4M78B

Crystal structure of lsm2-8 complex, space group p21
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
87
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 18
structure length 87
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78B00
1Y96B 5LJ3h 1LOJA 3RESA 4XTZA 2RM4A 3HFOA 4C8QF 3HSBA 4M77D 3RIRA 2EAYA 2RD1A 4C92G 2DXUA 4DQ2A 1LNXA 1U1SA 3V7SA 3V8KA 4RCCA 2YLBA 3JCMd 2DVEA 4M7DB 1HXDA 3EFRA 4M7AC 5GAN2 2FB7A 2E1HA 4J6WA 3V7CA 2DTIA 1I8FA 1X01A 2I2LA 4M75D 3QUIA 4XTWA 3SWNB 4C8QG 5DY9A 5LJ3j 5GAOp 1HK9A 2E10A 1I81A 1D3BB 4XU0A 5LJ3f 1YCYA 2EWNA 4C8QE 1N9RA 4X9DA 4C92E 4JRIA 2EJGA 3BDUA 5GAN8 3AHUA 4PJOG 4F7UE 4M75B 3JCMP 3JCMh 5GMKl 5LJ5d 2DEQA 3V8LA 1B34A 3M4GA 3EFSA 2E64A 2EJ9A 3FIFA 4M75F 4X9CA 4C92D 4F7UA 3JCMc 1Y96A 3JB9I 4XU1A 2RA2A 4MMKA 2E41A 2CGHA 3PGGA 4M77A 2DTOA 4C8QC 1M5Q1 4F7UG 5GMKm 5GAN3 4PJOE 4M78E 4C92B 4EMKB 1BIBA 4MMLA 4XU3A 3VU3C 3V7RA 4XU2A 5GAMd 5GAN7 2RB6A 1BIAA 5CAIA 3JB9G 3BFMA 4M7AG 3V8JA 1WQWA 2VXEA 4M77E 4HA8A 4JRKA 3RKWA 4M7DF 5LJ5j 4M7AE 4XTXA 4J5YA 1TH7A 1WQ7A 1KQ2A 4F7UF 1JBMA 1U1TA 4QVCA 2JN0A 3RKXA 3HFNA 3JCMW 4HT8A 3FJPA 5GAOm 2DKGA 1WPYA 1I5LA 5GMKi 2YLCA 4C92F 4A53A 4PJOC 5LJ3e 5GAN4 3SB2A 5GAOr 3JB9H 4RCBA 2YHTA 5LJ3g 2VC8A 5GAOq 5GANj 4NOYA 4M78D 4J6YA 3FB9A 1JRIA 3JB9D 3QSUA 4M7DC 1KQ1A 4J6XA 4A54A 4M78C 1MGQA 4HT9A 3SWNC 3RKYA 3JB9J 4V2SA 3JCMQ 4M75C 5GAN5 1N9SA 2K57A 2DZ9A 5GAMf 2E65A 2FYKA 5LJ5g 4M7AD 4M78B 5LJ5f 5GAMg 4M78A 5LJ5h 5GAOl 4M7DD 4N0AC 5GAN6 4M75A 4M78F 4XTYA 3GIBA 4M77C 3JCMg 4C8QA 5GMKh 3L1AA 5LJ3d 2ZGWA 5GANd 4PJOD 2QTXA 2HNIA 3INZA 4M7AB 5GAMe 4N0AA 4M7DG 4PNOA 4EMKC 5GANh 1LJOA 4F7UB 3JCMJ 2DXTA 4M7AF 5GANf 3JB9F 2Y90A 1H641 1B34B 4WF2A 4M77F 2EJFA 3RUXA 4NL2A 2DZCA 5GAMh 4QVDA 4PJOB 3JCMb 5GMKe 4M7DA 3JCMf 3JCMX 2DTHA 5GMKj 4C92C 3JCMV 4JUVA 4XTVA 2DJZA 1M8VA 4M78G 4PJOA 1I4K1 1D3BA 3QHSA 4OP0A 5GAOn 4C8QD 4M7DE 4M75G 4Y91A 5GANe 1WNLA 3QO3A 4EMKA 4XTUA 5I21A 4C92A 4XQ3A 5GANg 3RERA 3SWNA 4M75E 4M77B 3BW1A 5GAMj 4M7AA 4PJOF 3BY7A 3L2ZA 2VXFA 3JCMe 4JLIA 4NL3A 4EMGA 4C8QB 5LJ5e 4EMHA 4M77G
chains in the Genus database with same CATH superfamily
1CKAA 2VASA 2NWMA 2LX9A 2GNCA 1WGSA 1RAIB 3MEVA 5DY9A 2GFUA 1X2QA 1D3BB 2V8JA 4X9DA 4C0ZA 4ZTFA 2X51A 1R77A 2AK5A 1K9AA 4KUDK 1MUZA 2V8IA 1OZ3A 2L0AA 2M51A 2LTOA 2JS0A 2DVJA 3EGDA 5GMKm 2DL5A 5KYWA 4B9WA 2L8DA 3V7RA 3V8JA 3G1JA 5D6XA 2A08A 3LGFA 4IUQA 4HKEA 4OB2B 4BI3A 2ZPEB 3G71A 1LVKA 1K73U 3OW2S 1TUCA 3S3OA 3BDLA 1GBQA 7AT1B 3MP1A 1NJIU 5L23A 4RUGA 3VS1A 8AT1B 1PD1A 3NPFA 4ZGEB 2EGAA 2L3PA 1VQMA 3CCEA 3QXEB 1TUDA 4F16A 1QQJA 2RHIA 2A0FB 2O4XA 4N0AA 2YUOA 1AWJA 2RI5A 5KYYA 1SF9A 1H641 1Q86C 1YIJA 3CCST 1K8AR 4JUVA 4IUVA 2CZ6B 1G83A 4A4KA 1C6VX 3R6OA 2FG0A 4HXJA 1JEGA 2HSPA 4AFZC 2BTTA 3CMEA 4OF1A 3RERA 2QQAA 3CCQQ 2X35A 2WACA 2ZPGB 4GLMA 3PIOA 1YBYA 1YCSB 1VQPT 3HP9A 4BE0A 2M9UA 3I56A 2A28A 4J83A 2J7IA 1U1SA 4ZGDB 2DVEA 2XMFA 1PSEA 2JUFA 2E5KA 4ANJA 1BYMA 2I2LA 1NLPC 4C8QG 4PFZA 3REAB 1KC8U 3M0PA 4KBMB 1X69A 4OVAA 3PVLA 1QVFS 1R0BG 2J06A 2QQ9A 2F69A 4X34A 4OB0B 1X27A 3EFSA 4DBHA 2O88A 1UG1A 3NFCA 4X9CA 4J7IA 3I55T 1YI2A 3A8GB 1QCFA 2MPXC 4ZNXA 4PJOE 1D1AA 3MP6A 4LD9K 1PNJA 2GGRA 4C92B 3CBMA 1AWOA 3RR6A 1NYGA 1OU9A 1X43A 3CCLQ 1JJ2S 2RHUA 4J5YA 1TH7A 4RTWA 3I56T 2OTJQ 1YJ9A 2DM1A 2D0NA 2ZPHB 3C4SA 3SB2A 3QSUA 1SEMA 1RACB 2MMPA 3RKYA 3JCMQ 3VS4A 2DX1A 5HY6A 2AT1B 1NBEB 4E6RA 5LJ5f 5LJ5h 1YP5A 1RAGB 3VS5A 2HZYA 2OX7A 1JU5C 2SEMA 4J9HA 4EMKC 4F7UB 3VS2A 2DXBA 1S72A 2CS7A 5GAMh 3CC7Q 1M1GA 4J9DA 1D0ZA 4LUEA 2PUOB 4EPCA 1SHGA 5C6SA 2FO0A 2CSIA 1EX4A 5CQXA 1VQOA 3SWNA 2HQEA 1BBZA 4JRPA 4KGVB 3S3MA 1MMNA 4R55A 2A7YA 5DLQE 3RIRA 2QGGA 5CO7A 4DQ2A 3PFSA 3V7SA 3CD6Q 3CCUA 3UWNA 2YT6A 4M7DB 3EFRA 4M7AC 2E4HA 9ATCB 4N4HA 3MO8A 1X01A 4LNPA 2LX7A 3E2UA 5KE3A 4KGXB 1W2BP 1HK9A 1LPLA 4AG2C 2DJQA 1XJWB 1XOVA 1ZSZA 1VQKT 1WLPB 1G5VA 4C92D 1M2VA 3CPFA 4XU1A 4JZ4A 4LD6A 4PL6A 1X2KA 2GF7A 1I0CA 4CRIA 1YI2Q 1UGPB 2FVUA 4XU2A 1K0XA 4OMLA 2GQIA 2OI3A 2VXEA 1YJNT 1G3TA 5KYNA 1YWOA 3G4SQ 3EG3A 1I5LA 4MZMA 1QVPA 1N8RC 4B6MA 2CT4A 2YHTA 4XK8E 1EFNA 3EAEA 1EZZB 1WZOA 1HD3A 4M75C 5CIUA 3QKJA 3I55Q 2W10A 2FPFA 2JM9A 4FCYA 2B8AA 1VIEA 4C5IA 3NGPA 4FIBA 1VQ5T 2NUZA 1WJQA 3I5RA 4MZTA 3FDRA 3VYGA 2X3WD 1W1FA 4L59A 4A4HA 2PVDB 1IGQA 3VS0A 2L2PA 4IUTA 1OPKA 1YIJQ 3EG1A 4M75G 1OI1A 3G4SA 1MMDA 4EIKA 1VQLQ 3H8ZA 2KXCA 5GAMj 1U5SA 2VYTA 4E7LA 1Q82U 2VXFA 1IHVA 1K73C 2WSFE 1E6HA 3HSBA 1KQSA 3ZEHA 4JJNK 4AMCA 4FW2A 4YTLA 1D1BA 3CXCS 2KQWA 3OMGA 1JXMA 3HRTA 2ZZDA 2O31A 2KI7A 3E19A 3CD6A 4N4GA 1XQHA 2NUPB 1YCYA 4UC4A 4E2FB 3OBWA 1NJIR 2MIOA 5GAN8 4B9XA 2BZ8A 3JCMP 4RMOA 2DEQA 2EJ9A 4LDYA 3CCVT 5DLOA 1VQMT 2E41A 1OOTA 1PKSA 3EG2A 3OYEA 1QKWA 3EFOB 1F1BB 2RQRA 1BIBA 1YHQQ 4ZN3A 1YJWQ 1BIAA 4F04B 4M77E 3X26B 4HA8A 1WHGA 1FX7A 5IXFA 3MPUB 4XTXA 4M4ZA 3VRZA 3JV3A 2CYZB 2VKNA 4A53A 2BUDA 1IHWA 3CCJQ 2VC8A 2V26A 1KQSP 3M9QA 1M1KC 1YWPA 3OA6A 2C0TA 2XDBA 3X24B 2FRWA 3P8BB 3GPLA 2Z0WA 3CCQT 2O2OA 2DETA 1PC0A 4M78B 4M78A 2EYXA 5GAOl 2P4TA 3GF5A 1K4US 1MMGA 3CD6T 2V1QA 1YNZA 4M7AB 2LMJA 3FEOA 1VQ5A 5IHIA 3GP8A 1AVZC 3ZFJA 1M3BA 2DJZA 2X4JA 4PJOA 2EQUA 3QHSA 3CC7A 1GBRA 4HCBA 3QO3A 3L2RA 2M1HA 1TSFA 2DE0X 4JLGA 4OB3B 1GCPA 1TG0A 2QG9B 1WDXA 4C8QB 5CQYA 2DD4A 2RM4A 4C8QF 4E7JA 2D8HA 2XD0A 4WCIA 1PD0A 1GCQC 1YJ9T 1UFFA 1Q81C 5IXBA 1VQ8A 3QG1A 3J81E 3BE3A 3JCMe 3OYKA 1GCQA 3LGLA 1Q95G 1Q86R 1G3SA 1QMCA 2GTJA 3V8LA 3VS6A 3WXMB 1NJIC 1I1JA 1K9MU 5FWCA 3CCSQ 2M02A 5EC7A 4M78E 1PKTA 2ABLA 1WIEA 2ATCB 1ACMB 1K8AC 4BI4A 1GFCA 2RJEA 1WHHA 1YJWA 4Z02A 1Q7YC 1OPLA 2JTMA 3M58A 4BACA 5GAN4 3QPHA 3H0HA 5GANj 1K0SA 4M78D 4J6XA 2LNVA 2BZXA 2XG8D 2O9VA 3JB9J 4OMNA 3GNFB 2PTKA 2Y4XA 4M7AD 5GAMg 3DB3A 3P8DA 1K76A 1I5OB 2LDMA 2RI2A 1G8XA 5GMKh 3VRYA 5GANd 4IUUA 4VUBA 1AOJA 2QA4A 5DM7R 3CXCA 2QXFA 5J39A 2M0YA 5GMKj 1RUWA 5A0LA 2KT8A 1YJWT 4C8QD 2BZYA 1WNLA 1DJ7B 2J6OA 4QQDA 4DBFA 2XI9A 1S72Q 2RQVA 4OMPA 1BU1A 1K1ZA 2LQNA 1E7OA 3PIPA 5L8RE 3FLGA 1V29B 3FC3A 3CC4T 1RAHB 5A2QE 1FYNA 4N4IA 3CCUQ 2KEAA 2X9HA 1NPRA 1X6OA 2OAWA 4PJNA 5LJ3f 1W6XA 1VQ9A 1JJ2A 3JCMh 3QJ6A 2AZSA 1BKBA 3G6EA 5LJ5d 1G3WA 2WSCE 3M4GA 1WXUA 2DFUA 1LCKA 2DL3A 3RNJA 3SDZA 3ULRB 1NG2A 2YRVA 5GAN3 2CKKA 2QDLA 4D8KA 1Y57A 3TCJA 1YHQT 3EG0A 1Y0MA 2EKOA 1QWEA 4F7UF 3GBQA 1VOMA 2YUNA 1RAEB 1KC8C 2GBQA 2GQVA 3H0IA 3RDVA 3OYFA 3EHQA 4AG1C 1MGQA 2ZCFB 3WVDB 6AT1B 2K57A 3L2QA 1K8AU 2B86A 2CH4W 1M3CA 3L42A 2VB6A 3T9NA 4CI0C 5GAN6 1VQ4T 4M75A 3S6WA 1VQ7T 2RK1A 1E6GA 3M0SA 1UECA 4D8DA 4PNOA 1D0XA 3UA7A 1LJOA 1TWBA 1JO8A 3A8HB 3UDCA 2DL8A 1B34B 4JJBA 3SEMA 4M7DA 3G6ET 2RMOA 2XIDA 4C92C 2QEXQ 2O01E 1M8VA 4IIMA 3TREA 