4M78C

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
b'TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78C00
3V7CA 1M5Q1 5GAN4 5LJ5j 4JRIA 3SWNA 5GAOp 2VXFA 5GAMe 4F7UF 4PJOE 3HFOA 1I4K1 2E64A 5LJ3f 4C92C 3GIBA 3JB9G 1M8VA 4C8QC 4HA8A 3RESA 3HSBA 2CGHA 4M78F 4RCCA 1LOJA 1WQWA 4C92G 4C92E 4C8QG 4C8QE 4M7AB 5GMKj 2FYKA 1B34B 2FB7A 5GAMg 1LNXA 4NOYA 4M75C 3V8LA 5GAN5 4JLIA 4XU2A 5I21A 4X9DA 1TH7A 4PJOA 4XU1A 4M7DF 4M7AF 1WNLA 4J5YA 3EFRA 4M75G 4M75E 3SB2A 3L1AA 4N0AC 4M7DA 5GANh 5GAMj 1Y96A 2I2LA 2RA2A 1U1SA 2DXTA 3PGGA 4WF2A 4XTWA 4EMKA 5LJ5d 3JB9J 5GAOn 3SWNB 4MMKA 4J6WA 1KQ1A 4EMGA 4M77D 5LJ5f 3BY7A 5DY9A 1X01A 4F7UB 3JCMW 4F7UG 3QUIA 5LJ3d 2RD1A 5GMKi 4XTZA 4EMHA 2ZGWA 3JCMf 3JCMQ 5GAOm 1LJOA 1YCYA 2EWNA 4JUVA 4M78B 4M7AE 4PJOB 5GAOl 3RKXA 3JCMJ 4M78G 2DXUA 4RCBA 5GANe 4M7AC 2DZ9A 4A53A 4PJOF 2EAYA 3JB9D 4M7AG 4M7DB 1I8FA 1WQ7A 1Y96B 2Y90A 2DTOA 4J6YA 4EMKB 3JCMb 3RIRA 5GAOq 2EJ9A 4C92D 4XTXA 5GAMf 5GANg 3RUXA 4C8QD 1WPYA 4M77F 2QTXA 2E1HA 3EFSA 3FJPA 5LJ5h 4M77A 3SWNC 4HT8A 2DTHA 1KQ2A 3AHUA 4MMLA 2DJZA 4XTYA 5CAIA 3BFMA 5GANj 5GAN7 1I81A 1HXDA 2HNIA 3QO3A 2K57A 3JCMV 3JB9I 5GAOr 3JB9H 5LJ3h 3JCMd 2VC8A 4QVCA 3JCMX 3V8JA 4F7UE 4XU3A 4M78C 4PJOC 3JB9F 3VU3C 2DZCA 4XQ3A 3JCMc 4M78E 4PJOG 4Y91A 1BIAA 4C92F 3RKWA 3BW1A 3M4GA 4C8QF 5LJ5e 4NL3A 3RERA 4M7DC 4C92A 3V7SA 4EMKC 3INZA 2DVEA 5GAN2 5GAMd 1JBMA 1H641 4J6XA 4C8QA 4M77B 2JN0A 4M7DG 4M7DE 3V8KA 3JCMe 5LJ5g 3BDUA 5GAN6 5LJ3e 3QHSA 4M75A 5GMKe 5GANf 2VXEA 3FIFA 4XTUA 2YLCA 1D3BA 2RB6A 4M75D 2E65A 4N0AA 5LJ3g 1N9SA 3L2ZA 4NL2A 3JCMP 3JCMh 3QSUA 4A54A 2RM4A 1I5LA 1HK9A 1MGQA 2E41A 4QVDA 2DTIA 4F7UA 4PNOA 4X9CA 5GMKh 4C92B 5GAN8 4C8QB 5LJ3j 3HFNA 1BIBA 4M78A 1N9RA 4XTVA 5GAMh 4M77C 2DEQA 4DQ2A 4M75B 1U1TA 4M78D 4PJOD 4V2SA 2DKGA 2EJGA 2YHTA 4M7AA 1D3BB 1B34A 4M77G 4M77E 5GAN3 4M75F 2YLBA 5GANd 1JRIA 3V7RA 4HT9A 4JRKA 4OP0A 3RKYA 2E10A 5GMKm 4M7DD 4M7AD 3FB9A 5GMKl 4XU0A 3JCMg 2EJFA
chains in the Genus database with same CATH superfamily
5GAN4 1G83A 4J9CA 3JB9G 2AKLA 2COYA 1D0YA 3R6OA 5KYYA 2X3WD 1K9MU 4X9DA 3I5RA 1AT1B 3G4SA 4AFUC 2CT4A 3SDZA 4O5VA 5GANh 3E9GA 2E3IA 5LJ5d 1VQMA 3SWNB 3OW2S 1OEBA 4J9HA 3TSZA 3OYJA 1K1ZA 2K7AA 2RPNA 1KQSS 2LNHB 3ZEHA 5EC7A 2DIQA 4ZGEB 2QYZA 4BUGA 5GANe 2W10A 3MHXA 4Z88A 1OX8A 3JRZA 4WCIA 2DTOA 3OYAA 4TVRA 2LX7A 3MEAA 2FG0A 3CMAQ 3G71T 1GCQA 2B86A 3PMIA 4WTOB 5KYXB 2CSIA 4Y28E 3E2UA 3JB9I 3CCET 4CI0C 4XU3A 1D1BA 2QEXA 1RAIB 4OF1A 2G3RA 1ABOA 3MKDA 3L2WA 3CMEA 4C5HA 3BDUA 3CC2A 1QWFA 2I0NA 4HVVA 2JTMA 1WXTA 1ZA1B 2ESWA 2QQAA 1N9SA 3OYDA 1N5ZA 1PSEA 2YSQA 2XIDA 2DTIA 2IVWA 2YRDA 4BDYA 2K2VA 3CPWA 3QDRB 1I1JA 1H8KA 2HQXA 3QBYA 1A0NB 2NLUA 1UG1A 2R57A 1SEMA 2CZ0B 1O9SA 4V2SA 4Y92A 1D3BB 1B34A 3P8HA 1M90R 1OPLA 2XG8D 4GY5A 3G4SQ 2FRYA 1CKAA 4Z02A 2OTLT 4N4GA 1WGSA 1VQMQ 2JJ9A 1KC8C 1VQ6T 4KULA 3QYGB 2HD0A 1M90U 1YJWT 5FU7B 1JQQA 5FW9A 3EFRA 3OYMA 2QK0A 3L1AA 1UFFA 2XKOC 1RUWA 1X01A 3G6ET 2KEAA 1VQ4Q 2WSEE 4R0KA 4OB2B 1Q81U 5FU6C 2ZPIB 4J9IA 1Z9ZA 4M7DB 3CQTA 3CCLT 5CO7A 1YIJQ 2QEXQ 2WACA 2K3YA 4MMLA 1O75A 3CMEQ 1M1KC 1D0XA 2DL7A 3WXMB 1RAFB 3JB9H 1UGVA 4C5IA 2L3RA 1XOVA 3CC2Q 1ZA2B 4C0DC 4M78C 2PVDB 3MEVA 2CZ6B 4FT2A 5IHIA 4M78E 2DXBA 1AWXA 3EG1A 1KD1R 2DVEA 4J8OA 1IHWA 2JN0A 1G2BA 4M7DG 1WA7A 5LJ5g 1QVFS 3L2RA 1PRMC 4PL6A 3D7SB 4J9FA 2BIVA 2DL4A 4N0AA 1JJ2P 3L2ZA 2K3XA 8AT1B 1KD1U 1QMCA 3CCEA 4PNOA 3KBGA 1Q95G 1WHKA 2C0OA 2M0OA 1KG1A 2GCXA 3S6WA 3CCQT 2HAXA 3PVQA 3OMGA 1WDXA 1OQKA 3V7RA 4ZTJA 5GMKm 1ZUYA 4OMOA 1VUBA 1GBRA 2V8IA 2V8JA 3CCUA 1K4US 4JRIA 4JZ4A 4FCYA 1QKXA 4ZNXA 4CC3A 1MMGA 4MDWA 1ZHIA 1LOJA 1K73R 2L3QA 3DKMA 3QKJA 1JEGA 1BI3A 1R0CB 1RACB 2RNAA 2YXYA 3HRTA 3UA6A 1M2VB 2RHXA 5D6WA 1PC0A 3DLLA 1K73U 1UECA 2CH4A 2KYBA 4XTZA 2ZGWA 2YWWA 2OTLA 1Q7YR 2ZPGB 4A53A 1VQ6A 1Y96B 2X4WA 1YJWA 1OX9A 2O01E 4KH0B 1TXQA 4LDYA 1TUDA 1Q86R 2BE7D 4II1A 2ZCFB 1KHCA 2VKNA 5GAN7 1SRLA 2MAMA 3V8JA 3G6EA 3LLRA 4PJOC 2HEQA 1SRMA 2R5AA 3G71Q 3C12A 4PJOE 3M0RA 3OYYA 1WHGA 1I07A 3H0HA 3CCEQ 1VYUA 3JCMe 3CCLA 1ZBXA 1W2BP 2COWA 3FRNA 1YP5A 4KRTA 2DERA 1R77A 2KRMA 1QCFA 4L5GA 1WFWA 4FU6A 3OS5A 2BZXA 2KT8A 1EIFA 3OA6A 4M77C 1OOTA 2KGTA 4M77E 3TU4K 5HY6A 1EFNA 2FEIA 2RHYA 1N8RR 2RHZA 3CC4T 2FO0A 3QYHB 1KFZA 2V1QA 4RTYA 3ZL7C 1VOMA 2CP0A 2HBPA 5FU6B 4M75C 1N8RU 4J5YA 2F69A 3CXCA 4M75E 2O9SA 2OTLQ 3CCQA 3PGGA 4EMKA 2ATCB 2WSFE 1VQ6Q 2QAZA 2D8JA 1YJWQ 2YRVA 4IUTA 5KCOA 2CP6A 2LNVA 2M02A 1BK2A 2E12A 1E7OA 4C0DB 3FJ5A 3OS0A 4M78B 2NUTB 1XTDA 1AOJA 5L8RE 1YWOA 2C0TA 2KVQG 3G6EQ 3EH2A 3RIRA 2CP3A 4C92D 4FM4B 4C8QD 3QG1A 3P8DA 4LE9A 2QDYB 2KAFA 1FXXA 5CAIA 1TG0A 4M4ZA 1X6OA 3CCLQ 3IQLA 3EGDB 4IURA 3JCMX 4ORZA 4MDXA 3VU3C 2LT4A 4LDUA 1QVPA 2V26A 3OYIA 2X4XA 5GMKe 5GANf 3F70A 5IXBA 1VQ9T 1IHVA 4M75D 4LDXA 3CCRA 3QSUA 4E47A 2ROTA 5KE2A 5J3BA 1YI2A 5C6SA 1Y57A 5LJ3j 1VQOT 5A0DA 1G3YA 2CP7A 3JAME 3H0IA 5GAMh 2JXBA 1GCQC 3RR6A 1U5SA 2FHDA 2XK0A 5GANd 4OMLA 1K8AC 1JXMA 4J9BA 2JM8A 3M54A 2DEUA 1IGUA 2FPEA 5GAMe 4QW2A 3CCQQ 2Y4XA 2Z0WA 4OGEA 4HA8A 2LX9A 3HSBA 1TWBA 3EGXB 5GMKj 1PHTA 2QQBA 4KGVB 1EZZB 2XI9A 4E7LA 2QQ9A 2DYIA 2E70A 3H9NA 1MNDA 4XTWA 3UA7A 1ZX6A 4F14A 1Q86C 1J3TA 3CC4A 2P4TA 1RADB 4FYXB 1YITA 4KH1B 1WHLA 4PJOB 1UDLA 4AFQC 4L6V5 4PJOF 1YJNT 5FWBA 2LCSA 1SHFA 1JJ2A 2FZGB 3UWNA 2A7YA 2LTOA 2DBMA 4J7IA 3J7AF 2LQWA 4E7JA 4HCZA 5GAOr 4FSSA 2CYZB 3RMSA 1C0MA 2XDBA 1KC8R 3CC7T 1M3BA 2ZAEA 3EG2A 5HK0A 4XQ3A 4C92F 4PJOG 3QZ5B 4BD3A 4NL3A 2X9HA 4C8QF 2DETA 2QTVA 4C92A 1N6AA 4C8QA 5GJVB 1BYMA 4M77B 4JJCA 2FRWA 2K2MA 2LJ1A 2RHIA 5KYUA 1KC8U 5IAYA 1NPRA 2RB6A 2QG9B 4IIMA 4JRPA 1HK9A 1MGQA 3OS2A 4F7UA 2RHUA 4GLKA 2F5TX 2XDPA 4IKFA 4M75B 2DBKA 4M77G 3T9NA 4M75F 2YLBA 1UJYA 1K0SA 1M1KR 4BACA 2JS2A 1MHNA 3MEUA 2AT1B 2C0IA 2EQJA 2LQNA 1YFNA 2D8HA 1VIFA 4AMCA 3VS3A 3MPUB 2X35A 2VGNA 3CC4Q 1QVGS 2JT4A 2FYKA 5GAOn 2FB7A 1VQOA 1NYGA 2PUKB 2H3JA 2VV5A 1D1CA 2EGEA 4M75G 1K76A 1NEBA 4N0AC 5KCHA 3NMZC 1X2KA 3UATA 1M27C 1RABB 3NHNA 1WI7A 5LJ5f 5DY9A 1BCMA 2KRNA 4QT7A 2KE9A 2IIMA 4MZMA 4EMHA 3MJXA 3TQ7P 3R6NA 2GNCA 2VUBA 3H41A 2X4JA 1W2BA 3JCMb 2K4YA 5CVIA 5GANg 2KRSA 3CBMA 2L89A 3AHUA 2EYQA 2O9VA 3QO3A 5IN1A 3C0CA 2JZ2A 2VC8A 4A4FA 1YWPA 1TOVA 3VRYA 1OULA 5DLQE 3M4GA 2E5QA 2JOYA 3INZA 5GAN2 5I2SA 5D6YA 3CBOA 2KR3A 1AWOA 1XNIA 2F2XA 2F2WA 1YJNA 3JV3A 2VXEA 3EFOA 1M3CA 1HYOA 4HKEA 4GLMA 2L0AA 3CXCP 1XQHA 2CZ7B 4DBHA 5I2MA 1VQ9Q 2KSSA 3CC7A 1QP2A 3MP6A 2DEQA 1TU0B 2G6FX 2K5LA 1IO6A 5KH6A 1Q82C 1QP3A 1VQ8A 3RKYA 2SRCA 2R58A 1VQOQ 2AZVA 3CCUT 3PIOA 1W4SA 3QIIA 2VXFA 2M16A 2EYZA 3LGLA 1D1AA 2CGHA 3M0QA 2D0NA 3S3OA 1B34B 3OBWA 1IREB 2EQUA 3OBYA 3OW2P 2HKNA 2E6NA 2K6DA 