4M7AC

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 12
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aC00
2YLBA 2YHTA 4M7AB 5GAMj 1H641 1I8FA 4C8QF 3JB9J 3JCMe 4PJOD 3JB9I 4XTYA 3JB9H 2DXTA 4XU0A 4XU1A 2ZGWA 5GANf 2K57A 4F7UG 4JRKA 2HNIA 1Y96A 4EMKA 4M7AD 5DY9A 1HXDA 4C92E 5GAN4 3JCMJ 4C92G 3RKXA 3RERA 3RKWA 3HFNA 4M7DC 4J6WA 4M7DA 3QSUA 4NL3A 2RD1A 2DKGA 4N0AA 4NOYA 5LJ3j 4M7DG 3RESA 5GAOq 5GMKm 3JCMd 4MMLA 4J5YA 4XU3A 2QTXA 3QHSA 5GAOl 2RM4A 3JCMh 3V7SA 4A53A 1LJOA 1D3BA 3QO3A 1WQ7A 4HT8A 3EFSA 4M78B 2EJ9A 3AHUA 1BIBA 1WQWA 4MMKA 3JCMb 5GAOm 1LNXA 4C92B 4M77C 1X01A 3JB9G 3EFRA 3QUIA 3JCMc 1B34B 4M75C 4M75D 5GAN3 4C8QE 4C92A 5LJ3f 4C92C 4EMHA 2VXEA 5GMKj 5GAN5 2FYKA 4M77B 3SB2A 3V8LA 3BDUA 4C8QG 4X9CA 2E41A 4XTVA 1D3BB 4C8QA 4C8QC 4M75F 3FB9A 5GMKl 5GAN2 1I5LA 4M78C 5GAN6 4J6YA 2DJZA 3SWNA 4M78G 3V7RA 1WPYA 3PGGA 5GMKe 4XQ3A 4M75A 5I21A 5LJ3g 4M78F 4C92D 4X9DA 5GANh 4M75B 4XTWA 1JBMA 1LOJA 3BY7A 4HA8A 4PJOF 4QVDA 3M4GA 5LJ3d 3SWNB 3JCMQ 4M7DB 4XTXA 3JB9D 2YLCA 4M77G 4C8QB 4M7AF 4M77A 4EMKB 4M77F 4HT9A 2RB6A 2DTHA 4XTZA 4M75G 3SWNC 1U1TA 4XTUA 1M8VA 2E1HA 1B34A 1WNLA 4F7UF 4F7UE 5LJ5h 4Y91A 4OP0A 5GAMh 5GAMd 5GAOp 4JRIA 5LJ3e 2DZ9A 4JUVA 4F7UA 4M78A 4PNOA 3BW1A 3JCMP 1MGQA 2DTIA 2VC8A 4RCBA 4NL2A 3JCMX 4M7DE 4C8QD 4N0AC 3V8KA 3JCMW 3HFOA 3L1AA 2DEQA 3JB9F 4V2SA 3V8JA 4JLIA 1KQ1A 1U1SA 2JN0A 5LJ3h 5GANg 4M78D 5GAMe 1M5Q1 3FIFA 5GANd 5LJ5e 3V7CA 4PJOE 4DQ2A 5GAOn 2EWNA 1YCYA 4RCCA 4PJOG 3BFMA 5GAOr 1Y96B 5GMKh 5LJ5j 2CGHA 2DZCA 4M77D 1I4K1 1N9SA 3JCMf 4M7AA 5LJ5g 5GAMg 4C92F 5LJ5d 5GANe 3GIBA 3RUXA 2DTOA 1BIAA 3FJPA 3L2ZA 4M7DD 5CAIA 4M7AE 4A54A 2E10A 1I81A 1TH7A 2Y90A 4M7AG 4PJOB 1HK9A 2DVEA 3RIRA 5GANj 4M7DF 4M7AC 3RKYA 4M78E 5GAN8 1N9RA 2FB7A 1JRIA 2DXUA 2EAYA 2VXFA 5GAMf 5GMKi 5LJ5f 3HSBA 2EJGA 3JCMg 4PJOA 1KQ2A 4PJOC 2E65A 3JCMV 4J6XA 5GAN7 4EMKC 3INZA 2I2LA 4M75E 4XU2A 2EJFA 3VU3C 4EMGA 4F7UB 4WF2A 4M77E 4QVCA 2RA2A 2E64A
chains in the Genus database with same CATH superfamily
4OGCA 3I55T 1WFWA 4MDWA 4PJMA 2M16A 1PKTA 2Y4XA 5FU7B 2JMAA 3RKWA 4RUGA 3CCVT 2RD1A 3SFMA 3EG2A 3REBB 2XDDA 1UECA 2R57A 2KBTA 2CP5A 1OI1A 4PFOA 1EIFA 4ZGJB 2RF0A 2KQWA 2KEAA 2HQXA 2D9TA 3SDZA 3L2RA 2RI3A 4KGZB 2G3RA 2RI2A 3ZFJA 5GAN3 4B6MA 2OX7A 3QXEB 2MF2A 5GAN2 1WDXA 4Y92A 4J6YA 1T0HA 2JMCA 3UWNA 2DA9A 5IAYA 4QQDA 2A28A 3I35A 1Z9ZA 2MAMA 1M2OA 2RPNA 1K76A 2RB6A 1U1TA 1ACMB 2KXDA 2QI2A 3LWIA 1OQKA 2H8HA 4Q5WA 1VYUA 3EGUA 5GAMh 5GAMd 2Y4YA 4JRIA 1KHCA 1SRLA 2ECZA 3DLLA 1G3SA 4C5HA 3KXTA 3TREA 1U1SA 4UC4A 1M5Q1 1G5VA 3RBBB 1FMWA 4PJOE 4LDVA 2IG0A 2GNCA 2XHCA 2MI6A 4PL6A 5GMKh 3EFOB 1S1NA 5FRMA 2DZCA 3C94A 3IQLA 2K5FA 3JCMf 2EQUA 2ABLA 2BZYA 2DBMA 4M7DD 1I81A 1W2BS 1ABOA 2XIDA 4M7AC 5GAN8 1V1CA 3QYHB 3J7AF 3JCMV 4HCZA 5I21A 4BDZA 1JO8A 3M0TA 1I8FA 1WHKA 3CCRQ 1K4US 4C92G 1K73R 4J6WA 1ZX6A 4J7IA 2V26A 2X35A 2DJQA 1LPLA 3OS0A 3OYAA 1QVGP 2RHUA 3H9NA 3UATA 4LNPA 2IPOB 2HMAA 4IUVA 4ZN3A 1M4ZA 3OQ5A 4C92B 4YTLA 2OTLT 5KYUA 4JPBW 5CQYA 4FW1A 3GLXA 2DL8A 3M0SA 3MP6A 5HCKA 1WPYA 3TVTA 1N8RU 1UG1A 4M75B 2AKKA 1LOJA 1KC8U 3CCSQ 2KSSA 3CMAT 3E2UA 3G71A 4M7AF 1W2BP 3HPWA 5J3BA 3A8GB 5I11A 1RAFB 2J6KA 2H3EB 2VGNA 4C5EA 1M1KU 3BW1A 3OYCA 2LQNA 1YJWQ 3ZEHA 3OW2S 1ZSZB 2NUZA 2QGFB 3QIIA 1E7OA 1YIJT 4Z02A 2EWNA 3CXCA 1VQLT 3PVQA 1I4K1 2D8JA 2P0QA 2WACA 1GXIE 1GCQC 2CUDA 5KCOA 1KQSP 3VS6A 3OYIA 2NYSA 5I2MA 2AIRB 4A54A 1VQ9A 4L5GA 3ZBDA 1KHIA 1N9RA 2HCKA 2VXFA 2EJGA 2X4WA 5AT1B 1WLPB 2DYBA 1YJNT 2EKOA 1Z9QA 2KK4A 3OYEA 3CCQQ 2DX1A 3JCMe 1K9MR 2W10A 4KGXB 3VYHB 1TG0A 1QVFS 4N0AA 5FW9A 4M7DG 4PKCC 4II1A 1ZSZA 4KH0B 4MMLA 4BE0A 3I9QA 1K0XA 3JCMh 3H0IA 3X28B 3PIPA 2RQRA 1RUWA 2M0OA 2J05A 2P4TA 3CD6A 1OX8A 4D8KA 1OOTA 3QYGB 2MOXA 1R0CB 4C8QC 1TUDA 4FIBA 3FB9A 1QWEA 2CP7A 2KRMA 5IHKA 1QQJA 3VJPA 2RHYA 2GTOA 2CZ1B 3A5ZB 1QWFA 2VWFA 3QDRB 3VS3A 5KYXA 2YXYA 1OULA 4ZTJA 1B34A 2YT6A 3CCUQ 4C0DC 1VQ8T 1VIFA 4BI3A 4PNOA 2VKNA 1NEGA 2DEQA 3CC7T 4V2SA 5LJ3h 5GANg 4IUTA 1QKXA 2RJEA 4Y28E 1XQHA 2ZAEA 3PFSA 3UT1A 3NTKA 1YCYA 2MWOA 3OS1A 2K9GA 5J39A 5CKBA 5IHIA 2M1HA 1N27A 2EYQA 3A1PA 1N9SA 1RI9A 5A0DA 1VYVA 2HKQB 1WX6A 4IUQA 1X27A 5L8RE 2FRYA 2JTFA 1IREB 3VV0A 2HBPA 5CIUA 2FG0A 1OU8A 1ZBXA 3EG9A 3CMEA 1BCOA 2PVGB 1Q82C 3NHNA 4EMKC 2LCCA 1M1KC 2ATCB 3LW5E 1YWPA 1K73U 4DOWA 1MNDA 3EFOA 4ME7A 1RADB 4IIMA 5DY9A 1HXDA 3CCLT 3DB4A 4M7DA 1B07A 3G71Q 1G3WA 1M3CA 1YN8A 1IHVA 5HK0A 3OYHA 2DD5A 1TUCA 3F70A 3URGA 2COZA 1LJOA 3BE3A 1PRLC 2PQWA 1X01A 1BKBA 1HD3A 2HD0A 1K8AR 5GAN6 1QVFP 1R77A 2YUOA 1D1AA 2VV5A 4CC7A 2AKLA 5CR2A 3CMAQ 2VB6A 3A8OB 4EMKB 3WXMB 1I0CA 4XTUA 2P0PA 1AWXA 4X1VA 1PD0A 4N4GA 1G3TA 5GAOp 1AEYA 2JM8A 4R56A 1RAIB 4JS4A 3OW2A 1M2VA 2JM9A 5FU7C 2KI7A 3ULRB 4N0AC 1D09B 1YI2Q 1YJWT 1G83A 2MIOA 3S6WA 3CCEQ 5GAMe 2LJ3A 1NYFA 4HCKA 1Y96B 2ZPFB 1BI0A 1YCSB 1U8RA 1IZ6A 2E6ZA 2O4XB 2PUKB 1VQMQ 4PJNA 2E70A 4M7AE 3G7ZA 2L2PA 2PVOB 3CCLA 1TH7A 1ZBJA 1HK9A 4RTVA 1E6GA 3MKDA 7AT1B 5GANj 1GFDA 1BI2A 1ZUYA 2L3QA 1M3BA 4JZ4A 4VUBA 5GAMf 1VQNQ 1Q95G 2E65A 3INZA 2PUOB 2BZ8A 3E1SA 5FLXE 2RA2A 3CEYA 2V8JA 5KYWA 1GRIA 1QP2A 5D6XA 1YWOA 4E2FB 2HL3A 5D7UA 5GMKm 2XKOC 4BD3A 4XK8E 4LN2A 1YHQA 4M78B 5IH2A 5EG2A 4OB3B 1M1KR 2XU8A 3H0HA 1PWTA 2JZ2A 4EMHA 2QXFA 4CC2A 3V8LA 1YFNA 3HHTB 2CT3A 1KD1C 4M75F 1GL5A 2KAFA 1QLYA 2QA4A 4M78G 3TEEA 4M75A 1Q7YR 2CUBA 3G4SQ 1QCFA 4HA8A 3SHWA 4AG2C 4M7DB 3ER0A 4K11A 2J7IA 3OYJA 5A2QE 1MMAA 2EYZA 4XTZA 5CCAA 3A8LB 1IXDA 1XJWB 4LDXA 1P92A 1LCKA 2D8HA 3M56A 2HQHA 2BE9B 3H6ZA 1X69A 2MYSA 4OP0A 3CPFA 2QEXT 1VQ8Q 3OB9A 3C0CA 4ZGDB 4JLIA 1I07A 2DO3A 3MP1A 3R6NA 4OGEA 4IURA 3G4SA 3I5RA 1OZ3A 1W4SA 1ZUKA 5HK3A 2LX9A 4QQ6A 2K5IA 3GF5A 1UTIA 4C92F 5FRNA 3GIBA 2E3HA 3FJPA 2LNVA 5CAIA 1TWBA 3C4SA 2DVEA 4LUEA 3P8DA 3VUZA 1G3YA 4C0ZA 3CCJT 3GNGA 3L2QA 2CREA 4GBQA 5GAN7 3VU3C 2YRDA 1M8MA 4XU0A 2E6NA 2K57A 3X26B 2DL5A 2CP2A 3L2VA 3JCMJ 4J9BA 3M0QA 2LDMA 2O01E 4OF1A 4B9XA 2QA4T 3RESA 5GAOq 5KYNA 1ZSZC 4J5YA 3SD4A 4XU3A 1PG5B 1HSQA 1VQPA 2ZPEB 1KD1U 1D0YA 2QQAA 2CS7A 1X6BA 2CP0A 3OYDA 3M55A 3MPUB 3PMTA 2QEXA 2FL7A 2VXEA 1QKWA 1KG1A 4ELZC 2X4XA 1YITA 5LL6S 3RDVA 3PGGA 4OMFB 1VQLA 2X3WD 3QG1A 1UGPB 3M4GA 5LJ3d 3MEWA 5KE3A 1UE9A 1VQ7T 3CCJA 1VQ5A 4M77F 1VQ6T 2O9VA 2DNUA 1WNLA 2XK0A 2XD0A 3EAEA 2JNGA 1Q7YU 4E7IA 2GFUA 4JJBA 2JS2A 1PNJA 1YI2T 1AZEA 5D6YA 2QK0A 2LTOA 4M78D 3D7SB 3FIFA 4NS5A 1UJ0A 4TVRA 4MZTA 4RTYA 2DERA 2VASA 2CGHA 1IO6A 2D0QB 4M77D 1TS9A 2RO0A 4M7AA 2ZPIB 5I2SA 4DBQA 1UFFA 3L2WA 3OMGA 3OYGA 3G6EA 4M7AG 1EX4A 3PIOA 1JJ2P 4LXCA 4BY6B 4ZTFA 4EIKA 2ENMA 1WJRA 4PFZA 4QVCA 3G1JA 1HYOA 1KFZA 4WF2A 4NL3A 3VUBA 2JVVA 2D1XA 3UPUA 4M7AB 3JB9J 2KDSA 4PJOD 