4M7AC

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aC00
4N0AC 4C92F 3EFRA 4M78F 4A54A 2YHTA 5GMKh 3V7SA 3JCMe 4C8QD 5GAOn 3QUIA 4PJOA 5GAOr 3GIBA 5DY9A 4M7AB 4C92D 4C8QE 5GANe 4J6WA 5GAMj 4C92E 1I5LA 4F7UF 4M78D 2DZ9A 4C8QG 3JCMJ 4N0AA 4M78E 4C92G 4M7AC 1I81A 2VXFA 3JCMh 1D3BB 5LJ3f 4HT9A 3JCMQ 4M78G 2E10A 3BDUA 5GAOl 2RD1A 3V8LA 5GAMe 2DZCA 4F7UE 1BIAA 2RM4A 3V8KA 2DXTA 2EWNA 3V7RA 5GAN5 1LJOA 3V7CA 4F7UG 4DQ2A 1B34A 2EJ9A 4PJOF 4J5YA 4M75A 5LJ5f 2DXUA 3JCMX 5GAOm 4M7DB 1M8VA 5GAN8 3FB9A 2DEQA 4JLIA 4M77E 5LJ3j 3RERA 3BFMA 4M7DC 1H641 4PJOD 1WQWA 4QVCA 3JCMd 1X01A 1U1SA 1BIBA 2DTOA 4XTWA 4PJOG 4X9CA 5GMKl 5LJ5j 5GANd 5GMKi 1Y96B 5GAN2 1JBMA 1HXDA 5LJ3e 3JB9H 1JRIA 4PNOA 4JUVA 4M77B 4M75F 4NOYA 3JCMW 2ZGWA 4V2SA 2CGHA 2YLCA 4NL2A 4WF2A 5GAN4 4XTXA 5GMKm 3JCMg 4JRIA 3JB9F 4XU0A 2DKGA 4EMKB 5LJ5e 4M75D 5GAMd 5LJ3h 1LOJA 2QTXA 5GANg 3JB9J 4M75E 4XU2A 5GAOq 3JB9D 4C8QB 4EMKC 4XQ3A 3AHUA 4M75G 2DVEA 2RA2A 4C92B 4M7AA 3RKWA 5I21A 3JB9G 4M78B 2VXEA 2I2LA 3QO3A 4HA8A 4Y91A 4C8QC 5LJ5h 4J6YA 4C92C 5GAMg 3RKYA 1D3BA 3FIFA 4M78C 3JCMV 4F7UB 4PJOE 3SWNB 4A53A 3RESA 2EJGA 1M5Q1 3JCMb 3RIRA 3PGGA 4RCBA 5LJ3d 4J6XA 3QSUA 3SWNC 4EMHA 1WPYA 4XU1A 4M7DA 2K57A 4XU3A 3HFNA 4M7AF 3M4GA 1KQ1A 4X9DA 4MMKA 1KQ2A 4HT8A 5LJ5d 4M77C 2YLBA 1I8FA 2E41A 3L2ZA 5GAOp 2E65A 5LJ3g 4M7AD 3SWNA 4M7AE 1I4K1 3QHSA 4C8QF 4XTVA 2FYKA 3JCMP 4M7AG 2EAYA 2HNIA 4QVDA 2FB7A 1Y96A 1YCYA 4JRKA 2JN0A 4RCCA 4M77A 1HK9A 1U1TA 5LJ5g 3RUXA 3VU3C 4M7DF 2E64A 4EMGA 3FJPA 3INZA 1WQ7A 3RKXA 2VC8A 1WNLA 2DTHA 3L1AA 1B34B 2E1HA 4EMKA 4M75B 4M7DD 4MMLA 3SB2A 5GAN7 5GAN3 4M7DE 3EFSA 2DJZA 3JCMf 4C8QA 4M75C 4NL3A 4M7DG 5GMKj 4C92A 3HFOA 5GANf 1N9RA 4M78A 4OP0A 1TH7A 5GANh 3BW1A 4M77F 4XTYA 5GAN6 3JB9I 4XTUA 1MGQA 2EJFA 5CAIA 3HSBA 4PJOB 2RB6A 3V8JA 4F7UA 2Y90A 5GMKe 1LNXA 4M77D 1N9SA 5GAMf 4PJOC 3BY7A 3JCMc 5GANj 5GAMh 4XTZA 2DTIA 4M77G
chains in the Genus database with same CATH superfamily
