4M7AC

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
b'TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aC00
3RUXA 3JCMJ 4MMKA 3RKYA 3QUIA 4X9DA 2EWNA 3FJPA 4M77A 4M78B 4A54A 1WQWA 1YCYA 1I5LA 4RCCA 1HXDA 2DTHA 4M77D 4XTUA 4C92A 3QHSA 4XU1A 2YLCA 1HK9A 4F7UB 3JB9I 5I21A 3JCMV 1JRIA 4J6WA 1WPYA 3JB9F 5GMKj 2I2LA 3V8KA 4C92D 2EJ9A 4PJOB 2HNIA 3RKXA 4C8QD 4M78G 5GANh 4M7AA 5GAN3 1Y96B 3SB2A 4JUVA 3RIRA 3HFNA 2E41A 2DXTA 4OP0A 4EMKC 4M77C 4XTYA 4M7AD 3HFOA 2DTIA 2FYKA 4DQ2A 4F7UG 1MGQA 2DTOA 1U1SA 2VXFA 4XTZA 3JCMh 1BIBA 4QVCA 5LJ3g 4PJOG 2EJFA 4C92E 3BY7A 5GMKe 3JCMb 5GAOl 5GAOn 1WQ7A 4X9CA 4M78C 2RD1A 1LNXA 4C8QC 5LJ3j 2ZGWA 4M7DD 4M7DG 5LJ3d 4M75B 2DZ9A 5GAMf 1LJOA 3BW1A 4M7AE 4EMKA 1B34A 5GAN2 4HT9A 4M7AC 5GAN7 3V8LA 1BIAA 2K57A 5GAMe 3JCMP 5LJ3f 3JB9J 2EAYA 4J5YA 5GAOr 1WNLA 2FB7A 1I81A 1N9RA 3FB9A 4M78A 4C8QA 4M75G 5LJ3e 2VXEA 5GAMh 4M7DC 3V7RA 5LJ5g 4M78D 4EMHA 3L2ZA 4RCBA 4F7UA 3EFRA 4N0AC 4M77F 4WF2A 3V8JA 2E10A 5LJ5j 4JRIA 3SWNB 2YHTA 4NL2A 4XTVA 5LJ5d 4M77E 3GIBA 1N9SA 4Y91A 4PJOA 3FIFA 4C92F 1Y96A 4M7DA 4PJOD 5GMKi 4XU2A 4C8QF 1LOJA 3M4GA 2QTXA 5LJ5f 4M78E 3JB9G 3L1AA 3JB9H 4C8QE 2VC8A 3JCMc 4A53A 5GMKh 5GMKl 4HT8A 2YLBA 3V7SA 5LJ5e 4M7AF 4QVDA 1TH7A 4M75A 4PJOC 1U1TA 4MMLA 2DKGA 5GAN4 4HA8A 2RB6A 5DY9A 3V7CA 4M7DE 4M75D 3JCMW 1M5Q1 4J6XA 3RERA 1D3BB 5LJ3h 4NOYA 2E1HA 2EJGA 5GAN8 5GAOp 1X01A 5GANg 3HSBA 4PNOA 4XQ3A 4XTXA 1B34B 4EMKB 4M77B 4NL3A 3BDUA 5GANj 4M75E 4JRKA 2DJZA 2Y90A 4M75C 5GANd 4XTWA 1KQ2A 4M78F 3AHUA 2E65A 2CGHA 2DXUA 3SWNA 4C92B 3JB9D 5GAOm 3JCMg 1KQ1A 3PGGA 4EMGA 1I4K1 4C8QB 1H641 5GMKm 4F7UF 4J6YA 3JCMQ 2DEQA 5GAN6 5GANf 2RM4A 3JCMd 4M77G 4F7UE 4PJOF 4M7AB 2DZCA 4N0AA 5GANe 2DVEA 3RESA 5LJ5h 5GAOq 4PJOE 1I8FA 3JCMX 4M7DF 4C92G 4XU0A 3JCMf 4C8QG 4M7DB 1M8VA 2JN0A 3SWNC 5GAMg 3RKWA 3JCMe 5GAN5 3INZA 2RA2A 4V2SA 4M7AG 1JBMA 3QO3A 5GAMj 3QSUA 5CAIA 3VU3C 4XU3A 4JLIA 5GAMd 4C92C 4M75F 3BFMA 1D3BA 3EFSA 2E64A
chains in the Genus database with same CATH superfamily
3RUXA 3OSSC 1QWFA 2E3IA 4D6WA 5CKFA 4QW2A 3PNWC 4MZPA 5GANh 3CCUA 2M51A 1M27C 2HQHA 2QXFA 4O5VA 4RTUA 4M7AD 2KDSA 2B86A 2RN8A 1B3QA 1Q95G 3OYYA 2K3BA 1H8KA 1VQMA 4BB7A 5GAN2 4E7ZA 3CC7A 3OYHA 3JSCA 3M55A 1Q81R 2KR3A 2P4TA 3M5AA 1ZSGA 4M75G 3L2ZA 4PJJA 2LDMA 5LJ5j 2E10A 4JRIA 1N9SA 5KYUA 3MHXA 2F2WA 3JCMc 3CCRA 4HT8A 2DL5A 1BU1A 2LNHB 4QQGA 1ZHIA 3QYHB 5DY9A 3LWIA 1UGQB 3JCMW 3CCJQ 2CREA 2CSQA 4BI3A 1C6VX 1G3YA 2MMPA 4FSSA 3FC3A 1X01A 5GANg 2IPOB 4JJBA 4M77B 2X35A 2RH2A 3AHUA 3SD4A 2ZZDA 2A7YA 2KXCA 1LVKA 4F7UF 1GBRA 1Y57A 2MCNA 3ER0A 2E12A 1QKWA 1VQ5Q 4JS4A 3OBYA 4LDWA 2RA2A 3QG1A 3QSUA 3CPFA 3CMAQ 1FMVA 1VOMA 2M1HA 4N4GA 3HPWA 3FJPA 4M77A 2QYZA 2ZPIB 1OYXA 3E19A 1QVGS 1HXDA 3EG1A 1AVZC 1OZ2A 2QI2A 3M0SA 2W0ZA 3MPUB 2GQVA 1ZSZB 2LC4A 4RTTA 4A4HA 2E41A 3OBWA 3IQLA 3NHNA 2LZ6B 2DIGA 1VQ7A 4M7DG 1N6AA 4HT9A 1E6HA 1CKAA 4IUTA 4Z8AA 2CZ1B 2CH4A 3JV3A 3QJYA 2EFIA 4X1VA 5FU6B 4AFZC 2C06A 4L59A 1X69A 1ZSZA 1JQQA 3WVDB 3BDLA 2QTXA 3EH2A 3SFMA 2COYA 4GY5A 5LJ5e 1FXXA 2RF0A 1UFFA 5GAN4 3CMET 2XU8A 4BE1A 3M0PA 4A4EA 1JB0E 1OPKA 3H0IA 2DXCA 3CD6T 5FROA 4KH0B 1OX9A 4PNOA 1K4US 1QVPA 3M57A 2HKNA 4M75E 3RDVA 1YIJQ 5GANd 4XTWA 2E3HA 3OS2A 1I4K1 1Q7YU 3DB4A 2KI7A 1TG0A 1W1FA 1Q82R 4N0AA 2EQIA 1RAHB 3E2UA 1LPLA 3OMCA 1MNEA 4E2FB 1WHJA 3CXCA 4OGEA 2KT1A 9ATCB 5I22A 3CCST 1VQ9A 2GGRA 3QXEB 2HEQA 3H0HA 5LL6S 4JRQA 1W2BP 2E64A 2LT4A 1M2OA 4C0DC 3TU4K 3UWNA 3CCVQ 2G6FX 4EPCA 3GOXA 1YCYA 1X2QA 2OTLA 1VIFA 4M77D 3KUFA 3EFOB 4D8KA 4F7UB 1ACMB 5KYXA 1WPYA 3OQ5A 3S6WA 1WA7A 4OP0A 1BKBA 2H8HA 2K3XA 4QVCA 1IXDA 5GAOn 2D8JA 3VYHB 5LJ3j 4C8QC 2QDYB 4J9EA 4J7IA 1M2VB 3GLXA 3BW1A 2O88A 1B34A 2K57A 3RMQA 1AWXA 2A36A 2EQKA 4C0ZA 2PU9B 1KIKA 2OJ2A 1VYTA 2EYXA 4OMFB 5KE3A 2XDPA 4F7UA 4NL2A 1GFCA 2DD5A 1PCXA 5J39A 4C92F 3PT9A 4C8QF 3EAEA 4DBRA 1WYXA 2COWA 2ED1A 2X3WD 3CD6Q 4DOWA 3TVTA 3RNJA 3M0TA 4ZTJA 1M90C 4M7DE 3REBB 2DX1A 5C0MA 2ENMA 2G3RA 3UA7A 3A8GB 1QLYA 2Y90A 4HVUA 3CBPA 4M78F 1QMCA 2DRKA 4IIMA 3PGGA 1VQLQ 4JS5A 3D7SB 1BI1A 2M16A 2WSFE 1PC0A 2HD0A 3CCSQ 1I8FA 3LX7A 4XU0A 4PFZA 4DBHA 1G8XA 1M8VA 2NYSA 3J81E 4F16A 3BE3A 2E6ZA 4AG2C 2HL5C 3M53A 1YJNA 4M7AG 1RADB 1PRLC 1YHQT 1PM3A 1W70A 3EG3A 2NUZA 3RMSA 5C6SA 5CR2A 3L42A 3CCMQ 1VQPT 2HSPA 4J9CA 2HCKA 1OQKA 3MP8A 2HZYA 3RKYA 1CSKA 3J7AF 1T3SA 4R0KA 4Z89A 1ABOA 1R77A 2K6DA 2F1LA 2P0PA 3TCJA 1UHFA 2ZPGB 3QPHA 3O8VA 3G6ET 2DETA 1OZ3A 3EGXA 2PVGB 1U5SA 1KC8C 1NM7A 2RJEA 3JB9J 5LJ3e 2VXEA 4HKEA 2K5IA 1VQOA 1SHGA 3A1PA 2EGAA 3KFVA 3TREA 3QZ9B 2PNIA 3OB9A 1RUWA 3L2UA 4QQ6A 4BE2A 1QVGA 1ZBJA 4C0DB 4ELZC 1VQ4A 4RTZA 5KYWA 2R5AA 1BI0A 5KH6A 1W2BS 3CCQT 1XNIA 4C0GA 4BY6B 1KSWA 5CO7A 2CH4W 4FW2A 4FW1A 3QBYA 2A3LA 3CC2T 3I56Q 2C0IA 3H0FA 3AT1B 2J6FA 3ZL7C 1T0HA 2AIRB 1KK7A 1PHTA 1TU0B 4C92B 1AD5A 2JT4A 2KY9A 2ZPEB 4RTWA 4C8QB 5IAYA 1RACB 2Z0WA 1VQNT 4X34A 1V1CA 2DYBA 1YHQQ 1VQPQ 4F17A 3ME9A 1C1AA 4R56A 1GL5A 3TSZA 1JBMA 3QO3A 5GAMj 1K0SA 1WDXA 1F1BB 3S3NA 1QCNA 2FG0A 2QAZA 3F70A 4QQDA 2VGNA 4MDXA 1ZBXA 4LDVA 3CCEQ 2XIDA 2DILA 1UEBA 4M78B 4A54A 1XJWB 4BI4A 1VQKQ 2GTJA 1RAFB 4C92A 1QP3A 5KCHA 1M1GA 3ZEHA 3CCLA 2CT4A 1QW1A 3H41A 2FPEA 2L89A 1D0XA 2DD4A 1YBYA 3HFOA 3JCMh 2EJFA 1RI0A 2CZ0B 1IZ6A 4X9CA 3CPWP 2DM1A 3MCAB 1OPLA 4RG2A 4OB2B 4M7AE 2EQUA 3OYKA 3A5ZB 1NPRA 2EBPA 4B9WA 5IT9E 4M78A 1D09B 4PL6A 2LQ8A 2DPPB 1UE9A 1M90U 2J05A 1YJWA 2XDBA 2QEXQ 1BYMA 4XU2A 6AT1B 3OYNA 1Q7YR 4DEXA 2WSEE 2VC8A 1ABQA 2K2MA 2PUOB 3V7SA 3MEWA 1WJQA 1VUBA 2HDAA 2DL8A 4BACA 4BI8B 3C94A 2D1XA 3E9GA 4Z02A 4QKUA 2E1HA 2C0TA 3PVLA 4RKUE 1N8RC 5L23A 4HCKA 2JS0A 4Y92A 2KXDA 5J3BA 3JCMg 3WXMB 1KQ1A 2GTOA 3L2QA 1PWTA 1BI2A 4ZNXA 1UGRB 3X25B 4KUIA 2FRWA 4M77G 2CUBA 1QVFS 3OYFA 2KT8A 1M1KC 1UB4A 2L3RA 4FL6A 1DJ7B 3QIIA 2E6NA 2KVQG 4HXJA 1ARKA 3CCJT 3M9QA 1QCOA 2EWNA 4RUGA 2D0NA 2X9HA 4RCCA 3OYJA 4PLIA 3M58A 1UGSB 2A28A 3UDCA 1TUDA 3JB9I 1KC8U 3JB9F 5ECAA 4C92D 4BE0A 3RKXA 4C8QD 2XICA 2KE9A 1X6BA 3E1SA 2EYQA 3HFNA 1RABB 1MUZA 1J3TA 4J9DA 4DQ2A 1SRLA 4XTZA 2E5KA 1TWBA 1VQ5T 2CYZB 3MEUA 2DL7A 3ZFJA 1NEGA 4L6V5 4N4HA 2EKOA 2RPNA 2DF6A 1LJOA 1D1BA 3PIPA 4PFOA 2DXBA 1MMDA 2XK0A 4IURA 3OS0A 3A8HB 3OYLA 2MYSA 5DLOA 3CMAT 4J7FA 1MNDA 1K8AC 2KYMA 4M78D 4JPBW 3OA6A 3OW2P 1WHHA 3M0QA 4WF2A 1YFNA 4VUBA 4JZ3A 4EDUA 3MO8A 2PTKA 1G3TA 2R57A 2RK1A 2AK5A 5LJ5f 2ECZA 2D8HA 1BBZA 3G71A 2EVRA 1KHIA 4J83A 2XDDA 3WVEB 1Q86R 3SDZA 1K9MC 1OEBA 2DKGA 2LNVA 1T0JA 2DL3A 3UPUA 3R6OA 4LN2A 4OMOA 2DIQA 1KD1U 2JMCA 1YITQ 3BDUA 2AZSA 4JDSA 1SG5A 4AMCA 2P4RA 1KQ2A 2LVMA 3O5ZA 5CCAA 2NLUA 1PD0A 4KGVB 4UC4A 2F5KA 3CMEA 1VQ8Q 3JCMQ 1AWJA 3JCMd 3HRUA 2NUPB 4AFUC 5EC7A 3QWXX 3G4ST 