4FSXA 2MMPA 1TXQA 1W6XA 2EW3A 2F69A 2V1QA 2MK5A 2D6FA 3FEOA 4M7AD 3I56A 2PU9B 3EGDA 2K7AA 2J6OA 2OTJT 1YITT 1K73C 2YRCA 1NYGA 1Q81R 1DJ7B 3JCMd 3CMEQ 1UDLA 1M30A 2F5TX 3MEVA 1MMGA 2CP3A 3MHXA 3E9FA 2QTVA 1Y0MA 5I22A 1VQ5T 3Q1JA 3FDRA 1B34B 1PHTA 2FRWA 2KROA 2WSEE 2DRMA 4C92A 3SEMA 4C8QA 1NLPC 2M02A 2HSPA 3LWHA 1KC8C 1ARKA 5FWCA 2E5QA 2LCSA 1Q86U 3M53A 2DL7A 1YJ9T 4LE9A 3CCQT 1M8VA 2FZKB 2C06A 2P4RA 4CC3A 4F7UF 1M27C 2HKNA 4F7UA 2QEXQ 1UUEA 4C0FA 3JCMX 4E7ZA 2RH2A 3OBWA 3I55Q 3MP8A 1AWOA 4OVAA 4JLGA 3TSWA 3QWYA 2JUFA 4ORZA 2K2MA 3BFMA 3VS1A 4Z89A 1OPLA 5LJ5j 5L23A 1NPPA 5GANe 2DEUA 2HAXA 2OI3A 3REAB 4QT7A 3HRTA 2E5KA 1MMDA 3KBGA 1KIKA 1C1AA 2KGTA 1IRXA 3CXCP 2JTEA 4JJDA 3CCUA 5GJWB 4M75E 2KR3A 3NTHA 2K3YA 2ZGWA 2HNIA 2E4HA 1ZQ1A 1RAEB 3GNFB 4M7DC 1NJIU 3OSVA 2K79A 4AFSC 2K4YA 2RM4A 3RMSA 3E19A 2F5KA 3OYNA 2QQRA 1WI7A 4OMNA 1VA7A 2OJ2A 5A0LA 3T9NA 4C8QG 3SB2A 2E41A 3LLRA 1I5LA 1UHCA 1SPKA 4BI4A 2DJZA 5CKFA 1Y71A 1GBQA 1YHQQ 2A0FB 3JCMQ 2DAQA 3PVLA 3CCQA 4ZNXA 2BZXA 4C8QB 1SF9A 3CD6Q 1W1FA 2LJ0A 1FX7A 5LJ5h 4Y91A 4A4KA 2A08A 2FO0A 1VQ9Q 2QYZA 1BI1A 2ROTA 2RQTA 3M58A 3WVEB 1Y7XA 2W0ZA 1PC0A 4DBRA 3C95A 1ZA2B 1K0SA 4FYWB 1OYXA 2C0IA 1U06A 2EPDA 2EKHA 4C0GA 4R55A 3FJ5A 4KH1B 3VS7A 5LJ5d 4J9DA 2P84A 2BE7D 3VYGA 4B9WA 4RTXA 4M78E 2XI9A 4A4GA 2OTLQ 2LVMA 4KRTA 2DXUA 1D0XA 4LDWA 1D1CA 1TOVA 8ATCB 1Q81C 3QJYA 2LX7A 1AWJA 3H41A 4O5VA 2O4XA 3CCRT 3LX7A 3M0PA 3VRZA 5EC7A 5GANf 1VQ4Q 4ATOA 5KYYB 2XICA 2GQIA 2RK2A 5CKDA 3HFNA 1I1JA 4RKUE 1QCNA 1S72Q 3CMAA 1SHGA 3NFCA 2CSQA 3MO8A 4PJJA 2WSCE 1ZHIA 2KRNA 1N8RR 3QO3A 1RLPC 4C0DB 1BCMA 2ROLA 1U5SA 2HEQA 1XOVA 3QUIA 1XNIA 1EFNA 5GMKj 2X4JA 5GAN5 1VQNA 2FYKA 1D3BB 1KSWA 4JRPA 5GMKe 2HZYA 4QVDA 3VKIA 2EFIA 4XTXA 4C5GA 4F16A 1YJ9Q 1IHWA 2AZVA 1D0ZA 4AT1B 4RTZA 2DPPB 3M57A 4LD6A 1AVZC 2X51A 3CPWS 2R5AA 3A98A 3MEUA 1YIJQ 3OY9A 4C8QD 2OTJA 1ABQA 3L1AA 1OV3A 2LQWA 1FMVA 1WXBA 3V8JA 1H3ZA 2JN0A 1KK7A 2FPEA 1ZLMA 2JTMA 3H8ZA 2A37A 3EGDB 3LGFA 4DQ2A 5GAOn 3GPLA 4KT0E 1M90C 1WHGA 1LVKA 4HXJA 2QGGA 4RTWA 3HP9A 4MZMA 2KXCA 4E47A 2C0TA 4KBMB 3ASKA 1Q81U 2XDPA 3J80E 1PSEA 2SEMA 2BKDN 3JAME 4PJOC 1MV3A 1NE8A 4BACA 2DK3A 1KQ2A 2D0NA 4OMPA 2L3RA 4HVVA 2E64A 1IGQA 2QG9B 2ZZDA 4OMQA 3JB9I 1YP5A 4FSSA 4F7UG 2KRSA 1TSFA 1WHMA 1AD5A 4XAXB 1VQKA 5LJ3j 5CKEA 2GFAA 2AZSA 2DD4A 2QTXA 4X34A 1JJ2A 3PTAA 2RI5A 2DF6A 4A53A 3QPHA 4QVZA 4PLIA 2DBKA 5GAOm 1PRMC 2CYZB 4BUGA 1QVFA 4GY5A 5HY6A 1VQ8A 3EH1A 5LJ3f 2K3XA 4J83A 4FYXB 3PE0A 4JJCA 3CCJQ 2EGEA 3ME9A 8AT1B 5LJ3g 1Y57A 3BY7A 4RMOA 1YJNA 4FM4B 1T3LA 3DB3A 2M0YA 3GBQA 3CCUT 2DXCA 5KYYA 4M77A 3CCVQ 2J6FA 5DLOA 4ZGEB 3TU4K 3A8MB 4QW2A 4LD9K 5LJ3e 4M78A 2ED0A 2A36A 1MGQA 4D8DA 2V8IA 1AHJB 4J9CA 2RHZA 2ZPHB 3JSCA 1A0NB 3V7CA 2MWPA 4PFPA 4F04B 1EZZB 3C12A 4CRIA 1KD1R 3GOXA 3P8BB 4C5IA 1VQOQ 5GAMg 1V76A 1OEBA 2LZ6B 3OMCA 4FT4A 2L3PA 2LT4A 2VVKA 1B7TA 3I55A 2Y90A 5KE2A 3M0RA 4PK4A 2RJDA 4QKUA 3RKYA 2EGCA 4WCIA 3L2UA 4AFUC 4A4EA 3X20B 2FB7A 1VQ7Q 2EAYA 2BTTA 2CSIA 4J7FA 4J6XA 2O9SA 4N4IA 2YHTA 2DIQA 3CCMQ 2DXTA 2LCLA 1UEBA 4XU1A 1RI0A 3CCEA 3PMIA 4JRKA 1Y96A 5KYXB 1VQ4T 1X2KA 2CZ6B 1E6HA 1ZSGA 3MEAA 5J26A 1S72T 3CCSA 3UDCA 1M2VB 1RAAB 4HT8A 4Z88A 4KUDK 2RNAA 2QAZA 2DLPA 2K6DA 1N6AA 2ED1A 4A63B 4M75D 1AT1B 4M77B 4XTVA 1CSKA 1GBRA 3SWNA 3M59A 2V8KA 5A0GA 1SEMA 3VS5A 4OMLA 3M4YA 2COYA 2A3LA 4M77G 4M75G 2COWA 4L59A 2E1HA 3OSSC 2EYYA 2FHDA 2YUQA 2KT8A 1X2QA 2QQSA 1CKBA 2OTLA 2RN8A 1NJIR 4CI0C 3JCMP 2DTIA 3CCET 1WJQA 1Q82U 2VC8A 3KUFA 2ZPGB 1WHLA 2DVJA 3I56Q 2GF7A 1FWZA 3EHQA 3META 3VS4A 3QJ6A 5GANd 3R6OA 4LUDA 1BBZA 1MV0B 3CC4T 1Q86C 5GAOr 4PJOG 2QQBA 4IKFA 2F1LA 2IIMA 5D6WA 4J9FA 3A8HB 3S3MA 2CZ0B 3DKMA 2DYIA 1RL2A 2NWMA 1VQLQ 3LYIA 2L8DA 4P5NA 2AK5A 1VQNT 3RR6A 3G6EQ 4PJOB 3QWXX 1M90R 1RLQC 4J9GA 3M0UA 1VYTA 1RACB 1NPRA 4DA4A 1G2BA 2F2XA 2PZ1A 3MCAB 2GGRA 1UHFA 3EGXB 4FL6A 4L6V5 4JDSA 5HKCA 2DRKA 3S3NA 2YLBA 4E7JA 1XTDA 5AYFA 1Q86R 4BY6C 1YJNQ 4BDYA 1VQMA 3LH0A 4EMKA 4ESRA 1WYXA 4RG8A 1VQPQ 1NLOC 1OU9A 1V29B 4E7KA 3PNWC 1YJWA 3RKXA 2DILA 1VQ6A 2HL5C 2MPXC 2RQWA 1PKSA 1UB4A 1BK2A 3OYYA 3FLGA 1WQ7A 4KGVB 3NPFA 3CC2Q 3CBMA 4DEYA 1J3TA 2H3JA 2R5MA 5FU6B 4BE2A 3OYLA 1WJSA 4LDUA 1GCPA 1VQKQ 2VGMA 2JT4A 2K2VA 2M51A 4X9DA 3M5AA 2FEIA 4XTWA 1JBMA 4FYVB 1JJ2S 1WGSA 2DIGA 3EG1A 4FT2A 2X9HA 1QMCA 3HRUA 4MZPA 1JXOA 4EDUA 3OW2P 2RJFA 5IN1A 2HBWA 2AHJB 2O88A 3GP8A 2KNBB 2LC4A 4NL2A 5FROA 5IXFA 3JCMW 2DL4A 3CCRA 1KQSS 1QVGS 1O9SA 1VUBA 2FPDA 1M1GA 4RCCA 1ZUUA 3OS5A 1JEGA 1IGUA 4HVUA 4DOVA 2PVDB 1VQOT 2DTOA 1BIAA 1F1BB 2FZCB 4ELYC 3OYKA 2VYTA 5FU6C 2GQVA 2YSQA 3CQTA 3HSBA 1JRIA 4PJOA 5GMKi 1YNZA 1RAGB 3U23A 4IIOA 1MHNA 1H92A 4A4FA 3CC7Q 1YIJA 1HJDA 1BB9A 3CCMT 2L5QA 4JRQA 5GAN4 2GBQA 2DETA 1UGVA 2LMJA 4FW2A 3RERA 1M9SA 3TQ7P 2BUDA 4RG2A 4DBFA 2EQMA 3TSZA 3S3OA 5GJVB 1PM3A 3QHSA 2KYBA 3V7SA 4BI8B 1D3BA 2LP5A 3EFSA 3OA6A 3G71T 1LNXA 1C6VX 4M77C 3I5SA 1K8AC 4JZ3A 1OZ2A 4M75C 1G8XA 2V1RA 1PSFA 2PTKA 4OB1B 1QVGA 2KVQG 1JXMA 4M78C 4A4HA 2EYWA 1O75A 3V7RA 4XQ3A 4C92D 3CXCS 3RNJA 1VIEA 3M54A 1OX9A 5CO7A 3FRNA 2DTHA 3OBYA 4O6JA 3SWNC 2L3SA 5KYUB 2DXBA 2FZGB 1UGQB 4DBHA 1SSFA 3V8KA 1YJ9A 1W2BA 3X24B 3JB9F 3ZL7C 2L89A 1NJIC 2P0KA 5LJ5e 5DM7R 2CKKA 3CC4Q 1SKUB 3CMET 1SSHA 4N4HA 5KYWB 4LDYA 3BDLA 2CT4A 2NUPA 2KYMA 4CC4B 1KC8R 4AG1C 3G6ET 2E12A 1VQMT 4JS5A 1QP3A 5DLQE 3JCMg 2JS0A 4BE1A 3CCST 1H3HA 2HQEA 4RTUA 2HSEB 5C6SA 3EH2A 5GAMj 4XTYA 2LT1A 3OYBA 4M4ZA 5KH6A 5FWBA 4AFQC 5IXBA 1YI2A 3QSUA 2WSFE 2CH4W 3H0FA 3M9QA 1NM7A 4OB0B 4ANJA 2HDAA 2PNIA 6AT1B 5GAOl 2K3BA 4F17A 2Z0WA 1JU5C 3MJXA 1WQWA 3N5BB 3JB9G 3CC2T 3HRSA 3JCMc 1K8AU 1X6GA 4C8QE 4AMCA 1BYMA 5IHNA 3TCJA 4HCBA 1I5OB 1WHHA 1YBYA 9ATCB 5GANh 1VQ4A 4J9HA 3NTIA 1FMKA 5CVIA 2EVRA 4QQGA 2NLUA 2DMOA 3JV3A 2LNHB 3JB9D 3G4ST 2YDLA 3NGPA 2CH4A 4F7UE 2OAWA 3NMZC 4R0KA 2DFUA 2LQKA 1NZ9A 1K9MC 4AFZC 3VRYA 4GLKA 2LQ8A 5IT9E 1T0JA 4FYYB 2OAUA 3PT9A 2LRQA 2L0AA 1WHJA 4PJLA 2QASA 2ESWA 3KFVA 5ECAA 2JW4A 3AT1B 2LJ1A 2ZPBB 1OPKA 2MCNA 3LH5A 1GCQA 3O8VA 3QBYA 4FCYA 2XDBA 1R0BG 4FU6A 2X4YA 2E10A 3EGXA 3EG9B 2RHXA 3VS2A 3RIRA 4M7DF 1WZOA 4F14A 5LJ5f 2B8AA 1QCOA 2FVUA 2QQ9A 2I2LA 2EJFA 3THKA 4M77E 1QVPA 1AWWA 1RAHB 4IUUA 4C8QF 4Z8AA 3UF4A 1M3AA 1K9AA 2GCXA 2YUNA 1YHQT 2AT1B 3CPWP 3UA6A 3QZ9B 2DKGA 2XG8D 2IVWA 1FYNA 1TTHB 3OS2A 1D1BA 1M1FA 1VQ7A 1SRMA 4HVWA 5CKHA 2KE9A 5CK9A 2EJ9A 3CC2A 3AHUA 1BIBA 1K1ZA 4MMKA 4E7SA 1RABB 3EFRA 1X6OA 2G6FX 1MNEA 3UA7A 2GTJA 5GMKl 3VS0A 3OYFA 1UJYA 3QDFA 3CBOA 2YRVA 2EQIA 4D6WA 1NEBA 3CD6T 2C0OA 4PJOF 3SWNB 2F2VA 4KULA 2X3XD 3CBPA 1FXXA 3WVDB 2YLCA 4HT9A 1U3OA 1WIEA 2QA4Q 2NUTB 1VQ9T 4OB2B 1VQ6Q 2I0NA 1K9MU 2KY9A 4M7DE 3CCLQ 