4M78C

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78C00
4NL2A 1N9SA 1HK9A 5GAMf 3RKXA 4EMKC 5GAOm 5LJ3h 1Y96A 4J6XA 2RB6A 1B34A 4RCCA 5GANd 2JN0A 3QUIA 4M78D 4M77F 4C92B 4M7AF 4M78C 5CAIA 1YCYA 4C92E 5LJ3e 4M75G 4M75A 4C8QB 5LJ5f 3JCMJ 1JBMA 3INZA 5LJ3g 2FYKA 3QO3A 4C8QE 4M7DB 1MGQA 4Y91A 2E65A 5DY9A 5GAMd 4M7DE 4J6WA 4C92F 1Y96B 1U1TA 4PJOD 4M77C 5GMKi 4M7AC 2DTIA 2VC8A 4M78A 4JUVA 4PJOC 2DVEA 3BDUA 1WPYA 2DXTA 4M75B 4XTXA 5GAOq 3JCMc 3JCMP 4M75E 3V8KA 3JB9F 3RIRA 2DJZA 1M8VA 4XTWA 2EWNA 1I81A 4N0AA 4HT8A 2VXFA 5GAN4 3JCMQ 3BW1A 2EJFA 3RKYA 3GIBA 3SWNB 2DXUA 4XTZA 4PJOG 4PJOA 1JRIA 4XU2A 3BFMA 1H641 3FB9A 4XTYA 4A53A 1KQ2A 4V2SA 4F7UB 3VU3C 3PGGA 3RUXA 3QSUA 4F7UE 4HA8A 5GAN6 2DTOA 4EMKA 2E1HA 5GAOr 3EFSA 4M77D 4M7AD 1B34B 4NL3A 1U1SA 1I8FA 4C8QF 2E64A 4QVDA 4M78G 2RD1A 4PJOB 4F7UF 5GAMh 4PJOE 4M7DF 2YLCA 5LJ5j 2YHTA 1HXDA 2EAYA 5GMKj 5GAOl 3RERA 4C92D 5GAMe 4EMKB 4MMKA 4C92C 3JCMX 5GAOn 3FIFA 3JCMh 5GMKl 5LJ5h 4XTVA 5GANj 5LJ3f 4M77G 4M77A 3EFRA 4J5YA 3HFOA 3RKWA 4M75F 4A54A 4C8QC 5GMKh 4M7AA 4M7AG 4M78B 3L2ZA 4F7UA 3M4GA 2RM4A 2QTXA 2FB7A 2YLBA 3JCMW 4M78E 1WQWA 4J6YA 3JCMe 5LJ5e 3JB9D 4JRIA 2HNIA 5GANh 2ZGWA 4MMLA 1BIAA 4NOYA 5GMKe 2DEQA 3JCMg 3JCMV 4PNOA 3V8JA 4EMGA 5LJ5g 5GAN2 3JB9J 4M7DA 4XU1A 3V7RA 4C92A 5GAMj 2E41A 1WNLA 3JB9I 4OP0A 2DZCA 4M78F 1D3BA 3L1AA 2EJGA 5LJ3d 4RCBA 3SB2A 4M77B 5GANe 1N9RA 4M7AB 1I4K1 4QVCA 5GANg 4M7DC 2VXEA 4M77E 3BY7A 4M7AE 4HT9A 3V7CA 3HSBA 1KQ1A 3HFNA 1LOJA 3JB9G 4EMHA 2RA2A 3FJPA 2DKGA 4XQ3A 3SWNC 4JLIA 2DTHA 4DQ2A 5GMKm 1LNXA 5I21A 3V8LA 1M5Q1 4PJOF 4F7UG 4C8QD 1D3BB 5GAMg 3JCMf 1TH7A 5GAN5 1I5LA 2I2LA 3JCMb 4M7DD 1BIBA 5GAOp 4WF2A 5GAN7 3QHSA 3JB9H 4N0AC 4M7DG 1LJOA 4XU3A 5GANf 5GAN3 2DZ9A 3SWNA 2Y90A 4XU0A 5GAN8 4XTUA 4C92G 4M75D 4JRKA 2K57A 4X9CA 2E10A 3AHUA 5LJ3j 4X9DA 4C8QA 4C8QG 4M75C 5LJ5d 3JCMd 2CGHA 1X01A 3V7SA 2EJ9A 1WQ7A 3RESA
chains in the Genus database with same CATH superfamily
2NYSA 2GTJA 3H0FA 2PVOB 1K8AR 1O9SA 4FCYA 4M7AF 3VS2A 2C0TA 3OYJA 2CSQA 1G8XA 3C94A 2V1QA 2LC4A 3I56Q 1OU8A 1UTIA 2YUPA 1Z9ZA 2EQUA 2GQVA 4ELZC 1QWFA 3CPWS 1W6XA 2MWOA 2DVJA 2M51A 2ROTA 2EGEA 2CSIA 4LD6A 4MZPA 4M4ZA 3E9GA 3VS3A 1FMWA 2NUPA 4XTZA 1YJ9A 2ZPIB 2JOYA 1H641 1KIKA 1W1FA 3REAB 2EYWA 3OYYA 1UFFA 2DETA 2LJ3A 5KYYB 4C0GA 4M7AD 3QKJA 4BDZA 1JJ2S 2LQWA 2L2PA 2YLCA 1EIFA 1HSQA 5IXFA 2M0YA 4CRIA 2X3XD 3WVEB 4DEYA 2MMPA 2EYYA 3UATA 3QG1A 2MYSA 2QTXA 1X2QA 2HBWA 5GMKe 3CC7A 2VVKA 3EFOB 4FU6A 1D3BA 2F69A 2ROLA 5CQYA 5CKHA 2DJQA 2P0KA 1N8RU 3QYHB 2EPDA 5I21A 2QGGA 2DL7A 2YUQA 5EG2A 4HXJA 3VUBA 3JCMb 2V8IA 2L8DA 2J05A 2JNGA 3JB9H 3CCMT 5FWCA 2EYZA 2DZ9A 3UA7A 4EDUA 5GJVB 3CMAA 3QJ6A 1YFNA 1B07A 1PM3A 3LH5A 4JJDA 3RKXA 1MUZA 2CZ1B 8AT1B 2KI7A 1YP5A 4M78C 1YCYA 2VB6A 1S72T 1M1GA 1Q81U 3OY9A 2QASA 5CIUA 3M55A 2GBQA 4HCKA 2DD4A 4JUVA 3E2UA 1VQ4A 2QEXA 5FRNA 2VGMA 2WSFE 3CCLA 2XU8A 3CCJA 2QTVA 3VJPA 2QGFB 5DLQE 3RKYA 1XQHA 1UHFA 4ESRA 3VYHB 2YDLA 4C5EA 4HVWA 2LX7A 3VU3C 3RUXA 2VV5A 3QSUA 2DTOA 1YJ9Q 1VQ7T 3HPWA 2K9GA 4BD3A 2DRMA 2E3IA 2X3WD 2NUPB 2BIVA 4XK8E 4FL6A 5KYUB 3L2QA 1Q81R 2PUOB 5GAMe 3H9NA 2DM1A 4C92C 3JCMX 1PSEA 3HFOA 5CKFA 3GBQA 1M4ZA 1M9SA 3JCMe 3VS5A 3L2UA 1OZ3A 3JCMg 3V8JA 4QQGA 1HYOA 4XU1A 1TUDA 2O4XA 1KQSP 3CCSA 4Z02A 3CC7Q 2IG0A 2O9VA 3E19A 4RTTA 3CXCA 2CUDA 5IXBA 1ACMB 2PNIA 4N4HA 1NEBA 3LW5E 4CC2A 4XQ3A 3CCEA 1TWBA 4Y28E 1D3BB 1ZUKA 3CCQT 3A8LB 1W2BA 3NTIA 2W10A 2F1LA 1MNEA 3S6WA 2E6NA 2CP5A 1QCOA 5LJ3j 2ZCFB 2SRCA 2Z0WA 1HK9A 4C0ZA 3GLXA 2D8HA 1G83A 1LCKA 1EFNA 4L5GA 2M1HA 3CC4A 3DB4A 5AYFA 1UG1A 4J8OA 2HQXA 2CS7A 5CKEA 1OPLA 5GMKi 2K2MA 2MI6A 5HKCA 4JRQA 1WHHA 2F2VA 3P8HA 2RQRA 1KQSS 1KJWA 2PQWA 2RJCA 2HDAA 1X27A 2EKOA 2KAFA 1YITT 1P92A 1VQ4Q 2QA4T 5M9OA 4XTYA 3CCLQ 3CCJQ 1KQ2A 1QVFP 2LQNA 5FWBA 2PVDB 1VQ6A 2ZAEA 4F7UE 4J9DA 4QKUA 1C1AA 2DXBA 3HTRA 4PL6A 3OB9A 5KH6A 3MO8A 1YI2T 3G4ST 2PZ1A 3FEOA 2YHTA 1YBYA 2JXBA 5GAOl 4KGZB 1IGUA 4LDUA 2P4TA 4OB2B 2P84A 4MMKA 5GMKl 1NEGA 4XTVA 3CCVA 5GANj 2OX7A 1X6BA 1SHFA 2O9SA 2DD5A 5J26A 3HRSA 4M78B 4LUDA 3VS7A 2EYQA 5KYNA 5LJ5e 4C5GA 2VYTA 3JCMV 5LJ5g 4E2FB 4GLMA 2XD0A 2KRMA 1MNDA 3OYMA 2MIOA 3CMET 1LOJA 1UGRB 3CCSQ 2DKGA 1AEYA 2O4XB 4OMQA 2QDLA 2DF6A 2C06A 4O5VA 3JCMf 2FRWA 3RR6A 4LDVA 1K9MC 3CCEQ 2YSQA 3UT1A 3FJ5A 2Y90A 2EIFA 3EGDA 4FSSA 2WACA 1JEGA 4A4GA 1N9SA 4B6MA 2CZ7B 1WZOA 4LN2A 4C92B 2DL3A 4A4FA 1NZ9A 2EQIA 4ZTFA 1RAAB 4KBMB 5CVIA 4QQ6A 1Q7YC 3CC4Q 2KRNA 1NE8A 5J39A 4M77C 4NS5A 1M3BA 1ZA2B 3GP8A 1BI0A 1WHKA 4FT4A 2A3LA 4RUGA 3OYAA 2VASA 3OYBA 1LVKA 1N5ZA 1X2KA 5CO7A 2DL8A 3ZFJA 1XOVA 1B34B 5C0MA 3ER0A 4PJLA 1VQ6Q 3LX7A 2EW3A 2JW4A 1ZA1B 2YRDA 1S1NA 2EVRA 4DBFA 1GFDA 1VQLT 1KD1C 5LJ3f 1IRXA 4AG1C 4M77A 2NUTA 2KXCA 2GTOA 3S3OA 1YJWA 1WHJA 3MP8A 5GAN2 3C95A 4RCBA 3H41A 3QWXX 3BY7A 1BB9A 4DQ2A 1VQNT 4ZGDB 1R77A 1VQ5T 4F14A 2ECZA 4D8KA 3A98A 5GAN7 2L5QA 1VQPT 2QXFA 5KYXA 5IT9E 2XK0A 4QQDA 1MMNA 4E47A 3M57A 4XTUA 3DKMA 4JDSA 3TCJA 1IB8A 2RK1A 1JXOA 2Y4XA 3OW2S 2H8HA 4OMPA 2CP0A 3V7SA 5A0LA 3GOXA 4IUPA 2NUZA 5D7UA 2C0IA 4C0DB 1UHCA 1X69A 4RTVA 3EGDB 1WFWA 1OQKA 1NJIC 3SHWA 5HK0A 2BZ8A 1K9MU 1R8OB 2E65A 5DY9A 5GAMd 1M27C 3QXEB 3META 2DTIA 4JLGA 2BZXA 2KT8A 1PD1A 3RBBB 4E7LA 1SPKA 3GNGA 1YHQA 2ENMA 1WJRA 1FMKA 4J9EA 3M0QA 3DLMA 2DIGA 2J06A 4LDWA 3OQ5A 1UUEA 1K0XA 1I8FA 2RD1A 2YXYA 2COYA 4HKEA 1Y57A 1K9MR 2FZKB 3SEMA 3I55A 3H0HA 4M7AG 4A54A 2K2VA 4LNPA 1G3WA 1VIEA 2ED1A 3VKIA 2QAZA 2DBMA 1OX9A 4NOYA 3HHTB 1I1JA 3G71T 1BKBA 1IREB 2RI5A 2P0QA 2D1XA 1N9RA 3QDRB 4M77B 5A2QE 1YJWQ 4M7AE 4HT9A 3H6ZA 2VGNA 3CXCP 4PLLA 1TOVA 4JLIA 2G6FX 3LH0A 3R6NA 1JQQA 4CC4B 2XMFA 3SFMA 1VQMT 4EPCA 1V29B 3TQ7P 1KD1U 2YRVA 2XICA 2QQRA 1XTDA 1QVGS 3VS6A 3AHUA 4RTXA 4C5HA 4LUEA 2D0QB 2X35A 1UGSB 2XDDA 3CCRT 2QQ9A 2JMCA 2PTKA 4PLIA 5GAOm 1AWXA 3QZ5B 5KYXB 5IAYA 2M0OA 3G6ET 4X1VA 5AT1B 4AMCA 1F1BB 4RTYA 2HSPA 2K5IA 3INZA 4A63B 4HCBA 2GQIA 4J7IA 4E7ZA 1U1TA 4JRPA 3CBPA 2WSCE 4D8DA 5HY6A 4BI4A 1WIEA 4HVVA 3EHQA 1KD1R 5C6SA 1WPYA 1TUGB 3NHNA 4XTXA 4E7JA 5FU7C 1BI2A 2RHXA 1ABOA 1MMDA 2AKKA 1VOMA 1I0CA 1NJIU 3FB9A 3DB3A 2YUNA 1X6OA 4C0FA 1UJ0A 1YHQQ 2E6ZA 1AZEA 1CSKA 2VUBA 1U1SA 1RLQC 2DL4A 3CCMA 5GMKj 2K6DA 2RMOA 4GBQA 3EGXB 2RK2A 1OYXA 3M59A 2K3XA 2CKKA 3M4GA 4M7DC 1D1CA 1SRMA 4OB3B 3I55Q 4IUUA 4L59A 1Y71A 2RJFA 1WNLA 2DZCA 1BBZA 2CREA 1ZBXA 4RTWA 2LNVA 2G3RA 1NJIR 3U23A 1OPKA 1AD5A 3OYLA 2RA2A 3FJPA 1UB4A 2LCSA 3M0RA 4N4IA 3V8LA 1M5Q1 2OAWA 1C6VX 5CKDA 4ZGJB 3FRNA 2KSSA 1QVPA 4FM4B 4FYXB 4XU0A 2X4WA 3MKDA 1K1ZA 2LMJA 1KK7A 3CEYA 1SSHA 4F7UA 4M7DA 2R5AA 2K3YA 3OYFA 2M9UA 3A1PA 2QK0A 4M77F 2GFAA 4ELYC 2K79A 1X43A 1ZQ1A 2ZPGB 1Y07A 2LCLA 