4HCCA 2HL3A 2VUBA 3H8ZA 2MWPA 3QPHA 1F1BB 2MOXA 1I5LA 3H0IA 1N8RU 5HK0A 2LCCA 3FEOA 5KYNA 4CRIA 1I81A 2GFAA 1NYFA 1YJWQ 2B8AA 2IIMA 4OMLA 3V7CA 2NUPB 1LVKA 2FEIA 3CC7A 4M77E 4JS5A 1PD0A 2AKKA 1TU0B 1X27A 1VYUA 5D6YA 4XTWA 4PJOG 2A0FB 2DBKA 3VUBA 5A0DA 1OPKA 2ENMA 4M77B 2XDBA 1M3CA 3JB9F 1M1FA 2YRCA 3I5RA 3AT1B 2JMCA 2RQVA 2JS0A 3JB9D 2X4JA 2FZKB 2RA2A 4LXCA 4NS5A 4M7AA 2CT3A 3CCSQ 2K2MA 4LDWA 2QQSA 4PK4A 1UJ0A 1P92A 1ZHIA 1MV3A 4RTUA 4PJOE 4DBRA 2EJGA 3BE3A 7AT1B 3CCQQ 1M27C 2ED0A 4E7SA 1YI2T 4BDZA 4HVWA 1WI7A 1KQ2A 2LNHB 2V8IA 2PVDB 4R55A 1VQLT 4PLLA 3EG3A 2EPDA 2J6OA 1VQ7A 3CCRT 1VQ8Q 1D1BA 2EFIA 1B07A 1K1ZA 2X3XD 2XK0A 1QCFA 3OYBA 5GAN7 3VS4A 2ZPBB 3JCMf 1VQOT 3CC2A 1YHQQ 4D8DA 4A4HA 4M75C 3LYIA 3OMCA 4PJNA 3CCVQ 1XNIA 3T9NA 2K5IA 3REAB 2CT4A 2LJ3A 2L3PA 4P5NA 2GQVA 1LNXA 1U06A 1XJWB 2LCLA 2DX1A 2COZA 4PFPA 1MNEA 1QP3A 4PLIA 1N8RC 1JO8A 3QUIA 2WSEE 2RO0A 1NE8A 3OYGA 1Q81C 1Y0MA 2LRQA 3CCUA 1R0CB 5GAMe 3X26B 2K3YA 5LJ5f 3JCMX 5D6XA 4IURA 3OW2P 4C5GA 4JDSA 2LTOA 3MHXA 1HJDA 4D8KA 3QBYA 1PSEA 4KRTA 5DLQE 1WJRA 3OYLA 1AVZC 1KC8U 1HXDA 5LJ3e 3I56Q 3JB9H 1TTHB 4M75F 1ZA2B 1X2QA 2DKGA 2OJ2A 4M75D 1QVGP 1AT1B 3AHUA 3RKWA 2W10A 1D3BA 3JCMV 3A8HB 1SSFA 4J9IA 1WPYA 3RBBB 3NFCA 1KG1A 4E7JA 2KEAA 3VYGA 2YLBA 4GBQA 5IXFA 4HCKA 4RG8A 2OTJQ 1RACB 2ZCFB 2K5LA 1OX8A 1WGSA 5FWBA 1YJ9A 2L2PA 3OBWA 2CP7A 3ASKA 3EFSA 9ATCB 2RMOA 4KH1B 1PCXA 1W70A 4M7DG 4M78A 3VS1A 2MPXC 3DLMA 4Q5WA 4F7UA 1IB8A 2L3RA 1SKUB 1BCMA 4AG1C 5I11A 2ED1A 2RJFA 2YHTA 3V7SA 1W2BS 3GBQA 3G6ET 5GAMj 2P84A 1D0XA 2D1XA 2KRMA 3JCMJ 4C92G 3QXEB 3JCMh 4RTTA 4UC4A 1N27A 3QZ5B 3V8KA 5I2SA 3IQLA 2K4YA 2ROLA 3CEYA 1AEYA 4M7DB 3P8DA 3FB9A 5LJ3j 1WHHA 5HK3A 2E3HA 3EH1A 1QKWA 5DLOA 2HBPA 4RMOA 2DNUA 1Y96B 3A5ZB 4ZTJA 5CKFA 1OV3A 2HMAA 4ATOA 3CCLT 2QQ9A 1K9MU 3CD6Q 1WFWA 2HL5C 3GOXA 2EGEA 4LUEA 5HY6A 1I07A 3EG9B 2RJCA 4M75E 1SG5A 4C92B 2DIQA 4Y91A 5LJ5h 2O01E 4A4FA 3FIFA 4J8OA 4J83A 2F5TX 2DXBA 2EYQA 3EG9A 3VS2A 3OB9A 2BE7D 2HZYA 3OYMA 2EYWA 5J39A 1GRIA 2HQXA 