4M78C

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 10
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78C00
5GANd 5LJ3d 5GAOl 4M78B 3L2ZA 5LJ3h 3SWNB 4M78G 5GAN5 1D3BB 1I5LA 4RCCA 5GAMd 3GIBA 4M75D 4M78D 2VC8A 4JUVA 2E65A 1KQ1A 4PJOG 5GAN4 4XU1A 2E64A 4M75B 5GAN6 4PJOD 4M75G 2DTOA 3BDUA 1I8FA 4M7AD 5GAOp 2DJZA 2RA2A 5GANh 3PGGA 2I2LA 4EMKB 4M7AB 4C92B 2DXUA 3QUIA 3V7SA 2DXTA 1Y96B 4C92D 5GAOn 4C8QD 4HT8A 4C8QE 4XQ3A 5LJ3g 5LJ5f 3V8LA 5CAIA 1WQ7A 3EFSA 4N0AC 4M77F 4C92A 2DZ9A 3HSBA 5GAMg 5GMKh 3RUXA 1U1TA 4M75E 4JLIA 2EJFA 4JRKA 1M8VA 2DKGA 1LJOA 5GMKe 3JCMP 4M77C 5GAN8 2RB6A 4XTVA 4XU0A 1WQWA 3JCMX 1WNLA 2DZCA 4HA8A 4M77D 3JCMW 3RIRA 3JB9G 4XTWA 4M7DB 5LJ5h 4M7DG 1LNXA 3JCMd 1I81A 2QTXA 3BW1A 2DTHA 5GANf 2E10A 4M77B 3EFRA 5LJ3f 4M77G 3JCMh 1N9SA 4C92G 5GAMe 5LJ5e 5GMKl 4M7AF 1Y96A 1M5Q1 3HFOA 2EWNA 3QHSA 3V7CA 4XTXA 4PJOF 2EJGA 3HFNA 3INZA 4QVDA 3RERA 3RESA 4M75F 4J6WA 3AHUA 3JB9H 4C8QC 1BIBA 4M7DA 4OP0A 4C92C 4EMHA 4EMKC 4F7UE 3JB9F 4EMKA 3JB9I 1MGQA 5LJ3e 3JCMc 5GAOq 5GANj 1H641 1TH7A 4PJOE 5LJ5j 1U1SA 3BY7A 4M77A 4X9DA 3V7RA 4C92F 4M7AG 4X9CA 3RKWA 4NOYA 4F7UF 4MMKA 4M7AC 4M7DE 2VXFA 4XU3A 4QVCA 4M77E 3SB2A 4RCBA 3JCMJ 2VXEA 4M78E 4J5YA 3SWNC 3JCMg 3RKYA 2EJ9A 4M78C 4M75C 5I21A 2CGHA 3QO3A 4M78A 4XTZA 4C8QA 5LJ3j 5LJ5g 1B34A 3RKXA 5GANe 1JBMA 3VU3C 3JCMb 5GAMf 2DTIA 2HNIA 5GAMj 3BFMA 4M7AA 4F7UG 1JRIA 2YHTA 4Y91A 5GAN7 5GAOm 3JB9D 3FIFA 3QSUA 4PJOA 5GMKm 4V2SA 4M7AE 1N9RA 2DEQA 4M75A 4A54A 4M7DF 5GMKi 1HXDA 2DVEA 2E1HA 3FJPA 4PNOA 3JCMf 4C8QG 5GAN2 2K57A 3JCMQ 5GANg 4PJOC 2ZGWA 4A53A 1BIAA 3JCMV 1LOJA 2RM4A 4C8QB 4M7DD 4XTYA 5GMKj 1I4K1 1X01A 4EMGA 4XTUA 4F7UA 2RD1A 2FYKA 4J6YA 2JN0A 5LJ5d 4JRIA 4J6XA 1YCYA 4DQ2A 2E41A 1B34B 3JCMe 3V8JA 1D3BA 5GAOr 3SWNA 1KQ2A 4M7DC 2EAYA 4M78F 3FB9A 2YLBA 3L1AA 4C8QF 4MMLA 5GAN3 5GAMh 4NL2A 1HK9A 4WF2A 4F7UB 4PJOB 4XU2A 3V8KA 2Y90A 3JB9J 5DY9A 4C92E 2YLCA 1WPYA 3M4GA 4NL3A 4HT9A 2FB7A 4N0AA
chains in the Genus database with same CATH superfamily
2M0OA 3CCEA 1XTDA 1UGVA 4OMNA 1JXOA 3QDRB 4XU1A 4JS4A 1I8FA 1VQLQ 2HSPA 1MV3A 1HD3A 5LJ3g 3EGXA 2H8HA 1YITA 3WVEB 3EH1A 4M75E 4JLIA 2LX9A 1N5ZA 3QZ5B 3JCMX 1OPLA 3OS1A 3I55T 3HRTA 1SKUB 2K5IA 3CCSA 3EFRA 1WHGA 1Y96A 2MYSA 1VQKQ 2MIOA 1WXTA 1N8RR 4EMKC 5DM7R 3CCMT 5KE3A 4PJJA 3TCJA 2LP5A 4JJNK 3V7RA 3RKWA 4NOYA 1YI2T 2FPEA 4RCBA 2ZPIB 2V8KA 4CRIA 5GAMj 4CC2A 3LWIA 3TREA 4LUEA 1E6GA 2AT1B 5DLQE 2D1XA 1D0YA 4PNOA 2NUTA 2LT4A 1ZA1B 2K57A 3HP9A 4K11A 4RTTA 2RM4A 3NHNA 1W2BP 4OB2B 4NS5A 2V1RA 2DXCA 1FMKA 4RTUA 2R57A 1FXXA 3CBMA 2LX7A 2MWOA 4FT2A 1XOVA 1RABB 2COZA 3V8JA 3D7SB 2DL7A 3NFCA 2L3RA 1X2KA 4J7IA 4XU2A 2IVWA 3LW5E 5IHIA 2X3WD 2YLCA 3CCVA 4HT9A 3BE3A 2R58A 2L3PA 3SFMA 4MZMA 5M9OA 1K0SA 1UJYA 4M75D 3TEEA 1YJ9A 4OMFB 3CC2A 3JRZA 1AWWA 1QKWA 1ZA2B 1O75A 1WYXA 5KYYA 1PRMC 2HMAA 2KE9A 2HDAA 4KRTA 1UG1A 1OPKA 2CP5A 5A2QE 5FWBA 5IHKA 1F1BB 3CMEA 4Y28E 3A5ZB 3VS6A 2W10A 1YIJT 2D0NA 3OS0A 3CMAA 5HCKA 2D0QB 2D9TA 5A0GA 1M5Q1 4XTXA 2EJGA 1WA7A 4QVDA 2HBPA 4IUTA 2XMFA 3HRUA 4M75F 3JB9H 2KROA 3JCMc 3H0IA 2RHZA 2MCNA 1FX7A 1XJWB 3R6OA 5KYUB 5HKCA 1AZEA 5IXBA 2DO3A 3M55A 4AFQC 1RAEB 1WDXA 4DBFA 1KC8C 2VASA 1OX8A 2ED1A 1JRIA 2JTEA 1NM7A 1W6XA 2QASA 3NTIA 3L2VA 4DEXA 4PJNA 4FIBA 2F5TX 1VQ7Q 4FYWB 1UEBA 3OS2A 1PSEA 4P5NA 1M1FA 2JTMA 4HKEA 1VQ6T 2RD1A 3CC2Q 4AMCA 1YHQT 2P0QA 5IT9E 5ECAA 1YFNA 3T9NA 1WXBA 4M7DC 3SWNA 2F2WA 3CCJA 4PKCC 4WF2A 1D09B 2X3XD 1SHGA 1ZLMA 3O5ZA 4LXCA 3KFVA 2HEQA 1PNJA 2XKOC 2J6OA 3UA6A 5J3BA 2OX7A 2C06A 2M0YA 5GAN6 3BDUA 1NLPC 2HAXA 3EGDB 1ZUYA 4DOWA 1VYVA 4J8OA 2KI7A 4ZGJB 2L3SA 2DL5A 1K8AC 1VQNA 1WQ7A 4ZTFA 1T3LA 4LDVA 2RJCA 3EHRA 3C0CA 2RJFA 4GY5A 3JCMW 1IGQA 2LJ1A 5LJ5h 2HCKA 2QTXA 5CK9A 2E10A 4BUGA 3M0UA 2LCCA 3ULRB 3IQLA 3PMIA 3CCQT 4E7HA 5CKDA 1GFCA 3UDCA 2DD4A 3CMAQ 1PHTA 1K9AA 1M30A 4AG2C 3OYCA 4M7DE 5L23A 4J9GA 3REAB 1G3WA 2YUOA 2EW3A 2VWFA 3OYKA 1GBQA 2DTIA 3QG1A 4N4HA 4LN2A 5CKHA 1M8MA 5GAN7 3PVLA 1R0CB 4PJOA 5KYWB 3HKSA 4O6JA 3CCMA 5GMKi 4BD3A 4C0ZA 1TTHB 2QEXT 2AZVA 2E5KA 4F04B 2EGEA 5IXFA 2HQHA 5GMKj 1YI2A 5C6SA 1SRMA 4F7UA 1HSQA 4FYVB 1QVGS 4R56A 1B34B 3VS5A 1D3BA 2YXYA 5GAOr 2CDTA 1KD1U 2DMOA 1VQ9T 3V8KA 3R6NA 1G3YA 1NLOC 2LQKA 2HD0A 1K73U 2DVJA 4L5GA 1UUEA 3OMCA 4M78D 2VC8A 5GAN4 1Q7YC 4HCCA 1SSHA 5GANh 3VKIA 5KH6A 1VQKT 2KVQG 2LJ0A 4MZPA 1OYXA 3P8HA 1GCPA 5LJ5f 2DYIA 1W70A 1Q81C 4LNPA 2EPDA 2QYZA 1S1NA 2E6NA 4IIMA 2EJFA 3MCAB 1D1CA 3CC2T 1RI0A 2WSCE 1AOJA 2LQ8A 4M7DB 2A37A 1Q81R 5GANj 3BW1A 2QG9B 3GOXA 5FRMA 1PKTA 3I56A 3GBQA 3HFNA 4HVUA 4OP0A 2JS0A 3CPFA 4MDXA 3EFOB 1I07A 2M02A 2KNBB 2VXEA 2XK0A 2L0AA 4RTZA 5I21A 1SPKA 4KGZB 1JBMA 3VS3A 1PRLC 4KBMB 3VRZA 2OAWA 2G6FX 1X6BA 2JM8A 3G4SQ 3OMGA 3ME9A 1VIFA 2YUPA 1N9RA 3I55Q 1RAGB 4E7KA 3OYJA 3OYYA 3I56Q 1YJWA 4JLGA 3A8HB 1WHLA 4FSSA 2SEMA 4E7IA 3VUZA 4RMOA 4LDXA 1YP5A 4PJOD 2EAYA 5CIUA 2X4JA 4DBQA 3VUBA 3MEVA 2Z0WA 3OY9A 2A7YA 2MAMA 2A0FB 4A4FA 1YITT 3G7ZA 1KC8R 5LJ3d 3OYIA 4JRQA 1D3BB 2XU8A 3HPWA 4OMMA 3N5BB 2E65A 1QKXA 3I35A 5D6XA 1CKBA 2KT1A 2EGAA 3ZBDA 1WZOA 1M9SA 3LLRA 2Y4XA 2EQKA 4YTLA 5GAOn 4HT8A 2CP6A 1CSKA 5CVIA 1M1GA 3MJXA 2GNCA 4D6WA 2HL5C 3HSBA 3M9QA 1VQMT 2IIMA 2J6KA 4JRKA 3SHWA 2XI9A 2E70A 5I22A 1N6AA 3OYDA 1D0ZA 2KGTA 5LJ5e 1J3TA 3CC7Q 2L8DA 2D6FA 1QP3A 2DXBA 3CPWP 3H0FA 2FZGB 4BACA 4PFZA 3E1SA 1GBRA 5FROA 1MGQA 2CH4W 4C92F 1AWOA 4M7AG 1WJRA 3QJ6A 4ATOA 1OOTA 2CZ0B 3VS2A 1WHKA 3UWNA 1K9MU 1KK7A 3OBWA 3L42A 3GF5A 2QEXQ 1BU1A 1UB4A 2VKNA 2VYTA 2YRDA 4M7AA 4BE2A 2RNAA 3CCVT 1QVFS 2DERA 1KQSS 1LVKA 2BKDN 2BIVA 4E7SA 2R5AA 3UT1A 3LGLA 1UE9A 1GRIA 1OZ2A 4KT0E 3JCMQ 3MP1A 1X01A 2FPFA 4J9BA 1YCYA 2E4HA 3A8LB 2WACA 1HK9A 2X9HA 4LD6A 5KYXB 4DBHA 1P92A 1KHIA 2BZYA 2JTFA 1KD1C 1VQNQ 1PG5B 3M53A 1RL2A 2QEXA 3L2UA 2LQNA 2CKKA 3RR6A 2EYXA 3CCVQ 1X6OA 4M75G 3VYGA 2DJZA 2DA9A 2O9VA 2KRSA 2EIFA 2CZ7B 1WFWA 2XDDA 2CT3A 2QDLA 5FWCA 3VS0A 4JPBW 1YWPA 1VQ4Q 3ZFJA 2YRCA 1RACB 1HYOA 2X4WA 4D8DA 2ZPFB 1X43A 2EQMA 4BI4A 5GJWB 4HA8A 1GXIE 2QDYB 1M1KC 1WHHA 3EAEA 4M7AF 2RQWA 3OYGA 3CQTA 3NTHA 4DEYA 4QVZA 1C6VX 2P84A 2OAUA 4C92C 5LL6S 4BDYA 2MOXA 1Q81U 3S3OA 1BI3A 2DF6A 2YT6A 1BBZA 3JB9F 2PVOB 1TWBA 2OTJA 2ZPGB 2VVKA 2K2VA 3G1JA 4M77E 2VV5A 4OVAA 3JCMg 4OMLA 3OSVA 1AZGB 2MMPA 3LYIA 3NGPA 5KYWA 5GAOm 2F69A 1AWJA 3EG2A 4CC7A 1YWOA 2LMJA 1NJIR 3CCJQ 3MKDA 1PCXA 2DL3A 1Q82R 2EBPA 2KXCA 2A36A 3PE0A 1KG1A 1H8KA 2YLBA 1M3CA 4NL2A 4F7UB 1JB0E 1NPRA 1I5OB 1V1CA 4PK4A 5AT1B 2KAFA 1K8AR 3Q1JA 3QBYA 3FC3A 2QQSA 1PD0A 3CCEQ 3OYEA 1A0NB 2RK1A 1K1ZA 3OYAA 5HK3A 2GFUA 4OMOA 4QQDA 3QZ9B 2LT1A 5KE2A 8ATCB 1WGSA 4ZN1A 1MNEA 3HHTB 2DBKA 3PNWC 4UC4A 4RG8A 1NYGA 4AFSC 