2E3IA 1ZA1B 3CPWA 1CKAA 2DM1A 3HFOA 5KCHA 2K5LA 2KT1A 2EQKA 1Y07A 2EQJA 4J9EA 3X25B 1PD1A 2RJCA 2CDTA 2DE0X 2B86A 2O2OA 3O5ZA 3RUXA 3E9GA 5CQXA 5M9OA 1Q7YC 1WXTA 3P8HA 1IB8A 3QKJA 1GFCA 2KMTA 2ZCFB 1JB0E 1PCXA 2EYXA 3HTRA 4XU2A 4EMGA 4PLLA 4JJNK 2EGAA 2DL3A 1H641 1N8RC 1NG2A 4ZN1A 3JB9H 1B3QA 1NBEB 1BI3A 2RHIA 2JJ9A 1MUZA 1SHFA 4C92E 2SRCA 4EPCA 4OMMA 2EIFA 1WXUA 3I56T 2EBPA 3FC3A 4NOYA 4J9IA 3CCVA 1Q82R 2O31A 1AZGB 4GLMA 2F2WA 4J8OA 1C0MA 3JCMb 5C0MA 1R8OB 2NUTA 4C92C 1UGRB 3HL8A 3BDUA 1S72A 4X9CA 4MDXA 3LGLA 3CC4A 2CP6A 4M78F 4IUPA 2J06A 2RQVA 3OYMA 3L42A 1M90U 1VQOA 1JQQA 2XMFA 3EG0A 2M9UA 2OTJQ 2JXBA 1T3SA 4WTOB 1YITQ 2CZ7B 1SG5A 2RQUA 4RTTA 1VQPT 2QDYB 2DZ9A 4JUVA 2QDLA 1QW1A 1AOJA 4RCBA 4E7HA 2VUBA 1W70A 3J81E 1VQ5Q 1KJWA 1KQ1A 2BIVA 4DEXA 3CCMA 4BB7A 1TU0B 1KQSA 2FPFA 2NUPB 1H8KA 4HCCA 1N5ZA 2YUPA 1X75C 3EG3A 2A7YA 1VOMA 2JOYA 1BU1A 5LJ5g 1MMNA 4E6RA 2RMOA 3L2ZA 2RK1A 3HKSA 2YWWA 1VQKT 3DLMA 3CC7A 3RMQA 4E7LA 3QZ5B 4HKEA 1UGSB 1X43A 1WA7A 3EHRA 4KUIA 1TUGB 4OMOA 3JRZA 4F7UB 2R58A
chains in the Genus database with same CATH topology
2V8JA 4OGCA 3LX7A 4A4FA 3I55T 1QP2A 1YIJA 3CCMT 5D6XA 5GANf 2L5QA 4MDWA 4JRQA 2M16A 4ATOA 5GAN4 2XICA 2RK2A 2Y4XA 5FU7B 5CKDA 3RERA 3RKWA 3HFNA 1M9SA 3CCVT 2RD1A 4RKUE 2BUDA 3SFMA 4RG2A 5GMKm 2XDDA 2EQMA 2R57A 3S3OA 1KC8U 3CMAA 1OI1A 2XKOC 1EIFA 3NFCA 4XK8E 4BD3A 4ZGJB 3QHSA 3MO8A 2KQWA 3V7SA 2WSCE 1ZHIA 2HQXA 2D9TA 1D3BA 4BI8B 3QO3A 1YHQA 3EFSA 4M78B 4C0DB 5EG2A 4OB3B 3OA6A 1LNXA 3G71T 3SDZA 4M77C 3L2RA 2XU8A 1XOVA 3QUIA 1K8AC 2RI3A 1XNIA 2G3RA 1OZ2A 2RI2A 3ZFJA 4M75C 5GAN3 2JZ2A 4EMHA 5GMKj 2QXFA 2X4JA 3QXEB 2FYKA 2MF2A 3V8LA 5GAN5 1PSFA 1VQNA 3HHTB 4OB1B 5GAN2 1QVGA 1D3BB 1KD1C 2KVQG 4M75F 4M78C 4A4HA 2KAFA 4J6YA 2QA4A 4JRPA 4M78G 3TEEA 1O75A 3UWNA 3V7RA 5GMKe 4XQ3A 4M75A 4C92D 5IAYA 3CXCS 4QQDA 4QVDA 1VIEA 3M54A 4HA8A 3VKIA 4M7DB 2EFIA 4XTXA 5CO7A 2MAMA 3ER0A 4C5GA 3OYJA 5A2QE 3FRNA 2DTHA 2RB6A 3OBYA 4O6JA 4XTZA 1U1TA 3SWNC 5CCAA 3A8LB 4LDXA 1P92A 2QI2A 3M56A 3LWIA 2DPPB 4Q5WA 3H6ZA 3M57A 4OP0A 5GAMh 3CPFA 2Y4YA 4JRIA 1KHCA 5GAMd 4LD6A 2QEXT 2DXBA 3CPWS 3OB9A 2R5AA 3MEUA 1UGQB 3DLLA 1G3SA 4C5HA 3OY9A 4C8QD 3KXTA 4ZGDB 1SSFA 3V8KA 1YJ9A 1W2BA 3X24B 2OTJA 3L1AA 3JB9F 1H3ZA 3V8JA 4JLIA 3TREA 1U1SA 2JN0A 2DO3A 2L89A 1NJIC 4UC4A 1M5Q1 1G5VA 2P0KA 5LJ5e 2JTMA 3H8ZA 3MP1A 4OGEA 3LGFA 4IURA 4LDVA 4DQ2A 2CKKA 5DM7R 5GAOn 3G4SA 2IG0A 4KT0E 1OZ3A 2XHCA 2MI6A 1W4SA 4PL6A 1M90C 5GMKh 5HK3A 2LX9A 5FRMA 2DZCA 3C94A 2K5FA 3HP9A 2K5IA 4QQ6A 3JCMf 4MZMA 3CMET 2EQUA 3GF5A 4E47A 4N4HA 4KBMB 4C92F 4LDYA 5FRNA 3BDLA 3GIBA 3ASKA 3FJPA 2LNVA 1Q81U 4M7DD 5CAIA 2XDPA 1I81A 3J80E 1W2BS 3C4SA 1PSEA 2DVEA 2XIDA 3G6ET 2E12A 4M7AC 3P8DA 1VQMT 3VUZA 5GAN8 4JS5A 2BKDN 1G3YA 3QYHB 1QP3A 4C0ZA 3JAME 4PJOC 1NE8A 4BACA 3CCJT 5DLQE 3JCMg 2DK3A 1KQ2A 3GNGA 3J7AF 3L2QA 3JCMV 5GAN7 4BE1A 4HCZA 5I21A 3CCST 2L3RA 3VU3C 4BDZA 2HQEA 2E64A 5C6SA 2ZZDA 1I8FA 5GAMj 3JB9I 4XTYA 2LT1A 5FLXE 4XU0A 3OYBA 2E6NA 2K57A 3X26B 4F7UG 5KH6A 3L2VA 3JCMJ 1YI2A 4XAXB 4C92G 4J6WA 1VQKA 3QSUA 1S72A 5LJ3j 2LDMA 2O01E 4J7IA 4OF1A 5CKEA 3RESA 4B9XA 5GAOq 2X35A 2QA4T 2WSFE 4J5YA 3M9QA 2GFAA 4XU3A 3SD4A 4OB0B 2DD4A 2QTXA 4X34A 3OS0A 1VQPA 3PTAA 5GAOl 2RI5A 3OYAA 1JJ2A 2RHUA 2ZPEB 4A53A 1KD1U 3QPHA 4QVZA 4PLIA 2QQAA 4IUVA 4ZN3A 2CS7A 1WQWA 3N5BB 1M4ZA 5GAOm 3OQ5A 4C92B 2CYZB 4BUGA 3OYDA 3JB9G 3CC2T 1QVFA 3HRSA 3M55A 3PMTA 4GY5A 5HY6A 3JCMc 1K8AU 4YTLA 1VQ8A 2OTLT 4C8QE 2QEXA 2FL7A 5LJ3f 5CQYA 2VXEA 1BYMA 2K3XA 1KG1A 4J83A 3GLXA 3TCJA 4ELZC 2X4XA 3MP6A 5LL6S 1YITA 4HCBA 1WPYA 1YBYA 3PGGA 1N8RU 4OMFB 1VQLA 5GANh 3ME9A 4M75B 3QG1A 3NTIA 1LOJA 1UGPB 3BY7A 5LJ3g 1VQ4A 3M4GA 5LJ3d 5CVIA 4QQGA 4RMOA 1YJNA 3MEWA 4FM4B 2KSSA 2NLUA 5KE3A 3CMAT 3DB3A 1VQ7T 3CCUT 3JB9D 3G71A 2DXCA 4M7AF 3CCJA 1VQ5A 4M77A 3G4ST 4M77F 3HPWA 5J3BA 1VQ6T 3A8GB 5DLOA 1WNLA 2XK0A 4ZGEB 3TU4K 2XD0A 3A8MB 4F7UE 4QW2A 3EAEA 4LD9K 2JNGA 2VGNA 2LQKA 4C5EA 5LJ3e 1Q7YU 1M1KU 4M78A 3BW1A 1NZ9A 3OYCA 1MGQA 1K9MC 4E7IA 2GFUA 2V8IA 4GLKA 2LQ8A 5IT9E 1AHJB 3ZEHA 1YI2T 3OW2S 3QIIA 5D6YA 2RHZA 2LTOA 2ZPHB 4M78D 2OAUA 3PT9A 3FIFA 3JSCA 4NS5A 2LRQA 1YIJT 4TVRA 3V7CA 2MWPA 4MZTA 4Z02A 2EWNA 3CXCA 1VQLT 2CGHA 2D0QB 4M77D 1I4K1 3C12A 4CRIA 3GOXA 2P0QA 2RO0A 2WACA 3P8BB 4C5IA 4M7AA 2ZPBB 5GAMg 1GXIE 2ZPIB 3OMCA 5I2SA 5KCOA 3OYIA 3O8VA 3QBYA 4FT4A 2LT4A 5I2MA 4FU6A 2X4YA 2E10A 3OMGA 4A54A 3OYGA 3I55A 3L2WA 3G6EA 2RHXA 1VQ9A 2Y90A 4L5GA 5KE2A 4M7AG 3RIRA 3ZBDA 4M7DF 3PIOA 2RJDA 3RKYA 1KHIA 3L2UA 4BY6B 4A4EA 4ZTFA 3X20B 1N9RA 2VXFA 2FB7A 2EAYA 5LJ5f 2B8AA 2EJGA 2X4WA 4J7FA 4J6XA 1WJRA 2FVUA 2QQ9A 2I2LA 4QVCA 1YJNT 2EJFA 2EKOA 4WF2A 4M77E 4NL3A 1QVPA 3VUBA 4N4IA 2JVVA 3UPUA 2YHTA 2DIQA 2KK4A 4M7AB 4IUUA 2KDSA 4C8QF 4FSXA 2MMPA 3JCMe 2F69A 3OYEA 3JB9J 4PJOD 2DXTA 2LCLA 2D6FA 2GCXA 1YHQT 1UEBA 3FEOA 1RI0A 4XU1A 3PMIA 4JRKA 3VYHB 1Y96A 3CCEA 4M7AD 1VQ4T 3I56A 2PU9B 2CZ6B 2OTJT 1QVFS 3QZ9B 4N0AA 2DKGA 1YITT 1K73C 2XG8D 4M7DG 2IVWA 1DJ7B 4II1A 4PKCC 3MEAA 5J26A 4MMLA 3JCMd 3OS2A 4BE0A 1S72T 1M1FA 2F5TX 1VQ7A 3CCSA 5CKHA 3JCMh 3X28B 3UDCA 3PIPA 3MEVA 4HT8A 2M0OA 3CC2A 5CK9A 2EJ9A 3MHXA 1BIBA 3E9FA 2P4TA 4MMKA 3AHUA 3CD6A 4KUDK 1VQ5T 3Q1JA 1N6AA 3EFRA 3FDRA 1B34B 1X6OA 4M75D 2WSEE 4C92A 3QYGB 4M77B 4XTVA 5GMKl 4C8QA 4C8QC 4FIBA 3FB9A 3OYFA 3SWNA 3M59A 2V8KA 3CBOA 2YRVA 5A0GA 3LWHA 4D6WA 1KC8C 3CD6T 3VJPA 4PJOF 2RHYA 3SWNB 2CZ1B 3A5ZB 4KULA 3CBPA 3M4YA 2E5QA 1FXXA 1Q86U 2A3LA 3QDRB 3WVDB 3M53A 2YLCA 4M77G 1YJ9T 4HT9A 1M8VA 3CCQT 4M75G 4L59A 2C06A 2E1HA 3OSSC 4ZTJA 1B34A 2FHDA 1VQ9T 4F7UF 2QQSA 4C0DC 1VQ8T 2OTLA 4OB2B 1VIFA 4CI0C 4BI3A 4PNOA 4F7UA 3JCMP 2DTIA 3CCET 1WJQA 1Q82U 2VC8A 4C0FA 2KY9A 1K9MU 3JCMX 4M7DE 3KUFA 2RH2A 3OBWA 3CPWA 2ZPGB 3HFOA 5KCHA 2DEQA 3MP8A 3CC7T 4V2SA 4OVAA 2GF7A 4JLGA 1FWZA 3META 5LJ3h 2K5LA 5GANg 4IUTA 3QJ6A 5GANd 2RJEA 4Y28E 1XQHA 2EQKA 1Y07A 2JUFA 2EQJA 3R6OA 3PFSA 3CC4T 3UT1A 1Q86C 3NTKA 1YCYA 2MWOA 4PJOG 3BFMA 3X25B 5GAOr 3OS1A 5J39A 5LJ5j 2QQBA 5CKBA 4IKFA 2RJCA 1N27A 2M1HA 5D6WA 2EYQA 1N9SA 3A8HB 3S3MA 5A0DA 1NPPA 5GANe 2CZ0B 3DKMA 3E9GA 3RUXA 5CQXA 2HAXA 1RL2A 3LYIA 2L8DA 3HRTA 4IUQA 4P5NA 5M9OA 3KBGA 1Q7YC 1VQNT 5L8RE 4PJOB 2JTFA 1IREB 3P8HA 3VV0A 3QKJA 2HBPA 5CIUA 1NPRA 3CCUA 4DA4A 1ZBXA 2KMTA 2ZCFB 1JB0E 3MCAB 2PVGB 3CMEA 1Q82C 4FL6A 4L6V5 4EMKC 4M75E 4XU2A 3NTHA 4JDSA 4EMGA 5HKCA 2LCCA 3S3NA 1M1KC 4PLLA 3LW5E 4JJNK 2YLBA 4E7JA 1XTDA 2K3YA 5AYFA 1H641 1N8RC 4ZN1A 3JB9H 4BY6C 4DOWA 1K73U 2ZGWA 2RHIA 1BI3A 4ME7A 4BDYA 2HNIA 3LH0A 4EMKA 1VQMA 5DY9A 1HXDA 4RG8A 4C92E 3CCLT 4EPCA 1ZQ1A 1V29B 4E7KA 3PNWC 2EIFA 3DB4A 1YJWA 3RKXA 3GNFB 4M7DC 3I56T 4M7DA 3FC3A 4NOYA 