4PJOE 2OAWA 3CPWS 1FWZA 2KMTA 4YTLA 1M9SA 5D6XA 1WX6A 1ZLMA 2DNUA 3VU3C 2J6OA 3C0CA 2V8IA 2HMAA 4OF1A 3V7CA 1VQ6T 1UECA 5CKBA 3QZ5B 2BE9B 1W2BA 5KYYB 1JJ2P 1YP5A 2FVUA 2GF7A 1M3AA 5GMKj 1YIJT 5FRNA 2NUPA 3TQ7P 4JLGA 3OMGA 2SEMA 3RIRA 4EMKC 1YJ9A 1RL2A 4F7UG 1H3ZA 2IIMA 5HKCA 2RD1A 4OB1B 2F2VA 2FZGB 1WXBA 2QQAA 1IO6A 2KGTA 5GAOr 2BIVA 4M7DC 4Q5WA 5KYYA 3SHWA 3CCVT 2ABLA 2WACA 2ROTA 4RTVA 3FIFA 1BK2A 3NTIA 3UT1A 2QA4A 2CKKA 4C5GA 1N8RU 1NBEB 1WHLA 4PK4A 3I55T 1Q81C 1TH7A 1X6OA 2OTJT 1U1TA 2EYWA 3NTKA 1C0MA 3TEEA 1SEMA 2SRCA 1BCMA 1M1KU 2CP7A 1SRMA 3G4SQ 5GANj 3Q1JA 4MZMA 4B9XA 3S3OA 2MAMA 3A98A 2VB6A 2ROLA 1X43A 1KHCA 2K4YA 3X28B 2L3PA 2JMAA 1VQ6Q 1ZA2B 2L3QA 1LCKA 2Y4XA 3HKSA 2K79A 3A8OB 1AT1B 5GAN5 3PIOA 4ZTFA 2V1RA 5CAIA 2HSEB 2GFAA 4GBQA 2BKDN 1WHGA 2KBTA 1H92A 4GLMA 3R6NA 3M4YA 5DLQE 3FEOA 4XK8E 3OW2S 2EW3A 4MDWA 2VGMA 2K5FA 2M0YA 4B6MA 4IUQA 4M4ZA 2I2LA 2RHUA 4ATOA 1M90R 3CEYA 1YHQA 3MEVA 1VQLT 4FT2A 5GJVB 5I11A 5KE2A 1MGQA 2DTOA 1PRMC 5GMKe 3JCMb 3LLRA 5L8RE 4QT7A 1SSHA 3OYBA 1QVFA 3REAB 5LJ3f 2EAYA 2EPDA 4J5YA 1WI7A 4FYWB 3CC4Q 1N9RA 3FB9A 3CCMT 1MV0B 4DBQA 1S72Q 1G3SA 3EHQA 2DBMA 3G6EA 4RCBA 4CC3A 1O75A 1K76A 3EFRA 3I55Q 4LD6A 3M54A 2MWPA 2OTJQ 2JJ9A 1AWWA 4A63B 2L2PA 2ATCB 1XQHA 1FMKA 4ANJA 2XI9A 1Z9ZA 3CCUQ 4WTOB 2QTVA 2YDLA 4PJMA 1UHCA 3VS0A 2YSQA 3EFOA 5GAN8 2RO0A 1VQMQ 4EMKB 2YT6A 4HVVA 4PLLA 2J7IA 2HBWA 3CC7Q 3JB9D 1JEGA 2L5QA 1KC8R 3CCQA 2RM4A 3EGDB 5GANe 3RESA 1M2VA 1GCPA 4C92G 1UTIA 4C8QG 4M7DB 3CC2A 2J6KA 4FYXB 1AWOA 5GJWB 1YCSB 2JXBA 3M59A 4E7SA 3CCRQ 2KRMA 3HTRA 3I5RA 5J26A 2CSIA 2ZPBB 1VQNA 4LE9A 2QGFB 1X6GA 1TOVA 2YRCA 2V8JA 2LJ1A 3VUBA 2KYBA 2ZPFB 3PMIA 1QQJA 3I56T 1NG2A 4XU1A 3LH5A 5I21A 2HNIA 2BE7D 3EGDA 1R8OB 4M78G 2EYZA 4RG8A 4OB0B 1YI2T 3GF5A 2L0AA 1WQ7A 2ZGWA 2O2OA 3VS1A 3VS5A 3VYGA 2EYYA 2HAXA 3V8LA 3CPWA 2QQ9A 4RTXA 2DAQA 1RLPC 3N5BB 1MHNA 1UUEA 2X4WA 2KK4A 4KULA 1NZ9A 1KD1R 3CCET 2DK3A 1QCFA 2ESWA 1NJIC 2ZPHB 3GIBA 1VQKT 1TTHB 2D6FA 4C5IA 1VQ9T 2J06A 4FYYB 4ZGEB 2FHDA 4QVDA 4KGZB 1VQ7Q 2MWOA 5A0LA 3LGFA 2KSSA 1EIFA 3MP1A 5A0DA 2ZCFB 2L3SA 2DJZA 2EGCA 1JU5C 2H3EB 5IH2A 2R5MA 3UATA 4EMGA 1NLPC 1WFWA 3UF4A 3C4SA 2M02A 2DLPA 2YXYA 2KRSA 2YUNA 3PFSA 2QEXT 5AT1B 1MV3A 2DFUA 2X3XD 4LNPA 3J80E 4PKCC 3NGPA 1I5OB 3I35A 3I5SA 2BZXA 1EX4A 2PVOB 3A8MB 2NWMA 1M30A 1YI2Q 3JCMV 1Y07A 2ED0A 1YNZA 3H8ZA 2K9GA 1UGVA 2HQEA 2DTIA 2QQSA 1TXQA 2VXFA 3CCJA 3CBOA 2F69A 4C92E 1N8RR 2RK2A 3FJ5A 4M7DD 2DZ9A 1RAEB 3META 2DA9A 4P5NA 1BB9A 1WNLA 1I81A 2FB7A 2P84A 4C8QA 1VQ9Q 1KFZA 2QQRA 1RAIB 1M1KR 2FRYA 4DEYA 1WXUA 2O4XB 2KNBB 1RAAB 1OV3A 2CP6A 1VQ5A 1OX8A 1YJNT 3OW2A 4D8DA 2I0NA 4J9BA 3M4GA 4M78E 2NUTB 8ATCB 2LJ3A 3CMAA 2QASA 4PJOC 1I1JA 1Y7XA 2LCLA 4HA8A 2CT3A 2MI6A 1D1CA 4KT0E 1U3OA 3VRZA 3M56A 4NOYA 4ZGDB 2EJGA 4E47A 8AT1B 2KQWA 2LJ0A 5A2QE 4E7IA 2XD0A 1H641 3LH0A 2LCCA 4RTYA 2HL3A 3CBMA 4PJOF 2NUTA 5M9OA 5LJ5h 5GAOq 4N4IA 4J9IA 5I2MA 1VIEA 1WGSA 1T3LA 2RQTA 3RKWA 3OYMA 2HBPA 2CZ6B 1OULA 1WHMA 3VRYA 1VYUA 2GNCA 2KEAA 3HL8A 1I5LA 3G4SA 4RMOA 3GBQA 1VQ4T 3LGLA 1YITT 2PZ1A 3V8KA 5FWCA 2EJ9A 1JJ2A 3SB2A 1SKUB 3OYAA 2GQIA 1G83A 2DXTA 2D0QB 2DO3A 4ZN3A 1VQ8T 1VQ6A 2FYKA 3KXTA 2X51A 2P0QA 4TVRA 5GAOl 1LNXA 1NJIU 3DLMA 4EIKA 4II1A 2K2VA 5HK3A 1K1ZA 3LW5E 5GAMe 3GPLA 3JCMP 1YIJA 1SSFA 1YJNQ 2RHXA 1K73C 5LJ5g 3P8DA 4E7JA 3VKIA 4LUEA 4E7HA 4L5GA 1N27A 3JB9G 5D7UA 3NMZC 1B07A 1M3CA 3G7ZA 1IGUA 5EG2A 3SEMA 5CKHA 3CCVA 2M0OA 2C0OA 4C5EA 3QJ6A 2VYTA 1D3BB 4J9GA 4PJLA 2FPFA 2EKHA 2E5QA 2XHCA 1VA7A 4M75C 3I55A 1HYOA 2OTJA 4OGCA 2PVDB 3PTAA 4CRIA 4R55A 1VQOQ 5HCKA 3JCMX 1MMNA 4F14A 2O31A 3X24B 5KYUB 5FU7C 1WZOA 2DMOA 2F2XA 2D9TA 2YRVA 4JLIA 1RAGB 1M3BA 4M75F 1VQ4Q 1D3BA 1IRXA 2WSCE 3EFSA 1BCOA 1YJWT 3JCMJ 1KQSP 2CDTA 4KBMB 4AFQC 4LDYA 3OYEA 3PE0A 3CD6A 4PJOB 2B8AA 5CK9A 1D0YA 1FYNA 1ZUYA 3URGA 2AKKA 4J9HA 2EGEA 4XTYA 1IREB 3QYGB 1E6GA 4LD9K 2RHIA 2VWFA 1ZQ1A 2K5LA 4OMQA 1A0NB 2RHYA 1I0CA 4OVAA 2PQWA 2RQWA 2DE0X 3VJPA 1VQLA 3LYIA 3FDRA 3CCSA 5LJ5d 4PJOA 4M77E 1GCQC 1W6XA 2QDLA 5GMKi 1B7TA 1LOJA 1PG5B 2CS7A 3NTHA 4ORZA 3NFCA 3CCLQ 3QKJA 2RNAA 3M0UA 3CCMA 4ESRA 2JUFA 3VS3A 3PVQA 5LJ3h 1N5ZA 2RJDA 5GAOp 3MP6A 1D0ZA 1QP2A 3EGUA 1TSFA 3CC4T 1FMWA 1S72T 2DXUA 5FWBA 4IKFA 2BZ8A 1KJWA 1R0BG 2RJFA 1Q86C 4IUVA 5GANf 2DEQA 2RQRA 1U8RA 4M7DF 2RQUA 1YJWQ 3I9QA 4A4KA 3JCMe 2X4XA 2JZ2A 2H3JA 2AZVA 3CCUT 3ZBDA 5CKDA 3BFMA 4MZTA 2VASA 4OB3B 1WQWA 4JZ4A 2JM9A 2V26A 4XTUA 3G71T 4O6JA 1KG1A 2FO0A 3OS5A 1UGPB 1VQMT 1YWOA 3H6ZA 1OI1A 3CC7T 1IHWA 3OY9A 2MPXC 3E9FA 4OMMA 1K73U 2RI3A 1GRIA 5AYFA 2ZAEA 3EHRA 2FZKB 5LJ3g 2RJCA 2W10A 3GNGA 1NYFA 2VV5A 4XAXB 2K3YA 1WJSA 3QWYA 4M75B 3I56A 5GAN7 3CCRT 3MEAA 1BI3A 3RERA 1TUGB 1G3WA 3JRZA 4JJDA 1O9SA 3L2WA 1YI2A 3X26B 4EMHA 1NPPA 4FIBA 1VQPA 4FCYA 2YHTA 4XTVA 1G5VA 5FU7B 1K8AU 2GCXA 4PJOD 2VUBA 2A08A 2PUKB 1PKTA 5KYXB 2MOXA 2YLBA 4CC7A 1JXMA 1YWPA 4M75A 4AT1B 4A4FA 2JTEA 4MMLA 1NYGA 3CCEA 2LT1A 5FW9A 5CQXA 1KQSS 1GFDA 1VQKA 1S1NA 5CQYA 4BD3A 4K11A 1K9MU 1PD1A 3HSBA 1AHJB 2CP5A 1B34B 4XTXA 4ZN1A 1YJ9T 4NL3A 1IGQA 3THKA 4IIOA 2DEUA 5IXFA 2CGHA 1WJRA 4JJCA 1FX7A 2KRNA 4FM4B 2EIFA 3VS7A 4OMLA 4F7UE 4BY6C 2CUDA 2E70A 4KUDK 5HK0A 2O9VA 2JVVA 1P92A 1U06A 2LX9A 1X75C 3INZA 4LDXA 2JTFA 1JJ2S 1NJIR 4XU3A 3G71Q 4C92C 1UG1A 4HVWA 4BDYA 2XMFA 1UJ0A 2QG9B 2O01E 5D6WA 2QA4T 2OAUA 1VQ7T 3OSVA 4OMPA 2QEXA 2DTHA 1WXTA 2QQBA 1TS9A 2EQJA 3MKDA 4C0FA 4J6WA 1RI9A 2RI2A 3C95A 4QVZA 3T9NA 4HCBA 4KGXB 5D6YA 3UA6A 3OYDA 5GAN3 4JUVA 1YN8A 3HHTB 1D1AA 1ZUUA 5IHKA 1U1SA 3CMEQ 3QDRB 4BDZA 4M78C 1IHVA 3PMTA 1XOVA 5LJ3d 1V76A 4EMKA 4M7AC 2IVWA 1GCQA 1BIAA 1Q82C 3VV0A 2AHJB 1SF9A 5GAMh 1H3HA 4PJNA 1E7OA 4Z88A 3VS4A 2K7AA 3L2VA 2DERA 2R58A 1UJYA 1NLOC 1K9AA 5CIUA 1Y71A 2JTMA 3OS1A 2GFUA 3RBBB 4M7DA 4Y28E 2O9SA 2LQNA 1HSQA 4M7AF 4CC4B 3VS2A 1PKSA 3NPFA 5A0GA 1YJ9Q 2F5TX 2CZ7B 2RB6A 2LQWA 2JS2A 1Q86U 1GXIE 4M75D 3U23A 4J6XA 1M8MA 1Q81U 3EGXB 1I07A 2JOYA 1EFNA 4XQ3A 4AFSC 4JRKA 2A37A 2EQMA 2FEIA 3OYCA 4FSXA 5GMKm 5GAN6 2YUQA 4CI0C 5CVIA 2DVEA 2FPDA 3CXCP 1M4ZA 2OTLT 1XTDA 5KCOA 2MIOA 1AZGB 3SWNC 5GAMg 2HQXA 2QA4Q 1QKXA 4WCIA 4HCCA 4LUDA 5DM7R 2X4YA 1QVFP 4ME7A 5KYWB 3LWHA 3P8BB 4ELYC 4X9DA 3HRSA 4BUGA 3M0RA 2CP2A 1HJDA 4ZGJB 2LP5A 1HK9A 3H9NA 2RMOA 1PNJA 1EZZB 5FLXE 1Y96B 3FLGA 5IHNA 3CQTA 4DA4A 3VUZA 2AKLA 3EH1A 2BZYA 3BY7A 1V29B 1WLPB 2RHZA 5CKEA 5GAMf 4FYVB 1JO8A 1YITA 3VS6A 1RLQC 4KRTA 3OYIA 4HCZA 2V8KA 2LCSA 1VQ8A 1ZX6A 3FRNA 3V8JA 1Y96A 2IG0A 2MF2A 2YUPA 4FU6A 1AOJA 3JB9H 4C8QE 1PSFA 4A53A 3DLLA 5GMKl 2COZA 2LQKA 4NS5A 3GP8A 2VKNA 3OYGA 2JW4A 1KD1C 5IN1A 4LDUA 1WIEA 3X20B 1AEYA 4FT4A 4E6RA 2E4HA 2BTTA 2JM8A 2OTLQ 3QDFA 2M9UA 