2PZ1A 3ZL7C 3OW2A 1U1TA 1KJWA 4PLIA 2CSQA 2C0OA 4FYYB 3O8VA 2RB6A 2FRWA 1W4SA 3SDZA 2RK2A 3MEAA 2COYA 2L2PA 4IIOA 2JVVA 3FEOA 2MF2A 3GP8A 4F16A 4M7DA 4J6WA 2NUPB 2V8JA 4JJCA 1TH7A 1U1SA 1G8XA 1Q7YU 1QVGP 2OTLQ 2JUFA 5CCAA 4PJLA 4CC4B 4R55A 3CCUT 3RKXA 2CUBA 2CZ1B 4BI3A 2X4XA 1S72A 1VIEA 1ZSZC 2DM1A 2VGMA 3FJPA 1H3ZA 5GAN2 4HCKA 1E7OA 5FU7C 3CC7A 2M16A 3JCMV 2P0KA 1X27A 2LCLA 1ZUUA 1U3OA 5CKEA 4EIKA 4JRIA 2RO0A 2ZPBB 3RNJA 1UJ0A 1QCOA 1X75C 1JJ2A 3CPWA 3UATA 2LQWA 3ER0A 3M4GA 2V8IA 1TOVA 1IGUA 2FB7A 3CCUQ 2K79A 3I9QA 2FG0A 3SWNB 4ZN3A 1S72Q 2PQWA 1WJQA 2DILA 2LC4A 2RA2A 2L89A 2ATCB 2DX1A 4M7AB 2ZPHB 3KUFA 3JSCA 3V7SA 2RQRA 3I56T 3OYBA 4LD9K 3JV3A 3CEYA 3CCRQ 4RTWA 2D8HA 4A4KA 3X20B 4HXJA 1XQHA 1JO8A 1LJOA 2GBQA 2XG8D 2B8AA 4M77C 5GAN8 3KXTA 1SRLA 1WQWA 1YITQ 3C12A 1M27C 3S3NA 5GANf 2JMAA 2EWNA 2O88A 2DL8A 1D1BA 3EGXB 4C8QC 2KRNA 1VA7A 4BB7A 2HQXA 4X9DA 1Q7YR 4Z88A 5CR2A 4X9CA 1YJWT 1W2BA 4ZGDB 2A28A 3VRYA 5HY6A 2RJDA 2DETA 3VYHB 2EJ9A 2F5KA 3QO3A 3JAME 4HVWA 1Y7XA 1VQOA 3JCMb 3HRSA 2HNIA 1IHVA 3FDRA 2QK0A 2F2VA 3A8GB 1AWXA 4J9CA 4J9EA 1HXDA 2ECZA 3UPUA 2ZGWA 1VQLA 1M2VB 2AIRB 2P4RA 4PFPA 5A0DA 2EGCA 5LJ5d 4J6XA 1OI1A 2JT4A 4JRPA 1GCQA 2LZ6B 3FB9A 4D8KA 3G6EQ 1VQ5Q 5FU6B 3CD6Q 2QA4A 2DEUA 1UTIA 1MNDA 1WLPB 3CXCA 3QIIA 1VYUA 2WSFE 4E47A 5LJ3h 1VQMA 2FVUA 2NWMA 1Y07A 1IXDA 5GAMd 1TS9A 2FPDA 1DJ7B 4LUDA 4M75B 2O31A 2RPNA 4A4HA 2DTOA 3QXEB 4M7AD 5GAOp 2CT4A 2I2LA 1TUCA 1Y96B 2HKNA 1R77A 3QYGB 1Q86R 3EFSA 3M58A 3H0HA 3VJPA 2QA4Q 4WTOB 1QCFA 1YHQQ 3FJ5A 2DZCA 2NYSA 2RMOA 3C94A 3M57A 3RIRA 3C4SA 1BCMA 3SEMA 2GQIA 2KBTA 1OU9A 4C0GA 4PJOF 1KQSP 1WJSA 3RESA 3CCMQ 3CXCP 2DRMA 2AHJB 4JDSA 1VQ8T 1H641 4AFUC 3X28B 5FW9A 2GTJA 4F7UF 4MMKA 4DOVA 4M7AC 4C5GA 3CXCS 3M0TA 1IHWA 2CGHA 1B34A 3FLGA 4B9WA 4OB3B 3QPHA 2EYQA 4FL6A 1YJ9Q 5GMKm 4MZTA 1M90C 1BYMA 1K0XA 1BIAA 1VQPA 1QLYA 2JS2A 4O5VA 1I4K1 3TSWA 4JZ3A 3EG9B 4XTUA 2CS7A 3X24B 4PJMA 3M4YA 3CCUA 1MHNA 4RUGA 3L1AA 5GAMh 3CC4Q 1M2VA 1MMGA 1RUWA 2JNGA 3H9NA 1WPYA 2LTOA 1ZSZB 3OSSC 3CC7T 3L2ZA 2J6FA 1BB9A 2DBMA 5CQXA 4QW2A 1FWZA 1VUBA 2KMTA 1WXUA 1IB8A 1NE8A 2F1LA 2CYZB 4KH1B 1IRXA 2I0NA 2JOYA 1XNIA 3E9GA 2CZ6B 2FO0A 4C8QD 4C8QE 2JJ9A 3GNGA 2V26A 4AT1B 2G3RA 3V8LA 2LNHB 3U23A 1H92A 2OTJQ 5GMKh 2OTJT 1GL5A 4OGCA 5A0LA 2DKGA 5FU7B 2A08A 4ELYC 4OB0B 5D7UA 3GPLA 1HJDA 4XTWA 1M4ZA 2DL4A 5I11A 2K7AA 3CD6T 1NEBA 1VQ9Q 1QWEA 3L2WA 1OU8A 4F7UE 2FEIA 5GAOq 2ZCFB 1M90U 1ZUKA 2MWPA 3THKA 1VQ6Q 2J7IA 3EHQA 1B7TA 4FCYA 2K2MA 1ABQA 2K6DA 3CBOA 3NTKA 1ZSZA 2P0PA 2CUDA 2XDPA 4J9HA 3OYFA 4IKFA 2PTKA 2JM9A 3JB9D 4A54A 1RLPC 1NJIU 3G6ET 1VQ5T 3FRNA 2JN0A 2FZCB 1M2OA 2E41A 1PC0A 1QWFA 1YCSB 1KQ2A 2AK5A 3G4ST 2YSQA 3JB9J 2F2XA 6AT1B 2O01E 3OW2S 3E2UA 3KBGA 1NEGA 1NBEB 2K3BA 3OB9A 1TUGB 2LVMA 1VQLT 2RHIA 2RHXA 4JUVA 2KDSA 4HVVA 1M1KR 1GCQC 2K4YA 4OMPA 3RDVA 2ABLA 2NUTB 4XK8E 3QUIA 2DXTA 1K73C 3PIOA 1JEGA 2ROTA 4GLMA 4JS5A 1U06A 5CAIA 1NPPA 1IZ6A 5KYUA 4AG1C 3E19A 4F14A 4XTVA 2X4YA 1Q95G 1V76A 2K5LA 1K4US 2RN8A 5GAMe 4AFZC 3P8DA 4RTVA 2DNUA 2X35A 1S72T 3DB3A 1BIBA 1BKBA 2PVDB 4EMHA 5KYYB 1WHMA 4FSXA 3BY7A 2E12A 1R8OB 3EGDA 4QQGA 3VV0A 1SHFA 4ELZC 1KHCA 2BUDA 1Q82C 2EKOA 3VU3C 2HQEA 2KSSA 3SD4A 4F7UG 5CKBA 5KYXA 3FIFA 2EQUA 3RMSA 4FYXB 4IUPA 2A3LA 2VGNA 3JCMf 1LPLA 1I0CA 4A53A 2IPOB 4XAXB 3DLLA 4J6YA 5CQYA 3G71A 2QQRA 4DQ2A 1KIKA 4B6MA 3EG1A 4J7FA 2E5QA 1OEBA 1UGSB 4KUIA 3QKJA 1ACMB 1G3SA 4PJOB 1YBYA 3M5AA 5CKFA 3X25B 2EFIA 3RBBB 3L2RA 3M59A 4II1A 1AHJB 1UGPB 4OF1A 2C0TA 2PUKB 2NLUA 1QW1A 3EG0A 1WX6A 4C92D 2H3JA 1NYFA 3REBB 3G71Q 2KYMA 4FW2A 3AT1B 4RKUE 3HTRA 4Z02A 4M77F 1X6GA 2RI2A 3RUXA 1OZ3A 2ZPEB 5GMKe 4XU0A 3OYHA 2QQ9A 1WNLA 2FHDA 1N27A 1EIFA 2DTHA 1ARKA 3JCMh 5I2MA 1VQOT 4J9FA 3QJYA 3HFOA 2AZSA 3V7CA 1OULA 1T0HA 1JQQA 3LH0A 3I5SA 1B3QA 2K3XA 3H41A 3M0RA 3PT9A 5I2SA 2EQJA 4A63B 5IN1A 4J5YA 3MHXA 2M51A 1MMNA 5LJ5g 1YN8A 1QVPA 5GANe 4ANJA 1MV0B 3CD6A 1ZSGA 3M0SA 4A4GA 4B9XA 2QA4T 4Y91A 3QSUA 1BCOA 1Y71A 2DEQA 4J83A 4M75A 5IHNA 4ZGEB 5D6WA 2RQTA 2JMCA 2QI2A 1JXMA 1RADB 2FYKA 3J80E 1Y57A 2RHYA 4RTYA 2RHUA 5FLXE 2DRKA 4QQ6A 2CP3A 5GAN3 1PD1A 2B86A 1TG0A 3UF4A 5DY9A 3PMTA 3M54A 1RAHB 3MP8A 1PM3A 5GANd 5GAOl 2DFUA 4M78B 5KCOA 2DLPA 2GF7A 2HSEB 4L6V5 3CC4T 9ATCB 5J26A 4PJOG 1YIJQ 4Y92A 1VQ7A 1UECA 3EH2A 2GCXA 4JJDA 1YJNA 2MI6A 4C92B 1KD1R 2CREA 2FRYA 1VQ4A 4LDUA 4N4IA 2M1HA 4LDYA 1VQ8A 2BZ8A 2DK3A 1VQMQ 4F17A 3EFOA 4E7ZA 1M8VA 1IREB 1SG5A 1K8AU 3J7AF 1V29B 3ZEHA 3WXMB 2X51A 4N4GA 4KUDK 4X1VA 5L8RE 2GFAA 4M77B 4BE1A 4RTXA 1KSWA 2RI3A 1G5VA 2BTTA 1YJWQ 4R0KA 2P4TA 3CPWS 7AT1B 4OB1B 2GGRA 1YJNQ 1UFFA 2O2OA 4M4ZA 4EMKA 2HKQB 1K9MR 2ED0A 1ZX6A 3A98A 1Q86U 2DE0X 1AD5A 4LDWA 1VQPT 4A4EA 2VXFA 2XICA 4QVCA 3SB2A 3M0QA 3JCMJ 1FMWA 1UGRB 3I55A 5LJ3j 4C8QA 2RQUA 2KR3A 5CO7A 5GAMf 4IURA 3BFMA 2QAZA 1X69A 2M9UA 1QVFP 2XD0A 3M56A 3OYMA 4ESRA 4V2SA 1KQSA 2KQWA 4M7DF 5HK0A 2DVEA 3H8ZA 4C8QG 4PJOC 3MEWA 1Z9ZA 4DA4A 2CH4A 3PVQA 1Q82U 4FM4B 1BK2A 2PUOB 3JCMe 3S3MA 4ZNXA 2K5FA 3X26B 3RMQA 1SSFA 3DB4A 1W1FA 2OJ2A 2EQIA 2JZ2A 4NL3A 1Q86C 2RJEA 4BDZA 3META 1AVZC 2K9GA 1VOMA 2JXBA 1M3AA 2YWWA 2ENMA 4M78G 5GAN5 3OA6A 4RCCA 2CP2A 3OS5A 3GIBA 2E6ZA 3ASKA 2KY9A 1MUZA 1UHCA 2EYYA 2ZZDA 1NZ9A 1FMVA 2DAQA 2YDLA 2MK5A 1AT1B 1G3TA 1IO6A 3PGGA 4EMKB 4X34A 1N8RC 1PKSA 2DIGA 2KXDA 5FRNA 4EPCA 3MO8A 2RI5A 1YNZA 1I1JA 3MP6A 1O9SA 3CCLA 2NUZA 4FW1A 1QVGA 1EFNA 5FU6C 4HCZA 2OTLT 1SEMA 4M77D 4WCIA 3OYLA 1LCKA 1M3BA 2EYWA 1LNXA 4M7DG 4GBQA 2XIDA 1N9SA 3WVDB 4C0FA 1ABOA 4PL6A 4EDUA 3RERA 1TU0B 3BDLA 1C1AA 4J9DA 2KT8A 4CC3A 2DJQA 3J81E 3E9FA 1UGQB 2J06A 2QQAA 1YI2Q 2CP0A 3HL8A 3CCQQ 2QGFB 3G6EA 1VQ5A 4GLKA 3CMET 3CMEQ 1SF9A 4KGXB 1C0MA 3EG9A 3TQ7P 3URGA 5AYFA 1N8RU 4C5IA 4M78C 1AEYA 2KK4A 1U8RA 3I5RA 1KFZA 3G4SA 4BI8B 1NJIC 5C0MA 1W2BS 3LX7A 1KC8U 3CCRT 3CCET 1E6HA 3MEUA 4C8QB 1QMCA 4BE0A 4XTYA 3OQ5A 1FYNA 3GLXA 1M1KU 4C0DB 2L5QA 3P8BB 4KH0B 3F70A 4L59A 4Z89A 4FT4A 2YUNA 4M78F 1CKAA 2W0ZA 2QGGA 1PWTA 4IUQA 4PFOA 4KULA 2E3HA 2QXFA 3H6ZA 2LJ3A 4OGEA 4JZ4A 4IUVA 4N0AA 2Y4YA 5DLOA 1ZBXA 2LRQA 1EX4A 3CCLQ 1I5LA 2FL7A 2K3YA 2BE7D 4CI0C 1KQ1A 1NG2A 1EZZB 3QWYA 2YRVA 4OMQA 3OYNA 3CCST 1RAFB 3CCJT 3MPUB 2PNIA 2EKHA 1BI2A 1GFDA 2MPXC 1Y0MA 4HCBA 4N0AC 4BY6B 4C92A 5GAMg 2QTVA 4VUBA 1QQJA 4TVRA 2IG0A 3PIPA 2XDBA 3JCMP 2HZYA 1UHFA 1T0JA 2PVGB 3VS4A 1VQ7T 1PSFA 4RG2A 2XHCA 1I81A 2BE9B 5D6YA 1WHJA 4M77G 2VUBA 4C92G 5GMKl 1QP2A 3CCSQ 2SRCA 3C95A 1VQPQ 2O4XA 2QQBA 1RAIB 2O4XB 4C5EA 3LH5A 3S6WA 3A1PA 1Z9QA 4PJOE 4ZTJA 1VQOQ 4M77A 1RLQC 5GJVB 4DBRA 2J05A 4M78E 3SWNC 3G71T 3RKYA 4Z8AA 4XTZA 2R5MA 4Q5WA 2LCSA 1M90R 4FU6A 2L3QA 1G2BA 3CCQA 2O9SA 1ZBJA 3A8OB 4J9IA 