2XDBA 1NJIU 1VQ6A 3CCVA 3OSVA 1G3WA 1UB4A 5HK0A 3OYHA 2DD5A 2K4YA 2RM4A 3F70A 3OYYA 3URGA 3RMSA 1LJOA 3E19A 3FLGA 1WQ7A 2F5KA 4J8OA 3OYNA 3JCMb 2PQWA 2QQRA 3CBMA 1X01A 5C0MA 1R8OB 1BKBA 4C92C 5A0LA 3T9NA 4C8QG 1UGRB 2H3JA 2R5MA 3BDUA 3HL8A 4X9CA 2E41A 2HD0A 3LLRA 5FU6B 3GPLA 4BE2A 3OYLA 1WJSA 4LDUA 4BI4A 1I5LA 4MDXA 5GAN6 2DJZA 3LGLA 5CKFA 3CC4A 2VGMA 1Y71A 2K2VA 4M78F 4X9DA 4IUPA 3M5AA 4XTWA 1JBMA 2VV5A 3OYMA 1WGSA 3L42A 1JJ2S 3JCMQ 2DIGA 4FT2A 2DAQA 3CCQA 1M90U 1VQOA 5CR2A 4C8QB 2M9UA 3HRUA 4MZPA 3A8OB 4EDUA 4EMKB 3WXMB 4XTUA 2P0PA 2CZ7B 2RJFA 1FX7A 5IN1A 1VQPT 4PJOE 5LJ5h 4N4GA 4Y91A 1G3TA 2AHJB 5GAOp 2QDYB 4A4KA 4R56A 2DZ9A 4JUVA 4JS4A 1QW1A 3GP8A 3OW2A 2LC4A 4RCBA 4E7HA 4NL2A 2VUBA 5FU7C 4N0AC 3J81E 5FROA 3JCMW 1YJWT 1BI1A 3CCRA 1KQ1A 3S6WA 1KQSS 3M58A 3WVEB 1QVGS 5GAMe 2BIVA 1Y7XA 3CCMA 1O9SA 1VUBA 3C95A 4BB7A 1KQSA 1M1GA 4RCCA 1OYXA 1Y96B 2ZPFB 1BI0A 3OS5A 4HCCA 4C0GA 4R55A 1X75C 2A7YA 1U8RA 2JOYA 4DOVA 1IZ6A 2PVDB 5LJ5g 2E6ZA 1VQOT 5LJ5d 2O4XB 2PUKB 2DTOA 1BIAA 3L2ZA 4ELYC 3OYKA 2E70A 2RK1A 3SB2A 2VYTA 3HKSA 5FU6C 2GQVA 3G7ZA 1VQKT 4M7AE 2PVOB 3DLMA 3VYGA 4B9WA 3CCLA 1TH7A 3CC7A 3RMQA 4E7LA 1HK9A 5GANj 3QZ5B 4HKEA 1UGSB 4M78E 1BI2A 2XI9A 4A4GA 2LVMA 3HSBA 1JRIA 2DXUA 4VUBA 5GAMf 5GMKi 4PJOA 4KUIA 4LDWA 2E65A 1Q81C 3INZA 3QJYA 3JRZA 2PUOB 3E1SA 2R58A 4O5VA 1MHNA 2O4XA 4F7UB 2RA2A 3CCRT 3CEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLB A;  2YHT A;  4M7A B;  5GAM j;  1H64 1;  1I8F A;  4C8Q F;  3JB9 J;  3JCM e;  4PJO D;  3JB9 I;  4XTY A;  3JB9 H;  2DXT A;  4XU0 A;  4XU1 A;  2ZGW A;  5GAN f;  2K57 A;  4F7U G;  4JRK A;  2HNI A;  1Y96 A;  4EMK A;  4M7A D;  5DY9 A;  1HXD A;  4C92 E;  5GAN 4;  3JCM J;  4C92 G;  3RKX A;  3RER A;  3RKW A;  3HFN A;  4M7D C;  4J6W A;  4M7D A;  3QSU A;  4NL3 A;  2RD1 A;  2DKG A;  4N0A A;  4NOY A;  5LJ3 j;  4M7D G;  3RES A;  5GAO q;  5GMK m;  3JCM d;  4MML A;  4J5Y A;  4XU3 A;  2QTX A;  3QHS A;  5GAO l;  2RM4 A;  3JCM h;  3V7S A;  4A53 A;  1LJO A;  1D3B A;  3QO3 A;  1WQ7 A;  4HT8 A;  3EFS A;  4M78 B;  2EJ9 A;  3AHU A;  1BIB A;  1WQW A;  4MMK A;  3JCM b;  5GAO m;  1LNX A;  4C92 B;  4M77 C;  1X01 A;  3JB9 G;  3EFR A;  3QUI A;  3JCM c;  1B34 B;  4M75 C;  4M75 D;  5GAN 3;  4C8Q E;  4C92 A;  5LJ3 f;  4C92 C;  4EMH A;  2VXE A;  5GMK j;  5GAN 5;  2FYK A;  4M77 B;  3SB2 A;  3V8L A;  3BDU A;  4C8Q G;  4X9C A;  2E41 A;  4XTV A;  1D3B B;  4C8Q A;  4C8Q C;  4M75 F;  3FB9 A;  5GMK l;  5GAN 2;  1I5L A;  4M78 C;  5GAN 6;  4J6Y A;  2DJZ A;  3SWN A;  4M78 G;  3V7R A;  1WPY A;  3PGG A;  5GMK e;  4XQ3 A;  4M75 A;  5I21 A;  5LJ3 g;  4M78 F;  4C92 D;  4X9D A;  5GAN h;  4M75 B;  4XTW A;  1JBM A;  1LOJ A;  3BY7 A;  4HA8 A;  4PJO F;  4QVD A;  3M4G A;  5LJ3 d;  3SWN B;  3JCM Q;  4M7D B;  4XTX A;  3JB9 D;  2YLC A;  4M77 G;  4C8Q B;  4M7A F;  4M77 A;  4EMK B;  4M77 F;  4HT9 A;  2RB6 A;  2DTH A;  4XTZ A;  4M75 G;  3SWN C;  1U1T A;  4XTU A;  1M8V A;  2E1H A;  1B34 A;  1WNL A;  4F7U F;  4F7U E;  5LJ5 h;  4Y91 A;  4OP0 A;  5GAM h;  5GAM d;  5GAO p;  4JRI A;  5LJ3 e;  2DZ9 A;  4JUV A;  4F7U A;  4M78 A;  4PNO A;  3BW1 A;  3JCM P;  1MGQ A;  2DTI A;  2VC8 A;  4RCB A;  4NL2 A;  3JCM X;  4M7D E;  4C8Q D;  4N0A C;  3V8K A;  3JCM W;  3HFO A;  3L1A A;  2DEQ A;  3JB9 F;  4V2S A;  3V8J A;  4JLI A;  1KQ1 A;  1U1S A;  2JN0 A;  5LJ3 h;  5GAN g;  4M78 D;  5GAM e;  1M5Q 1;  3FIF A;  5GAN d;  5LJ5 e;  3V7C A;  4PJO E;  4DQ2 A;  5GAO n;  2EWN A;  1YCY A;  4RCC A;  4PJO G;  3BFM A;  5GAO r;  1Y96 B;  5GMK h;  5LJ5 j;  2CGH A;  2DZC A;  4M77 D;  1I4K 1;  1N9S A;  3JCM f;  4M7A A;  5LJ5 g;  5GAM g;  4C92 F;  5LJ5 d;  5GAN e;  3GIB A;  3RUX A;  2DTO A;  1BIA A;  3FJP A;  3L2Z A;  4M7D D;  5CAI A;  4M7A E;  4A54 A;  2E10 A;  1I81 A;  1TH7 A;  2Y90 A;  4M7A G;  4PJO B;  1HK9 A;  2DVE A;  3RIR A;  5GAN j;  4M7D F;  4M7A C;  3RKY A;  4M78 E;  5GAN 8;  1N9R A;  2FB7 A;  1JRI A;  2DXU A;  2EAY A;  2VXF A;  5GAM f;  5GMK i;  5LJ5 f;  3HSB A;  2EJG A;  3JCM g;  4PJO A;  1KQ2 A;  4PJO C;  2E65 A;  3JCM V;  4J6X A;  5GAN 7;  4EMK C;  3INZ A;  2I2L A;  4M75 E;  4XU2 A;  2EJF A;  3VU3 C;  4EMG A;  4F7U B;  4WF2 A;  4M77 E;  4QVC A;  2RA2 A;  2E64 A; 
#chains in the Genus database with same CATH topology
 4OGC A;  3I55 T;  1WFW A;  4MDW A;  4PJM A;  2M16 A;  1PKT A;  2Y4X A;  5FU7 B;  2JMA A;  3RKW A;  4RUG A;  3CCV T;  2RD1 A;  3SFM A;  3EG2 A;  3REB B;  2XDD A;  1UEC A;  2R57 A;  2KBT A;  2CP5 A;  1OI1 A;  4PFO A;  1EIF A;  4ZGJ B;  2RF0 A;  2KQW A;  2KEA A;  2HQX A;  2D9T A;  3SDZ A;  3L2R A;  2RI3 A;  4KGZ B;  2G3R A;  2RI2 A;  3ZFJ A;  5GAN 3;  4B6M A;  2OX7 A;  3QXE B;  2MF2 A;  5GAN 2;  1WDX A;  4Y92 A;  4J6Y A;  1T0H A;  2JMC A;  3UWN A;  2DA9 A;  5IAY A;  4QQD A;  2A28 A;  3I35 A;  1Z9Z A;  2MAM A;  1M2O A;  2RPN A;  1K76 A;  2RB6 A;  1U1T A;  1ACM B;  2KXD A;  2QI2 A;  3LWI A;  1OQK A;  2H8H A;  4Q5W A;  1VYU A;  3EGU A;  5GAM h;  5GAM d;  2Y4Y A;  4JRI A;  1KHC A;  1SRL A;  2ECZ A;  3DLL A;  1G3S A;  4C5H A;  3KXT A;  3TRE A;  1U1S A;  4UC4 A;  1M5Q 1;  1G5V A;  3RBB B;  1FMW A;  4PJO E;  4LDV A;  2IG0 A;  2GNC A;  2XHC A;  2MI6 A;  4PL6 A;  5GMK h;  3EFO B;  1S1N A;  5FRM A;  2DZC A;  3C94 A;  3IQL A;  2K5F A;  3JCM f;  2EQU A;  2ABL A;  2BZY A;  2DBM A;  4M7D D;  1I81 A;  1W2B S;  1ABO A;  2XID A;  4M7A C;  5GAN 8;  1V1C A;  3QYH B;  3J7A F;  3JCM V;  4HCZ A;  5I21 A;  4BDZ A;  1JO8 A;  3M0T A;  1I8F A;  1WHK A;  3CCR Q;  1K4U S;  4C92 G;  1K73 R;  4J6W A;  1ZX6 A;  4J7I A;  2V26 A;  2X35 A;  2DJQ A;  1LPL A;  3OS0 A;  3OYA A;  1QVG P;  2RHU A;  3H9N A;  3UAT A;  4LNP A;  2IPO B;  2HMA A;  4IUV A;  4ZN3 A;  1M4Z A;  3OQ5 A;  4C92 B;  4YTL A;  2OTL T;  5KYU A;  4JPB W;  5CQY A;  4FW1 A;  3GLX A;  2DL8 A;  3M0S A;  3MP6 A;  5HCK A;  1WPY A;  3TVT A;  1N8R U;  1UG1 A;  4M75 B;  2AKK A;  1LOJ A;  1KC8 U;  3CCS Q;  2KSS A;  3CMA T;  3E2U A;  3G71 A;  4M7A F;  1W2B P;  3HPW A;  5J3B A;  3A8G B;  5I11 A;  1RAF B;  2J6K A;  2H3E B;  2VGN A;  4C5E A;  1M1K U;  3BW1 A;  3OYC A;  2LQN A;  1YJW Q;  3ZEH A;  3OW2 S;  1ZSZ B;  2NUZ A;  2QGF B;  3QII A;  1E7O A;  1YIJ T;  4Z02 A;  2EWN A;  3CXC A;  1VQL T;  3PVQ A;  1I4K 1;  2D8J A;  2P0Q A;  2WAC A;  1GXI E;  1GCQ C;  2CUD A;  5KCO A;  1KQS P;  3VS6 A;  3OYI A;  2NYS A;  5I2M A;  2AIR B;  4A54 A;  1VQ9 A;  4L5G A;  3ZBD A;  1KHI A;  1N9R A;  2HCK A;  2VXF A;  2EJG A;  2X4W A;  5AT1 B;  1WLP B;  2DYB A;  1YJN T;  2EKO A;  1Z9Q A;  2KK4 A;  3OYE A;  3CCQ Q;  2DX1 A;  3JCM e;  1K9M R;  2W10 A;  4KGX B;  3VYH B;  1TG0 A;  1QVF S;  4N0A A;  5FW9 A;  4M7D G;  4PKC C;  4II1 A;  1ZSZ A;  