3OYEA 3CC2A 2MK5A 2QQAA 1TG0A 3BDLA 4BE1A 2J6KA 3URGA 3EH2A 2JTFA 3JV3A 1ZUYA 3FDRA 2BZYA 1JRIA 1PHTA 1RADB 2XG8D 5KCHA 2EKHA 3VS0A 4FYWB 1T0JA 4ZGEB 2DXCA 3ZL7C 4M77D 3CCQA 4A4EA 1N8RR 5FROA 1M8MA 4DOWA 2BE9B 1W70A 2MF2A 2D0NA 2EAYA 1VYUA 2EBPA 3LLRA 3RERA 5CQXA 3MPUB 5A0DA 3RNJA 1VA7A 4DEXA 3CCMQ 4C8QC 3Q1JA 2HBPA 2CP3A 2FB7A 2AZVA 1VQKT 5EC7A 1BIAA 2HCKA 4KT0E 1WYXA 2KBTA 1YJNT 3PVQA 1GRIA 2JZ2A 1V76A 2OTJT 3ASKA 4ANJA 4VUBA 2HQEA 3LWHA 2KT1A 1YWPA 3CPFA 2LQKA 5FU7B 3CC7T 1LNXA 2RQVA 2XIDA 5GAMg 3P8BB 1MHNA 1SKUB 2DILA 3VYGA 2K7AA 1CKBA 3QYGB 3MJXA 2JVVA 1LJOA 1YITA 2CUBA 4XU3A 2QA4A 3HL8A 2C0OA 2RI2A 2X4YA 2K57A 4X9CA 4E6RA 1XNIA 3OSSC 4C8QA 1RLPC 4JRIA 2JM8A 2L3QA 3A8HB 5LJ3h 1YI2A 3C4SA 3L2RA 3G4SA 1X75C 1ZSGA 2CP6A 4KUIA 1DJ7B 4BI8B 1VQ7Q 3CMAT 4M75A 4PFPA 4RTUA 2LVMA 3M56A 4M7DB 2BUDA 2EYXA 3GF5A 2D8JA 4J7FA 1VQOA 2A37A 2HZYA 1KC8C 3BDUA 2KEAA 3M9QA 4PFOA 3CC2Q 1I81A 2JS0A 5GAN4 3JCMQ 2V8JA 4J9FA 4F17A 2IPOB 4RG8A 3S3NA 3CMEA 1O75A 4V2SA 1G2BA 2K4YA 1IZ6A 1VQ4T 3L2WA 2QEXT 2ZPBB 2CZ6B 4KULA 3WVDB 1WX6A 4AFZC 2J7IA 1FMVA 3KFVA 4XAXB 4OB1B 1FYNA 5LJ5j 3J81E 1WDXA 3CCQQ 5D6YA 4KH0B 2KXDA 2M02A 3ZEHA 2BTTA 4FYYB 4O6JA 1JJ2A 1WQWA 5GANh 2JM9A 4J9HA 2YWWA 4AG2C 4MDXA 1AVZC 1MV0B 1WJSA 3R6OA 3QPHA 4AFQC 3LWIA 1Q95G 1QQJA 3OS2A 4MZMA 5KYWA 2BE7D 1QP3A 3EHRA 2CP2A 3OYIA 5I22A 4WCIA 4C0DC 3CBMA 3QDFA 4AFSC 5I2SA 5GAOp 3EG2A 3OMGA 2K3BA 2LT4A 4X34A 3SWNA 1YNZA 1ZUUA 2QG9B 4JRKA 2E70A 3VS1A 2FEIA 1YITQ 1UGPB 4IUVA 3M5AA 1Y7XA 2QA4Q 5GAMf 4BACA 3C0CA 1M90C 4RCCA 4PKCC 4QW2A 2RNAA 4JS5A 2DK3A 3PNWC 4C8QB 1JBMA 4BUGA 1YI2Q 2F2WA 2OAUA 3QO3A 2E5KA 3QZ9B 3G4SQ 1PWTA 2LDMA 3S3MA 4J83A 3VRZA 1IGQA 2EFIA 2LTOA 1FXXA 3I9QA 4A4KA 1SG5A 2VC8A 1GXIE 1QVFS 1K76A 2DVEA 3CC4T 4M75B 2DXTA 2X51A 2LJ1A 3JCMc 1VQ8T 2X9HA 3JB9F 3RIRA 4RTZA 1TSFA 3PVLA 1VQOQ 2EJFA 3MCAB 5CR2A 2DL5A 4PJOA 3EH1A 2B86A 3C12A 3CMEQ 1OV3A 1WLPB 2CH4W 3ZBDA 1VQ5A 4NL3A 4Y92A 5IHNA 1PRLC 4M78G 1VIFA 4F7UF 1VQPA 4M7DF 1KC8U 3REBB 4OGCA 1QKXA 4RKUE 2M16A 2LT1A 4MDWA 1ZHIA 3CQTA 5ECAA 3EFRA 4J5YA 3VRYA 3EG9A 5IN1A 3TEEA 3JB9D 4M78E 1J3TA 1K73C 4OB0B 3JB9J 1D0YA 4E7SA 2XDBA 2EJGA 2HSEB 4HVUA 3CCVT 1UE9A 2XHCA 3V7CA 2AZSA 3NGPA 1JXMA 1KQ1A 3HFNA 1OOTA 1K4US 1VQ9T 5GJWB 1N6AA 4ME7A 2DO3A 4R0KA 4M7DD 4UC4A 1BIBA 1KC8R 4WF2A 5KYWB 5FLXE 5HK3A 3L42A 2ED0A 4R55A 1GFCA 1BCOA 4C92G 2F5KA 1RAFB 2HMAA 4X9DA 4BE0A 3CD6A 4J9CA 1M30A 1WHMA 3QWYA 1AWJA 1PNJA 1NM7A 1Y0MA 2ESWA 4C92E 2FVUA 5LJ5f 3JCMJ 1K8AC 2AK5A 3H8ZA 1AWWA 4PJMA 1B7TA 1SHGA 2COWA 3EG0A 3MEAA 4BY6B 5IHKA 3JCMP 3OYDA 4OMFB 3DLLA 4BI3A 4DOVA 3G71A 2AIRB 3I5RA 3SD4A 1OEBA 2MCNA 1M90U 1NYFA 4ZN3A 1M3AA 3OYNA 1E7OA 3BFMA 2V26A 5CCAA 3N5BB 3OMCA 1KQSA 4K11A 3CCUA 3THKA 1ZSZC 2JTEA 2OTLT 1GCQA 4C8QF 1VQNQ 4PJOB 5L8RE 4DBQA 2P0PA 1VQ5Q 2E3HA 3GPLA 1VQPQ 3CCRA 4M75F 4IUTA 3J7AF 1HD3A 1TTHB 2V8KA 3A8OB 4MMLA 2DEQA 2DYBA 1BI3A 3G6EA 4EIKA 1Q7YU 2PU9B 1M90R 4QVCA 2K5LA 3EG9B 1SRLA 3RMQA 4JZ4A 4ORZA 1ZSZA 4C8QD 5GAN5 2L0AA 1QP2A 5I2MA 1YIJT 4KRTA 9ATCB 1E6HA 4Z8AA 3UF4A 1EZZB 1K73U 5GAN3 1AHJB 4LDXA 4M75D 1FX7A 3I5SA 5FRMA 1WI7A 3G7ZA 2HKNA 3J80E 2DLPA 2EJ9A 2NUTB 5KYYA 2HD0A 2GFUA 5CKBA 3JAME 4OMMA 1YWOA 2E5QA 4GLKA 3PFSA 3CD6Q 1Q7YR 1ARKA 1T3SA 2FPEA 1NG2A 5D6WA 2QYZA 1W2BP 3AT1B 3RMSA 1A0NB 2EGCA 1C0MA 3KXTA 1OI1A 3M54A 3EG1A 1AWOA 1K73R 1EX4A 3NTKA 4B9XA 3SDZA 2QDYB 4XU2A 3G71Q 1M2OA 1M1FA 3PIOA 4JPBW 4B9WA 5GAN6 1D0ZA 4PJJA 4QVDA 3I56T 2HEQA 1K0SA 1VQMQ 3ME9A 5IH2A 1RUWA 4ZN1A 3CCUQ 2ZZDA 1HXDA 4HCCA 2KR3A 3QIIA 2RI3A 1OZ2A 1M3CA 2A7YA 1RAEB 4OMNA 4M77G 5GMKh 3P8DA 4E7HA 3F70A 2YRCA 3CXCS 3A5ZB 4QVZA 3CCRQ 3MP6A 1JJ2P 2GF7A 2DEUA 2EQJA 4CC7A 3V7RA 1WXTA 3M53A 2RQUA 5HCKA 1W2BS 4M77E 3G6EQ 4P5NA 3A8MB 3MHXA 2SEMA 2LX9A 1JB0E 3L2VA 4PJOF 1PKSA 1JU5C 4JJNK 4A4HA 3QHSA 4CC3A 2VWFA 1TUCA 2KMTA 1S72A 1ZSZB 3E1SA 2CYZB 2CGHA 1WQ7A 2RHUA 1H3HA 4EMKC 3QBYA 2KQWA 5GANd 1I07A 5J3BA 3MP1A 4IURA 4OF1A 3M0SA 2O88A 5KYUA 1QLYA 3OW2A 1UJYA 4Q5WA 1KHCA 2JMAA 5DM7R 4KGXB 4PJOD 2AHJB 5CK9A 1HJDA 1YCSB 2FPFA 3IQLA 1VQKA 1MMAA 1LPLA 1KG1A 1YJNA 4XTWA 1VQ7A 2YT6A 1G3YA 2FG0A 2FL7A 2AT1B 1N27A 2FZGB 2OTJA 2I0NA 1QCNA 1MV3A 1GBQA 3G1JA 3M58A 2KYBA 2R57A 4LXCA 3KBGA 4EMKA 1IHVA 2DPPB 5GAOr 3NMZC 2QQBA 2E64A 5GAMh 2LJ0A 1BYMA 1SSFA 3JCMh 2HL5C 1OULA 2MWPA 4J9GA 3QJYA 2J6OA 5D6XA 1FWZA 5GAMj 1D1AA 2LNHB 2O01E 4RG2A 2PVGB 1YJ9T 4PK4A 2X4XA 1TS9A 1CKAA 2IIMA 1X6GA 4E7KA 4PFZA 4FIBA 2KVQG 3UPUA 2DIQA 1WA7A 3T9NA 2XI9A 1QMCA 4L6V5 2RHZA 3TSWA 1D0XA 1QWEA 2HL3A 3JSCA 4M75C 1X01A 1WJQA 2O31A 4A53A 1AZGB 1QVGA 1S72Q 2RB6A 4RMOA 2LCCA 1ABQA 3VS4A 2ZPFB 3X24B 1NLOC 2FYKA 1NBEB 4OVAA 2CT4A 3HRTA 3EGUA 3PTAA 2KGTA 2XDPA 1B3QA 4M78A 1T3LA 1U5SA 2DJZA 2EWNA 1PSFA 3GIBA 1VQKQ 5L23A 3CC2T 1QKWA 4FW1A 1YJNQ 2MPXC 4D6WA 5KE3A 2J6FA 1PKTA 4FW2A 1RAIB 4OMLA 3X28B 4F7UB 3PGGA 4HA8A 2OTJQ 2PUKB 2KROA 2DFUA 2B8AA 4KGVB 4ZNXA 4WTOB 2K5FA 1GL5A 2D6FA 1H92A 1RAHB 1RAGB 4EMKB 3FIFA 3O8VA 5LJ5h 2LQ8A 2GNCA 4IKFA 1BI1A 3CPWA 1H3ZA 2DE0X 4N4GA 4PNOA 4F04B 4C92A 2E41A 3CCLT 3CCJT 3OSVA 2OJ2A 1U8RA 3A8GB 3JB9G 3CMAQ 4EMHA 1WHLA 3PMIA 2XKOC 3SWNC 2EQKA 1RL2A 1VYVA 4CI0C 4JJBA 2COZA 1VQ8A 2I2LA 1XJWB 3LYIA 1G5VA 4F16A 3TU4K 2EGAA 1AOJA 3HP9A 3JRZA 4BY6C 2DRKA 4ZTJA 4F7UG 4M7DG 3RESA 1M2VA 1PCXA 2DNUA 4GY5A 1G3TA 1B34A 2KY9A 2QEXQ 3TVTA 1QCFA 5LJ3e 3CCST 5LJ3g 2MOXA 4M7DE 4FT2A 5LL6S 1WGSA 3TREA 4M7AC 4PJOC 3CCET 2KNBB 2HQHA 3VUZA 8ATCB 4II1A 1UGQB 2RN8A 2RQTA 1M8VA 1JO8A 4HT8A 2DXUA 3E9FA 1WHGA 4JJCA 3OYCA 1KFZA 1VQOT 2ZPEB 2F5TX 1NPPA 1GBRA 1VQ9A 3NTHA 2L3RA 1VQLA 2E1HA 1Q82C 1D1BA 2E12A 2DYIA 2JJ9A 4MZTA 1IHWA 2RJEA 1OX8A 5GAOn 4PJNA 2HKQB 1E6GA 3BE3A 3RKWA 2EQMA 2L3SA 4M7AA 1G3SA 2W0ZA 1PRMC 1VQNA 2KK4A 4EMGA 3EG3A 3M0PA 3OA6A 2CZ0B 4IUQA 2L89A 1M1KC 5GANe 1AT1B 3O5ZA 2P4RA 4LD9K 5GANg 1KSWA 1BCMA 2H3JA 1NLPC 5A0GA 4IIOA 2YUOA 2DMOA 2E4HA 4DBHA 1VQ6T 2F2XA 2L3PA 1I5OB 1TH7A 3OBYA 4JS4A 1RI0A 2OI3A 2A28A 4J9IA 1U3OA 2RHYA 2CT3A 6AT1B 1VQ8Q 2Y4YA 1SEMA 4QT7A 3PT9A 2LZ6B 4C8QG 1BK2A 3RDVA 5FW9A 5GAN8 4NL2A 2RO0A 2OTLA 2BKDN 1Y96A 4BB7A 4J6XA 3FC3A 1WXBA 1Q86C 2MAMA 3NPFA 1IXDA 4M75G 5IHIA 4Z88A 4C8QE 3H0IA 2FRYA 1MGQA 1M2VB 3FLGA 3OW2P 4Y91A 2WSEE 4J6WA 2RQWA 4E7IA 4AFUC 4BDYA 1BU1A 4DBRA 5GAOq 3OS1A 4M75E 5I11A 2VXFA 3OYHA 5KE2A 2R5MA 2JTMA 3SWNB 1GCQC 2ATCB 2FZCB 3TSZA 5FU6C 3UA6A 3CCVQ 1R0CB 1UECA 2JUFA 4KH1B 3EFSA 1YIJA 4FSXA 1NYGA 2DBKA 1VQ9Q 3VV0A 1VQLQ 3HKSA 2IVWA 2QQSA 3GNFB 1QW1A 2FO0A 4JZ3A 3HRUA 2FPDA 1NPRA 2JT4A 3OBWA 4KUDK 3CBOA 3OYGA 2RM4A 2YLBA 4J6YA 3UWNA 1UDLA 2HNIA 3OS0A 1VQMA 4BE2A 4LE9A 2KYMA 3EAEA 1UGVA 1ZX6A 3JB9I 4M78F 3L1AA 3SB2A 1D09B 