2OI3A 3PFSA 2KYBA 2E1HA 2C0IA 4ORZA 3CBPA 4M7DD 1LOJA 2GTOA 2EYZA 2RQVA 4LE9A 1YJ9T 1RAAB 2ESWA 4KGVB 3PTAA 1JU5C 4MMLA 3QYHB 2DD5A 1X2QA 2Y90A 8AT1B 3NMZC 1B07A 4MDWA 3UA7A 3OW2P 1K73R 4BY6C 1TUDA 2GQVA 2YUQA 1U5SA 1G83A 2EVRA 1BI0A 2HL3A 2E64A 2LDMA 1YIJA 1K76A 2HBWA 2COWA 3CMAT 3EGUA 1MMDA 2VB6A 2DPPB 3OBYA 3DKMA 1WIEA 2KEAA 2DXUA 1VQ9A 1QVFA 4E7LA 5IAYA 2NUPA 4XQ3A 3GNFB 3LGFA 4IUUA 2RF0A 2JW4A 2DZ9A 4ME7A 3EG3A 1VQ8Q 5J39A 5KYNA 1QCNA 2PU9B 1MMAA 1UDLA 3JB9G 1ZHIA 2CP7A 2E3IA 4PLLA 1OQKA 3JCMd 5LJ3f 1VQKA 3QHSA 2BZXA 2H3EB 3L2QA 1D0XA 1OV3A 3INZA 1ZQ1A 3AHUA 2LNVA 2D8JA 3VS7A 5KCHA 2DYBA 2ZAEA 3JB9I 5LJ3e 3A8MB 1D1AA 5LJ5j 3CCLT 1JJ2S 2V1QA 1RI9A 4XU3A 1VQ6A 3LWHA 1YHQA 4E6RA 2OTLA 1R0BG 2FZKB 4M75C 4M78A 3DLMA 3M0PA 1JJ2P 4E7JA 4JJBA 3VS1A 2YHTA 2KRMA 2AKKA 1T3SA 4QT7A 3NPFA 2DIQA 4M7AE 1VYTA 2CSIA 3TSZA 5GANg 4QKUA 4C0DC 5EG2A 3CC4A 4EMGA 5EC7A 1TSFA 2ROLA 1YJNT 1TXQA 2WSEE 4C8QF 1WI7A 3QWXX 5IH2A 2AKLA 1OX9A 2RH2A 3TVTA 1VQ4T 1K9MC 1H3HA 4C92E 4E2FB 1BI1A 3CCRA 3QDFA 4C5HA 3TU4K 1VQNT
chains in the Genus database with same CATH topology
5GANd 2WSFE 5LJ3d 4E47A 3OYIA 2M0OA 5GAOl 3CCEA 4M78B 5LJ3h 1VQMA 1XTDA 5KCOA 2FVUA 1Y07A 4JRQA 1D3BB 2GF7A 2XU8A 3HPWA 4L6V5 3N5BB 5GAMd 3CC4T 1DJ7B 5J26A 4PJOG 2E65A 4XU1A 3QDRB 4M75B 4A4HA 2DTOA 3QXEB 4JS4A 1I8FA 1VQ7A 4M7AD 5D6XA 5GAOp 2GCXA 1YJNA 2MI6A 2I2LA 4C92B 3ZBDA 1M9SA 3LLRA 2Y4XA 2EQKA 4YTLA 1VQ4A 1Y96B 5GAOn 4HT8A 4LDUA 4N4IA 5CVIA 1M1GA 5LJ3g 2M1HA 4D6WA 1YITA 3QYGB 3WVEB 3EFSA 4LDYA 1VQ8A 3HSBA 3M9QA 1VQMT 2DK3A 3M58A 4M75E 3VJPA 4JLIA 4JRKA 1M8VA 2XI9A 2LX9A 3QZ5B 1IREB 2E70A 3JCMX 1K8AU 3J7AF 1V29B 2DZCA 3WXMB 3ZEHA 3C94A 3M57A 4N4GA 3RIRA 1N6AA 3OS1A 3OYDA 3I55T 3C4SA 5L8RE 3HRTA 4KUDK 2K5IA 2GFAA 3CCSA 4M77B 3EFRA 4BE1A 5LJ5e 1Y96A 2L8DA 2D6FA 2RI3A 1QP3A 4C0GA 1G5VA 4PJOF 2DXBA 1WJSA 4BACA 2P4TA 3RESA 3CPWS 4OB1B 1VQNT 3E1SA 4EMKC 5FROA 5DM7R 3CCMT 5KE3A 4EMKA 2AHJB 1MGQA 4JDSA 1Q86U 1H641 3TCJA 1VQ8T 3X28B 4C92F 4LDWA 3V7RA 4JJNK 1VQPT 1WJRA 3RKWA 4NOYA 4F7UF 4MMKA 1YI2T 4M7AG 4DOVA 4M7AC 4A4EA 2VXFA 3QJ6A 2XICA 4C5GA 4QVCA 4ATOA 2CZ0B 3SB2A 4RCBA 3JCMJ 3CXCS 1UGRB 3I55A 3UWNA 1K9MU 2CGHA 5LJ3j 4C8QA 2ZPIB 2V8KA 1B34A 3FLGA 4B9WA 3OBWA 3L42A 5CO7A 3GF5A 4CRIA 4IURA 5GAMf 1UB4A 5GAMj 2VYTA 3BFMA 4OB3B 4M7AA 2M9UA 3QPHA 3LWIA 2XD0A 3M56A 3OYMA 4BE2A 2EYQA 3TREA 4FL6A 3CCVT 1QVFS 1KQSS 5GMKm 4V2SA 2BKDN 5DLQE 1KQSA 2KQWA 4M7DF 2BIVA 4MZTA 2R5AA 3UT1A 5HK0A 1M90C 2DVEA 3LGLA 4PNOA 1BYMA 3H8ZA 2LT4A 3HP9A 1OZ2A 2K57A 4KT0E 4C8QG 3JCMQ 4PJOC 1BIAA 3MEWA 1VQPA 2RM4A 3MP1A 4O5VA 1I4K1 4DA4A 1X01A 4XTUA 4OB2B 4NS5A 2CS7A 2DXCA 3X24B 2R57A 1Q82U 1FXXA 3CBMA 2MWOA 1YCYA 3M4YA 1XOVA 4FM4B 4FT2A 1MHNA 2PUOB 3CCUA 3JCMe 3V8JA 3A8LB 3S3MA 2K5FA 3L1AA 3NFCA 2L3RA 2WACA 5GAMh 3X26B 1HK9A 4J7IA 3RMQA 3CCRA 1SSFA 3DB4A 4LD6A 4XU2A 2IVWA 3LW5E 2JNGA 1P92A 1Q86C 2YLCA 2JZ2A 1WPYA 4NL3A 1KHIA 3CCVA 4HT9A 2JTFA 2RJEA 2LTOA 4BDZA 1KD1C 3META 3OSSC 3M53A 2R58A 1RL2A 2QEXA 3CC7T 3L2ZA 3L2UA 3SFMA 4M78G 4MZMA 5M9OA 5GAN5 4RCCA 3OS5A 3OA6A 3GIBA 5CQXA 2CKKA 4M75D 4QW2A 1FWZA 1VUBA 2E6ZA 2KMTA 3TEEA 1YJ9A 3ASKA 2KY9A 2ZZDA 4OMFB 3CC2A 1X6OA 1NZ9A 2DAQA 4M75G 1NE8A 3JRZA 3VYGA 2CYZB 2DJZA 1G3TA 3PGGA 4EMKB 2EIFA 4X34A 1N8RC 1O75A 2DIGA 2JOYA 2CZ7B 1XNIA 2XDDA 3E9GA 5FRNA 2CZ6B 4EPCA 3MO8A 4C8QD 4C8QE 3GNGA 2RI5A 3QIIA 3MP6A 3ZFJA 2G3RA 3V8LA 1O9SA 3CCLA 5GMKh 2OTJT 4OGCA 5A0LA 1QVGA 2DKGA 2X4WA 5FU7B 5A2QE 2ZPFB 4ELYC 3CMEA 4OB0B 4Y28E 5FU6C 3A5ZB 2EQMA 4BI4A 4HA8A 4HCZA 3GPLA 4M77D 3OYLA 1YIJT 2OTLT 2QDYB 1GXIE 4XTWA 1M4ZA 3OS0A 3CMAA 1M1KC 1LNXA 4M7DG 2D0QB 2D9TA 1N9SA 2XIDA 3EAEA 3WVDB 5A0GA 4M7AF 1M5Q1 4C0FA 3OYGA 3CD6T 4XTXA 4PL6A 3NTHA 4EDUA 2EJGA 4QVDA 3RERA 2HBPA 4IUTA 4QVZA 3HRUA 4M75F 3BDLA 3JB9H 2OAUA 4C92C 3L2WA 5LL6S 4BDYA 1Q81U 4F7UE 1BI3A 3S3OA 3JB9F 5GAOq 3JCMc 2RHZA 2PVOB 1FX7A 1UGQB 2ZCFB 3E9FA 3J81E 1M90U 2MWPA 2QQAA 3R6OA 2OTJA 2ZPGB 3HL8A 3G6EA 1VQ5A 2K2VA 4GLKA 5HKCA 3CMET 2DO3A 3M55A 4M77E 2VV5A 4OVAA 3URGA 3CBOA 5AYFA 3JCMg 3NTKA 4C5IA 1N8RU 4M78C 2P0PA 2KK4A 1U8RA 3OSVA 1KC8C 2XDPA 3G4SA 2MMPA 3LYIA 3OYFA 4IKFA 1JRIA 4BI8B 5GAOm 5C0MA 3JB9D 1W2BS 1NJIC 3LX7A 2F69A 3NTIA 1KC8U 3L2VA 3CCRT 4A54A 4FIBA 2F5TX 3CCET 1NJIU 3MEUA 1UEBA 4C8QB 3OS2A 1PSEA 4P5NA 1M1FA 2JTMA 4HKEA 4XTYA 4BE0A 3OQ5A 3G6ET 3GLXA 1M1KU 1VQ5T 1VQ6T 2RD1A 3FRNA 2L5QA 3P8BB 4C0DB 1YHQT 2JN0A 3F70A 2P0QA 5IT9E 4L59A 1KG1A 3T9NA 2E41A 4M7DC 4FT4A 3SWNA 3CCJA 1KQ2A 4M78F 2YLBA 4PKCC 4NL2A 4F7UB 4WF2A 3G4ST 1JB0E 1NPRA 4IUQA 3JB9J 4KULA 2O01E 2KAFA 2QXFA 3H6ZA 3Q1JA 3OW2S 3KBGA 4OGEA 4N0AA 4IUVA 5DLOA 2Y4YA 1ZBXA 2LRQA 3QBYA 3FC3A 3OB9A 2XKOC 2QQSA 2LVMA 1I5LA 5J3BA 1VQLT 2FL7A 2K3YA 2RHIA 3OYEA 2C06A 2RHXA 2RK1A 3OYAA 4JUVA 4CI0C 1KQ1A 2GFUA 2KDSA 5HK3A 4QQDA 3QZ9B 2K4YA 5GAN6 3BDUA 2YRVA 2LT1A 3OYNA 3CCST 3CCJT 2HAXA 5KE2A 1WGSA 4ZN1A 4XK8E 3QUIA 2DXTA 4DOWA 3HHTB 4J8OA 1K73C 1BI2A 3PIOA 4ZGJB 4JS5A 1K8AC 4HCBA 5CAIA 3PNWC 1WQ7A 4N0AC 4UC4A 4BY6B 4ZTFA 4RG8A 1VQNA 4C92A 1NPPA 5GAMg 1IZ6A 4VUBA 1U1TA 3OW2A 3E19A 4LDVA 2RJCA 4TVRA 2IG0A 4PLIA 3PIPA 3JCMP 2XDBA 2RJFA 3O8VA 2RB6A 4XTVA 2PVGB 4GY5A 2X4YA 1W4SA 3JCMW 1VQ7T 1PSFA 4RG2A 3SDZA 5LJ5h 2K5LA 2XHCA 1I81A 2QTXA 2RK2A 3MEAA 5CK9A 2E10A 5D6YA 4BUGA 4M77G 4C92G 2JVVA 2LCCA 2VUBA 3P8DA 3FEOA 1QP2A 5GAMe 2MF2A 5GMKl 3PMIA 3C95A 3CCQT 2X35A 3GP8A 4E7HA 2O4XA 2QQBA 4J6WA 1S72T 3DB3A 2O4XB 1BIBA 4C5EA 5CKDA 4M7DA 1BKBA 2PVDB 3UDCA 2DD4A 2V8JA 4EMHA 3S6WA 4PJOE 1TH7A 4FSXA 4ZTJA 1U1SA 3BY7A 4M77A 2E12A 3OYCA 1Q7YU 4M7DE 1R8OB 2JUFA 4QQGA 5CCAA 3VV0A 1G3WA 4M78E 3SWNC 3G71T 3RKYA 4ELZC 4R55A 1KHCA 3CCUT 4XTZA 2BUDA 2R5MA 1Q82C 2EKOA 3OYKA 4Q5WA 3RKXA 3VU3C 2DTIA 2HQEA 3QG1A 4N4HA 2KSSA 4FU6A 5CKHA 3SD4A 4F7UG 3CCQA 5CKBA 5GAN7 2CZ1B 3FIFA 4BI3A 4PJOA 2X4XA 3A8OB 1S72A 2EQUA 1VIEA 3RMSA 4IUPA 3HKSA 4O6JA 3PFSA 3CCMA 5GMKi 4BD3A 2A3LA 2VGMA 2VGNA 4C0ZA 3FJPA 2E1HA 1H3ZA 3JCMf 5GAN2 2QEXT 3CC7A 5FU7C 3CBPA 2M16A 3JCMV 4A53A 1LOJA 4M7DD 2P0KA 2LCLA 5GMKj 1YI2A 5C6SA 4XAXB 4F7UA 1YJ9T 3DLLA 4J6YA 5CKEA 5CQYA 1QVGS 4R56A 3G71A 4JRIA 2QQRA 4DQ2A 1B34B 3PTAA 2RO0A 2ZPBB 1D3BA 1KD1U 5GAOr 4J7FA 2E5QA 1UGSB 4KUIA 4MMLA 3QYHB 3QKJA 1X75C 2DD5A 3CPWA 1VQ9T 1G3SA 1JJ2A 4PJOB 1YBYA 3V8KA 2Y90A 3ER0A 1G3YA 2LQKA 3M5AA 3M4GA 2V8IA 2HD0A 1K73U 2FB7A 4MDWA 5CKFA 3X25B 4BY6C 2EFIA 3L2RA 4L5GA 3M59A 2GQVA 3SWNB 4ZN3A 3OMCA 4M78D 4II1A 1BI0A 2VC8A 5GAN4 2PQWA 2E64A 2LDMA 1AHJB 1WJQA 1YIJA 1Q7YC 2LC4A 4HCCA 1UGPB 2RA2A 4OF1A 3CMAT 2L89A 3OBYA 2DPPB 5GANh 2PUKB 3DKMA 4M7AB 2ZPHB 3KUFA 2NLUA 3VKIA 5KH6A 1QW1A 3JSCA 2DXUA 2KVQG 1VQKT 1VQ9A 1QVFA 3V7SA 3I56T 4MZPA 