4KH0 B;  4MML A;  4BE0 A;  3I9Q A;  1K0X A;  3JCM h;  3H0I A;  3X28 B;  3PIP A;  2RQR A;  1RUW A;  2M0O A;  2J05 A;  2P4T A;  3CD6 A;  1OX8 A;  4D8K A;  1OOT A;  3QYG B;  2MOX A;  1R0C B;  4C8Q C;  1TUD A;  4FIB A;  3FB9 A;  1QWE A;  2CP7 A;  2KRM A;  5IHK A;  1QQJ A;  3VJP A;  2RHY A;  2GTO A;  2CZ1 B;  3A5Z B;  1QWF A;  2VWF A;  3QDR B;  3VS3 A;  5KYX A;  2YXY A;  1OUL A;  4ZTJ A;  1B34 A;  2YT6 A;  3CCU Q;  4C0D C;  1VQ8 T;  1VIF A;  4BI3 A;  4PNO A;  2VKN A;  1NEG A;  2DEQ A;  3CC7 T;  4V2S A;  5LJ3 h;  5GAN g;  4IUT A;  1QKX A;  2RJE A;  4Y28 E;  1XQH A;  2ZAE A;  3PFS A;  3UT1 A;  3NTK A;  1YCY A;  2MWO A;  3OS1 A;  2K9G A;  5J39 A;  5CKB A;  5IHI A;  2M1H A;  1N27 A;  2EYQ A;  3A1P A;  1N9S A;  1RI9 A;  5A0D A;  1VYV A;  2HKQ B;  1WX6 A;  4IUQ A;  1X27 A;  5L8R E;  2FRY A;  2JTF A;  1IRE B;  3VV0 A;  2HBP A;  5CIU A;  2FG0 A;  1OU8 A;  1ZBX A;  3EG9 A;  3CME A;  1BCO A;  2PVG B;  1Q82 C;  3NHN A;  4EMK C;  2LCC A;  1M1K C;  2ATC B;  3LW5 E;  1YWP A;  1K73 U;  4DOW A;  1MND A;  3EFO A;  4ME7 A;  1RAD B;  4IIM A;  5DY9 A;  1HXD A;  3CCL T;  3DB4 A;  4M7D A;  1B07 A;  3G71 Q;  1G3W A;  1M3C A;  1YN8 A;  1IHV A;  5HK0 A;  3OYH A;  2DD5 A;  1TUC A;  3F70 A;  3URG A;  2COZ A;  1LJO A;  3BE3 A;  1PRL C;  2PQW A;  1X01 A;  1BKB A;  1HD3 A;  2HD0 A;  1K8A R;  5GAN 6;  1QVF P;  1R77 A;  2YUO A;  1D1A A;  2VV5 A;  4CC7 A;  2AKL A;  5CR2 A;  3CMA Q;  2VB6 A;  3A8O B;  4EMK B;  3WXM B;  1I0C A;  4XTU A;  2P0P A;  1AWX A;  4X1V A;  1PD0 A;  4N4G A;  1G3T A;  5GAO p;  1AEY A;  2JM8 A;  4R56 A;  1RAI B;  4JS4 A;  3OW2 A;  1M2V A;  2JM9 A;  5FU7 C;  2KI7 A;  3ULR B;  4N0A C;  1D09 B;  1YI2 Q;  1YJW T;  1G83 A;  2MIO A;  3S6W A;  3CCE Q;  5GAM e;  2LJ3 A;  1NYF A;  4HCK A;  1Y96 B;  2ZPF B;  1BI0 A;  1YCS B;  1U8R A;  1IZ6 A;  2E6Z A;  2O4X B;  2PUK B;  1VQM Q;  4PJN A;  2E70 A;  4M7A E;  3G7Z A;  2L2P A;  2PVO B;  3CCL A;  1TH7 A;  1ZBJ A;  1HK9 A;  4RTV A;  1E6G A;  3MKD A;  7AT1 B;  5GAN j;  1GFD A;  1BI2 A;  1ZUY A;  2L3Q A;  1M3B A;  4JZ4 A;  4VUB A;  5GAM f;  1VQN Q;  1Q95 G;  2E65 A;  3INZ A;  2PUO B;  2BZ8 A;  3E1S A;  5FLX E;  2RA2 A;  3CEY A;  2V8J A;  5KYW A;  1GRI A;  1QP2 A;  5D6X A;  1YWO A;  4E2F B;  2HL3 A;  5D7U A;  5GMK m;  2XKO C;  4BD3 A;  4XK8 E;  4LN2 A;  1YHQ A;  4M78 B;  5IH2 A;  5EG2 A;  4OB3 B;  1M1K R;  2XU8 A;  3H0H A;  1PWT A;  2JZ2 A;  4EMH A;  2QXF A;  4CC2 A;  3V8L A;  1YFN A;  3HHT B;  2CT3 A;  1KD1 C;  4M75 F;  1GL5 A;  2KAF A;  1QLY A;  2QA4 A;  4M78 G;  3TEE A;  4M75 A;  1Q7Y R;  2CUB A;  3G4S Q;  1QCF A;  4HA8 A;  3SHW A;  4AG2 C;  4M7D B;  3ER0 A;  4K11 A;  2J7I A;  3OYJ A;  5A2Q E;  1MMA A;  2EYZ A;  4XTZ A;  5CCA A;  3A8L B;  1IXD A;  1XJW B;  4LDX A;  1P92 A;  1LCK A;  2D8H A;  3M56 A;  2HQH A;  2BE9 B;  3H6Z A;  1X69 A;  2MYS A;  4OP0 A;  3CPF A;  2QEX T;  1VQ8 Q;  3OB9 A;  3C0C A;  4ZGD B;  4JLI A;  1I07 A;  2DO3 A;  3MP1 A;  3R6N A;  4OGE A;  4IUR A;  3G4S A;  3I5R A;  1OZ3 A;  1W4S A;  1ZUK A;  5HK3 A;  2LX9 A;  4QQ6 A;  2K5I A;  3GF5 A;  1UTI A;  4C92 F;  5FRN A;  3GIB A;  2E3H A;  3FJP A;  2LNV A;  5CAI A;  1TWB A;  3C4S A;  2DVE A;  4LUE A;  3P8D A;  3VUZ A;  1G3Y A;  4C0Z A;  3CCJ T;  3GNG A;  3L2Q A;  2CRE A;  4GBQ A;  5GAN 7;  3VU3 C;  2YRD A;  1M8M A;  4XU0 A;  2E6N A;  2K57 A;  3X26 B;  2DL5 A;  2CP2 A;  3L2V A;  3JCM J;  4J9B A;  3M0Q A;  2LDM A;  2O01 E;  4OF1 A;  4B9X A;  2QA4 T;  3RES A;  5GAO q;  5KYN A;  1ZSZ C;  4J5Y A;  3SD4 A;  4XU3 A;  1PG5 B;  1HSQ A;  1VQP A;  2ZPE B;  1KD1 U;  1D0Y A;  2QQA A;  2CS7 A;  1X6B A;  2CP0 A;  3OYD A;  3M55 A;  3MPU B;  3PMT A;  2QEX A;  2FL7 A;  2VXE A;  1QKW A;  1KG1 A;  4ELZ C;  2X4X A;  1YIT A;  5LL6 S;  3RDV A;  3PGG A;  4OMF B;  1VQL A;  2X3W D;  3QG1 A;  1UGP B;  3M4G A;  5LJ3 d;  3MEW A;  5KE3 A;  1UE9 A;  1VQ7 T;  3CCJ A;  1VQ5 A;  4M77 F;  1VQ6 T;  2O9V A;  2DNU A;  1WNL A;  2XK0 A;  2XD0 A;  3EAE A;  2JNG A;  1Q7Y U;  4E7I A;  2GFU A;  4JJB A;  2JS2 A;  1PNJ A;  1YI2 T;  1AZE A;  5D6Y A;  2QK0 A;  2LTO A;  4M78 D;  3D7S B;  3FIF A;  4NS5 A;  1UJ0 A;  4TVR A;  4MZT A;  4RTY A;  2DER A;  2VAS A;  2CGH A;  1IO6 A;  2D0Q B;  4M77 D;  1TS9 A;  2RO0 A;  4M7A A;  2ZPI B;  5I2S A;  4DBQ A;  1UFF A;  3L2W A;  3OMG A;  3OYG A;  3G6E A;  4M7A G;  1EX4 A;  3PIO A;  1JJ2 P;  4LXC A;  4BY6 B;  4ZTF A;  4EIK A;  2ENM A;  1WJR A;  4PFZ A;  4QVC A;  3G1J A;  1HYO A;  1KFZ A;  4WF2 A;  4NL3 A;  3VUB A;  2JVV A;  2D1X A;  3UPU A;  4M7A B;  3JB9 J;  2KDS A;  4PJO D;  4FSX A;  2MMP A;  1TXQ A;  1W6X A;  2EW3 A;  2F69 A;  2V1Q A;  2MK5 A;  2D6F A;  3FEO A;  4M7A D;  3I56 A;  2PU9 B;  3EGD A;  2K7A A;  2J6O A;  2OTJ T;  1YIT T;  1K73 C;  2YRC A;  1NYG A;  1Q81 R;  1DJ7 B;  3JCM d;  3CME Q;  1UDL A;  1M30 A;  2F5T X;  3MEV A;  1MMG A;  2CP3 A;  3MHX A;  3E9F A;  2QTV A;  1Y0M A;  5I22 A;  1VQ5 T;  3Q1J A;  3FDR A;  1B34 B;  1PHT A;  2FRW A;  2KRO A;  2WSE E;  2DRM A;  4C92 A;  3SEM A;  4C8Q A;  1NLP C;  2M02 A;  2HSP A;  3LWH A;  1KC8 C;  1ARK A;  5FWC A;  2E5Q A;  2LCS A;  1Q86 U;  3M53 A;  2DL7 A;  1YJ9 T;  4LE9 A;  3CCQ T;  1M8V A;  2FZK B;  2C06 A;  2P4R A;  4CC3 A;  4F7U F;  1M27 C;  2HKN A;  4F7U A;  2QEX Q;  1UUE A;  4C0F A;  3JCM X;  4E7Z A;  2RH2 A;  3OBW A;  3I55 Q;  3MP8 A;  1AWO A;  4OVA A;  4JLG A;  3TSW A;  3QWY A;  2JUF A;  4ORZ A;  2K2M A;  3BFM A;  3VS1 A;  4Z89 A;  1OPL A;  5LJ5 j;  5L23 A;  1NPP A;  5GAN e;  2DEU A;  2HAX A;  2OI3 A;  3REA B;  4QT7 A;  3HRT A;  2E5K A;  1MMD A;  3KBG A;  1KIK A;  1C1A A;  2KGT A;  1IRX A;  3CXC P;  2JTE A;  4JJD A;  3CCU A;  5GJW B;  4M75 E;  2KR3 A;  3NTH A;  2K3Y A;  2ZGW A;  2HNI A;  2E4H A;  1ZQ1 A;  1RAE B;  3GNF B;  4M7D C;  1NJI U;  3OSV A;  2K79 A;  4AFS C;  2K4Y A;  2RM4 A;  3RMS A;  3E19 A;  2F5K A;  3OYN A;  2QQR A;  1WI7 A;  4OMN A;  1VA7 A;  2OJ2 A;  5A0L A;  3T9N A;  4C8Q G;  3SB2 A;  2E41 A;  3LLR A;  1I5L A;  1UHC A;  1SPK A;  4BI4 A;  2DJZ A;  5CKF A;  1Y71 A;  1GBQ A;  1YHQ Q;  2A0F B;  3JCM Q;  2DAQ A;  3PVL A;  3CCQ A;  4ZNX A;  2BZX A;  4C8Q B;  1SF9 A;  3CD6 Q;  1W1F A;  2LJ0 A;  1FX7 A;  5LJ5 h;  4Y91 A;  4A4K A;  2A08 A;  2FO0 A;  1VQ9 Q;  2QYZ A;  1BI1 A;  2ROT A;  2RQT A;  3M58 A;  3WVE B;  1Y7X A;  2W0Z A;  1PC0 A;  4DBR A;  3C95 A;  1ZA2 B;  1K0S A;  4FYW B;  1OYX A;  2C0I A;  1U06 A;  2EPD A;  2EKH A;  4C0G A;  4R55 A;  3FJ5 A;  4KH1 B;  3VS7 A;  5LJ5 d;  4J9D A;  2P84 A;  2BE7 D;  3VYG A;  4B9W A;  4RTX A;  4M78 E;  2XI9 A;  4A4G A;  2OTL Q;  2LVM A;  4KRT A;  2DXU A;  1D0X A;  4LDW A;  1D1C A;  1TOV A;  8ATC B;  1Q81 C;  3QJY A;  2LX7 A;  1AWJ A;  