1ZUKA 5IXBA 5GAOm 1PSEA 2KAFA 2YUOA 2CP0A 2V1QA 4JRPA 1X27A 4J6YA 1MMAA 3L2RA 1NEBA 3G6EQ 4M7AB 2DZCA 2MK5A 4E7KA 1JXOA 1R0CB 1SPKA 3EG9B 1K73R 2LX7A 1Y0MA 2JN0A 3HRTA 2JNGA 3KBGA 1WHKA 3HP9A 4IUUA 4V2SA 1G2BA 2P0KA 2DL4A 3DB3A 5GAMd 4PFPA 2YRDA 2XG8D 2O4XA 1OU8A 2LTOA 4MMKA 3QUIA 2HKQB 1K0XA 4AG1C 3MJXA 1M1FA 3RR6A 2L8DA 1KQSA 3QHSA 1OOTA 2YLCA 3EG0A 7AT1B 1JRIA 1Q82U 2OI3A 2BUDA 4M7AA 1K8AR 5KYNA 1CKBA 4M77C 5FRMA 3EG9A 3C12A 1BIBA 1VQOT 4PJOG 3CCQQ 3G1JA 1X2KA 1UDLA 3CC2Q 4J9FA 3ULRB 3JAME 2OX7A 1W4SA 2X4JA 4IUPA 2DVJA 3V7RA 1K9MR 4C5HA 4M77F 2VVKA 4E7LA 1QVGP 1VQNQ 3SWNB 4Y91A 2FZCB 1QWEA 4OMNA 3EG2A 3P8HA 4JJNK 2RI5A 3CXCS 2DJQA 2XKOC 3L1AA 1SHFA 5GMKh 5IHIA 2DBKA 1VYVA 1NE8A 2YWWA 1IB8A 2KROA 2FL7A 1ZSZC 1OU9A 1M5Q1 2A0FB 1MMGA 2RQVA 3A8LB 5HY6A 4DOVA 1AZEA 4LXCA 2LMJA 2E65A 3TSWA 3SWNA 3S3MA 2AT1B 2DRMA 1HD3A 4A4GA 3ASKA 2QK0A 4KH1B 1TUCA 4CC2A 4DBFA 4F04B 5FU6C 2LRQA 4GLKA 3DKMA 3JCMf 3CCLT 1GBQA 2Y4YA 3CC4A 2DYIA 1S72A 4J8OA 2CP3A 1Q7YC 2GBQA 1Z9QA 4N0AC 1ZA1B 5I2SA 3GNFB 2QGGA
chains in the Genus database with same CATH topology
3RUXA 1ZBXA 2ZPBB 4MZTA 1VQNA 4LDVA 4OB3B 3OSSC 2XIDA 1UEBA 4M78B 4A54A 1WQWA 4BI4A 2V8JA 3VUBA 4D6WA 2ZPFB 3PMIA 5CKFA 4XTUA 4QW2A 4O6JA 1QP3A 3OS5A 3PNWC 1UGPB 4XU1A 4C92A 5KCHA 5I21A 1M1GA 1VQMT 3ZEHA 3H6ZA 1OI1A 4MZPA 3CCLA 2HNIA 3CC7T 3I56T 5GANh 1R8OB 4M78G 3OY9A 3E9FA 1QW1A 2L89A 3CCUA 4RG8A 1K73U 2RI3A 2DD4A 2QXFA 1YBYA 4O5VA 5AYFA 4M7AD 3HFOA 4OB0B 1YI2T 2KDSA 5LJ3g 3JCMh 2RJCA 3GF5A 3GNGA 2EJFA 1RI0A 2CZ0B 1IZ6A 1WQ7A 2VV5A 4X9CA 3MCAB 2ZGWA 4XAXB 2K3YA 1WJSA 4M75B 3OYYA 4RG2A 3VYGA 3I56A 4OB2B 1VQMA 4BB7A 5GAN2 4M7AE 2HAXA 2EQUA 3V8LA 3A5ZB 5GAN7 1NPRA 3OYKA 3CPWA 2QQ9A 3CCRT 4B9WA 3CC7A 3MEAA 2DAQA 3OYHA 5IT9E 1BI3A 3JSCA 3M55A 3N5BB 3RERA 4M78A 1MHNA 1G3WA 2P4TA 3JRZA 3M5AA 2X4WA 4M75G 2KK4A 4KULA 4PL6A 1O9SA 3L2WA 1NZ9A 1YI2A 3X26B 4EMHA 3L2ZA 1NPPA 2DK3A 2LDMA 2DPPB 2LQ8A 3CCET 4FIBA 5LJ5j 1NJIC 2E10A 1VQPA 2ZPHB 4JRIA 2YHTA 4XTVA 1M90U 1VQKT 3GIBA 5FU7B 1N9SA 1G5VA 1YJWA 1K8AU 2D6FA 2XDBA 2GCXA 4PJOD 4C5IA 3MHXA 4XU2A 2VUBA 1BYMA 1VQ9T 2PUKB 3OYNA 2WSEE 2VC8A 3JCMc 4ZGEB 3CCRA 2PUOB 4HT8A 2YLBA 3V7SA 3MEWA 2FHDA 4QVDA 1WJQA 1VUBA 4QQGA 4M75A 4A4FA 4MMLA 1ZHIA 3QYHB 4BACA 5DY9A 3C94A 4BI8B 3LWIA 2LT1A 1UGQB 3CCEA 3JCMW 5CQXA 1KQSS 1VQKA 4BI3A 3E9GA 5CQYA 1G3YA 2MMPA 2MWOA 4Z02A 4BD3A 5A0LA 1K9MU 2E1HA 3FC3A 1X01A 5GANg 3LGFA 2KSSA 1EIFA 3MP1A 4RKUE 5A0DA 1AHJB 2ZCFB 1B34B 4XTXA 4M77B 4ZN1A 4NL3A 1YJ9T 1N8RC 2X35A 2RH2A 2DJZA 5J3BA 3AHUA 2CGHA 2R5MA 1WJRA 3JCMg 3WXMB 1KQ1A 3SD4A 4EMGA 2ZZDA 1FX7A 3L2QA 2A7YA 1BI2A 2EIFA 4FM4B 1UGRB 3C4SA 3X25B 4F7UF 4KUIA 4M77G 4F7UE 4BY6C 3ER0A 2E12A 1QVFS 2E70A 3OYFA 4JS4A 4KUDK 3PFSA 2QEXT 1M1KC 1UB4A 5HK0A 2L3RA 4FL6A 2JVVA 3OBYA 1P92A 4LDWA 2LX9A 1X75C 1DJ7B 2RA2A 3INZA 3QG1A 3J80E 2JTFA 3QIIA 4LDXA 2E6NA 3QSUA 3CPFA 2KVQG 1JJ2S 4PKCC 4XU3A 4C92C 4BDYA 2M1HA 4N4GA 3HPWA 3CCJT 3M9QA 2O01E 2EWNA 3FJPA 4M77A 5D6WA 2QA4T 2OAUA 1VQ7T 2PVOB 2ZPIB 1OYXA 3A8MB 3E19A 1HXDA 3OSVA 4RCCA 3OYJA 2QEXA 1QVGS 1OZ2A 2DTHA 2QI2A 4PLIA 3M58A 1UGSB 2QQBA 3UDCA 3JB9I 2EQJA 3JCMV 4C0FA 4J6WA 1Y07A 2RI2A 3C95A 4QVZA 3T9NA 4C92D 4BE0A 1KC8U 4HCBA 1K9MC 5D6YA 3RKXA 3OYDA 4C8QD 2XICA 5GAN3 2GQVA 3HHTB 4JUVA 3E1SA 2EYQA 2LC4A 3H8ZA 4A4HA 3HFNA 2E41A 3OBWA 2HQEA 4DQ2A 2DTIA 2QQSA 4XTZA 1U1SA 2VXFA 3CCJA 2DIGA 2F69A 3CBOA 4C92E 3QDRB 4BDZA 1VQ5T 2CYZB 3MEUA 4M78C 3ZFJA 2RK2A 1VQ7A 3PMTA 4M7DD 4M7DG 1XOVA 5LJ3d 4L6V5 2DZ9A 2EKOA 4N4HA 3G71T 1LJOA 3PIPA 1N6AA 4EMKA 4M7AC 2IVWA 3META 4HT9A 1BIAA 1Q82C 2DXBA 4P5NA 3VV0A 2XK0A 4IURA 3OS0A 2AHJB 3A8HB 3OYLA 5DLOA 3CMAT 1WNLA 2FB7A 1I81A 5GAMh 4J7FA 4IUTA 4C8QA 1K8AC 2QQRA 3L2VA 2CZ1B 4M78D 3QJYA 5FU6B 2EFIA 3OA6A 2R58A 2O4XB 4WF2A 4VUBA 4EDUA 5CIUA 1VQ5A 1Y71A 3MO8A 2JTMA 1G3TA 2C06A 1YJNT 3OS1A 2GFUA 4M7DA 4Y28E 4L59A 3OW2A 3WVDB 2R57A 2RK1A 3M4GA 3BDLA 2QTXA 5LJ5f 4M78E 3SFMA 3CMAA 5LJ5e 4GY5A 4M7AF 3G71A 1FXXA 1KHIA 4J83A 2XDDA 3WVEB 4PJOC 5A0GA 3SDZA 1Y7XA 2DKGA 2F5TX 2LNVA 2CZ7B 2LCLA 2RB6A 2XU8A 4HA8A 5GAN4 2MI6A 4A4EA 4BE1A 1Q86U 1JB0E 4M75D 1GXIE 2DXCA 4J6XA 4KT0E 1Q81U 3CD6T 3M56A 5FROA 4NOYA 3R6OA 4ZGDB 2JOYA 3UPUA 2EJGA 4E47A 2DIQA 1KD1U 4PNOA 4XQ3A 1QVPA 3M57A 3BDUA 2KQWA 4M75E 4JRKA 4JDSA 5GANd 4XTWA 1KQ2A 2LVMA 2EQMA 5CCAA 2NLUA 5A2QE 4E7IA 2XD0A 3OS2A 1I4K1 1H641 4UC4A 3LH0A 4FSXA 2F5KA 3OYCA 5GMKm 3CMEA 3JCMQ 1Q7YU 5GAN6 3DB4A 2LCCA 3JCMd 3HRUA 3CBMA 4PJOF 4CI0C 5CVIA 4N0AA 5M9OA 2DVEA 5LJ5h 3JB9F 5GAOq 3G4ST 4PJOE 1M4ZA 4N4IA 2OTLT 3CPWS 1FWZA 2KMTA 1VIEA 1WGSA 1M9SA 1XTDA 3OMCA 4YTLA 5I2MA 5D6XA 5KCOA 3SWNC 5GAMg 2HQXA 3RKWA 3OYMA 4HCCA 3CXCA 2HBPA 4OGEA 5DM7R 2X4YA 3VU3C 3CCST 1VQ9A 2V8IA 3QXEB 2CZ6B 4ME7A 5LL6S 4JRQA 4OF1A 3V7CA 1VQ6T 2E64A 2LT4A 3LWHA 4C0DC 3TU4K 3P8BB 4ELYC 3UWNA 3HL8A 4X9DA 5CKBA 3QZ5B 3HRSA 3CMET 4EPCA 3GOXA 4BUGA 1YCYA 3G4SA 1W2BA 1I5LA 4RMOA 2OTLA 1VIFA 2FVUA 4M77D 3KUFA 4ZGJB 1VQ4T 1HK9A 3LGLA 2GF7A 4F7UB 1YITT 1WPYA 5GMKj 3V8KA 2EJ9A 1YIJT 5FRNA 1JJ2A 3OQ5A 5FLXE 3S6WA 1Y96B 3SB2A 3FLGA 4JLGA 3OYAA 4DA4A 3OMGA 3RIRA 2DXTA 4OP0A 4EMKC 1YJ9A 2D0QB 2DO3A 4ZN3A 1RL2A 1VQ8T 2FYKA 1VQ6A 3VUZA 4F7UG 1BKBA 3KXTA 1H3ZA 2P0QA 2K3XA 4QVCA 3BY7A 4TVRA 5GAOl 5HKCA 1V29B 5GAOn 3VYHB 1LNXA 2RD1A 4C8QC 5LJ3j 1NJIU 2QDYB 3DLMA 2RHZA 4OB1B 4J7IA 3GLXA 2K2VA 4II1A 5CKEA 5GAMf 3BW1A 1B34A 5HK3A 1YITA 3LW5E 2K57A 2QQAA 3RMQA 5GAMe 3GPLA 3JCMP 1YIJA 1SSFA 2RHXA 3OYIA 5GAOr 1K73C 2BIVA 2EQKA 4C0ZA 4HCZA 2PU9B 4M7DC 4Q5WA 2V8KA 4OMFB 5KE3A 5LJ5g 1VQ8A 3P8DA 2XDPA 3CCVT 4E7JA 4F7UA 3FRNA 3V8JA 4NL2A 2DD5A 2WACA 3VKIA 4E7HA 3FIFA 5J39A 4C92F 1Y96A 3PT9A 2IG0A 2MF2A 3NTIA 4FU6A 4C8QF 3UT1A 3EAEA 4L5GA 1N27A 2QA4A 2CKKA 3JB9G 4C5GA 4C8QE 3JB9H 1PSFA 4A53A 3DLLA 1N8RU 5GMKl 2LQKA 3I55T 4NS5A 1Q81C 1TH7A 1X6OA 3G7ZA 4DOWA 3GP8A 3OYGA 2OTJT 4MDXA 1U1TA 5EG2A 3NTKA 4ZTJA 5CKHA 3CCVA 1KD1C 1M90C 5IN1A 4LDUA 4M7DE 5C0MA 2M0OA 3TEEA 4C5EA 3QJ6A 2VYTA 1D3BB 3X20B 2G3RA 1M1KU 1VQOA 2E5QA 2XHCA 3A8GB 4FT4A 5GANj 4M75C 2Y90A 3CBPA 3Q1JA 2M9UA 4M78F 4MZMA 3I55A 4B9XA 5GAOm 1PSEA 3PGGA 3S3OA 2OTJA 2KAFA 2MAMA 2PVDB 4OGCA 3PTAA 4JS5A 4JRPA 4CRIA 4J6YA 1BI1A 3L2RA 2M16A 2WSFE 4M7AB 2DZCA 1KHCA 2K4YA 2HD0A 3X28B 4R55A 4E7KA 1I8FA 3JCMX 3LX7A 4XU0A 2Y4XA 3HKSA 1M8VA 3J81E 3X24B 2JN0A 3HRTA 3A8OB 2JNGA 2E6ZA 3KBGA 5GAN5 5FU7C 3HP9A 3M53A 4IUUA 1YJNA 3PIOA 2P0KA 4ZTFA 4M7AG 4V2SA 1YHQT 2D9TA 3DB3A 2YRVA 5CAIA 4JLIA 5GAMd 2GFAA 3RMSA 4M75F 5C6SA 3L42A 5CR2A 1VQPT 1D3BA 2BKDN 2WSCE 3EFSA 3MP8A 2XG8D 2O4XA 3M4YA 1YJWT 3JCMJ 2LTOA 4MMKA 5DLQE 3RKYA 3FEOA 3QUIA 3J7AF 4XK8E 3OW2S 4KBMB 4LDYA 1M1FA 3OYEA 