2RA2A 3NFCA 2DL3A 3LH0A 3J81E 5A2QE 2YT6A 4ELZC 1KQSP 4E7ZA 3S3MA 2DO3A 5CKBA 3GNGA 2HMAA 2J06A 4JUVA 3VUZA 4C0FA 4KBMB 1UGRB 3GF5A 4RCBA 1M3AA 4IIOA 3SHWA 1UB4A 1PCXA 4X1VA 1M1GA 5CKDA 2E1HA 2ROLA 2DTHA 1SSFA 2DJZA 3GOXA 1I81A 1DJ7B 1I5OB 4R56A 1YJNQ 1ZSGA 4BB7A 5FLXE 3PVLA 1IB8A 2MK5A 3QZ9B 4FSXA 2OX7A 2QQRA 3EG9A 3RKWA 3C4SA 4EMKC 4HVWA 1X6BA 1TTHB 3CD6T 2GFAA 3NTHA 2L5QA 1AD5A 2EKHA 3VV0A 3CC7Q 2YRCA 4OGCA 4ZN3A 2HBWA 2RJEA 1NLOC 4OMFB 4ELYC 2NUPA 3OS1A 3DB3A 1ZSZA 1M9SA 1W1FA 1NLPC 2KNBB 2RJCA 2DA9A 1PSFA 2EJGA 5GAN3 4FL6A 3VYHB 1IZ6A 1X6GA 5C0MA 3MCAB 1I0CA 1WIEA 5D6XA 2R5MA 1X75C 4D8DA 2QI2A 5IH2A 4RCCA 3EGUA 3UPUA 4IUPA 5IHKA 1FWZA 3OMCA 3BY7A 2ABLA 1MNEA 3JCMW 1YHQT 1RLPC 2DM1A 1JB0E 3M59A 4L59A 2Y90A 2BTTA 4E7HA 5GAMf 1WXBA 1K8AR 4FT4A 2CS7A 1ZQ1A 3M58A 5KYWA 1W70A 2AIRB 2K57A 2P4RA 1X2QA 5CK9A 1UGSB 1VYVA 3RMQA 2RQTA 2MOXA 2XICA 3ME9A 1WJQA 4DA4A 2O2OA 3FDRA 1TSFA 2DAQA 1BI2A 1QVFP 5GAMd 2EQMA 3QHSA 1GFCA 1PNJA 2P84A 2RQRA 2RK1A 3CCRT 1LPLA 4N4HA 3WVDB 1Q7YU 3JCMh 3FC3A 1MV3A 2A28A 1YI2T 3NPFA 2E41A 4E7SA 5DLOA 2CDTA 1BIBA 1BKBA 3LH5A 3E1SA 2RI2A 1N9RA 5FWCA 2QA4T 1Q86U 3L42A 2KQWA 4ZN1A 3CD6A 4HT9A 1OZ2A 4JRKA 4PJLA 1FMKA 1IGQA 3X24B 3MP1A 4ZGJB 4FW1A 2VGMA 1UTIA 4LDVA 4KUIA 1LCKA 2RF0A 3CCVT 3ZBDA 1BCOA 2E64A 4C92C 4C8QC 2MMPA 2EQIA 4QQ6A 3LW5E 4JPBW 4C92E 4C8QE 3GPLA 3CCUQ 3V8LA 2XMFA 2CREA 3DLMA 2L3SA 4BI8B 3L2VA 3CPWS 4D8KA 3J80E 1NE8A 3VS1A 1YITT 4B9XA 2LJ0A 1UE9A 3M57A 2X4YA 2DZ9A 3TVTA 3A1PA 1I8FA 4CRIA 1AZGB 2PVGB 4EMKB 3L2QA 1Q81C 1FMWA 1OYXA 4B9WA 3FJPA 1BI0A 1BU1A 3ER0A 4XTYA 1KK7A 1AZEA 2K5IA 3KXTA 2CP2A 5LJ3h 3ULRB 4QKUA 4RTXA 2YUPA 4QQDA 1YHQA 3JCMc 1K0XA 1BIAA 3LYIA 2QQSA 1NZ9A 2F5KA 2JM9A 3HP9A 1OZ3A 1Y71A 5LJ3e 3OY9A 1IXDA 8ATCB 1G8XA 3PMTA 4BE2A 2JNGA 3JCMP 3CD6Q 4A54A 2XHCA 5GMKh 4OB0B 2RI3A 3RDVA 2E3HA 3OW2A 4M78A 2NUTA 4EIKA 3Q1JA 4RG2A 3H0FA 1ZUUA 4M7AA 1KQSA 1G3TA 4ATOA 1HSQA 3AT1B 2O88A 2FPFA 3QPHA 2FPDA 4DEYA 1WXUA 3CCJT 3WVEB 2RN8A 5IXFA 4YTLA 1M2OA 2HL5C 1MMAA 3X28B 3EG3A 1WQWA 5GAMg 2PUOB 2P0PA 2K5FA 1S1NA 2QA4A 3OYBA 1FYNA 2MI6A 4WF2A 2DXTA 4XK8E 3JB9J 3X20B 2JW4A 4BI4A 2J6FA 4DOWA 1V29B 3S3NA 3I56T 4UC4A 2H3EB 1VQ5T 1LJOA 2VVKA 3CCVA 3G7ZA 3M0PA 2EQKA 2JMAA 4EPCA 2LT1A 1OI1A 3JB9D 1WQ7A 4E7IA 2A3LA 4ESRA 2EJ9A 3GBQA 1M4ZA 1Q82R 1YHQQ 1FMVA 3OYGA 3OQ5A 5J39A 1PWTA 2A36A 3C95A 2AK5A 2EVRA 2OTJA 2KROA 3PNWC 4AT1B 3EHRA 3M4YA 1Q82U 1QCNA 4LUEA 4PK4A 3VYGA 4RTZA 2QGFB 3V7SA 3PT9A 1KJWA 1T0JA 3I5SA 3A8GB 2D9TA 5CQXA 4CC2A 2XD0A 2L3PA 3EH1A 3EG0A 2GQVA 1PD1A 1H3HA 2FVUA 2X51A 3URGA 3U23A 2GQIA 4QVDA 4C92B 3VS0A 4C8QB 1QWEA 4LD6A 2M1HA 1VQLT 3CCRQ 1CSKA 2QDLA 1D09B 1PG5B 1V1CA 4C5GA 5KYUB 1YI2Q 1VQ8T 1QLYA 4OVAA 1TUCA 3HHTB 1JRIA 3MP8A 2D6FA 1B07A 4ANJA 2EKOA 2HL3A 3A8OB 1JO8A 2M9UA 3BE3A 2QA4Q 4X34A 3PIPA 1WHMA 2IPOB 4F7UF 5ECAA 1X43A 3GIBA 3M0UA 2P0KA 4C92G 4C8QG 2KBTA 3E9FA 3TEEA 1OU9A 3H6ZA 2EYXA 4JRQA 3CCVQ 2EGAA 2MWPA 2VB6A 4PJMA 2CT3A 3M55A 3M9QA 3ASKA 4JZ3A 1ZSZC 4AG1C 1GCPA 5CIUA 4P5NA 2CSQA 4F7UG 2OAWA 3CCJA 1QVFA 3LGFA 1BI1A 3META 5GAOl 5L23A 1UGPB 2LMJA 2KI7A 3PTAA 1M1KU 2J6KA 4PFZA 2L8DA 3HL8A 3HRUA 1YITQ 3MEWA 1UGQB 4F16A 1UHFA 4LXCA 2RQVA 3JCMV 4C5EA 3CXCS 3I56A 4QVCA 1M8MA 3M5AA 3GNFB 1NM7A 2RMOA 3JB9F 5KYYB 2DZCA 1VQ5A 2PTKA 4FYWB 2O4XA 1F1BB 4QQGA 2DIGA 4J6XA 4HCBA 2YUQA 1YN8A 2DYBA 3FIFA 1ABQA 2CUBA 2DILA 2E65A 2A37A 3M0TA 4DBQA 4R55A 3C94A 4E2FB 2HCKA 1ZUKA 1VQNT 1VYTA 2YUOA 2CZ1B 3QWYA 4OB3B 4BDZA 4DQ2A 1SHGA 4J7FA 3EHQA 2RH2A 5CR2A 1GFDA 1JXOA 1WX6A 2ENMA 3EFOB 2M51A 3CCST 2YUNA 1VIEA 2K9GA 3UT1A 4M7DD 3OYLA 1WHJA 2CP5A 1E6HA 1QCOA 4BE0A 3SWNA 3NTIA 3CBPA 1QVGP 3NTKA 1T3SA 4QVZA 2CUDA 5DM7R 3I9QA 4RG8A 1VQLA 1TH7A 4VUBA 3CCJQ 4LDWA 1WNLA 2QXFA 1P92A 1VQ4A 2EYYA 5IT9E 2DX1A 2LZ6B 1RL2A 1C1AA 2GGRA 2MCNA 3QDFA 2E4HA 2QGGA 5KYXA 5GMKi 1S72T 1YIJA 3JCMf 1RAGB 3HTRA 2GBQA 1G5VA 3QXEB 1LVKA 4J9GA 4A4EA 4ME7A 3O5ZA 2EAYA 3I56Q 2LC4A 1KSWA 3OB9A 2V1RA 5GAOq 1YJ9T 2COZA 2LVMA 1IRXA 1VQ5Q 3EFSA 4FYYB 1VQKT 2LQKA 4HT8A 2LCCA 2J05A 1PD0A 5GANj 3VUBA 2HNIA 4LNPA 2A08A 3JCMd 3BDLA 4DOVA 1NPPA 1X27A 2PNIA 2DRMA 2EBPA 3LWIA 5AYFA 1WLPB 4Y91A 3BW1A 2DD5A 1H641 1AHJB 3VS2A 1U3OA 4PJJA 3QJYA 1M1FA 2MYSA 2YLCA 1D3BA 4J9DA 2XU8A 2SEMA 4PFPA 3CCMT 3HPWA 3EG9B 5FROA 1JJ2S 1D0ZA 2KMTA 2DJQA 1OPKA 3TSWA 2DMOA 4LD9K 5CQYA 2ZPHB 1JU5C 1Q81R 1U1TA 2NWMA 2OJ2A 1NJIC 4BY6C 4OP0A 3A8HB 2EGCA 2NUPB 2RJDA 3SD4A 1VQLQ 1ZSZB 5GAOp 2EFIA 1VQ8Q 5LJ3f 3UDCA 1WZOA 2OAUA 2ED0A 3RESA 2KK4A 1FX7A 3HKSA 4XAXB 3M56A 3OYFA 3OYNA 1VQNA 1LNXA 2V8KA 3REBB 4JLIA 5I21A 4OMPA 2M0YA 1GRIA 4M7DF 2VYTA 2GFUA 2CKKA 2HZYA 4M7DA 4KUDK 1U1SA 3CCSA 3G1JA 1UJ0A 1WHHA 1KQ1A 1R8OB 2ZZDA 5LJ3d 2AKKA 2RO0A 3JCMQ 5GAOm 1YCYA 2EWNA 4N4IA 4F17A 3RKXA 1K9AA 3KFVA 1H3ZA 2JS0A 4OMMA 2LP5A 4M7AC 1H92A 4PLLA 4O6JA 4AFSC 2PZ1A 4J6YA 4M7AE 3FLGA 4XTXA 1HD3A 1TS9A 4EDUA 5LJ5h 1RLQC 2AZSA 3G71A 3A8MB 1KIKA 2J6OA 1RAHB 1K9MC 1B7TA 2GTOA 1NG2A 1S72A 4OMQA 5CKFA 2HSPA 5LJ5e 2D1XA 3L2UA 1VQPT 1Y7XA 1SG5A 1YJ9A 5KYWB 5GAN6 2X3XD 2JTFA 3TCJA 1VQKA 3EAEA 2F1LA 3X26B 1W2BS 4MZPA 1VQ7T 1SKUB 2KXCA 3N5BB 4JJNK 4DBFA 2EPDA 4DBRA 4HXJA 1XJWB 3I35A 3HFNA 1K8AU 1EX4A 2D0QB 2JUFA 4M78D 1UUEA 2HDAA 4RTVA 2LDMA 1HJDA 2E10A 2VWFA 1VQNQ 4M7AD 1MV0B 3VS7A 4XU0A 3JCMg 4RUGA 3JSCA 2BZYA 2EJFA 1M5Q1 3ZFJA 5LJ5j 3RNJA 1M2VA 2ZPFB 1BB9A 3CCSQ 2BZ8A 2ZPEB 3CCMA 1X69A 2Y4YA 4JS5A 4ZTFA 4NOYA 4XU2A 4BI3A 4A4KA 4XU1A 2MF2A 1CKBA 2A0FB 2KDSA 2P0QA 1RI9A 1R0BG 1C6VX 1Y96A 3VS4A 3VRZA 3M0SA 2HQHA 2KXDA 4JDSA 4RKUE 2MPXC 5I22A 5A0GA 2F2VA 2RK2A 3VS6A 4HCCA 1AWWA 2PQWA 2RD1A 5LL6S 1QQJA 1YCSB 4J9EA 4C0ZA 2W0ZA 4BE1A 1AVZC 1V76A 1S72Q 1WPYA 3I55T 1RI0A 4PKCC 2K79A 2QTXA 2RJFA 1NEGA 2AHJB 5M9OA 4IUQA 1M90C 2OI3A 3X25B 2OTJT 1YJ9Q 2MWOA 4F7UE 4K11A 4A4GA 1OU8A 2EW3A 2J7IA 4KGZB 1VQKQ 2LCLA 1Y07A 4RTUA 1B3QA 1MMDA 5A0LA 1JBMA 2B8AA 4BY6B 4JJDA 4XTUA 5J26A 1QKWA 1QVGA 4IUUA 4JLGA 4DEXA 5LJ3g 2JTEA 5EG2A 3MO8A 1YBYA 2DD4A 3QJ6A 4LN2A 4F04B 2LRQA 1Z9QA 2E5KA 1VQPA 4PJOD 1W6XA 1RAAB 3GP8A 2DKGA 3CCMQ 2BKDN 2NYSA 2DL5A 2H8HA 2DRKA 2K3BA 2E6ZA 2GF7A 3KUFA 1VQ7A 5KE3A 4NS5A 3VKIA 1I4K1 1M8VA 4MZTA 3RBBB 4AG2C 2LQ8A 4M78F 2CH4W 4RMOA 4M7AB 2FZCB 5KYNA 1KD1C 3CPWP 4M7AF 1BBZA 3SB2A 2DNUA 2I2LA 2LJ3A 3OSSC 4J6WA 4EMGA 1KHIA 1Y0MA 4M77D 1VA7A 3QUIA 4M78G 2DXUA 3EGDA 3CMAT 4PLIA 4B6MA 2IG0A 2ECZA 2FZKB 1QW1A 1G3SA 4M7AG 5GJWB 2KY9A 1U06A 3THKA 2KT1A 7AT1B 2DK3A 2DPPB 3SWNC 1WYXA 1KQ2A 3VS5A 5IHNA 3BFMA 3REAB 2DLPA 5I11A 1NBEB 2VASA 1NYFA 1GXIE 2DF6A 3P8BB 1PKSA 5HCKA 3DB4A 9ATCB 3RERA 3SEMA 1K73C 5FRMA 1WJSA 1GBQA 3H8ZA 2GTJA 5D7UA 3I55A 1M30A 2DE0X 4Z8AA 3VJPA 3HRSA 