1OYXA 4E7LA 4C92D 2H3JA 5IAYA 3P8HA 3OYBA 4LD9K 4XQ3A 3CEYA 3GNFB 3LGFA 4IUUA 5LJ5f 4RKUE 4Z02A 4M77F 2DZ9A 1Q81C 4ME7A 2RI2A 4A4KA 2E6NA 3RUXA 3X20B 1OZ3A 2EJFA 3MCAB 5J39A 2ZPEB 2XG8D 1XQHA 1LJOA 5GMKe 2B8AA 2PU9B 4M77C 5GAN8 3KXTA 4XU0A 1WQWA 3CC2T 3OYHA 1RI0A 2QQ9A 1WNLA 2WSCE 2FHDA 3JB9G 1ZHIA 2LQ8A 4PLLA 1N27A 3C12A 4M7DB 1EIFA 3JCMd 5GANj 3BW1A 2DTHA 5GANf 5LJ3f 3S3NA 3JCMh 5I2MA 1VQOT 3QJYA 3GOXA 3HFOA 3QHSA 2EWNA 3V7CA 3L2QA 1VQKA 5FRMA 3I56A 3HFNA 3INZA 1ZQ1A 4C5HA 3AHUA 2LNVA 4C8QC 4OP0A 5KCHA 3LH0A 3JB9I 5LJ3e 3A8MB 3CPFA 4BB7A 5LJ5j 3CCLT 1JJ2S 2HQXA 4X9DA 4MDXA 2K3XA 5CR2A 4X9CA 1YJWT 1W2BA 3PT9A 4XU3A 5I2SA 4ZGDB 3LWHA 1VQ6A 5HY6A 2RJDA 2EQJA 1YHQA 2VXEA 5IN1A 2XK0A 4J5YA 3VYHB 3MHXA 2OTLA 2EJ9A 4M75C 2F5KA 5I21A 3QO3A 4M78A 5LJ5g 3DLMA 3JAME 1Y7XA 1QVPA 5GANe 4E7JA 1VQOA 1JBMA 3JCMb 3HRSA 2HNIA 3CD6A 4KBMB 4A4GA 2YHTA 3FDRA 4B9XA 2QA4T 4Y91A 3OMGA 3QSUA 3ME9A 1VIFA 3A8GB 2DIQA 4M7AE 1N9RA 1Y71A 2DEQA 4J83A 4M75A 4ZGEB 1HXDA 5D6WA 3UPUA 4E7KA 5GANg 3OYJA 2ZGWA 1VQLA 3OYYA 4C0DC 5EG2A 1YJWA 3CC4A 4JLGA 2QI2A 3A8HB 4EMGA 2FYKA 5A0DA 3J80E 4E7IA 3VUZA 2RHYA 5LJ5d 4J6XA 2RHUA 1OI1A 5FLXE 1YJNT 4QQ6A 4RMOA 4LDXA 2WSEE 4JRPA 2EAYA 4PJOD 3FB9A 2X4JA 5CIUA 4C8QF 5GAN3 3VUBA 3MEVA 5FU6B 2RH2A 1VQ4T 2QA4A 1K9MC 5DY9A 3PMTA 4C92E 3OY9A 2A7YA 2MAMA 3M54A 3CXCA 1BI1A 4A4FA 1YITT 3MP8A 3TU4K 3G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN d;  5LJ3 d;  5GAO l;  4M78 B;  3L2Z A;  5LJ3 h;  3SWN B;  4M78 G;  5GAN 5;  1D3B B;  1I5L A;  4RCC A;  5GAM d;  3GIB A;  4M75 D;  4M78 D;  2VC8 A;  4JUV A;  2E65 A;  1KQ1 A;  4PJO G;  5GAN 4;  4XU1 A;  2E64 A;  4M75 B;  5GAN 6;  4PJO D;  4M75 G;  2DTO A;  3BDU A;  1I8F A;  4M7A D;  5GAO p;  2DJZ A;  2RA2 A;  5GAN h;  3PGG A;  2I2L A;  4EMK B;  4M7A B;  4C92 B;  2DXU A;  3QUI A;  3V7S A;  2DXT A;  1Y96 B;  4C92 D;  5GAO n;  4C8Q D;  4HT8 A;  4C8Q E;  4XQ3 A;  5LJ3 g;  5LJ5 f;  3V8L A;  5CAI A;  1WQ7 A;  3EFS A;  4N0A C;  4M77 F;  4C92 A;  2DZ9 A;  3HSB A;  5GAM g;  5GMK h;  3RUX A;  1U1T A;  4M75 E;  4JLI A;  2EJF A;  4JRK A;  1M8V A;  2DKG A;  1LJO A;  5GMK e;  3JCM P;  4M77 C;  5GAN 8;  2RB6 A;  4XTV A;  4XU0 A;  1WQW A;  3JCM X;  1WNL A;  2DZC A;  4HA8 A;  4M77 D;  3JCM W;  3RIR A;  3JB9 G;  4XTW A;  4M7D B;  5LJ5 h;  4M7D G;  1LNX A;  3JCM d;  1I81 A;  2QTX A;  3BW1 A;  2DTH A;  5GAN f;  2E10 A;  4M77 B;  3EFR A;  5LJ3 f;  4M77 G;  3JCM h;  1N9S A;  4C92 G;  5GAM e;  5LJ5 e;  5GMK l;  4M7A F;  1Y96 A;  1M5Q 1;  3HFO A;  2EWN A;  3QHS A;  3V7C A;  4XTX A;  4PJO F;  2EJG A;  3HFN A;  3INZ A;  4QVD A;  3RER A;  3RES A;  4M75 F;  4J6W A;  3AHU A;  3JB9 H;  4C8Q C;  1BIB A;  4M7D A;  4OP0 A;  4C92 C;  4EMH A;  4EMK C;  4F7U E;  3JB9 F;  4EMK A;  3JB9 I;  1MGQ A;  5LJ3 e;  3JCM c;  5GAO q;  5GAN j;  1H64 1;  1TH7 A;  4PJO E;  5LJ5 j;  1U1S A;  3BY7 A;  4M77 A;  4X9D A;  3V7R A;  4C92 F;  4M7A G;  4X9C A;  3RKW A;  4NOY A;  4F7U F;  4MMK A;  4M7A C;  4M7D E;  2VXF A;  4XU3 A;  4QVC A;  4M77 E;  3SB2 A;  4RCB A;  3JCM J;  2VXE A;  4M78 E;  4J5Y A;  3SWN C;  3JCM g;  3RKY A;  2EJ9 A;  4M78 C;  4M75 C;  5I21 A;  2CGH A;  3QO3 A;  4M78 A;  4XTZ A;  4C8Q A;  5LJ3 j;  5LJ5 g;  1B34 A;  3RKX A;  5GAN e;  1JBM A;  3VU3 C;  3JCM b;  5GAM f;  2DTI A;  2HNI A;  5GAM j;  3BFM A;  4M7A A;  4F7U G;  1JRI A;  2YHT A;  4Y91 A;  5GAN 7;  5GAO m;  3JB9 D;  3FIF A;  3QSU A;  4PJO A;  5GMK m;  4V2S A;  4M7A E;  1N9R A;  2DEQ A;  4M75 A;  4A54 A;  4M7D F;  5GMK i;  1HXD A;  2DVE A;  2E1H A;  3FJP A;  4PNO A;  3JCM f;  4C8Q G;  5GAN 2;  2K57 A;  3JCM Q;  5GAN g;  4PJO C;  2ZGW A;  4A53 A;  1BIA A;  3JCM V;  1LOJ A;  2RM4 A;  4C8Q B;  4M7D D;  4XTY A;  5GMK j;  1I4K 1;  1X01 A;  4EMG A;  4XTU A;  4F7U A;  2RD1 A;  2FYK A;  4J6Y A;  2JN0 A;  5LJ5 d;  4JRI A;  4J6X A;  1YCY A;  4DQ2 A;  2E41 A;  1B34 B;  3JCM e;  3V8J A;  1D3B A;  5GAO r;  3SWN A;  1KQ2 A;  4M7D C;  2EAY A;  4M78 F;  3FB9 A;  2YLB A;  3L1A A;  4C8Q F;  4MML A;  5GAN 3;  5GAM h;  4NL2 A;  1HK9 A;  4WF2 A;  4F7U B;  4PJO B;  4XU2 A;  3V8K A;  2Y90 A;  3JB9 J;  5DY9 A;  4C92 E;  2YLC A;  1WPY A;  3M4G A;  4NL3 A;  4HT9 A;  2FB7 A;  4N0A A; 
#chains in the Genus database with same CATH topology
 2M0O A;  3CCE A;  1XTD A;  1UGV A;  4OMN A;  1JXO A;  3QDR B;  4XU1 A;  4JS4 A;  1I8F A;  1VQL Q;  2HSP A;  1MV3 A;  1HD3 A;  5LJ3 g;  3EGX A;  2H8H A;  1YIT A;  3WVE B;  3EH1 A;  4M75 E;  4JLI A;  2LX9 A;  1N5Z A;  3QZ5 B;  3JCM X;  1OPL A;  3OS1 A;  3I55 T;  3HRT A;  1SKU B;  2K5I A;  3CCS A;  3EFR A;  1WHG A;  1Y96 A;  2MYS A;  1VQK Q;  2MIO A;  1WXT A;  1N8R R;  4EMK C;  5DM7 R;  3CCM T;  5KE3 A;  4PJJ A;  3TCJ A;  2LP5 A;  4JJN K;  3V7R A;  3RKW A;  4NOY A;  1YI2 T;  2FPE A;  4RCB A;  2ZPI B;  2V8K A;  4CRI A;  5GAM j;  4CC2 A;  3LWI A;  3TRE A;  4LUE A;  1E6G A;  2AT1 B;  5DLQ E;  2D1X A;  1D0Y A;  4PNO A;  2NUT A;  2LT4 A;  1ZA1 B;  2K57 A;  3HP9 A;  4K11 A;  4RTT A;  2RM4 A;  3NHN A;  1W2B P;  4OB2 B;  4NS5 A;  2V1R A;  2DXC A;  1FMK A;  4RTU A;  2R57 A;  1FXX A;  3CBM A;  2LX7 A;  2MWO A;  4FT2 A;  1XOV A;  1RAB B;  2COZ A;  3V8J A;  3D7S B;  2DL7 A;  3NFC A;  2L3R A;  1X2K A;  4J7I A;  4XU2 A;  2IVW A;  3LW5 E;  5IHI A;  2X3W D;  2YLC A;  3CCV A;  4HT9 A;  3BE3 A;  2R58 A;  2L3P A;  3SFM A;  4MZM A;  5M9O A;  1K0S A;  1UJY A;  4M75 D;  3TEE A;  1YJ9 A;  4OMF B;  3CC2 A;  3JRZ A;  1AWW A;  1QKW A;  1ZA2 B;  1O75 A;  1WYX A;  5KYY A;  1PRM C;  2HMA A;  2KE9 A;  2HDA A;  4KRT A;  1UG1 A;  1OPK A;  2CP5 A;  5A2Q E;  5FWB A;  5IHK A;  1F1B B;  3CME A;  4Y28 E;  3A5Z B;  3VS6 A;  2W10 A;  1YIJ T;  2D0N A;  3OS0 A;  3CMA A;  5HCK A;  2D0Q B;  2D9T A;  5A0G A;  1M5Q 1;  4XTX A;  2EJG A;  1WA7 A;  4QVD A;  2HBP A;  4IUT A;  2XMF A;  3HRU A;  4M75 F;  3JB9 H;  2KRO A;  3JCM c;  3H0I A;  2RHZ A;  2MCN A;  1FX7 A;  1XJW B;  3R6O A;  5KYU B;  5HKC A;  1AZE A;  5IXB A;  2DO3 A;  3M55 A;  4AFQ C;  1RAE B;  1WDX A;  4DBF A;  1KC8 C;  2VAS A;  1OX8 A;  2ED1 A;  1JRI A;  2JTE A;  1NM7 A;  1W6X A;  2QAS A;  3NTI A;  3L2V A;  4DEX A;  4PJN A;  4FIB A;  2F5T X;  1VQ7 Q;  4FYW B;  1UEB A;  3OS2 A;  1PSE A;  4P5N A;  1M1F A;  2JTM A;  4HKE A;  1VQ6 T;  2RD1 A;  3CC2 Q;  4AMC A;  1YHQ T;  2P0Q A;  5IT9 E;  5ECA A;  1YFN A;  3T9N A;  1WXB A;  4M7D C;  3SWN A;  2F2W A;  3CCJ A;  4PKC C;  4WF2 A;  1D09 B;  2X3X D;  1SHG A;  1ZLM A;  3O5Z A;  4LXC A;  3KFV A;  2HEQ A;  1PNJ A;  2XKO C;  2J6O A;  3UA6 A;  5J3B A;  2OX7 A;  2C06 A;  2M0Y A;  5GAN 6;  3BDU A;  1NLP C;  2HAX A;  3EGD B;  1ZUY A;  4DOW A;  1VYV A;  4J8O A;  2KI7 A;  4ZGJ B;  2L3S A;  