1RI0A 1G3YA 3GLXA 2ROLA 2QDYB 2RQWA 4ORZA 4PJOF 3QYGB 4JLIA 4OMQA 4K11A 2VGMA 3OS0A 1PRMC 5CVIA 4HCKA 2DBMA 1BI1A 1RLQC 2CZ1B 2DRKA 3V8KA 2RJFA 3I35A 1OZ2A 3RMSA 2E1HA 1JB0E 5GAOp 1NEBA 5HKCA 2RO0A 3EG9B 4C0DB 3JCMd 2MWOA 1XTDA 1R0CB 2R58A 2OJ2A 2L3SA 1T0HA 2CDTA 1WYXA 1T3SA 1UGSB 4PLLA 2D8JA 4QQGA 4M75F 2QEXA 1N5ZA 2IIMA 1TS9A 1SSHA 3C12A 3OYCA 4C8QC 3ME9A 2LQKA 2O9SA 3OY9A 3MEUA 2L3RA 3OS5A 1OULA 3CCSA 3RKWA 2CT3A 3H6ZA 2R57A 1N27A 4M7AE 1KQ2A 4RKUE 4R0KA 3A5ZB 3HFNA 5GAOr 3OYLA 2RHXA 1VQNA 2COZA 3FB9A 5FU6B 1YHQA 3NTIA 2BKDN 3ZBDA 2ED0A 2DZ9A 1UGVA 3OYJA 4O5VA 3QDFA 5KE2A 2OAUA 3M53A 3CMET 3L2WA 4OMOA 2ZGWA 3TSZA 3OYDA 2E3IA 1SKUB 4GLKA 1H3ZA 5GAMe 1BCOA 2K6DA 2RHZA 4KULA 4NL2A 3CPWP 5GMKe 3PVQA 1OYXA 2MWPA 3KUFA 3ER0A 5GAOn 1O9SA 2ROTA 2FHDA 2LJ1A 4PJJA 8ATCB 1FXXA 2CUDA 2LCLA 3P8HA 4NL3A 2HKNA 5I11A 1KSWA 4XTZA 3M56A 2RD1A 3TQ7P 2E5QA 4E47A 2KMTA 4FSSA 5CKDA 1X6BA 1QP2A 1U06A 1I8FA 2FPEA 1KD1R 1VQPQ 4BB7A 1RAAB 1UB4A 5FRMA 4LN2A 1WHLA 2D1XA 2QEXT 3VS3A 3MKDA 4LE9A 2EQIA 2F2VA 4II1A 4F7UG 3KFVA 2HMAA 2IPOB 3CCVQ 2DILA 2LQ8A 2QTVA 1HYOA 4ELZC 2E6ZA 4CC4B 2HQHA 2QI2A 5IT9E 5KYYB 2YLCA 1W70A 4RCBA 1R8OB 3M4YA 5GAOq 3LYIA 1PM3A 4E7SA 1Q82R 1S72T 5A0GA 4V2SA 1VQPA 4DEXA 2E65A 1KD1U 2RJDA 3CC2Q 1VQ7A 2KYMA 4XTYA 2MOXA 4FM4B 4EDUA 4LXCA 5LJ3d 3VS7A 3HKSA 2LJ3A 3M57A 2KE9A 1UGQB 2E3HA 4QVDA 3MP8A 3QJYA 1MV3A 2ZAEA 3HRSA 3JCMX 3LW5E 4J7FA 2DMOA 2GCXA 2KXDA 2DNUA 1NE8A 1UGRB 4RTUA 1PWTA 4QKUA 4EMKA 3PTAA 2EQKA 2EPDA 1FWZA 3EHRA 3RMQA 4M77G 3EGXB 3JRZA 4NS5A 4Y28E 1LOJA 3HFOA 4HCZA 5I2MA 2DXUA 1IZ6A 2LVMA 3X25B 4RCCA 3CCET 1RL2A 1VUBA 4PJLA 2CP6A 4A63B 2K5FA 4D6WA 3SWNB 3M0TA 3QUIA 4J9BA 4C8QE 1EIFA 2C06A 5FU7C 4OB1B 1FMVA 3BDUA 3CCRT 1M1KR 4IIOA 1VQNQ 1B34A 3CMAQ 1UUEA 2L3QA 3URGA 2HL3A 3OYHA 1A0NB 1OQKA 2YDLA 4L5GA 1UTIA 1CSKA 2CGHA 3OSSC 3QZ5B 1IREB 3LWHA 2JVVA 3JB9G 1KC8R 2H8HA 3BFMA 3LWIA 2KT1A 1U1TA 2ZPBB 4FW1A 1WPYA 4CC3A 2KVQG 2OTJA 5GMKi 2LC4A 2QYZA 1MMAA 3H0FA 4C5HA 5LJ3g 2QQBA 2EFIA 2R5AA 4QW2A 2E6NA 4KH0B 1IXDA 1X6GA 5KCOA 2EQJA 4QVZA 1IRXA 3DLMA 3EGUA 2EGCA 3VJPA 2P84A 2SRCA 1NPPA 4DEYA 1ZSZB 3INZA 2YWWA 3A98A 2NLUA 4J9FA 1OV3A 1M2VB 3JB9F 3OYBA 1M30A 2CZ0B 4M77F 2FZKB 2A3LA 5FU7B 3I9QA 2JMAA 3M54A 2DRMA 1PRLC 1Q7YR 3CC7T 1M2OA 4C92A 4MDXA 4KGZB 3A8LB 2CP2A 2VVKA 3GNGA 2I0NA 4ZTJA 5CCAA 3QBYA 1RADB 4KUIA 3A8MB 1W2BS 4M77D 3CCMA 4MZPA 4OMMA 2YLBA 1YITQ 2MCNA 3H9NA 1YN8A 1WJRA 2FB7A 2J05A 2VGNA 3X28B 1BI3A 2KR3A 2JXBA 5FU6C 2XDPA 1I81A 4M7DD 2C0OA 1Q81R 4M75B 3CCJA 2PU9B 1VQ8Q 1RLPC 2DL7A 2VV5A 2K3XA 1ZUUA 3OW2A 2YSQA 1BK2A 1VQOT 1XNIA 3M0RA 2X4YA 1VA7A 1M90C 3VU3C 4BUGA 1BI2A 1VQKA 3CCEQ 4M7DF 2M16A 1NYFA 1Y7XA 4JJCA 3JCMW 2X4WA 3NHNA 2JJ9A 4J8OA 4C92F 3CPWA 2RH2A 2OTLT 3J80E 2V1RA 1ZA1B 1D1CA 2YRCA 3GOXA 2Y4YA 2CP0A 4F14A 5FROA 2PNIA 2BIVA 4C0FA 5HCKA 2PZ1A 4M78F 1Q81U 2HBWA 2O4XB 3GIBA 1OEBA 3QWYA 3CPWS 2FZGB 3SHWA 3QIIA 1QCOA 2DERA 4M7AF 5FWBA 1WFWA 3JCMf 2DTHA 2LP5A 2K5IA 2A36A 2EQMA 2KK4A 1I4K1 4OP0A 2NUPA 2HCKA 3JSCA 2V8KA 1AEYA 2P0PA 3I55A 4M75E 2MAMA 4M77B 5D6WA 3BY7A 3META 2KGTA 2BE7D 2H3JA 1WXTA 3RESA 1P92A 1UJ0A 3A8OB 2CP7A 3L2VA 1LNXA 5J26A 3TVTA 1UEBA 4ELYC 1KD1C 1QWFA 4BY6B 3NTHA 2RN8A 3R6NA 1UE9A 2KROA 5GAN2 2LRQA 4M75D 5KYUB 2KBTA 5KYUA 1YITA 3L2UA 2E10A 1B07A 1CKBA 4FSXA 2GTOA 2EWNA 2XKOC 1NM7A 4J9EA 1YIJT 2DLPA 3H41A 3FIFA 1Z9ZA 3HL8A 2FZCB 2A37A 1PCXA 2QQRA 4ME7A 4O6JA 3E9GA 2DTOA 2PVOB 1M9SA 5CR2A 4QQ6A 5CKFA 4DOVA 5GAMd 1VYVA 2XICA 4L6V5 1WQWA 1VQ5Q 1VQ9T 2NUTA 3G6EQ 2D9TA 3CCLT 2JN0A 4HT8A 3FJPA 2OTJT 3REBB 1QP3A 1W4SA 2DYIA 2DK3A 2QAZA 1AZEA 2XHCA 1N8RU 2EBPA 2KYBA 3OYNA 4A54A 3DB4A 3VUBA 4J9IA 1VQOQ 4FU6A 3QYHB 4C8QA 2R5MA 1YI2T 2CH4A 2ED1A 1PHTA 4E7HA 2VWFA 2DXTA 2DPPB 1SRMA 4RTVA 1WI7A 2EJFA 4Y92A 4PJOB 3MEAA 1ARKA 3JCMb 1AWWA 4FT2A 4FYVB 2YUPA 4M78G 2DEUA 2RHYA 3S3NA 5GANe 4LDXA 5IHKA 2FL7A 3LX7A 4XQ3A 5EG2A 1B7TA 1KHCA 2HEQA 2MF2A 5FW9A 2JT4A 1VQ6Q 1Q82C 1I07A 2E12A 2XDDA 1VQMQ 1Y96B 1ABOA 4ZGJB 5FLXE 4C92G 1H92A 3A1PA 1HXDA 2EW3A 4J6WA 4HVVA 1QVGP 3CBPA 1VYTA 4XU0A 4GBQA 1N9RA 4F17A 1ABQA 1O75A 3OW2P 1ZA2B 1WXBA 3DLLA 3DKMA 2K5LA 2CSQA 3O8VA 2W0ZA 3LLRA 5IAYA 4BDZA 2EYQA 2QA4T 2RA2A 3X20B 1NZ9A 1M5Q1 2LCCA 3PNWC 5HK3A 1KIKA 1VQ9Q 2K3BA 2X4XA 5CAIA 2K79A 5LJ5j 2MI6A 1OX8A 4X1VA 2PQWA 5KYXA 4ZN1A 1UHCA 3U23A 5AT1B 2ZPIB 1ZBXA 4NOYA 3JAME 4J6YA 3JB9D 1QLYA 4JJDA 3SFMA 1VIFA 1M1KU 3OS1A 1AWXA 3CCLA 4RTZA 1ZSZC 1Y07A 4GY5A 2FYKA 2JOYA 3VV0A 4BY6C 5GAMf 5KH6A 3UATA 2IVWA 4JS4A 3E9FA 4PLIA 1UDLA 4N0AC 5D6YA 1KK7A 3NMZC 4M77C 3E1SA 3L1AA 1AT1B 4RG8A 3I56Q 3J7AF 4PJOD 4PKCC 1VQ7Q 2KDSA 3M55A 4AFSC 4M7DG 2NYSA 3HPWA 4JZ3A 5ECAA 2CUBA 4WF2A 4FL6A 3PMIA 3HHTB 1T3LA 3EG9A 1OX9A 1JQQA 4E7ZA 3L2ZA 1ZSGA 4EMGA 1KHIA 4R56A 4BD3A 2RQUA 2DIGA 2LT1A 4BE2A 2EVRA 1UJYA 2XK0A 2RF0A 3N5BB 4HCCA 2AKKA 2RPNA 3PMTA 4QT7A 3KBGA 2KNBB 1M90R 4HVWA 2K2VA 2JTFA 1W2BA 2DL4A 2YRDA 5GMKl 3CC4A 2RQTA 3CCQA 2COWA 4Z8AA 2OTLQ 3FRNA 3JCMc 1Y96A 3JB9I 2F2WA 2QK0A 3CCUT 3CEYA 2JTEA 1VQNT 3M5AA 1K9MC 1M4ZA 3CCRQ 3MJXA 4J9GA 4MMLA 4EMKB 5GAN7 3OMCA 5IHNA 3CCRA 1ZLMA 1AD5A 2CZ7B 4J9CA 4MDWA 4AFUC 5A0DA 1U8RA 1JBMA 5J3BA 2LT4A 4DBRA 4QVCA 3CCMQ 4RTXA 4KRTA 1M1FA 2DKGA 2CP5A 1Y71A 3ZL7C 5LJ3e 2ENMA 5LL6S 2KSSA 1JRIA 1SPKA 1KQ1A 2ECZA 1VQ6T 4HT9A 3QWXX 4LDWA 2AHJB 4A4GA 2EYZA 2COYA 2GFAA 4KH1B 4BI8B 2QQSA 3LH0A 4RTTA 1UHFA 3UF4A 3CCVA 1M27C 3VUZA 1VQLA 4FYYB 3F70A 1BI0A 1SHFA 2RK2A 3UT1A 3OYIA 2HQXA 3TEEA 3NTKA 2RJCA 3JCMV 1TXQA 4HVUA 3AT1B 1M3AA 1SSFA 4PJMA 3BW1A 3HRUA 1KFZA 1H8KA 1QVFP 4EMHA 2HL5C 1ZHIA 4DOWA 1TOVA 4AT1B 5CK9A 1N6AA 1VQ4Q 3PE0A 2EAYA 4RTYA 3UA6A 1NEGA 2AZVA 3M0UA 1GRIA 1ZQ1A 3C0CA 2FPDA 2IG0A 3EGDB 1TUGB 4XTWA 3G71Q 2JMCA 1VQ6A 4C92E 4PFPA 4JRIA 4C0GA 5I2SA 3AHUA 4F7UE 1SG5A 2D0QB 1V76A 1KQSS 3CCJT 2F2XA 3TU4K 2E64A 4F7UA 1N8RR 4LUDA 1ZUKA 2L5QA 4JS5A 4MMKA 1VQLT 4M77A 1K73R 2JZ2A 2JNGA 4XU3A 4CC7A 2JM8A 1YJNA 4IKFA 2XU8A 3CC2T 1WQ7A 2QGFB 2FEIA 2EGEA 3RKXA 4KT0E 2EIFA 2KY9A 3Q1JA 4RG2A 2LJ0A 5GJVB 1VYUA 3JB9H 2AIRB 4M7DC 3LH5A 4JPBW 1SRLA 4M78C 3SWNC 1KG1A 1N9SA 5D7UA 2F5TX 4OMFB 1AHJB 2F5KA 1Q7YU 1GXIE 2AKLA 2LQWA 3JCMg 2EYYA 1M90U 5KYWB 3G4ST 2P0KA 2HSEB 4ATOA 1G2BA 3OB9A 1QKXA 1RABB 2HKQB 3VYHB 2FRYA 2Y90A 4AFQC 2DZCA 3OYGA 4OGEA 1YJNQ 1PG5B 3CC2A 3QZ9B 2H3EB 4FYWB 3OYYA 4XTVA 3CMEQ 2LZ6B 4M7DE 2VUBA 2MYSA 4Y91A 3HTRA 5CKHA 1WHJA 4LDUA 4XTUA 4Q5WA 5GANg 2F1LA 3C95A 2P4RA 1MHNA 3RBBB 4CC2A 4DBQA 5KCHA 2DIQA 1GFDA 4BE1A 1U3OA 2C0IA 3TSWA 2K7AA 5I22A 2EYWA 1M8MA 2EKHA 3SD4A 2DAQA 3V7CA 1K9MR 1BCMA 1T0JA 1J3TA 4LDVA 4TVRA 3MCAB 1WA7A 2LCSA 1Z9QA 4C5EA 2EJGA 4JRQA 1FMKA 1IB8A 3CCMT 3KXTA 3MHXA 1JXOA 3VKIA 2J6FA 