2LDMA 3EGDA 4FYVB 1K8AU 4JRQA 2QQAA 2PQWA 2XIDA 2M51A 1KD1R 4FT2A 3CXCS 3S6WA 4C0FA 3L2UA 2C0TA 2C0OA 2JNGA 3I35A 4LDVA 2EJFA 2A3LA 3PVLA 1H92A 3C12A 2DXCA 5HCKA 1GL5A 4HVVA 3LGFA 1KQSS 2NUZA 1G83A 2DL3A 3G4SA 1OI1A 5IAYA 3DB4A 2K2VA 1QCNA 4KULA 3KBGA 1RI9A 2DYIA 1AWWA 2EWNA 3A8OB 4KUIA 3GF5A 5A2QE 2FL7A 4JLIA 3NTHA 2EQUA 1G3SA 2E12A 5KYWA 1ARKA 3RMQA 2NLUA 3PMTA 4RG2A 5I22A 4LDXA 1VUBA 3X28B 1QVFS 1QP2A 4ZGDB 1K9MC 3D7SB 2EVRA 4NOYA 2QEXA 2J6FA 4AFZC 4WF2A 2L8DA 2KK4A 3OS2A 3CMAA 2YUNA 3OSVA 1RAHB 2QTVA 3M9QA 2GQIA 4J9GA 3CCEQ 2LQNA 4N4HA 2RPNA 2DILA 1TWBA 1RLQC 3OMGA 3OYIA 3HFNA 2OX7A 1YJWA 1K8AC 3L2ZA 5GAOp 1LPLA 1YJNQ 2J7IA 1Q95G 3GNFB 2I0NA 2E6ZA 4XTVA 2KT8A 4DA4A 2EAYA 2QI2A 3Q1JA 2RI2A 4C0GA 2EGAA 3UPUA 1TS9A 2F2WA 2E1HA 3G71Q 1VQ6T 2GCXA 2FRWA 4C8QA 3M0TA 5KH6A 3NMZC 4E7ZA 1B7TA 1VQ4T 4FSSA 2KGTA 1GCQA 5GANh 2QDLA 5CAIA 3L2WA 4DBFA 1YIJQ 1JJ2S 1VQPT 3OQ5A 2JVVA 3CCSA 1H3ZA 5C0MA 5IHKA 2DL5A 2C0IA 2L5QA 4L6V5 3R6OA 4FW1A 1WX6A 4BD3A 3OYNA 1FWZA 1VQ4A 1VQ8T 3A8GB 3J7AF 3CCQA 4M7AC 4HT9A 4II1A 1LCKA 1VQ5T 1UTIA 3BDLA 4Z88A 1JXMA 1KFZA 1N8RR 5IT9E 4J5YA 2QXFA 1YITQ 2CS7A 2YUQA 1UUEA 1X01A 1VQ8A 1V1CA 4OVAA 1YN8A 2BZYA 2XMFA 1JRIA 1SEMA 3SD4A 4F17A 1YHQA 2ZGWA 4XTXA 1VQ5A 1PHTA 1VQNQ 3CCVA 1VQ9T 2QTXA 2ZZDA 3A98A 1PG5B 1D0YA 4KBMB 2I2LA 2K3XA 3CCJT 1I1JA 4A53A 1G5VA 2Y4XA 3C95A 1VQKT 2DMOA 2DFUA 3I55T 4QW2A 3TSZA 4M7AF 3M4GA 5IXBA 4HT8A 4M7AD 4JS4A 3JCMP 1NJIU 3TREA 4QVDA 3LW5E 4C0DB 3EHRA 3CCMQ 5CKBA 3VRYA 2EYZA 2IG0A 3VU3C 1GFCA 4MDWA 3J80E 3H41A 3I56A 1PKTA 3E1SA 4J7IA 1N5ZA 5CVIA 4LN2A 3VRZA 1ZSZA 2JOYA 3M4YA 3REBB 1UGSB 3QKJA 3EAEA 3PIPA 4PJLA 2FZCB 3QDFA 2K9GA 2PTKA 3HL8A 4XTZA 1W4SA 4MZMA 5FROA 1TG0A 5IHNA 4J9BA 2LQWA 4LE9A 4LDUA 4Z8AA 5CKDA 1XQHA 2VB6A 3FDRA 3FC3A 1IREB 4F14A 3P8HA 2DXTA 1GBQA 2EJ9A 2OTJA 2LX9A 2DEQA 3VYHB 3RERA 3PT9A 2FVUA 1H641 3OYJA 3URGA 1CKAA 4K11A 2CP6A 3JCMd 3CC7T 1V29B 1U1SA 2MAMA 2QASA 2LNVA 3GLXA 3GPLA 1M3BA 4KGVB 5D6WA 5IH2A 5ECAA 5GMKi 