4MDWA 2L8DA 1KQSA 2VGMA 3QHSA 2YLCA 2K5FA 1JRIA 4IUQA 2I2LA 3CD6A 4PJOB 2B8AA 5CK9A 2RHUA 1Q82U 4ATOA 2BUDA 2P0PA 3CEYA 3TCJA 2ZPGB 1YHQA 4M7AA 3MEVA 3URGA 3QPHA 4FT2A 1VQLT 4M77C 4XTYA 1IREB 5KE2A 3O8VA 5FRMA 1MGQA 3QYGB 3C12A 2DTOA 3G6ET 1BIBA 1OZ3A 1VQOT 4PJOG 4LD9K 2RHIA 5GMKe 3JCMb 1ZQ1A 2K5LA 3LLRA 5L8RE 2PVGB 2RHYA 3OYBA 1KC8C 4OVAA 1QVFA 2PQWA 3JAME 5LJ3f 2RJEA 3JB9J 2EAYA 1W4SA 4J5YA 3VJPA 1N9RA 3FB9A 5LJ3e 3CCMT 1VQLA 1G3SA 2VXEA 2X4JA 4HKEA 4IUPA 3V7RA 3LYIA 2K5IA 4C5HA 3G6EA 4RCBA 1O75A 3EFRA 3FDRA 4M77F 3CCSA 4LD6A 3M54A 4E7LA 3SWNB 5LJ5d 2MWPA 4PJOA 4M77E 4Y91A 3TREA 3QZ9B 3OB9A 3L2UA 4QQ6A 3P8HA 5GMKi 2RI5A 4JJNK 3CXCS 1LOJA 4BE2A 1QVGA 2CS7A 2XKOC 3L1AA 3NTHA 1XQHA 3NFCA 5GMKh 4C0DB 4ELZC 2XI9A 3QKJA 1VQ4A 3CCMA 1NE8A 2R5AA 1BI0A 5KH6A 1W2BS 3CCQT 1XNIA 4C0GA 4BY6B 5CO7A 2JUFA 2FL7A 1M5Q1 5LJ3h 3A8LB 3QBYA 2A3LA 2RJDA 5HY6A 5GAN8 5GAOp 3CC2T 4DOVA 2RO0A 3MP6A 4EMKB 1QP2A 4PLLA 3CC4T 1S72T 2E65A 2DXUA 3SWNA 4IKFA 4C92B 3JB9D 3S3MA 2KY9A 2ZPEB 2L5QA 4C8QB 5IAYA 1Q86C 2RJFA 1KG1A 4IUVA 5GANf 2DEQA 3CCQA 2RM4A 1VQNT 4X34A 4A4GA 3ASKA 5GANe 3RESA 1U8RA 4M7DF 4C92G 3ME9A 5FU6C 2LRQA 4GLKA 3DKMA 3JCMf 3HSBA 4C8QG 4M7DB 4R56A 3CC2A 4A4KA 3JCMe 3CCLT 2X4XA 3M59A 2Y4YA 3CC4A 1JBMA 2H3JA 2JZ2A 3QO3A 5GAMj 1S72A 4J8OA 3CCUT 3ZBDA 3S3NA 3F70A 5CKDA 1Q7YC 3BFMA 4QQDA 4N0AC 5J26A 2VGNA 5I2SA 3GNFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RUX A;  3JCM J;  4MMK A;  3RKY A;  3QUI A;  4X9D A;  2EWN A;  3FJP A;  4M77 A;  4M78 B;  4A54 A;  1WQW A;  1YCY A;  1I5L A;  4RCC A;  1HXD A;  2DTH A;  4M77 D;  4XTU A;  4C92 A;  3QHS A;  4XU1 A;  2YLC A;  1HK9 A;  4F7U B;  3JB9 I;  5I21 A;  3JCM V;  1JRI A;  4J6W A;  1WPY A;  3JB9 F;  5GMK j;  2I2L A;  3V8K A;  4C92 D;  2EJ9 A;  4PJO B;  2HNI A;  3RKX A;  4C8Q D;  4M78 G;  5GAN h;  4M7A A;  5GAN 3;  1Y96 B;  3SB2 A;  4JUV A;  3RIR A;  3HFN A;  2E41 A;  2DXT A;  4OP0 A;  4EMK C;  4M77 C;  4XTY A;  4M7A D;  3HFO A;  2DTI A;  2FYK A;  4DQ2 A;  4F7U G;  1MGQ A;  2DTO A;  1U1S A;  2VXF A;  4XTZ A;  3JCM h;  1BIB A;  4QVC A;  5LJ3 g;  4PJO G;  2EJF A;  4C92 E;  3BY7 A;  5GMK e;  3JCM b;  5GAO l;  5GAO n;  1WQ7 A;  4X9C A;  4M78 C;  2RD1 A;  1LNX A;  4C8Q C;  5LJ3 j;  2ZGW A;  4M7D D;  4M7D G;  5LJ3 d;  4M75 B;  2DZ9 A;  5GAM f;  1LJO A;  3BW1 A;  4M7A E;  4EMK A;  1B34 A;  5GAN 2;  4HT9 A;  4M7A C;  5GAN 7;  3V8L A;  1BIA A;  2K57 A;  5GAM e;  3JCM P;  5LJ3 f;  3JB9 J;  2EAY A;  4J5Y A;  5GAO r;  1WNL A;  2FB7 A;  1I81 A;  1N9R A;  3FB9 A;  4M78 A;  4C8Q A;  4M75 G;  5LJ3 e;  2VXE A;  5GAM h;  4M7D C;  3V7R A;  5LJ5 g;  4M78 D;  4EMH A;  3L2Z A;  4RCB A;  4F7U A;  3EFR A;  4N0A C;  4M77 F;  4WF2 A;  3V8J A;  2E10 A;  5LJ5 j;  4JRI A;  3SWN B;  2YHT A;  4NL2 A;  4XTV A;  5LJ5 d;  4M77 E;  3GIB A;  1N9S A;  4Y91 A;  4PJO A;  3FIF A;  4C92 F;  1Y96 A;  4M7D A;  4PJO D;  5GMK i;  4XU2 A;  4C8Q F;  1LOJ A;  3M4G A;  2QTX A;  5LJ5 f;  4M78 E;  3JB9 G;  3L1A A;  3JB9 H;  4C8Q E;  2VC8 A;  3JCM c;  4A53 A;  5GMK h;  5GMK l;  4HT8 A;  2YLB A;  3V7S A;  5LJ5 e;  4M7A F;  4QVD A;  1TH7 A;  4M75 A;  4PJO C;  1U1T A;  4MML A;  2DKG A;  5GAN 4;  4HA8 A;  2RB6 A;  5DY9 A;  3V7C A;  4M7D E;  4M75 D;  3JCM W;  1M5Q 1;  4J6X A;  3RER A;  1D3B B;  5LJ3 h;  4NOY A;  2E1H A;  2EJG A;  5GAN 8;  5GAO p;  1X01 A;  5GAN g;  3HSB A;  4PNO A;  4XQ3 A;  4XTX A;  1B34 B;  4EMK B;  4M77 B;  4NL3 A;  3BDU A;  5GAN j;  4M75 E;  4JRK A;  2DJZ A;  2Y90 A;  4M75 C;  5GAN d;  4XTW A;  1KQ2 A;  4M78 F;  3AHU A;  2E65 A;  2CGH A;  2DXU A;  3SWN A;  4C92 B;  3JB9 D;  5GAO m;  3JCM g;  1KQ1 A;  3PGG A;  4EMG A;  1I4K 1;  4C8Q B;  1H64 1;  5GMK m;  4F7U F;  4J6Y A;  3JCM Q;  2DEQ A;  5GAN 6;  5GAN f;  2RM4 A;  3JCM d;  4M77 G;  4F7U E;  4PJO F;  4M7A B;  2DZC A;  4N0A A;  5GAN e;  2DVE A;  3RES A;  5LJ5 h;  5GAO q;  4PJO E;  1I8F A;  3JCM X;  4M7D F;  4C92 G;  4XU0 A;  3JCM f;  4C8Q G;  4M7D B;  1M8V A;  2JN0 A;  3SWN C;  5GAM g;  3RKW A;  3JCM e;  5GAN 5;  3INZ A;  2RA2 A;  4V2S A;  4M7A G;  1JBM A;  3QO3 A;  5GAM j;  3QSU A;  5CAI A;  3VU3 C;  4XU3 A;  4JLI A;  5GAM d;  4C92 C;  4M75 F;  3BFM A;  1D3B A;  3EFS A;  2E64 A; 
#chains in the Genus database with same CATH topology
 3RUX A;  3OSS C;  1QWF A;  2E3I A;  4D6W A;  5CKF A;  4QW2 A;  3PNW C;  4MZP A;  5GAN h;  3CCU A;  2M51 A;  1M27 C;  2HQH A;  2QXF A;  4O5V A;  4RTU A;  4M7A D;  2KDS A;  2B86 A;  2RN8 A;  1B3Q A;  1Q95 G;  3OYY A;  2K3B A;  1H8K A;  1VQM A;  4BB7 A;  5GAN 2;  4E7Z A;  3CC7 A;  3OYH A;  3JSC A;  3M55 A;  1Q81 R;  2KR3 A;  2P4T A;  3M5A A;  1ZSG A;  4M75 G;  3L2Z A;  4PJJ A;  2LDM A;  5LJ5 j;  2E10 A;  4JRI A;  1N9S A;  5KYU A;  3MHX A;  2F2W A;  3JCM c;  3CCR A;  4HT8 A;  2DL5 A;  1BU1 A;  2LNH B;  4QQG A;  1ZHI A;  3QYH B;  5DY9 A;  3LWI A;  1UGQ B;  3JCM W;  3CCJ Q;  2CRE A;  2CSQ A;  4BI3 A;  1C6V X;  1G3Y A;  2MMP A;  4FSS A;  3FC3 A;  1X01 A;  5GAN g;  2IPO B;  4JJB A;  4M77 B;  2X35 A;  2RH2 A;  3AHU A;  3SD4 A;  2ZZD A;  2A7Y A;  2KXC A;  1LVK A;  4F7U F;  1GBR A;  1Y57 A;  2MCN A;  3ER0 A;  2E12 A;  1QKW A;  1VQ5 Q;  4JS4 A;  3OBY A;  4LDW A;  2RA2 A;  3QG1 A;  3QSU A;  3CPF A;  3CMA Q;  1FMV A;  1VOM A;  2M1H A;  4N4G A;  3HPW A;  3FJP A;  4M77 A;  2QYZ A;  2ZPI B;  1OYX A;  3E19 A;  1QVG S;  1HXD A;  3EG1 A;  1AVZ C;  1OZ2 A;  2QI2 A;  3M0S A;  2W0Z A;  3MPU B;  2GQV A;  1ZSZ B;  2LC4 A;  4RTT A;  4A4H A;  2E41 A;  3OBW A;  3IQL A;  3NHN A;  2LZ6 B;  2DIG A;  1VQ7 A;  4M7D G;  1N6A A;  4HT9 A;  1E6H A;  1CKA A;  4IUT A;  4Z8A A;  2CZ1 B;  2CH4 A;  3JV3 A;  3QJY A;  2EFI A;  4X1V A;  5FU6 B;  4AFZ C;  2C06 A;  4L59 A;  1X69 A;  1ZSZ A;  1JQQ A;  3WVD B;  3BDL A;  2QTX A;  3EH2 A;  3SFM A;  2COY A;  4GY5 A;  5LJ5 e;  1FXX A;  2RF0 A;  1UFF A;  5GAN 4;  3CME T;  2XU8 A;  4BE1 A;  3M0P A;  4A4E A;  1JB0 E;  1OPK A;  3H0I A;  2DXC A;  3CD6 T;  5FRO A;  4KH0 B;  1OX9 A;  4PNO A;  1K4U S;  1QVP A;  3M57 A;  2HKN A;  4M75 E;  3RDV A;  1YIJ Q;  5GAN d;  4XTW A;  2E3H A;  3OS2 A;  1I4K 1;  1Q7Y U;  3DB4 A;  2KI7 A;  1TG0 A;  1W1F A;  1Q82 R;  4N0A A;  2EQI A;  1RAH B;  3E2U A;  1LPL A;  3OMC A;  1MNE A;  4E2F B;  1WHJ A;  3CXC A;  4OGE A;  2KT1 A;  9ATC B;  5I22 A;  3CCS T;  1VQ9 A;  2GGR A;  3QXE B;  2HEQ A;  3H0H A;  5LL6 S;  4JRQ A;  1W2B P;  2E64 A;  2LT4 A;  1M2O A;  4C0D C;  3TU4 K;  3UWN A;  3CCV Q;  2G6F X;  4EPC A;  3GOX A;  1YCY A;  1X2Q A;  2OTL A;  1VIF A;  4M77 D;  3KUF A;  3EFO B;  4D8K A;  4F7U B;  1ACM B;  5KYX A;  1WPY A;  3OQ5 A;  3S6W A;  1WA7 A;  4OP0 A;  1BKB A;  2H8H A;  2K3X A;  4QVC A;  1IXD A;  5GAO n;  