2DL5 A;  1K8A C;  1VQN A;  1WQ7 A;  4ZTF A;  1T3L A;  4LDV A;  2RJC A;  3EHR A;  3C0C A;  2RJF A;  4GY5 A;  3JCM W;  1IGQ A;  2LJ1 A;  5LJ5 h;  2HCK A;  2QTX A;  5CK9 A;  2E10 A;  4BUG A;  3M0U A;  2LCC A;  3ULR B;  3IQL A;  3PMI A;  3CCQ T;  4E7H A;  5CKD A;  1GFC A;  3UDC A;  2DD4 A;  3CMA Q;  1PHT A;  1K9A A;  1M30 A;  4AG2 C;  3OYC A;  4M7D E;  5L23 A;  4J9G A;  3REA B;  1G3W A;  2YUO A;  2EW3 A;  2VWF A;  3OYK A;  1GBQ A;  2DTI A;  3QG1 A;  4N4H A;  4LN2 A;  5CKH A;  1M8M A;  5GAN 7;  3PVL A;  1R0C B;  4PJO A;  5KYW B;  3HKS A;  4O6J A;  3CCM A;  5GMK i;  4BD3 A;  4C0Z A;  1TTH B;  2QEX T;  2AZV A;  2E5K A;  4F04 B;  2EGE A;  5IXF A;  2HQH A;  5GMK j;  1YI2 A;  5C6S A;  1SRM A;  4F7U A;  1HSQ A;  4FYV B;  1QVG S;  4R56 A;  1B34 B;  3VS5 A;  1D3B A;  2YXY A;  5GAO r;  2CDT A;  1KD1 U;  2DMO A;  1VQ9 T;  3V8K A;  3R6N A;  1G3Y A;  1NLO C;  2LQK A;  2HD0 A;  1K73 U;  2DVJ A;  4L5G A;  1UUE A;  3OMC A;  4M78 D;  2VC8 A;  5GAN 4;  1Q7Y C;  4HCC A;  1SSH A;  5GAN h;  3VKI A;  5KH6 A;  1VQK T;  2KVQ G;  2LJ0 A;  4MZP A;  1OYX A;  3P8H A;  1GCP A;  5LJ5 f;  2DYI A;  1W70 A;  1Q81 C;  4LNP A;  2EPD A;  2QYZ A;  1S1N A;  2E6N A;  4IIM A;  2EJF A;  3MCA B;  1D1C A;  3CC2 T;  1RI0 A;  2WSC E;  1AOJ A;  2LQ8 A;  4M7D B;  2A37 A;  1Q81 R;  5GAN j;  3BW1 A;  2QG9 B;  3GOX A;  5FRM A;  1PKT A;  3I56 A;  3GBQ A;  3HFN A;  4HVU A;  4OP0 A;  2JS0 A;  3CPF A;  4MDX A;  3EFO B;  1I07 A;  2M02 A;  2KNB B;  2VXE A;  2XK0 A;  2L0A A;  4RTZ A;  5I21 A;  1SPK A;  4KGZ B;  1JBM A;  3VS3 A;  1PRL C;  4KBM B;  3VRZ A;  2OAW A;  2G6F X;  1X6B A;  2JM8 A;  3G4S Q;  3OMG A;  3ME9 A;  1VIF A;  2YUP A;  1N9R A;  3I55 Q;  1RAG B;  4E7K A;  3OYJ A;  3OYY A;  3I56 Q;  1YJW A;  4JLG A;  3A8H B;  1WHL A;  4FSS A;  2SEM A;  4E7I A;  3VUZ A;  4RMO A;  4LDX A;  1YP5 A;  4PJO D;  2EAY A;  5CIU A;  2X4J A;  4DBQ A;  3VUB A;  3MEV A;  2Z0W A;  3OY9 A;  2A7Y A;  2MAM A;  2A0F B;  4A4F A;  1YIT T;  3G7Z A;  1KC8 R;  5LJ3 d;  3OYI A;  4JRQ A;  1D3B B;  2XU8 A;  3HPW A;  4OMM A;  3N5B B;  2E65 A;  1QKX A;  3I35 A;  5D6X A;  1CKB A;  2KT1 A;  2EGA A;  3ZBD A;  1WZO A;  1M9S A;  3LLR A;  2Y4X A;  2EQK A;  4YTL A;  5GAO n;  4HT8 A;  2CP6 A;  1CSK A;  5CVI A;  1M1G A;  3MJX A;  2GNC A;  4D6W A;  2HL5 C;  3HSB A;  3M9Q A;  1VQM T;  2IIM A;  2J6K A;  4JRK A;  3SHW A;  2XI9 A;  2E70 A;  5I22 A;  1N6A A;  3OYD A;  1D0Z A;  2KGT A;  5LJ5 e;  1J3T A;  3CC7 Q;  2L8D A;  2D6F A;  1QP3 A;  2DXB A;  3CPW P;  3H0F A;  2FZG B;  4BAC A;  4PFZ A;  3E1S A;  1GBR A;  5FRO A;  1MGQ A;  2CH4 W;  4C92 F;  1AWO A;  4M7A G;  1WJR A;  3QJ6 A;  4ATO A;  1OOT A;  2CZ0 B;  3VS2 A;  1WHK A;  3UWN A;  1K9M U;  1KK7 A;  3OBW A;  3L42 A;  3GF5 A;  2QEX Q;  1BU1 A;  1UB4 A;  2VKN A;  2VYT A;  2YRD A;  4M7A A;  4BE2 A;  2RNA A;  3CCV T;  1QVF S;  2DER A;  1KQS S;  1LVK A;  2BKD N;  2BIV A;  4E7S A;  2R5A A;  3UT1 A;  3LGL A;  1UE9 A;  1GRI A;  1OZ2 A;  4KT0 E;  3JCM Q;  3MP1 A;  1X01 A;  2FPF A;  4J9B A;  1YCY A;  2E4H A;  3A8L B;  2WAC A;  1HK9 A;  2X9H A;  4LD6 A;  5KYX B;  4DBH A;  1P92 A;  1KHI A;  2BZY A;  2JTF A;  1KD1 C;  1VQN Q;  1PG5 B;  3M53 A;  1RL2 A;  2QEX A;  3L2U A;  2LQN A;  2CKK A;  3RR6 A;  2EYX A;  3CCV Q;  1X6O A;  4M75 G;  3VYG A;  2DJZ A;  2DA9 A;  2O9V A;  2KRS A;  2EIF A;  2CZ7 B;  1WFW A;  2XDD A;  2CT3 A;  2QDL A;  5FWC A;  3VS0 A;  4JPB W;  1YWP A;  1VQ4 Q;  3ZFJ A;  2YRC A;  1RAC B;  1HYO A;  2X4W A;  4D8D A;  2ZPF B;  1X43 A;  2EQM A;  4BI4 A;  5GJW B;  4HA8 A;  1GXI E;  2QDY B;  1M1K C;  1WHH A;  3EAE A;  4M7A F;  2RQW A;  3OYG A;  3CQT A;  3NTH A;  4DEY A;  4QVZ A;  1C6V X;  2P84 A;  2OAU A;  4C92 C;  5LL6 S;  4BDY A;  2MOX A;  1Q81 U;  3S3O A;  1BI3 A;  2DF6 A;  2YT6 A;  1BBZ A;  3JB9 F;  2PVO B;  1TWB A;  2OTJ A;  2ZPG B;  2VVK A;  2K2V A;  3G1J A;  4M77 E;  2VV5 A;  4OVA A;  3JCM g;  4OML A;  3OSV A;  1AZG B;  2MMP A;  3LYI A;  3NGP A;  5KYW A;  5GAO m;  2F69 A;  1AWJ A;  3EG2 A;  4CC7 A;  1YWO A;  2LMJ A;  1NJI R;  3CCJ Q;  3MKD A;  1PCX A;  2DL3 A;  1Q82 R;  2EBP A;  2KXC A;  2A36 A;  3PE0 A;  1KG1 A;  1H8K A;  2YLB A;  1M3C A;  4NL2 A;  4F7U B;  1JB0 E;  1NPR A;  1I5O B;  1V1C A;  4PK4 A;  5AT1 B;  2KAF A;  1K8A R;  3Q1J A;  3QBY A;  3FC3 A;  2QQS A;  1PD0 A;  3CCE Q;  3OYE A;  1A0N B;  2RK1 A;  1K1Z A;  3OYA A;  5HK3 A;  2GFU A;  4OMO A;  4QQD A;  3QZ9 B;  2LT1 A;  5KE2 A;  8ATC B;  1WGS A;  4ZN1 A;  1MNE A;  3HHT B;  2DBK A;  3PNW C;  4UC4 A;  4RG8 A;  1NYG A;  4AFS C;  2PZ1 A;  3ZL7 C;  3OW2 A;  1U1T A;  1KJW A;  4PLI A;  2CSQ A;  2C0O A;  4FYY B;  3O8V A;  2RB6 A;  2FRW A;  1W4S A;  3SDZ A;  2RK2 A;  3MEA A;  2COY A;  2L2P A;  4IIO A;  2JVV A;  3FEO A;  2MF2 A;  3GP8 A;  4F16 A;  4M7D A;  4J6W A;  2NUP B;  2V8J A;  4JJC A;  1TH7 A;  1U1S A;  1G8X A;  1Q7Y U;  1QVG P;  2OTL Q;  2JUF A;  5CCA A;  4PJL A;  4CC4 B;  4R55 A;  3CCU T;  3RKX A;  2CUB A;  2CZ1 B;  4BI3 A;  2X4X A;  1S72 A;  1VIE A;  1ZSZ C;  2DM1 A;  2VGM A;  3FJP A;  1H3Z A;  5GAN 2;  4HCK A;  1E7O A;  5FU7 C;  3CC7 A;  2M16 A;  3JCM V;  2P0K A;  1X27 A;  2LCL A;  1ZUU A;  1U3O A;  5CKE A;  4EIK A;  4JRI A;  2RO0 A;  2ZPB B;  3RNJ A;  1UJ0 A;  1QCO A;  1X75 C;  1JJ2 A;  3CPW A;  3UAT A;  2LQW A;  3ER0 A;  3M4G A;  2V8I A;  1TOV A;  1IGU A;  2FB7 A;  3CCU Q;  2K79 A;  3I9Q A;  2FG0 A;  3SWN B;  4ZN3 A;  1S72 Q;  2PQW A;  1WJQ A;  2DIL A;  2LC4 A;  2RA2 A;  2L89 A;  2ATC B;  2DX1 A;  4M7A B;  2ZPH B;  3KUF A;  3JSC A;  3V7S A;  2RQR A;  3I56 T;  3OYB A;  4LD9 K;  3JV3 A;  3CEY A;  3CCR Q;  4RTW A;  2D8H A;  4A4K A;  3X20 B;  4HXJ A;  1XQH A;  1JO8 A;  1LJO A;  2GBQ A;  2XG8 D;  2B8A A;  4M77 C;  5GAN 8;  3KXT A;  1SRL A;  1WQW A;  1YIT Q;  3C12 A;  1M27 C;  3S3N A;  5GAN f;  2JMA A;  2EWN A;  2O88 A;  2DL8 A;  1D1B A;  3EGX B;  4C8Q C;  2KRN A;  1VA7 A;  4BB7 A;  2HQX A;  4X9D A;  1Q7Y R;  4Z88 A;  5CR2 A;  4X9C A;  1YJW T;  1W2B A;  4ZGD B;  2A28 A;  3VRY A;  5HY6 A;  2RJD A;  2DET A;  3VYH B;  2EJ9 A;  2F5K A;  3QO3 A;  3JAM E;  4HVW A;  1Y7X A;  1VQO A;  3JCM b;  3HRS A;  2HNI A;  1IHV A;  3FDR A;  2QK0 A;  2F2V A;  3A8G B;  1AWX A;  4J9C A;  4J9E A;  1HXD A;  2ECZ A;  3UPU A;  2ZGW A;  1VQL A;  1M2V B;  2AIR B;  2P4R A;  4PFP A;  5A0D A;  2EGC A;  5LJ5 d;  4J6X A;  1OI1 A;  2JT4 A;  4JRP A;  1GCQ A;  2LZ6 B;  3FB9 A;  4D8K A;  3G6E Q;  1VQ5 Q;  5FU6 B;  3CD6 Q;  2QA4 A;  2DEU A;  1UTI A;  1MND A;  1WLP B;  3CXC A;  3QII A;  1VYU A;  2WSF E;  4E47 A;  5LJ3 h;  1VQM A;  2FVU A;  2NWM A;  1Y07 A;  1IXD A;  5GAM d;  1TS9 A;  2FPD A;  1DJ7 B;  4LUD A;  4M75 B;  2O31 A;  2RPN A;  