4KUDK 1M8MA 2KROA 1Q82U 3M53A 2YLCA 1HSQA 3RDVA 1BI2A 2K7AA 4JRIA 4ZGJB 4X34A 1WHMA 4KH0B 4RTZA 4EMKB 1U5SA 5GANg 1Q81U 3E2UA 1ZUUA 1KC8R 1M1GA 5GAOq 4IIOA 2A7YA 4LNPA 4J6YA 3MP6A 4BI8B 2DL8A 4M78C 3EFOB 4J7FA 3P8BB 2ABLA 4JPBW 3TSWA 2NUPA 1SRMA 2OAWA 3OS1A 2DF6A 1YWPA 1NYGA 2NWMA 1M2VB 5LJ5d 1D1AA 3UA6A 1I8FA 1QW1A 4DBQA 1NJIC 2OTLQ 4M7AE 1S72T 3VUZA 1YCYA 4JRKA 4N4IA 4M77A 1U1TA 2LC4A 2LCSA 1Q7YU 3MO8A 5CIUA 3RKXA 4XAXB 3N5BB 1WNLA 3L1AA 1VQ7T 4YTLA 4OGEA 4AFQC 4Z02A 4VUBA 4FW2A 1X43A 1AD5A 3VV0A 1ZQ1A 3CC2T 1S72A 3HSBA 4PJOB 1AOJA 4PL6A 3V8JA 4C0ZA 4RUGA 1KK7A 1UG1A 3X25B 4J9CA 1BYMA 4M78F 4KT0E 3VKIA 1WHKA 4PJOA 4HKEA 5FRNA 4F7UF 4M78D 2CP5A 2E6NA 1VQMQ 3HTRA 1I0CA 1FMWA 5GAOl 1PSFA 2X4YA 2ESWA 2HCKA 4DQ2A 2J06A 2G3RA 3CCUT 1M8VA 4BE0A 3VS6A 2QQRA 3L42A 2X9HA 4CC3A 4FYXB 4JRPA 2KE9A 1Q82C 1OULA 4PNOA 2XU8A 4DEXA 1TOVA 1W2BA 2QA4Q 4RTYA 2GFUA 1TUCA 3NPFA 1K9MR 3JB9G 3LH5A 1UHCA 3WVDB 1MUZA 3CC4Q 1UGRB 1OZ2A 1UECA 3QYGB 3PGGA 4JJBA 3VJPA 5CK9A 2X51A 3M59A 1K73C 4EMHA 1W1FA 3VS0A 2PU9B 1IRXA 2KAFA 2KRNA 2RQTA 2PVGB 3S3MA 4ORZA 4BI4A 1Q7YC 2HKNA 2V26A 3E9FA 4FU6A 2ZPGB 1GFDA 1NBEB 3FJPA 2VC8A 1YJ9T 2CZ7B 3HFOA 3QIIA 1TH7A 1X6BA 4CC2A 5J3BA 2EKHA 5J26A 2DIGA 1Y7XA 1UEBA 4E2FB 2M0YA 3JCMc 5GAMh 2RF0A 1EFNA 4N0AC 3EG1A 2DVJA 5GMKh 3JCMe 3CCEA 1EIFA 5GAOn 3CXCA 3CMEQ 4B6MA 2JTEA 2A08A 5DM7R 4BACA 2M16A 1V76A 2XD0A 2RHIA 2VGNA 4M78E 3ME9A 1PC0A 1BCOA 2EYYA 2JS2A 2AZVA 3JAME 4F7UE 2D0NA 1C1AA 3M57A 1YJNA 4JJDA 5GAOm 4JLGA 3E19A 1AWOA 1YNZA 1G3TA 1WQWA 2EQIA 4C5HA 1BIBA 1KQSA 3FLGA 4X9CA 1HD3A 3G71A 2RHYA 1BI3A 2MIOA 4R0KA 3PE0A 3ULRB 4E47A 5LJ5e 4FYWB 5GJVB 3GNGA 1YIJA 1NEBA 3A8LB 4M75G 2CKKA 1Y71A 4OMNA 1ZA1B 5I21A 1WHGA 3LWHA 4C8QC 3H0FA 4GLMA 2JT4A 4LUDA 1BU1A 3QYHB 3SWNC 4M7DA 1G8XA 1QVFA 4R56A 1RI0A 2DETA 4JJCA 1MMAA 2KT1A 3C0CA 3U23A 4QQGA 3QHSA 2JXBA 2CH4W 1Y96A 2DEUA 1I5OB 4RCCA 1YITA 1YP5A 2JJ9A 4RKUE 3VS7A 3I9QA 1B34B 2D0QB 4M75B 4C92A 2HQEA 5GANf 3M54A 3ZL7C 1S1NA 