3H41 A;  4O5V A;  2O4X A;  3CCR T;  3LX7 A;  3M0P A;  3VRZ A;  5EC7 A;  5GAN f;  1VQ4 Q;  4ATO A;  5KYY B;  2XIC A;  2GQI A;  2RK2 A;  5CKD A;  3HFN A;  1I1J A;  4RKU E;  1QCN A;  1S72 Q;  3CMA A;  1SHG A;  3NFC A;  2CSQ A;  3MO8 A;  4PJJ A;  2WSC E;  1ZHI A;  2KRN A;  1N8R R;  3QO3 A;  1RLP C;  4C0D B;  1BCM A;  2ROL A;  1U5S A;  2HEQ A;  1XOV A;  3QUI A;  1XNI A;  1EFN A;  5GMK j;  2X4J A;  5GAN 5;  1VQN A;  2FYK A;  1D3B B;  1KSW A;  4JRP A;  5GMK e;  2HZY A;  4QVD A;  3VKI A;  2EFI A;  4XTX A;  4C5G A;  4F16 A;  1YJ9 Q;  1IHW A;  2AZV A;  1D0Z A;  4AT1 B;  4RTZ A;  2DPP B;  3M57 A;  4LD6 A;  1AVZ C;  2X51 A;  3CPW S;  2R5A A;  3A98 A;  3MEU A;  1YIJ Q;  3OY9 A;  4C8Q D;  2OTJ A;  1ABQ A;  3L1A A;  1OV3 A;  2LQW A;  1FMV A;  1WXB A;  3V8J A;  1H3Z A;  2JN0 A;  1KK7 A;  2FPE A;  1ZLM A;  2JTM A;  3H8Z A;  2A37 A;  3EGD B;  3LGF A;  4DQ2 A;  5GAO n;  3GPL A;  4KT0 E;  1M90 C;  1WHG A;  1LVK A;  4HXJ A;  2QGG A;  4RTW A;  3HP9 A;  4MZM A;  2KXC A;  4E47 A;  2C0T A;  4KBM B;  3ASK A;  1Q81 U;  2XDP A;  3J80 E;  1PSE A;  2SEM A;  2BKD N;  3JAM E;  4PJO C;  1MV3 A;  1NE8 A;  4BAC A;  2DK3 A;  1KQ2 A;  2D0N A;  4OMP A;  2L3R A;  4HVV A;  2E64 A;  1IGQ A;  2QG9 B;  2ZZD A;  4OMQ A;  3JB9 I;  1YP5 A;  4FSS A;  4F7U G;  2KRS A;  1TSF A;  1WHM A;  1AD5 A;  4XAX B;  1VQK A;  5LJ3 j;  5CKE A;  2GFA A;  2AZS A;  2DD4 A;  2QTX A;  4X34 A;  1JJ2 A;  3PTA A;  2RI5 A;  2DF6 A;  4A53 A;  3QPH A;  4QVZ A;  4PLI A;  2DBK A;  5GAO m;  1PRM C;  2CYZ B;  4BUG A;  1QVF A;  4GY5 A;  5HY6 A;  1VQ8 A;  3EH1 A;  5LJ3 f;  2K3X A;  4J83 A;  4FYX B;  3PE0 A;  4JJC A;  3CCJ Q;  2EGE A;  3ME9 A;  8AT1 B;  5LJ3 g;  1Y57 A;  3BY7 A;  4RMO A;  1YJN A;  4FM4 B;  1T3L A;  3DB3 A;  2M0Y A;  3GBQ A;  3CCU T;  2DXC A;  5KYY A;  4M77 A;  3CCV Q;  2J6F A;  5DLO A;  4ZGE B;  3TU4 K;  3A8M B;  4QW2 A;  4LD9 K;  5LJ3 e;  4M78 A;  2ED0 A;  2A36 A;  1MGQ A;  4D8D A;  2V8I A;  1AHJ B;  4J9C A;  2RHZ A;  2ZPH B;  3JSC A;  1A0N B;  3V7C A;  2MWP A;  4PFP A;  4F04 B;  1EZZ B;  3C12 A;  4CRI A;  1KD1 R;  3GOX A;  3P8B B;  4C5I A;  1VQO Q;  5GAM g;  1V76 A;  1OEB A;  2LZ6 B;  3OMC A;  4FT4 A;  2L3P A;  2LT4 A;  2VVK A;  1B7T A;  3I55 A;  2Y90 A;  5KE2 A;  3M0R A;  4PK4 A;  2RJD A;  4QKU A;  3RKY A;  2EGC A;  4WCI A;  3L2U A;  4AFU C;  4A4E A;  3X20 B;  2FB7 A;  1VQ7 Q;  2EAY A;  2BTT A;  2CSI A;  4J7F A;  4J6X A;  2O9S A;  4N4I A;  2YHT A;  2DIQ A;  3CCM Q;  2DXT A;  2LCL A;  1UEB A;  4XU1 A;  1RI0 A;  3CCE A;  3PMI A;  4JRK A;  1Y96 A;  5KYX B;  1VQ4 T;  1X2K A;  2CZ6 B;  1E6H A;  1ZSG A;  3MEA A;  5J26 A;  1S72 T;  3CCS A;  3UDC A;  1M2V B;  1RAA B;  4HT8 A;  4Z88 A;  4KUD K;  2RNA A;  2QAZ A;  2DLP A;  2K6D A;  1N6A A;  2ED1 A;  4A63 B;  4M75 D;  1AT1 B;  4M77 B;  4XTV A;  1CSK A;  1GBR A;  3SWN A;  3M59 A;  2V8K A;  5A0G A;  1SEM A;  3VS5 A;  4OML A;  3M4Y A;  2COY A;  2A3L A;  4M77 G;  4M75 G;  2COW A;  4L59 A;  2E1H A;  3OSS C;  2EYY A;  2FHD A;  2YUQ A;  2KT8 A;  1X2Q A;  2QQS A;  1CKB A;  2OTL A;  2RN8 A;  1NJI R;  4CI0 C;  3JCM P;  2DTI A;  3CCE T;  1WJQ A;  1Q82 U;  2VC8 A;  3KUF A;  2ZPG B;  1WHL A;  2DVJ A;  3I56 Q;  2GF7 A;  1FWZ A;  3EHQ A;  3MET A;  3VS4 A;  3QJ6 A;  5GAN d;  3R6O A;  4LUD A;  1BBZ A;  1MV0 B;  3CC4 T;  1Q86 C;  5GAO r;  4PJO G;  2QQB A;  4IKF A;  2F1L A;  2IIM A;  5D6W A;  4J9F A;  3A8H B;  3S3M A;  2CZ0 B;  3DKM A;  2DYI A;  1RL2 A;  2NWM A;  1VQL Q;  3LYI A;  2L8D A;  4P5N A;  2AK5 A;  1VQN T;  3RR6 A;  3G6E Q;  4PJO B;  3QWX X;  1M90 R;  1RLQ C;  4J9G A;  3M0U A;  1VYT A;  1RAC B;  1NPR A;  4DA4 A;  1G2B A;  2F2X A;  2PZ1 A;  3MCA B;  2GGR A;  1UHF A;  3EGX B;  4FL6 A;  4L6V 5;  4JDS A;  5HKC A;  2DRK A;  3S3N A;  2YLB A;  4E7J A;  1XTD A;  5AYF A;  1Q86 R;  4BY6 C;  1YJN Q;  4BDY A;  1VQM A;  3LH0 A;  4EMK A;  4ESR A;  1WYX A;  4RG8 A;  1VQP Q;  1NLO C;  1OU9 A;  1V29 B;  4E7K A;  3PNW C;  1YJW A;  3RKX A;  2DIL A;  1VQ6 A;  2HL5 C;  2MPX C;  2RQW A;  1PKS A;  1UB4 A;  1BK2 A;  3OYY A;  3FLG A;  1WQ7 A;  4KGV B;  3NPF A;  3CC2 Q;  3CBM A;  4DEY A;  1J3T A;  2H3J A;  2R5M A;  5FU6 B;  4BE2 A;  3OYL A;  1WJS A;  4LDU A;  1GCP A;  1VQK Q;  2VGM A;  2JT4 A;  2K2V A;  2M51 A;  4X9D A;  3M5A A;  2FEI A;  4XTW A;  1JBM A;  4FYV B;  1JJ2 S;  1WGS A;  2DIG A;  3EG1 A;  4FT2 A;  2X9H A;  1QMC A;  3HRU A;  4MZP A;  1JXO A;  4EDU A;  3OW2 P;  2RJF A;  5IN1 A;  2HBW A;  2AHJ B;  2O88 A;  3GP8 A;  2KNB B;  2LC4 A;  4NL2 A;  5FRO A;  5IXF A;  3JCM W;  2DL4 A;  3CCR A;  1KQS S;  1QVG S;  1O9S A;  1VUB A;  2FPD A;  1M1G A;  4RCC A;  1ZUU A;  3OS5 A;  1JEG A;  1IGU A;  4HVU A;  4DOV A;  2PVD B;  1VQO T;  2DTO A;  1BIA A;  1F1B B;  2FZC B;  4ELY C;  3OYK A;  2VYT A;  5FU6 C;  2GQV A;  2YSQ A;  3CQT A;  3HSB A;  1JRI A;  4PJO A;  5GMK i;  1YNZ A;  1RAG B;  3U23 A;  4IIO A;  1MHN A;  1H92 A;  4A4F A;  3CC7 Q;  1YIJ A;  1HJD A;  1BB9 A;  3CCM T;  2L5Q A;  4JRQ A;  5GAN 4;  2GBQ A;  2DET A;  1UGV A;  2LMJ A;  4FW2 A;  3RER A;  1M9S A;  3TQ7 P;  2BUD A;  4RG2 A;  4DBF A;  2EQM A;  3TSZ A;  3S3O A;  5GJV B;  1PM3 A;  3QHS A;  2KYB A;  3V7S A;  4BI8 B;  1D3B A;  2LP5 A;  3EFS A;  3OA6 A;  3G71 T;  1LNX A;  1C6V X;  4M77 C;  3I5S A;  1K8A C;  4JZ3 A;  1OZ2 A;  4M75 C;  1G8X A;  2V1R A;  1PSF A;  2PTK A;  4OB1 B;  1QVG A;  2KVQ G;  1JXM A;  4M78 C;  4A4H A;  2EYW A;  1O75 A;  3V7R A;  4XQ3 A;  4C92 D;  3CXC S;  3RNJ A;  1VIE A;  3M54 A;  1OX9 A;  5CO7 A;  3FRN A;  2DTH A;  3OBY A;  4O6J A;  3SWN C;  2L3S A;  5KYU B;  2DXB A;  2FZG B;  1UGQ B;  4DBH A;  1SSF A;  3V8K A;  1YJ9 A;  1W2B A;  3X24 B;  3JB9 F;  3ZL7 C;  2L89 A;  1NJI C;  2P0K A;  5LJ5 e;  5DM7 R;  2CKK A;  3CC4 Q;  1SKU B;  3CME T;  1SSH A;  4N4H A;  5KYW B;  4LDY A;  3BDL A;  2CT4 A;  2NUP A;  2KYM A;  4CC4 B;  1KC8 R;  4AG1 C;  3G6E T;  2E12 A;  1VQM T;  4JS5 A;  1QP3 A;  5DLQ E;  3JCM g;  2JS0 A;  4BE1 A;  3CCS T;  1H3H A;  2HQE A;  4RTU A;  2HSE B;  5C6S A;  3EH2 A;  5GAM j;  4XTY A;  2LT1 A;  3OYB A;  4M4Z A;  5KH6 A;  5FWB A;  4AFQ C;  5IXB A;  1YI2 A;  3QSU A;  2WSF E;  2CH4 W;  3H0F A;  3M9Q A;  1NM7 A;  4OB0 B;  4ANJ A;  2HDA A;  2PNI A;  6AT1 B;  5GAO l;  2K3B A;  4F17 A;  2Z0W A;  1JU5 C;  3MJX A;  1WQW A;  3N5B B;  3JB9 G;  3CC2 T;  3HRS A;  3JCM c;  1K8A U;  1X6G A;  4C8Q E;  4AMC A;  1BYM A;  5IHN A;  3TCJ A;  4HCB A;  1I5O B;  1WHH A;  1YBY A;  9ATC B;  5GAN h;  1VQ4 A;  4J9H A;  3NTI A;  1FMK A;  5CVI A;  2EVR A;  4QQG A;  2NLU A;  2DMO A;  3JV3 A;  2LNH B;  3JB9 D;  3G4S T;  2YDL A;  3NGP A;  2CH4 A;  4F7U E;  2OAW A;  3NMZ C;  4R0K A;  2DFU A;  2LQK A;  1NZ9 A;  1K9M