4M7AB 3M0TA 1Q82U 2RJDA 1T0HA 4TVRA 1PG5B 2A08A 2LP5A 3M0UA 2DTHA 2H3EB 2KRSA 2NWMA 3X26B 3PE0A 3NFCA 1RI9A 2DA9A 3X25B 2V1RA 4N0AC 1RABB 4FYVB 4ATOA 5GANf 4OMOA 4J9BA 1VUBA 2FHDA 2DAQA 1H8KA 2E10A 1M1KU 3JCMd 4AT1B 2VKNA 3LGLA 2CH4A 1QVGP 2O2OA 1YJWT 2JN0A 3QUIA 4M78D 3I56A 3MEWA 2D9TA 5CAIA 3ULRB 5KCOA 2OTLQ 1Q82R 3PMTA 3CD6T 2A0FB 2RH2A 2R58A 2X4JA 2GCXA 2JS2A 1R0BG 1IO6A 3EGXA 4C92F 1Y96B 2GGRA 2QI2A 1WXUA 3V8KA 1YN8A 2RPNA 4N0AA 3X20B 3BW1A 1GCPA 1RACB 2RF0A 3LGFA 1Q86U 4PJOG 2A36A 4DA4A 1QVFA 1M1KR 1K9AA 2LRQA 4R56A 7AT1B 3OYKA 2CP7A 2KE9A 5DLOA 3UDCA 1SF9A 2KDSA 3WXMB 3MEVA 4OGEA 4PJOE 1PC0A 1W4SA 4LDYA 2ABLA 1YIJQ 4C92D 1N8RC 3EFOA 4Z89A 3CCUT 4YTLA 1TXQA 3M4YA 1PD0A 3L2ZA 1VYTA 1MMGA 3JCMW 2RHIA 2ZGWA 1K8AU 1UEBA 3CPWP 1ZBJA 4OP0A 1V1CA 5LJ3d 1Q86R 2HAXA 1I4K1 2VXEA 1YHQT 4HCZA 1ZLMA 3HSBA 1TU0B 5GMKm 4IIMA 2NLUA 4C5IA 3PIPA 1I5LA 1Q81C 3KUFA 2DX1A 3I35A 3OS5A 5FU6B 3D7SB 1OU9A 2DERA 2CDTA 3I55T 1U06A 5LJ5d 1Z9QA 2AKLA 2ZPHB 3MEUA 1KHIA
chains in the Genus database with same CATH topology
5GAMf 1QVGA 4BACA 3GOXA 4IUPA 2PVOB 2RB6A 4RMOA 4RCCA 1O9SA 1M90C 4C0DB 2LCCA 4PKCC 4M7AF 4QW2A 1NJIC 4JS5A 2ZPFB 3OYJA 3X24B 2DK3A 3PNWC 4C8QB 3C94A 1JBMA 4BUGA 2FYKA 2OAUA 3QO3A 3QZ9B 5HK0A 2LDMA 4OVAA 3S3MA 1K9MU 1R8OB 2LC4A 4J83A 2E65A 5DY9A 3HRTA 5GAMd 3QXEB 2EFIA 2GQVA 2EQUA 2XDPA 3PTAA 2LTOA 1FXXA 4ELZC 1GXIE 3META 2DTIA 2VC8A 4A4KA 4M78A 4JLGA 1QVFS 2DVEA 3CPWS 3CC4T 4M75B 2DXTA 3JCMc 1VQ8T 3JB9F 2MWOA 4E7LA 3RIRA 2DJZA 2EWNA 1PSFA 2EJFA 3MCAB 4LD6A 4MZPA 3GIBA 3GNGA 1YHQA 3E9GA 3CC2T 5CR2A 4XTZA 1YJ9A 4PJOA 2ZPIB 2JOYA 1H641 4D6WA 5KE3A 1WJRA 3X28B 4F7UB 3OYYA 3PGGA 4HA8A 3C12A 2PUKB 3DLMA 2DIGA 4LDWA 4C0GA 4M7AD 3ZBDA 3OQ5A 2B8AA 3QKJA 4NL3A 4BDZA 1VQ5A 1I8FA 4M78G 1VIFA 2RD1A 4F7UF 1VQPA 1JJ2S 2K5FA 4M7DF 4HKEA 1KC8U 2YLCA 1EIFA 4OGCA 4RKUE 2D6FA 2M16A 2LT1A 4MDWA 4CRIA 1ZHIA 4EMKB 3I55A 3FIFA 3O8VA 3WVEB 5LJ5h 3EFRA 2MMPA 4J5YA 4M7AG 4A54A 2K2VA 2LQ8A 4IKFA 5IN1A 3TEEA 3QG1A 1G3WA 2QTXA 1VIEA 3JB9D 4M78E 3VKIA 1BI1A 1K73C 3CPWA 4NOYA 5GMKe 4OB0B 1H3ZA 3CC7A 4N4GA 4PNOA 3JB9J 3HHTB 4C92A 4FU6A 2XDBA 3G71T 2E41A 1BKBA 1IREB 1D3BA 2F69A 2EJGA 3CCJT 2RI5A 3CCLT 2P0QA 3OSVA 1N9RA 3QDRB 4M77B 5A2QE 3CCVT 1U8RA 3A8GB 2XHCA 4HT9A 4M7AE 3V7CA 5CQYA 5CKHA 1KQ1A 3H6ZA 3HFNA 3JB9G 2VGNA 4PLLA 4EMHA 3PMIA 2P0KA 2XKOC 2EQKA 4JLIA 3SWNC 3LH0A 1VQ9T 1N8RU 1RL2A 3QYHB 5I21A 3SFMA 4CI0C 1VQMT 4EPCA 5EG2A 1N6AA 1V29B 4ME7A 1KD1U 1VQ8A 2DO3A 2I2LA 2V8IA 2YRVA 3VUBA 3JCMb 2XICA 2L8DA 2QQRA 1XTDA 4M7DD 4UC4A 3LYIA 1BIBA 1QVGS 1G5VA 4WF2A 2JNGA 3TU4K 5FLXE 4HCCA 5HK3A 3L42A 3JB9H 3CCMT 4R55A 2DZ9A 4EDUA 3HP9A 3JRZA 4C92G 2F5KA 3CMAA 3AHUA 4BY6C 4C5HA 4X9DA 3QJ6A 2XDDA 2D0QB 2X35A 1UGSB 3CCRT 4BE0A 4ZTJA 4F7UG 3CD6A 4M7DG 3RESA 2QQ9A 3QSUA 4PLIA 3RKXA 2CZ1B 5GAOm 3QZ5B 4GY5A 1G3TA 5IAYA 1B34A 2KY9A 2M0OA 3G6ET 4M78C 1YCYA 4C92E 5LJ3e 1S72T 2FVUA 5LJ5f 3JCMJ 3CCST 2K5IA 3INZA 1M1GA 5LJ3g 1K8AC 4HCBA 1VQNA 1Q81U 3H8ZA 4J7IA 3OY9A 4M7DE 4FT2A 5LL6S 1WGSA 1U1TA 5CIUA 3M55A 3TREA 3CBPA 4JRPA 2WSCE 2DD4A 4M7AC 3MEAA 5HY6A 4BI4A 4PJOC 4JUVA 3CCET 4BY6B 3VUZA 5C6SA 1WPYA 4XTXA 3OYDA 4OMFB 3DLLA 3JCMP 1VQ4A 4BI3A 4DOVA 2QEXA 4E7JA 4II1A 1UGQB 5FU7C 3G71A 1BI2A 2VGMA 2WSFE 5FRNA 1M8VA 4HT8A 3CCLA 2XU8A 3CCJA 2RHXA 3VJPA 5DLQE 3SD4A 3RKYA 1XQHA 2DXUA 3E9FA 1M90U 4ZN3A 3OYCA 3OYNA 3BFMA 5CCAA 1VQOT 3VYHB 1NJIU 3FB9A 2ZPEB 3N5BB 2F5TX 3DB3A 4C5EA 1NPPA 3VU3C 1VQ9A 1X6OA 3NTHA 2VV5A 3RUXA 4C0FA 2E6ZA 3OMCA 2DTOA 1KQSA 2L3RA 4KUDK 1VQLA 2E1HA 3HPWA 3CCUA 2VUBA 4BD3A 1VQ7T 2OTLT 1U1SA 1Q82C 2BIVA 4C8QF 4PJOB 2E12A 5L8RE 3CCMA 4XK8E 4FL6A 5GAOr 2P0PA 5GMKj 4MZTA 3L2QA 2RJEA 2PUOB 5GAMe 4C92C 3GPLA 3JCMX 5GAOn 3CCRA 2RK2A 1OYXA 3M59A 2K3XA 1PSEA 2EQMA 3RKWA 3HFOA 1G3SA 4M75F 4M7AA 4IUTA 2CKKA 5CKFA 1M4ZA 3J7AF 3M4GA 4M7DC 1M9SA 3JCMe 4OB3B 2V8KA 3L2UA 1OZ3A 2KK4A 3A8OB 4IUUA 2DEQA 4MMLA 1BI3A 3JCMg 3V8JA 4EMGA 4QQGA 4L59A 3G6EA 1Y71A 4XU1A 2O4XA 2RJFA 3OA6A 2CZ0B 4IUQA 1WNLA 2L89A 2DZCA 5GANe 3CCSA 2PU9B 1Q7YU 1M1KC 4QVCA 4LD9K 4Z02A 1ZBXA 2K5LA 5GANg 2H3JA 2IG0A 2LNVA 5A0GA 3E19A 2G3RA 3CXCA 3RMQA 4N4HA 3OYLA 2RA2A 3FJPA 3LW5E 1UB4A 4XQ3A 3CCEA 4N4IA 1VQ6T 4Y28E 3V8LA 1M5Q1 4C8QD 1D3BB 1TH7A 3OBYA 5I2MA 1QP2A 5GAN5 4JS4A 4ZN1A 3CCQT 1RI0A 1YIJT 3A8LB 1W2BA 5CKDA 3NTIA 4ZGJB 2RHYA 1K73U 5GAN3 3FRNA 2KSSA 1QVPA 2Y4YA 4FM4B 4XU0A 2X4WA 3PT9A 3S6WA 1AHJB 2E6NA 4M75D 1FX7A 4LDXA 5FRMA 3CEYA 3G7ZA 5LJ3j 4C8QG 3J80E 2ZCFB 4F7UA 2EJ9A 4M7DA 5GAN8 4NL2A 2R5AA 1HK9A 2K3YA 2HD0A 2RO0A 4C0ZA 2BKDN 3GLXA 2OTLA 2GFUA 5CKBA 3JAME 3OYFA 1Y96A 4BB7A 2M9UA 4J6XA 3FC3A 2E5QA 4GLKA 1Q86C 3PFSA 2MAMA 4M77F 2GFAA 4L5GA 2M1HA 3CC4A 3DB4A 1S72A 4M75G 4ELYC 5AYFA 4C8QE 1MGQA 1ZQ1A 3FLGA 2ZPGB 4Y91A 4J8OA 2WSEE 5D6WA 2HQXA 1Y07A 4J6WA 2LCLA 3OYEA 3CC2A 2CS7A 5CKEA 2QQAA 3RMSA 3BDLA 5GMKi 4E7IA 4BE1A 3KXTA 2MI6A 5HKCA 4BDYA 3OS1A 4JRQA 1OI1A 3M54A 5GAOq 3URGA 3P8HA 4M75E 1KQSS 2JTFA 2PQWA 2RJCA 2VXFA 3OYHA 3FDRA 5KE2A 3NTKA 4B9XA 2EKOA 3SDZA 2KAFA 2R5MA 2JTMA 3SWNB 1YITT 1P92A 2QA4T 5M9OA 2QDYB 1JRIA 4XU2A 2XG8D 4XTYA 5KCHA 1KQ2A 1M1FA 5FU6C 3PIOA 2PVDB 4B9WA 1VQ6A 4F7UE 5GAN6 2DXBA 4ZGEB 4PL6A 2DXCA 2JUFA 3EFSA 4M77D 3OB9A 3CCQA 4FSXA 1YIJA 5KH6A 3MO8A 4A4EA 1YI2T 3G4ST 4QVDA 5FROA 3I56T 4DOWA 3FEOA 3VV0A 2YHTA 1YBYA 2IVWA 2MF2A 3HKSA 2ZZDA 1HXDA 2EAYA 3ME9A 2QQSA 3GNFB 3QIIA 1QW1A 2RI3A 3LLRA 4LDUA 5CQXA 2P4TA 4OB2B 5GAOl 3RERA 1OZ2A 5A0DA 4MMKA 3HRUA 5GMKl 3CCVA 4XTVA 2A7YA 5GANj 5J26A 1NPRA 4M77G 5GMKh 2DD5A 4C8QC 3P8DA 4E7HA 3F70A 2HBPA 3OBWA 3CBOA 3HRSA 3Q1JA 4M78B 3A5ZB 3OYGA 2EYQA 3CXCS 2RM4A 2YLBA 2FB7A 4J6YA 5LJ5e 4QVZA 3UWNA 2HNIA 3OS0A 1VQKT 3MP6A 1BIAA 4C5GA 2GF7A 2VYTA 2EQJA 3JCMV 5LJ5g 2XD0A 4KT0E 1VQMA 4BE2A 3V7RA 1YJNT 3EAEA 3JB9I 4IUVA 4M78F 3M53A 3L1AA 3SB2A 3M5AA 4M7AB 2JZ2A 3OYMA 1W2BS 1Q82U 4M77E 2RJDA 3ASKA 4P5NA 4TVRA 4VUBA 2OTJT 3A8MB 3CMET 2HQEA 1LOJA 3MHXA 3LWHA 1UGRB 2DKGA 2LX9A 2LQKA 3CPFA 5FU7B 2DTHA 1JB0E 3CC7T 1LNXA 3L2VA 2O4XB 3X26B 4PJOF 2C06A 2XIDA 4O5VA 5GAMg 3P8BB 3JCMf 1MHNA 4JJNK 3VYGA 4LDVA 3NFCA 3QYGB 1K9MC 3X25B 4A4HA 2JVVA 3QHSA 4N0AC 1LJOA 1YITA 4ATOA 3UT1A 4XU3A 5GANf 2QA4A 2Y90A 2EIFA 1VUBA 3HL8A 2RI2A 2FHDA 2KMTA 2X4YA 2DAQA 2K57A 2E10A 3E1SA 2CYZB 1XNIA 3OSSC 4X9CA 4C8QA 3JCMd 1M1KU 2WACA 2CGHA 4JRIA 1WQ7A 2RHUA 4A4GA 1N9SA 3A8HB 3LGLA 4EMKC 3QBYA 2CZ7B 5LJ3h 1YI2A 2KQWA 3C4SA 5GANd 3L2RA 3G4SA 1YJWT 1X75C 2JN0A 3QUIA 4M78D 3MP1A 5J3BA 3I56A 4C92B 4KUIA 3MEWA 1DJ7B 2D9TA 4IURA 4A4FA 4BI8B 4OF1A 1NZ9A 5CAIA 5KCOA 4M75A 3CMAT 3OW2A 2LVMA 3M56A 3PMTA 4KBMB 4Q5WA 2RH2A 5CVIA 4ZTFA 2R58A 2X4JA 3CD6T 2GCXA 4M7DB 