1VQNA 2KVQG 4PKCC 2KYBA 3A1PA 1RABB 4C8QF 1YI2Q 1G2BA 3M0RA 2ZAEA 2HD0A 4C8QD 2RHZA 3GIBA 4Y92A 3G4ST 1M30A 1QKXA 1RAEB 2VXFA 1VQLQ 2E10A 3BDUA 4OMMA 2K5FA 2RD1A 1Q86U 1W2BP 4LD9K 2LT1A 3LH0A 3CCRQ 3V7RA 3GP8A 5AYFA 2RJEA 5A0LA 1BBZA 4DBHA 5GAN8 3M0PA 3CCMA 3H9NA 1JJ2A 1VQOQ 4LD6A 2CP2A 1KSWA 1ZSGA 2KXCA 1D09B 2EIFA 5LJ5j 3SDZA 1IGQA 2D8HA 3KXTA 1MV0B 2F2VA 2QEXT 2DD5A 1HYOA 1KHIA 1SF9A 3C94A 1VIFA 4IKFA 1Y57A 3DKMA 2VXEA 3EG0A 5GAMg 1ZSZC 3CMAT 3MPUB 1D0ZA 3JCMb 1AZGB 4O6JA 3RIRA 1IZ6A 3SHWA 1M90U 1UGPB 5I2MA 4O5VA 2DD4A 2FHDA 4OB3B 1M2OA 1AWJA 2XG8D 3CBOA 2AKLA 5LJ3g 2M02A 2LQKA 4IUUA 1YJWT 2DERA 1RLPC 2DK3A 1JEGA 4XK8E 2V8KA 2QG9B 1ABQA 1X69A 2DM1A 3EGXB 1EZZB 2HDAA 3MEAA 2LMJA 3DB3A 4J9FA 5FU6C 5C6SA 3CXCP 1RAIB 1MMNA 4QQ6A 1YBYA 4C5EA 3EGXA 2LP5A 2GBQA 1C6VX 4E6RA 3OYCA 1N6AA 1N9SA 1K0SA 3NTIA 4A4GA 3SEMA 3TCJA 1NPPA 2X3WD 4ELYC 3CCST 3M0UA 2JUFA 3MJXA 4C8QE 5KE2A 1KQSP 2COYA 4ZGEB 1Q86C 5FWCA 3CCQT 2W0ZA 1BIAA 5CKHA 5GJWB 4FCYA 4EPCA 3CPWS 2DLPA 3BFMA 4GLKA 2V8JA 2X4XA 2VASA 4ANJA 5GAN2 2PUKB 5FU7C 3JCMW 1KIKA 2V1RA 3QJYA 1OX9A 2LT4A 4ZN3A 3TU4K 1YHQT 4J9DA 1QVFP 2M1HA 4XQ3A 3CCVT 2DVEA 3G6EQ 4CC4B 2H3JA 2RJDA 4AG2C 2K3BA 2NUTB 3OA6A 1Q81R 4J9EA 5HKCA 3L2VA 2YT6A 4BI3A 1X6OA 2DAQA 1D1CA 1UGVA 4RCBA 1M90C 2FRYA 4X1VA 4F16A 5KYUB 3PMIA 1VQMA 2O4XB 1PM3A 1FX7A 2R5AA 4A4KA 2AHJB 5M9OA 2FB7A 5CO7A 2P4TA 3UDCA 1HK9A 1K0XA 4QQDA 4GY5A 3INZA 2J6KA 3CCLQ 3HRTA 3PTAA 3L2QA 4OF1A 4PFOA 2X4WA 4NL3A 1Q7YR 2QA4A 2KRSA 4M77F 2KSSA 5GAN6 3I56T 1U8RA 2O9SA 4M77D 3ZEHA 4OB1B 2KI7A 4ELZC 3X24B 5CQYA 1JU5C 3CC4A 5KYYB 1JJ2P 1VOMA 4J6WA 1X6GA 2P0QA 2A28A 2VWFA 2HKQB 3JCMQ 2VV5A 2DA9A 1K4US 2LJ0A 4PJOF 3M56A 1PWTA 2L89A 4LDYA 3LGLA 1JXOA 2JZ2A 4BE1A 4PJOD 2OTJT 1CSKA 2GF7A 3NHNA 1EX4A 3O5ZA 1B3QA 2YRVA 1KD1C 2D6FA 2KMTA 1PRMC 2LQ8A 4WCIA 4XU2A 3OYHA 1QQJA 2Z0WA 2DPPB 2KR3A 1PRLC 4OB2B 3H6ZA 2M0OA 3A8MB 2FPDA 1QLYA 2G6FX 2JW4A 2RK1A 4XU1A 2MMPA 4X9DA 3DLLA 1MMDA 3KFVA 3C4SA 2FO0A 1MNDA 