1VQPQ 2NUZA 2DL8A 1I5LA 3OYCA 3OYEA 2PVOB 3A5ZB 4X9CA 5GAN8 1UHCA 1OV3A 1Q7YC 3QWXX 1SF9A 1VQ7Q 1WJRA 3CEYA 3G4ST 4KT0E 3SFMA 2XDDA 3EGXA 2WSCE 1VQMT 1ACMB 4OMNA 4Z89A 1PRLC 3M53A 4LUDA 4HVUA 3V7CA 1E6GA 4CC4B 3HFOA 3LX7A 4C0GA 4PFOA 3LWHA 2KYMA 2BE9B 4ZGDB 4FYVB 2JMCA 3FEOA 3CPFA 3E19A 1PKTA 2ZPBB 4PJOA 5GAN5 5CCAA 1N27A 1VQ4T 3O8VA 3OYKA 5GAMj 1G3WA 4RTTA 4MMKA 4E7KA 1SPKA 4F7UB 5CKHA 1AWJA 2EYWA 1YIJT 2YDLA 3UF4A 2QEXT 2DFUA 1T3LA 4J83A 3JCMJ 1ARKA 4JJBA 1GL5A 1TUGB 3CMET 2L2PA 5FU7C 1NJIR 1ZLMA 4HCKA 3CC2T 1AEYA 3RUXA 4M77F 4M77A 1YNZA 3TREA 4IUVA 2BUDA 1N8RC 1MMNA 1MUZA 2DXCA 1PM3A 1HXDA 3A98A 4RTWA 3I55Q 1NJIU 3GLXA 4D6WA 2O31A 2EIFA 2FL7A 4Q5WA 4KGXB 6AT1B 4A63B 3CMAA 4M7DC 1T0HA 3PFSA 2HKQB 2PU9B 2QASA 2OTJQ 4M7DE 3V8KA 4CC7A 5HK3A 5AT1B 1ZBJA 4E6RA 4M75A 3OSVA 4GBQA 2JVVA 4JS4A 1VQ9A 5HKCA 1SSHA 4FIBA 2RQUA 4NL2A 5FRNA 2RI5A 4OB1B 2ED1A 2RM4A 1U8RA 2O4XB 4FW2A 2DVJA 1UEBA 5CKEA 4PJNA 2C06A 2MIOA 4XTVA 3NGPA 4AFZC 2YHTA 1RAEB 2HQEA 3FB9A 3A8LB 3OYHA 1K9MR 3PE0A 5GMKl 4A4HA 2RQWA 2HSEB
chains in the Genus database with same CATH topology
5GAN4 2VGMA 5GAOp 4LDVA 4KUIA 5GAMe 4QW2A 3ZBDA 2EFIA 3CCVT 5LJ3f 2E64A 4C92C 2Y4XA 3JB9G 4C8QC 3UDCA 2MMPA 2OAUA 4OGEA 4HA8A 2LX9A 3RESA 4QQ6A 2KK4A 3LW5E 1FX7A 3HKSA 4XAXB 3M56A 4C92E 3OYFA 5GMKj 3R6OA 4C8QE 2QQBA 3OYNA 3GPLA 1VQNA 2XI9A 1LNXA 3V8LA 2V8KA 1K9MU 4JLIA 3DLMA 5I21A 4X9DA 4M7DF 2VYTA 3G4SA 4BI8B 2GFUA 4E7LA 2CKKA 2QQ9A 4O5VA 3SDZA 2E70A 5GANh 3L2VA 4KUDK 4M7DA 3E9GA 1U1SA 3LWIA 4XTWA 3CPWS 5LJ5d 3CCSA 1VQMA 3SWNB 3OW2S 3J80E 1KQ1A 1Q86C 1R8OB 2ZZDA 3OYJA 3CC4A 1NE8A 2P4TA 5LJ3d 2RO0A 3ZEHA 3JCMQ 1KQSS 5GAOm 1YITT 2DIQA 4B9XA 1YCYA 2EWNA 1YITA 4N4IA 4ZGEB 4PJOB 3RKXA 4BUGA 3M57A 4L6V5 5GANe 1H3ZA 2X4YA 4M7AC 2DZ9A 4PLLA 4PJOF 3MHXA 1I8FA 4CRIA 4O6JA 3JRZA 2PVGB 2DTOA 4J6YA 4EMKB 3OYAA 4TVRA 3L2QA 1YJNT 3FLGA 4XTXA 1Q81C 4M7AE 1OYXA 4EDUA 4B9WA 3MEAA 3UWNA 3FJPA 5LJ5h 1JJ2A 1BI0A 2A7YA 3G71T 3ER0A 2LTOA 3A8MB 3PMIA 4XTYA 4J7IA 3G71A 1K9MC 3J7AF 4Y28E 4E7JA 4HCZA 3JB9I 5GAOr 3CCET 2K5IA 3KXTA 5LJ3h 4CI0C 2CYZB 3RMSA 2XDBA 4XU3A 2QEXA 1S72A 5CKFA 4OF1A 3CC7T 4QQDA 1YHQA 5HK0A 2G3RA 4XQ3A 3JCMc 4C92F 4PJOG 1BIAA 3QZ5B 4BD3A 5LJ5e 4NL3A 3LYIA 4C8QF 3L2UA 3L2WA 1VQPT 4C92A 3CMEA 1N6AA 4C5HA 2QQSA 1NZ9A 2F5KA 1Y7XA 4C8QA 4M77B 1BYMA 3HP9A 1OZ3A 1YJ9A 2HAXA 2RHIA 3BDUA 1Y71A 5GAN6 5LJ3e 3CC2A 3OY9A 2JTFA 1KC8U 3TCJA 5IAYA 1VQKA 1NPRA 3EAEA 2RB6A 3PMTA 4BE2A 2JTMA 3X26B 2JNGA 1W2BS 4MZPA 1VQ7T 2QQAA 3N5BB 1N9SA 4JJNK 4JRPA 3JCMP 3OYDA 4A54A 1HK9A 1MGQA 1PSEA 2XHCA 2XIDA 5GMKh 2DTIA 2RHUA 4F7UA 3OS2A 2IVWA 4BDYA 4OB0B 2K2VA 2RI3A 3CPWA 3HFNA 3QDRB 1K8AU 3OW2A 2HQXA 3QBYA 4M78A 4GLKA 2F5TX 2NLUA 2XDPA 2R57A 3Q1JA 2JUFA 2CZ0B 2D0QB 4M75B 4RG2A 4IKFA 4M78D 1O9SA 4V2SA 2LDMA 4M7AA 1D3BB 1B34A 3P8HA 4M77G 3T9NA 4M75F 2YLBA 1KQSA 1G3TA 2E10A 4M7AD 4BACA 4ATOA 1MHNA 3MEUA 4XU0A 2EQJA 2XG8D 3JSCA 2EJFA 4GY5A 3JCMg 1M5Q1 3QPHA 3ZFJA 5LJ5j 2ZPFB 3CCJT 3WVEB 4Z02A 2OTLT 2ZPEB 4N4GA 1WGSA 1VIFA 4YTLA 3CCMA 1KC8C 2Y4YA 3X28B 1VQ6T 4KULA 3QYGB 2X35A 1WQWA 2VGNA 2HD0A 4JS5A 5GAMg 4ZTFA 1QVGS 2FYKA 2PUOB 2FB7A 5GAOn 1YJWT 4NOYA 5FU7B 1VQOA 1M90U 2P0PA 4XU2A 4BI3A 2PUKB 2K5FA 4XU1A 2MF2A 2H3JA 2KDSA 2P0QA 2VV5A 4A4KA 3OYBA 3EFRA 4M75G 3OYMA 2QA4A 3L1AA 4N0AC 5KCHA 1Y96A 2MI6A 4WF2A 2DXTA 4XK8E 3JB9J 3X20B 4BI4A 4DOWA 4JDSA 2XKOC 4RKUE 1V29B 5LJ5f 3S3NA 5DY9A 5A0GA 3I56T 1X01A 2RK2A 4HCCA 3G6ET 2PQWA 2RD1A 4UC4A 5LL6S 4MZMA 4EMHA 1VQ5T 1LJOA 2WSEE 1Q81U 4OB2B 3CCVA 3G7ZA 5FU6C 2ZPIB 2EQKA 4EPCA 2LT1A 2VUBA 1OI1A 3JB9D 4M7DB 1WQ7A 2X4JA 1W2BA 4E7IA 4C0ZA 2A3LA 5CO7A 3JCMb 3CCLT 2EJ9A 2K4YA 4BE1A 5CVIA 1M4ZA 5GANg 2WACA 1WPYA 3I55T 3CBMA 1RI0A 4PKCC 2QTXA 2RJFA 5M9OA 2AHJB 2L89A 3OYGA 2K3YA 3OQ5A 3AHUA 4IUQA 1O75A 4MMLA 1M1KC 1M90C 5J39A 3X25B 2EYQA 3WXMB 3HSBA 5IN1A 3QO3A 3C95A 2OTJT 3JB9H 2JZ2A 4C5IA 2L3RA 2OTJA 1XOVA 2VC8A 3PNWC 2MWOA 4A4FA 4C0DC 4A4GA 4F7UE 4M78C 3M4YA 2PVDB 3MEVA 1Q82U 2CZ6B 2LCLA 1Y07A 4FT2A 4M78E 2DXBA 5DLQE 3VYGA 3M4GA 2E5QA 2JOYA 5A0LA 3V7SA 3INZA 2DVEA 4J8OA 5GAN2 1JBMA 3PT9A 5D6YA 2B8AA 3CBOA 2JN0A 5I2SA 4M7DG 1XNIA 1YJNA 5LJ5g 1QVFS 3A8GB 3L2RA 2D9TA 5CQXA 2XD0A 4BY6B 2VXEA 4XTUA 2GQVA 4PL6A 2BIVA 5J26A 4HKEA 1QVGA 4IUUA 4JLGA 4N0AA 5LJ3g 1XQHA 2FVUA 3L2ZA 5EG2A 3URGA 2K3XA 3MO8A 2CZ7B 1KD1U 3CCEA 1YBYA 4QVDA 2DD4A 4PNOA 5I2MA 4C92B 3QJ6A 3KBGA 2LRQA 4C8QB 4LD6A 2KSSA 2M1HA 3CC7A 1QP2A 2M0OA 1VQLT 3MP6A 2DEQA 1KG1A 1VQPA 2K5LA 4C5GA 2GCXA 3S6WA 4PJOD 3GP8A 2DKGA 3CCQT 1VQ8T 5KH6A 2BKDN 3OMGA 1QP3A 4OVAA 3HHTB 1JRIA 3V7RA 4ZTJA 1Q82C 1VQ8A 3MP8A 3RKYA 5GMKm 2D6FA 2R58A 2EKOA 1VUBA 3A8OB 2E6ZA 2M9UA 3CCUT 2GF7A 3PIOA 2V8IA 1W4SA 2V8JA 3CCUA 3KUFA 4JRIA 4X34A 1VQ7A 5KE3A 3QIIA 4NS5A 2VXFA 2M16A 3VKIA 4F7UF 3PIPA 1I4K1 1M8VA 3GIBA 4MZTA 3LGLA 2P0KA 4MDWA 2LQ8A 2CGHA 1ZHIA 4M78F 1LOJA 4C92G 4RMOA 3S3OA 4C8QG 4M7AB 1B34B 3DKMA 3E9FA 3OBWA 3QKJA 3H6ZA 3TEEA 1BI3A 1IREB 1KD1C 4M7AF 4JRQA 2EQUA 3OBYA 3SB2A 2MWPA 2E6NA 2I2LA 2RA2A 3HRTA 3NFCA 3OSSC 3LH0A 3J81E 4J6WA 4EMGA 1KHIA 2RHXA 3ASKA 3M55A 3M9QA 4M77D 5A2QE 5D6WA 4ELZC 3DLLA 3S3MA 5CIUA 2DO3A 4P5NA 1K73U 4F7UG 3QUIA 5CKBA 4XTZA 2ZGWA 3GNGA 3CCJA 1QVFA 4JUVA 3VUZA 4C0FA 3LGFA 1BI1A 3META 5GAOl 4KBMB 1UGRB 2DXUA 3GF5A 2ZPGB 4M78G 4RCBA 4PLIA 3CMAT 1UGPB 4A53A 2IG0A 1VQ6A 1UB4A 3PTAA 1QW1A 1Y96B 1M1KU 1G3SA 4M7AG 2X4WA 1YJWA 1M1GA 2O01E 2L8DA 3HL8A 2KY9A 5CKDA 3HRUA 3MEWA 4MDXA 1UGQB 2E1HA 2DK3A 4LDYA 2DPPB 3SWNC 2DTHA 1KQ2A 1SSFA 4II1A 2DJZA 2ZCFB 1KHCA 3BFMA 5GAN7 3GOXA 1I81A 1DJ7B 3JCMV 4R56A 2MAMA 4C5EA 3CXCS 3I56A 4QVCA 4BB7A 3V8JA 3M5AA 5FLXE 3G6EA 3LLRA 1GXIE 3GNFB 4PJOC 3P8BB 3JB9F 2DZCA 3QZ9B 4FSXA 1VQ5A 2R5AA 3DB4A 3C12A 2QQRA 4PJOE 2O4XA 3C4SA 3RKWA 3RERA 3OYYA 4EMKC 4QQGA 1K73C 5FRMA 2DIGA 4J6XA 1WJSA 3CD6T 2GFAA 2OTLA 3JCMe 3CCLA 1ZBXA 3NTHA 2L5QA 4HCBA 3H8ZA 3VV0A 3I55A 3FIFA 3FRNA 4OGCA 3VJPA 4ZN3A 3HRSA 2RJEA 2E65A 4OMFB 4ELYC 4L5GA 4R55A 4FU6A 1I5LA 3C94A 3OS1A 3DB3A 3OYCA 3OYEA 2PVOB 3A5ZB 4X9CA 5GAN8 1M9SA 3OS5A 1VQNT 1Q7YC 1EIFA 2CZ1B 2RJCA 1WJRA 3CEYA 4OB3B 4KT0E 4M77C 3SFMA 4DQ2A 4J7FA 3OA6A 3G4ST 4BDZA 2RH2A 5CR2A 2XDDA 1PSFA 2EJGA 3CCST 4M77E 3TU4K 2WSCE 5GAN3 1VIEA 1VQMT 3UT1A 4FL6A 5HY6A 3VYHB 1IZ6A 4M7DD 2RHYA 5C0MA 3OYLA 3MCAB 2RHZA 3CC4T 3M53A 3V7CA 4BE0A 3QYHB 3SWNA 5D6XA 2R5MA 1X75C 3NTIA 3HFOA 3LX7A 4C0GA 3LWHA 3CBPA 2HBPA 2QI2A 3NTKA 5FU6B 5DM7R 4QVZA 4ZGDB 4RCCA 3FEOA 3CPFA 3E19A 4RG8A 2ZPBB 4PJOA 4M75C 5GAN5 1N8RU 5CCAA 3UPUA 1TH7A 1VQLA 4VUBA 4LDWA 1WNLA 2F69A 4J5YA 4IUPA 4M75E 3CXCA 1N27A 1VQ4T 3O8VA 3OYKA 2QXFA 1P92A 1G3WA 5GAMj 3PGGA 4EMKA 3CCQA 1VQ4A 5IT9E 2WSFE 1FWZA 