4QQ6A 2BUDA 3GF5A 1KHCA 1Q7YC 4C92F 1Y96B 5DM7R 4J7FA 1NE8A 5J39A 2AHJB 4M77C 5CK9A 4PJOD 4NS5A 2QI2A 1VQOA 1KC8C 1VQKA 3BDUA 1KG1A 3GP8A 3M9QA 3V8KA 1BI0A 1YJNA 4XTWA 1VQ7A 1I81A 4N0AA 1G3YA 5GAN4 3JCMQ 3X20B 2V8JA 3BW1A 4FT4A 2FL7A 1N27A 2A3LA 3LGFA 3OYAA 4RG8A 1Q86U 3S3NA 4PJOG 3OYBA 2OTJA 4DA4A 3CMEA 1QVFA 1O75A 4V2SA 2K4YA 5CO7A 1IZ6A 2LRQA 3M58A 3ZFJA 4R56A 3L2WA 1VQ4T 2QEXT 2ZPBB 3OYKA 2R57A 3KBGA 4EMKA 2DPPB 2CZ6B 4KULA 5DLOA 3UDCA 3WVDB 1XOVA 1B34B 2KDSA 3ER0A 3WXMB 5C0MA 2QQBA 4XAXB 2E64A 3MEVA 4OB1B 4OGEA 5GAMh 3LX7A 4PJOE 1W4SA 5LJ5j 3J81E 4LDYA 1BYMA 1SSFA 4C92D 1N8RC 5D6YA 3JCMh 1VQLT 1KD1C 5LJ3f 3ZEHA 3CCUT 4M77A 4YTLA 3M4YA 2MWPA 3L2ZA 3QJYA 4O6JA 3JCMW 3S3OA 1JJ2A 1WQWA 2RHIA 5GANh 2ZGWA 1YJWA 4MDXA 3MP8A 1K8AU 1UEBA 5GAN2 5D6XA 1FWZA 3C95A 5GAMj 1WJSA 3R6OA 3QPHA 4OP0A 3LWIA 5LJ3d 4RCBA 2HAXA 2O01E 1I4K1 2VXEA 4RG2A 2PVGB 3BY7A 4HCZA 1YHQT 3OS2A 1YJ9T 3HSBA 4MZMA 2X4XA 1QP3A 4E7KA 4DQ2A 1VQNT 4FIBA 2KVQG 3OYIA 5GMKm 4C0DC 3CBMA 2NLUA 3UPUA 4ZGDB 4C5IA 2DIQA 3PIPA 1I5LA 5I2SA 3T9NA 1VQ5T 1Q81C 2XI9A 3KUFA 5GAOp 5GAN7 1VQPT 2L5QA 2QXFA 3OMGA 3OS5A 5FU6B 5IT9E 2LT4A 2XK0A 4QQDA 4X34A 3SWNA 4E47A 3M57A 4XTUA 3DKMA 4JDSA 2RHZA 4L6V5 3TCJA 2RK1A 4JRKA 2Y4XA 3OW2S 2E70A 3JSCA 3I55T 4M75C 5LJ5d 2ZPHB 3MEUA 1X01A 3V7SA 1UGPB 1WJQA 1Y7XA 5A0LA 1KHIA 4A53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL2 A;  1N9S A;  1HK9 A;  5GAM f;  3RKX A;  4EMK C;  5GAO m;  5LJ3 h;  1Y96 A;  4J6X A;  2RB6 A;  1B34 A;  4RCC A;  5GAN d;  2JN0 A;  3QUI A;  4M78 D;  4M77 F;  4C92 B;  4M7A F;  4M78 C;  5CAI A;  1YCY A;  4C92 E;  5LJ3 e;  4M75 G;  4M75 A;  4C8Q B;  5LJ5 f;  3JCM J;  1JBM A;  3INZ A;  5LJ3 g;  2FYK A;  3QO3 A;  4C8Q E;  4M7D B;  1MGQ A;  4Y91 A;  2E65 A;  5DY9 A;  5GAM d;  4M7D E;  4J6W A;  4C92 F;  1Y96 B;  1U1T A;  4PJO D;  4M77 C;  5GMK i;  4M7A C;  2DTI A;  2VC8 A;  4M78 A;  4JUV A;  4PJO C;  2DVE A;  3BDU A;  1WPY A;  2DXT A;  4M75 B;  4XTX A;  5GAO q;  3JCM c;  3JCM P;  4M75 E;  3V8K A;  3JB9 F;  3RIR A;  2DJZ A;  1M8V A;  4XTW A;  2EWN A;  1I81 A;  4N0A A;  4HT8 A;  2VXF A;  5GAN 4;  3JCM Q;  3BW1 A;  2EJF A;  3RKY A;  3GIB A;  3SWN B;  2DXU A;  4XTZ A;  4PJO G;  4PJO A;  1JRI A;  4XU2 A;  3BFM A;  1H64 1;  3FB9 A;  4XTY A;  4A53 A;  1KQ2 A;  4V2S A;  4F7U B;  3VU3 C;  3PGG A;  3RUX A;  3QSU A;  4F7U E;  4HA8 A;  5GAN 6;  2DTO A;  4EMK A;  2E1H A;  5GAO r;  3EFS A;  4M77 D;  4M7A D;  1B34 B;  4NL3 A;  1U1S A;  1I8F A;  4C8Q F;  2E64 A;  4QVD A;  4M78 G;  2RD1 A;  4PJO B;  4F7U F;  5GAM h;  4PJO E;  4M7D F;  2YLC A;  5LJ5 j;  2YHT A;  1HXD A;  2EAY A;  5GMK j;  5GAO l;  3RER A;  4C92 D;  5GAM e;  4EMK B;  4MMK A;  4C92 C;  3JCM X;  5GAO n;  3FIF A;  3JCM h;  5GMK l;  5LJ5 h;  4XTV A;  5GAN j;  5LJ3 f;  4M77 G;  4M77 A;  3EFR A;  4J5Y A;  3HFO A;  3RKW A;  4M75 F;  4A54 A;  4C8Q C;  5GMK h;  4M7A A;  4M7A G;  4M78 B;  3L2Z A;  4F7U A;  3M4G A;  2RM4 A;  2QTX A;  2FB7 A;  2YLB A;  3JCM W;  4M78 E;  1WQW A;  4J6Y A;  3JCM e;  5LJ5 e;  3JB9 D;  4JRI A;  2HNI A;  5GAN h;  2ZGW A;  4MML A;  1BIA A;  4NOY A;  5GMK e;  2DEQ A;  3JCM g;  3JCM V;  4PNO A;  3V8J A;  4EMG A;  5LJ5 g;  5GAN 2;  3JB9 J;  4M7D A;  4XU1 A;  3V7R A;  4C92 A;  5GAM j;  2E41 A;  1WNL A;  3JB9 I;  4OP0 A;  2DZC A;  4M78 F;  1D3B A;  3L1A A;  2EJG A;  5LJ3 d;  4RCB A;  3SB2 A;  4M77 B;  5GAN e;  1N9R A;  4M7A B;  1I4K 1;  4QVC A;  5GAN g;  4M7D C;  2VXE A;  4M77 E;  3BY7 A;  4M7A E;  4HT9 A;  3V7C A;  3HSB A;  1KQ1 A;  3HFN A;  1LOJ A;  3JB9 G;  4EMH A;  2RA2 A;  3FJP A;  2DKG A;  4XQ3 A;  3SWN C;  4JLI A;  2DTH A;  4DQ2 A;  5GMK m;  1LNX A;  5I21 A;  3V8L A;  1M5Q 1;  4PJO F;  4F7U G;  4C8Q D;  1D3B B;  5GAM g;  3JCM f;  1TH7 A;  5GAN 5;  1I5L A;  2I2L A;  3JCM b;  4M7D D;  1BIB A;  5GAO p;  4WF2 A;  5GAN 7;  3QHS A;  3JB9 H;  4N0A C;  4M7D G;  1LJO A;  4XU3 A;  5GAN f;  5GAN 3;  2DZ9 A;  3SWN A;  2Y90 A;  4XU0 A;  5GAN 8;  4XTU A;  4C92 G;  4M75 D;  4JRK A;  2K57 A;  4X9C A;  2E10 A;  3AHU A;  5LJ3 j;  4X9D A;  4C8Q A;  4C8Q G;  4M75 C;  5LJ5 d;  3JCM d;  2CGH A;  1X01 A;  3V7S A;  2EJ9 A;  1WQ7 A;  3RES A; 
#chains in the Genus database with same CATH topology
 2NYS A;  2GTJ A;  3H0F A;  2PVO B;  1K8A R;  1O9S A;  4FCY A;  4M7A F;  3VS2 A;  2C0T A;  3OYJ A;  2CSQ A;  1G8X A;  3C94 A;  2V1Q A;  2LC4 A;  3I56 Q;  1OU8 A;  1UTI A;  2YUP A;  1Z9Z A;  2EQU A;  2GQV A;  4ELZ C;  1QWF A;  3CPW S;  1W6X A;  2MWO A;  2DVJ A;  2M51 A;  2ROT A;  2EGE A;  2CSI A;  4LD6 A;  4MZP A;  4M4Z A;  3E9G A;  3VS3 A;  1FMW A;  2NUP A;  4XTZ A;  1YJ9 A;  2ZPI B;  2JOY A;  1H64 1;  1KIK A;  1W1F A;  3REA B;  2EYW A;  3OYY A;  1UFF A;  2DET A;  2LJ3 A;  5KYY B;  4C0G A;  4M7A D;  3QKJ A;  4BDZ A;  1JJ2 S;  2LQW A;  2L2P A;  2YLC A;  1EIF A;  1HSQ A;  5IXF A;  2M0Y A;  4CRI A;  2X3X D;  3WVE B;  4DEY A;  2MMP A;  2EYY A;  3UAT A;  3QG1 A;  2MYS A;  2QTX A;  1X2Q A;  2HBW A;  5GMK e;  3CC7 A;  2VVK A;  3EFO B;  4FU6 A;  1D3B A;  2F69 A;  2ROL A;  5CQY A;  5CKH A;  2DJQ A;  2P0K A;  1N8R U;  3QYH B;  2EPD A;  5I21 A;  2QGG A;  2DL7 A;  2YUQ A;  5EG2 A;  4HXJ A;  3VUB A;  3JCM b;  2V8I A;  2L8D A;  2J05 A;  2JNG A;  3JB9 H;  3CCM T;  5FWC A;  2EYZ A;  2DZ9 A;  3UA7 A;  4EDU A;  5GJV B;  3CMA A;  3QJ6 A;  1YFN A;  1B07 A;  1PM3 A;  3LH5 A;  4JJD A;  3RKX A;  1MUZ A;  2CZ1 B;  8AT1 B;  2KI7 A;  1YP5 A;  4M78 C;  1YCY A;  2VB6 A;  1S72 T;  1M1G A;  1Q81 U;  3OY9 A;  2QAS A;  5CIU A;  3M55 A;  2GBQ A;  4HCK A;  2DD4 A;  4JUV A;  3E2U A;  1VQ4 A;  2QEX A;  5FRN A;  2VGM A;  2WSF E;  3CCL A;  2XU8 A;  3CCJ A;  2QTV A;  3VJP A;  2QGF B;  5DLQ E;  3RKY A;  1XQH A;  1UHF A;  4ESR A;  3VYH B;  2YDL A;  4C5E A;  4HVW A;  2LX7 A;  3VU3 C;  3RUX A;  2VV5 A;  3QSU A;  2DTO A;  1YJ9 Q;  1VQ7 T;  3HPW A;  2K9G A;  4BD3 A;  2DRM A;  2E3I A;  2X3W D;  2NUP B;  2BIV A;  4XK8 E;  4FL6 A;  5KYU B;  3L2Q A;  1Q81 R;  2PUO B;  5GAM e;  3H9N A;  2DM1 A;  4C92 C;  3JCM X;  1PSE A;  3HFO A;  5CKF A;  3GBQ A;  1M4Z A;  1M9S A;  3JCM e;  3VS5 A;  3L2U A;  1OZ3 A;  3JCM g;  3V8J A;  4QQG A;  1HYO A;  4XU1 A;  1TUD A;  2O4X A;  1KQS P;  3CCS A;  4Z02 A;  3CC7 Q;  2IG0 A;  2O9V A;  3E19 A;  4RTT A;  3CXC A;  2CUD A;  5IXB A;  1ACM B;  2PNI A;  4N4H A;  1NEB A;  3LW5 E;  4CC2 A;  4XQ3 A;  3CCE A;  1TWB A;  4Y28 E;  1D3B B;  1ZUK A;  3CCQ T;  3A8L B;  1W2B A;  3NTI A;  2W10 A;  2F1L A;  1MNE A;  3S6W A;  2E6N A;  2CP5 A;  1QCO A;  5LJ3 j;  2ZCF B;  2SRC A;  2Z0W A;  1HK9 A;  4C0Z A;  3GLX A;  2D8H A;  1G83 A;  1LCK A;  1EFN A;  4L5G A;  2M1H A;  3CC4 A;  3DB4 A;  5AYF A;  