4A4H A;  2DTO A;  3QXE B;  4M7A D;  5GAO p;  2CT4 A;  2I2L A;  1TUC A;  1Y96 B;  2HKN A;  1R77 A;  3QYG B;  1Q86 R;  3EFS A;  3M58 A;  3H0H A;  3VJP A;  2QA4 Q;  4WTO B;  1QCF A;  1YHQ Q;  3FJ5 A;  2DZC A;  2NYS A;  2RMO A;  3C94 A;  3M57 A;  3RIR A;  3C4S A;  1BCM A;  3SEM A;  2GQI A;  2KBT A;  1OU9 A;  4C0G A;  4PJO F;  1KQS P;  1WJS A;  3RES A;  3CCM Q;  3CXC P;  2DRM A;  2AHJ B;  4JDS A;  1VQ8 T;  1H64 1;  4AFU C;  3X28 B;  5FW9 A;  2GTJ A;  4F7U F;  4MMK A;  4DOV A;  4M7A C;  4C5G A;  3CXC S;  3M0T A;  1IHW A;  2CGH A;  1B34 A;  3FLG A;  4B9W A;  4OB3 B;  3QPH A;  2EYQ A;  4FL6 A;  1YJ9 Q;  5GMK m;  4MZT A;  1M90 C;  1BYM A;  1K0X A;  1BIA A;  1VQP A;  1QLY A;  2JS2 A;  4O5V A;  1I4K 1;  3TSW A;  4JZ3 A;  3EG9 B;  4XTU A;  2CS7 A;  3X24 B;  4PJM A;  3M4Y A;  3CCU A;  1MHN A;  4RUG A;  3L1A A;  5GAM h;  3CC4 Q;  1M2V A;  1MMG A;  1RUW A;  2JNG A;  3H9N A;  1WPY A;  2LTO A;  1ZSZ B;  3OSS C;  3CC7 T;  3L2Z A;  2J6F A;  1BB9 A;  2DBM A;  5CQX A;  4QW2 A;  1FWZ A;  1VUB A;  2KMT A;  1WXU A;  1IB8 A;  1NE8 A;  2F1L A;  2CYZ B;  4KH1 B;  1IRX A;  2I0N A;  2JOY A;  1XNI A;  3E9G A;  2CZ6 B;  2FO0 A;  4C8Q D;  4C8Q E;  2JJ9 A;  3GNG A;  2V26 A;  4AT1 B;  2G3R A;  3V8L A;  2LNH B;  3U23 A;  1H92 A;  2OTJ Q;  5GMK h;  2OTJ T;  1GL5 A;  4OGC A;  5A0L A;  2DKG A;  5FU7 B;  2A08 A;  4ELY C;  4OB0 B;  5D7U A;  3GPL A;  1HJD A;  4XTW A;  1M4Z A;  2DL4 A;  5I11 A;  2K7A A;  3CD6 T;  1NEB A;  1VQ9 Q;  1QWE A;  3L2W A;  1OU8 A;  4F7U E;  2FEI A;  5GAO q;  2ZCF B;  1M90 U;  1ZUK A;  2MWP A;  3THK A;  1VQ6 Q;  2J7I A;  3EHQ A;  1B7T A;  4FCY A;  2K2M A;  1ABQ A;  2K6D A;  3CBO A;  3NTK A;  1ZSZ A;  2P0P A;  2CUD A;  2XDP A;  4J9H A;  3OYF A;  4IKF A;  2PTK A;  2JM9 A;  3JB9 D;  4A54 A;  1RLP C;  1NJI U;  3G6E T;  1VQ5 T;  3FRN A;  2JN0 A;  2FZC B;  1M2O A;  2E41 A;  1PC0 A;  1QWF A;  1YCS B;  1KQ2 A;  2AK5 A;  3G4S T;  2YSQ A;  3JB9 J;  2F2X A;  6AT1 B;  2O01 E;  3OW2 S;  3E2U A;  3KBG A;  1NEG A;  1NBE B;  2K3B A;  3OB9 A;  1TUG B;  2LVM A;  1VQL T;  2RHI A;  2RHX A;  4JUV A;  2KDS A;  4HVV A;  1M1K R;  1GCQ C;  2K4Y A;  4OMP A;  3RDV A;  2ABL A;  2NUT B;  4XK8 E;  3QUI A;  2DXT A;  1K73 C;  3PIO A;  1JEG A;  2ROT A;  4GLM A;  4JS5 A;  1U06 A;  5CAI A;  1NPP A;  1IZ6 A;  5KYU A;  4AG1 C;  3E19 A;  4F14 A;  4XTV A;  2X4Y A;  1Q95 G;  1V76 A;  2K5L A;  1K4U S;  2RN8 A;  5GAM e;  4AFZ C;  3P8D A;  4RTV A;  2DNU A;  2X35 A;  1S72 T;  3DB3 A;  1BIB A;  1BKB A;  2PVD B;  4EMH A;  5KYY B;  1WHM A;  4FSX A;  3BY7 A;  2E12 A;  1R8O B;  3EGD A;  4QQG A;  3VV0 A;  1SHF A;  4ELZ C;  1KHC A;  2BUD A;  1Q82 C;  2EKO A;  3VU3 C;  2HQE A;  2KSS A;  3SD4 A;  4F7U G;  5CKB A;  5KYX A;  3FIF A;  2EQU A;  3RMS A;  4FYX B;  4IUP A;  2A3L A;  2VGN A;  3JCM f;  1LPL A;  1I0C A;  4A53 A;  2IPO B;  4XAX B;  3DLL A;  4J6Y A;  5CQY A;  3G71 A;  2QQR A;  4DQ2 A;  1KIK A;  4B6M A;  3EG1 A;  4J7F A;  2E5Q A;  1OEB A;  1UGS B;  4KUI A;  3QKJ A;  1ACM B;  1G3S A;  4PJO B;  1YBY A;  3M5A A;  5CKF A;  3X25 B;  2EFI A;  3RBB B;  3L2R A;  3M59 A;  4II1 A;  1AHJ B;  1UGP B;  4OF1 A;  2C0T A;  2PUK B;  2NLU A;  1QW1 A;  3EG0 A;  1WX6 A;  4C92 D;  2H3J A;  1NYF A;  3REB B;  3G71 Q;  2KYM A;  4FW2 A;  3AT1 B;  4RKU E;  3HTR A;  4Z02 A;  4M77 F;  1X6G A;  2RI2 A;  3RUX A;  1OZ3 A;  2ZPE B;  5GMK e;  4XU0 A;  3OYH A;  2QQ9 A;  1WNL A;  2FHD A;  1N27 A;  1EIF A;  2DTH A;  1ARK A;  3JCM h;  5I2M A;  1VQO T;  4J9F A;  3QJY A;  3HFO A;  2AZS A;  3V7C A;  1OUL A;  1T0H A;  1JQQ A;  3LH0 A;  3I5S A;  1B3Q A;  2K3X A;  3H41 A;  3M0R A;  3PT9 A;  5I2S A;  2EQJ A;  4A63 B;  5IN1 A;  4J5Y A;  3MHX A;  2M51 A;  1MMN A;  5LJ5 g;  1YN8 A;  1QVP A;  5GAN e;  4ANJ A;  1MV0 B;  3CD6 A;  1ZSG A;  3M0S A;  4A4G A;  4B9X A;  2QA4 T;  4Y91 A;  3QSU A;  1BCO A;  1Y71 A;  2DEQ A;  4J83 A;  4M75 A;  5IHN A;  4ZGE B;  5D6W A;  2RQT A;  2JMC A;  2QI2 A;  1JXM A;  1RAD B;  2FYK A;  3J80 E;  1Y57 A;  2RHY A;  4RTY A;  2RHU A;  5FLX E;  2DRK A;  4QQ6 A;  2CP3 A;  5GAN 3;  1PD1 A;  2B86 A;  1TG0 A;  3UF4 A;  5DY9 A;  3PMT A;  3M54 A;  1RAH B;  3MP8 A;  1PM3 A;  5GAN d;  5GAO l;  2DFU A;  4M78 B;  5KCO A;  2DLP A;  2GF7 A;  2HSE B;  4L6V 5;  3CC4 T;  9ATC B;  5J26 A;  4PJO G;  1YIJ Q;  4Y92 A;  1VQ7 A;  1UEC A;  3EH2 A;  2GCX A;  4JJD A;  1YJN A;  2MI6 A;  4C92 B;  1KD1 R;  2CRE A;  2FRY A;  1VQ4 A;  4LDU A;  4N4I A;  2M1H A;  4LDY A;  1VQ8 A;  2BZ8 A;  2DK3 A;  1VQM Q;  4F17 A;  3EFO A;  4E7Z A;  1M8V A;  1IRE B;  1SG5 A;  1K8A U;  3J7A F;  1V29 B;  3ZEH A;  3WXM B;  2X51 A;  4N4G A;  4KUD K;  4X1V A;  5L8R E;  2GFA A;  4M77 B;  4BE1 A;  4RTX A;  1KSW A;  2RI3 A;  1G5V A;  2BTT A;  1YJW Q;  4R0K A;  2P4T A;  3CPW S;  7AT1 B;  4OB1 B;  2GGR A;  1YJN Q;  1UFF A;  2O2O A;  4M4Z A;  4EMK A;  2HKQ B;  1K9M R;  2ED0 A;  1ZX6 A;  3A98 A;  1Q86 U;  2DE0 X;  1AD5 A;  4LDW A;  1VQP T;  4A4E A;  2VXF A;  2XIC A;  4QVC A;  3SB2 A;  3M0Q A;  3JCM J;  1FMW A;  1UGR B;  3I55 A;  5LJ3 j;  4C8Q A;  2RQU A;  2KR3 A;  5CO7 A;  5GAM f;  4IUR A;  3BFM A;  2QAZ A;  1X69 A;  2M9U A;  1QVF P;  2XD0 A;  3M56 A;  3OYM A;  4ESR A;  4V2S A;  1KQS A;  2KQW A;  4M7D F;  5HK0 A;  2DVE A;  3H8Z A;  4C8Q G;  4PJO C;  3MEW A;  1Z9Z A;  4DA4 A;  2CH4 A;  3PVQ A;  1Q82 U;  4FM4 B;  1BK2 A;  2PUO B;  3JCM e;  3S3M A;  4ZNX A;  2K5F A;  3X26 B;  3RMQ A;  1SSF A;  3DB4 A;  1W1F A;  2OJ2 A;  2EQI A;  2JZ2 A;  4NL3 A;  1Q86 C;  2RJE A;  4BDZ A;  3MET A;  1AVZ C;  2K9G A;  1VOM A;  2JXB A;  1M3A A;  2YWW A;  2ENM A;  4M78 G;  5GAN 5;  3OA6 A;  4RCC A;  2CP2 A;  3OS5 A;  3GIB A;  2E6Z A;  3ASK A;  2KY9 A;  1MUZ A;  1UHC A;  2EYY A;  2ZZD A;  1NZ9 A;  1FMV A;  2DAQ A;  2YDL A;  2MK5 A;  1AT1 B;  1G3T A;  1IO6 A;  3PGG A;  4EMK B;  4X34 A;  1N8R C;  1PKS A;  2DIG A;  2KXD A;  5FRN A;  4EPC A;  3MO8 A;  2RI5 A;  1YNZ A;  1I1J A;  3MP6 A;  1O9S A;  3CCL A;  2NUZ A;  4FW1 A;  1QVG A;  1EFN A;  5FU6 C;  4HCZ A;  2OTL T;  1SEM A;  4M77 D;  4WCI A;  3OYL A;  1LCK A;  1M3B A;  2EYW A;  1LNX A;  4M7D G;  4GBQ A;  2XID A;  1N9S A;  3WVD B;  4C0F A;  1ABO A;  4PL6 A;  4EDU A;  3RER A;  1TU0 B;  3BDL A;  1C1A A;  4J9D A;  2KT8 A;  4CC3 A;  2DJQ A;  3J81 E;  3E9F A;  1UGQ B;  2J06 A;  2QQA A;  1YI2 Q;  2CP0 A;  3HL8 A;  3CCQ Q;  2QGF B;  3G6E A;  1VQ5 A;  4GLK A;  3CME T;  3CME Q;  1SF9 A;  4KGX B;  1C0M A;  3EG9 A;  3TQ7 P;  3URG A;  5AYF A;  1N8R U;  4C5I A;  4M78 C;  1AEY A;  2KK4 A;  1U8R A;  3I5R A;  1KFZ A;  3G4S A;  4BI8 B;  1NJI C;  5C0M A;  1W2B S;  3LX7 A;  1KC8 U;  3CCR T;  3CCE T;  1E6H A;  3MEU A;  4C8Q B;  1QMC A;  4BE0 A;  4XTY