYX A;  1NEB A;  2I2L A;  3ME9 A;  2X3W D;  5A0G A;  1QVP A;  1NE8 A;  4Z88 A;  5GAM d;  3PIP A;  5CAI A;  2IVW A;  1LNX A;  2JT4 A;  5GMK i;  2AZV A;  1PSE A;  4M7D C;  3SDZ A;  2FVU A;  4C8Q E;  4M77 D;  4FSX A;  3H6Z A;  2HNI A;  5GAN 2;  1KD1 C;  2CH4 A;  2CUD A;  1PM3 A;  2DXT A;  2KRS A;  5GAM h;  3CCE A;  2XD0 A;  2L2P A;  2K3B A;  5CQY A;  5GAN 7;  2RQT A;  1Q81 U;  4IIM A;  1ZSZ C;  5KYW A;  3OYC A;  1UJY A;  5J3B A;  5LJ3 d;  4XTX A;  1QVF P;  1TUC A;  3HFO A;  4HA8 A;  4LUE A;  3ZBD A;  3TVT A;  5HY6 A;  2KQW A;  3M4Y A;  3AT1 B;  5GAO n;  4JJB A;  3LH0 A;  5GAO r;  3GOX A;  2QA4 T;  1JO8 A;  2KRM A;  2DXC A;  2D9T A;  4N4I A;  4IUP A;  3QZ9 B;  1LCK A;  5CKE A;  1DJ7 B;  2YUO A;  2V1R A;  5GAN d;  2JNG A;  4C5H A;  1VQK A;  2YUP A;  4M7D D;  3TRE A;  5KYY A;  3FLG A;  2KMT A;  2QEX A;  2RHU A;  2E64 A;  5LL6 S;  3RKX A;  3EG3 A;  4ZGJ B;  2FG0 A;  1M90 R;  1BI3 A;  2KK4 A;  2JMA A;  1ZQ1 A;  2X4X A;  3RUX A;  4F7U F;  3PE0 A;  3M54 A;  2CP7 A;  1TG0 A;  2LT1 A;  3JB9 F;  1KK7 A;  3HP9 A;  2V1Q A;  4M77 E;  3EG9 B;  1S72 Q;  3WVD B;  1SHG A;  3UPU A;  1M30 A;  2RD1 A;  1HXD A;  4MZT A;  4M7A A;  4WCI A;  3M57 A;  4RCC A;  5GAM j;  2DM1 A;  4RTT A;  1PNJ A;  4BD3 A;  1R77 A;  3EAE A;  3CMA Q;  2M1H A;  2KR3 A;  2K79 A;  2O4X B;  4F7U B;  2HBP A;  2NUT B;  2A36 A;  2DIG A;  2JM8 A;  4PNO A;  4M7D A;  1BBZ A;  2JZ2 A;  5GAO l;  4OGE A;  4DEY A;  1WYX A;  2DYI A;  4GLM A;  2DJQ A;  3CCL A;  1KQS P;  5LJ3 j;  4XTZ A;  2AK5 A;  3CC7 T;  1VQL A;  1YNZ A;  3EG1 A;  1ZSZ A;  1ZA1 B;  2PVD B;  4C92 D;  3QDR B;  4HXJ A;  4BI4 A;  1XNI A;  3MEV A;  4M7D E;  4DA4 A;  2R57 A;  4C0G A;  3CXC P;  1UFF A;  3CXC A;  1ABQ A;  1G8X A;  3OS5 A;  1OUL A;  4MZM A;  3EFS A;  5FWC A;  4XTU A;  3CCR T;  5I11 A;  3I56 T;  3LGF A;  1KQ2 A;  4B9X A;  4QVC A;  5GAN j;  4RTZ A;  2LX7 A;  1QVF S;  2RQU A;  3HRT A;  1HJD A;  4XQ3 A;  1W2B P;  3EHQ A;  1OEB A;  1VQ8 A;  4ELY C;  2CRE A;  4PJM A;  3ZFJ A;  1K73 C;  2EPD A;  3G7Z A;  4FU6 A;  4QQ6 A;  1K9M R;  3MET A;  2EJG A;  3KUF A;  3OYM A;  4WTO B;  4PJO C;  3OYY A;  2V26 A;  1BYM A;  2QQA A;  2J7I A;  4K11 A;  2ZPH B;  5EC7 A;  3G4S Q;  3LYI A;  1Y07 A;  4GY5 