3OMCA 4MMKA 4E7KA 1RL2A 3BY7A 2YRVA 4IUTA 4F7UB 3JCMW 5KCOA 5CKHA 2LNVA 1YIJT 5GMKi 2QEXT 1S72T 1YIJA 3JCMf 2E12A 1YHQT 4C0DB 3OS0A 4M78B 4J83A 3QXEB 1G5VA 3JCMJ 3CMET 1JB0E 3M59A 4A4EA 1XTDA 4ME7A 4L59A 5FU7C 2EAYA 2LC4A 2Y90A 3OB9A 2KVQG 5L8RE 5GAOq 4E7HA 3RIRA 2LVMA 4C92D 1YJ9T 5GAMf 4FM4B 3CC2T 3RUXA 4C8QD 3QG1A 4M77F 4FT4A 2CS7A 3P8DA 3EFSA 1VQKT 2LQKA 4M77A 4HT8A 2QDYB 2KAFA 2LCCA 1ZQ1A 3M58A 4IUVA 1FXXA 3TREA 2BUDA 5CAIA 5GANj 1N8RC 2DXCA 3VUBA 1HXDA 2HNIA 2K57A 1X6OA 5CK9A 1UGSB 3JCMd 3RMQA 4IURA 3JCMX 3BDLA 4DOVA 1NPPA 1NJIU 3GLXA 2XICA 4D6WA 3ME9A 2EIFA 2FL7A 1WJQA 2LT4A 4LDUA 4Q5WA 5AYFA 3VU3C 3FDRA 4DA4A 4Y91A 1QVPA 3BW1A 3CMAA 4M7DC 3PFSA 2DAQA 1BI2A 2PU9B 2DD5A 5GAMd 1H641 3OYIA 1AHJB 4M7DE 2X4XA 3V8KA 5HK3A 2EQMA 3QHSA 3QJYA 1M1FA 3OSVA 4M75A 5GMKe 5GANf 3F70A 2JVVA 2RK1A 1VQ9T 2YLCA 4JS4A 1D3BA 1VQ9A 2XU8A 3CCRT 4M75D 4LDXA 5HKCA 3CCRA 4N4HA 3WVDB 1Q7YU 4FIBA 4NL2A 5FRNA 3QSUA 3JCMh 2RI5A 4OB1B 3FC3A 4E47A 2RM4A 3CCMT 1YI2T 1U8RA 3HPWA 5FROA 2O4XB 5J3BA 2E41A 5KE2A 5DLOA 1YI2A 1JJ2S 5C6SA 1UEBA 2KMTA 5LJ3j 5CKEA 1BIBA 1BKBA 1VQOT 3E1SA 2RI2A 5A0DA 1N9RA 1G3YA 2C06A 4XTVA 3JAME 4LD9K 2QA4T 5CQYA 5GAMh 2ZPHB 1Q86U 3L42A 1U1TA 2KQWA 4ZN1A 1NJIC 2YHTA 3CD6A 2FHDA 2XK0A 4HT9A 1OZ2A 4BY6C 5GANd 1K8AC 4JRKA 2HQEA 4OP0A 3A8HB 3FB9A 3A8LB 3X24B 3OYHA 5GMKl 2RJDA 3SD4A 4A4HA 3MP1A 3M54A 4ZGJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  1M5Q 1;  5GAN 4;  5LJ5 j;  4JRI A;  3SWN A;  5GAO p;  2VXF A;  5GAM e;  4F7U F;  4PJO E;  3HFO A;  1I4K 1;  2E64 A;  5LJ3 f;  4C92 C;  3GIB A;  3JB9 G;  1M8V A;  4C8Q C;  4HA8 A;  3RES A;  3HSB A;  2CGH A;  4M78 F;  4RCC A;  1LOJ A;  1WQW A;  4C92 G;  4C92 E;  4C8Q G;  4C8Q E;  4M7A B;  5GMK j;  2FYK A;  1B34 B;  2FB7 A;  5GAM g;  1LNX A;  4NOY A;  4M75 C;  3V8L A;  5GAN 5;  4JLI A;  4XU2 A;  5I21 A;  4X9D A;  1TH7 A;  4PJO A;  4XU1 A;  4M7D F;  4M7A F;  1WNL A;  4J5Y A;  3EFR A;  4M75 G;  4M75 E;  3SB2 A;  3L1A A;  4N0A C;  4M7D A;  5GAN h;  5GAM j;  1Y96 A;  2I2L A;  2RA2 A;  1U1S A;  2DXT A;  3PGG A;  4WF2 A;  4XTW A;  4EMK A;  5LJ5 d;  3JB9 J;  5GAO n;  3SWN B;  4MMK A;  4J6W A;  1KQ1 A;  4EMG A;  4M77 D;  5LJ5 f;  3BY7 A;  5DY9 A;  1X01 A;  4F7U B;  3JCM W;  4F7U G;  3QUI A;  5LJ3 d;  2RD1 A;  5GMK i;  4XTZ A;  4EMH A;  2ZGW A;  3JCM f;  3JCM Q;  5GAO m;  1LJO A;  1YCY A;  2EWN A;  4JUV A;  4M78 B;  4M7A E;  4PJO B;  5GAO l;  3RKX A;  3JCM J;  4M78 G;  2DXU A;  4RCB A;  5GAN e;  4M7A C;  2DZ9 A;  4A53 A;  4PJO F;  2EAY A;  3JB9 D;  4M7A G;  4M7D B;  1I8F A;  1WQ7 A;  1Y96 B;  2Y90 A;  2DTO A;  4J6Y A;  4EMK B;  3JCM b;  3RIR A;  5GAO q;  2EJ9 A;  4C92 D;  4XTX A;  5GAM f;  5GAN g;  3RUX A;  4C8Q D;  1WPY A;  4M77 F;  2QTX A;  2E1H A;  3EFS A;  3FJP A;  5LJ5 h;  4M77 A;  3SWN C;  4HT8 A;  2DTH A;  1KQ2 A;  3AHU A;  4MML A;  2DJZ A;  4XTY A;  5CAI A;  3BFM A;  5GAN j;  5GAN 7;  1I81 A;  1HXD A;  2HNI A;  3QO3 A;  2K57 A;  3JCM V;  3JB9 I;  5GAO r;  3JB9 H;  5LJ3 h;  3JCM d;  2VC8 A;  4QVC A;  3JCM X;  3V8J A;  4F7U E;  4XU3 A;  4M78 C;  4PJO C;  3JB9 F;  3VU3 C;  2DZC A;  4XQ3 A;  3JCM c;  4M78 E;  4PJO G;  4Y91 A;  1BIA A;  4C92 F;  3RKW A;  3BW1 A;  3M4G A;  4C8Q F;  5LJ5 e;  4NL3 A;  3RER A;  4M7D C;  4C92 A;  3V7S A;  4EMK C;  3INZ A;  2DVE A;  5GAN 2;  5GAM d;  1JBM A;  1H64 1;  4J6X A;  4C8Q A;  4M77 B;  2JN0 A;  4M7D G;  4M7D E;  3V8K A;  3JCM e;  5LJ5 g;  3BDU A;  5GAN 6;  5LJ3 e;  3QHS A;  4M75 A;  5GMK e;  5GAN f;  2VXE A;  3FIF A;  4XTU A;  2YLC A;  1D3B A;  2RB6 A;  4M75 D;  2E65 A;  4N0A A;  5LJ3 g;  1N9S A;  3L2Z A;  4NL2 A;  3JCM P;  3JCM h;  3QSU A;  4A54 A;  2RM4 A;  1I5L A;  1HK9 A;  1MGQ A;  2E41 A;  4QVD A;  2DTI A;  4F7U A;  4PNO A;  4X9C A;  5GMK h;  4C92 B;  5GAN 8;  4C8Q B;  5LJ3 j;  3HFN A;  1BIB A;  4M78 A;  1N9R A;  4XTV A;  5GAM h;  4M77 C;  2DEQ A;  4DQ2 A;  4M75 B;  1U1T A;  4M78 D;  4PJO D;  4V2S A;  2DKG A;  2EJG A;  2YHT A;  4M7A A;  1D3B B;  1B34 A;  4M77 G;  4M77 E;  5GAN 3;  4M75 F;  2YLB A;  5GAN d;  1JRI A;  3V7R A;  4HT9 A;  4JRK A;  4OP0 A;  3RKY A;  2E10 A;  5GMK m;  4M7D D;  4M7A D;  3FB9 A;  5GMK l;  4XU0 A;  3JCM g;  2EJF A; 
#chains in the Genus database with same CATH topology
 5GAN 4;  1G83 A;  4J9C A;  3JB9 G;  2AKL A;  2COY A;  1D0Y A;  3R6O A;  5KYY A;  2X3W D;  1K9M U;  4X9D A;  3I5R A;  1AT1 B;  3G4S A;  4AFU C;  2CT4 A;  3SDZ A;  4O5V A;  5GAN h;  3E9G A;  2E3I A;  5LJ5 d;  1VQM A;  3SWN B;  3OW2 S;  1OEB A;  4J9H A;  3TSZ A;  3OYJ A;  1K1Z A;  2K7A A;  2RPN A;  1KQS S;  2LNH B;  3ZEH A;  5EC7 A;  2DIQ A;  4ZGE B;  2QYZ A;  4BUG A;  5GAN e;  2W10 A;  3MHX A;  4Z88 A;  1OX8 A;  3JRZ A;  4WCI A;  2DTO A;  3OYA A;  4TVR A;  2LX7 A;  3MEA A;  2FG0 A;  3CMA Q;  3G71 T;  1GCQ A;  2B86 A;  3PMI A;  4WTO B;  5KYX B;  2CSI A;  4Y28 E;  3E2U A;  3JB9 I;  3CCE T;  4CI0 C;  4XU3 A;  1D1B A;  2QEX A;  1RAI B;  4OF1 A;  2G3R A;  1ABO A;  3MKD A;  3L2W A;  3CME A;  4C5H A;  3BDU A;  3CC2 A;  1QWF A;  2I0N A;  4HVV A;  2JTM A;  1WXT A;  1ZA1 B;  2ESW A;  2QQA A;  1N9S A;  3OYD A;  1N5Z A;  1PSE A;  2YSQ A;  2XID A;  2DTI A;  2IVW A;  2YRD A;  4BDY A;  2K2V A;  3CPW A;  3QDR B;  1I1J A;  1H8K A;  2HQX A;  3QBY A;  1A0N B;  2NLU A;  1UG1 A;  2R57 A;  1SEM A;  2CZ0 B;  1O9S A;  4V2S A;  4Y92 A;  1D3B B;  1B34 A;  3P8H A;  1M90 R;  1OPL A;  2XG8 D;  4GY5 A;  3G4S Q;  2FRY A;  1CKA A;  4Z02 A;  2OTL T;  4N4G A;  1WGS A;  1VQM Q;  2JJ9 A;  1KC8 C;  1VQ6 T;  4KUL A;  3QYG B;  2HD0 A;  1M90 U;  1YJW T;  5FU7 B;  1JQQ A;  5FW9 A;  3EFR A;  3OYM A;  2QK0 A;  3L1A A;  1UFF A;  2XKO C;  1RUW A;  1X01 A;  3G6E T;  2KEA A;  1VQ4 Q;  2WSE E;  4R0K A;  4OB2 B;  1Q81 U;  5FU6 C;  2ZPI B;  4J9I A;  1Z9Z A;  4M7D B;  3CQT A;  3CCL T;  5CO7 A;  1YIJ Q;  2QEX Q;  2WAC A;  2K3Y A;  4MML A;  1O75 A;  3CME Q;  1M1K C;  1D0X A;  2DL7 A;  3WXM B;  1RAF B;  3JB9 H;  1UGV A;  4C5I A;  2L3R A;  1XOV A;  3CC2 Q;  1ZA2 B;  4C0D C;  4M78 C;  2PVD B;  3MEV A;  2CZ6 B;  4FT2 A;  5IHI A;  4M78 E;  2DXB A;  1AWX A;  3EG1 A;  1KD1 R;  2DVE A;  4J8O A;  1IHW A;  2JN0 A;  1G2B A;  4M7D G;  1WA7 A;  5LJ5 g;  1QVF S;  3L2R A;  1PRM C;  4PL6 A;  3D7S B;  4J9F A;  2BIV A;  2DL4 A;  4N0A A;  1JJ2 P;  3L2Z A;  2K3X A;  8AT1 B;  1KD1 U;  1QMC A;  3CCE A;  4PNO A;  3KBG A;  1Q95 G;  1WHK A;  2C0O A;  2M0O A;  1KG1 A;  2GCX A;  3S6W A;  3CCQ T;  2HAX A;  3PVQ A;  3OMG A;  1WDX A;  1OQK A;  3V7R A;  4ZTJ A;  5GMK m;  1ZUY A;  4OMO A;  1VUB A;  1GBR A;  2V8I A;  2V8J A;  3CCU A;  1K4U S;  4JRI A;  4JZ4 A;  4FCY A;  1QKX A;  4ZNX A;  4CC3 A;  1MMG A;  4MDW A;  1ZHI