4M7AG 2MYSA 1OZ3A 4KGXB 1WZOA 1WJSA 2ZPEB 2K6DA 3OYYA 4FT4A 1T3LA 2BZ8A 2CSIA 2H3EB 3F70A 4EMKA 2ZPFB 2A37A 3CBMA 1N9RA 1M4ZA 3QWYA 1K73U 1AWXA 1JQQA 3EFOA 2MCNA 3QWXX 3HHTB 2AIRB 5GAMf 3PNWC 3BY7A 3CD6T 2DBMA 3MEUA 1M2VA 2H8HA 5FU7B 1ZBXA 5DY9A 4M7AB 4CI0C 2CZ1B 1RADB 1SRLA 3SFMA 1M1KU 1NLPC 2MF2A 5LJ3f 1OPLA 3OW2S 4BDYA 2DZCA 2C06A 2RQRA 3CD6A 3ZFJA 2OAUA 1WXUA 1OYXA 4M7DC 1VQ6Q 1OEBA 2AK5A 4L59A 2R57A 2DTOA 1VQ4Q 2P4RA 1QVGS 1BB9A 1YFNA 3EHQA 3UT1A 1FYNA 4JUVA 1E7OA 1T3SA 2L3SA 2DL4A 2ZPHB 3OS0A 1VQPQ 3JB9J 2ATCB 3MCAB 4KGZB 3FRNA 4M4ZA 3WXMB 4C92C 1OU8A 1NG2A 3RKYA 1GCPA 1YI2A 4MZTA 4RTXA 1JB0E 4IUTA 4J6XA 4BUGA 2CSQA 1VQ5Q 2HEQA 1Z9QA 2K57A 5EG2A 4OGCA 1VQLA 4FIBA 2R58A 1G3WA 2QQBA 3JV3A 4OMOA 1W6XA 3ER0A 4A63B 4ME7A 3JRZA 1K76A 4QT7A 4OMQA 3CCRA 2FYKA 4IIMA 3PFSA 1NEGA 1RL2A 2JN0A 2KNBB 2M9UA 4M7DF 3M0SA 2BTTA 1VQOA 2HAXA 4M7DD 5GAN3 2R5MA 1VQ9Q 1J3TA 3UA7A 2SEMA 1GBRA 5L8RE 3BW1A 3CQTA 2ROTA 3FJ5A 2HSEB 3JB9I 1MGQA 1OOTA 1NZ9A 2P0PA 3CCJQ 5GMKe 1FMKA 3EGUA 1WA7A 2O31A 1VQKQ 4C92F 2CH4A 1O9SA 4HCZA 4OMPA 3I55Q 1K9AA 2E4HA 5IN1A 2F2XA 1K8AR 5GAOr 4C92D 1M1KC 1WDXA 1WXBA 1U3OA 2EKOA 3CCET 3LWIA 1D3BB 2AZSA 4M78G 1FMVA 1PNJA 5D7UA 3TQ7P 5FW9A 5GAN5 1NM7A 4QKUA 4F7UG 3HRSA 4FYYB 1VIEA 2DXUA 3MP8A 2ECZA 4ZNXA 1YJNT 2BKDN 4IUVA 1Q86R 1WYXA 1H8KA 1G3YA 1MMGA 2EW3A 3PVQA 2YUPA 2CUDA 5GANd 2CYZB 3E9GA 1Z9ZA 4NL2A 5GAN4 3G71T 2DYBA 5CKEA 5A0GA 5LJ3h 1LOJA 1TSFA 2KBTA 2YWWA 1A0NB 4M78B 4IUPA 4AFUC 3RNJA 2Y4YA 2WSFE 4DOVA 1YIJT 2RHUA 2F1LA 2BE9B 1TUGB 4F7UB 1ZX6A 4TVRA 1RAFB 3QDRB 1QVPA 3QSUA 2JMAA 3LX7A 2KYMA 4XU3A 3OYDA 2EYXA 2P0KA 3NGPA 1WXTA 1WHLA 5CR2A 4QVZA 1PD1A 3CC7Q 1BK2A 1M90R 2HNIA 2CZ0B 3OYKA 3X20B 2E64A 4N4GA 3UF4A 4J9HA 1R0BG 1GCQC 1YITT 1UJYA 2RH2A 1TXQA 4M7DE 4JZ3A 3M55A 2HSPA 5GMKj 1H3HA 2J05A 4OP0A 1UB4A 1R8OB 5KYXB 2Y90A 1VA7A 1VQNT 1R77A 3G1JA 4BY6C 3M5AA 3G7ZA 1SPKA 3VS5A 2X35A 3G6EA 3TVTA 1KC8C 1WIEA 4A54A 4ZTFA 1AHJB 2VVKA 2MI6A 5KYXA 4C92E 2V1QA 2PUOB 1S72Q 