A;  2LX9 A;  1VQ6 A;  5KYX B;  2DXU A;  2XIC A;  5GAM g;  4KUD K;  4OB1 B;  1ZUU A;  2WSC E;  4J83 A;  3M0S A;  4HVW A;  5FU7 B;  5D6X A;  1RAB B;  2VC8 A;  2VXE A;  2K5I A;  2PUK B;  3M59 A;  1YN8 A;  1H3H A;  3VJP A;  2L89 A;  2DL7 A;  2M16 A;  2FRY A;  2XDD A;  4C92 E;  2X4J A;  5HKC A;  5LJ3 g;  1OOT A;  4BY6 B;  1NZ9 A;  1AT1 B;  3PFS A;  2CZ0 B;  1KHI A;  2ZZD A;  3OYD A;  2DTH A;  5KCH A;  2NUP B;  2MIO A;  2KYB A;  5GAN g;  1UE9 A;  4NL3 A;  3A98 A;  4P5N A;  3V8J A;  1Q86 R;  1K8A C;  2E10 A;  3RER A;  1KQS S;  4M78 F;  4HCK A;  4JJD A;  3HPW A;  2DBK A;  3P8B B;  1Q82 U;  1K4U S;  1Z9Z A;  1VQP Q;  3CXC S;  4HCC A;  1GCP A;  2FZC B;  3L2V A;  1YJ9 T;  2MI6 A;  3ULR B;  3BDU A;  2OI3 A;  2DEU A;  2RHI A;  3JCM Q;  4JZ4 A;  3OBW A;  5HCK A;  4M75 B;  1N6A A;  1IRX A;  2X9H A;  4ME7 A;  1S72 A;  1W2B S;  2RHX A;  4M78 B;  4E7I A;  1Q81 C;  2VB6 A;  4PJO A;  1YIT T;  2LCL A;  2E41 A;  2EVR A;  2L0A A;  3ZEH A;  4UC4 A;  4LXC A;  3JV3 A;  4IUR A;  3CMA A;  1Q7Y U;  4FYX B;  2X51 A;  2PVG B;  3JB9 D;  3L2Z A;  4ZNX A;  1RL2 A;  1SG5 A;  1W4S A;  1M2V A;  1IGQ A;  3OYK A;  3C4S A;  1PRM C;  4F16 A;  1G3T A;  4FYW B;  2AT1 B;  4BI3 A;  4C8Q F;  3H0H A;  2CKK A;  3H8Z A;  2K9G A;  3RNJ A;  2JS0 A;  2HL3 A;  1T0J A;  2E65 A;  4FIB A;  1V29 B;  1VYU A;  4JRQ A;  3TU4 K;  3EHR A;  2LJ1 A;  2LNH B;  4DBF A;  2FPE A;  2GQI A;  2G6F X;  1OZ2 A;  1RAE B;  3OB9 A;  3O8V A;  1I4K 1;  3QUI A;  1VQN A;  3CCV T;  5FU6 C;  1TUG B;  2QAS A;  3GIB A;  1FYN A;  2GFU A;  4A4E A;  2DRK A;  2D8H A;  3X26 B;  4C8Q B;  2EQK A;  4Z02 A;  4ZN1 A;  1SKU B;  2EKO A;  1VIE A;  2KXD A;  1UUE A;  1KD1 U;  3MO8 A;  4OMN A;  3H9N A;  2QQ9 A;  2BZ8 A;  1E7O A;  4IIO A;  3PGG A;  1VQ9 T;  3CME T;  3VYG A;  3G4S A;  1SPK A;  1WPY A;  1UEB A;  2X3X D;  1XTD A;  5AT1 B;  4PJJ A;  5CK9 A;  3OS1 A;  3SHW A;  3G71 T;  1N9S A;  3OYL A;  3OYH A;  4HCZ A;  4MML A;  1Y7X A;  2ZPE B;  2DER A;  2KGT A;  3A1P A;  3CBO A;  2VUB A;  4JRI A;  1VOM A;  2Y4Y A;  3M0P A;  2DE0 X;  3MEU A;  2EYW A;  3S3N A;  4QVZ A;  2LVM A;  5AYF A;  2E6Z A;  2X4W A;  2FL7 A;  4PK4 A;  1RAA B;  4M4Z A;  4MMK A;  2FB7 A;  3VRZ A;  3FC3 A;  3CC2 T;  3KXT