3EGXA 1H3HA 1MNDA 2OTLA 1V1CA 2RI3A 1AZGB 4P5NA 2BE9B 1IGUA 1X75C 3I5SA 3QDRB 2QASA 2K2MA 3EH1A 2HAXA 3ASKA 5GAOm 2P0QA 4E7KA 1PSFA 1JJ2P 1MNEA 1OU8A 4PK4A 5CKEA 2PUKB 4Z88A 2CREA 5GAN5 5LJ5g 1NLOC 1ZUYA 4C5GA 5IH2A 3G7ZA 1RAFB 3O5ZA 4BDYA 1MV0B 2KRNA 3OYAA 2HNIA 2QTXA 4JDSA 4OGCA 1BB9A 3UPUA 1WHKA 2M0OA 1D0YA 1FMWA 2X3XD 3CC4Q 3RUXA 2WSEE 4FYXB 2G6FX 3OBYA 3CXCP 2K9GA 2DF6A 1D3BA 1WJSA 1QVFA 2KRSA 5I21A 3CMAA 4M7AA 2YXYA 1VQ8T 2HDAA 3OYMA 5LJ5e 1WHMA 3M59A 4WTOB 5LJ3h 1KJWA 1RI9A 4A4EA 1QVGS 2DBKA 2DO3A 4XAXB 2L89A 3D7SB 3C94A 1VQ4A 1WX6A 1HSQA 2DTIA 2J6KA 5LJ3j 5CKBA 1QW1A 1YITT 2HD0A 2CP3A 1IO6A 1VQKQ 3CQTA 4PJOG 1QVGA 3OQ5A 3THKA 2RNAA 5M9OA 2DD5A 2KAFA 4E7IA 5FRNA 4A4FA 2D6FA 3EFOA 1ZX6A 4FT4A 5GJWB 3PGGA 2K3YA 4M7AG 2RB6A 2QA4Q 5AYFA 1D09B 4JRKA 5KYXB 1C1AA 1C0MA 3IQLA 1YFNA 2K4YA 2YUQA 4C0DC 4PJOC 1TU0B 2JW4A 3OS2A 4IURA 3EH2A 2E70A 1B3QA 3CBOA 1Q86U 2DYBA 3PT9A 2ESWA 4Z89A 2NUTB 2G3RA 2LNHB 2ZPFB 1S1NA 5IN1A 3WVEB 2HBPA 2MK5A 2PVGB 2JS2A 5C0MA 3FJ5A 1YJ9Q 5GANh 2DA9A 3JCMJ 3MEWA 5GANf 1HJDA 2DXCA 4PFOA 1GL5A 4ESRA 4IUPA 3M0QA 1ZBJA 3CMAT 1QCNA 3OSVA 3G71T 1TTHB 2KRMA 4DA4A 5HK0A
chains in the Genus database with same CATH topology
4NS5A 4Y28E 1LOJA 2DD4A 2RM4A 3HFOA 4R56A 4C8QF 4HCZA 4BD3A 5I2MA 4E7JA 2DXUA 1IZ6A 2LVMA 3X25B 4RCCA 3CCET 5GANg 1RL2A 2DIGA 2LT1A 1VUBA 2XD0A 4BE2A 1YJ9T 2K5FA 2LX9A 1Q81C 2XK0A 4D6WA 3SWNB 1WGSA 3QUIA 3MEVA 5DY9A 3N5BB 4HCCA 2GFUA 1VQ8A 3QG1A 3J81E 3JCMe 1D3BB 2V8JA 4C8QE 3OYKA 1EIFA 2C06A 4X9DA 3LGLA 3PMTA 4OB1B 3KBGA 5FU7C 4C0ZA 4ZTFA 3BDUA 3CCRT 2K2VA 2JTFA 1W2BA 4KUDK 1G3SA 5GMKl 3CC4A 3CCQA 3V8LA 1B34A 2V8IA 1OZ3A 3URGA 3WXMB 1NJIC 3FRNA 3JCMc 1Y96A 2LTOA 3JB9I 3OYHA 3CCUT 3CEYA 4L5GA 1K9MU 1VQNT 2CGHA 3M5AA 3OSSC 1K9MC 3QZ5B 1M4ZA 5GMKm 4M78E 4B9WA 1IREB 3LWHA 4EMKB 2JVVA 4MMLA 2L8DA 3V7RA 5GAN7 3JB9G 3BFMA 3LWIA 3V8JA 3OMCA 3CCRA 1K8AC 4BI4A 2CZ7B 4MDWA 1U8RA 2RJEA 5A0DA 1JBMA 1U1TA 2LT4A 2ZPBB 5J3BA 4QVCA 1YJWA 5D6XA 4Z02A 1Q7YC 1M1FA 2DKGA 1WPYA 2KVQG 2OTJA 1Y71A 5GMKi 3LGFA 2JTMA 2LC4A 3M58A 5LJ3e 4IUQA 5GAN4 4BACA 4HKEA 3QPHA 4OB2B 4C5HA 5LJ3g 2QQBA 5GANj 4BI3A 2ZPEB 2EFIA 2KSSA 4M78D 1JRIA 2R5AA 4QW2A 5LL6S 1KQ1A 2E6NA 2LNVA 4J6XA 3G71A 1K73U 1VQ6T 2XG8D 3OW2S 5KCOA 3JB9J 3S3OA 4HT9A 3BDLA 4LDWA 2EQJA 4QVZA 3GNFB 2AHJB 3MP1A 4A4GA 3DLMA 2Y4XA 1NJIU 2GFAA 4M7AD 4BI8B 2QQSA 3DB3A 3P8DA 3VJPA 5GAMg 2LDMA 4ZGEB 2RI2A 1NPPA 1VQMA 5GMKh 3LH0A 3CCEA 3QXEB 5GANd 4IUUA 4VUBA 3CCVA 2RHIA 3VUZA 5DM7R 3INZA 2QA4A 1VQLA 2O4XA 4N0AA 3F70A 2NLUA 1BI0A 2RI5A 3CXCA 3JB9F 3OYBA 1H641 2CZ0B 2RK2A 4M77F 1Q86C 3UT1A 1YIJA 3OYIA 2QXFA 5J39A 2A3LA 3CCST 2HQXA 3TEEA 5FU7B 5GMKj 3NTKA 2RJCA 3JCMV 3M54A 4JUVA 5A0LA 4IUVA 1YJWT 2CZ6B 4A4KA 3R6OA 4C8QD 3CC7T 1SSFA 1WNLA 3CMEA 4OF1A 4C92A 3RERA 4MDXA 3A8LB 1DJ7B 3BW1A 3HRUA 2QQAA 2X35A 4QQDA 2WACA 3GNGA 4ZTJA 4EMHA 2XI9A 1ZHIA 4DOWA 2ZPGB 5CCAA 3PIOA 3QBYA 1YBYA 1VQPT 5CK9A 1N6AA 3A8MB 3HP9A 4KUIA 3PIPA 4BE0A 1W2BS 4M77D 2M9UA 5L8RE 3I56A 3CCMA 2EAYA 4J83A 4MZPA 3FLGA 1U1SA 1V29B 4ZGDB 3FC3A 2YLBA 3CC4T 2DVEA 1PSEA 1WJRA 1ZQ1A 2FB7A 2JUFA 5CQYA 5A2QE 2IG0A 1BYMA 2I2LA 2VGNA 4N4IA 4XTWA 3X28B 4C8QG 1KC8U 1BI3A 1NPRA 1X6OA 5FU6C 1VQ6A 4KBMB 2XDPA 1I81A 4OVAA 4M7DD 5LJ3f 4C92E 4JRIA 1QVFS 4C0GA 5I2SA 1VQ9A 2QQ9A 4F7UE 1JJ2A 3AHUA 2F69A 4M75B 3CCJA 3JCMh 3QJ6A 2PU9B 2D0QB 1BKBA 4X34A 5LJ5d 3G6EA 1KQSS 4OB0B 1G3WA 3CCJT 2WSCE 3M4GA 2VV5A 3EFSA 3TU4K 2E64A 3NFCA 4X9CA 2K3XA 4F7UA 4J7IA 3OW2A 3I55T 1XNIA 3SDZA 1VQOT 1YI2A 3A8GB 2L5QA 4JS5A 4MMKA 2YRVA 1VQLT 2X4YA 4M77A 5GAN3 4PJOE 3MP6A 2JZ2A 1M90C 4LD9K 2CKKA 2JNGA 4C92B 4XU3A 3CBMA 3VU3C 3TCJA 4BUGA 1BI2A 1VQKA 1YHQT 1YJNA 4IKFA 4M7DF 2EKOA 1JJ2S 2XU8A 2M16A 2RHUA 4J5YA 1TH7A 1WQ7A 1Y7XA 3I56T 4F7UF 3CC2T 3JCMW 3RKXA 2X4WA 1YJ9A 4KT0E 2EIFA 2KY9A 3Q1JA 4RG2A 1KC8C 4J8OA 4C92F 2GQVA 2ZPHB 3C4SA 3SB2A 3CPWA 3JB9H 3OYFA 2RH2A 2OTLT 3J80E 3QSUA 4M7DC 2MMPA 4M78C 1MGQA 3SWNC 3RKYA 1KG1A 3GOXA 2Y4YA 2ZCFB 3JCMQ 3WVDB 1N9SA 2K57A 5HY6A 5FROA 3L2QA 1K8AU 2F5TX 4OMFB 1AHJB 2BIVA 5LJ5f 2F5KA 4C0FA 3L42A 5LJ5h 1Q7YU 1GXIE 4CI0C 3T9NA 5GAN6 1VQ4T 4M75A 4M78F 1Q81U 2O4XB 3S6WA 3JCMg 1VQ7T 2RK1A 1M90U 3GIBA 3G4ST 2P0KA 3CPWS 4ATOA 3OB9A 3VYHB 3QIIA 4PNOA 4EMKC 3UDCA 1LJOA 3A8HB 4F7UB 4M7AF 2DXBA 1S72A 2Y90A 1B34B 2CS7A 5GAMh 2DZCA 3OYGA 4OGEA 4M7DA 3JCMf 3G6ET 2DTHA 2XIDA 3CC2A 1M1GA 3QZ9B 4C92C 2O01E 2PUOB 4EPCA 3OYYA 2K5IA 4XTVA 2EQMA 1M8VA 2KK4A 1I4K1 3TREA 5C6SA 1RI0A 1G3YA 4OP0A 4M7DE 2VUBA 5CKHA 4Y91A 3JSCA 3GLXA 4LDUA 4XTUA 2V8KA 2P0PA 4Q5WA 2QDYB 5CQXA 3C95A 4M75E 3SWNA 2MAMA 2HQEA 4M77B 5D6WA 3I55A 1VQOA 4PJOF 4JRPA 3BY7A 3META 3QYGB 1MHNA 4JLIA 3S3MA 5KCHA 3OS0A 2VGMA 2DIQA 2H3JA 3RESA 1P92A 3A8OB 4R55A 5CVIA 2A7YA 5DLQE 4BE1A 5CO7A 1BI1A 2CZ1B 3RIRA 3L2VA 4DQ2A 1LNXA 3PFSA 3V7SA 5J26A 2RJFA 1UEBA 3V8KA 4ELYC 1KD1C 3CCUA 3UWNA 4BY6B 3NTHA 4M7DB 1OZ2A 3EFRA 4M7AC 5GAN2 3RMSA 2LRQA 2E1HA 3MO8A 4N4HA 3SD4A 2DAQA 3V7CA 1JB0E 4M75D 1X01A 5GAOp 4LDVA 5KE3A 5HKCA 2RO0A 4C0DB 1YITA 3L2UA 1HK9A 2E10A 3MCAB 4TVRA 2XKOC 2MWOA 4FSXA 2EWNA 3JCMd 1XOVA 4C5EA 2EJGA 1XTDA 4JRQA 1YIJT 1VQKT 2R58A 3CCMT 3KXTA 1UGSB 1G5VA 3MHXA 4PLLA 3VKIA 4QQGA 4M75F 3FIFA 2QEXA 4C92D 3HL8A 3CPFA 4XU1A 3C12A 4LD6A 2QQRA 4PL6A 4ME7A 3OYCA 3E9GA 2RI3A 4O6JA 2DTOA 2GF7A 2PVOB 1M9SA 3ME9A 4C8QC 5CR2A 4QQ6A 5CKFA 4P5NA 2LQKA 4CRIA 4DOVA 5GAMd 1UGPB 2FVUA 2XICA 3MEUA 2L3RA 3OS5A 4XU2A 3OY9A 4L6V5 1WQWA 2VXEA 1VQ9T 3CCSA 3RKWA 1YJNT 3H6ZA 2R57A 1N27A 1G3TA 4M7AE 1X75C 1KQ2A 4RKUE 3QDRB 2D9TA 3CCLT 3A5ZB 2JN0A 3HFNA 2HAXA 4HT8A 5HK0A 3ASKA 3FJPA 5GAOm 2OTJT 2P0QA 1QP3A 1I5LA 1W4SA 2DK3A 1PSFA 1QVPA 4MZMA 4E7KA 1N8RC 5GAOr 3OYLA 2RHXA 2XHCA 2YHTA 1N8RU 1VQNA 4XK8E 3FB9A 5FU6B 5CKEA 3OYNA 4A54A 3EAEA 2PUKB 1YHQA 3DB4A 3NTIA 2BKDN 4M75C 5CIUA 3VUBA 3ZBDA 5GAN5 2OTLA 2DZ9A 5LJ5g 3QKJA 4FU6A 3OYJA 3QYHB 4C5GA 4O5VA 5KE2A 2OAUA 3G7ZA 3M53A 4C8QA 4BDYA 2R5MA 3CMET 3L2WA 2ZGWA 3OYAA 1YI2T 2B8AA 1VIEA 3OYDA 4GLKA 2HNIA 2QTXA 4JDSA 4OGCA 1H3ZA 5GAMe 4C5IA 4E7HA 4FIBA 3UPUA 1VQ5T 1WJQA 4MZTA 3FDRA 2M0OA 2DXTA 3VYGA 2DPPB 2RHZA 3RUXA 2EJFA 4KULA 4NL2A 4L59A 4A4HA 4PJOB 3MEAA 2WSEE 3JCMb 5GMKe 2PVDB 3OBYA 4FT2A 1OYXA 2MWPA 4M78G 3KUFA 4IUTA 2RHYA 3ER0A 1D3BA 1WJSA 5GAOn 3S3NA 4M75G 1O9SA 1OI1A 5GANe 4LDXA 1QVFA 3G4SA 2FL7A 3LX7A 2FHDA 5I21A 4XQ3A 5EG2A 3H8ZA 1FXXA 1KHCA 5GAMj 3CMAA 4M7AA 2LCLA 2VYTA 3P8HA 2VXFA 2MF2A 3OYMA 4E7LA 1Q82U 1VQ8T 4NL3A 5LJ5e 3M59A 1Q82C 2E12A 2WSFE 2XDDA 1K73C 1Y96B 5LJ3h 4A4EA 1QVGS 4XTZA 2DO3A 3HSBA 4XAXB 5FLXE 4ZGJB 3M56A 1KQSA 2RD1A 4C92G 2L89A 2E5QA 3ZEHA 4JJNK 4E47A 4YTLA 3CXCS 2KQWA 1HXDA 2KMTA 3C94A 3OMGA 5CKDA 1VQ4A 4J6WA 