1UG1 A;  4J8O A;  2HQX A;  2CS7 A;  5CKE A;  1OPL A;  5GMK i;  2K2M A;  2MI6 A;  5HKC A;  4JRQ A;  1WHH A;  2F2V A;  3P8H A;  2RQR A;  1KQS S;  1KJW A;  2PQW A;  2RJC A;  2HDA A;  1X27 A;  2EKO A;  2KAF A;  1YIT T;  1P92 A;  1VQ4 Q;  2QA4 T;  5M9O A;  4XTY A;  3CCL Q;  3CCJ Q;  1KQ2 A;  1QVF P;  2LQN A;  5FWB A;  2PVD B;  1VQ6 A;  2ZAE A;  4F7U E;  4J9D A;  4QKU A;  1C1A A;  2DXB A;  3HTR A;  4PL6 A;  3OB9 A;  5KH6 A;  3MO8 A;  1YI2 T;  3G4S T;  2PZ1 A;  3FEO A;  2YHT A;  1YBY A;  2JXB A;  5GAO l;  4KGZ B;  1IGU A;  4LDU A;  2P4T A;  4OB2 B;  2P84 A;  4MMK A;  5GMK l;  1NEG A;  4XTV A;  3CCV A;  5GAN j;  2OX7 A;  1X6B A;  1SHF A;  2O9S A;  2DD5 A;  5J26 A;  3HRS A;  4M78 B;  4LUD A;  3VS7 A;  2EYQ A;  5KYN A;  5LJ5 e;  4C5G A;  2VYT A;  3JCM V;  5LJ5 g;  4E2F B;  4GLM A;  2XD0 A;  2KRM A;  1MND A;  3OYM A;  2MIO A;  3CME T;  1LOJ A;  1UGR B;  3CCS Q;  2DKG A;  1AEY A;  2O4X B;  4OMQ A;  2QDL A;  2DF6 A;  2C06 A;  4O5V A;  3JCM f;  2FRW A;  3RR6 A;  4LDV A;  1K9M C;  3CCE Q;  2YSQ A;  3UT1 A;  3FJ5 A;  2Y90 A;  2EIF A;  3EGD A;  4FSS A;  2WAC A;  1JEG A;  4A4G A;  1N9S A;  4B6M A;  2CZ7 B;  1WZO A;  4LN2 A;  4C92 B;  2DL3 A;  4A4F A;  1NZ9 A;  2EQI A;  4ZTF A;  1RAA B;  4KBM B;  5CVI A;  4QQ6 A;  1Q7Y C;  3CC4 Q;  2KRN A;  1NE8 A;  5J39 A;  4M77 C;  4NS5 A;  1M3B A;  1ZA2 B;  3GP8 A;  1BI0 A;  1WHK A;  4FT4 A;  2A3L A;  4RUG A;  3OYA A;  2VAS A;  3OYB A;  1LVK A;  1N5Z A;  1X2K A;  5CO7 A;  2DL8 A;  3ZFJ A;  1XOV A;  1B34 B;  5C0M A;  3ER0 A;  4PJL A;  1VQ6 Q;  3LX7 A;  2EW3 A;  2JW4 A;  1ZA1 B;  2YRD A;  1S1N A;  2EVR A;  4DBF A;  1GFD A;  1VQL T;  1KD1 C;  5LJ3 f;  1IRX A;  4AG1 C;  4M77 A;  2NUT A;  2KXC A;  2GTO A;  3S3O A;  1YJW A;  1WHJ A;  3MP8 A;  5GAN 2;  3C95 A;  4RCB A;  3H41 A;  3QWX X;  3BY7 A;  1BB9 A;  4DQ2 A;  1VQN T;  4ZGD B;  1R77 A;  1VQ5 T;  4F14 A;  2ECZ A;  4D8K A;  3A98 A;  5GAN 7;  2L5Q A;  1VQP T;  2QXF A;  5KYX A;  5IT9 E;  2XK0 A;  4QQD A;  1MMN A;  4E47 A;  3M57 A;  4XTU A;  3DKM A;  4JDS A;  3TCJ A;  1IB8 A;  2RK1 A;  1JXO A;  2Y4X A;  3OW2 S;  2H8H A;  4OMP A;  2CP0 A;  3V7S A;  5A0L A;  3GOX A;  4IUP A;  2NUZ A;  5D7U A;  2C0I A;  4C0D B;  1UHC A;  1X69 A;  4RTV A;  3EGD B;  1WFW A;  1OQK A;  1NJI C;  3SHW A;  5HK0 A;  2BZ8 A;  1K9M U;  1R8O B;  2E65 A;  5DY9 A;  5GAM d;  1M27 C;  3QXE B;  3MET A;  2DTI A;  4JLG A;  2BZX A;  2KT8 A;  1PD1 A;  3RBB B;  4E7L A;  1SPK A;  3GNG A;  1YHQ A;  2ENM A;  1WJR A;  1FMK A;  4J9E A;  3M0Q A;  3DLM A;  2DIG A;  2J06 A;  4LDW A;  3OQ5 A;  1UUE A;  1K0X A;  1I8F A;  2RD1 A;  2YXY A;  2COY A;  4HKE A;  1Y57 A;  1K9M R;  2FZK B;  3SEM A;  3I55 A;  3H0H A;  4M7A G;  4A54 A;  2K2V A;  4LNP A;  1G3W A;  1VIE A;  2ED1 A;  3VKI A;  2QAZ A;  2DBM A;  1OX9 A;  4NOY A;  3HHT B;  1I1J A;  3G71 T;  1BKB A;  1IRE B;  2RI5 A;  2P0Q A;  2D1X A;  1N9R A;  3QDR B;  4M77 B;  5A2Q E;  1YJW Q;  4M7A E;  4HT9 A;  3H6Z A;  2VGN A;  3CXC P;  4PLL A;  1TOV A;  4JLI A;  2G6F X;  3LH0 A;  3R6N A;  1JQQ A;  4CC4 B;  2XMF A;  3SFM A;  1VQM T;  4EPC A;  1V29 B;  3TQ7 P;  1KD1 U;  2YRV A;  2XIC A;  2QQR A;  1XTD A;  1QVG S;  3VS6 A;  3AHU A;  4RTX A;  4C5H A;  4LUE A;  2D0Q B;  2X35 A;  1UGS B;  2XDD A;  3CCR T;  2QQ9 A;  2JMC A;  2PTK A;  4PLI A;  5GAO m;  1AWX A;  3QZ5 B;  5KYX B;  5IAY A;  2M0O A;  3G6E T;  4X1V A;  5AT1 B;  4AMC A;  1F1B B;  4RTY A;  2HSP A;  2K5I A;  3INZ A;  4A63 B;  4HCB A;  2GQI A;  4J7I A;  4E7Z A;  1U1T A;  4JRP A;  3CBP A;  2WSC E;  4D8D A;  5HY6 A;  4BI4 A;  1WIE A;  4HVV A;  3EHQ A;  1KD1 R;  5C6S A;  1WPY A;  1TUG B;  3NHN A;  4XTX A;  4E7J A;  5FU7 C;  1BI2 A;  2RHX A;  1ABO A;  1MMD A;  2AKK A;  1VOM A;  1I0C A;  1NJI U;  3FB9 A;  3DB3 A;  2YUN A;  1X6O A;  4C0F A;  1UJ0 A;  1YHQ Q;  2E6Z A;  1AZE A;  1CSK A;  2VUB A;  1U1S A;  1RLQ C;  2DL4 A;  3CCM A;  5GMK j;  2K6D A;  2RMO A;  4GBQ A;  3EGX B;  2RK2 A;  1OYX A;  3M59 A;  2K3X A;  2CKK A;  3M4G A;  4M7D C;  1D1C A;  1SRM A;  4OB3 B;  3I55 Q;  4IUU A;  4L59 A;  1Y71 A;  2RJF A;  1WNL A;  2DZC A;  1BBZ A;  2CRE A;  1ZBX A;  4RTW A;  2LNV A;  2G3R A;  1NJI R;  3U23 A;  1OPK A;  1AD5 A;  3OYL A;  2RA2 A;  3FJP A;  1UB4 A;  2LCS A;  3M0R A;  4N4I A;  3V8L A;  1M5Q 1;  2OAW A;  1C6V X;  5CKD A;  4ZGJ B;  3FRN A;  2KSS A;  1QVP A;  4FM4 B;  4FYX B;  4XU0 A;  2X4W A;  3MKD A;  1K1Z A;  2LMJ A;  1KK7 A;  3CEY A;  1SSH A;  4F7U A;  4M7D A;  2R5A A;  2K3Y A;  3OYF A;  2M9U A;  3A1P A;  2QK0 A;  4M77 F;  2GFA A;  4ELY C;  2K79 A;  1X43 A;  1ZQ1 A;  2ZPG B;  1Y07 A;  2LCL A;  3OYE A;  3CC2 A;  2MK5 A;  2QQA A;  1TG0 A;  3BDL A;  4BE1 A;  2J6K A;  3URG A;  3EH2 A;  2JTF A;  3JV3 A;  1ZUY A;  3FDR A;  2BZY A;  1JRI A;  1PHT A;  1RAD B;  2XG8 D;  5KCH A;  2EKH A;  3VS0 A;  4FYW B;  1T0J A;  4ZGE B;  2DXC A;  3ZL7 C;  4M77 D;  3CCQ A;  4A4E A;  1N8R R;  5FRO A;  1M8M A;  4DOW A;  2BE9 B;  1W70 A;  2MF2 A;  2D0N A;  2EAY A;  1VYU A;  2EBP A;  3LLR A;  3RER A;  5CQX A;  3MPU B;  5A0D A;  3RNJ A;  1VA7 A;  4DEX A;  3CCM Q;  4C8Q C;  3Q1J A;  2HBP A;  2CP3 A;  2FB7 A;  2AZV A;  1VQK T;  5EC7 A;  1BIA A;  2HCK A;  4KT0 E;  1WYX A;  2KBT A;  1YJN T;  3PVQ A;  1GRI A;  2JZ2 A;  1V76 A;  2OTJ T;  3ASK A;  4ANJ A;  4VUB A;  2HQE A;  3LWH A;  2KT1 A;  1YWP A;  3CPF A;  2LQK A;  5FU7 B;  3CC7 T;  1LNX A;  2RQV A;  2XID A;  5GAM g;  3P8B B;  1MHN A;  1SKU B;  2DIL A;  3VYG A;  2K7A A;  1CKB A;  3QYG B;  3MJX A;  2JVV A;  1LJO A;  1YIT A;  2CUB A;  4XU3 A;  2QA4 A;  3HL8 A;  2C0O A;  2RI2 A;  2X4Y A;  2K57 A;  4X9C A;  4E6R A;  1XNI A;  3OSS C;  4C8Q A;  1RLP C;  4JRI A;  2JM8 A;  2L3Q A;  3A8H B;  5LJ3 h;  1YI2 A;  3C4S A;  3L2R A;  3G4S A;  1X75 C;  1ZSG A;  2CP6 A;  4KUI A;  1DJ7 B;  4BI8 B;  1VQ7 Q;  3CMA T;  4M75 A;  4PFP A;  4RTU A;  2LVM A;  3M56 A;  4M7D B;  2BUD A;  2EYX A;  3GF5 A;  2D8J A;  4J7F A;  1VQO A;  2A37 A;  2HZY A;  1KC8 C;  3BDU A;  2KEA A;  3M9Q A;  4PFO A;  3CC2 Q;  1I81 A;  2JS0 A;  5GAN 4;  3JCM Q;  2V8J A;  4J9F A;  4F17 A;  2IPO B;  4RG8 A;  3S3N A;  3CME A;  1O75 A;  4V2S A;  1G2B A;  2K4Y A;  1IZ6 A;  1VQ4 T;  3L2W A;  2QEX T;  2ZPB B;  2CZ6 B;  4KUL A;  3WVD B;  1WX6 A;  4AFZ C;  2J7I A;  1FMV A;  3KFV A;  4XAX B;  4OB1 B;  1FYN A;  5LJ5 j;  3J81 E;  1WDX A;  3CCQ Q;  5D6Y A;  4KH0 B;  2KXD A;  2M02 A;  3ZEH A;  2BTT A;  4FYY B;  4O6J A;  1JJ2 A;  1WQW A;  5GAN h;  2JM9 A;  4J9H A;  2YWW A;  4AG2 C;  4MDX A;  1AVZ C;  1MV0 B;  1WJS A;  3R6O A;  3QPH A;  4AFQ C;  3LWI A;  1Q95 G;  1QQJ A;  3OS2 A;  4MZM A;  5KYW A;  2BE7 D;  1QP3 A;  3EHR A;  2CP2 A;  3OYI A;  5I22 A;  4WCI