A;  3EH2 A;  1RLP C;  7AT1 B;  2L3S A;  3EFO A;  1UGQ B;  2BUD A;  3MPU B;  2DLP A;  1M1K U;  4RTY A;  2XDB A;  4M77 B;  1D0Y A;  4M7A F;  4RKU E;  3O5Z A;  4FT2 A;  3OY9 A;  1YHQ A;  1T0H A;  2QDY B;  4OB0 B;  5CKB A;  2RA2 A;  4X9D A;  2DL8 A;  2VV5 A;  1RAC B;  3THK A;  2ED1 A;  4M7D F;  3MP6 A;  4FSS A;  5IT9 E;  2ROT A;  3QJ6 A;  1NLO C;  1R0C B;  1VQP A;  2JM9 A;  3L1A A;  5GAO m;  4L6V 5;  2VGN A;  3BY7 A;  2Y4X A;  1X69 A;  1VQ4 T;  1XOV A;  2QTV A;  3A8H B;  1RUW A;  3M0Q A;  4JS5 A;  2OTL T;  2NLU A;  4C0Z A;  1YJN Q;  3QHS A;  4BI8 B;  2Y90 A;  4JJN K;  4M7D B;  4OVA A;  3RR6 A;  1VQ5 Q;  1VQO Q;  1YI2 Q;  4J9F A;  1WJS A;  2OAW A; 
#chains in the Genus database with same CATH homology
 3LLR A;  4IUV A;  3JCM J;  1FX7 A;  2LT4 A;  5LJ3 d;  5GMK j;  2L8D A;  3A8M B;  4R56 A;  4XTX A;  2B8A A;  5FU7 C;  3HFO A;  3A5Z B;  4HA8 A;  4RG8 A;  4A4G A;  2RB6 A;  4NL2 A;  3SWN B;  4C5E A;  3ZBD A;  5GAN 8;  4ZTF A;  5HY6 A;  5GAO p;  2M0O A;  2KQW A;  3M4Y A;  3QJY A;  5GAO n;  3LH0 A;  3X25 B;  2DTI A;  2LTO A;  5GAO r;  2ZPF B;  5FU6 B;  3GOX A;  2DD4 A;  2PUO B;  2KAF A;  3VUB A;  4DOW A;  4C92 A;  5FLX E;  3CCM T;  2QA4 T;  2DXC A;  2D9T A;  5I2M A;  4IUT A;  4N4I A;  3OYF A;  4IUP A;  3QZ9 B;  1MGQ A;  4TVR A;  1G3S A;  5CKE A;  1KG1 A;  3QO3 A;  1VQM A;  3JCM d;  4M7D G;  1DJ7 B;  1WNL A;  2KDS A;  5GAN d;  2JNG A;  2RK1 A;  4C5H A;  1G3W A;  2RM4 A;  4QW2 A;  2WSE E;  4Q5W A;  2EJ9 A;  2K4Y A;  4PLI A;  5LJ5 d;  4J6Y A;  1VQK A;  3LWH A;  3OYN A;  1VUB A;  4FT4 A;  2O4X A;  4M7D D;  1WGS A;  5CR2 A;  2VXF A;  2K57 A;  3TRE A;  2YHT A;  3L2Q A;  5GAN e;  3FLG A;  1IRE B;  2KMT A;  2OAU A;  4KT0 E;  2QEX A;  1Q82 C;  2RHU A;  3M5A A;  2LCC A;  1VQN T;  5LJ5 e;  2E64 A;  5A2Q E;  3CD6 T;  3E9G A;  4XTY A;  5LL6 S;  3PMT A;  2XK0 A;  1BIA A;  5L8R E;  2MWO A;  3RKX A;  4ZGJ B;  3M4G A;  3OYB A;  4JRP A;  5LJ5 h;  1BI3 A;  5HK3 A;  2KK4 A;  1ZQ1 A;  2X4X A;  4IUQ A;  3RUX A;  2LRQ A;  4F7U F;  4BDZ A;  4QQG A;  3N5B B;  3AHU A;  4CRI A;  3M54 A;  5GAM f;  3HFN A;  4JLI A;  5KCO A;  1YJ9 A;  4J5Y A;  2LT1 A;  3JB9 F;  2HAX A;  2L3R A;  1LOJ A;  3HP9 A;  1N27 A;  3X20 B;  3M56 A;  4M77 