3V8LA 3CBPA 2EGCA 2KDSA 2RM4A 1LJOA 8AT1B 3LLRA 1B34A 4M75A 1VQ7Q 2XHCA 2DRKA 3EGDB 4QVCA 1CKBA 1YCSB 1MHNA 5LL6S 3CCMT 3CCLA 1QMCA 1ZUYA 3ZBDA 5GMKl 3CC2Q 1JBMA 3HRUA 4E7KA 3EH2A 2GGRA 1Y07A 4A4EA 2CGHA 2COWA 4Z89A 2EQMA 1KHCA 1GXIE 3O8VA 2FG0A 2E5QA 3CPFA 1NPRA 4B9XA 2XDDA 4HA8A 2KY9A 2QAZA 2YSQA 3THKA 3HPWA 3CPWA 4Y28E 3RESA 2BIVA 4IUQA 2O2OA 1T0HA 4MMKA 1IHVA 3CCUQ 4E7HA 1BI1A 2E65A 1I4K1 4PJJA 2VGMA 4AT1B 1M9SA 3HKSA 4C0DC 2BUDA 1BI0A 2DTHA 2YDLA 1C0MA 5CCAA 3KUFA 1TUDA 3M58A 2RI3A 5KYWB 3PIOA 2YXYA 2CP0A 3MKDA 3QG1A 3OY9A 4MDXA 2RB6A 1IXDA 4E7LA 2DO3A 2VKNA 2RQUA 2WACA 1AZEA 5KCHA 2DTIA 2DRMA 4FSXA 2JM8A 2QYZA 1UDLA 4F04B 2YUOA 3OBYA 2D9TA 5GANe 3OYFA 4AFSC 1NJIR 2HBWA 2XDPA 2DZ9A 4C8QG 4N0AA 1VYTA 4FL6A 4JJNK 1UE9A 2DE0X 2FZGB 1QWFA 1VYVA 2MWOA 1X2KA 1YJ9Q 2OTLT 4RTWA 3I5SA 3OSSC 2DL7A 1X75C 3QJ6A 2F69A 3UATA 4B9WA 4V2SA 2XKOC 1PKSA 5GMKm 1DJ7B 3JCMg 4XU0A 1ABOA 2F5KA 5KE3A 3L2RA 2KXDA 2VYTA 4C8QB 4EMKC 2OTLA 4HCBA 2CDTA 2PVOB 4C5IA 1SHFA 2DJQA 1FXXA 2RI5A 4HVUA 3SWNB 4CC7A 1M5Q1 1IO6A 1M3AA 1RUWA 1IGUA 1KQ1A 1KD1U 2EBPA 4WTOB 4M77C 1QCOA 1XOVA 5EC7A 2E41A 3RMSA 4BY6B 3META 3SWNA 3M0QA 1VQMT 4BE2A 2FPFA 1Q82R 4EDUA 2CUBA 5LJ5g 1VQ6A 2WSCE 5AT1B 2E3IA 3TEEA 2FPEA 4RTVA 3S3NA 3SB2A 5CQXA 2DJZA 2PZ1A 3OYAA 5KCOA 2GNCA 1NLOC 4AMCA 3RR6A 4PJMA 1VQPA 2NUTA 1ZLMA 1ZUKA 1OQKA 5L23A 2O88A 2QA4T 2OI3A 4PJOC 5GANj 2GTJA 1K73R 2QDYB 2KQWA 3EFRA 5KYUA 2PNIA 1UHFA 1ZBJA 2LZ6B 2O4XA 2O9VA 2YRDA 3HP9A 4HXJA 3H0HA 2B86A 3CC4T 1ACMB 1SHGA 2CP3A 2D8JA 8ATCB 2IVWA 3VS3A 1SSHA 2XICA 1M1KR 1BKBA 4JZ4A 4DEYA 2K79A 3R6NA 1O75A 2CREA 2BZXA 3EG2A 3JSCA 2NYSA 5FLXE 2EQKA 2QGFB 3CPWP 1VQ9A 2MK5A 2XI9A 2QGGA 4FM4B 3OYEA 2RHXA 4DOWA 1XTDA 5GAMd 4MZPA 2IPOB 3QZ9B 5KYYA 2L3QA 3CCJA 3OW2A 2JM9A 4E7IA 4ZN1A 1ZSZB 3QO3A 1UFFA 1WJQA 2LX7A 1WHJA 3J81E 3NTKA 1VQKA 3G4SQ 4L5GA 3I55A 2QK0A 2GTOA 2L0AA 1QWEA 5LJ3d 4ESRA 1WLPB 3UWNA 1UGQB 1QVGA 1OU9A 3CMET 2AT1B 4OMFB 1T0JA 2RN8A 3MP1A 1IHWA 2LJ1A 2RQWA 5FRMA 1KJWA 2SRCA 3RUXA 2A36A 4D6WA 4EMGA 4OB0B 1WQ7A 2E5KA 1RAGB 5FU6B 1RAAB 2EQJA 2ZPIB 5IHIA 2CZ6B 4MMLA 1YWOA 3CMEA 2QEXQ 3S3OA 4BB7A 2E70A 4PFZA 3MEWA 2JTFA 2HQHA 4XTYA 4EIKA 4XTUA 3OS5A 1E6GA 6AT1B 1E6HA 2LVMA 3CMAQ 2RNAA 3WVEB 3MEVA 2RK2A 2JTMA 4M77G