C;  4AFZ C;  3VRY A;  4GLK A;  2LQ8 A;  5IT9 E;  1T0J A;  4FYY B;  2OAU A;  3PT9 A;  2LRQ A;  2L0A A;  1WHJ A;  4PJL A;  2QAS A;  2ESW A;  3KFV A;  5ECA A;  2JW4 A;  3AT1 B;  2LJ1 A;  2ZPB B;  1OPK A;  2MCN A;  3LH5 A;  1GCQ A;  3O8V A;  3QBY A;  4FCY A;  2XDB A;  1R0B G;  4FU6 A;  2X4Y A;  2E10 A;  3EGX A;  3EG9 B;  2RHX A;  3VS2 A;  3RIR A;  4M7D F;  1WZO A;  4F14 A;  5LJ5 f;  2B8A A;  1QCO A;  2FVU A;  2QQ9 A;  2I2L A;  2EJF A;  3THK A;  4M77 E;  1QVP A;  1AWW A;  1RAH B;  4IUU A;  4C8Q F;  4Z8A A;  3UF4 A;  1M3A A;  1K9A A;  2GCX A;  2YUN A;  1YHQ T;  2AT1 B;  3CPW P;  3UA6 A;  3QZ9 B;  2DKG A;  2XG8 D;  2IVW A;  1FYN A;  1TTH B;  3OS2 A;  1D1B A;  1M1F A;  1VQ7 A;  1SRM A;  4HVW A;  5CKH A;  2KE9 A;  5CK9 A;  2EJ9 A;  3CC2 A;  3AHU A;  1BIB A;  1K1Z A;  4MMK A;  4E7S A;  1RAB B;  3EFR A;  1X6O A;  2G6F X;  1MNE A;  3UA7 A;  2GTJ A;  5GMK l;  3VS0 A;  3OYF A;  1UJY A;  3QDF A;  3CBO A;  2YRV A;  2EQI A;  4D6W A;  1NEB A;  3CD6 T;  2C0O A;  4PJO F;  3SWN B;  2F2V A;  4KUL A;  2X3X D;  3CBP A;  1FXX A;  3WVD B;  2YLC A;  4HT9 A;  1U3O A;  1WIE A;  2QA4 Q;  2NUT B;  1VQ9 T;  4OB2 B;  1VQ6 Q;  2I0N A;  1K9M U;  2KY9 A;  4M7D E;  3CCL Q;  2E3I A;  1ZA1 B;  3CPW A;  1CKA A;  2DM1 A;  3HFO A;  5KCH A;  2K5L A;  2KT1 A;  2EQK A;  1Y07 A;  2EQJ A;  4J9E A;  3X25 B;  1PD1 A;  2RJC A;  2CDT A;  2DE0 X;  2B86 A;  2O2O A;  3O5Z A;  3RUX A;  3E9G A;  5CQX A;  5M9O A;  1Q7Y C;  1WXT A;  3P8H A;  1IB8 A;  3QKJ A;  1GFC A;  2KMT A;  2ZCF B;  1JB0 E;  1PCX A;  2EYX A;  3HTR A;  4XU2 A;  4EMG A;  4PLL A;  4JJN K;  2EGA A;  2DL3 A;  1H64 1;  1N8R C;  1NG2 A;  4ZN1 A;  3JB9 H;  1B3Q A;  1NBE B;  1BI3 A;  2RHI A;  2JJ9 A;  1MUZ A;  1SHF A;  4C92 E;  2SRC A;  4EPC A;  4OMM A;  2EIF A;  1WXU A;  3I56 T;  2EBP A;  3FC3 A;  4NOY A;  4J9I A;  3CCV A;  1Q82 R;  2O31 A;  1AZG B;  4GLM A;  2F2W A;  4J8O A;  1C0M A;  3JCM b;  5C0M A;  1R8O B;  2NUT A;  4C92 C;  1UGR B;  3HL8 A;  3BDU A;  1S72 A;  4X9C A;  4MDX A;  3LGL A;  3CC4 A;  2CP6 A;  4M78 F;  4IUP A;  2J06 A;  2RQV A;  3OYM A;  3L42 A;  1M90 U;  1VQO A;  1JQQ A;  2XMF A;  3EG0 A;  2M9U A;  2OTJ Q;  2JXB A;  1T3S A;  4WTO B;  1YIT Q;  2CZ7 B;  1SG5 A;  2RQU A;  4RTT A;  1VQP T;  2QDY B;  2DZ9 A;  4JUV A;  2QDL A;  1QW1 A;  1AOJ A;  4RCB A;  4E7H A;  2VUB A;  1W70 A;  3J81 E;  1VQ5 Q;  1KJW A;  1KQ1 A;  2BIV A;  4DEX A;  3CCM A;  4BB7 A;  1TU0 B;  1KQS A;  2FPF A;  2NUP B;  1H8K A;  4HCC A;  1N5Z A;  2YUP A;  1X75 C;  3EG3 A;  2A7Y A;  1VOM A;  2JOY A;  1BU1 A;  5LJ5 g;  1MMN A;  4E6R A;  2RMO A;  3L2Z A;  2RK1 A;  3HKS A;  2YWW A;  1VQK T;  3DLM A;  3CC7 A;  3RMQ A;  4E7L A;  3QZ5 B;  4HKE A;  1UGS B;  1X43 A;  1WA7 A;  3EHR A;  4KUI A;  1TUG B;  4OMO A;  3JRZ A;  4F7U B;  2R58 A; 
#chains in the Genus database with same CATH homology
 2V8J A;  4OGC A;  3LX7 A;  4A4F A;  3I55 T;  1QP2 A;  1YIJ A;  3CCM T;  5D6X A;  5GAN f;  2L5Q A;  4MDW A;  4JRQ A;  2M16 A;  4ATO A;  5GAN 4;  2XIC A;  2RK2 A;  2Y4X A;  5FU7 B;  5CKD A;  3RER A;  3RKW A;  3HFN A;  1M9S A;  3CCV T;  2RD1 A;  4RKU E;  2BUD A;  3SFM A;  4RG2 A;  5GMK m;  2XDD A;  2EQM A;  2R57 A;  3S3O A;  1KC8 U;  3CMA A;  1OI1 A;  2XKO C;  1EIF A;  3NFC A;  4XK8 E;  4BD3 A;  4ZGJ B;  3QHS A;  3MO8 A;  2KQW A;  3V7S A;  2WSC E;  1ZHI A;  2HQX A;  2D9T A;  1D3B A;  4BI8 B;  3QO3 A;  1YHQ A;  3EFS A;  4M78 B;  4C0D B;  5EG2 A;  4OB3 B;  3OA6 A;  1LNX A;  3G71 T;  3SDZ A;  4M77 C;  3L2R A;  2XU8 A;  1XOV A;  3QUI A;  1K8A C;  2RI3 A;  1XNI A;  2G3R A;  1OZ2 A;  2RI2 A;  3ZFJ A;  4M75 C;  5GAN 3;  2JZ2 A;  4EMH A;  5GMK j;  2QXF A;  2X4J A;  3QXE B;  2FYK A;  2MF2 A;  3V8L A;  5GAN 5;  1PSF A;  1VQN A;  3HHT B;  4OB1 B;  5GAN 2;  1QVG A;  1D3B B;  1KD1 C;  2KVQ G;  4M75 F;  4M78 C;  4A4H A;  2KAF A;  4J6Y A;  2QA4 A;  4JRP A;  4M78 G;  3TEE A;  1O75 A;  3UWN A;  3V7R A;  5GMK e;  4XQ3 A;  4M75 A;  4C92 D;  5IAY A;  3CXC S;  4QQD A;  4QVD A;  1VIE A;  3M54 A;  4HA8 A;  3VKI A;  4M7D B;  2EFI A;  4XTX A;  5CO7 A;  2MAM A;  3ER0 A;  4C5G A;  3OYJ A;  5A2Q E;  3FRN A;  2DTH A;  2RB6 A;  3OBY A;  4O6J A;  4XTZ A;  1U1T A;  3SWN C;  5CCA A;  3A8L B;  4LDX A;  1P92 A;  2QI2 A;  3M56 A;  3LWI A;  2DPP B;  4Q5W A;  3H6Z A;  3M57 A;  4OP0 A;  5GAM h;  3CPF A;  2Y4Y A;  4JRI A;  1KHC A;  5GAM d;  4LD6 A;  2QEX T;  2DXB A;  3CPW S;  3OB9 A;  2R5A A;  3MEU A;  1UGQ B;  3DLL A;  1G3S A;  4C5H A;  3OY9 A;  4C8Q D;  3KXT A;  4ZGD B;  1SSF A;  3V8K A;  1YJ9 A;  1W2B A;  3X24 B;  2OTJ A;  3L1A A;  3JB9 F;  1H3Z A;  3V8J A;  4JLI A;  3TRE A;  1U1S A;  2JN0 A;  2DO3 A;  2L89 A;  1NJI C;  4UC4 A;  1M5Q 1;  1G5V A;  2P0K A;  5LJ5 e;  2JTM A;  3H8Z A;  3MP1 A;  4OGE A;  3LGF A;  4IUR A;  4LDV A;  4DQ2 A;  2CKK A;  5DM7 R;  5GAO n;  3G4S A;  2IG0 A;  4KT0 E;  1OZ3 A;  2XHC A;  2MI6 A;  1W4S A;  4PL6 A;  1M90 C;  5GMK h;  5HK3 A;  2LX9 A;  5FRM A;  2DZC A;  3C94 A;  2K5F A;  3HP9 A;  2K5I A;  4QQ6 A;  3JCM f;  4MZM A;  3CME T;  2EQU A;  3GF5 A;  4E47 A;  4N4H A;  4KBM B;  4C92 F;  4LDY A;  5FRN A;  3BDL A;  3GIB A;  3ASK A;  3FJP A;  2LNV A;  1Q81 U;  4M7D D;  5CAI A;  2XDP A;  1I81 A;  3J80 E;  1W2B S;  3C4S A;  1PSE A;  2DVE A;  2XID A;  3G6E T;  2E12 A;  4M7A C;  3P8D A;  1VQM T;  3VUZ A;  5GAN 8;  4JS5 A;  2BKD N;  1G3Y A;  3QYH B;  1QP3 A;  4C0Z A;  3JAM E;  4PJO C;  1NE8 A;  4BAC A;  3CCJ T;  5DLQ E;  3JCM g;  2DK3 A;  1KQ2 A;  3GNG A;  3J7A F;  3L2Q A;  3JCM V;  5GAN 7;  4BE1 A;  4HCZ A;  5I21 A;  3CCS T;  2L3R A;  3VU3 C;  4BDZ A;  2HQE A;  2E64 A;  5C6S A;  2ZZD A;  1I8F A;  5GAM j;  3JB9 I;  4XTY A;  2LT1 A;  5FLX E;  4XU0 A;  3OYB A;  2E6N A;  2K57 A;  3X26 B;  4F7U G;  5KH6 A;  3L2V A;  3JCM J;  1YI2 A;  4XAX B;  4C92 G;  4J6W A;  1VQK A;  3QSU A;  1S72 A;  5LJ3 j;  2LDM A;  2O01 E;  4J7I A;  4OF1 A;  5CKE A;  3RES A;  4B9X A;  5GAO q;  2X35 A;  2QA4 T;  2WSF E;  4J5Y A;  3M9Q A;  2GFA A;  4XU3 A;  3SD4 A;  4OB0 B;  2DD4 A;  2QTX A;  4X34 A;  3OS0 A;  1VQP A;  3PTA A;  5GAO l;  2RI5 A;  3OYA A;  1JJ2 A;  2RHU A;  2ZPE B;  4A53 A;  1KD1 U;  3QPH A;  4QVZ A;  4PLI A;  2QQA A;  4IUV A;  4ZN3 A;  2CS7 A;  1WQW A;  3N5B B;  1M4Z A;  5GAO m;  3OQ5 A;  4C92 B;  2CYZ B;  4BUG A;  3OYD A;  3JB9 G;  3CC2 T;  1QVF A;  3HRS A;  3M55 A;  3PMT A;  4GY5 A;  5HY6 A;  3JCM c;  1K8A U;  4YTL A;  1VQ8 A;  2OTL T;  4C8Q E;  2QEX A;  2FL7 A;  5LJ3 f;  5CQY A;  2VXE A;  1BYM A;  2K3X A;  1KG1 A;  4J83 A;  3GLX A;  3TCJ A;  4ELZ C;  2X4X A;  3MP6 A;  5LL6 S;  1YIT A;  4HCB A;  1WPY A;  1YBY A;  3PGG A;  1N8R U;  4OMF B;  1VQL A;  5GAN h;  3ME9 A;  4M75 B;  3QG1 