E;  1RI0 A;  4OF1 A;  2DIQ A;  3HRS A;  4JS4 A;  2CYZ B;  2LQK A;  5CQX A;  5EG2 A;  3WVD B;  1XQH A;  4LDV A;  4EMK A;  2IG0 A;  3CC4 T;  1BI0 A;  3UPU A;  3SD4 A;  2RD1 A;  1HXD A;  4MZT A;  3G4S T;  2ZCF B;  4BE1 A;  1X75 C;  2XHC A;  4C92 B;  4M7A A;  2MAM A;  3M57 A;  4RCC A;  5GAM j;  3CCQ T;  1D3B A;  5A0D A;  4ZN3 A;  4M75 F;  1YIT A;  1U1S A;  4BD3 A;  1X01 A;  3EAE A;  2M1H A;  4GLK A;  3SB2 A;  3LW5 E;  2O4X B;  4F7U B;  1I8F A;  2PVO B;  2HBP A;  2YRV A;  5C6S A;  2V8J A;  1M5Q 1;  2XKO C;  3GLX A;  2DIG A;  5LJ3 f;  1YIJ A;  1H3Z A;  4PNO A;  4M75 C;  3CBP A;  1YJW A;  4M7D A;  3OS2 A;  2JZ2 A;  3PT9 A;  5GAO l;  4OGE A;  4XTV A;  4A4F A;  3L2U A;  3OS0 A;  3R6O A;  4M78 C;  2QQB A;  4OB3 B;  5DM7 R;  3CCL A;  2LDM A;  4C92 G;  1N8R C;  3G6E T;  5LJ3 j;  1U1T A;  4OP0 A;  4XTZ A;  3CPF A;  5I2S A;  3CC7 T;  1VQL A;  2DZ9 A;  4YTL A;  4MZP A;  2PVD B;  4C92 D;  3QDR B;  3DLM A;  3JCM f;  3JSC A;  4LD6 A;  4N0A C;  4BI4 A;  5GAN f;  4RG2 A;  1XNI A;  5GAN 4;  3MEV A;  4EMK B;  4M7D E;  1AHJ B;  3VUZ A;  3CCU T;  2R57 A;  4DA4 A;  4F7U G;  1QW1 A;  4JUV A;  4C0G A;  4L5G A;  2EQJ A;  3CXC A;  4M7A B;  4LD9 K;  2R5M A;  2RI3 A;  4DQ2 A;  4ELZ C;  1LJO A;  2XID A;  3OS5 A;  3JCM P;  4C5I A;  2LC4 A;  4MZM A;  3EFS A;  1QP2 A;  4XTU A;  1MHN A;  2ZPB B;  3MCA B;  3X24 B;  3OMG A;  3I56 T;  3LGF A;  3CCR T;  1KQ2 A;  4B9X A;  1WQ7 A;  3URG A;  4E7L A;  4QVC A;  5GAN j;  3VV0 A;  3OBY A;  1QVF S;  3HRT A;  5LJ5 j;  1JJ2 A;  3RKW A;  1UGS B;  5KE3 A;  4E47 A;  3CCV A;  4XQ3 A;  4PJO F;  2K3Y A;  4XU1 A;  1NJI U;  4DOV A;  1Y96 A;  1YHQ T;  1KC8 C;  4EMH A;  1VQ8 A;  4ELY C;  3ZFJ A;  4OGC A;  2D0Q B;  2E70 A;  1K73 C;  3OW2 A;  4A53 A;  3OSV A;  3G7Z A;  4IKF A;  2JTM A;  1OYX A;  2MMP A;  4FU6 A;  4QQ6 A;  5KE2 A;  4PL6 A;  5GAO q;  3CPW A;  3MET A;  3QYG B;  2EJG A;  2DTO A;  3KUF A;  3OYM A;  4BDY A;  4PJO C;  3I55 A;  3OYY A;  4C0D C;  3JB9 H;  1BYM A;  2QI2 A;  4M7A G;  1BKB A;  2QQA A;  3JCM X;  1VQP T;  2ZPH B;  2C06 A;  3LYI A;  1Y07 A;  4GY5 A;  5CIU A;  2EJF A;  4C5G A;  3CME A;  2LX9 A;  1VQ9 A;  1VQ6 A;  4Y28 E;  5FRM A;  4ZTJ A;  2DXU A;  4ZN1 A;  4JDS A;  2XIC A;  3M55 A;  