2D8J A;  3VYH B;  5LJ3 j;  4C8Q C;  2QDY B;  4J9E A;  4J7I A;  1M2V B;  3GLX A;  3BW1 A;  2O88 A;  1B34 A;  2K57 A;  3RMQ A;  1AWX A;  2A36 A;  2EQK A;  4C0Z A;  2PU9 B;  1KIK A;  2OJ2 A;  1VYT A;  2EYX A;  4OMF B;  5KE3 A;  2XDP A;  4F7U A;  4NL2 A;  1GFC A;  2DD5 A;  1PCX A;  5J39 A;  4C92 F;  3PT9 A;  4C8Q F;  3EAE A;  4DBR A;  1WYX A;  2COW A;  2ED1 A;  2X3W D;  3CD6 Q;  4DOW A;  3TVT A;  3RNJ A;  3M0T A;  4ZTJ A;  1M90 C;  4M7D E;  3REB B;  2DX1 A;  5C0M A;  2ENM A;  2G3R A;  3UA7 A;  3A8G B;  1QLY A;  2Y90 A;  4HVU A;  3CBP A;  4M78 F;  1QMC A;  2DRK A;  4IIM A;  3PGG A;  1VQL Q;  4JS5 A;  3D7S B;  1BI1 A;  2M16 A;  2WSF E;  1PC0 A;  2HD0 A;  3CCS Q;  1I8F A;  3LX7 A;  4XU0 A;  4PFZ A;  4DBH A;  1G8X A;  1M8V A;  2NYS A;  3J81 E;  4F16 A;  3BE3 A;  2E6Z A;  4AG2 C;  2HL5 C;  3M53 A;  1YJN A;  4M7A G;  1RAD B;  1PRL C;  1YHQ T;  1PM3 A;  1W70 A;  3EG3 A;  2NUZ A;  3RMS A;  5C6S A;  5CR2 A;  3L42 A;  3CCM Q;  1VQP T;  2HSP A;  4J9C A;  2HCK A;  1OQK A;  3MP8 A;  2HZY A;  3RKY A;  1CSK A;  3J7A F;  1T3S A;  4R0K A;  4Z89 A;  1ABO A;  1R77 A;  2K6D A;  2F1L A;  2P0P A;  3TCJ A;  1UHF A;  2ZPG B;  3QPH A;  3O8V A;  3G6E T;  2DET A;  1OZ3 A;  3EGX A;  2PVG B;  1U5S A;  1KC8 C;  1NM7 A;  2RJE A;  3JB9 J;  5LJ3 e;  2VXE A;  4HKE A;  2K5I A;  1VQO A;  1SHG A;  3A1P A;  2EGA A;  3KFV A;  3TRE A;  3QZ9 B;  2PNI A;  3OB9 A;  1RUW A;  3L2U A;  4QQ6 A;  4BE2 A;  1QVG A;  1ZBJ A;  4C0D B;  4ELZ C;  1VQ4 A;  4RTZ A;  5KYW A;  2R5A A;  1BI0 A;  5KH6 A;  1W2B S;  3CCQ T;  1XNI A;  4C0G A;  4BY6 B;  1KSW A;  5CO7 A;  2CH4 W;  4FW2 A;  4FW1 A;  3QBY A;  2A3L A;  3CC2 T;  3I56 Q;  2C0I A;  3H0F A;  3AT1 B;  2J6F A;  3ZL7 C;  1T0H A;  2AIR B;  1KK7 A;  1PHT A;  1TU0 B;  4C92 B;  1AD5 A;  2JT4 A;  2KY9 A;  2ZPE B;  4RTW A;  4C8Q B;  5IAY A;  1RAC B;  2Z0W A;  1VQN T;  4X34 A;  1V1C A;  2DYB A;  1YHQ Q;  1VQP Q;  4F17 A;  3ME9 A;  1C1A A;  4R56 A;  1GL5 A;  3TSZ A;  1JBM A;  3QO3 A;  5GAM j;  1K0S A;  1WDX A;  1F1B B;  3S3N A;  1QCN A;  2FG0 A;  2QAZ A;  3F70 A;  4QQD A;  2VGN A;  4MDX A;  1ZBX A;  4LDV A;  3CCE Q;  2XID A;  2DIL A;  1UEB A;  4M78 B;  4A54 A;  1XJW B;  4BI4 A;  1VQK Q;  2GTJ A;  1RAF B;  4C92 A;  1QP3 A;  5KCH A;  1M1G A;  3ZEH A;  3CCL A;  2CT4 A;  1QW1 A;  3H41 A;  2FPE A;  2L89 A;  1D0X A;  2DD4 A;  1YBY A;  3HFO A;  3JCM h;  2EJF A;  1RI0 A;  2CZ0 B;  1IZ6 A;  4X9C A;  3CPW P;  2DM1 A;  3MCA B;  1OPL A;  4RG2 A;  4OB2 B;  4M7A E;  2EQU A;  3OYK A;  3A5Z B;  1NPR A;  2EBP A;  4B9W A;  5IT9 E;  4M78 A;  1D09 B;  4PL6 A;  2LQ8 A;  2DPP B;  1UE9 A;  1M90 U;  2J05 A;  1YJW A;  2XDB A;  2QEX Q;  1BYM A;  4XU2 A;  6AT1 B;  3OYN A;  1Q7Y R;  4DEX A;  2WSE E;  2VC8 A;  1ABQ A;  2K2M A;  2PUO B;  3V7S A;  3MEW A;  1WJQ A;  1VUB A;  2HDA A;  2DL8 A;  4BAC A;  4BI8 B;  3C94 A;  2D1X A;  3E9G A;  4Z02 A;  4QKU A;  2E1H A;  2C0T A;  3PVL A;  4RKU E;  1N8R C;  5L23 A;  4HCK A;  2JS0 A;  4Y92 A;  2KXD A;  5J3B A;  3JCM g;  3WXM B;  1KQ1 A;  2GTO A;  3L2Q A;  1PWT A;  1BI2 A;  4ZNX A;  1UGR B;  3X25 B;  4KUI A;  2FRW A;  4M77 G;  2CUB A;  1QVF S;  3OYF A;  2KT8 A;  1M1K C;  1UB4 A;  2L3R A;  4FL6 A;  1DJ7 B;  3QII A;  2E6N A;  2KVQ G;  4HXJ A;  1ARK A;  3CCJ T;  3M9Q A;  1QCO A;  2EWN A;  4RUG A;  2D0N A;  2X9H A;  4RCC A;  3OYJ A;  4PLI A;  3M58 A;  1UGS B;  2A28 A;  3UDC A;  1TUD A;  3JB9 I;  1KC8 U;  3JB9 F;  5ECA A;  4C92 D;  4BE0 A;  3RKX A;  4C8Q D;  2XIC A;  2KE9 A;  1X6B A;  3E1S A;  2EYQ A;  3HFN A;  1RAB B;  1MUZ A;  1J3T A;  4J9D A;  4DQ2 A;  1SRL A;  4XTZ A;  2E5K A;  1TWB A;  1VQ5 T;  2CYZ B;  3MEU A;  2DL7 A;  3ZFJ A;  1NEG A;  4L6V 5;  4N4H A;  2EKO A;  2RPN A;  2DF6 A;  1LJO A;  1D1B A;  3PIP A;  4PFO A;  2DXB A;  1MMD A;  2XK0 A;  4IUR A;  3OS0 A;  3A8H B;  3OYL A;  2MYS A;  5DLO A;  3CMA T;  4J7F A;  1MND A;  1K8A C;  2KYM A;  4M78 D;  4JPB W;  3OA6 A;  3OW2 P;  1WHH A;  3M0Q A;  4WF2 A;  1YFN A;  4VUB A;  4JZ3 A;  4EDU A;  3MO8 A;  2PTK A;  1G3T A;  2R57 A;  2RK1 A;  2AK5 A;  5LJ5 f;  2ECZ A;  2D8H A;  1BBZ A;  3G71 A;  2EVR A;  1KHI A;  4J83 A;  2XDD A;  3WVE B;  1Q86 R;  3SDZ A;  1K9M C;  1OEB A;  2DKG A;  2LNV A;  1T0J A;  2DL3 A;  3UPU A;  3R6O A;  4LN2 A;  4OMO A;  2DIQ A;  1KD1 U;  2JMC A;  1YIT Q;  3BDU A;  2AZS A;  4JDS A;  1SG5 A;  4AMC A;  2P4R A;  1KQ2 A;  2LVM A;  3O5Z A;  5CCA A;  2NLU A;  1PD0 A;  4KGV B;  4UC4 A;  2F5K A;  3CME A;  1VQ8 Q;  3JCM Q;  1AWJ A;  3JCM d;  3HRU A;  2NUP B;  4AFU C;  5EC7 A;  3QWX X;  3G4S T;  4PJO E;  2OAW A;  3CPW S;  1FWZ A;  2KMT A;  4YTL A;  1M9S A;  5D6X A;  1WX6 A;  1ZLM A;  2DNU A;  3VU3 C;  2J6O A;  3C0C A;  2V8I A;  2HMA A;  4OF1 A;  3V7C A;  1VQ6 T;  1UEC A;  5CKB A;  3QZ5 B;  2BE9 B;  1W2B A;  5KYY B;  1JJ2 P;  1YP5 A;  2FVU A;  2GF7 A;  1M3A A;  5GMK j;  1YIJ T;  5FRN A;  2NUP A;  3TQ7 P;  4JLG A;  3OMG A;  2SEM A;  3RIR A;  4EMK C;  1YJ9 A;  1RL2 A;  4F7U G;  1H3Z A;  2IIM A;  5HKC A;  2RD1 A;  4OB1 B;  2F2V A;  2FZG B;  1WXB A;  2QQA A;  1IO6 A;  2KGT A;  5GAO r;  2BIV A;  4M7D C;  4Q5W A;  5KYY A;  3SHW A;  3CCV T;  2ABL A;  2WAC A;  2ROT A;  4RTV A;  3FIF A;  1BK2 A;  3NTI A;  3UT1 A;  2QA4 A;  2CKK A;  4C5G A;  1N8R U;  1NBE B;  1WHL A;  4PK4 A;  3I55 T;  1Q81 C;  1TH7 A;  1X6O A;  2OTJ T;  1U1T A;  2EYW A;  3NTK A;  1C0M A;  3TEE A;  1SEM A;  2SRC A;  1BCM A;  1M1K U;  2CP7 A;  1SRM A;  3G4S Q;  5GAN j;  3Q1J A;  4MZM A;  4B9X A;  3S3O A;  2MAM A;  3A98 A;  2VB6 A;  2ROL A;  1X43 A;  1KHC A;  2K4Y A;  3X28 B;  2L3P A;  2JMA A;  1VQ6 Q;  1ZA2 B;  2L3Q A;  1LCK A;  2Y4X A;  3HKS A;  2K79 A;  3A8O B;  1AT1 B;  5GAN 5;  3PIO A;  4ZTF A;  2V1R A;  5CAI A;  2HSE B;  2GFA A;  4GBQ A;  2BKD N;  1WHG A;  2KBT A;  1H92 A;  4GLM A;  3R6N A;  3M4Y A;  5DLQ E;  3FEO A;  4XK8 E;  3OW2 S;  2EW3 A;  4MDW A;  2VGM A;  2K5F A;  2M0Y A;  4B6M A;  4IUQ A;  4M4Z A;  2I2L A;  2RHU A;  4ATO A;  1M90 R;  3CEY A;  1YHQ A;  3MEV A;  1VQL T;  4FT2 A;  5GJV B;  5I11 A;  5KE2 A;  1MGQ A;  2DTO A;  1PRM C;  5GMK e;  3JCM b;  3LLR A;  5L8R E;  4QT7 A;  1SSH A;  3OYB A;  1QVF A;  3REA B;  5LJ3 f;  2EAY A;  2EPD A;  4J5Y A;  1WI7 A;  4FYW B;  3CC4 Q;  1N9R A;  3FB9 A;  3CCM T;  1MV0 B;  4DBQ A;  1S72 Q;  1G3S A;  3EHQ A;  2DBM A;  3G6E A;  4RCB A;  4CC3 A;  1O75 A;  1K76 A;  3EFR A;  3I55 Q;  4LD6 A;  3M54 A;  2MWP A;  2OTJ Q;  2JJ9 A;  1AWW A;  4A63 B;  2L2P A;  2ATC B;  1XQH A;  1FMK A;  4ANJ A;  2XI9 A;  1Z9Z A;  3CCU Q;  4WTO B;  2QTV A;  2YDL A;  4PJM A;  1UHC A;  3VS0 A;  2YSQ A;  3EFO A;  5GAN 8;  2RO0 A;  1VQM Q;  4EMK B;  2YT6 A;  4HVV A;  4PLL A;  2J7I A;  