3HRTA 2ZZDA 1QP2A 2DTIA 1I8FA 3E19A 3CD6A 5LJ3j 3CBPA 4N4GA 5CKBA 1QW1A 1YITT 1XQHA 4XU0A 2HD0A 1YCYA 4UC4A 1N9RA 3OBWA 5GAN8 1O75A 4B9XA 4PJOG 4BB7A 1QVGA 3OQ5A 1UB4A 3JCMP 5FRMA 3DLLA 3DKMA 2K5LA 5M9OA 4RMOA 2DEQA 2QEXT 3O8VA 2DD5A 2KAFA 2EJ9A 3LLRA 4E7IA 5IAYA 4BDZA 2EYQA 4LDYA 5FRNA 4A4FA 2D6FA 3CCVT 2QA4T 2RA2A 5DLOA 4FT4A 3X20B 2E41A 1VQMT 3PGGA 1NZ9A 4II1A 1M5Q1 4F7UG 2LCCA 3PNWC 3OYEA 5HK3A 2K3YA 1BIBA 4ZN3A 4M7AG 2RB6A 1BIAA 2X4XA 5CAIA 5AYFA 4M77E 3X26B 2LQ8A 4HA8A 4JRKA 1FX7A 5LJ5j 4XTXA 4ELZC 2E6ZA 2MI6A 2PQWA 2K4YA 2QI2A 4C0DC 4ZN1A 5IT9E 2CYZB 2YLCA 4PJOC 4A53A 2BUDA 3OS2A 2ZPIB 4IURA 4RCBA 1R8OB 2E70A 2VC8A 3M4YA 5GAOq 1ZBXA 3LYIA 4NOYA 3JAME 4J6YA 3JB9D 3M9QA 1M1KC 3SFMA 3OA6A 1VIFA 3CBOA 1S72T 5A0GA 2XDBA 4V2SA 3X24B 1M1KU 3OS1A 1Q86U 1VQPA 3P8BB 3GPLA 3CCQT 3CCLA 1Y07A 3PT9A 2E65A 2FYKA 2JOYA 4GY5A 3VV0A 4BY6C 4M78B 5GAMf 5KH6A 1KD1U 2IVWA 4M78A 4JS4A 2G3RA 2RJDA 3E9FA 4PLIA 5GAOl 4N0AC 1VQ7A 2ZPFB 5D6YA 4XTYA 2P4TA 4M77C 3E1SA 3GF5A 4FM4B 4EDUA 3L1AA 4RG8A 5LJ3d 3J7AF 4PJOD 4PKCC 5IN1A 3WVEB 3CD6T 2HBPA 2KDSA 4M7AB 1VQ5A 3FEOA 2PVGB 3M55A 3HKSA 3M57A 5C0MA 4M7DG 3HPWA 5GANh 3JCMJ 3MEWA 5GANf 1UGQB 4WF2A 3GP8A 2DXCA 4QVDA 3MP8A 3QJYA 3JCMX 3HRSA 3LW5E 4J7FA 3ZFJA 4FL6A 3PMIA 2DJZA 2X4JA 2GCXA 3HHTB 4PJOA 4IUPA 2EQUA 3QHSA 3CC7A 1NE8A 1UGRB 4HCBA 3QO3A 4EMKA 2M1HA 3PTAA 3L2RA 3CMAT 4JLGA 4OB3B 2EQKA 3OSVA 1FWZA 3L2ZA 3G71T 4DA4A 4EMGA 4C8QB 3RMQA 4M77G 1KHIA 3JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y96 B;  5LJ3 h;  1LOJ A;  3RES A;  4XTZ A;  2RM4 A;  3HFO A;  4C8Q F;  3HSB A;  4M77 D;  3RIR A;  2EAY A;  2RD1 A;  4C92 G;  2DXU A;  4DQ2 A;  1LNX A;  1U1S A;  3V7S A;  3V8K A;  4RCC A;  2YLB A;  3JCM d;  2DVE A;  4M7D B;  1HXD A;  3EFR A;  4M7A C;  5GAN 2;  2FB7 A;  2E1H A;  4J6W A;  3V7C A;  2DTI A;  1I8F A;  1X01 A;  2I2L A;  4M75 D;  3QUI A;  4XTW A;  3SWN B;  4C8Q G;  5DY9 A;  5LJ3 j;  5GAO p;  1HK9 A;  2E10 A;  1I81 A;  1D3B B;  4XU0 A;  5LJ3 f;  1YCY A;  2EWN A;  4C8Q E;  1N9R A;  4X9D A;  4C92 E;  4JRI A;  2EJG A;  3BDU A;  5GAN 8;  3AHU A;  4PJO G;  4F7U E;  4M75 B;  3JCM P;  3JCM h;  5GMK l;  5LJ5 d;  2DEQ A;  3V8L A;  1B34 A;  3M4G A;  3EFS A;  2E64 A;  2EJ9 A;  3FIF A;  4M75 F;  4X9C A;  4C92 D;  4F7U A;  3JCM c;  1Y96 A;  3JB9 I;  4XU1 A;  2RA2 A;  4MMK A;  2E41 A;  2CGH A;  3PGG A;  4M77 A;  2DTO A;  4C8Q C;  1M5Q 1;  4F7U G;  5GMK m;  5GAN 3;  4PJO E;  4M78 E;  4C92 B;  4EMK B;  1BIB A;  4MML A;  4XU3 A;  3VU3 C;  3V7R A;  4XU2 A;  5GAM d;  5GAN 7;  2RB6 A;  1BIA A;  5CAI A;  3JB9 G;  3BFM A;  4M7A G;  3V8J A;  1WQW A;  2VXE A;  4M77 E;  4HA8 A;  4JRK A;  3RKW A;  4M7D F;  5LJ5 j;  4M7A E;  4XTX A;  4J5Y A;  1TH7 A;  1WQ7 A;  1KQ2 A;  4F7U F;  1JBM A;  1U1T A;  4QVC A;  2JN0 A;  3RKX A;  3HFN A;  3JCM W;  4HT8 A;  3FJP A;  5GAO m;  2DKG A;  1WPY A;  1I5L A;  5GMK i;  2YLC A;  4C92 F;  4A53 A;  4PJO C;  5LJ3 e;  5GAN 4;  3SB2 A;  5GAO r;  3JB9 H;  4RCB A;  2YHT A;  5LJ3 g;  2VC8 A;  5GAO q;  5GAN j;  4NOY A;  4M78 D;  4J6Y A;  3FB9 A;  1JRI A;  3JB9 D;  3QSU A;  4M7D C;  1KQ1 A;  4J6X A;  4A54 A;  4M78 C;  1MGQ A;  4HT9 A;  3SWN C;  3RKY A;  3JB9 J;  4V2S A;  3JCM Q;  4M75 C;  5GAN 5;  1N9S A;  2K57 A;  2DZ9 A;  5GAM f;  2E65 A;  2FYK A;  5LJ5 g;  4M7A D;  4M78 B;  5LJ5 f;  5GAM g;  4M78 A;  5LJ5 h;  5GAO l;  4M7D D;  4N0A C;  5GAN 6;  4M75 A;  4M78 F;  4XTY A;  3GIB A;  4M77 C;  3JCM g;  4C8Q A;  5GMK h;  3L1A A;  5LJ3 d;  2ZGW A;  5GAN d;  4PJO D;  2QTX A;  2HNI A;  3INZ A;  4M7A B;  5GAM e;  4N0A A;  4M7D G;  4PNO A;  4EMK C;  5GAN h;  1LJO A;  4F7U B;  3JCM J;  2DXT A;  4M7A F;  5GAN f;  3JB9 F;  2Y90 A;  1H64 1;  1B34 B;  4WF2 A;  4M77 F;  2EJF A;  3RUX A;  4NL2 A;  2DZC A;  5GAM h;  4QVD A;  4PJO B;  3JCM b;  5GMK e;  4M7D A;  3JCM f;  3JCM X;  2DTH A;  5GMK j;  4C92 C;  3JCM V;  4JUV A;  4XTV A;  2DJZ A;  1M8V A;  4M78 G;  4PJO A;  1I4K 1;  1D3B A;  3QHS A;  4OP0 A;  5GAO n;  4C8Q D;  4M7D E;  4M75 G;  4Y91 A;  5GAN e;  1WNL A;  3QO3 A;  4EMK A;  4XTU A;  5I21 A;  4C92 A;  4XQ3 A;  5GAN g;  3RER A;  3SWN A;  4M75 E;  4M77 B;  3BW1 A;  5GAM j;  4M7A A;  4PJO F;  3BY7 A;  3L2Z A;  2VXF A;  3JCM e;  4JLI A;  4NL3 A;  4EMG A;  4C8Q B;  5LJ5 e;  4EMH A;  4M77 G; 
#chains in the Genus database with same CATH topology
 1CKA A;  2VAS A;  2NWM A;  2LX9 A;  2GNC A;  1WGS A;  1RAI B;  3MEV A;  5DY9 A;  2GFU A;  1X2Q A;  1D3B B;  2V8J A;  4X9D A;  4C0Z A;  4ZTF A;  2X51 A;  1R77 A;  2AK5 A;  1K9A A;  4KUD K;  1MUZ A;  2V8I A;  1OZ3 A;  2L0A A;  2M51 A;  2LTO A;  2JS0 A;  2DVJ A;  3EGD A;  5GMK m;  2DL5 A;  5KYW A;  4B9W A;  2L8D A;  3V7R A;  3V8J A;  3G1J A;  5D6X A;  2A08 A;  3LGF A;  4IUQ A;  4HKE A;  4OB2 B;  4BI3 A;  2ZPE B;  3G71 A;  1LVK A;  1K73 U;  3OW2 S;  1TUC A;  3S3O A;  3BDL A;  1GBQ A;  7AT1 B;  3MP1 A;  1NJI U;  5L23 A;  4RUG A;  3VS1 A;  8AT1 B;  1PD1 A;  3NPF A;  4ZGE B;  2EGA A;  2L3P A;  1VQM A;  3CCE A;  3QXE B;  1TUD A;  4F16 A;  1QQJ A;  2RHI A;  2A0F B;  2O4X A;  4N0A A;  2YUO A;  1AWJ A;  2RI5 A;  5KYY A;  1SF9 A;  1H64 1;  1Q86 C;  1YIJ A;  3CCS T;  1K8A R;  4JUV A;  4IUV A;  2CZ6 B;  1G83 A;  4A4K A;  1C6V X;  3R6O A;  2FG0 A;  4HXJ A;  1JEG A;  2HSP A;  4AFZ C;  2BTT A;  3CME A;  4OF1 A;  3RER A;  2QQA A;  3CCQ Q;  2X35 A;  2WAC A;  2ZPG B;  4GLM A;  3PIO A;  1YBY A;  1YCS B;  1VQP T;  3HP9 A;  4BE0 A;  2M9U A;  3I56 A;  2A28 A;  4J83 A;  2J7I A;  1U1S A;  4ZGD B;  2DVE A;  2XMF A;  1PSE A;  2JUF A;  2E5K A;  4ANJ A;  1BYM A;  2I2L A;  1NLP C;  4C8Q G;  4PFZ A;  3REA B;  1KC8 U;  3M0P A;  4KBM B;  1X69 A;  4OVA A;  3PVL A;  1QVF S;  1R0B G;  2J06 A;  2QQ9 A;  2F69 A;  4X34 A;  4OB0 B;  1X27 A;  3EFS A;  4DBH A;  2O88 A;  1UG1 A;  3NFC A;  4X9C A;  4J7I A;  3I55 T;  1YI2 A;  3A8G B;  1QCF A;  2MPX C;  4ZNX A;  4PJO E;  1D1A A;  3MP6 A;  4LD9 K;  1PNJ A;  2GGR A;  4C92 B;  3CBM A;  1AWO A;  3RR6 A;  1NYG A;  1OU9 A;  1X43 A;  3CCL Q;  1JJ2 S;  2RHU A;  4J5Y A;  1TH7 A;  4RTW A;  3I56 T;  2OTJ Q;  1YJ9 A;  2DM1 A;  2D0N A;  2ZPH B;  3C4S A;  3SB2 A;  3QSU A;  1SEM A;  1RAC B;  2MMP A;  3RKY A;  3JCM Q;  3VS4 A;  2DX1 A;  5HY6 A;  2AT1 B;  1NBE B;  4E6R A;  5LJ5 f;  5LJ5 h;  1YP5 A;  1RAG B;  3VS5 A;  2HZY A;  2OX7 A;  1JU5 C;  2SEM A;  4J9H A;  4EMK C;  4F7U B;  3VS2 A;  2DXB A;  1S72 A;  2CS7 A;  5GAM h;  3CC7 Q;  1M1G A;  4J9D A;  1D0Z A;  4LUE A;  2PUO B;  4EPC A;  1SHG A;  5C6S A;  2FO0 A;  2CSI A;  1EX4 A;  5CQX A;  1VQO A;  3SWN A;  2HQE A;  1BBZ A;  4JRP A;  4KGV B;  3S3M A;  1MMN A;  4R55 A;  2A7Y A;  5DLQ E;  3RIR A;  2QGG A;  5CO7 A;  4DQ2 A;  3PFS