4M7A D;  4LDW A;  4C8Q C;  5GAM g;  1B34 A;  3SFM A;  4KUD K;  3FJP A;  1M8V A;  3DLL A;  4OB1 B;  3OYJ A;  2WSC E;  2OTJ T;  1I81 A;  4ZGD B;  4E7K A;  3G71 A;  3S6W A;  4J83 A;  2DXB A;  1WQW A;  5FU7 B;  2JN0 A;  4D6W A;  5D6X A;  1GXI E;  2QQR A;  2VC8 A;  4LDU A;  3V8K A;  3CCE T;  2VXE A;  2K5I A;  2PUK B;  2XI9 A;  3M59 A;  1YJN A;  2JVV A;  2ZPG B;  3E19 A;  3MP1 A;  4LDY A;  3QYH B;  4E7J A;  1BIB A;  3VJP A;  4FL6 A;  3JCM c;  3EFR A;  4F7U A;  2L89 A;  3PTA A;  3NTK A;  3OYA A;  4BY6 C;  2M16 A;  3FDR A;  2E12 A;  1Y96 B;  2O01 E;  2DPP B;  1VQ5 A;  2XDD A;  4C92 E;  1VQO A;  1YI2 A;  2X4J A;  4QVD A;  4EDU A;  1NPR A;  5HKC A;  3GPL A;  2M9U A;  5LJ3 g;  2GF7 A;  2KY9 A;  4NS5 A;  1VQ7 A;  5FRO A;  3V7C A;  4BY6 B;  2RI2 A;  4BUG A;  1NZ9 A;  2RJF A;  3CEY A;  3GNG A;  3PFS A;  2CZ0 B;  1M1K C;  4V2S A;  2YLB A;  3CC2 A;  4M75 A;  4F7U E;  2K5F A;  2E6N A;  1KHI A;  2ZZD A;  3OYD A;  2DTH A;  2X4Y A;  5CKD A;  2KVQ G;  4M78 A;  1JB0 E;  5KH6 A;  2FHD A;  1KHC A;  2FYK A;  3JB9 J;  5A0L A;  1VQM T;  5KCH A;  1B34 B;  1BI1 A;  2EQU A;  3GNF B;  4J6W A;  2EIF A;  1VQK T;  2XG8 D;  4HKE A;  3LWI A;  5HK0 A;  3JCM g;  1K9M U;  2CZ1 B;  3NTI A;  5GAN g;  5LJ5 g;  3CCJ A;  3JCM b;  4NL3 A;  4N0A A;  4P5N A;  3V8J A;  2QEX T;  1U8R A;  2E10 A;  1K8A C;  3RER A;  2BKD N;  1KQS S;  3FEO A;  4M77 F;  4Y91 A;  4M78 F;  3OYI A;  4BAC A;  3ER0 A;  5GMK e;  3PMI A;  3F70 A;  3HPW A;  2ZPI B;  1M4Z A;  3INZ A;  3QKJ A;  4L59 A;  2D6F A;  3RMQ A;  5DLO A;  5GMK h;  3P8B B;  1Q82 U;  1M90 C;  1YBY A;  2EAY A;  4X34 A;  1R8O B;  2R5A A;  2VYT A;  3FRN A;  5C0M A;  4M7A E;  3CXC S;  1PSF A;  3L2V A;  4HCC A;  1YJ9 T;  4A4H A;  2MI6 A;  4M77 C;  4OB2 B;  4N4G A;  1N9R A;  3C95 A;  2WAC A;  3C94 A;  3VYH B;  5I21 A;  4BE0 A;  4O6J A;  3BDU A;  4KUI A;  3HHT B;  5GAN 6;  5GMK l;  3OYG A;  2RHI A;  3JCM Q;  3OBW A;  2EQM A;  3UWN A;  3RIR A;  4M75 B;  1JBM A;  1N6A A;  4ME7 A;  1VQ4 A;  1S72 A;  3T9N A;  3S3O A;  2EFI A;  1W2B S;  5J39 A;  1FXX A;  4KBM B;  3CCS A;  2JTF A;  2RHX A;  4M78 B;  4E7I A;  4HCB A;  1Q81 C;  3OMC A;  5LJ5 f;  3OW2 S;  1YIT T;  5CKH A;  2LCL A;  4PJO A;  2DAQ A;  2E41 A;  