A;  1LOJ A;  1K73 R;  2L3Q A;  3DKM A;  3QKJ A;  1JEG A;  1BI3 A;  1R0C B;  1RAC B;  2RNA A;  2YXY A;  3HRT A;  3UA6 A;  1M2V B;  2RHX A;  5D6W A;  1PC0 A;  3DLL A;  1K73 U;  1UEC A;  2CH4 A;  2KYB A;  4XTZ A;  2ZGW A;  2YWW A;  2OTL A;  1Q7Y R;  2ZPG B;  4A53 A;  1VQ6 A;  1Y96 B;  2X4W A;  1YJW A;  1OX9 A;  2O01 E;  4KH0 B;  1TXQ A;  4LDY A;  1TUD A;  1Q86 R;  2BE7 D;  4II1 A;  2ZCF B;  1KHC A;  2VKN A;  5GAN 7;  1SRL A;  2MAM A;  3V8J A;  3G6E A;  3LLR A;  4PJO C;  2HEQ A;  1SRM A;  2R5A A;  3G71 Q;  3C12 A;  4PJO E;  3M0R A;  3OYY A;  1WHG A;  1I07 A;  3H0H A;  3CCE Q;  1VYU A;  3JCM e;  3CCL A;  1ZBX A;  1W2B P;  2COW A;  3FRN A;  1YP5 A;  4KRT A;  2DER A;  1R77 A;  2KRM A;  1QCF A;  4L5G A;  1WFW A;  4FU6 A;  3OS5 A;  2BZX A;  2KT8 A;  1EIF A;  3OA6 A;  4M77 C;  1OOT A;  2KGT A;  4M77 E;  3TU4 K;  5HY6 A;  1EFN A;  2FEI A;  2RHY A;  1N8R R;  2RHZ A;  3CC4 T;  2FO0 A;  3QYH B;  1KFZ A;  2V1Q A;  4RTY A;  3ZL7 C;  1VOM A;  2CP0 A;  2HBP A;  5FU6 B;  4M75 C;  1N8R U;  4J5Y A;  2F69 A;  3CXC A;  4M75 E;  2O9S A;  2OTL Q;  3CCQ A;  3PGG A;  4EMK A;  2ATC B;  2WSF E;  1VQ6 Q;  2QAZ A;  2D8J A;  1YJW Q;  2YRV A;  4IUT A;  5KCO A;  2CP6 A;  2LNV A;  2M02 A;  1BK2 A;  2E12 A;  1E7O A;  4C0D B;  3FJ5 A;  3OS0 A;  4M78 B;  2NUT B;  1XTD A;  1AOJ A;  5L8R E;  1YWO A;  2C0T A;  2KVQ G;  3G6E Q;  3EH2 A;  3RIR A;  2CP3 A;  4C92 D;  4FM4 B;  4C8Q D;  3QG1 A;  3P8D A;  4LE9 A;  2QDY B;  2KAF A;  1FXX A;  5CAI A;  1TG0 A;  4M4Z A;  1X6O A;  3CCL Q;  3IQL A;  3EGD B;  4IUR A;  3JCM X;  4ORZ A;  4MDX A;  3VU3 C;  2LT4 A;  4LDU A;  1QVP A;  2V26 A;  3OYI A;  2X4X A;  5GMK e;  5GAN f;  3F70 A;  5IXB A;  1VQ9 T;  1IHV A;  4M75 D;  4LDX A;  3CCR A;  3QSU A;  4E47 A;  2ROT A;  5KE2 A;  5J3B A;  1YI2 A;  5C6S A;  1Y57 A;  5LJ3 j;  1VQO T;  5A0D A;  1G3Y A;  2CP7 A;  3JAM E;  3H0I A;  5GAM h;  2JXB A;  1GCQ C;  3RR6 A;  1U5S A;  2FHD A;  2XK0 A;  5GAN d;  4OML A;  1K8A C;  1JXM A;  4J9B A;  2JM8 A;  3M54 A;  2DEU A;  1IGU A;  2FPE A;  5GAM e;  4QW2 A;  3CCQ Q;  2Y4X A;  2Z0W A;  4OGE A;  4HA8 A;  2LX9 A;  3HSB A;  1TWB A;  3EGX B;  5GMK j;  1PHT A;  2QQB A;  4KGV B;  1EZZ B;  2XI9 A;  4E7L A;  2QQ9 A;  2DYI A;  2E70 A;  3H9N A;  1MND A;  4XTW A;  3UA7 A;  1ZX6 A;  4F14 A;  1Q86 C;  1J3T A;  3CC4 A;  2P4T A;  1RAD B;  4FYX B;  1YIT A;  4KH1 B;  1WHL A;  4PJO B;  1UDL A;  4AFQ C;  4L6V 5;  4PJO F;  1YJN T;  5FWB A;  2LCS A;  1SHF A;  1JJ2 A;  2FZG B;  3UWN A;  2A7Y A;  2LTO A;  2DBM A;  4J7I A;  3J7A F;  2LQW A;  4E7J A;  4HCZ A;  5GAO r;  4FSS A;  2CYZ B;  3RMS A;  1C0M A;  2XDB A;  1KC8 R;  3CC7 T;  1M3B A;  2ZAE A;  3EG2 A;  5HK0 A;  4XQ3 A;  4C92 F;  4PJO G;  3QZ5 B;  4BD3 A;  4NL3 A;  2X9H A;  4C8Q F;  2DET A;  2QTV A;  4C92 A;  1N6A A;  4C8Q A;  5GJV B;  1BYM A;  4M77 B;  4JJC A;  2FRW A;  2K2M A;  2LJ1 A;  2RHI A;  5KYU A;  1KC8 U;  5IAY A;  1NPR A;  2RB6 A;  2QG9 B;  4IIM A;  4JRP A;  1HK9 A;  1MGQ A;  3OS2 A;  4F7U A;  2RHU A;  4GLK A;  2F5T X;  2XDP A;  4IKF A;  4M75 B;  2DBK A;  4M77 G;  3T9N A;  4M75 F;  2YLB A;  1UJY A;  1K0S A;  1M1K R;  4BAC A;  2JS2 A;  1MHN A;  3MEU A;  2AT1 B;  2C0I A;  2EQJ A;  2LQN A;  1YFN A;  2D8H A;  1VIF A;  4AMC A;  3VS3 A;  3MPU B;  2X35 A;  2VGN A;  3CC4 Q;  1QVG S;  2JT4 A;  2FYK A;  5GAO n;  2FB7 A;  1VQO A;  1NYG A;  2PUK B;  2H3J A;  2VV5 A;  1D1C A;  2EGE A;  4M75 G;  1K76 A;  1NEB A;  4N0A C;  5KCH A;  3NMZ C;  1X2K A;  3UAT A;  1M27 C;  1RAB B;  3NHN A;  1WI7 A;  5LJ5 f;  5DY9 A;  1BCM A;  2KRN A;  4QT7 A;  2KE9 A;  2IIM A;  4MZM A;  4EMH A;  3MJX A;  3TQ7 P;  3R6N A;  2GNC A;  2VUB A;  3H41 A;  2X4J A;  1W2B A;  3JCM b;  2K4Y A;  5CVI A;  5GAN g;  2KRS A;  3CBM A;  2L89 A;  3AHU A;  2EYQ A;  2O9V A;  3QO3 A;  5IN1 A;  3C0C A;  2JZ2 A;  2VC8 A;  4A4F A;  1YWP A;  1TOV A;  3VRY A;  1OUL A;  5DLQ E;  3M4G A;  2E5Q A;  2JOY A;  3INZ A;  5GAN 2;  5I2S A;  5D6Y A;  3CBO A;  2KR3 A;  1AWO A;  1XNI A;  2F2X A;  2F2W A;  1YJN A;  3JV3 A;  2VXE A;  3EFO A;  1M3C A;  1HYO A;  4HKE A;  4GLM A;  2L0A A;  3CXC P;  1XQH A;  2CZ7 B;  4DBH A;  5I2M A;  1VQ9 Q;  2KSS A;  3CC7 A;  1QP2 A;  3MP6 A;  2DEQ A;  1TU0 B;  2G6F X;  2K5L A;  1IO6 A;  5KH6 A;  1Q82 C;  1QP3 A;  1VQ8 A;  3RKY A;  2SRC A;  2R58 A;  1VQO Q;  2AZV A;  3CCU T;  3PIO A;  1W4S A;  3QII A;  2VXF A;  2M16 A;  2EYZ A;  3LGL A;  1D1A A;  2CGH A;  3M0Q A;  2D0N A;  3S3O A;  1B34 B;  3OBW A;  1IRE B;  2EQU A;  3OBY A;  3OW2 P;  2HKN A;  2E6N A;  2K6D A;  2RA2 A;  3NFC A;  2DL3 A;  3LH0 A;  3J81 E;  5A2Q E;  2YT6 A;  4ELZ C;  1KQS P;  4E7Z A;  3S3M A;  2DO3 A;  5CKB A;  3GNG A;  2HMA A;  2J06 A;  4JUV A;  3VUZ A;  4C0F A;  4KBM B;  1UGR B;  3GF5 A;  4RCB A;  1M3A A;  4IIO A;  3SHW A;  1UB4 A;  1PCX A;  4X1V A;  1M1G A;  5CKD A;  2E1H A;  2ROL A;  2DTH A;  1SSF A;  2DJZ A;  3GOX A;  1I81 A;  1DJ7 B;  1I5O B;  4R56 A;  1YJN Q;  1ZSG A;  4BB7 A;  5FLX E;  3PVL A;  1IB8 A;  2MK5 A;  3QZ9 B;  4FSX A;  2OX7 A;  2QQR A;  3EG9 A;  3RKW A;  3C4S A;  4EMK C;  4HVW A;  1X6B A;  1TTH B;  3CD6 T;  2GFA A;  3NTH A;  2L5Q A;  1AD5 A;  2EKH A;  3VV0 A;  3CC7 Q;  2YRC A;  4OGC A;  4ZN3 A;  2HBW A;  2RJE A;  1NLO C;  4OMF B;  4ELY C;  2NUP A;  3OS1 A;  3DB3 A;  1ZSZ A;  1M9S A;  1W1F A;  1NLP C;  2KNB B;  2RJC A;  2DA9 A;  1PSF A;  2EJG A;  5GAN 3;  4FL6 A;  3VYH B;  1IZ6 A;  1X6G A;  5C0M A;  3MCA B;  1I0C A;  1WIE A;  5D6X A;  2R5M A;  1X75 C;  4D8D A;  2QI2 A;  5IH2 A;  4RCC A;  3EGU A;  3UPU A;  4IUP A;  5IHK A;  1FWZ A;  3OMC A;  3BY7 A;  2ABL A;  1MNE A;  3JCM W;  1YHQ T;  1RLP C;  2DM1 A;  1JB0 E;  3M59 A;  4L59 A;  2Y90 A;  2BTT A;  4E7H A;  5GAM f;  1WXB A;  1K8A R;  4FT4 A;  2CS7 A;  1ZQ1 A;  3M58 A;  5KYW A;  1W70 A;  2AIR B;  2K57 A;  2P4R A;  1X2Q A;  5CK9 A;  1UGS B;  1VYV A;  3RMQ A;  2RQT A;  2MOX A;  2XIC A;  3ME9 A;  1WJQ A;  4DA4 A;  2O2O A;  3FDR A;  1TSF A;  2DAQ A;  1BI2 A;  1QVF P;  5GAM d;  2EQM A;  3QHS A;  1GFC A;  1PNJ A;  2P84 A;  2RQR A;  2RK1 A;  3CCR T;  1LPL A;  4N4H A;  3WVD B;  1Q7Y U;  3JCM h;  3FC3 A;  1MV3 A;  2A28 A;  1YI2 T;  3NPF A;  2E41 A;  4E7S A;  5DLO A;  2CDT A;  1BIB A;  1BKB A;  3LH5 A;  3E1S A;  2RI2 A;  1N9R A;  5FWC A;  2QA4 T;  1Q86 U;  3L42 A;  2KQW A;  4ZN1 A;  3CD6 A;  4HT9 A;  1OZ2 A;  4JRK A;  4PJL A;  1FMK A;  1IGQ A;  3X24 B;  3MP1 A;  4ZGJ B;  4FW1 A;  2VGM A;  1UTI A;  4LDV A;  4KUI A;  1LCK A;  2RF0 A;  3CCV T;  3ZBD A;  1BCO A;  2E64 A;  4C92 C;  4C8Q C;  2MMP A;  2EQI A;  4QQ6 A;  3LW5 E;  4JPB W;  4C92 E;  4C8Q E;  3GPL A;  3CCU Q;  3V8L A;  2XMF A;  2CRE A;  3DLM A;  2L3S A;  4BI8 