A;  3V7S A;  3CD6 Q;  3CCU A;  3UWN A;  2YT6 A;  4M7D B;  3EFR A;  4M7A C;  2E4H A;  9ATC B;  4N4H A;  3MO8 A;  1X01 A;  4LNP A;  2LX7 A;  3E2U A;  5KE3 A;  4KGX B;  1W2B P;  1HK9 A;  1LPL A;  4AG2 C;  2DJQ A;  1XJW B;  1XOV A;  1ZSZ A;  1VQK T;  1WLP B;  1G5V A;  4C92 D;  1M2V A;  3CPF A;  4XU1 A;  4JZ4 A;  4LD6 A;  4PL6 A;  1X2K A;  2GF7 A;  1I0C A;  4CRI A;  1YI2 Q;  1UGP B;  2FVU A;  4XU2 A;  1K0X A;  4OML A;  2GQI A;  2OI3 A;  2VXE A;  1YJN T;  1G3T A;  5KYN A;  1YWO A;  3G4S Q;  3EG3 A;  1I5L A;  4MZM A;  1QVP A;  1N8R C;  4B6M A;  2CT4 A;  2YHT A;  4XK8 E;  1EFN A;  3EAE A;  1EZZ B;  1WZO A;  1HD3 A;  4M75 C;  5CIU A;  3QKJ A;  3I55 Q;  2W10 A;  2FPF A;  2JM9 A;  4FCY A;  2B8A A;  1VIE A;  4C5I A;  3NGP A;  4FIB A;  1VQ5 T;  2NUZ A;  1WJQ A;  3I5R A;  4MZT A;  3FDR A;  3VYG A;  2X3W D;  1W1F A;  4L59 A;  4A4H A;  2PVD B;  1IGQ A;  3VS0 A;  2L2P A;  4IUT A;  1OPK A;  1YIJ Q;  3EG1 A;  4M75 G;  1OI1 A;  3G4S A;  1MMD A;  4EIK A;  1VQL Q;  3H8Z A;  2KXC A;  5GAM j;  1U5S A;  2VYT A;  4E7L A;  1Q82 U;  2VXF A;  1IHV A;  1K73 C;  2WSF E;  1E6H A;  3HSB A;  1KQS A;  3ZEH A;  4JJN K;  4AMC A;  4FW2 A;  4YTL A;  1D1B A;  3CXC S;  2KQW A;  3OMG A;  1JXM A;  3HRT A;  2ZZD A;  2O31 A;  2KI7 A;  3E19 A;  3CD6 A;  4N4G A;  1XQH A;  2NUP B;  1YCY A;  4UC4 A;  4E2F B;  3OBW A;  1NJI R;  2MIO A;  5GAN 8;  4B9X A;  2BZ8 A;  3JCM P;  4RMO A;  2DEQ A;  2EJ9 A;  4LDY A;  3CCV T;  5DLO A;  1VQM T;  2E41 A;  1OOT A;  1PKS A;  3EG2 A;  3OYE A;  1QKW A;  3EFO B;  1F1B B;  2RQR A;  1BIB A;  1YHQ Q;  4ZN3 A;  1YJW Q;  1BIA A;  4F04 B;  4M77 E;  3X26 B;  4HA8 A;  1WHG A;  1FX7 A;  5IXF A;  3MPU B;  4XTX A;  4M4Z A;  3VRZ A;  3JV3 A;  2CYZ B;  2VKN A;  4A53 A;  2BUD A;  1IHW A;  3CCJ Q;  2VC8 A;  2V26 A;  1KQS P;  3M9Q A;  1M1K C;  1YWP A;  3OA6 A;  2C0T A;  2XDB A;  3X24 B;  2FRW A;  3P8B B;  3GPL A;  2Z0W A;  3CCQ T;  2O2O A;  2DET A;  1PC0 A;  4M78 B;  4M78 A;  2EYX A;  5GAO l;  2P4T A;  3GF5 A;  1K4U S;  1MMG A;  3CD6 T;  2V1Q A;  1YNZ A;  4M7A B;  2LMJ A;  3FEO A;  1VQ5 A;  5IHI A;  3GP8 A;  1AVZ C;  3ZFJ A;  1M3B A;  2DJZ A;  2X4J A;  4PJO A;  2EQU A;  3QHS A;  3CC7 A;  1GBR A;  4HCB A;  3QO3 A;  3L2R A;  2M1H A;  1TSF A;  2DE0 X;  4JLG A;  4OB3 B;  1GCP A;  1TG0 A;  2QG9 B;  1WDX A;  4C8Q B;  5CQY A;  2DD4 A;  2RM4 A;  4C8Q F;  4E7J A;  2D8H A;  2XD0 A;  4WCI A;  1PD0 A;  1GCQ C;  1YJ9 T;  1UFF A;  1Q81 C;  5IXB A;  1VQ8 A;  3QG1 A;  3J81 E;  3BE3 A;  3JCM e;  3OYK A;  1GCQ A;  3LGL A;  1Q95 G;  1Q86 R;  1G3S A;  1QMC A;  2GTJ A;  3V8L A;  3VS6 A;  3WXM B;  1NJI C;  1I1J A;  1K9M U;  5FWC A;  3CCS Q;  2M02 A;  5EC7 A;  4M78 E;  1PKT A;  2ABL A;  1WIE A;  2ATC B;  1ACM B;  1K8A C;  4BI4 A;  1GFC A;  2RJE A;  1WHH A;  1YJW A;  4Z02 A;  1Q7Y C;  1OPL A;  2JTM A;  3M58 A;  4BAC A;  5GAN 4;  3QPH A;  3H0H A;  5GAN j;  1K0S A;  4M78 D;  4J6X A;  2LNV A;  2BZX A;  2XG8 D;  2O9V A;  3JB9 J;  4OMN A;  3GNF B;  2PTK A;  2Y4X A;  4M7A D;  5GAM g;  3DB3 A;  3P8D A;  1K76 A;  1I5O B;  2LDM A;  2RI2 A;  1G8X A;  5GMK h;  3VRY A;  5GAN d;  4IUU A;  4VUB A;  1AOJ A;  2QA4 A;  5DM7 R;  3CXC A;  2QXF A;  5J39 A;  2M0Y A;  5GMK j;  1RUW A;  5A0L A;  2KT8 A;  1YJW T;  4C8Q D;  2BZY A;  1WNL A;  1DJ7 B;  2J6O A;  4QQD A;  4DBF A;  2XI9 A;  1S72 Q;  2RQV A;  4OMP A;  1BU1 A;  1K1Z A;  2LQN A;  1E7O A;  3PIP A;  5L8R E;  3FLG A;  1V29 B;  3FC3 A;  3CC4 T;  1RAH B;  5A2Q E;  1FYN A;  4N4I A;  3CCU Q;  2KEA A;  2X9H A;  1NPR A;  1X6O A;  2OAW A;  4PJN A;  5LJ3 f;  1W6X A;  1VQ9 A;  1JJ2 A;  3JCM h;  3QJ6 A;  2AZS A;  1BKB A;  3G6E A;  5LJ5 d;  1G3W A;  2WSC E;  3M4G A;  1WXU A;  2DFU A;  1LCK A;  2DL3 A;  3RNJ A;  3SDZ A;  3ULR B;  1NG2 A;  2YRV A;  5GAN 3;  2CKK A;  2QDL A;  4D8K A;  1Y57 A;  3TCJ A;  1YHQ T;  3EG0 A;  1Y0M A;  2EKO A;  1QWE A;  4F7U F;  3GBQ A;  1VOM A;  2YUN A;  1RAE B;  1KC8 C;  2GBQ A;  2GQV A;  3H0I A;  3RDV A;  3OYF A;  3EHQ A;  4AG1 C;  1MGQ A;  2ZCF B;  3WVD B;  6AT1 B;  2K57 A;  3L2Q A;  1K8A U;  2B86 A;  2CH4 W;  1M3C A;  3L42 A;  2VB6 A;  3T9N A;  4CI0 C;  5GAN 6;  1VQ4 T;  4M75 A;  3S6W A;  1VQ7 T;  2RK1 A;  1E6G A;  3M0S A;  1UEC A;  4D8D A;  4PNO A;  1D0X A;  3UA7 A;  1LJO A;  1TWB A;  1JO8 A;  3A8H B;  3UDC A;  2DL8 A;  1B34 B;  4JJB A;  3SEM A;  4M7D A;  3G6E T;  2RMO A;  2XID A;  4C92 C;  2QEX Q;  2O01 E;  1M8V A;  4IIM A;  3TRE A;  1RI0 A;  1G3Y A;  3GLX A;  2ROL A;  2QDY B;  2RQW A;  4ORZ A;  4PJO F;  3QYG B;  4JLI A;  4OMQ A;  4K11 A;  2VGM A;  3OS0 A;  1PRM C;  5CVI A;  4HCK A;  2DBM A;  1BI1 A;  1RLQ C;  2CZ1 B;  2DRK A;  3V8K A;  2RJF A;  3I35 A;  1OZ2 A;  3RMS A;  2E1H A;  1JB0 E;  5GAO p;  1NEB A;  5HKC A;  2RO0 A;  3EG9 B;  4C0D B;  3JCM d;  2MWO A;  1XTD A;  1R0C B;  2R58 A;  2OJ2 A;  2L3S A;  1T0H A;  2CDT A;  1WYX A;  1T3S A;  1UGS B;  4PLL A;  2D8J A;  4QQG A;  4M75 F;  2QEX A;  1N5Z A;  2IIM A;  1TS9 A;  1SSH A;  3C12 A;  3OYC A;  4C8Q C;  3ME9 A;  2LQK A;  2O9S A;  3OY9 A;  3MEU A;  2L3R A;  3OS5 A;  1OUL A;  3CCS A;  3RKW A;  2CT3 A;  3H6Z A;  2R57 A;  1N27 A;  4M7A E;  1KQ2 A;  4RKU E;  4R0K A;  3A5Z B;  3HFN A;  5GAO r;  3OYL A;  2RHX A;  1VQN A;  2COZ A;  3FB9 A;  5FU6 B;  1YHQ A;  3NTI A;  2BKD N;  3ZBD A;  2ED0 A;  2DZ9 A;  1UGV A;  3OYJ A;  4O5V A;  3QDF A;  5KE2 A;  2OAU A;  3M53 A;  3CME T;  3L2W A;  4OMO A;  2ZGW A;  3TSZ A;  3OYD A;  2E3I A;  1SKU B;  4GLK A;  1H3Z A;  5GAM e;  1BCO A;  2K6D A;  2RHZ A;  4KUL A;  4NL2 A;  3CPW P;  5GMK e;  3PVQ A;  1OYX A;  2MWP A;  3KUF A;  3ER0 A;  5GAO n;  1O9S A;  2ROT A;  2FHD A;  2LJ1 A;  4PJJ A;  8ATC B;  1FXX A;  2CUD A;  2LCL A;  3P8H A;  4NL3 A;  2HKN A;  5I11 A;  1KSW A;  4XTZ A;  3M56 A;  2RD1 A;  3TQ7 P;  2E5Q A;  4E47 A;  2KMT A;  4FSS A;  5CKD A;  1X6B A;  1QP2 A;  1U06 A;  1I8F A;  2FPE A;  1KD1 R;  1VQP Q;  4BB7 A;  1RAA B;  1UB4 A;  5FRM A;  4LN2 A;  1WHL A;  2D1X A;  2QEX T;  3VS3 A;  3MKD A;  4LE9 A;  2EQI A;  2F2V A;  4II1 A;  4F7U G;  3KFV A;  2HMA A;  2IPO B;  3CCV Q;  2DIL A;  2LQ8 A;  2QTV A;  1HYO A;  4ELZ C;  2E6Z A;  4CC4 B;  2HQH A;  2QI2 A;  5IT9 E;  5KYY B;  2YLC A;  1W70 A;  4RCB A;  1R8O B;  3M4Y A;  5GAO q;  3LYI A;  1PM3 A;  4E7S A;  1Q82 R;  1S72 T;  5A0G A;  4V2S A;  1VQP A;  4DEX A;  2E65 A;  1KD1 U;  2RJD A;  3CC2 Q;  1VQ7 A;  2KYM A;  4XTY A;  2MOX A;  4FM4 B;  4EDU A;  4LXC A;  5LJ3 d;  3VS7 A;  3HKS A;  2LJ3 A;  3M57 A;  2KE9 A;  1UGQ B;  2E3H A;  4QVD A;  3MP8 A;  3QJY A;  1MV3 A;  2ZAE A;  3HRS A;  3JCM X;  3LW5 E;  4J7F A;  2DMO A;  2GCX A;  2KXD A;  2DNU A;  1NE8 A;  1UGR B;  4RTU A;  1PWT A;  4QKU A;  4EMK A;  3PTA