A;  4C0D C;  3CBM A;  3QDF A;  4AFS C;  5I2S A;  5GAO p;  3EG2 A;  3OMG A;  2K3B A;  2LT4 A;  4X34 A;  3SWN A;  1YNZ A;  1ZUU A;  2QG9 B;  4JRK A;  2E70 A;  3VS1 A;  2FEI A;  1YIT Q;  1UGP B;  4IUV A;  3M5A A;  1Y7X A;  2QA4 Q;  5GAM f;  4BAC A;  3C0C A;  1M90 C;  4RCC A;  4PKC C;  4QW2 A;  2RNA A;  4JS5 A;  2DK3 A;  3PNW C;  4C8Q B;  1JBM A;  4BUG A;  1YI2 Q;  2F2W A;  2OAU A;  3QO3 A;  2E5K A;  3QZ9 B;  3G4S Q;  1PWT A;  2LDM A;  3S3M A;  4J83 A;  3VRZ A;  1IGQ A;  2EFI A;  2LTO A;  1FXX A;  3I9Q A;  4A4K A;  1SG5 A;  2VC8 A;  1GXI E;  1QVF S;  1K76 A;  2DVE A;  3CC4 T;  4M75 B;  2DXT A;  2X51 A;  2LJ1 A;  3JCM c;  1VQ8 T;  2X9H A;  3JB9 F;  3RIR A;  4RTZ A;  1TSF A;  3PVL A;  1VQO Q;  2EJF A;  3MCA B;  5CR2 A;  2DL5 A;  4PJO A;  3EH1 A;  2B86 A;  3C12 A;  3CME Q;  1OV3 A;  1WLP B;  2CH4 W;  3ZBD A;  1VQ5 A;  4NL3 A;  4Y92 A;  5IHN A;  1PRL C;  4M78 G;  1VIF A;  4F7U F;  1VQP A;  4M7D F;  1KC8 U;  3REB B;  4OGC A;  1QKX A;  4RKU E;  2M16 A;  2LT1 A;  4MDW A;  1ZHI A;  3CQT A;  5ECA A;  3EFR A;  4J5Y A;  3VRY A;  3EG9 A;  5IN1 A;  3TEE A;  3JB9 D;  4M78 E;  1J3T A;  1K73 C;  4OB0 B;  3JB9 J;  1D0Y A;  4E7S A;  2XDB A;  2EJG A;  2HSE B;  4HVU A;  3CCV T;  1UE9 A;  2XHC A;  3V7C A;  2AZS A;  3NGP A;  1JXM A;  1KQ1 A;  3HFN A;  1OOT A;  1K4U S;  1VQ9 T;  5GJW B;  1N6A A;  4ME7 A;  2DO3 A;  4R0K A;  4M7D D;  4UC4 A;  1BIB A;  1KC8 R;  4WF2 A;  5KYW B;  5FLX E;  5HK3 A;  3L42 A;  2ED0 A;  4R55 A;  1GFC A;  1BCO A;  4C92 G;  2F5K A;  1RAF B;  2HMA A;  4X9D A;  4BE0 A;  3CD6 A;  4J9C A;  1M30 A;  1WHM A;  3QWY A;  1AWJ A;  1PNJ A;  1NM7 A;  1Y0M A;  2ESW A;  4C92 E;  2FVU A;  5LJ5 f;  3JCM J;  1K8A C;  2AK5 A;  3H8Z A;  1AWW A;  4PJM A;  1B7T A;  1SHG A;  2COW A;  3EG0 A;  3MEA A;  4BY6 B;  5IHK A;  3JCM P;  3OYD A;  4OMF B;  3DLL A;  4BI3 A;  4DOV A;  3G71 A;  2AIR B;  3I5R A;  3SD4 A;  1OEB A;  2MCN A;  1M90 U;  1NYF A;  4ZN3 A;  1M3A A;  3OYN A;  1E7O A;  3BFM A;  2V26 A;  5CCA A;  3N5B B;  3OMC A;  1KQS A;  4K11 A;  3CCU A;  3THK A;  1ZSZ C;  2JTE A;  2OTL T;  1GCQ A;  4C8Q F;  1VQN Q;  4PJO B;  5L8R E;  4DBQ A;  2P0P A;  1VQ5 Q;  2E3H A;  3GPL A;  1VQP Q;  3CCR A;  4M75 F;  4IUT A;  3J7A F;  1HD3 A;  1TTH B;  2V8K A;  3A8O B;  4MML A;  2DEQ A;  2DYB A;  1BI3 A;  3G6E A;  4EIK A;  1Q7Y U;  2PU9 B;  1M90 R;  4QVC A;  2K5L A;  3EG9 B;  1SRL A;  3RMQ A;  4JZ4 A;  4ORZ A;  1ZSZ A;  4C8Q D;  5GAN 5;  2L0A A;  1QP2 A;  5I2M A;  1YIJ T;  4KRT A;  9ATC B;  1E6H A;  4Z8A A;  3UF4 A;  1EZZ B;  1K73 U;  5GAN 3;  1AHJ B;  4LDX A;  4M75 D;  1FX7 A;  3I5S A;  5FRM A;  1WI7 A;  3G7Z A;  2HKN A;  3J80 E;  2DLP A;  2EJ9 A;  2NUT B;  5KYY A;  2HD0 A;  2GFU A;  5CKB A;  3JAM E;  4OMM A;  1YWO A;  2E5Q A;  4GLK A;  3PFS A;  3CD6 Q;  1Q7Y R;  1ARK A;  1T3S A;  2FPE A;  1NG2 A;  5D6W A;  2QYZ A;  1W2B P;  3AT1 B;  3RMS A;  1A0N B;  2EGC A;  1C0M A;  3KXT A;  1OI1 A;  3M54 A;  3EG1 A;  1AWO A;  1K73 R;  1EX4 A;  3NTK A;  4B9X A;  3SDZ A;  2QDY B;  4XU2 A;  3G71 Q;  1M2O A;  1M1F A;  3PIO A;  4JPB W;  4B9W A;  5GAN 6;  1D0Z A;  4PJJ A;  4QVD A;  3I56 T;  2HEQ A;  1K0S A;  1VQM Q;  3ME9 A;  5IH2 A;  1RUW A;  4ZN1 A;  3CCU Q;  2ZZD A;  1HXD A;  4HCC A;  2KR3 A;  3QII A;  2RI3 A;  1OZ2 A;  1M3C A;  2A7Y A;  1RAE B;  4OMN A;  4M77 G;  5GMK h;  3P8D A;  4E7H A;  3F70 A;  2YRC A;  3CXC S;  3A5Z B;  4QVZ A;  3CCR Q;  3MP6 A;  1JJ2 P;  2GF7 A;  2DEU A;  2EQJ A;  4CC7 A;  3V7R A;  1WXT A;  3M53 A;  2RQU A;  5HCK A;  1W2B S;  4M77 E;  3G6E Q;  4P5N A;  3A8M B;  3MHX A;  2SEM A;  2LX9 A;  1JB0 E;  3L2V A;  4PJO F;  1PKS A;  1JU5 C;  4JJN K;  4A4H A;  3QHS A;  4CC3 A;  2VWF A;  1TUC A;  2KMT A;  1S72 A;  1ZSZ B;  3E1S A;  2CYZ B;  2CGH A;  1WQ7 A;  2RHU A;  1H3H A;  4EMK C;  3QBY A;  2KQW A;  5GAN d;  1I07 A;  5J3B A;  3MP1 A;  4IUR A;  4OF1 A;  3M0S A;  2O88 A;  5KYU A;  1QLY A;  3OW2 A;  1UJY A;  4Q5W A;  1KHC A;  2JMA A;  5DM7 R;  4KGX B;  4PJO D;  2AHJ B;  5CK9 A;  1HJD A;  1YCS B;  2FPF A;  3IQL A;  1VQK A;  1MMA A;  1LPL A;  1KG1 A;  1YJN A;  4XTW A;  1VQ7 A;  2YT6 A;  1G3Y A;  2FG0 A;  2FL7 A;  2AT1 B;  1N27 A;  2FZG B;  2OTJ A;  2I0N A;  1QCN A;  1MV3 A;  1GBQ A;  3G1J A;  3M58 A;  2KYB A;  2R57 A;  4LXC A;  3KBG A;  4EMK A;  1IHV A;  2DPP B;  5GAO r;  3NMZ C;  2QQB A;  2E64 A;  5GAM h;  2LJ0 A;  1BYM A;  1SSF A;  3JCM h;  2HL5 C;  1OUL A;  2MWP A;  4J9G A;  3QJY A;  2J6O A;  5D6X A;  1FWZ A;  5GAM j;  1D1A A;  2LNH B;  2O01 E;  4RG2 A;  2PVG B;  1YJ9 T;  4PK4 A;  2X4X A;  1TS9 A;  1CKA A;  2IIM A;  1X6G A;  4E7K A;  4PFZ A;  4FIB A;  2KVQ G;  3UPU A;  2DIQ A;  1WA7 A;  3T9N A;  2XI9 A;  1QMC A;  4L6V 5;  2RHZ A;  3TSW A;  1D0X A;  1QWE A;  2HL3 A;  3JSC A;  4M75 C;  1X01 A;  1WJQ A;  2O31 A;  4A53 A;  1AZG B;  1QVG A;  1S72 Q;  2RB6 A;  4RMO A;  2LCC A;  1ABQ A;  3VS4 A;  2ZPF B;  3X24 B;  1NLO C;  2FYK A;  1NBE B;  4OVA A;  2CT4 A;  3HRT A;  3EGU A;  3PTA A;  2KGT A;  2XDP A;  1B3Q A;  4M78 A;  1T3L A;  1U5S A;  2DJZ A;  2EWN A;  1PSF A;  3GIB A;  1VQK Q;  5L23 A;  3CC2 T;  1QKW A;  4FW1 A;  1YJN Q;  2MPX C;  4D6W A;  5KE3 A;  2J6F A;  1PKT A;  4FW2 A;  1RAI B;  4OML A;  3X28 B;  4F7U B;  3PGG A;  4HA8 A;  2OTJ Q;  2PUK B;  2KRO A;  2DFU A;  2B8A A;  4KGV B;  4ZNX A;  4WTO B;  2K5F A;  1GL5 A;  2D6F A;  1H92 A;  1RAH B;  1RAG B;  4EMK B;  3FIF A;  3O8V A;  5LJ5 h;  2LQ8 A;  2GNC A;  4IKF A;  1BI1 A;  3CPW A;  1H3Z A;  2DE0 X;  4N4G A;  4PNO A;  4F04 B;  4C92 A;  2E41 A;  3CCL T;  3CCJ T;  3OSV A;  2OJ2 A;  1U8R A;  3A8G B;  3JB9 G;  3CMA Q;  4EMH A;  1WHL A;  3PMI A;  2XKO C;  3SWN C;  2EQK A;  1RL2 A;  1VYV A;  4CI0 C;  4JJB A;  2COZ A;  1VQ8 A;  2I2L A;  1XJW B;  3LYI A;  1G5V A;  4F16 A;  3TU4 K;  2EGA A;  1AOJ A;  3HP9 A;  3JRZ A;  4BY6 C;  2DRK A;  4ZTJ A;  4F7U G;  4M7D G;  3RES A;  1M2V A;  1PCX A;  2DNU A;  4GY5 A;  1G3T A;  1B34 A;  2KY9 A;  2QEX Q;  3TVT A;  1QCF A;  5LJ3 e;  3CCS T;  5LJ3 g;  2MOX A;  4M7D E;  4FT2 A;  5LL6 S;  1WGS A;  3TRE A;  4M7A C;  4PJO C;  3CCE T;  2KNB B;  2HQH A;  3VUZ A;  8ATC B;  4II1 A;  1UGQ B;  2RN8 A;  2RQT A;  1M8V A;  1JO8 A;  4HT8 A;  2DXU A;  3E9F A;  1WHG A;  4JJC A;  3OYC A;  1KFZ A;  1VQO T;  2ZPE B;  2F5T X;  1NPP A;  1GBR A;  1VQ9 A;  3NTH A;  2L3R A;  1VQL A;  2E1H A;  1Q82 C;  1D1B A;  2E12 A;  2DYI A;  2JJ9 A;  4MZT A;  1IHW A;  2RJE A;  1OX8 A;  5GAO n;  4PJN A;  2HKQ B;  1E6G A;  3BE3 A;  3RKW A;  2EQM A;  2L3S A;  4M7A A;  1G3S A;  2W0Z A;  1PRM C;  1VQN A;  2KK4 A;  4EMG A;  3EG3 A;  3M0P A;  3OA6 A;  2CZ0 B;  4IUQ A;  2L89 A;  1M1K C;  5GAN e;  1AT1 B;  3O5Z A;  