2OTL A;  1TH7 A;  4NOY A;  2P4T A;  3ZEH A;  4UC4 A;  3X28 B;  5CO7 A;  3QSU A;  3QPH A;  3JB9 G;  4IUR A;  3CMA A;  4HT8 A;  5DY9 A;  3JCM V;  1Q7Y U;  5J26 A;  2CZ7 B;  3ASK A;  5GMK m;  4RMO A;  2K5L A;  2RH2 A;  2PVG B;  5M9O A;  2RHY A;  1YIJ T;  2HD0 A;  4C8Q A;  3JB9 D;  3L2Z A;  2DK3 A;  2P0P A;  1YJW T;  2DO3 A;  3QBY A;  1RL2 A;  3TEE A;  1W4S A;  3LGL A;  3MHX A;  1VIF A;  3E1S A;  1O75 A;  3OYK A;  4M75 G;  3C4S A;  3HL8 A;  3JAM E;  1G3T A;  3CCL T;  3RMS A;  2F5T X;  3P8H A;  2WSF E;  4J7I A;  3JRZ A;  4M78 G;  4KUL A;  1QVG A;  4C8Q F;  4M75 D;  4BI3 A;  1VQL T;  2GFA A;  2CKK A;  2K3X A;  3H8Z A;  4IUU A;  3J80 E;  1Q86 U;  2V8K A;  3OYE A;  4A4K A;  2RO0 A;  3NFC A;  3CCM A;  2QA4 A;  2CGH A;  4M78 D;  2E65 A;  3E9F A;  4FIB A;  1V29 B;  1M1F A;  1N8R U;  2RJC A;  4JRQ A;  4BE2 A;  4MDX A;  1FWZ A;  3TU4 K;  1IZ6 A;  2DD5 A;  2E5Q A;  4XU3 A;  1OI1 A;  2DKG A;  4EPC A;  2A3L A;  4PJO B;  4C0D B;  2EWN A;  2RK2 A;  1OZ2 A;  3SWN C;  4R55 A;  3OB9 A;  3V7S A;  3O8V A;  1I4K 1;  3QUI A;  1VQN A;  3CD6 A;  3CCV T;  1UGR B;  3PIO A;  5FU6 C;  3GIB A;  2XDP A;  1EIF A;  2GFU A;  4A4E A;  3S3M A;  1X6O A;  1VQ8 T;  4PLL A;  1WJQ A;  3X26 B;  4C8Q B;  2EQK A;  3C12 A;  3CBM A;  2QTX A;  4XAX B;  4Z02 A;  2EKO A;  4XU0 A;  3QZ5 B;  1VIE A;  1QVF A;  1KQ1 A;  2R58 A;  5IN1 A;  3J7A F;  3WVE B;  3FIF A;  5LJ3 e;  3GP8 A;  1KD1 U;  3MO8 A;  2HQE A;  3J81 E;  2QQ9 A;  4X9C A;  3LX7 A;  1SSF A;  1KC8 U;  2JUF A;  2A7Y A;  2RJD A;  2JOY A;  3HRU A;  5LJ3 h;  3I55 T;  1K9M C;  2YLC A;  1K73 U;  1Y71 A;  2V8I A;  3DKM A;  3CC4 A;  3PGG A;  1VQ9 T;  3CME T;  1VQ6 T;  4PJO G;  3A8G B;  3WXM B;  2PQW A;  3OSS C;  3VYG A;  3G4S A;  4LDX A;  1WPY A;  1UEB A;  2MWP A;  3L42 A;  4EMG A;  4ATO A;  1WJR A;  3CCQ A;  4XTW A;  3M58 A;  1XTD A;  1QP3 A;  3HKS A;  4PJO D;  2QQS A;  5DLQ E;  2MF2 A;  2DJZ A;  5CK9 A;  3JCM e;  2G3R A;  3M53 A;  3DB3 A;  3OS1 A;  4M77 A;  3G71 T;  1N9S A;  4C92 F;  3MEA A;  4ZGE B;  4C8Q G;  5FRN A;  1YCY A;  3RES A;  3JCM h;  3OYL A;  3OYH A;  4VUB A;  4HCZ A;  4O5V A;  5GAN h;  4PKC C;  1YJN T;  1ZBX A;  1M9S A;  4C8Q D;  3P8D A;  4MML A;  1Y7X A;  2ZPE B;  3BW1 A;  3BDL