2HBW A;  3CC7 Q;  3JB9 D;  1JEG A;  2L5Q A;  1KC8 R;  3CCQ A;  2RM4 A;  3EGD B;  5GAN e;  3RES A;  1M2V A;  1GCP A;  4C92 G;  1UTI A;  4C8Q G;  4M7D B;  3CC2 A;  2J6K A;  4FYX B;  1AWO A;  5GJW B;  1YCS B;  2JXB A;  3M59 A;  4E7S A;  3CCR Q;  2KRM A;  3HTR A;  3I5R A;  5J26 A;  2CSI A;  2ZPB B;  1VQN A;  4LE9 A;  2QGF B;  1X6G A;  1TOV A;  2YRC A;  2V8J A;  2LJ1 A;  3VUB A;  2KYB A;  2ZPF B;  3PMI A;  1QQJ A;  3I56 T;  1NG2 A;  4XU1 A;  3LH5 A;  5I21 A;  2HNI A;  2BE7 D;  3EGD A;  1R8O B;  4M78 G;  2EYZ A;  4RG8 A;  4OB0 B;  1YI2 T;  3GF5 A;  2L0A A;  1WQ7 A;  2ZGW A;  2O2O A;  3VS1 A;  3VS5 A;  3VYG A;  2EYY A;  2HAX A;  3V8L A;  3CPW A;  2QQ9 A;  4RTX A;  2DAQ A;  1RLP C;  3N5B B;  1MHN A;  1UUE A;  2X4W A;  2KK4 A;  4KUL A;  1NZ9 A;  1KD1 R;  3CCE T;  2DK3 A;  1QCF A;  2ESW A;  1NJI C;  2ZPH B;  3GIB A;  1VQK T;  1TTH B;  2D6F A;  4C5I A;  1VQ9 T;  2J06 A;  4FYY B;  4ZGE B;  2FHD A;  4QVD A;  4KGZ B;  1VQ7 Q;  2MWO A;  5A0L A;  3LGF A;  2KSS A;  1EIF A;  3MP1 A;  5A0D A;  2ZCF B;  2L3S A;  2DJZ A;  2EGC A;  1JU5 C;  2H3E B;  5IH2 A;  2R5M A;  3UAT A;  4EMG A;  1NLP C;  1WFW A;  3UF4 A;  3C4S A;  2M02 A;  2DLP A;  2YXY A;  2KRS A;  2YUN A;  3PFS A;  2QEX T;  5AT1 B;  1MV3 A;  2DFU A;  2X3X D;  4LNP A;  3J80 E;  4PKC C;  3NGP A;  1I5O B;  3I35 A;  3I5S A;  2BZX A;  1EX4 A;  2PVO B;  3A8M B;  2NWM A;  1M30 A;  1YI2 Q;  3JCM V;  1Y07 A;  2ED0 A;  1YNZ A;  3H8Z A;  2K9G A;  1UGV A;  2HQE A;  2DTI A;  2QQS A;  1TXQ A;  2VXF A;  3CCJ A;  3CBO A;  2F69 A;  4C92 E;  1N8R R;  2RK2 A;  3FJ5 A;  4M7D D;  2DZ9 A;  1RAE B;  3MET A;  2DA9 A;  4P5N A;  1BB9 A;  1WNL A;  1I81 A;  2FB7 A;  2P84 A;  4C8Q A;  1VQ9 Q;  1KFZ A;  2QQR A;  1RAI B;  1M1K R;  2FRY A;  4DEY A;  1WXU A;  2O4X B;  2KNB B;  1RAA B;  1OV3 A;  2CP6 A;  1VQ5 A;  1OX8 A;  1YJN T;  3OW2 A;  4D8D A;  2I0N A;  4J9B A;  3M4G A;  4M78 E;  2NUT B;  8ATC B;  2LJ3 A;  3CMA A;  2QAS A;  4PJO C;  1I1J A;  1Y7X A;  2LCL A;  4HA8 A;  2CT3 A;  2MI6 A;  1D1C A;  4KT0 E;  1U3O A;  3VRZ A;  3M56 A;  4NOY A;  4ZGD B;  2EJG A;  4E47 A;  8AT1 B;  2KQW A;  2LJ0 A;  5A2Q E;  4E7I A;  2XD0 A;  1H64 1;  3LH0 A;  2LCC A;  4RTY A;  2HL3 A;  3CBM A;  4PJO F;  2NUT A;  5M9O A;  5LJ5 h;  5GAO q;  4N4I A;  4J9I A;  5I2M A;  1VIE A;  1WGS A;  1T3L A;  2RQT A;  3RKW A;  3OYM A;  2HBP A;  2CZ6 B;  1OUL A;  1WHM A;  3VRY A;  1VYU A;  2GNC A;  2KEA A;  3HL8 A;  1I5L A;  3G4S A;  4RMO A;  3GBQ A;  1VQ4 T;  3LGL A;  1YIT T;  2PZ1 A;  3V8K A;  5FWC A;  2EJ9 A;  1JJ2 A;  3SB2 A;  1SKU B;  3OYA A;  2GQI A;  1G83 A;  2DXT A;  2D0Q B;  2DO3 A;  4ZN3 A;  1VQ8 T;  1VQ6 A;  2FYK A;  3KXT A;  2X51 A;  2P0Q A;  4TVR A;  5GAO l;  1LNX A;  1NJI U;  3DLM A;  4EIK A;  4II1 A;  2K2V A;  5HK3 A;  1K1Z A;  3LW5 E;  5GAM e;  3GPL A;  3JCM P;  1YIJ A;  1SSF A;  1YJN Q;  2RHX A;  1K73 C;  5LJ5 g;  3P8D A;  4E7J A;  3VKI A;  4LUE A;  4E7H A;  4L5G A;  1N27 A;  3JB9 G;  5D7U A;  3NMZ C;  1B07 A;  1M3C A;  3G7Z A;  1IGU A;  5EG2 A;  3SEM A;  5CKH A;  3CCV A;  2M0O A;  2C0O A;  4C5E A;  3QJ6 A;  2VYT A;  1D3B B;  4J9G A;  4PJL A;  2FPF A;  2EKH A;  2E5Q A;  2XHC A;  1VA7 A;  4M75 C;  3I55 A;  1HYO A;  2OTJ A;  4OGC A;  2PVD B;  3PTA A;  4CRI A;  4R55 A;  1VQO Q;  5HCK A;  3JCM X;  1MMN A;  4F14 A;  2O31 A;  3X24 B;  5KYU B;  5FU7 C;  1WZO A;  2DMO A;  2F2X A;  2D9T A;  2YRV A;  4JLI A;  1RAG B;  1M3B A;  4M75 F;  1VQ4 Q;  1D3B A;  1IRX A;  2WSC E;  3EFS A;  1BCO A;  1YJW T;  3JCM J;  1KQS P;  2CDT A;  4KBM B;  4AFQ C;  4LDY A;  3OYE A;  3PE0 A;  3CD6 A;  4PJO B;  2B8A A;  5CK9 A;  1D0Y A;  1FYN A;  1ZUY A;  3URG A;  2AKK A;  4J9H A;  2EGE A;  4XTY A;  1IRE B;  3QYG B;  1E6G A;  4LD9 K;  2RHI A;  2VWF A;  1ZQ1 A;  2K5L A;  4OMQ A;  1A0N B;  2RHY A;  1I0C A;  4OVA A;  2PQW A;  2RQW A;  2DE0 X;  3VJP A;  1VQL A;  3LYI A;  3FDR A;  3CCS A;  5LJ5 d;  4PJO A;  4M77 E;  1GCQ C;  1W6X A;  2QDL A;  5GMK i;  1B7T A;  1LOJ A;  1PG5 B;  2CS7 A;  3NTH A;  4ORZ A;  3NFC A;  3CCL Q;  3QKJ A;  2RNA A;  3M0U A;  3CCM A;  4ESR A;  2JUF A;  3VS3 A;  3PVQ A;  5LJ3 h;  1N5Z A;  2RJD A;  5GAO p;  3MP6 A;  1D0Z A;  1QP2 A;  3EGU A;  1TSF A;  3CC4 T;  1FMW A;  1S72 T;  2DXU A;  5FWB A;  4IKF A;  2BZ8 A;  1KJW A;  1R0B G;  2RJF A;  1Q86 C;  4IUV A;  5GAN f;  2DEQ A;  2RQR A;  1U8R A;  4M7D F;  2RQU A;  1YJW Q;  3I9Q A;  4A4K A;  3JCM e;  2X4X A;  2JZ2 A;  2H3J A;  2AZV A;  3CCU T;  3ZBD A;  5CKD A;  3BFM A;  4MZT A;  2VAS A;  4OB3 B;  1WQW A;  4JZ4 A;  2JM9 A;  2V26 A;  4XTU A;  3G71 T;  4O6J A;  1KG1 A;  2FO0 A;  3OS5 A;  1UGP B;  1VQM T;  1YWO A;  3H6Z A;  1OI1 A;  3CC7 T;  1IHW A;  3OY9 A;  2MPX C;  3E9F A;  4OMM A;  1K73 U;  2RI3 A;  1GRI A;  5AYF A;  2ZAE A;  3EHR A;  2FZK B;  5LJ3 g;  2RJC A;  2W10 A;  3GNG A;  1NYF A;  2VV5 A;  4XAX B;  2K3Y A;  1WJS A;  3QWY A;  4M75 B;  3I56 A;  5GAN 7;  3CCR T;  3MEA A;  1BI3 A;  3RER A;  1TUG B;  1G3W A;  3JRZ A;  4JJD A;  1O9S A;  3L2W A;  1YI2 A;  3X26 B;  4EMH A;  1NPP A;  4FIB A;  1VQP A;  4FCY A;  2YHT A;  4XTV A;  1G5V A;  5FU7 B;  1K8A U;  2GCX A;  4PJO D;  2VUB A;  2A08 A;  2PUK B;  1PKT A;  5KYX B;  2MOX A;  2YLB A;  4CC7 A;  1JXM A;  1YWP A;  4M75 A;  4AT1 B;  4A4F A;  2JTE A;  4MML A;  1NYG A;  3CCE A;  2LT1 A;  5FW9 A;  5CQX A;  1KQS S;  1GFD A;  1VQK A;  1S1N A;  5CQY A;  4BD3 A;  4K11 A;  1K9M U;  1PD1 A;  3HSB A;  1AHJ B;  2CP5 A;  1B34 B;  4XTX A;  4ZN1 A;  1YJ9 T;  4NL3 A;  1IGQ A;  3THK A;  4IIO A;  2DEU A;  5IXF A;  2CGH A;  1WJR A;  4JJC A;  1FX7 A;  2KRN A;  4FM4 B;  2EIF A;  3VS7 A;  4OML A;  4F7U E;  4BY6 C;  2CUD A;  2E70 A;  4KUD K;  5HK0 A;  2O9V A;  2JVV A;  1P92 A;  1U06 A;  2LX9 A;  1X75 C;  3INZ A;  4LDX A;  2JTF A;  1JJ2 S;  1NJI R;  4XU3 A;  3G71 Q;  4C92 C;  1UG1 A;  4HVW A;  4BDY A;  2XMF A;  1UJ0 A;  2QG9 B;  2O01 E;  5D6W A;  2QA4 T;  2OAU A;  1VQ7 T;  3OSV A;  4OMP A;  2QEX A;  2DTH A;  1WXT A;  2QQB A;  1TS9 A;  2EQJ A;  3MKD A;  4C0F A;  4J6W A;  1RI9 A;  2RI2 A;  3C95 A;  4QVZ A;  3T9N A;  4HCB A;  4KGX B;  5D6Y A;  3UA6 A;  3OYD A;  5GAN 3;  4JUV A;  1YN8 A;  3HHT B;  1D1A A;  1ZUU A;  5IHK A;  1U1S A;  3CME Q;  3QDR B;  4BDZ A;  4M78 C;  1IHV A;  3PMT A;  1XOV A;  5LJ3 d;  1V76 A;  4EMK A;  4M7A C;  2IVW A;  1GCQ A;  1BIA A;  1Q82 C;  3VV0 A;  2AHJ B;  1SF9 A;  5GAM h;  1H3H A;  4PJN A;  1E7O A;  4Z88 A;  3VS4 A;  2K7A A;  3L2V A;  2DER A;  2R58 A;  1UJY A;  1NLO C;  1K9A A;  5CIU A;  1Y71 A;  2JTM A;  3OS1 A;  2GFU A;  3RBB B;  4M7D A;  4Y28 E;  2O9S A;  2LQN A;  1HSQ A;  4M7A F;  4CC4 B;  3VS2 A;  1PKS A;  3NPF A;  5A0G A;  1YJ9 Q;  2F5T X;  2CZ7 