A;  2EQK A;  2EPD A;  1FWZ A;  3EHR A;  3RMQ A;  4M77 G;  3EGX B;  3JRZ A;  4NS5 A;  4Y28 E;  1LOJ A;  3HFO A;  4HCZ A;  5I2M A;  2DXU A;  1IZ6 A;  2LVM A;  3X25 B;  4RCC A;  3CCE T;  1RL2 A;  1VUB A;  4PJL A;  2CP6 A;  4A63 B;  2K5F A;  4D6W A;  3SWN B;  3M0T A;  3QUI A;  4J9B A;  4C8Q E;  1EIF A;  2C06 A;  5FU7 C;  4OB1 B;  1FMV A;  3BDU A;  3CCR T;  1M1K R;  4IIO A;  1VQN Q;  1B34 A;  3CMA Q;  1UUE A;  2L3Q A;  3URG A;  2HL3 A;  3OYH A;  1A0N B;  1OQK A;  2YDL A;  4L5G A;  1UTI A;  1CSK A;  2CGH A;  3OSS C;  3QZ5 B;  1IRE B;  3LWH A;  2JVV A;  3JB9 G;  1KC8 R;  2H8H A;  3BFM A;  3LWI A;  2KT1 A;  1U1T A;  2ZPB B;  4FW1 A;  1WPY A;  4CC3 A;  2KVQ G;  2OTJ A;  5GMK i;  2LC4 A;  2QYZ A;  1MMA A;  3H0F A;  4C5H A;  5LJ3 g;  2QQB A;  2EFI A;  2R5A A;  4QW2 A;  2E6N A;  4KH0 B;  1IXD A;  1X6G A;  5KCO A;  2EQJ A;  4QVZ A;  1IRX A;  3DLM A;  3EGU A;  2EGC A;  3VJP A;  2P84 A;  2SRC A;  1NPP A;  4DEY A;  1ZSZ B;  3INZ A;  2YWW A;  3A98 A;  2NLU A;  4J9F A;  1OV3 A;  1M2V B;  3JB9 F;  3OYB A;  1M30 A;  2CZ0 B;  4M77 F;  2FZK B;  2A3L A;  5FU7 B;  3I9Q A;  2JMA A;  3M54 A;  2DRM A;  1PRL C;  1Q7Y R;  3CC7 T;  1M2O A;  4C92 A;  4MDX A;  4KGZ B;  3A8L B;  2CP2 A;  2VVK A;  3GNG A;  2I0N A;  4ZTJ A;  5CCA A;  3QBY A;  1RAD B;  4KUI A;  3A8M B;  1W2B S;  4M77 D;  3CCM A;  4MZP A;  4OMM A;  2YLB A;  1YIT Q;  2MCN A;  3H9N A;  1YN8 A;  1WJR A;  2FB7 A;  2J05 A;  2VGN A;  3X28 B;  1BI3 A;  2KR3 A;  2JXB A;  5FU6 C;  2XDP A;  1I81 A;  4M7D D;  2C0O A;  1Q81 R;  4M75 B;  3CCJ A;  2PU9 B;  1VQ8 Q;  1RLP C;  2DL7 A;  2VV5 A;  2K3X A;  1ZUU A;  3OW2 A;  2YSQ A;  1BK2 A;  1VQO T;  1XNI A;  3M0R A;  2X4Y A;  1VA7 A;  1M90 C;  3VU3 C;  4BUG A;  1BI2 A;  1VQK A;  3CCE Q;  4M7D F;  2M16 A;  1NYF A;  1Y7X A;  4JJC A;  3JCM W;  2X4W A;  3NHN A;  2JJ9 A;  4J8O A;  4C92 F;  3CPW A;  2RH2 A;  2OTL T;  3J80 E;  2V1R A;  1ZA1 B;  1D1C A;  2YRC A;  3GOX A;  2Y4Y A;  2CP0 A;  4F14 A;  5FRO A;  2PNI A;  2BIV A;  4C0F A;  5HCK A;  2PZ1 A;  4M78 F;  1Q81 U;  2HBW A;  2O4X B;  3GIB A;  1OEB A;  3QWY A;  3CPW S;  2FZG B;  3SHW A;  3QII A;  1QCO A;  2DER A;  4M7A F;  5FWB A;  1WFW A;  3JCM f;  2DTH A;  2LP5 A;  2K5I A;  2A36 A;  2EQM A;  2KK4 A;  1I4K 1;  4OP0 A;  2NUP A;  2HCK A;  3JSC A;  2V8K A;  1AEY A;  2P0P A;  3I55 A;  4M75 E;  2MAM A;  4M77 B;  5D6W A;  3BY7 A;  3MET A;  2KGT A;  2BE7 D;  2H3J A;  1WXT A;  3RES A;  1P92 A;  1UJ0 A;  3A8O B;  2CP7 A;  3L2V A;  1LNX A;  5J26 A;  3TVT A;  1UEB A;  4ELY C;  1KD1 C;  1QWF A;  4BY6 B;  3NTH A;  2RN8 A;  3R6N A;  1UE9 A;  2KRO A;  5GAN 2;  2LRQ A;  4M75 D;  5KYU B;  2KBT A;  5KYU A;  1YIT A;  3L2U A;  2E10 A;  1B07 A;  1CKB A;  4FSX A;  2GTO A;  2EWN A;  2XKO C;  1NM7 A;  4J9E A;  1YIJ T;  2DLP A;  3H41 A;  3FIF A;  1Z9Z A;  3HL8 A;  2FZC B;  2A37 A;  1PCX A;  2QQR A;  4ME7 A;  4O6J A;  3E9G A;  2DTO A;  2PVO B;  1M9S A;  5CR2 A;  4QQ6 A;  5CKF A;  4DOV A;  5GAM d;  1VYV A;  2XIC A;  4L6V 5;  1WQW A;  1VQ5 Q;  1VQ9 T;  2NUT A;  3G6E Q;  2D9T A;  3CCL T;  2JN0 A;  4HT8 A;  3FJP A;  2OTJ T;  3REB B;  1QP3 A;  1W4S A;  2DYI A;  2DK3 A;  2QAZ A;  1AZE A;  2XHC A;  1N8R U;  2EBP A;  2KYB A;  3OYN A;  4A54 A;  3DB4 A;  3VUB A;  4J9I A;  1VQO Q;  4FU6 A;  3QYH B;  4C8Q A;  2R5M A;  1YI2 T;  2CH4 A;  2ED1 A;  1PHT A;  4E7H A;  2VWF A;  2DXT A;  2DPP B;  1SRM A;  4RTV A;  1WI7 A;  2EJF A;  4Y92 A;  4PJO B;  3MEA A;  1ARK A;  3JCM b;  1AWW A;  4FT2 A;  4FYV B;  2YUP A;  4M78 G;  2DEU A;  2RHY A;  3S3N A;  5GAN e;  4LDX A;  5IHK A;  2FL7 A;  3LX7 A;  4XQ3 A;  5EG2 A;  1B7T A;  1KHC A;  2HEQ A;  2MF2 A;  5FW9 A;  2JT4 A;  1VQ6 Q;  1Q82 C;  1I07 A;  2E12 A;  2XDD A;  1VQM Q;  1Y96 B;  1ABO A;  4ZGJ B;  5FLX E;  4C92 G;  1H92 A;  3A1P A;  1HXD A;  2EW3 A;  4J6W A;  4HVV A;  1QVG P;  3CBP A;  1VYT A;  4XU0 A;  4GBQ A;  1N9R A;  4F17 A;  1ABQ A;  1O75 A;  3OW2 P;  1ZA2 B;  1WXB A;  3DLL A;  3DKM A;  2K5L A;  2CSQ A;  3O8V A;  2W0Z A;  3LLR A;  5IAY A;  4BDZ A;  2EYQ A;  2QA4 T;  2RA2 A;  3X20 B;  1NZ9 A;  1M5Q 1;  2LCC A;  3PNW C;  5HK3 A;  1KIK A;  1VQ9 Q;  2K3B A;  2X4X A;  5CAI A;  2K79 A;  5LJ5 j;  2MI6 A;  1OX8 A;  4X1V A;  2PQW A;  5KYX A;  4ZN1 A;  1UHC A;  3U23 A;  5AT1 B;  2ZPI B;  1ZBX A;  4NOY A;  3JAM E;  4J6Y A;  3JB9 D;  1QLY A;  4JJD A;  3SFM A;  1VIF A;  1M1K U;  3OS1 A;  1AWX A;  3CCL A;  4RTZ A;  1ZSZ C;  1Y07 A;  4GY5 A;  2FYK A;  2JOY A;  3VV0 A;  4BY6 C;  5GAM f;  5KH6 A;  3UAT A;  2IVW A;  4JS4 A;  3E9F A;  4PLI A;  1UDL A;  4N0A C;  5D6Y A;  1KK7 A;  3NMZ C;  4M77 C;  3E1S A;  3L1A A;  1AT1 B;  4RG8 A;  3I56 Q;  3J7A F;  4PJO D;  4PKC C;  1VQ7 Q;  2KDS A;  3M55 A;  4AFS C;  4M7D G;  2NYS A;  3HPW A;  4JZ3 A;  5ECA A;  2CUB A;  4WF2 A;  4FL6 A;  3PMI A;  3HHT B;  1T3L A;  3EG9 A;  1OX9 A;  1JQQ A;  4E7Z A;  3L2Z A;  1ZSG A;  4EMG A;  1KHI A;  4R56 A;  4BD3 A;  2RQU A;  2DIG A;  2LT1 A;  4BE2 A;  2EVR A;  1UJY A;  2XK0 A;  2RF0 A;  3N5B B;  4HCC A;  2AKK A;  2RPN A;  3PMT A;  4QT7 A;  3KBG A;  2KNB B;  1M90 R;  4HVW A;  2K2V A;  2JTF A;  1W2B A;  2DL4 A;  2YRD A;  5GMK l;  3CC4 A;  2RQT A;  3CCQ A;  2COW A;  4Z8A A;  2OTL Q;  3FRN A;  3JCM c;  1Y96 A;  3JB9 I;  2F2W A;  2QK0 A;  3CCU T;  3CEY A;  2JTE A;  1VQN T;  3M5A A;  1K9M C;  1M4Z A;  3CCR Q;  3MJX A;  4J9G A;  4MML A;  4EMK B;  5GAN 7;  3OMC A;  5IHN A;  3CCR A;  1ZLM A;  1AD5 A;  2CZ7 B;  4J9C A;  4MDW A;  4AFU C;  5A0D A;  1U8R A;  1JBM A;  5J3B A;  2LT4 A;  4DBR A;  4QVC A;  3CCM Q;  4RTX A;  4KRT A;  1M1F A;  2DKG A;  2CP5 A;  1Y71 A;  3ZL7 C;  5LJ3 e;  2ENM A;  5LL6 S;  2KSS A;  1JRI A;  1SPK A;  1KQ1 A;  2ECZ A;  1VQ6 T;  4HT9 A;  3QWX X;  4LDW A;  2AHJ B;  4A4G A;  2EYZ A;  2COY A;  2GFA A;  4KH1 B;  4BI8 B;  2QQS A;  3LH0 A;  4RTT A;  1UHF A;  3UF4 A;  3CCV A;  1M27 C;  3VUZ A;  1VQL A;  4FYY B;  3F70 A;  1BI0 A;  1SHF A;  2RK2 A;  3UT1 A;  3OYI A;  2HQX A;  3TEE A;  3NTK A;  2RJC A;  3JCM V;  1TXQ A;  4HVU A;  3AT1 B;  1M3A A;  1SSF A;  4PJM A;  3BW1 A;  3HRU A;  1KFZ A;  1H8K A;  1QVF P;  4EMH A;  2HL5 C;  1ZHI A;  4DOW A;  1TOV A;  4AT1 B;  5CK9 A;  1N6A A;  1VQ4 Q;  3PE0 A;  2EAY A;  4RTY A;  3UA6 A;  1NEG A;  2AZV A;  3M0U A;  1GRI A;  1ZQ1 A;  3C0C A;  2FPD A;  2IG0 A;  3EGD B;  1TUG B;  4XTW A;  3G71 Q;  2JMC A;  1VQ6 A;  4C92 E;  4PFP A;  4JRI A;  4C0G A;  5I2S A;  3AHU A;  4F7U E;  1SG5 A;  2D0Q B;  1V76 A;  1KQS S;  3CCJ T;  2F2X A;  3TU4 K;  2E64 A;  4F7U A;  1N8R R;  4LUD A;  1ZUK A;  2L5Q A;  4JS5 A;  4MMK A;  1VQL T;  4M77 A;  1K73 R;  2JZ2 A;  2JNG A;  4XU3 A;  4CC7 A;  2JM8 A;  1YJN A;  4IKF A;  2XU8 A;  3CC2 T;  1WQ7 A;  2QGF B;  2FEI A;  2EGE A;  3RKX A;  4KT0 E;  2EIF A;  2KY9 A;  3Q1J A;  4RG2 A;  2LJ0 A;  5GJV B;  1VYU A;  3JB9 H;  2AIR B;  4M7D C;  3LH5 A;  4JPB W;  1SRL A;  4M78 C;  3SWN C;  1KG1 A;  1N9S A;  5D7U A;  2F5T X;  4OMF B;  1AHJ B;  2F5K A;  1Q7Y U;  1GXI E;  2AKL A;  2LQW A;  3JCM g;  2EYY A;  1M90 U;  5KYW B;  3G4S T;  2P0K A;  2HSE B;  4ATO A;  1G2B A;  3OB9 A;  1QKX A;  1RAB B;  2HKQ B;  3VYH B;  2FRY A;  2Y90 A;  4AFQ C;  2DZC A;  3OYG A;  4OGE A;  1YJN Q;  1PG5 B;  3CC2 A;  3QZ9 B;  2H3E B;  4FYW B;  3OYY A;  4XTV A;  3CME Q;  2LZ6 B;  4M7D E;  2VUB A;  2MYS A;  4Y91 A;  3HTR A;  5CKH A;  1WHJ A;  4LDU A;  4XTU A;  4Q5W A;  5GAN g;  2F1L A;  3C95 A;  2P4R A;  1MHN A;  3RBB B;  4CC2 A;  4DBQ A;  5KCH A;  2DIQ A;  1GFD A;  4BE1 A;  1U3O A;  2C0I A;  3TSW A;  2K7A A;  5I22 A;  2EYW A;  1M8M A;  2EKH A;  3SD4 A;  2DAQ A;  3V7C A;  1K9M R;  1BCM A;  1T0J A;  1J3T A;  4LDV A;  4TVR A;  3MCA B;  1WA7 A;  2LCS A;  1Z9Q A;  4C5E A;  2EJG A;  4JRQ A;  1FMK A;  1IB8 A;  3CCM T;  3KXT A;  3MHX A;  1JXO A;  3VKI A;  2J6F A;  3EGX A;  1H3H A;  1MND A;  2OTL A;  1V1C A;  2RI3 A;  1AZG B;  4P5N A;  2BE9 B;  1IGU A;  1X75 C;  3I5S A;  3QDR B;  2QAS A;  2K2M A;  3EH1 A;  2HAX A;  3ASK A;  5GAO m;  2P0Q A;  4E7K A;  1PSF A;  1JJ2 P;  1MNE A;  1OU8 A;  4PK4 A;  5CKE A;  2PUK B;  4Z88 A;  2CRE A;  5GAN 5;  5LJ5 g;  1NLO C;  1ZUY A;  4C5G A;  5IH2 A;  3G7Z A;  1RAF B;  3O5Z A;  4BDY A;  1MV0 B;  2KRN A;  3OYA A;  2HNI A;  2QTX A;  4JDS A;  4OGC A;  1BB9 A;  3UPU A;  1WHK A;  2M0O A;  1D0Y A;  1FMW A;  2X3X D;  3CC4 Q;  3RUX A;  2WSE E;  4FYX B;  2G6F X;  3OBY A;  3CXC P;  2K9G A;  2DF6 A;  1D3B A;  1WJS A;  1QVF A;  2KRS A;  5I21 A;  3CMA A;  4M7A A;  2YXY A;  1VQ8 T;  2HDA A;  3OYM A;  5LJ5 e;  1WHM A;  3M59 A;  4WTO B;  5LJ3 h;  1KJW A;  1RI9 A;  4A4E A;  1QVG S;  2DBK A;  2DO3 A;  4XAX B;  2L89 A;  3D7S B;  3C94 A;  1VQ4 A;  1WX6 A;  1HSQ A;  2DTI A;  2J6K A;  5LJ3 j;  5CKB A;  1QW1 A;  1YIT T;  2HD0 A;  2CP3 A;  1IO6 A;  1VQK Q;  3CQT A;  4PJO G;  1QVG A;  3OQ5 A;  3THK A;  2RNA A;  5M9O A;  2DD5 A;  2KAF A;  4E7I A;  5FRN A;  4A4F A;  2D6F A;  3EFO A;  1ZX6 A;  4FT4 A;  5GJW B;  3PGG A;  2K3Y A;  4M7A G;  2RB6 A;  2QA4 Q;  5AYF A;  1D09 B;  4JRK A;  5KYX B;  1C1A A;  1C0M A;  3IQL A;  1YFN A;  2K4Y A;  2YUQ A;  4C0D C;  4PJO C;  1TU0 B;  2JW4 A;  3OS2 A;  4IUR A;  3EH2 A;  2E70 A;  1B3Q A;  3CBO A;  1Q86 U;  2DYB A;  3PT9 A;  2ESW A;  4Z89 A;  2NUT B;  2G3R A;  2LNH B;  2ZPF B;  1S1N A;  5IN1 A;  3WVE B;  2HBP A;  2MK5 A;  2PVG B;  2JS2 A;  5C0M A;  3FJ5 A;  1YJ9 Q;  5GAN h;  2DA9 A;  3JCM J;  3MEW A;  5GAN f;  1HJD A;  2DXC A;  4PFO A;  1GL5 A;  4ESR A;  4IUP A;  3M0Q A;  1ZBJ A;  3CMA T;  1QCN A;  3OSV A;  3G71 T;  1TTH B;  2KRM A;  4DA4 A;  5HK0 A; 
#chains in the Genus database with same CATH homology
 4NS5 A;  4Y28 E;  1LOJ A;  2DD4 A;  2RM4 A;  3HFO A;  4R56 A;  4C8Q F;  4HCZ A;  4BD3 A;  5I2M A;  4E7J A;  2DXU A;  1IZ6 A;  2LVM A;  3X25 B;  4RCC A;  3CCE T;  5GAN g;  1RL2 A;  2DIG A;  2LT1 A;  1VUB A;  2XD0 A;  4BE2 A;  1YJ9 T;  2K5F A;  2LX9 A;  1Q81 C;  2XK0 A;  4D6W A;  3SWN B;  1WGS A;  3QUI A;  3MEV A;  5DY9 A;  3N5B B;  4HCC A;  2GFU A;  1VQ8 A;  3QG1 A;  3J81 E;  3JCM e;  1D3B B;  2V8J A;  4C8Q E;  3OYK A;  1EIF A;  2C06 A;  4X9D A;  3LGL A;  3PMT A;  4OB1 B;  3KBG A;  5FU7 C;  4C0Z A;  4ZTF A;  3BDU A;  3CCR T;  2K2V A;  2JTF A;  1W2B A;  4KUD K;  1G3S A;  5GMK l;  3CC4 A;  3CCQ A;  3V8L A;  1B34 A;  2V8I A;  1OZ3 A;  3URG A;  3WXM B;  1NJI C;  3FRN A;  3JCM c;  1Y96 A;  2LTO A;  3JB9 I;  3OYH A;  3CCU T;  3CEY A;  4L5G A;  1K9M U;  1VQN T;  2CGH A;  3M5A A;  3OSS C;  1K9M C;  3QZ5 B;  1M4Z A;  5GMK m;  4M78 E;  4B9W A;  1IRE B;  3LWH A;  4EMK B;  2JVV A;  4MML A;  2L8D A;  3V7R A;  5GAN 7;  3JB9 G;  3BFM A;  3LWI A;  3V8J A;  3OMC A;  3CCR A;  1K8A C;  4BI4 A;  2CZ7 B;  4MDW A;  1U8R A;  2RJE A;  5A0D A;  1JBM A;  1U1T A;  2LT4 A;  2ZPB B;  5J3B A;  4QVC A;  1YJW A;  5D6X A;  4Z02 A;  1Q7Y C;  1M1F A;  2DKG A;  1WPY A;  2KVQ G;  2OTJ A;  1Y71 A;  5GMK i;  3LGF A;  2JTM A;  2LC4 A;  3M58 A;  5LJ3 e;  4IUQ A;  5GAN 4;  4BAC A;  4HKE A;  3QPH A;  4OB2 B;  4C5H A;  5LJ3 g;  2QQB A;  5GAN j;  4BI3 A;  2ZPE B;  2EFI A;  2KSS A;  4M78 D;  1JRI A;  2R5A A;  4QW2 A;  5LL6 S;  1KQ1 A;  2E6N A;  2LNV A;  4J6X A;  3G71 A;  1K73 U;  1VQ6 T;  2XG8 D;  3OW2 S;  5KCO A;  3JB9 J;  3S3O A;  4HT9 A;  3BDL A;  4LDW A;  2EQJ A;  4QVZ A;  3GNF B;  2AHJ B;  3MP1 A;  4A4G A;  3DLM A;  2Y4X A;  1NJI U;  2GFA A;  4M7A D;  4BI8 B;  2QQS A;  3DB3 A;  3P8D A;  3VJP A;  5GAM g;  2LDM A;  4ZGE B;  2RI2 A;  1NPP A;  1VQM A;  5GMK h;  3LH0 A;  3CCE A;  3QXE B;  5GAN d;  4IUU A;  4VUB A;  3CCV A;  2RHI A;  3VUZ A;  5DM7 R;  3INZ A;  2QA4 A;  1VQL A;  2O4X A;  4N0A A;  3F70 A;  2NLU A;  1BI0 A;  2RI5 A;  3CXC A;  3JB9 F;  3OYB A;  1H64 1;  2CZ0 B;  2RK2 A;  4M77 F;  1Q86 C;  3UT1 A;  1YIJ A;  3OYI A;  2QXF A;  5J39 A;  2A3L A;  3CCS T;  2HQX A;  3TEE A;  5FU7 B;  5GMK j;  3NTK A;  2RJC A;  3JCM V;  3M54 A;  4JUV A;  5A0L A;  4IUV A;  1YJW T;  2CZ6 B;  4A4K A;  3R6O A;  4C8Q D;  3CC7 T;  1SSF A;  1WNL A;  3CME A;  4OF1 A;  4C92 A;  3RER A;  4MDX A;  3A8L B;  1DJ7 B;  3BW1 A;  3HRU A;  2QQA A;  2X35 A;  4QQD A;  2WAC A;  3GNG A;  4ZTJ A;  4EMH A;  2XI9 A;  1ZHI A;  4DOW A;  2ZPG B;  5CCA A;  3PIO A;  3QBY A;  1YBY A;  1VQP T;  5CK9 A;  1N6A A;  3A8M B;  3HP9 A;  4KUI A;  3PIP A;  4BE0 A;  1W2B S;  4M77 D;  2M9U A;  5L8R E;  3I56 A;  3CCM A;  2EAY A;  4J83 A;  4MZP A;  3FLG A;  1U1S A;  1V29 B;  4ZGD B;  3FC3 A;  2YLB A;  3CC4 T;  2DVE A;  1PSE A;  1WJR A;  1ZQ1 A;  2FB7 A;  2JUF A;  5CQY A;  5A2Q E;  2IG0 A;  1BYM A;  2I2L A;  2VGN A;  4N4I A;  4XTW A;  3X28 B;  4C8Q G;  1KC8 U;  1BI3 A;  1NPR A;  1X6O A;  5FU6 C;  1VQ6 A;  4KBM B;  2XDP A;  1I81 A;  4OVA A;  4M7D D;  5LJ3 f;  4C92 E;  4JRI A;  1QVF S;  4C0G A;  5I2S A;  1VQ9 A;  2QQ9 A;  4F7U E;  1JJ2 A;  3AHU A;  2F69 A;  4M75 B;  3CCJ A;  3JCM h;  3QJ6 A;  2PU9 B;  2D0Q B;  1BKB A;  4X34 A;  5LJ5 d;  3G6E A;  1KQS S;  4OB0 B;  1G3W A;  3CCJ T;  2WSC E;  3M4G A;  2VV5 A;  3EFS A;  3TU4 K;  2E64 A;  3NFC A;  4X9C A;  2K3X A;  4F7U A;  4J7I A;  3OW2 A;  3I55 T;  1XNI A;  3SDZ A;  1VQO T;  1YI2 A;  3A8G B;  2L5Q A;  4JS5 A;  4MMK A;  2YRV A;  1VQL T;  2X4Y A;  4M77 A;  5GAN 3;  4PJO E;  3MP6 A;  2JZ2 A;  1M90 C;  4LD9 K;  2CKK A;  2JNG A;  4C92 B;  4XU3 A;  3CBM A;  3VU3 C;  3TCJ A;  4BUG A;  1BI2 A;  1VQK A;  1YHQ T;  1YJN A;  4IKF A;  4M7D F;  2EKO A;  1JJ2 S;  2XU8 A;  2M16 A;  2RHU A;  4J5Y