A;  3NTI A;  1LOJ A;  1UGP B;  3BY7 A;  5LJ3 g;  1VQ4 A;  3M4G A;  5LJ3 d;  5CVI A;  4QQG A;  4RMO A;  1YJN A;  3MEW A;  4FM4 B;  2KSS A;  2NLU A;  5KE3 A;  3CMA T;  3DB3 A;  1VQ7 T;  3CCU T;  3JB9 D;  3G71 A;  2DXC A;  4M7A F;  3CCJ A;  1VQ5 A;  4M77 A;  3G4S T;  4M77 F;  3HPW A;  5J3B A;  1VQ6 T;  3A8G B;  5DLO A;  1WNL A;  2XK0 A;  4ZGE B;  3TU4 K;  2XD0 A;  3A8M B;  4F7U E;  4QW2 A;  3EAE A;  4LD9 K;  2JNG A;  2VGN A;  2LQK A;  4C5E A;  5LJ3 e;  1Q7Y U;  1M1K U;  4M78 A;  3BW1 A;  1NZ9 A;  3OYC A;  1MGQ A;  1K9M C;  4E7I A;  2GFU A;  2V8I A;  4GLK A;  2LQ8 A;  5IT9 E;  1AHJ B;  3ZEH A;  1YI2 T;  3OW2 S;  3QII A;  5D6Y A;  2RHZ A;  2LTO A;  2ZPH B;  4M78 D;  2OAU A;  3PT9 A;  3FIF A;  3JSC A;  4NS5 A;  2LRQ A;  1YIJ T;  4TVR A;  3V7C A;  2MWP A;  4MZT A;  4Z02 A;  2EWN A;  3CXC A;  1VQL T;  2CGH A;  2D0Q B;  4M77 D;  1I4K 1;  3C12 A;  4CRI A;  3GOX A;  2P0Q A;  2RO0 A;  2WAC A;  3P8B B;  4C5I A;  4M7A A;  2ZPB B;  5GAM g;  1GXI E;  2ZPI B;  3OMC A;  5I2S A;  5KCO A;  3OYI A;  3O8V A;  3QBY A;  4FT4 A;  2LT4 A;  5I2M A;  4FU6 A;  2X4Y A;  2E10 A;  3OMG A;  4A54 A;  3OYG A;  3I55 A;  3L2W A;  3G6E A;  2RHX A;  1VQ9 A;  2Y90 A;  4L5G A;  5KE2 A;  4M7A G;  3RIR A;  3ZBD A;  4M7D F;  3PIO A;  2RJD A;  3RKY A;  1KHI A;  3L2U A;  4BY6 B;  4A4E A;  4ZTF A;  3X20 B;  1N9R A;  2VXF A;  2FB7 A;  2EAY A;  5LJ5 f;  2B8A A;  2EJG A;  2X4W A;  4J7F A;  4J6X A;  1WJR A;  2FVU A;  2QQ9 A;  2I2L A;  4QVC A;  1YJN T;  2EJF A;  2EKO A;  4WF2 A;  4M77 E;  4NL3 A;  1QVP A;  3VUB A;  4N4I A;  2JVV A;  3UPU A;  2YHT A;  2DIQ A;  2KK4 A;  4M7A B;  4IUU A;  2KDS A;  4C8Q F;  4FSX A;  2MMP A;  3JCM e;  2F69 A;  3OYE A;  3JB9 J;  4PJO D;  2DXT A;  2LCL A;  2D6F A;  2GCX A;  1YHQ T;  1UEB A;  3FEO A;  1RI0 A;  4XU1 A;  3PMI A;  4JRK A;  3VYH B;  1Y96 A;  3CCE A;  4M7A D;  1VQ4 T;  3I56 A;  2PU9 B;  2CZ6 B;  2OTJ T;  1QVF S;  3QZ9 B;  4N0A A;  2DKG A;  1YIT T;  1K73 C;  2XG8 D;  4M7D G;  2IVW A;  1DJ7 B;  4II1 A;  4PKC C;  3MEA A;  5J26 A;  4MML A;  3JCM d;  3OS2 A;  4BE0 A;  1S72 T;  1M1F A;  2F5T X;  1VQ7 A;  3CCS A;  5CKH A;  3JCM h;  3X28 B;  3UDC A;  3PIP A;  3MEV A;  4HT8 A;  2M0O A;  3CC2 A;  5CK9 A;  2EJ9 A;  3MHX A;  1BIB A;  3E9F A;  2P4T A;  4MMK A;  3AHU A;  3CD6 A;  4KUD K;  1VQ5 T;  3Q1J A;  1N6A A;  3EFR A;  3FDR A;  1B34 B;  1X6O A;  4M75 D;  2WSE E;  4C92 A;  3QYG B;  4M77 B;  4XTV A;  5GMK l;  4C8Q A;  4C8Q C;  4FIB A;  3FB9 A;  3OYF A;  3SWN A;  3M59 A;  2V8K A;  3CBO A;  2YRV A;  5A0G A;  3LWH A;  4D6W A;  1KC8 C;  3CD6 T;  3VJP A;  4PJO F;  2RHY A;  3SWN B;  2CZ1 B;  3A5Z B;  4KUL A;  3CBP A;  3M4Y A;  2E5Q A;  1FXX A;  1Q86 U;  2A3L A;  3QDR B;  3WVD B;  3M53 A;  2YLC A;  4M77 G;  1YJ9 T;  4HT9 A;  1M8V A;  3CCQ T;  4M75 G;  4L59 A;  2C06 A;  2E1H A;  3OSS C;  4ZTJ A;  1B34 A;  2FHD A;  1VQ9 T;  4F7U F;  2QQS A;  4C0D C;  1VQ8 T;  2OTL A;  4OB2 B;  1VIF A;  4CI0 C;  4BI3 A;  4PNO A;  4F7U A;  3JCM P;  2DTI A;  3CCE T;  1WJQ A;  1Q82 U;  2VC8 A;  4C0F A;  2KY9 A;  1K9M U;  3JCM X;  4M7D E;  3KUF A;  2RH2 A;  3OBW A;  3CPW A;  2ZPG B;  3HFO A;  5KCH A;  2DEQ A;  3MP8 A;  3CC7 T;  4V2S A;  4OVA A;  2GF7 A;  4JLG A;  1FWZ A;  3MET A;  5LJ3 h;  2K5L A;  5GAN g;  4IUT A;  3QJ6 A;  5GAN d;  2RJE A;  4Y28 E;  1XQH A;  2EQK A;  1Y07 A;  2JUF A;  2EQJ A;  3R6O A;  3PFS A;  3CC4 T;  3UT1 A;  1Q86 C;  3NTK A;  1YCY A;  2MWO A;  4PJO G;  3BFM A;  3X25 B;  5GAO r;  3OS1 A;  5J39 A;  5LJ5 j;  2QQB A;  5CKB A;  4IKF A;  2RJC A;  1N27 A;  2M1H A;  5D6W A;  2EYQ A;  1N9S A;  3A8H B;  3S3M A;  5A0D A;  1NPP A;  5GAN e;  2CZ0 B;  3DKM A;  3E9G A;  3RUX A;  5CQX A;  2HAX A;  1RL2 A;  3LYI A;  2L8D A;  3HRT A;  4IUQ A;  4P5N A;  5M9O A;  3KBG A;  1Q7Y C;  1VQN T;  5L8R E;  4PJO B;  2JTF A;  1IRE B;  3P8H A;  3VV0 A;  3QKJ A;  2HBP A;  5CIU A;  1NPR A;  3CCU A;  4DA4 A;  1ZBX A;  2KMT A;  2ZCF B;  1JB0 E;  3MCA B;  2PVG B;  3CME A;  1Q82 C;  4FL6 A;  4L6V 5;  4EMK C;  4M75 E;  4XU2 A;  3NTH A;  4JDS A;  4EMG A;  5HKC A;  2LCC A;  3S3N A;  1M1K C;  4PLL A;  3LW5 E;  4JJN K;  2YLB A;  4E7J A;  1XTD A;  2K3Y A;  5AYF A;  1H64 1;  1N8R C;  4ZN1 A;  3JB9 H;  4BY6 C;  4DOW A;  1K73 U;  2ZGW A;  2RHI A;  1BI3 A;  4ME7 A;  4BDY A;  2HNI A;  3LH0 A;  4EMK A;  1VQM A;  5DY9 A;  1HXD A;  4RG8 A;  4C92 E;  3CCL T;  4EPC A;  1ZQ1 A;  1V29 B;  4E7K A;  3PNW C;  2EIF A;  3DB4 A;  1YJW A;  3RKX A;  3GNF B;  4M7D C;  3I56 T;  4M7D A;  3FC3 A;  4NOY A;  2XDB A;  1NJI U;  1VQ6 A;  3CCV A;  3OSV A;  1G3W A;  1UB4 A;  5HK0 A;  3OYH A;  2DD5 A;  2K4Y A;  2RM4 A;  3F70 A;  3OYY A;  3URG A;  3RMS A;  1LJO A;  3E19 A;  3FLG A;  1WQ7 A;  2F5K A;  4J8O A;  3OYN A;  3JCM b;  2PQW A;  2QQR A;  3CBM A;  1X01 A;  5C0M A;  1R8O B;  1BKB A;  4C92 C;  5A0L A;  3T9N A;  4C8Q G;  1UGR B;  2H3J A;  2R5M A;  3BDU A;  3HL8 A;  4X9C A;  2E41 A;  2HD0 A;  3LLR A;  5FU6 B;  3GPL A;  4BE2 A;  3OYL A;  1WJS A;  4LDU A;  4BI4 A;  1I5L A;  4MDX A;  5GAN 6;  2DJZ A;  3LGL A;  5CKF A;  3CC4 A;  2VGM A;  1Y71 A;  2K2V A;  4M78 F;  4X9D A;  4IUP A;  3M5A A;  4XTW A;  1JBM A;  2VV5 A;  3OYM A;  1WGS A;  3L42 A;  1JJ2 S;  3JCM Q;  2DIG A;  4FT2 A;  2DAQ A;  3CCQ A;  1M90 U;  1VQO A;  5CR2 A;  4C8Q B;  2M9U A;  3HRU A;  4MZP A;  3A8O B;  4EDU A;  4EMK B;  3WXM B;  4XTU A;  2P0P A;  2CZ7 B;  2RJF A;  1FX7 A;  5IN1 A;  1VQP T;  4PJO E;  5LJ5 h;  4N4G A;  4Y91 A;  1G3T A;  2AHJ B;  5GAO p;  2QDY B;  4A4K A;  4R56 A;  2DZ9 A;  4JUV A;  4JS4 A;  1QW1 A;  3GP8 A;  3OW2 A;  2LC4 A;  4RCB A;  4E7H A;  4NL2 A;  2VUB A;  5FU7 C;  4N0A C;  3J81 E;  5FRO A;  3JCM W;  1YJW T;  1BI1 A;  3CCR A;  1KQ1 A;  3S6W A;  1KQS S;  3M58 A;  3WVE B;  1QVG S;  5GAM e;  2BIV A;  1Y7X A;  3CCM A;  1O9S A;  1VUB A;  3C95 A;  4BB7 A;  1KQS A;  1M1G A;  4RCC A;  1OYX A;  1Y96 B;  2ZPF B;  1BI0 A;  3OS5 A;  4HCC A;  4C0G A;  4R55 A;  1X75 C;  2A7Y A;  1U8R A;  2JOY A;  4DOV A;  1IZ6 A;  2PVD B;  5LJ5 g;  2E6Z A;  1VQO T;  5LJ5 d;  2O4X B;  2PUK B;  2DTO A;  1BIA A;  3L2Z A;  4ELY C;  3OYK A;  2E70 A;  2RK1 A;  3SB2 A;  2VYT A;  3HKS A;  5FU6 C;  2GQV A;  3G7Z A;  1VQK T;  4M7A E;  2PVO B;  3DLM A;  3VYG A;  4B9W A;  3CCL A;  1TH7 A;  3CC7 A;  3RMQ A;  4E7L A;  1HK9 A;  5GAN j;  3QZ5 B;  4HKE A;  1UGS B;  4M78 E;  1BI2 A;  2XI9 A;  4A4G A;  2LVM A;  3HSB A;  1JRI A;  2DXU A;  4VUB A;  5GAM f;  5GMK i;  4PJO A;  4KUI A;  4LDW A;  2E65 A;  1Q81 C;  3INZ A;  3QJY A;  3JRZ A;  2PUO B;  3E1S A;  2R58 A;  4O5V A;  1MHN A;  2O4X A;  4F7U B;  2RA2 A;  3CCR T;  3CEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...