A;  3OQ5 A;  1FYN A;  3GLX A;  1M1K U;  4C0D B;  2L5Q A;  3P8B B;  4KH0 B;  3F70 A;  4L59 A;  4Z89 A;  4FT4 A;  2YUN A;  4M78 F;  1CKA A;  2W0Z A;  2QGG A;  1PWT A;  4IUQ A;  4PFO A;  4KUL A;  2E3H A;  2QXF A;  3H6Z A;  2LJ3 A;  4OGE A;  4JZ4 A;  4IUV A;  4N0A A;  2Y4Y A;  5DLO A;  1ZBX A;  2LRQ A;  1EX4 A;  3CCL Q;  1I5L A;  2FL7 A;  2K3Y A;  2BE7 D;  4CI0 C;  1KQ1 A;  1NG2 A;  1EZZ B;  3QWY A;  2YRV A;  4OMQ A;  3OYN A;  3CCS T;  1RAF B;  3CCJ T;  3MPU B;  2PNI A;  2EKH A;  1BI2 A;  1GFD A;  2MPX C;  1Y0M A;  4HCB A;  4N0A C;  4BY6 B;  4C92 A;  5GAM g;  2QTV A;  4VUB A;  1QQJ A;  4TVR A;  2IG0 A;  3PIP A;  2XDB A;  3JCM P;  2HZY A;  1UHF A;  1T0J A;  2PVG B;  3VS4 A;  1VQ7 T;  1PSF A;  4RG2 A;  2XHC A;  1I81 A;  2BE9 B;  5D6Y A;  1WHJ A;  4M77 G;  2VUB A;  4C92 G;  5GMK l;  1QP2 A;  3CCS Q;  2SRC A;  3C95 A;  1VQP Q;  2O4X A;  2QQB A;  1RAI B;  2O4X B;  4C5E A;  3LH5 A;  3S6W A;  3A1P A;  1Z9Q A;  4PJO E;  4ZTJ A;  1VQO Q;  4M77 A;  1RLQ C;  5GJV B;  4DBR A;  2J05 A;  4M78 E;  3SWN C;  3G71 T;  3RKY A;  4Z8A A;  4XTZ A;  2R5M A;  4Q5W A;  2LCS A;  1M90 R;  4FU6 A;  2L3Q A;  1G2B A;  3CCQ A;  2O9S A;  1ZBJ A;  3A8O B;  4J9I A;  2OI3 A;  3PFS A;  2KYB A;  2E1H A;  2C0I A;  4ORZ A;  3CBP A;  4M7D D;  1LOJ A;  2GTO A;  2EYZ A;  2RQV A;  4LE9 A;  1YJ9 T;  1RAA B;  2ESW A;  4KGV B;  3PTA A;  1JU5 C;  4MML A;  3QYH B;  2DD5 A;  1X2Q A;  2Y90 A;  8AT1 B;  3NMZ C;  1B07 A;  4MDW A;  3UA7 A;  3OW2 P;  1K73 R;  4BY6 C;  1TUD A;  2GQV A;  2YUQ A;  1U5S A;  1G83 A;  2EVR A;  1BI0 A;  2HL3 A;  2E64 A;  2LDM A;  1YIJ A;  1K76 A;  2HBW A;  2COW A;  3CMA T;  3EGU A;  1MMD A;  2VB6 A;  2DPP B;  3OBY A;  3DKM A;  1WIE A;  2KEA A;  2DXU A;  1VQ9 A;  1QVF A;  4E7L A;  5IAY A;  2NUP A;  4XQ3 A;  3GNF B;  3LGF A;  4IUU A;  2RF0 A;  2JW4 A;  2DZ9 A;  4ME7 A;  3EG3 A;  1VQ8 Q;  5J39 A;  5KYN A;  1QCN A;  2PU9 B;  1MMA A;  1UDL A;  3JB9 G;  1ZHI A;  2CP7 A;  2E3I A;  4PLL A;  1OQK A;  3JCM d;  5LJ3 f;  1VQK A;  3QHS A;  2BZX A;  2H3E B;  3L2Q A;  1D0X A;  1OV3 A;  3INZ A;  1ZQ1 A;  3AHU A;  2LNV A;  2D8J A;  3VS7 A;  5KCH A;  2DYB A;  2ZAE A;  3JB9 I;  5LJ3 e;  3A8M B;  1D1A A;  5LJ5 j;  3CCL T;  1JJ2 S;  2V1Q A;  1RI9 A;  4XU3 A;  1VQ6 A;  3LWH A;  1YHQ A;  4E6R A;  2OTL A;  1R0B G;  2FZK B;  4M75 C;  4M78 A;  3DLM A;  3M0P A;  1JJ2 P;  4E7J A;  4JJB A;  3VS1 A;  2YHT A;  2KRM A;  2AKK A;  1T3S A;  4QT7 A;  3NPF A;  2DIQ A;  4M7A E;  1VYT A;  2CSI A;  3TSZ A;  5GAN g;  4QKU A;  4C0D C;  5EG2 A;  3CC4 A;  4EMG A;  5EC7 A;  1TSF A;  2ROL A;  1YJN T;  1TXQ A;  2WSE E;  4C8Q F;  1WI7 A;  3QWX X;  5IH2 A;  2AKL A;  1OX9 A;  2RH2 A;  3TVT A;  1VQ4 T;  1K9M C;  1H3H A;  4C92 E;  4E2F B;  1BI1 A;  3CCR A;  3QDF A;  4C5H A;  3TU4 K;  1VQN T; 
#chains in the Genus database with same CATH homology
 5GAN d;  2WSF E;  5LJ3 d;  4E47 A;  3OYI A;  2M0O A;  5GAO l;  3CCE A;  4M78 B;  5LJ3 h;  1VQM A;  1XTD A;  5KCO A;  2FVU A;  1Y07 A;  4JRQ A;  1D3B B;  2GF7 A;  2XU8 A;  3HPW A;  4L6V 5;  3N5B B;  5GAM d;  3CC4 T;  1DJ7 B;  5J26 A;  4PJO G;  2E65 A;  4XU1 A;  3QDR B;  4M75 B;  4A4H A;  2DTO A;  3QXE B;  4JS4 A;  1I8F A;  1VQ7 A;  4M7A D;  5D6X A;  5GAO p;  2GCX A;  1YJN A;  2MI6 A;  2I2L A;  4C92 B;  3ZBD A;  1M9S A;  3LLR A;  2Y4X A;  2EQK A;  4YTL A;  1VQ4 A;  1Y96 B;  5GAO n;  4HT8 A;  4LDU A;  4N4I A;  5CVI A;  1M1G A;  5LJ3 g;  2M1H A;  4D6W A;  1YIT A;  3QYG B;  3WVE B;  3EFS A;  4LDY A;  1VQ8 A;  3HSB A;  3M9Q A;  1VQM T;  2DK3 A;  3M58 A;  4M75 E;  3VJP A;  4JLI A;  4JRK A;  1M8V A;  2XI9 A;  2LX9 A;  3QZ5 B;  1IRE B;  2E70 A;  3JCM X;  1K8A U;  3J7A F;  1V29 B;  2DZC A;  3WXM B;  3ZEH A;  3C94 A;  3M57 A;  4N4G A;  3RIR A;  1N6A A;  3OS1 A;  3OYD A;  3I55 T;  3C4S A;  5L8R E;  3HRT A;  4KUD K;  2K5I A;  2GFA A;  3CCS A;  4M77 B;  3EFR A;  4BE1 A;  5LJ5 e;  1Y96 A;  2L8D A;  2D6F A;  2RI3 A;  1QP3 A;  4C0G A;  1G5V A;  4PJO F;  2DXB A;  1WJS A;  4BAC A;  2P4T A;  3RES A;  3CPW S;  4OB1 B;  1VQN T;  3E1S A;  4EMK C;  5FRO A;  5DM7 R;  3CCM T;  5KE3 A;  4EMK A;  2AHJ B;  1MGQ A;  4JDS A;  1Q86 U;  1H64 1;  3TCJ A;  1VQ8 T;  3X28 B;  4C92 F;  4LDW A;  3V7R A;  4JJN K;  1VQP T;  1WJR A;  3RKW A;  4NOY A;  4F7U F;  4MMK A;  1YI2 T;  4M7A G;  4DOV A;  4M7A C;  4A4E A;  2VXF A;  3QJ6 A;  2XIC A;  4C5G A;  4QVC A;  4ATO A;  2CZ0 B;  3SB2 A;  4RCB A;  3JCM J;  3CXC S;  1UGR B;  3I55 A;  3UWN A;  1K9M U;  2CGH A;  5LJ3 j;  4C8Q A;  2ZPI B;  2V8K A;  1B34 A;  3FLG A;  4B9W A;  3OBW A;  3L42 A;  5CO7 A;  3GF5 A;  4CRI A;  4IUR A;  5GAM f;  1UB4 A;  5GAM j;  2VYT A;  3BFM A;  4OB3 B;  4M7A A;  2M9U A;  3QPH A;  3LWI A;  2XD0 A;  3M56 A;  3OYM A;  4BE2 A;  2EYQ A;  3TRE A;  4FL6 A;  3CCV T;  1QVF S;  1KQS S;  5GMK m;  4V2S A;  2BKD N;  5DLQ E;  1KQS A;  2KQW A;  4M7D F;  2BIV A;  4MZT A;  2R5A A;  3UT1 A;  5HK0 A;  1M90 C;  2DVE A;  3LGL A;  4PNO A;  1BYM A;  3H8Z A;  2LT4 A;  3HP9 A;  1OZ2 A;  2K57 A;  4KT0 E;  4C8Q G;  3JCM Q;  4PJO C;  1BIA A;  3MEW A;  1VQP A;  2RM4 A;  3MP1 A;  4O5V A;  1I4K 1;  4DA4 A;  1X01 A;  4XTU A;  4OB2 B;  4NS5 A;  2CS7 A;  2DXC A;  3X24 B;  2R57 A;  1Q82 U;  1FXX A;  3CBM A;  2MWO A;  1YCY A;  3M4Y A;  1XOV A;  4FM4 B;  4FT2 A;  1MHN A;  2PUO B;  3CCU A;  3JCM e;  3V8J A;  3A8L B;  3S3M A;  2K5F A;  3L1A A;  3NFC A;  2L3R A;  2WAC A;  5GAM h;  3X26 B;  1HK9 A;  4J7I A;  3RMQ A;  3CCR A;  1SSF A;  3DB4 A;  4LD6 A;  4XU2 A;  2IVW A;  3LW5 E;  2JNG A;  1P92 A;  1Q86 C;  2YLC A;  2JZ2 A;  1WPY A;  4NL3 A;  1KHI A;  3CCV A;  4HT9 A;  2JTF A;  2RJE A;  2LTO A;  4BDZ A;  1KD1 C;  3MET A;  3OSS C;  3M53 A;  2R58 A;  1RL2 A;  2QEX A;  3CC7 T;  3L2Z A;  3L2U A;  3SFM A;  4M78 G;  4MZM A;  5M9O A;  5GAN 5;  4RCC A;  3OS5 A;  3OA6 A;  3GIB A;  5CQX A;  2CKK A;  4M75 D;  4QW2 A;  1FWZ A;  1VUB A;  2E6Z A;  2KMT A;  3TEE A;  1YJ9 A;  3ASK A;  2KY9 A;  2ZZD A;  4OMF B;  3CC2 A;  1X6O A;  1NZ9 A;  2DAQ A;  4M75 G;  1NE8 A;  3JRZ A;  3VYG A;  2CYZ B;  2DJZ A;  1G3T A;  3PGG A;  4EMK B;  2EIF A;  4X34 A;  1N8R C;  1O75 A;  2DIG A;  2JOY A;  2CZ7 B;  1XNI A;  2XDD A;  3E9G A;  5FRN A;  2CZ6 B;  4EPC A;  3MO8 A;  4C8Q D;  4C8Q E;  3GNG A;  2RI5 A;  3QII A;  3MP6 A;  3ZFJ A;  2G3R A;  3V8L A;  1O9S A;  3CCL A;  5GMK h;  2OTJ T;  4OGC A;  5A0L A;  1QVG A;  2DKG A;  2X4W A;  5FU7 B;  5A2Q E;  2ZPF B;  4ELY C;  3CME A;  4OB0 B;  4Y28 E;  5FU6 C;  3A5Z B;  2EQM A;  4BI4 A;  4HA8 A;  4HCZ A;  3GPL A;  4M77 D;  3OYL A;  1YIJ T;  2OTL T;  2QDY B;  1GXI E;  4XTW A;  1M4Z A;  3OS0 A;  3CMA A;  1M1K C;  1LNX A;  4M7D G;  2D0Q B;  2D9T A;  1N9S