B;  2RB6 A;  2LQW A;  2JS2 A;  1Q86 U;  1GXI E;  4M75 D;  3U23 A;  4J6X A;  1M8M A;  1Q81 U;  3EGX B;  1I07 A;  2JOY A;  1EFN A;  4XQ3 A;  4AFS C;  4JRK A;  2A37 A;  2EQM A;  2FEI A;  3OYC A;  4FSX A;  5GMK m;  5GAN 6;  2YUQ A;  4CI0 C;  5CVI A;  2DVE A;  2FPD A;  3CXC P;  1M4Z A;  2OTL T;  1XTD A;  5KCO A;  2MIO A;  1AZG B;  3SWN C;  5GAM g;  2HQX A;  2QA4 Q;  1QKX A;  4WCI A;  4HCC A;  4LUD A;  5DM7 R;  2X4Y A;  1QVF P;  4ME7 A;  5KYW B;  3LWH A;  3P8B B;  4ELY C;  4X9D A;  3HRS A;  4BUG A;  3M0R A;  2CP2 A;  1HJD A;  4ZGJ B;  2LP5 A;  1HK9 A;  3H9N A;  2RMO A;  1PNJ A;  1EZZ B;  5FLX E;  1Y96 B;  3FLG A;  5IHN A;  3CQT A;  4DA4 A;  3VUZ A;  2AKL A;  3EH1 A;  2BZY A;  3BY7 A;  1V29 B;  1WLP B;  2RHZ A;  5CKE A;  5GAM f;  4FYV B;  1JO8 A;  1YIT A;  3VS6 A;  1RLQ C;  4KRT A;  3OYI A;  4HCZ A;  2V8K A;  2LCS A;  1VQ8 A;  1ZX6 A;  3FRN A;  3V8J A;  1Y96 A;  2IG0 A;  2MF2 A;  2YUP A;  4FU6 A;  1AOJ A;  3JB9 H;  4C8Q E;  1PSF A;  4A53 A;  3DLL A;  5GMK l;  2COZ A;  2LQK A;  4NS5 A;  3GP8 A;  2VKN A;  3OYG A;  2JW4 A;  1KD1 C;  5IN1 A;  4LDU A;  1WIE A;  3X20 B;  1AEY A;  4FT4 A;  4E6R A;  2E4H A;  2BTT A;  2JM8 A;  2OTL Q;  3QDF A;  2M9U A;  1ZUK A;  5IXB A;  5GAO m;  1PSE A;  2KAF A;  2YUO A;  2CP0 A;  2V1Q A;  4JRP A;  1X27 A;  4J6Y A;  1MMA A;  3L2R A;  1NEB A;  3G6E Q;  4M7A B;  2DZC A;  2MK5 A;  4E7K A;  1JXO A;  1R0C B;  1SPK A;  3EG9 B;  1K73 R;  2LX7 A;  1Y0M A;  2JN0 A;  3HRT A;  2JNG A;  3KBG A;  1WHK A;  3HP9 A;  4IUU A;  4V2S A;  1G2B A;  2P0K A;  2DL4 A;  3DB3 A;  5GAM d;  4PFP A;  2YRD A;  2XG8 D;  2O4X A;  1OU8 A;  2LTO A;  4MMK A;  3QUI A;  2HKQ B;  1K0X A;  4AG1 C;  3MJX A;  1M1F A;  3RR6 A;  2L8D A;  1KQS A;  3QHS A;  1OOT A;  2YLC A;  3EG0 A;  7AT1 B;  1JRI A;  1Q82 U;  2OI3 A;  2BUD A;  4M7A A;  1K8A R;  5KYN A;  1CKB A;  4M77 C;  5FRM A;  3EG9 A;  3C12 A;  1BIB A;  1VQO T;  4PJO G;  3CCQ Q;  3G1J A;  1X2K A;  1UDL A;  3CC2 Q;  4J9F A;  3ULR B;  3JAM E;  2OX7 A;  1W4S A;  2X4J A;  4IUP A;  2DVJ A;  3V7R A;  1K9M R;  4C5H A;  4M77 F;  2VVK A;  4E7L A;  1QVG P;  1VQN Q;  3SWN B;  4Y91 A;  2FZC B;  1QWE A;  4OMN A;  3EG2 A;  3P8H A;  4JJN K;  2RI5 A;  3CXC S;  2DJQ A;  2XKO C;  3L1A A;  1SHF A;  5GMK h;  5IHI A;  2DBK A;  1VYV A;  1NE8 A;  2YWW A;  1IB8 A;  2KRO A;  2FL7 A;  1ZSZ C;  1OU9 A;  1M5Q 1;  2A0F B;  1MMG A;  2RQV A;  3A8L B;  5HY6 A;  4DOV A;  1AZE A;  4LXC A;  2LMJ A;  2E65 A;  3TSW A;  3SWN A;  3S3M A;  2AT1 B;  2DRM A;  1HD3 A;  4A4G A;  3ASK A;  2QK0 A;  4KH1 B;  1TUC A;  4CC2 A;  4DBF A;  4F04 B;  5FU6 C;  2LRQ A;  4GLK A;  3DKM A;  3JCM f;  3CCL T;  1GBQ A;  2Y4Y A;  3CC4 A;  2DYI A;  1S72 A;  4J8O A;  2CP3 A;  1Q7Y C;  2GBQ A;  1Z9Q A;  4N0A C;  1ZA1 B;  5I2S A;  3GNF B;  2QGG A; 
#chains in the Genus database with same CATH homology
 3RUX A;  1ZBX A;  2ZPB B;  4MZT A;  1VQN A;  4LDV A;  4OB3 B;  3OSS C;  2XID A;  1UEB A;  4M78 B;  4A54 A;  1WQW A;  4BI4 A;  2V8J A;  3VUB A;  4D6W A;  2ZPF B;  3PMI A;  5CKF A;  4XTU A;  4QW2 A;  4O6J A;  1QP3 A;  3OS5 A;  3PNW C;  1UGP B;  4XU1 A;  4C92 A;  5KCH A;  5I21 A;  1M1G A;  1VQM T;  3ZEH A;  3H6Z A;  1OI1 A;  4MZP A;  3CCL A;  2HNI A;  3CC7 T;  3I56 T;  5GAN h;  1R8O B;  4M78 G;  3OY9 A;  3E9F A;  1QW1 A;  2L89 A;  3CCU A;  4RG8 A;  1K73 U;  2RI3 A;  2DD4 A;  2QXF A;  1YBY A;  4O5V A;  5AYF A;  4M7A D;  3HFO A;  4OB0 B;  1YI2 T;  2KDS A;  5LJ3 g;  3JCM h;  2RJC A;  3GF5 A;  3GNG A;  2EJF A;  1RI0 A;  2CZ0 B;  1IZ6 A;  1WQ7 A;  2VV5 A;  4X9C A;  3MCA B;  2ZGW A;  4XAX B;  2K3Y A;  1WJS A;  4M75 B;  3OYY A;  4RG2 A;  3VYG A;  3I56 A;  4OB2 B;  1VQM A;  4BB7 A;  5GAN 2;  4M7A E;  2HAX A;  2EQU A;  3V8L A;  3A5Z B;  5GAN 7;  1NPR A;  3OYK A;  3CPW A;  2QQ9 A;  3CCR T;  4B9W A;  3CC7 A;  3MEA A;  2DAQ A;  3OYH A;  5IT9 E;  1BI3 A;  3JSC A;  3M55 A;  3N5B B;  3RER A;  4M78 A;  1MHN A;  1G3W A;  2P4T A;  3JRZ A;  3M5A A;  2X4W A;  4M75 G;  2KK4 A;  4KUL A;  4PL6 A;  1O9S A;  3L2W A;  1NZ9 A;  1YI2 A;  3X26 B;  4EMH A;  3L2Z A;  1NPP A;  2DK3 A;  2LDM A;  2DPP B;  2LQ8 A;  3CCE T;  4FIB A;  5LJ5 j;  1NJI C;  2E10 A;  1VQP A;  2ZPH B;  4JRI A;  2YHT A;  4XTV A;  1M90 U;  1VQK T;  3GIB A;  5FU7 B;  1N9S A;  1G5V A;  1YJW A;  1K8A U;  2D6F A;  2XDB A;  2GCX A;  4PJO D;  4C5I A;  3MHX A;  4XU2 A;  2VUB A;  1BYM A;  1VQ9 T;  2PUK B;  3OYN A;  2WSE E;  2VC8 A;  3JCM c;  4ZGE B;  3CCR A;  2PUO B;  4HT8 A;  2YLB A;  3V7S A;  3MEW A;  2FHD A;  4QVD A;  1WJQ A;  1VUB A;  4QQG A;  4M75 A;  4A4F A;  4MML A;  1ZHI A;  3QYH B;  4BAC A;  5DY9 A;  3C94 A;  4BI8 B;  3LWI A;  2LT1 A;  1UGQ B;  3CCE A;  3JCM W;  5CQX A;  1KQS S;  1VQK A;  4BI3 A;  3E9G A;  5CQY A;  1G3Y A;  2MMP A;  2MWO A;  4Z02 A;  4BD3 A;  5A0L A;  1K9M U;  2E1H A;  3FC3 A;  1X01 A;  5GAN g;  3LGF A;  2KSS A;  1EIF A;  3MP1 A;  4RKU E;  5A0D A;  1AHJ B;  2ZCF B;  1B34 B;  4XTX A;  4M77 B;  4ZN1 A;  4NL3 A;  1YJ9 T;  1N8R C;  2X35 A;  2RH2 A;  2DJZ A;  5J3B A;  3AHU A;  2CGH A;  2R5M A;  1WJR A;  3JCM g;  3WXM B;  1KQ1 A;  3SD4 A;  4EMG A;  2ZZD A;  1FX7 A;  3L2Q A;  2A7Y A;  1BI2 A;  2EIF A;  4FM4 B;  1UGR B;  3C4S A;  3X25 B;  4F7U F;  4KUI A;  4M77 G;  4F7U E;  4BY6 C;  3ER0 A;  2E12 A;  1QVF S;  2E70 A;  3OYF A;  4JS4 A;  4KUD K;  3PFS A;  2QEX T;  1M1K C;  1UB4 A;  5HK0 A;  2L3R A;  4FL6 A;  2JVV A;  3OBY A;  1P92 A;  4LDW A;  2LX9 A;  1X75 C;  1DJ7 B;  2RA2 A;  3INZ A;  3QG1 A;  3J80 E;  2JTF A;  3QII A;  4LDX A;  2E6N A;  3QSU A;  3CPF A;  2KVQ G;  1JJ2 S;  4PKC C;  4XU3 A;  4C92 C;  4BDY A;  2M1H A;  4N4G A;  3HPW A;  3CCJ T;  3M9Q A;  2O01 E;  2EWN A;  3FJP A;  4M77 A;  5D6W A;  2QA4 T;  2OAU A;  1VQ7 T;  2PVO B;  2ZPI B;  1OYX A;  3A8M B;  3E19 A;  1HXD A;  3OSV A;  4RCC A;  3OYJ A;  2QEX A;  1QVG S;  1OZ2 A;  2DTH A;  2QI2 A;  4PLI A;  3M58 A;  1UGS B;  2QQB A;  3UDC A;  3JB9 I;  2EQJ A;  3JCM V;  4C0F A;  4J6W A;  1Y07 A;  2RI2 A;  3C95 A;  4QVZ A;  3T9N A;  4C92 D;  4BE0 A;  1KC8 U;  4HCB A;  1K9M C;  5D6Y A;  3RKX A;  3OYD A;  4C8Q D;  2XIC A;  5GAN 3;  2GQV A;  3HHT B;  4JUV A;  3E1S A;  2EYQ A;  2LC4 A;  3H8Z A;  4A4H A;  3HFN A;  2E41 A;  3OBW A;  2HQE A;  4DQ2 A;  2DTI A;  2QQS A;  4XTZ A;  1U1S A;  2VXF A;  3CCJ A;  2DIG A;  2F69 A;  3CBO A;  4C92 E;  3QDR B;  4BDZ A;  1VQ5 T;  2CYZ B;  3MEU A;  4M78 C;  3ZFJ A;  2RK2 A;  1VQ7 A;  3PMT A;  4M7D D;  4M7D G;  1XOV A;  5LJ3 d;  4L6V 5;  2DZ9 A;  2EKO A;  4N4H A;  3G71 T;  1LJO A;  3PIP A;  1N6A A;  4EMK A;  4M7A C;  2IVW A;  3MET A;  4HT9 A;  1BIA A;  1Q82 C;  2DXB A;  4P5N A;  3VV0 A;  2XK0 A;  4IUR A;  3OS0 A;  2AHJ B;  3A8H B;  3OYL A;  5DLO A;  3CMA T;  1WNL A;  2FB7 A;  1I81 A;  5GAM h;  4J7F A;  4IUT A;  4C8Q A;  1K8A C;  2QQR A;  3L2V A;  2CZ1 B;  4M78 D;  3QJY A;  5FU6 B;  2EFI A;  3OA6 A;  2R58 A;  2O4X B;  4WF2 A;  4VUB A;  4EDU A;  5CIU A;  1VQ5 A;  1Y71 A;  3MO8 A;  2JTM A;  1G3T A;  2C06 A;  1YJN T;  3OS1 A;  2GFU A;  4M7D A;  4Y28 E;  4L59 A;  3OW2 A;  3WVD B;  2R57 A;  2RK1 A;  3M4G A;  3BDL A;  2QTX A;  5LJ5 f;  4M78 E;  3SFM A;  3CMA A;  5LJ5 e;  4GY5 A;  4M7A F;  3G71 A;  1FXX A;  1KHI A;  4J83 A;  2XDD A;  3WVE B;  4PJO C;  5A0G A;  3SDZ A;  1Y7X A;  2DKG A;  2F5T X;  2LNV A;  2CZ7 B;  2LCL A;  2RB6 A;  2XU8 A;  4HA8 A;  5GAN 4;  2MI6 A;  4A4E A;  4BE1 A;  1Q86 U;  1JB0 E;  4M75 D;  1GXI E;  2DXC A;  4J6X A;  4KT0 E;  1Q81 U;  3CD6 T;  3M56 A;  5FRO A;  4NOY A;  3R6O A;  4ZGD B;  2JOY A;  3UPU A;  2EJG A;  4E47 A;  2DIQ A;  1KD1 U;  4PNO A;  4XQ3 A;  1QVP A;  3M57 A;  3BDU A;  2KQW A;  4M75 E;  4JRK A;  4JDS A;  5GAN d;  4XTW A;  1KQ2 A;  2LVM A;  2EQM A;  5CCA A;  2NLU A;  5A2Q E;  4E7I A;  2XD0 A;  3OS2 A;  1I4K 1;  1H64 1;  4UC4 A;  3LH0 A;  4FSX A;  2F5K A;  3OYC A;  5GMK m;  3CME A;  3JCM Q;  1Q7Y U;  5GAN 6;  3DB4 A;  2LCC A;  3JCM d;  3HRU A;  3CBM A;  4PJO F;  4CI0 C;  5CVI A;  4N0A A;  5M9O A;  2DVE A;  5LJ5 h;  3JB9 F;  5GAO q;  3G4S T;  4PJO E;  1M4Z A;  4N4I A;  2OTL T;  3CPW S;  1FWZ A;  2KMT A;  1VIE A;  1WGS A;  1M9S A;  1XTD A;  3OMC A;  4YTL A;  5I2M A;  5D6X A;  5KCO A;  3SWN C;  5GAM g;  2HQX A;  3RKW A;  3OYM A;  4HCC A;  3CXC A;  2HBP A;  4OGE A;  5DM7 R;  2X4Y A;  3VU3 C;  3CCS T;  1VQ9 A;  2V8I A;  3QXE B;  2CZ6 B;  4ME7 A;  5LL6 S;  4JRQ A;  4OF1 A;  3V7C A;  1VQ6 T;  2E64 A;  2LT4 A;  3LWH A;  4C0D C;  3TU4 K;  3P8B B;  4ELY C;  3UWN A;  3HL8 A;  4X9D A;  5CKB A;  3QZ5 B;  3HRS A;  3CME T;  4EPC A;  3GOX A;  4BUG A;  1YCY A;  3G4S A;  1W2B A;  1I5L A;  4RMO A;  2OTL A;  1VIF A;  2FVU A;  4M77 D;  3KUF A;  4ZGJ B;  1VQ4 T;  1HK9 A;  3LGL A;  2GF7 A;  4F7U B;  1YIT T;  1WPY A;  5GMK j;  3V8K A;  2EJ9 A;  1YIJ T;  5FRN A;  1JJ2 A;  3OQ5 A;  5FLX E;  3S6W A;  1Y96 B;  3SB2 A;  3FLG A;  4JLG A;  3OYA A;  4DA4 A;  3OMG A;  3RIR A;  2DXT A;  4OP0 A;  4EMK C;  1YJ9 A;  2D0Q B;  2DO3 A;  4ZN3 A;  1RL2 A;  1VQ8 T;  2FYK A;  1VQ6 A;  3VUZ A;  4F7U G;  1BKB A;  3KXT A;  1H3Z A;  2P0Q A;  2K3X A;  4QVC A;  3BY7 A;  4TVR A;  5GAO l;  5HKC A;  1V29 B;  5GAO n;  3VYH B;  1LNX A;  2RD1 A;  4C8Q C;  5LJ3 j;  1NJI U;  2QDY B;  3DLM A;  2RHZ A;  4OB1 B;  4J7I A;  3GLX A;  2K2V A;  4II1 A;  5CKE A;  5GAM f;  3BW1 A;  1B34 A;  5HK3 A;  1YIT A;  3LW5 E;  2K57 A;  2QQA A;  3RMQ A;  5GAM e;  3GPL A;  3JCM P;  1YIJ A;  1SSF A;  2RHX A;  3OYI A;  5GAO r;  1K73 C;  2BIV A;  2EQK A;  4C0Z A;  4HCZ A;  2PU9 B;  4M7D C;  4Q5W A;  2V8K A;  4OMF B;  5KE3 A;  5LJ5 g;  1VQ8 A;  3P8D A;  2XDP A;  3CCV T;  4E7J A;  4F7U A;  3FRN A;  3V8J A;  4NL2 A;  2DD5 A;  2WAC A;  3VKI A;  4E7H A;  3FIF A;  5J39 A;  4C92 F;  1Y96 A;  3PT9 A;  2IG0 A;  2MF2 A;  3NTI A;  4FU6 A;  4C8Q F;  3UT1 A;  3EAE A;  4L5G A;  1N27 A;  2QA4 A;  2CKK A;  3JB9 G;  4C5G A;  4C8Q E;  3JB9 H;  1PSF A;  4A53 A;  3DLL A;  1N8R U;  5GMK l;  2LQK A;  3I55 T;  4NS5 A;  1Q81 C;  1TH7 A;  1X6O A;  3G7Z A;  4DOW A;  3GP8 A;  3OYG A;  2OTJ T;  4MDX A;  1U1T A;  5EG2 A;  3NTK A;  4ZTJ A;  5CKH A;  3CCV A;  1KD1 C;  1M90 C;  5IN1 A;  4LDU A;  4M7D E;  5C0M A;  2M0O A;  3TEE A;  4C5E A;  3QJ6 A;  2VYT A;  1D3B B;  3X20 B;  2G3R A;  1M1K U;  1VQO A;  2E5Q A;  2XHC A;  3A8G B;  4FT4 A;  5GAN j;  4M75 C;  2Y90 A;  3CBP A;  3Q1J A;  2M9U A;  4M78 F;  4MZM A;  3I55 A;  4B9X A;  5GAO m;  1PSE A;  3PGG A;  3S3O A;  2OTJ A;  2KAF A;  2MAM A;  2PVD B;  4OGC A;  3PTA A;  4JS5 A;  4JRP A;  4CRI A;  4J6Y A;  1BI1 A;  3L2R A;  2M16 A;  2WSF E;  4M7A B;  2DZC A;  1KHC A;  2K4Y A;  2HD0 A;  3X28 B;  4R55 A;  4E7K A;  1I8F A;  3JCM X;  3LX7 A;  4XU0 A;  2Y4X A;  3HKS A;  1M8V A;  3J81 E;  3X24 B;  2JN0 A;  3HRT A;  3A8O B;  2JNG A;  2E6Z A;  3KBG A;  5GAN 5;  5FU7 C;  3HP9 A;  3M53 A;  4IUU A;  1YJN A;  3PIO A;  2P0K A;  4ZTF A;  4M7A G;  4V2S A;  1YHQ T;  2D9T A;  3DB3 A;  2YRV A;  5CAI A;  4JLI A;  5GAM d;  2GFA A;  3RMS A;  4M75 F;  5C6S A;  3L42 A;  5CR2 A;  1VQP T;  1D3B A;  2BKD N;  2WSC E;  3EFS A;  3MP8 A;  2XG8 D;  2O4X A;  3M4Y A;  1YJW T;  3JCM J;  2LTO A;  4MMK A;  5DLQ E;  3RKY A;  3FEO A;  3QUI A;  3J7A F;  4XK8 E;  3OW2 S;  4KBM B;  4LDY A;  1M1F A;  3OYE A;  4MDW A;  2L8D A;  1KQS A;  2VGM A;  3QHS A;  2YLC A;  2K5F A;  1JRI A;  4IUQ A;  2I2L A;  3CD6 A;  4PJO B;  2B8A A;  5CK9 A;  2RHU A;  1Q82 U;  4ATO A;  2BUD A;  2P0P A;  3CEY A;  3TCJ A;  2ZPG B;  1YHQ A;  4M7A A;  3MEV A;  3URG A;  3QPH A;  4FT2 A;  1VQL T;  4M77 C;  4XTY A;  1IRE B;  5KE2 A;  3O8V A;  5FRM A;  1MGQ A;  3QYG B;  3C12 A;  2DTO A;  3G6E T;  1BIB A;  1OZ3 A;  1VQO T;  4PJO G;  4LD9 K;  2RHI A;  5GMK e;  3JCM b;  1ZQ1 A;  2K5L A;  3LLR A;  5L8R E;  2PVG B;  2RHY A;  3OYB A;  1KC8 C;  4OVA A;  1QVF A;  2PQW A;  3JAM E;  5LJ3 f;  2RJE A;  3JB9 J;  2EAY A;  1W4S A;  4J5Y A;  3VJP A;  1N9R A;  3FB9 A;  5LJ3 e;  3CCM T;  1VQL A;  1G3S A;  2VXE A;  2X4J A;  4HKE A;  4IUP A;  3V7R A;  3LYI A;  2K5I A;  4C5H A;  3G6E A;  4RCB A;  1O75 A;  3EFR A;  3FDR A;  4M77 F;  3CCS A;  4LD6 A;  3M54 A;  4E7L A;  3SWN B;  5LJ5 d;  2MWP A;  4PJO A;  4M77 E;  4Y91 A;  3TRE A;  3QZ9 B;  3OB9 A;  3L2U A;  4QQ6 A;  3P8H A;  5GMK i;  2RI5 A;  4JJN K;  3CXC S;  1LOJ A;  4BE2 A;  1QVG A;  2CS7 A;  2XKO C;  3L1A A;  3NTH A;  1XQH A;  3NFC A;  5GMK h;  4C0D B;  4ELZ C;  2XI9 A;  3QKJ A;  1VQ4 A;  3CCM A;  1NE8 A;  2R5A A;  1BI0 A;  5KH6 A;  1W2B S;  3CCQ T;  1XNI A;  4C0G A;  4BY6 B;  5CO7 A;  2JUF A;  2FL7 A;  1M5Q 1;  5LJ3 h;  3A8L B;  3QBY A;  2A3L A;  2RJD A;  5HY6 A;  5GAN 8;  5GAO p;  3CC2 T;  4DOV A;  2RO0 A;  3MP6 A;  4EMK B;  1QP2 A;  4PLL A;  3CC4 T;  1S72 T;  2E65 A;  2DXU A;  3SWN A;  4IKF A;  4C92 B;  3JB9 D;  3S3M A;  2KY9 A;  2ZPE B;  2L5Q A;  4C8Q B;  5IAY A;  1Q86 C;  2RJF A;  1KG1 A;  4IUV A;  5GAN f;  2DEQ A;  3CCQ A;  2RM4 A;  1VQN T;  4X34 A;  4A4G A;  3ASK A;  5GAN e;  3RES A;  1U8R A;  4M7D F;  4C92 G;  3ME9 A;  5FU6 C;  2LRQ A;  4GLK A;  3DKM A;  3JCM f;  3HSB A;  4C8Q G;  4M7D B;  4R56 A;  3CC2 A;  4A4K A;  3JCM e;  3CCL T;  2X4X A;  3M59 A;  2Y4Y A;  3CC4 A;  1JBM A;  2H3J A;  2JZ2 A;  3QO3 A;  5GAM j;  1S72 A;  4J8O A;  3CCU T;  3ZBD A;  3S3N A;  3F70 A;  5CKD A;  1Q7Y C;  3BFM A;  4QQD A;  4N0A C;  5J26 A;  2VGN A;  5I2S A;  3GNF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...