A;  2DEQ A;  4MDW A;  3CBO A;  2VUB A;  4A54 A;  4JRI A;  2CS7 A;  4J8O A;  3RKY A;  2BIV A;  2Y4Y A;  4C92 C;  3MEU A;  4B9W A;  4M75 E;  1VQ5 T;  1H64 1;  2DVE A;  2LNV A;  3S3N A;  1VQO T;  2GQV A;  2LVM A;  2RHZ A;  3NTH A;  3OQ5 A;  3KBG A;  4JRK A;  4QVZ A;  4XU2 A;  5AYF A;  2E6Z A;  4M78 E;  3L2W A;  2X4W A;  2KSS A;  5CKF A;  2FL7 A;  3G6E A;  1VQ7 T;  4MMK A;  3QG1 A;  3CC7 A;  2FB7 A;  2GCX A;  2RJE A;  4OMF B;  3FC3 A;  1Q7Y C;  5GAN 3;  3CC2 T;  3KXT A;  1M1G A;  1O9S A;  4FM4 B;  3UDC A;  2QXF A;  3CCU A;  3A8L B;  3L2R A;  4HT9 A;  2EYQ A;  4XK8 E;  2ZGW A;  1UGQ B;  4II1 A;  2BUD A;  2AHJ B;  1JJ2 S;  1NJI C;  2VGM A;  1I5L A;  2E1H A;  1M1K U;  1G5V A;  1HK9 A;  3V8L A;  2XDB A;  4BB7 A;  4E7H A;  3QXE B;  2F5K A;  4WF2 A;  3UT1 A;  2XU8 A;  4M77 B;  3I56 A;  3CCR A;  1YI2 T;  4M7A F;  3HSB A;  3VU3 C;  3OA6 A;  3JCM W;  3CCJ T;  2L5Q A;  4RKU E;  5IAY A;  3MP8 A;  3GF5 A;  2P0K A;  3QII A;  4FT2 A;  2RI5 A;  1QVG S;  3M9Q A;  3CPW S;  3OY9 A;  1UB4 A;  1YHQ A;  1G3Y A;  2QDY B;  4OB0 B;  1OZ3 A;  4RCB A;  4C0F A;  4EMK C;  1Q86 C;  1JRI A;  1UGP B;  1BI2 A;  5CKB A;  3JB9 I;  2DZC A;  2RA2 A;  2LQ8 A;  4X9D A;  4JLG A;  2F69 A;  4M7A C;  2VV5 A;  1KQS A;  5D6W A;  1K8A U;  2CZ6 B;  3V7R A;  3SWN A;  2PU9 B;  2HQX A;  5GAN 5;  4M7D F;  3BFM A;  3MP6 A;  5IT9 E;  3FB9 A;  4QQD A;  2X35 A;  3QJ6 A;  3DB4 A;  1VQP A;  2I2L A;  4PJO E;  3ME9 A;  3VKI A;  5A0G A;  1QVP A;  3L1A A;  5GAO m;  1NE8 A;  4L6V 5;  4CI0 C;  3A8O B;  3MEW A;  4J6X A;  5GAM d;  2VGN A;  3BY7 A;  5CAI A;  2IVW A;  1LNX A;  2K2V A;  2Y4X A;  4M77 G;  5GMK i;  3PIP A;  1M90 U;  1D3B B;  3TCJ A;  2H3J A;  1VQ4 T;  4J7F A;  1S72 T;  3Q1J A;  1PSE A;  1XOV A;  3A8H B;  4M7D C;  1P92 A;  3SDZ A;  2FVU A;  5GAM e;  5CVI A;  3CCS T;  4C8Q E;  4M77 D;  4FSX A;  3H6Z A;  5CCA A;  2OTJ A;  4JS5 A;  2HNI A;  5GAN 2;  1KD1 C;  4N4H A;  2OTL T;  2NLU A;  4C0Z A;  2DXT A;  3PNW C;  3QHS A;  5GAM h;  3CCE A;  1W2B A;  1NPP A;  3CMA T;  2XD0 A;  4BI8 B;  5D6Y A;  2Y90 A;  5CQY A;  5GAN 7;  4JJN K;  2P0Q A;  4M7D B;  1ZHI A;  4OVA A;  1Q81 U;  3OYC A;  1WJS A;  5J3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...