A;  2XID A;  3EAE A;  3WVD B;  5A0G A;  4M7A F;  1M5Q 1;  4C0F A;  3OYG A;  3CD6 T;  4XTX A;  4PL6 A;  3NTH A;  4EDU A;  2EJG A;  4QVD A;  3RER A;  2HBP A;  4IUT A;  4QVZ A;  3HRU A;  4M75 F;  3BDL A;  3JB9 H;  2OAU A;  4C92 C;  3L2W A;  5LL6 S;  4BDY A;  1Q81 U;  4F7U E;  1BI3 A;  3S3O A;  3JB9 F;  5GAO q;  3JCM c;  2RHZ A;  2PVO B;  1FX7 A;  1UGQ B;  2ZCF B;  3E9F A;  3J81 E;  1M90 U;  2MWP A;  2QQA A;  3R6O A;  2OTJ A;  2ZPG B;  3HL8 A;  3G6E A;  1VQ5 A;  2K2V A;  4GLK A;  5HKC A;  3CME T;  2DO3 A;  3M55 A;  4M77 E;  2VV5 A;  4OVA A;  3URG A;  3CBO A;  5AYF A;  3JCM g;  3NTK A;  4C5I A;  1N8R U;  4M78 C;  2P0P A;  2KK4 A;  1U8R A;  3OSV A;  1KC8 C;  2XDP A;  3G4S A;  2MMP A;  3LYI A;  3OYF A;  4IKF A;  1JRI A;  4BI8 B;  5GAO m;  5C0M A;  3JB9 D;  1W2B S;  1NJI C;  3LX7 A;  2F69 A;  3NTI A;  1KC8 U;  3L2V A;  3CCR T;  4A54 A;  4FIB A;  2F5T X;  3CCE T;  1NJI U;  3MEU A;  1UEB A;  4C8Q B;  3OS2 A;  1PSE A;  4P5N A;  1M1F A;  2JTM A;  4HKE A;  4XTY A;  4BE0 A;  3OQ5 A;  3G6E T;  3GLX A;  1M1K U;  1VQ5 T;  1VQ6 T;  2RD1 A;  3FRN A;  2L5Q A;  3P8B B;  4C0D B;  1YHQ T;  2JN0 A;  3F70 A;  2P0Q A;  5IT9 E;  4L59 A;  1KG1 A;  3T9N A;  2E41 A;  4M7D C;  4FT4 A;  3SWN A;  3CCJ A;  1KQ2 A;  4M78 F;  2YLB A;  4PKC C;  4NL2 A;  4F7U B;  4WF2 A;  3G4S T;  1JB0 E;  1NPR A;  4IUQ A;  3JB9 J;  4KUL A;  2O01 E;  2KAF A;  2QXF A;  3H6Z A;  3Q1J A;  3OW2 S;  3KBG A;  4OGE A;  4N0A A;  4IUV A;  5DLO A;  2Y4Y A;  1ZBX A;  2LRQ A;  3QBY A;  3FC3 A;  3OB9 A;  2XKO C;  2QQS A;  2LVM A;  1I5L A;  5J3B A;  1VQL T;  2FL7 A;  2K3Y A;  2RHI A;  3OYE A;  2C06 A;  2RHX A;  2RK1 A;  3OYA A;  4JUV A;  4CI0 C;  1KQ1 A;  2GFU A;  2KDS A;  5HK3 A;  4QQD A;  3QZ9 B;  2K4Y A;  5GAN 6;  3BDU A;  2YRV A;  2LT1 A;  3OYN A;  3CCS T;  3CCJ T;  2HAX A;  5KE2 A;  1WGS A;  4ZN1 A;  4XK8 E;  3QUI A;  2DXT A;  4DOW A;  3HHT B;  4J8O A;  1K73 C;  1BI2 A;  3PIO A;  4ZGJ B;  4JS5 A;  1K8A C;  4HCB A;  5CAI A;  3PNW C;  1WQ7 A;  4N0A C;  4UC4 A;  4BY6 B;  4ZTF A;  4RG8 A;  1VQN A;  4C92 A;  1NPP A;  5GAM g;  1IZ6 A;  4VUB A;  1U1T A;  3OW2 A;  3E19 A;  4LDV A;  2RJC A;  4TVR A;  2IG0 A;  4PLI A;  3PIP A;  3JCM P;  2XDB A;  2RJF A;  3O8V A;  2RB6 A;  4XTV A;  2PVG B;  4GY5 A;  2X4Y A;  1W4S A;  3JCM W;  1VQ7 T;  1PSF A;  4RG2 A;  3SDZ A;  5LJ5 h;  2K5L A;  2XHC A;  1I81 A;  2QTX A;  2RK2 A;  3MEA A;  5CK9 A;  2E10 A;  5D6Y A;  4BUG A;  4M77 G;  4C92 G;  2JVV A;  2LCC A;  2VUB A;  3P8D A;  3FEO A;  1QP2 A;  5GAM e;  2MF2 A;  5GMK l;  3PMI A;  3C95 A;  3CCQ T;  2X35 A;  3GP8 A;  4E7H A;  2O4X A;  2QQB A;  4J6W A;  1S72 T;  3DB3 A;  2O4X B;  1BIB A;  4C5E A;  5CKD A;  4M7D A;  1BKB A;  2PVD B;  3UDC A;  2DD4 A;  2V8J A;  4EMH A;  3S6W A;  4PJO E;  1TH7 A;  4FSX A;  4ZTJ A;  1U1S A;  3BY7 A;  4M77 A;  2E12 A;  3OYC A;  1Q7Y U;  4M7D E;  1R8O B;  2JUF A;  4QQG A;  5CCA A;  3VV0 A;  1G3W A;  4M78 E;  3SWN C;  3G71 T;  3RKY A;  4ELZ C;  4R55 A;  1KHC A;  3CCU T;  4XTZ A;  2BUD A;  2R5M A;  1Q82 C;  2EKO A;  3OYK A;  4Q5W A;  3RKX A;  3VU3 C;  2DTI A;  2HQE A;  3QG1 A;  4N4H A;  2KSS A;  4FU6 A;  5CKH A;  3SD4 A;  4F7U G;  3CCQ A;  5CKB A;  5GAN 7;  2CZ1 B;  3FIF A;  4BI3 A;  4PJO A;  2X4X A;  3A8O B;  1S72 A;  2EQU A;  1VIE A;  3RMS A;  4IUP A;  3HKS A;  4O6J A;  3PFS A;  3CCM A;  5GMK i;  4BD3 A;  2A3L A;  2VGM A;  2VGN A;  4C0Z A;  3FJP A;  2E1H A;  1H3Z A;  3JCM f;  5GAN 2;  2QEX T;  3CC7 A;  5FU7 C;  3CBP A;  2M16 A;  3JCM V;  4A53 A;  1LOJ A;  4M7D D;  2P0K A;  2LCL A;  5GMK j;  1YI2 A;  5C6S A;  4XAX B;  4F7U A;  1YJ9 T;  3DLL A;  4J6Y A;  5CKE A;  5CQY A;  1QVG S;  4R56 A;  3G71 A;  4JRI A;  2QQR A;  4DQ2 A;  1B34 B;  3PTA A;  2RO0 A;  2ZPB B;  1D3B A;  1KD1 U;  5GAO r;  4J7F A;  2E5Q A;  1UGS B;  4KUI A;  4MML A;  3QYH B;  3QKJ A;  1X75 C;  2DD5 A;  3CPW A;  1VQ9 T;  1G3S A;  1JJ2 A;  4PJO B;  1YBY A;  3V8K A;  2Y90 A;  3ER0 A;  1G3Y A;  2LQK A;  3M5A A;  3M4G A;  2V8I A;  2HD0 A;  1K73 U;  2FB7 A;  4MDW A;  5CKF A;  3X25 B;  4BY6 C;  2EFI A;  3L2R A;  4L5G A;  3M59 A;  2GQV A;  3SWN B;  4ZN3 A;  3OMC A;  4M78 D;  4II1 A;  1BI0 A;  2VC8 A;  5GAN 4;  2PQW A;  2E64 A;  2LDM A;  1AHJ B;  1WJQ A;  1YIJ A;  1Q7Y C;  2LC4 A;  4HCC A;  1UGP B;  2RA2 A;  4OF1 A;  3CMA T;  2L89 A;  3OBY A;  2DPP B;  5GAN h;  2PUK B;  3DKM A;  4M7A B;  2ZPH B;  3KUF A;  2NLU A;  3VKI A;  5KH6 A;  1QW1 A;  3JSC A;  2DXU A;  2KVQ G;  1VQK T;  1VQ9 A;  1QVF A;  3V7S A;  3I56 T;  4MZP A;  1OYX A;  4E7L A;  4C92 D;  2H3J A;  5IAY A;  3P8H A;  3OYB A;  4LD9 K;  4XQ3 A;  3CEY A;  3GNF B;  3LGF A;  4IUU A;  5LJ5 f;  4RKU E;  4Z02 A;  4M77 F;  2DZ9 A;  1Q81 C;  4ME7 A;  2RI2 A;  4A4K A;  2E6N A;  3RUX A;  3X20 B;  1OZ3 A;  2EJF A;  3MCA B;  5J39 A;  2ZPE B;  2XG8 D;  1XQH A;  1LJO A;  5GMK e;  2B8A A;  2PU9 B;  4M77 C;  5GAN 8;  3KXT A;  4XU0 A;  1WQW A;  3CC2 T;  3OYH A;  1RI0 A;  2QQ9 A;  1WNL A;  2WSC E;  2FHD A;  3JB9 G;  1ZHI A;  2LQ8 A;  4PLL A;  1N27 A;  3C12 A;  4M7D B;  1EIF A;  3JCM d;  5GAN j;  3BW1 A;  2DTH A;  5GAN f;  5LJ3 f;  3S3N A;  3JCM h;  5I2M A;  1VQO T;  3QJY A;  3GOX A;  3HFO A;  3QHS A;  2EWN A;  3V7C A;  3L2Q A;  1VQK A;  5FRM A;  3I56 A;  3HFN A;  3INZ A;  1ZQ1 A;  4C5H A;  3AHU A;  2LNV A;  4C8Q C;  4OP0 A;  5KCH A;  3LH0 A;  3JB9 I;  5LJ3 e;  3A8M B;  3CPF A;  4BB7 A;  5LJ5 j;  3CCL T;  1JJ2 S;  2HQX A;  4X9D A;  4MDX A;  2K3X A;  5CR2 A;  4X9C A;  1YJW T;  1W2B A;  3PT9 A;  4XU3 A;  5I2S A;  4ZGD B;  3LWH A;  1VQ6 A;  5HY6 A;  2RJD A;  2EQJ A;  1YHQ A;  2VXE A;  5IN1 A;  2XK0 A;  4J5Y A;  3VYH B;  3MHX A;  2OTL A;  2EJ9 A;  4M75 C;  2F5K A;  5I21 A;  3QO3 A;  4M78 A;  5LJ5 g;  3DLM A;  3JAM E;  1Y7X A;  1QVP A;  5GAN e;  4E7J A;  1VQO A;  1JBM A;  3JCM b;  3HRS A;  2HNI A;  3CD6 A;  4KBM B;  4A4G A;  2YHT A;  3FDR A;  4B9X A;  2QA4 T;  4Y91 A;  3OMG A;  3QSU A;  3ME9 A;  1VIF A;  3A8G B;  2DIQ A;  4M7A E;  1N9R A;  1Y71 A;  2DEQ A;  4J83 A;  4M75 A;  4ZGE B;  1HXD A;  5D6W A;  3UPU A;  4E7K A;  5GAN g;  3OYJ A;  2ZGW A;  1VQL A;  3OYY A;  4C0D C;  5EG2 A;  1YJW A;  3CC4 A;  4JLG A;  2QI2 A;  3A8H B;  4EMG A;  2FYK A;  5A0D A;  3J80 E;  4E7I A;  3VUZ A;  2RHY A;  5LJ5 d;  4J6X A;  2RHU A;  1OI1 A;  5FLX E;  1YJN T;  4QQ6 A;  4RMO A;  4LDX A;  2WSE E;  4JRP A;  2EAY A;  4PJO D;  3FB9 A;  2X4J A;  5CIU A;  4C8Q F;  5GAN 3;  3VUB A;  3MEV A;  5FU6 B;  2RH2 A;  1VQ4 T;  2QA4 A;  1K9M C;  5DY9 A;  3PMT A;  4C92 E;  3OY9 A;  2A7Y A;  2MAM A;  3M54 A;  3CXC A;  1BI1 A;  4A4F A;  1YIT T;  3MP8 A;  3TU4 K;  3G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...