2P4R A;  4LD9 K;  5GAN g;  1KSW A;  1BCM A;  2H3J A;  1NLP C;  5A0G A;  4IIO A;  2YUO A;  2DMO A;  2E4H A;  4DBH A;  1VQ6 T;  2F2X A;  2L3P A;  1I5O B;  1TH7 A;  3OBY A;  4JS4 A;  1RI0 A;  2OI3 A;  2A28 A;  4J9I A;  1U3O A;  2RHY A;  2CT3 A;  6AT1 B;  1VQ8 Q;  2Y4Y A;  1SEM A;  4QT7 A;  3PT9 A;  2LZ6 B;  4C8Q G;  1BK2 A;  3RDV A;  5FW9 A;  5GAN 8;  4NL2 A;  2RO0 A;  2OTL A;  2BKD N;  1Y96 A;  4BB7 A;  4J6X A;  3FC3 A;  1WXB A;  1Q86 C;  2MAM A;  3NPF A;  1IXD A;  4M75 G;  5IHI A;  4Z88 A;  4C8Q E;  3H0I A;  2FRY A;  1MGQ A;  1M2V B;  3FLG A;  3OW2 P;  4Y91 A;  2WSE E;  4J6W A;  2RQW A;  4E7I A;  4AFU C;  4BDY A;  1BU1 A;  4DBR A;  5GAO q;  3OS1 A;  4M75 E;  5I11 A;  2VXF A;  3OYH A;  5KE2 A;  2R5M A;  2JTM A;  3SWN B;  1GCQ C;  2ATC B;  2FZC B;  3TSZ A;  5FU6 C;  3UA6 A;  3CCV Q;  1R0C B;  1UEC A;  2JUF A;  4KH1 B;  3EFS A;  1YIJ A;  4FSX A;  1NYG A;  2DBK A;  1VQ9 Q;  3VV0 A;  1VQL Q;  3HKS A;  2IVW A;  2QQS A;  3GNF B;  1QW1 A;  2FO0 A;  4JZ3 A;  3HRU A;  2FPD A;  1NPR A;  2JT4 A;  3OBW A;  4KUD K;  3CBO A;  3OYG A;  2RM4 A;  2YLB A;  4J6Y A;  3UWN A;  1UDL A;  2HNI A;  3OS0 A;  1VQM A;  4BE2 A;  4LE9 A;  2KYM A;  3EAE A;  1UGV A;  1ZX6 A;  3JB9 I;  4M78 F;  3L1A A;  3SB2 A;  1D09 B;  4M7A B;  3M0T A;  1Q82 U;  2RJD A;  1T0H A;  4TVR A;  1PG5 B;  2A08 A;  2LP5 A;  3M0U A;  2DTH A;  2H3E B;  2KRS A;  2NWM A;  3X26 B;  3PE0 A;  3NFC A;  1RI9 A;  2DA9 A;  3X25 B;  2V1R A;  4N0A C;  1RAB B;  4FYV B;  4ATO A;  5GAN f;  4OMO A;  4J9B A;  1VUB A;  2FHD A;  2DAQ A;  1H8K A;  2E10 A;  1M1K U;  3JCM d;  4AT1 B;  2VKN A;  3LGL A;  2CH4 A;  1QVG P;  2O2O A;  1YJW T;  2JN0 A;  3QUI A;  4M78 D;  3I56 A;  3MEW A;  2D9T A;  5CAI A;  3ULR B;  5KCO A;  2OTL Q;  1Q82 R;  3PMT A;  3CD6 T;  2A0F B;  2RH2 A;  2R58 A;  2X4J A;  2GCX A;  2JS2 A;  1R0B G;  1IO6 A;  3EGX A;  4C92 F;  1Y96 B;  2GGR A;  2QI2 A;  1WXU A;  3V8K A;  1YN8 A;  2RPN A;  4N0A A;  3X20 B;  3BW1 A;  1GCP A;  1RAC B;  2RF0 A;  3LGF A;  1Q86 U;  4PJO G;  2A36 A;  4DA4 A;  1QVF A;  1M1K R;  1K9A A;  2LRQ A;  4R56 A;  7AT1 B;  3OYK A;  2CP7 A;  2KE9 A;  5DLO A;  3UDC A;  1SF9 A;  2KDS A;  3WXM B;  3MEV A;  4OGE A;  4PJO E;  1PC0 A;  1W4S A;  4LDY A;  2ABL A;  1YIJ Q;  4C92 D;  1N8R C;  3EFO A;  4Z89 A;  3CCU T;  4YTL A;  1TXQ A;  3M4Y A;  1PD0 A;  3L2Z A;  1VYT A;  1MMG A;  3JCM W;  2RHI A;  2ZGW A;  1K8A U;  1UEB A;  3CPW P;  1ZBJ A;  4OP0 A;  1V1C A;  5LJ3 d;  1Q86 R;  2HAX A;  1I4K 1;  2VXE A;  1YHQ T;  4HCZ A;  1ZLM A;  3HSB A;  1TU0 B;  5GMK m;  4IIM A;  2NLU A;  4C5I A;  3PIP A;  1I5L A;  1Q81 C;  3KUF A;  2DX1 A;  3I35 A;  3OS5 A;  5FU6 B;  3D7S B;  1OU9 A;  2DER A;  2CDT A;  3I55 T;  1U06 A;  5LJ5 d;  1Z9Q A;  2AKL A;  2ZPH B;  3MEU A;  1KHI A; 
#chains in the Genus database with same CATH homology
 5GAM f;  1QVG A;  4BAC A;  3GOX A;  4IUP A;  2PVO B;  2RB6 A;  4RMO A;  4RCC A;  1O9S A;  1M90 C;  4C0D B;  2LCC A;  4PKC C;  4M7A F;  4QW2 A;  1NJI C;  4JS5 A;  2ZPF B;  3OYJ A;  3X24 B;  2DK3 A;  3PNW C;  4C8Q B;  3C94 A;  1JBM A;  4BUG A;  2FYK A;  2OAU A;  3QO3 A;  3QZ9 B;  5HK0 A;  2LDM A;  4OVA A;  3S3M A;  1K9M U;  1R8O B;  2LC4 A;  4J83 A;  2E65 A;  5DY9 A;  3HRT A;  5GAM d;  3QXE B;  2EFI A;  2GQV A;  2EQU A;  2XDP A;  3PTA A;  2LTO A;  1FXX A;  4ELZ C;  1GXI E;  3MET A;  2DTI A;  2VC8 A;  4A4K A;  4M78 A;  4JLG A;  1QVF S;  2DVE A;  3CPW S;  3CC4 T;  4M75 B;  2DXT A;  3JCM c;  1VQ8 T;  3JB9 F;  2MWO A;  4E7L A;  3RIR A;  2DJZ A;  2EWN A;  1PSF A;  2EJF A;  3MCA B;  4LD6 A;  4MZP A;  3GIB A;  3GNG A;  1YHQ A;  3E9G A;  3CC2 T;  5CR2 A;  4XTZ A;  1YJ9 A;  4PJO A;  2ZPI B;  2JOY A;  1H64 1;  4D6W A;  5KE3 A;  1WJR A;  3X28 B;  4F7U B;  3OYY A;  3PGG A;  4HA8 A;  3C12 A;  2PUK B;  3DLM A;  2DIG A;  4LDW A;  4C0G A;  4M7A D;  3ZBD A;  3OQ5 A;  2B8A A;  3QKJ A;  4NL3 A;  4BDZ A;  1VQ5 A;  1I8F A;  4M78 G;  1VIF A;  2RD1 A;  4F7U F;  1VQP A;  1JJ2 S;  2K5F A;  4M7D F;  4HKE A;  1KC8 U;  2YLC A;  1EIF A;  4OGC A;  4RKU E;  2D6F A;  2M16 A;  2LT1 A;  4MDW A;  4CRI A;  1ZHI A;  4EMK B;  3I55 A;  3FIF A;  3O8V A;  3WVE B;  5LJ5 h;  3EFR A;  2MMP A;  4J5Y A;  4M7A G;  4A54 A;  2K2V A;  2LQ8 A;  4IKF A;  5IN1 A;  3TEE A;  3QG1 A;  1G3W A;  2QTX A;  1VIE A;  3JB9 D;  4M78 E;  3VKI A;  1BI1 A;  1K73 C;  3CPW A;  4NOY A;  5GMK e;  4OB0 B;  1H3Z A;  3CC7 A;  4N4G A;  4PNO A;  3JB9 J;  3HHT B;  4C92 A;  4FU6 A;  2XDB A;  3G71 T;  2E41 A;  1BKB A;  1IRE B;  1D3B A;  2F69 A;  2EJG A;  3CCJ T;  2RI5 A;  3CCL T;  2P0Q A;  3OSV A;  1N9R A;  3QDR B;  4M77 B;  5A2Q E;  3CCV T;  1U8R A;  3A8G B;  2XHC A;  4HT9 A;  4M7A E;  3V7C A;  5CQY A;  5CKH A;  1KQ1 A;  3H6Z A;  3HFN A;  3JB9 G;  2VGN A;  4PLL A;  4EMH A;  3PMI A;  2P0K A;  2XKO C;  2EQK A;  4JLI A;  3SWN C;  3LH0 A;  1VQ9 T;  1N8R U;  1RL2 A;  3QYH B;  5I21 A;  3SFM A;  4CI0 C;  1VQM T;  4EPC A;  5EG2 A;  1N6A A;  1V29 B;  4ME7 A;  1KD1 U;  1VQ8 A;  2DO3 A;  2I2L A;  2V8I A;  2YRV A;  3VUB A;  3JCM b;  2XIC A;  2L8D A;  2QQR A;  1XTD A;  4M7D D;  4UC4 A;  3LYI A;  1BIB A;  1QVG S;  1G5V A;  4WF2 A;  2JNG A;  3TU4 K;  5FLX E;  4HCC A;  5HK3 A;  3L42 A;  3JB9 H;  3CCM T;  4R55 A;  2DZ9 A;  4EDU A;  3HP9 A;  3JRZ A;  4C92 G;  2F5K A;  3CMA A;  3AHU A;  4BY6 C;  4C5H A;  4X9D A;  3QJ6 A;  2XDD A;  2D0Q B;  2X35 A;  1UGS B;  3CCR T;  4BE0 A;  4ZTJ A;  4F7U G;  3CD6 A;  4M7D G;  3RES A;  2QQ9 A;  3QSU A;  4PLI A;  3RKX A;  2CZ1 B;  5GAO m;  3QZ5 B;  4GY5 A;  1G3T A;  5IAY A;  1B34 A;  2KY9 A;  2M0O A;  3G6E T;  4M78 C;  1YCY A;  4C92 E;  5LJ3 e;  1S72 T;  2FVU A;  5LJ5 f;  3JCM J;  3CCS T;  2K5I A;  3INZ A;  1M1G A;  5LJ3 g;  1K8A C;  4HCB A;  1VQN A;  1Q81 U;  3H8Z A;  4J7I A;  3OY9 A;  4M7D E;  4FT2 A;  5LL6 S;  1WGS A;  1U1T A;  5CIU A;  3M55 A;  3TRE A;  3CBP A;  4JRP A;  2WSC E;  2DD4 A;  4M7A C;  3MEA A;  5HY6 A;  4BI4 A;  4PJO C;  4JUV A;  3CCE T;  4BY6 B;  3VUZ A;  5C6S A;  1WPY A;  4XTX A;  3OYD A;  4OMF B;  3DLL A;  3JCM P;  1VQ4 A;  4BI3 A;  4DOV A;  2QEX A;  4E7J A;  4II1 A;  1UGQ B;  5FU7 C;  3G71 A;  1BI2 A;  2VGM A;  2WSF E;  5FRN A;  1M8V A;  4HT8 A;  3CCL A;  2XU8 A;  3CCJ A;  2RHX A;  3VJP A;  5DLQ E;  3SD4 A;  3RKY A;  1XQH A;  2DXU A;  3E9F A;  1M90 U;  4ZN3 A;  3OYC A;  3OYN A;  3BFM A;  5CCA A;  1VQO T;  3VYH B;  1NJI U;  3FB9 A;  2ZPE B;  3N5B B;  2F5T X;  3DB3 A;  4C5E A;  1NPP A;  3VU3 C;  1VQ9 A;  1X6O A;  3NTH A;  2VV5 A;  3RUX A;  4C0F A;  2E6Z A;  3OMC A;  2DTO A;  1KQS A;  2L3R A;  4KUD K;  1VQL A;  2E1H A;  3HPW A;  3CCU A;  2VUB A;  4BD3 A;  1VQ7 T;  2OTL T;  1U1S A;  1Q82 C;  