A;  1TH7 A;  1WQ7 A;  1Y7X A;  3I56 T;  4F7U F;  3CC2 T;  3JCM W;  3RKX A;  2X4W A;  1YJ9 A;  4KT0 E;  2EIF A;  2KY9 A;  3Q1J A;  4RG2 A;  1KC8 C;  4J8O A;  4C92 F;  2GQV A;  2ZPH B;  3C4S A;  3SB2 A;  3CPW A;  3JB9 H;  3OYF A;  2RH2 A;  2OTL T;  3J80 E;  3QSU A;  4M7D C;  2MMP A;  4M78 C;  1MGQ A;  3SWN C;  3RKY A;  1KG1 A;  3GOX A;  2Y4Y A;  2ZCF B;  3JCM Q;  3WVD B;  1N9S A;  2K57 A;  5HY6 A;  5FRO A;  3L2Q A;  1K8A U;  2F5T X;  4OMF B;  1AHJ B;  2BIV A;  5LJ5 f;  2F5K A;  4C0F A;  3L42 A;  5LJ5 h;  1Q7Y U;  1GXI E;  4CI0 C;  3T9N A;  5GAN 6;  1VQ4 T;  4M75 A;  4M78 F;  1Q81 U;  2O4X B;  3S6W A;  3JCM g;  1VQ7 T;  2RK1 A;  1M90 U;  3GIB A;  3G4S T;  2P0K A;  3CPW S;  4ATO A;  3OB9 A;  3VYH B;  3QII A;  4PNO A;  4EMK C;  3UDC A;  1LJO A;  3A8H B;  4F7U B;  4M7A F;  2DXB A;  1S72 A;  2Y90 A;  1B34 B;  2CS7 A;  5GAM h;  2DZC A;  3OYG A;  4OGE A;  4M7D A;  3JCM f;  3G6E T;  2DTH A;  2XID A;  3CC2 A;  1M1G A;  3QZ9 B;  4C92 C;  2O01 E;  2PUO B;  4EPC A;  3OYY A;  2K5I A;  4XTV A;  2EQM A;  1M8V A;  2KK4 A;  1I4K 1;  3TRE A;  5C6S A;  1RI0 A;  1G3Y A;  4OP0 A;  4M7D E;  2VUB A;  5CKH A;  4Y91 A;  3JSC A;  3GLX A;  4LDU A;  4XTU A;  2V8K A;  2P0P A;  4Q5W A;  2QDY B;  5CQX A;  3C95 A;  4M75 E;  3SWN A;  2MAM A;  2HQE A;  4M77 B;  5D6W A;  3I55 A;  1VQO A;  4PJO F;  4JRP A;  3BY7 A;  3MET A;  3QYG B;  1MHN A;  4JLI A;  3S3M A;  5KCH A;  3OS0 A;  2VGM A;  2DIQ A;  2H3J A;  3RES A;  1P92 A;  3A8O B;  4R55 A;  5CVI A;  2A7Y A;  5DLQ E;  4BE1 A;  5CO7 A;  1BI1 A;  2CZ1 B;  3RIR A;  3L2V A;  4DQ2 A;  1LNX A;  3PFS A;  3V7S A;  5J26 A;  2RJF A;  1UEB A;  3V8K A;  4ELY C;  1KD1 C;  3CCU A;  3UWN A;  4BY6 B;  3NTH A;  4M7D B;  1OZ2 A;  3EFR A;  4M7A C;  5GAN 2;  3RMS A;  2LRQ A;  2E1H A;  3MO8 A;  4N4H A;  3SD4 A;  2DAQ A;  3V7C A;  1JB0 E;  4M75 D;  1X01 A;  5GAO p;  4LDV A;  5KE3 A;  5HKC A;  2RO0 A;  4C0D B;  1YIT A;  3L2U A;  1HK9 A;  2E10 A;  3MCA B;  4TVR A;  2XKO C;  2MWO A;  4FSX A;  2EWN A;  3JCM d;  1XOV A;  4C5E A;  2EJG A;  1XTD A;  4JRQ A;  1YIJ T;  1VQK T;  2R58 A;  3CCM T;  3KXT A;  1UGS B;  1G5V A;  3MHX A;  4PLL A;  3VKI A;  4QQG A;  4M75 F;  3FIF A;  2QEX A;  4C92 D;  3HL8 A;  3CPF A;  4XU1 A;  3C12 A;  4LD6 A;  2QQR A;  4PL6 A;  4ME7 A;  3OYC A;  3E9G A;  2RI3 A;  4O6J A;  2DTO A;  2GF7 A;  2PVO B;  1M9S A;  3ME9 A;  4C8Q C;  5CR2 A;  4QQ6 A;  5CKF A;  4P5N A;  2LQK A;  4CRI A;  4DOV A;  5GAM d;  1UGP B;  2FVU A;  2XIC A;  3MEU A;  2L3R A;  3OS5 A;  4XU2 A;  3OY9 A;  4L6V 5;  1WQW A;  2VXE A;  1VQ9 T;  3CCS A;  3RKW A;  1YJN T;  3H6Z A;  2R57 A;  1N27 A;  1G3T A;  4M7A E;  1X75 C;  1KQ2 A;  4RKU E;  3QDR B;  2D9T A;  3CCL T;  3A5Z B;  2JN0 A;  3HFN A;  2HAX A;  4HT8 A;  5HK0 A;  3ASK A;  3FJP A;  5GAO m;  2OTJ T;  2P0Q A;  1QP3 A;  1I5L A;  1W4S A;  2DK3 A;  1PSF A;  1QVP A;  4MZM A;  4E7K A;  1N8R C;  5GAO r;  3OYL A;  2RHX A;  2XHC A;  2YHT A;  1N8R U;  1VQN A;  4XK8 E;  3FB9 A;  5FU6 B;  5CKE A;  3OYN A;  4A54 A;  3EAE A;  2PUK B;  1YHQ A;  3DB4 A;  3NTI A;  2BKD N;  4M75 C;  5CIU A;  3VUB A;  3ZBD A;  5GAN 5;  2OTL A;  2DZ9 A;  5LJ5 g;  3QKJ A;  4FU6 A;  3OYJ A;  3QYH B;  4C5G A;  4O5V A;  5KE2 A;  2OAU A;  3G7Z A;  3M53 A;  4C8Q A;  4BDY A;  2R5M A;  3CME T;  3L2W A;  2ZGW A;  3OYA A;  1YI2 T;  2B8A A;  1VIE A;  3OYD A;  4GLK A;  2HNI A;  2QTX A;  4JDS A;  4OGC A;  1H3Z A;  5GAM e;  4C5I A;  4E7H A;  4FIB A;  3UPU A;  1VQ5 T;  1WJQ A;  4MZT A;  3FDR A;  2M0O A;  2DXT A;  3VYG A;  2DPP B;  2RHZ A;  3RUX A;  2EJF A;  4KUL A;  4NL2 A;  4L59 A;  4A4H A;  4PJO B;  3MEA A;  2WSE E;  3JCM b;  5GMK e;  2PVD B;  3OBY A;  4FT2 A;  1OYX A;  2MWP A;  4M78 G;  3KUF A;  4IUT A;  2RHY A;  3ER0 A;  1D3B A;  1WJS A;  5GAO n;  3S3N A;  4M75 G;  1O9S A;  1OI1 A;  5GAN e;  4LDX A;  1QVF A;  3G4S A;  2FL7 A;  3LX7 A;  2FHD A;  5I21 A;  4XQ3 A;  5EG2 A;  3H8Z A;  1FXX A;  1KHC A;  5GAM j;  3CMA A;  4M7A A;  2LCL A;  2VYT A;  3P8H A;  2VXF A;  2MF2 A;  3OYM A;  4E7L A;  1Q82 U;  1VQ8 T;  4NL3 A;  5LJ5 e;  3M59 A;  1Q82 C;  2E12 A;  2WSF E;  2XDD A;  1K73 C;  1Y96 B;  5LJ3 h;  4A4E A;  1QVG S;  4XTZ A;  2DO3 A;  3HSB A;  4XAX B;  5FLX E;  4ZGJ B;  3M56 A;  1KQS A;  2RD1 A;  4C92 G;  2L89 A;  2E5Q A;  3ZEH A;  4JJN K;  4E47 A;  4YTL A;  3CXC S;  2KQW A;  1HXD A;  2KMT A;  3C94 A;  3OMG A;  5CKD A;  1VQ4 A;  4J6W A;  3HRT A;  2ZZD A;  1QP2 A;  2DTI A;  1I8F A;  3E19 A;  3CD6 A;  5LJ3 j;  3CBP A;  4N4G A;  5CKB A;  1QW1 A;  1YIT T;  1XQH A;  4XU0 A;  2HD0 A;  1YCY A;  4UC4 A;  1N9R A;  3OBW A;  5GAN 8;  1O75 A;  4B9X A;  4PJO G;  4BB7 A;  1QVG A;  3OQ5 A;  1UB4 A;  3JCM P;  5FRM A;  3DLL A;  3DKM A;  2K5L A;  5M9O A;  4RMO A;  2DEQ A;  2QEX T;  3O8V A;  2DD5 A;  2KAF A;  2EJ9 A;  3LLR A;  4E7I A;  5IAY A;  4BDZ A;  2EYQ A;  4LDY A;  5FRN A;  4A4F A;  2D6F A;  3CCV T;  2QA4 T;  2RA2 A;  5DLO A;  4FT4 A;  3X20 B;  2E41 A;  1VQM T;  3PGG A;  1NZ9 A;  4II1 A;  1M5Q 1;  4F7U G;  2LCC A;  3PNW C;  3OYE A;  5HK3 A;  2K3Y A;  1BIB A;  4ZN3 A;  4M7A G;  2RB6 A;  1BIA A;  2X4X A;  5CAI A;  5AYF A;  4M77 E;  3X26 B;  2LQ8 A;  4HA8 A;  4JRK A;  1FX7 A;  5LJ5 j;  4XTX A;  4ELZ C;  2E6Z A;  2MI6 A;  2PQW A;  2K4Y A;  2QI2 A;  4C0D C;  4ZN1 A;  5IT9 E;  2CYZ B;  2YLC A;  4PJO C;  4A53 A;  2BUD A;  3OS2 A;  2ZPI B;  4IUR A;  4RCB A;  1R8O B;  2E70 A;  2VC8 A;  3M4Y A;  5GAO q;  1ZBX A;  3LYI A;  4NOY A;  3JAM E;  4J6Y A;  3JB9 D;  3M9Q A;  1M1K C;  3SFM A;  3OA6 A;  1VIF A;  3CBO A;  1S72 T;  5A0G A;  2XDB A;  4V2S A;  3X24 B;  1M1K U;  3OS1 A;  1Q86 U;  1VQP A;  3P8B B;  3GPL A;  3CCQ T;  3CCL A;  1Y07 A;  3PT9 A;  2E65 A;  2FYK A;  2JOY A;  4GY5 A;  3VV0 A;  4BY6 C;  4M78 B;  5GAM f;  5KH6 A;  1KD1 U;  2IVW A;  4M78 A;  4JS4 A;  2G3R A;  2RJD A;  3E9F A;  4PLI A;  5GAO l;  4N0A C;  1VQ7 A;  2ZPF B;  5D6Y A;  4XTY A;  2P4T A;  4M77 C;  3E1S A;  3GF5 A;  4FM4 B;  4EDU A;  3L1A A;  4RG8 A;  5LJ3 d;  3J7A F;  4PJO D;  4PKC C;  5IN1 A;  3WVE B;  3CD6 T;  2HBP A;  2KDS A;  4M7A B;  1VQ5 A;  3FEO A;  2PVG B;  3M55 A;  3HKS A;  3M57 A;  5C0M A;  4M7D G;  3HPW A;  5GAN h;  3JCM J;  3MEW A;  5GAN f;  1UGQ B;  4WF2 A;  3GP8 A;  2DXC A;  4QVD A;  3MP8 A;  3QJY A;  3JCM X;  3HRS A;  3LW5 E;  4J7F A;  3ZFJ A;  4FL6 A;  3PMI A;  2DJZ A;  2X4J A;  2GCX A;  3HHT B;  4PJO A;  4IUP A;  2EQU A;  3QHS A;  3CC7 A;  1NE8 A;  1UGR B;  4HCB A;  3QO3 A;  4EMK A;  2M1H A;  3PTA A;  3L2R A;  3CMA T;  4JLG A;  4OB3 B;  2EQK A;  3OSV A;  1FWZ A;  3L2Z A;  3G71 T;  4DA4 A;  4EMG A;  4C8Q B;  3RMQ A;  4M77 G;  1KHI A;  3JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...