B;  3L2V A;  3CPW S;  4D8K A;  3J80 E;  1NE8 A;  3VS1 A;  1YIT T;  4B9X A;  2LJ0 A;  1UE9 A;  3M57 A;  2X4Y A;  2DZ9 A;  3TVT A;  3A1P A;  1I8F A;  4CRI A;  1AZG B;  2PVG B;  4EMK B;  3L2Q A;  1Q81 C;  1FMW A;  1OYX A;  4B9W A;  3FJP A;  1BI0 A;  1BU1 A;  3ER0 A;  4XTY A;  1KK7 A;  1AZE A;  2K5I A;  3KXT A;  2CP2 A;  5LJ3 h;  3ULR B;  4QKU A;  4RTX A;  2YUP A;  4QQD A;  1YHQ A;  3JCM c;  1K0X A;  1BIA A;  3LYI A;  2QQS A;  1NZ9 A;  2F5K A;  2JM9 A;  3HP9 A;  1OZ3 A;  1Y71 A;  5LJ3 e;  3OY9 A;  1IXD A;  8ATC B;  1G8X A;  3PMT A;  4BE2 A;  2JNG A;  3JCM P;  3CD6 Q;  4A54 A;  2XHC A;  5GMK h;  4OB0 B;  2RI3 A;  3RDV A;  2E3H A;  3OW2 A;  4M78 A;  2NUT A;  4EIK A;  3Q1J A;  4RG2 A;  3H0F A;  1ZUU A;  4M7A A;  1KQS A;  1G3T A;  4ATO A;  1HSQ A;  3AT1 B;  2O88 A;  2FPF A;  3QPH A;  2FPD A;  4DEY A;  1WXU A;  3CCJ T;  3WVE B;  2RN8 A;  5IXF A;  4YTL A;  1M2O A;  2HL5 C;  1MMA A;  3X28 B;  3EG3 A;  1WQW A;  5GAM g;  2PUO B;  2P0P A;  2K5F A;  1S1N A;  2QA4 A;  3OYB A;  1FYN A;  2MI6 A;  4WF2 A;  2DXT A;  4XK8 E;  3JB9 J;  3X20 B;  2JW4 A;  4BI4 A;  2J6F A;  4DOW A;  1V29 B;  3S3N A;  3I56 T;  4UC4 A;  2H3E B;  1VQ5 T;  1LJO A;  2VVK A;  3CCV A;  3G7Z A;  3M0P A;  2EQK A;  2JMA A;  4EPC A;  2LT1 A;  1OI1 A;  3JB9 D;  1WQ7 A;  4E7I A;  2A3L A;  4ESR A;  2EJ9 A;  3GBQ A;  1M4Z A;  1Q82 R;  1YHQ Q;  1FMV A;  3OYG A;  3OQ5 A;  5J39 A;  1PWT A;  2A36 A;  3C95 A;  2AK5 A;  2EVR A;  2OTJ A;  2KRO A;  3PNW C;  4AT1 B;  3EHR A;  3M4Y A;  1Q82 U;  1QCN A;  4LUE A;  4PK4 A;  3VYG A;  4RTZ A;  2QGF B;  3V7S A;  3PT9 A;  1KJW A;  1T0J A;  3I5S A;  3A8G B;  2D9T A;  5CQX A;  4CC2 A;  2XD0 A;  2L3P A;  3EH1 A;  3EG0 A;  2GQV A;  1PD1 A;  1H3H A;  2FVU A;  2X51 A;  3URG A;  3U23 A;  2GQI A;  4QVD A;  4C92 B;  3VS0 A;  4C8Q B;  1QWE A;  4LD6 A;  2M1H A;  1VQL T;  3CCR Q;  1CSK A;  2QDL A;  1D09 B;  1PG5 B;  1V1C A;  4C5G A;  5KYU B;  1YI2 Q;  1VQ8 T;  1QLY A;  4OVA A;  1TUC A;  3HHT B;  1JRI A;  3MP8 A;  2D6F A;  1B07 A;  4ANJ A;  2EKO A;  2HL3 A;  3A8O B;  1JO8 A;  2M9U A;  3BE3 A;  2QA4 Q;  4X34 A;  3PIP A;  1WHM A;  2IPO B;  4F7U F;  5ECA A;  1X43 A;  3GIB A;  3M0U A;  2P0K A;  4C92 G;  4C8Q G;  2KBT A;  3E9F A;  3TEE A;  1OU9 A;  3H6Z A;  2EYX A;  4JRQ A;  3CCV Q;  2EGA A;  2MWP A;  2VB6 A;  4PJM A;  2CT3 A;  3M55 A;  3M9Q A;  3ASK A;  4JZ3 A;  1ZSZ C;  4AG1 C;  1GCP A;  5CIU A;  4P5N A;  2CSQ A;  4F7U G;  2OAW A;  3CCJ A;  1QVF A;  3LGF A;  1BI1 A;  3MET A;  5GAO l;  5L23 A;  1UGP B;  2LMJ A;  2KI7 A;  3PTA A;  1M1K U;  2J6K A;  4PFZ A;  2L8D A;  3HL8 A;  3HRU A;  1YIT Q;  3MEW A;  1UGQ B;  4F16 A;  1UHF A;  4LXC A;  2RQV A;  3JCM V;  4C5E A;  3CXC S;  3I56 A;  4QVC A;  1M8M A;  3M5A A;  3GNF B;  1NM7 A;  2RMO A;  3JB9 F;  5KYY B;  2DZC A;  1VQ5 A;  2PTK A;  4FYW B;  2O4X A;  1F1B B;  4QQG A;  2DIG A;  4J6X A;  4HCB A;  2YUQ A;  1YN8 A;  2DYB A;  3FIF A;  1ABQ A;  2CUB A;  2DIL A;  2E65 A;  2A37 A;  3M0T A;  4DBQ A;  4R55 A;  3C94 A;  4E2F B;  2HCK A;  1ZUK A;  1VQN T;  1VYT A;  2YUO A;  2CZ1 B;  3QWY A;  4OB3 B;  4BDZ A;  4DQ2 A;  1SHG A;  4J7F A;  3EHQ A;  2RH2 A;  5CR2 A;  1GFD A;  1JXO A;  1WX6 A;  2ENM A;  3EFO B;  2M51 A;  3CCS T;  2YUN A;  1VIE A;  2K9G A;  3UT1 A;  4M7D D;  3OYL A;  1WHJ A;  2CP5 A;  1E6H A;  1QCO A;  4BE0 A;  3SWN A;  3NTI A;  3CBP A;  1QVG P;  3NTK A;  1T3S A;  4QVZ A;  2CUD A;  5DM7 R;  3I9Q A;  4RG8 A;  1VQL A;  1TH7 A;  4VUB A;  3CCJ Q;  4LDW A;  1WNL A;  2QXF A;  1P92 A;  1VQ4 A;  2EYY A;  5IT9 E;  2DX1 A;  2LZ6 B;  1RL2 A;  1C1A A;  2GGR A;  2MCN A;  3QDF A;  2E4H A;  2QGG A;  5KYX A;  5GMK i;  1S72 T;  1YIJ A;  3JCM f;  1RAG B;  3HTR A;  2GBQ A;  1G5V A;  3QXE B;  1LVK A;  4J9G A;  4A4E A;  4ME7 A;  3O5Z A;  2EAY A;  3I56 Q;  2LC4 A;  1KSW A;  3OB9 A;  2V1R A;  5GAO q;  1YJ9 T;  2COZ A;  2LVM A;  1IRX A;  1VQ5 Q;  3EFS A;  4FYY B;  1VQK T;  2LQK A;  4HT8 A;  2LCC A;  2J05 A;  1PD0 A;  5GAN j;  3VUB A;  2HNI A;  4LNP A;  2A08 A;  3JCM d;  3BDL A;  4DOV A;  1NPP A;  1X27 A;  2PNI A;  2DRM A;  2EBP A;  3LWI A;  5AYF A;  1WLP B;  4Y91 A;  3BW1 A;  2DD5 A;  1H64 1;  1AHJ B;  3VS2 A;  1U3O A;  4PJJ A;  3QJY A;  1M1F A;  2MYS A;  2YLC A;  1D3B A;  4J9D A;  2XU8 A;  2SEM A;  4PFP A;  3CCM T;  3HPW A;  3EG9 B;  5FRO A;  1JJ2 S;  1D0Z A;  2KMT A;  2DJQ A;  1OPK A;  3TSW A;  2DMO A;  4LD9 K;  5CQY A;  2ZPH B;  1JU5 C;  1Q81 R;  1U1T A;  2NWM A;  2OJ2 A;  1NJI C;  4BY6 C;  4OP0 A;  3A8H B;  2EGC A;  2NUP B;  2RJD A;  3SD4 A;  1VQL Q;  1ZSZ B;  5GAO p;  2EFI A;  1VQ8 Q;  5LJ3 f;  3UDC A;  1WZO A;  2OAU A;  2ED0 A;  3RES A;  2KK4 A;  1FX7 A;  3HKS A;  4XAX B;  3M56 A;  3OYF A;  3OYN A;  1VQN A;  1LNX A;  2V8K A;  3REB B;  4JLI A;  5I21 A;  4OMP A;  2M0Y A;  1GRI A;  4M7D F;  2VYT A;  2GFU A;  2CKK A;  2HZY A;  4M7D A;  4KUD K;  1U1S A;  3CCS A;  3G1J A;  1UJ0 A;  1WHH A;  1KQ1 A;  1R8O B;  2ZZD A;  5LJ3 d;  2AKK A;  2RO0 A;  3JCM Q;  5GAO m;  1YCY A;  2EWN A;  4N4I A;  4F17 A;  3RKX A;  1K9A A;  3KFV A;  1H3Z A;  2JS0 A;  4OMM A;  2LP5 A;  4M7A C;  1H92 A;  4PLL A;  4O6J A;  4AFS C;  2PZ1 A;  4J6Y A;  4M7A E;  3FLG A;  4XTX A;  1HD3 A;  1TS9 A;  4EDU A;  5LJ5 h;  1RLQ C;  2AZS A;  3G71 A;  3A8M B;  1KIK A;  2J6O A;  1RAH B;  1K9M C;  1B7T A;  2GTO A;  1NG2 A;  1S72 A;  4OMQ A;  5CKF A;  2HSP A;  5LJ5 e;  2D1X A;  3L2U A;  1VQP T;  1Y7X A;  1SG5 A;  1YJ9 A;  5KYW B;  5GAN 6;  2X3X D;  2JTF A;  3TCJ A;  1VQK A;  3EAE A;  2F1L A;  3X26 B;  1W2B S;  4MZP A;  1VQ7 T;  1SKU B;  2KXC A;  3N5B B;  4JJN K;  4DBF A;  2EPD A;  4DBR A;  4HXJ A;  1XJW B;  3I35 A;  3HFN A;  1K8A U;  1EX4 A;  2D0Q B;  2JUF A;  4M78 D;  1UUE A;  2HDA A;  4RTV A;  2LDM A;  1HJD A;  2E10 A;  2VWF A;  1VQN Q;  4M7A D;  1MV0 B;  3VS7 A;  4XU0 A;  3JCM g;  4RUG A;  3JSC A;  2BZY A;  2EJF A;  1M5Q 1;  3ZFJ A;  5LJ5 j;  3RNJ A;  1M2V A;  2ZPF B;  1BB9 A;  3CCS Q;  2BZ8 A;  2ZPE B;  3CCM A;  1X69 A;  2Y4Y A;  4JS5 A;  4ZTF A;  4NOY A;  4XU2 A;  4BI3 A;  4A4K A;  4XU1 A;  2MF2 A;  1CKB A;  2A0F B;  2KDS A;  2P0Q A;  1RI9 A;  1R0B G;  1C6V X;  1Y96 A;  3VS4 A;  3VRZ A;  3M0S A;  2HQH A;  2KXD A;  4JDS A;  4RKU E;  2MPX C;  5I22 A;  5A0G A;  2F2V A;  2RK2 A;  3VS6 A;  4HCC A;  1AWW A;  2PQW A;  2RD1 A;  5LL6 S;  1QQJ A;  1YCS B;  4J9E A;  4C0Z A;  2W0Z A;  4BE1 A;  1AVZ C;  1V76 A;  1S72 Q;  1WPY A;  3I55 T;  1RI0 A;  4PKC C;  2K79 A;  2QTX A;  2RJF A;  1NEG A;  2AHJ B;  5M9O A;  4IUQ A;  1M90 C;  2OI3 A;  3X25 B;  2OTJ T;  1YJ9 Q;  2MWO A;  4F7U E;  4K11 A;  4A4G A;  1OU8 A;  2EW3 A;  2J7I A;  4KGZ B;  1VQK Q;  2LCL A;  1Y07 A;  4RTU A;  1B3Q