2BIV A;  4C8Q F;  4PJO B;  2E12 A;  5L8R E;  3CCM A;  4XK8 E;  4FL6 A;  5GAO r;  2P0P A;  5GMK j;  4MZT A;  3L2Q A;  2RJE A;  2PUO B;  5GAM e;  4C92 C;  3GPL A;  3JCM X;  5GAO n;  3CCR A;  2RK2 A;  1OYX A;  3M59 A;  2K3X A;  1PSE A;  2EQM A;  3RKW A;  3HFO A;  1G3S A;  4M75 F;  4M7A A;  4IUT A;  2CKK A;  5CKF A;  1M4Z A;  3J7A F;  3M4G A;  4M7D C;  1M9S A;  3JCM e;  4OB3 B;  2V8K A;  3L2U A;  1OZ3 A;  2KK4 A;  3A8O B;  4IUU A;  2DEQ A;  4MML A;  1BI3 A;  3JCM g;  3V8J A;  4EMG A;  4QQG A;  4L59 A;  3G6E A;  1Y71 A;  4XU1 A;  2O4X A;  2RJF A;  3OA6 A;  2CZ0 B;  4IUQ A;  1WNL A;  2L89 A;  2DZC A;  5GAN e;  3CCS A;  2PU9 B;  1Q7Y U;  1M1K C;  4QVC A;  4LD9 K;  4Z02 A;  1ZBX A;  2K5L A;  5GAN g;  2H3J A;  2IG0 A;  2LNV A;  5A0G A;  3E19 A;  2G3R A;  3CXC A;  3RMQ A;  4N4H A;  3OYL A;  2RA2 A;  3FJP A;  3LW5 E;  1UB4 A;  4XQ3 A;  3CCE A;  4N4I A;  1VQ6 T;  4Y28 E;  3V8L A;  1M5Q 1;  4C8Q D;  1D3B B;  1TH7 A;  3OBY A;  5I2M A;  1QP2 A;  5GAN 5;  4JS4 A;  4ZN1 A;  3CCQ T;  1RI0 A;  1YIJ T;  3A8L B;  1W2B A;  5CKD A;  3NTI A;  4ZGJ B;  2RHY A;  1K73 U;  5GAN 3;  3FRN A;  2KSS A;  1QVP A;  2Y4Y A;  4FM4 B;  4XU0 A;  2X4W A;  3PT9 A;  3S6W A;  1AHJ B;  2E6N A;  4M75 D;  1FX7 A;  4LDX A;  5FRM A;  3CEY A;  3G7Z A;  5LJ3 j;  4C8Q G;  3J80 E;  2ZCF B;  4F7U A;  2EJ9 A;  4M7D A;  5GAN 8;  4NL2 A;  2R5A A;  1HK9 A;  2K3Y A;  2HD0 A;  2RO0 A;  4C0Z A;  2BKD N;  3GLX A;  2OTL A;  2GFU A;  5CKB A;  3JAM E;  3OYF A;  1Y96 A;  4BB7 A;  2M9U A;  4J6X A;  3FC3 A;  2E5Q A;  4GLK A;  1Q86 C;  3PFS A;  2MAM A;  4M77 F;  2GFA A;  4L5G A;  2M1H A;  3CC4 A;  3DB4 A;  1S72 A;  4M75 G;  4ELY C;  5AYF A;  4C8Q E;  1MGQ A;  1ZQ1 A;  3FLG A;  2ZPG B;  4Y91 A;  4J8O A;  2WSE E;  5D6W A;  2HQX A;  1Y07 A;  4J6W A;  2LCL A;  3OYE A;  3CC2 A;  2CS7 A;  5CKE A;  2QQA A;  3RMS A;  3BDL A;  5GMK i;  4E7I A;  4BE1 A;  3KXT A;  2MI6 A;  5HKC A;  4BDY A;  3OS1 A;  4JRQ A;  1OI1 A;  3M54 A;  5GAO q;  3URG A;  3P8H A;  4M75 E;  1KQS S;  2JTF A;  2PQW A;  2RJC A;  2VXF A;  3OYH A;  3FDR A;  5KE2 A;  3NTK A;  4B9X A;  2EKO A;  3SDZ A;  2KAF A;  2R5M A;  2JTM A;  3SWN B;  1YIT T;  1P92 A;  2QA4 T;  5M9O A;  2QDY B;  1JRI A;  4XU2 A;  2XG8 D;  4XTY A;  5KCH A;  1KQ2 A;  1M1F A;  5FU6 C;  3PIO A;  2PVD B;  4B9W A;  1VQ6 A;  4F7U E;  5GAN 6;  2DXB A;  4ZGE B;  4PL6 A;  2DXC A;  2JUF A;  3EFS A;  4M77 D;  3OB9 A;  3CCQ A;  4FSX A;  1YIJ A;  5KH6 A;  3MO8 A;  4A4E A;  1YI2 T;  3G4S T;  4QVD A;  5FRO A;  3I56 T;  4DOW A;  3FEO A;  3VV0 A;  2YHT A;  1YBY A;  2IVW A;  2MF2 A;  3HKS A;  2ZZD A;  1HXD A;  2EAY A;  3ME9 A;  2QQS A;  3GNF B;  3QII A;  1QW1 A;  2RI3 A;  3LLR A;  4LDU A;  5CQX A;  2P4T A;  4OB2 B;  5GAO l;  3RER A;  1OZ2 A;  5A0D A;  4MMK A;  3HRU A;  5GMK l;  3CCV A;  4XTV A;  2A7Y A;  5GAN j;  5J26 A;  1NPR A;  4M77 G;  5GMK h;  2DD5 A;  4C8Q C;  3P8D A;  4E7H A;  3F70 A;  2HBP A;  3OBW A;  3CBO A;  3HRS A;  3Q1J A;  4M78 B;  3A5Z B;  3OYG A;  2EYQ A;  3CXC S;  2RM4 A;  2YLB A;  2FB7 A;  4J6Y A;  5LJ5 e;  4QVZ A;  3UWN A;  2HNI A;  3OS0 A;  1VQK T;  3MP6 A;  1BIA A;  4C5G A;  2GF7 A;  2VYT A;  2EQJ A;  3JCM V;  5LJ5 g;  2XD0 A;  4KT0 E;  1VQM A;  4BE2 A;  3V7R A;  1YJN T;  3EAE A;  3JB9 I;  4IUV A;  4M78 F;  3M53 A;  3L1A A;  3SB2 A;  3M5A A;  4M7A B;  2JZ2 A;  3OYM A;  1W2B S;  1Q82 U;  4M77 E;  2RJD A;  3ASK A;  4P5N A;  4TVR A;  4VUB A;  2OTJ T;  3A8M B;  3CME T;  2HQE A;  1LOJ A;  3MHX A;  3LWH A;  1UGR B;  2DKG A;  2LX9 A;  2LQK A;  3CPF A;  5FU7 B;  2DTH A;  1JB0 E;  3CC7 T;  1LNX A;  3L2V A;  2O4X B;  3X26 B;  4PJO F;  2C06 A;  2XID A;  4O5V A;  5GAM g;  3P8B B;  3JCM f;  1MHN A;  4JJN K;  3VYG A;  4LDV A;  3NFC A;  3QYG B;  1K9M C;  3X25 B;  4A4H A;  2JVV A;  3QHS A;  4N0A C;  1LJO A;  1YIT A;  4ATO A;  3UT1 A;  4XU3 A;  5GAN f;  2QA4 A;  2Y90 A;  2EIF A;  1VUB A;  3HL8 A;  2RI2 A;  2FHD A;  2KMT A;  2X4Y A;  2DAQ A;  2K57 A;  2E10 A;  3E1S A;  2CYZ B;  1XNI A;  3OSS C;  4X9C A;  4C8Q A;  3JCM d;  1M1K U;  2WAC A;  2CGH A;  4JRI A;  1WQ7 A;  2RHU A;  4A4G A;  1N9S A;  3A8H B;  3LGL A;  4EMK C;  3QBY A;  2CZ7 B;  5LJ3 h;  1YI2 A;  2KQW A;  3C4S A;  5GAN d;  3L2R A;  3G4S A;  1YJW T;  1X75 C;  2JN0 A;  3QUI A;  4M78 D;  3MP1 A;  5J3B A;  3I56 A;  4C92 B;  4KUI A;  3MEW A;  1DJ7 B;  2D9T A;  4IUR A;  4A4F A;  4BI8 B;  4OF1 A;  1NZ9 A;  5CAI A;  5KCO A;  4M75 A;  3CMA T;  3OW2 A;  2LVM A;  3M56 A;  3PMT A;  4KBM B;  4Q5W A;  2RH2 A;  5CVI A;  4ZTF A;  2R58 A;  2X4J A;  3CD6 T;  2GCX A;  4M7D B;  4QQ6 A;  2BUD A;  3GF5 A;  1KHC A;  1Q7Y C;  4C92 F;  1Y96 B;  5DM7 R;  4J7F A;  1NE8 A;  5J39 A;  2AHJ B;  4M77 C;  5CK9 A;  4PJO D;  4NS5 A;  2QI2 A;  1VQO A;  1KC8 C;  1VQK A;  3BDU A;  1KG1 A;  3GP8 A;  3M9Q A;  3V8K A;  1BI0 A;  1YJN A;  4XTW A;  1VQ7 A;  1I81 A;  4N0A A;  1G3Y A;  5GAN 4;  3JCM Q;  3X20 B;  2V8J A;  3BW1 A;  4FT4 A;  2FL7 A;  1N27 A;  2A3L A;  3LGF A;  3OYA A;  4RG8 A;  1Q86 U;  3S3N A;  4PJO G;  3OYB A;  2OTJ A;  4DA4 A;  3CME A;  1QVF A;  1O75 A;  4V2S A;  2K4Y A;  5CO7 A;  1IZ6 A;  2LRQ A;  3M58 A;  3ZFJ A;  4R56 A;  3L2W A;  1VQ4 T;  2QEX T;  2ZPB B;  3OYK A;  2R57 A;  3KBG A;  4EMK A;  2DPP B;  2CZ6 B;  4KUL A;  5DLO A;  3UDC A;  3WVD B;  1XOV A;  1B34 B;  2KDS A;  3ER0 A;  3WXM B;  5C0M A;  2QQB A;  4XAX B;  2E64 A;  3MEV A;  4OB1 B;  4OGE A;  5GAM h;  3LX7 A;  4PJO E;  1W4S A;  5LJ5 j;  3J81 E;  4LDY A;  1BYM A;  1SSF A;  4C92 D;  1N8R C;  5D6Y A;  3JCM h;  1VQL T;  1KD1 C;  5LJ3 f;  3ZEH A;  3CCU T;  4M77 A;  4YTL A;  3M4Y A;  2MWP A;  3L2Z A;  3QJY A;  4O6J A;  3JCM W;  3S3O A;  1JJ2 A;  1WQW A;  2RHI A;  5GAN h;  2ZGW A;  1YJW A;  4MDX A;  3MP8 A;  1K8A U;  1UEB A;  5GAN 2;  5D6X A;  1FWZ A;  3C95 A;  5GAM j;  1WJS A;  3R6O A;  3QPH A;  4OP0 A;  3LWI A;  5LJ3 d;  4RCB A;  2HAX A;  2O01 E;  1I4K 1;  2VXE A;  4RG2 A;  2PVG B;  3BY7 A;  4HCZ A;  1YHQ T;  3OS2 A;  1YJ9 T;  3HSB A;  4MZM A;  2X4X A;  1QP3 A;  4E7K A;  4DQ2 A;  1VQN T;  4FIB A;  2KVQ G;  3OYI A;  5GMK m;  4C0D C;  3CBM A;  2NLU A;  3UPU A;  4ZGD B;  4C5I A;  2DIQ A;  3PIP A;  1I5L A;  5I2S A;  3T9N A;  1VQ5 T;  1Q81 C;  2XI9 A;  3KUF A;  5GAO p;  5GAN 7;  1VQP T;  2L5Q A;  2QXF A;  3OMG A;  3OS5 A;  5FU6 B;  5IT9 E;  2LT4 A;  2XK0 A;  4QQD A;  4X34 A;  3SWN A;  4E47 A;  3M57 A;  4XTU A;  3DKM A;  4JDS A;  2RHZ A;  4L6V 5;  3TCJ A;  2RK1 A;  4JRK A;  2Y4X A;  3OW2 S;  2E70 A;  3JSC A;  3I55 T;  4M75 C;  5LJ5 d;  2ZPH B;  3MEU A;  1X01 A;  3V7S A;  1UGP B;  1WJQ A;  1Y7X A;  5A0L A;  1KHI A;  4A53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...