A;  1MMD A;  5A0L A;  1JBM A;  2B8A A;  4BY6 B;  4JJD A;  4XTU A;  5J26 A;  1QKW A;  1QVG A;  4IUU A;  4JLG A;  4DEX A;  5LJ3 g;  2JTE A;  5EG2 A;  3MO8 A;  1YBY A;  2DD4 A;  3QJ6 A;  4LN2 A;  4F04 B;  2LRQ A;  1Z9Q A;  2E5K A;  1VQP A;  4PJO D;  1W6X A;  1RAA B;  3GP8 A;  2DKG A;  3CCM Q;  2BKD N;  2NYS A;  2DL5 A;  2H8H A;  2DRK A;  2K3B A;  2E6Z A;  2GF7 A;  3KUF A;  1VQ7 A;  5KE3 A;  4NS5 A;  3VKI A;  1I4K 1;  1M8V A;  4MZT A;  3RBB B;  4AG2 C;  2LQ8 A;  4M78 F;  2CH4 W;  4RMO A;  4M7A B;  2FZC B;  5KYN A;  1KD1 C;  3CPW P;  4M7A F;  1BBZ A;  3SB2 A;  2DNU A;  2I2L A;  2LJ3 A;  3OSS C;  4J6W A;  4EMG A;  1KHI A;  1Y0M A;  4M77 D;  1VA7 A;  3QUI A;  4M78 G;  2DXU A;  3EGD A;  3CMA T;  4PLI A;  4B6M A;  2IG0 A;  2ECZ A;  2FZK B;  1QW1 A;  1G3S A;  4M7A G;  5GJW B;  2KY9 A;  1U06 A;  3THK A;  2KT1 A;  7AT1 B;  2DK3 A;  2DPP B;  3SWN C;  1WYX A;  1KQ2 A;  3VS5 A;  5IHN A;  3BFM A;  3REA B;  2DLP A;  5I11 A;  1NBE B;  2VAS A;  1NYF A;  1GXI E;  2DF6 A;  3P8B B;  1PKS A;  5HCK A;  3DB4 A;  9ATC B;  3RER A;  3SEM A;  1K73 C;  5FRM A;  1WJS A;  1GBQ A;  3H8Z A;  2GTJ A;  5D7U A;  3I55 A;  1M30 A;  2DE0 X;  4Z8A A;  3VJP A;  3HRS A;  1VQP Q;  2NUZ A;  2DL8 A;  1I5L A;  3OYC A;  3OYE A;  2PVO B;  3A5Z B;  4X9C A;  5GAN 8;  1UHC A;  1OV3 A;  1Q7Y C;  3QWX X;  1SF9 A;  1VQ7 Q;  1WJR A;  3CEY A;  3G4S T;  4KT0 E;  3SFM A;  2XDD A;  3EGX A;  2WSC E;  1VQM T;  1ACM B;  4OMN A;  4Z89 A;  1PRL C;  3M53 A;  4LUD A;  4HVU A;  3V7C A;  1E6G A;  4CC4 B;  3HFO A;  3LX7 A;  4C0G A;  4PFO A;  3LWH A;  2KYM A;  2BE9 B;  4ZGD B;  4FYV B;  2JMC A;  3FEO A;  3CPF A;  3E19 A;  1PKT A;  2ZPB B;  4PJO A;  5GAN 5;  5CCA A;  1N27 A;  1VQ4 T;  3O8V A;  3OYK A;  5GAM j;  1G3W A;  4RTT A;  4MMK A;  4E7K A;  1SPK A;  4F7U B;  5CKH A;  1AWJ A;  2EYW A;  1YIJ T;  2YDL A;  3UF4 A;  2QEX T;  2DFU A;  1T3L A;  4J83 A;  3JCM J;  1ARK A;  4JJB A;  1GL5 A;  1TUG B;  3CME T;  2L2P A;  5FU7 C;  1NJI R;  1ZLM A;  4HCK A;  3CC2 T;  1AEY A;  3RUX A;  4M77 F;  4M77 A;  1YNZ A;  3TRE A;  4IUV A;  2BUD A;  1N8R C;  1MMN A;  1MUZ A;  2DXC A;  1PM3 A;  1HXD A;  3A98 A;  4RTW A;  3I55 Q;  1NJI U;  3GLX A;  4D6W A;  2O31 A;  2EIF A;  2FL7 A;  4Q5W A;  4KGX B;  6AT1 B;  4A63 B;  3CMA A;  4M7D C;  1T0H A;  3PFS A;  2HKQ B;  2PU9 B;  2QAS A;  2OTJ Q;  4M7D E;  3V8K A;  4CC7 A;  5HK3 A;  5AT1 B;  1ZBJ A;  4E6R A;  4M75 A;  3OSV A;  4GBQ A;  2JVV A;  4JS4 A;  1VQ9 A;  5HKC A;  1SSH A;  4FIB A;  2RQU A;  4NL2 A;  5FRN A;  2RI5 A;  4OB1 B;  2ED1 A;  2RM4 A;  1U8R A;  2O4X B;  4FW2 A;  2DVJ A;  1UEB A;  5CKE A;  4PJN A;  2C06 A;  2MIO A;  4XTV A;  3NGP A;  4AFZ C;  2YHT A;  1RAE B;  2HQE A;  3FB9 A;  3A8L B;  3OYH A;  1K9M R;  3PE0 A;  5GMK l;  4A4H A;  2RQW A;  2HSE B; 
#chains in the Genus database with same CATH homology
 5GAN 4;  2VGM A;  5GAO p;  4LDV A;  4KUI A;  5GAM e;  4QW2 A;  3ZBD A;  2EFI A;  3CCV T;  5LJ3 f;  2E64 A;  4C92 C;  2Y4X A;  3JB9 G;  4C8Q C;  3UDC A;  2MMP A;  2OAU A;  4OGE A;  4HA8 A;  2LX9 A;  3RES A;  4QQ6 A;  2KK4 A;  3LW5 E;  1FX7 A;  3HKS A;  4XAX B;  3M56 A;  4C92 E;  3OYF A;  5GMK j;  3R6O A;  4C8Q E;  2QQB A;  3OYN A;  3GPL A;  1VQN A;  2XI9 A;  1LNX A;  3V8L A;  2V8K A;  1K9M U;  4JLI A;  3DLM A;  5I21 A;  4X9D A;  4M7D F;  2VYT A;  3G4S A;  4BI8 B;  2GFU A;  4E7L A;  2CKK A;  2QQ9 A;  4O5V A;  3SDZ A;  2E70 A;  5GAN h;  3L2V A;  4KUD K;  4M7D A;  3E9G A;  1U1S A;  3LWI A;  4XTW A;  3CPW S;  5LJ5 d;  3CCS A;  1VQM A;  3SWN B;  3OW2 S;  3J80 E;  1KQ1 A;  1Q86 C;  1R8O B;  2ZZD A;  3OYJ A;  3CC4 A;  1NE8 A;  2P4T A;  5LJ3 d;  2RO0 A;  3ZEH A;  3JCM Q;  1KQS S;  5GAO m;  1YIT T;  2DIQ A;  4B9X A;  1YCY A;  2EWN A;  1YIT A;  4N4I A;  4ZGE B;  4PJO B;  3RKX A;  4BUG A;  3M57 A;  4L6V 5;  5GAN e;  1H3Z A;  2X4Y A;  4M7A C;  2DZ9 A;  4PLL A;  4PJO F;  3MHX A;  1I8F A;  4CRI A;  4O6J A;  3JRZ A;  2PVG B;  2DTO A;  4J6Y A;  4EMK B;  3OYA A;  4TVR A;  3L2Q A;  1YJN T;  3FLG A;  4XTX A;  1Q81 C;  4M7A E;  1OYX A;  4EDU A;  4B9W A;  3MEA A;  3UWN A;  3FJP A;  5LJ5 h;  1JJ2 A;  1BI0 A;  2A7Y A;  3G71 T;  3ER0 A;  2LTO A;  3A8M B;  3PMI A;  4XTY A;  4J7I A;  3G71 A;  1K9M C;  3J7A F;  4Y28 E;  4E7J A;  4HCZ A;  3JB9 I;  5GAO r;  3CCE T;  2K5I A;  3KXT A;  5LJ3 h;  4CI0 C;  2CYZ B;  3RMS A;  2XDB A;  4XU3 A;  2QEX A;  1S72 A;  5CKF A;  4OF1 A;  3CC7 T;  4QQD A;  1YHQ A;  5HK0 A;  2G3R A;  4XQ3 A;  3JCM c;  4C92 F;  4PJO G;  1BIA A;  3QZ5 B;  4BD3 A;  5LJ5 e;  4NL3 A;  3LYI A;  4C8Q F;  3L2U A;  3L2W A;  1VQP T;  4C92 A;  3CME A;  1N6A A;  4C5H A;  2QQS A;  1NZ9 A;  2F5K A;  1Y7X A;  4C8Q A;  4M77 B;  1BYM A;  3HP9 A;  1OZ3 A;  1YJ9 A;  2HAX A;  2RHI A;  3BDU A;  1Y71 A;  5GAN 6;  5LJ3 e;  3CC2 A;  3OY9 A;  2JTF A;  1KC8 U;  3TCJ A;  5IAY A;  1VQK A;  1NPR A;  3EAE A;  2RB6 A;  3PMT A;  4BE2 A;  2JTM A;  3X26 B;  2JNG A;  1W2B S;  4MZP A;  1VQ7 T;  2QQA A;  3N5B B;  1N9S A;  4JJN K;  4JRP A;  3JCM P;  3OYD A;  4A54 A;  1HK9 A;  1MGQ A;  1PSE A;  2XHC A;  2XID A;  5GMK h;  2DTI A;  2RHU A;  4F7U A;  3OS2 A;  2IVW A;  4BDY A;  4OB0 B;  2K2V A;  2RI3 A;  3CPW A;  3HFN A;  3QDR B;  1K8A U;  3OW2 A;  2HQX A;  3QBY A;  4M78 A;  4GLK A;  2F5T X;  2NLU A;  2XDP A;  2R57 A;  3Q1J A;  2JUF A;  2CZ0 B;  2D0Q B;  4M75 B;  4RG2 A;  4IKF A;  4M78 D;  1O9S A;  4V2S A;  2LDM A;  4M7A A;  1D3B B;  1B34 A;  3P8H A;  4M77 G;  3T9N A;  4M75 F;  2YLB A;  1KQS A;  1G3T A;  2E10 A;  4M7A D;  4BAC A;  4ATO A;  1MHN A;  3MEU A;  4XU0 A;  2EQJ A;  2XG8 D;  3JSC A;  2EJF A;  4GY5 A;  3JCM g;  1M5Q 1;  3QPH A;  3ZFJ A;  5LJ5 j;  2ZPF B;  3CCJ T;  3WVE B;  4Z02 A;  2OTL T;  2ZPE B;  4N4G A;  1WGS A;  1VIF A;  4YTL A;  3CCM A;  1KC8 C;  2Y4Y A;  3X28 B;  1VQ6 T;  4KUL A;  3QYG B;  2X35 A;  1WQW A;  2VGN A;  2HD0 A;  4JS5 A;  5GAM g;  4ZTF A;  1QVG S;  2FYK A;  2PUO B;  2FB7 A;  5GAO n;  1YJW T;  4NOY A;  5FU7 B;  1VQO A;  1M90 U;  2P0P A;  4XU2 A;  4BI3 A;  2PUK B;  2K5F A;  4XU1 A;  2MF2 A;  2H3J A;  2KDS A;  2P0Q A;  2VV5 A;  4A4K A;  3OYB A;  3EFR A;  4M75 G;  3OYM A;  2QA4 A;  3L1A A;  4N0A C;  5KCH A;  1Y96 A;  2MI6 A;  4WF2 A;  2DXT A;  4XK8 E;  3JB9 J;  3X20 B;  4BI4 A;  4DOW A;  4JDS A;  2XKO C;  4RKU E;  1V29 B;  5LJ5 f;  3S3N A;  5DY9 A;  5A0G A;  3I56 T;  1X01 A;  2RK2 A;  4HCC A;  3G6E T;  2PQW A;  2RD1 A;  4UC4 A;  5LL6 S;  4MZM A;  4EMH A;  1VQ5 T;  1LJO A;  2WSE E;  1Q81 U;  4OB2 B;  3CCV A;  3G7Z A;  5FU6 C;  2ZPI B;  2EQK A;  4EPC A;  2LT1 A;  2VUB A;  1OI1 A;  3JB9 D;  4M7D B;  1WQ7 A;  2X4J A;  1W2B A;  4E7I A;  4C0Z A;  2A3L A;  5CO7 A;  3JCM b;  3CCL T;  2EJ9 A;  2K4Y A;  4BE1 A;  5CVI A;  1M4Z A;  5GAN g;  2WAC A;  1WPY A;  3I55 T;  3CBM A;  1RI0 A;  4PKC C;  2QTX A;  2RJF A;  5M9O A;  2AHJ B;  2L89 A;  3OYG A;  2K3Y A;  3OQ5 A;  3AHU A;  4IUQ A;  1O75 A;  4MML A;  1M1K C;  1M90 C;  5J39 A;  3X25 B;  2EYQ A;  3WXM B;  3HSB A;  5IN1 A;  3QO3 A;  3C95 A;  2OTJ T;  3JB9 H;  2JZ2 A;  4C5I A;  2L3R A;  2OTJ A;  1XOV A;  2VC8 A;  3PNW C;  2MWO A;  4A4F A;  4C0D C;  4A4G A;  4F7U E;  4M78 C;  3M4Y A;  2PVD B;  3MEV A;  1Q82 U;  2CZ6 B;  2LCL A;  1Y07 A;  4FT2 A;  4M78 E;  2DXB A;  5DLQ E;  3VYG A;  3M4G A;  2E5Q A;  2JOY A;  5A0L A;  3V7S A;  3INZ A;  2DVE A;  4J8O A;  5GAN 2;  1JBM A;  3PT9 A;  5D6Y A;  2B8A A;  3CBO A;  2JN0 A;  5I2S A;  4M7D G;  1XNI A;  1YJN A;  5LJ5 g;  1QVF S;  3A8G B;  3L2R A;  2D9T A;  5CQX A;  2XD0 A;  4BY6 B;  2VXE A;  4XTU A;  2GQV A;  4PL6 A;  2BIV A;  5J26 A;  4HKE A;  1QVG A;  4IUU A;  4JLG A;  4N0A A;  5LJ3 g;  1XQH A;  2FVU A;  3L2Z A;  5EG2 A;  3URG A;  2K3X A;  3MO8 A;  2CZ7 B;  1KD1 U;  3CCE A;  1YBY A;  4QVD A;  2DD4 A;  4PNO A;  5I2M A;  4C92 B;  3QJ6 A;  3KBG A;  2LRQ A;  4C8Q B;  4LD6 A;  2KSS A;  2M1H A;  3CC7 A;  1QP2 A;  2M0O A;  1VQL T;  3MP6 A;  2DEQ A;  1KG1 A;  1VQP A;  2K5L A;  4C5G A;  2GCX A;  3S6W A;  4PJO D;  3GP8 A;  2DKG A;  3CCQ T;  1VQ8 T;  5KH6 A;  2BKD N;  3OMG A;  1QP3 A;  4OVA A;  3HHT B;  1JRI A;  3V7R A;  4ZTJ A;  1Q82 C;  1VQ8 A;  3MP8 A;  3RKY A;  5GMK m;  2D6F A;  2R58 A;  2EKO A;  1VUB A;  3A8O B;  2E6Z A;  2M9U A;  3CCU T;  2GF7 A;  3PIO A;  2V8I A;  1W4S A;  2V8J A;  3CCU A;  3KUF A;  4JRI A;  4X34 A;  1VQ7 A;  5KE3 A;  3QII A;  4NS5 A;  2VXF A;  2M16 A;  3VKI A;  4F7U F;  3PIP A;  1I4K 1;  1M8V A;  3GIB A;  4MZT A;  3LGL A;  2P0K A;  4MDW A;  2LQ8 A;  2CGH A;  1ZHI A;  4M78 F;  1LOJ A;  4C92 G;  4RMO A;  3S3O A;  4C8Q G;  4M7A B;  1B34 B;  3DKM A;  3E9F A;  3OBW A;  3QKJ A;  3H6Z A;  3TEE A;  1BI3 A;  1IRE B;  1KD1 C;  4M7A F;  4JRQ A;  2EQU A;  3OBY A;  3SB2 A;  2MWP A;  2E6N A;  2I2L A;  2RA2 A;  3HRT A;  3NFC A;  3OSS C;  3LH0 A;  3J81 E;  4J6W A;  4EMG A;  1KHI A;  2RHX A;  3ASK A;  3M55 A;  3M9Q A;  4M77 D;  5A2Q E;  5D6W A;  4ELZ C;  3DLL A;  3S3M A;  5CIU A;  2DO3 A;  4P5N A;  1K73 U;  4F7U G;  3QUI A;  5CKB A;  4XTZ A;  2ZGW A;  3GNG A;  3CCJ A;  1QVF A;  4JUV A;  3VUZ A;  4C0F A;  3LGF A;  1BI1 A;  3MET A;  5GAO l;  4KBM B;  1UGR B;  2DXU A;  3GF5 A;  2ZPG B;  4M78 G;  4RCB A;  4PLI A;  3CMA T;  1UGP B;  4A53 A;  2IG0 A;  1VQ6 A;  1UB4 A;  3PTA A;  1QW1 A;  1Y96 B;  1M1K U;  1G3S A;  4M7A G;  2X4W A;  1YJW A;  1M1G A;  2O01 E;  2L8D A;  3HL8 A;  2KY9 A;  5CKD A;  3HRU A;  3MEW A;  4MDX A;  1UGQ B;  2E1H A;  2DK3 A;  4LDY A;  2DPP B;  3SWN C;  2DTH A;  1KQ2 A;  1SSF A;  4II1 A;  2DJZ A;  2ZCF B;  1KHC A;  3BFM A;  5GAN 7;  3GOX A;  1I81 A;  1DJ7 B;  3JCM V;  4R56 A;  2MAM A;  4C5E A;  3CXC S;  3I56 A;  4QVC A;  4BB7 A;  3V8J A;  3M5A A;  5FLX E;  3G6E A;  3LLR A;  1GXI E;  3GNF B;  4PJO C;  3P8B B;  3JB9 F;  2DZC A;  3QZ9 B;  4FSX A;  1VQ5 A;  2R5A A;  3DB4 A;  3C12 A;  2QQR A;  4PJO E;  2O4X A;  3C4S A;  3RKW A;  3RER A;  3OYY A;  4EMK C;  4QQG A;  1K73 C;  5FRM A;  2DIG A;  4J6X A;  1WJS A;  3CD6 T;  2GFA A;  2OTL A;  3JCM e;  3CCL A;  1ZBX A;  3NTH A;  2L5Q A;  4HCB A;  3H8Z A;  3VV0 A;  3I55 A;  3FIF A;  3FRN A;  4OGC A;  3VJP A;  4ZN3 A;  3HRS A;  2RJE A;  2E65 A;  4OMF B;  4ELY C;  4L5G A;  4R55 A;  4FU6 A;  1I5L A;  3C94 A;  3OS1 A;  3DB3 A;  3OYC A;  3OYE A;  2PVO B;  3A5Z B;  4X9C A;  5GAN 8;  1M9S A;  3OS5 A;  1VQN T;  1Q7Y C;  1EIF A;  2CZ1 B;  2RJC A;  1WJR A;  3CEY A;  4OB3 B;  4KT0 E;  4M77 C;  3SFM A;  4DQ2 A;  4J7F A;  3OA6 A;  3G4S T;  4BDZ A;  2RH2 A;  5CR2 A;  2XDD A;  1PSF A;  2EJG A;  3CCS T;  4M77 E;  3TU4 K;  2WSC E;  5GAN 3;  1VIE A;  1VQM T;  3UT1 A;  4FL6 A;  5HY6 A;  3VYH B;  1IZ6 A;  4M7D D;  2RHY A;  5C0M A;  3OYL A;  3MCA B;  2RHZ A;  3CC4 T;  3M53 A;  3V7C A;  4BE0 A;  3QYH B;  3SWN A;  5D6X A;  2R5M A;  1X75 C;  3NTI A;  3HFO A;  3LX7 A;  4C0G A;  3LWH A;  3CBP A;  2HBP A;  2QI2 A;  3NTK A;  5FU6 B;  5DM7 R;  4QVZ A;  4ZGD B;  4RCC A;  3FEO A;  3CPF A;  3E19 A;  4RG8 A;  2ZPB B;  4PJO A;  4M75 C;  5GAN 5;  1N8R U;  5CCA A;  3UPU A;  1TH7 A;  1VQL A;  4VUB A;  4LDW A;  1WNL A;  2F69 A;  4J5Y A;  4IUP A;  4M75 E;  3CXC A;  1N27 A;  1VQ4 T;  3O8V A;  3OYK A;  2QXF A;  1P92 A;  1G3W A;  5GAM j;  3PGG A;  4EMK A;  3CCQ A;  1VQ4 A;  5IT9 E;  2WSF E;  1FWZ A;  3OMC A;  4MMK A;  4E7K A;  1RL2 A;  3BY7 A;  2YRV A;  4IUT A;  4F7U B;  3JCM W;  5KCO A;  5CKH A;  2LNV A;  1YIJ T;  5GMK i;  2QEX T;  1S72 T;  1YIJ A;  3JCM f;  2E12 A;  1YHQ T;  4C0D B;  3OS0 A;  4M78 B;  4J83 A;  3QXE B;  1G5V A;  3JCM J;  3CME T;  1JB0 E;  3M59 A;  4A4E A;  1XTD A;  4ME7 A;  4L59 A;  5FU7 C;  2EAY A;  2LC4 A;  2Y90 A;  3OB9 A;  2KVQ G;  5L8R E;  5GAO q;  4E7H A;  3RIR A;  2LVM A;  4C92 D;  1YJ9 T;  5GAM f;  4FM4 B;  3CC2 T;  3RUX A;  4C8Q D;  3QG1 A;  4M77 F;  4FT4 A;  2CS7 A;  3P8D A;  3EFS A;  1VQK T;  2LQK A;  4M77 A;  4HT8 A;  2QDY B;  2KAF A;  2LCC A;  1ZQ1 A;  3M58 A;  4IUV A;  1FXX A;  3TRE A;  2BUD A;  5CAI A;  5GAN j;  1N8R C;  2DXC A;  3VUB A;  1HXD A;  2HNI A;  2K57 A;  1X6O A;  5CK9 A;  1UGS B;  3JCM d;  3RMQ A;  4IUR A;  3JCM X;  3BDL A;  4DOV A;  1NPP A;  1NJI U;  3GLX A;  2XIC A;  4D6W A;  3ME9 A;  2EIF A;  2FL7 A;  1WJQ A;  2LT4 A;  4LDU A;  4Q5W A;  5AYF A;  3VU3 C;  3FDR A;  4DA4 A;  4Y91 A;  1QVP A;  3BW1 A;  3CMA A;  4M7D C;  3PFS A;  2DAQ A;  1BI2 A;  2PU9 B;  2DD5 A;  5GAM d;  1H64 1;  3OYI A;  1AHJ B;  4M7D E;  2X4X A;  3V8K A;  5HK3 A;  2EQM A;  3QHS A;  3QJY A;  1M1F A;  3OSV A;  4M75 A;  5GMK e;  5GAN f;  3F70 A;  2JVV A;  2RK1 A;  1VQ9 T;  2YLC A;  4JS4 A;  1D3B A;  1VQ9 A;  2XU8 A;  3CCR T;  4M75 D;  4LDX A;  5HKC A;  3CCR A;  4N4H A;  3WVD B;  1Q7Y U;  4FIB A;  4NL2 A;  5FRN A;  3QSU A;  3JCM h;  2RI5 A;  4OB1 B;  3FC3 A;  4E47 A;  2RM4 A;  3CCM T;  1YI2 T;  1U8R A;  3HPW A;  5FRO A;  2O4X B;  5J3B A;  2E41 A;  5KE2 A;  5DLO A;  1YI2 A;  1JJ2 S;  5C6S A;  1UEB A;  2KMT A;  5LJ3 j;  5CKE A;  1BIB A;  1BKB A;  1VQO T;  3E1S A;  2RI2 A;  5A0D A;  1N9R A;  1G3Y A;  2C06 A;  4XTV A;  3JAM E;  4LD9 K;  2QA4 T;  5CQY A;  5GAM h;  2ZPH B;  1Q86 U;  3L42 A;  1U1T A;  2KQW A;  4ZN1 A;  1NJI C;  2YHT A;  3CD6 A;  2FHD A;  2XK0 A;  4HT9 A;  1OZ2 A;  4BY6 C;  5GAN d;  1K8A C;  4JRK A;  2HQE A;  4OP0 A;  3A8H B;  3FB9 A;  3A8L B;  3X24 B;  3OYH A;  5GMK l;  2RJD A;  3SD4 A;  4A4H A;  3MP1 A;  3M54 A;  4ZGJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...