chains in the Genus database with same CATH topology
4HCCA 4C92F 2L5QA 1O9SA 4HCZA 4L6V5 2VUBA 2HD0A 3H8ZA 2MWPA 3QPHA 5IN1A 4C8QD 2RHZA 3R6OA 5GAOr 3GIBA 4BD3A 4C92D 1FWZA 3OYNA 3CCSA 1VQ4A 1M1KC 1VQ8T 1H3ZA 1I5LA 1N8RU 3A8GB 3G4ST 5HK0A 2EKOA 2LCCA 3FEOA 3CCQA 4CRIA 3CCET 3J7AF 4M7AC 1I81A 2GFAA 2VXFA 1D3BB 3LWIA 4HT9A 4M78G 2B8AA 2E10A 4II1A 3BDUA 2K5FA 2RD1A 1Q86U 4LD9K 1VQ5T 3BDLA 2LT1A 3LH0A 3V7RA 5GAN5 3V7CA 3GP8A 4F7UG 3HRSA 1VIEA 5IT9E 5AYFA 4J5YA 2RJEA 5A0LA 2DXUA 3CC7A 2QXFA 5GAN8 4M77E 4JS5A 3MP8A 3CCMA 1YJNT 2CS7A 1JJ2A 2BKDN 4IUVA 4LD6A 1X01A 1VQ8A 5D6YA 4XTWA 1G3YA 2EIFA 4PJOG 5LJ5j 5GANd 2CYZB 4OVAA 3SDZA 1JRIA 3VUBA 5A0DA 3SD4A 4M77B 3E9GA 1YHQA 2XDBA 2ZGWA 3KXTA 4NL2A 5GAN4 4XTXA 1VQ5A 3G71T 3JB9F 1M1FA 5CKEA 3CCVA 1VQ9T 5A0GA 5LJ3h 1LOJA 2DD5A 2QTXA 2QEXT 1KHIA 2ZZDA 3JB9D 3C94A 2X4JA 3CCLA 1VIFA 4IKFA 2RA2A 4NS5A 4M7AA 3DKMA 2VXEA 2I2LA 4IUPA 4KBMB 2Y4YA 2WSFE 4LDWA 2K3XA 4M78B 4DOVA 5GAMg 1YIJT 3CCJT 2QQSA 2RHUA 1P92A 1ZHIA 3CMAT 4F7UB 4PJOE 4A53A 4TVRA 2EJGA 4O6JA 3JCMb 3RIRA 1G5VA 1IZ6A 3QDRB 1QVPA 2Y4XA 3C95A 1VQKT 3QSUA 3LX7A 1YI2T 3I55T 4BDZA 4QW2A 1M90U 1UGPB 4XU3A 5I2MA 3OYDA 4O5VA 4M7AF 2DD4A 2FHDA 3M4GA 4OB3B 2P0KA 1KQ2A 4HT8A 5CR2A 2XG8D 3CBOA 4M7AD 4QVZA 5LJ3g 2V8IA 2LQKA 4IUUA 2PVDB 4R55A 4JS4A 1YJWT 1VQLT 3JCMP 1NJIU 2HNIA 3TREA 4PLLA 4QVDA 3LW5E 4C0DB 2DK3A 2CZ0B 5CKBA 1VQ7A 4XK8E 2V8KA 3OYKA 3X20B 3CCRT 2IG0A 3VU3C 2E64A 4N4GA 2EFIA 2XK0A 1YITT 3OYBA 4MDWA 2RH2A 3MEAA 5GAN7 3J80E 4M7DE 2ZPBB 3M55A 3DB3A 3JCMf 1VQOT 3CC2A 5FU6C 4A4HA 5C6SA 4M75C 3LYIA 3I56A 3E1SA 3OMCA 4J7IA 5GMKj 5CVIA 1XNIA 4OP0A 3T9NA 1UB4A 2JOYA 3M4YA 1YBYA 4QQ6A 2K5IA 1R8OB 4C5EA 1UGSB 3QKJA 4P5NA 3EAEA 3PIPA 2GQVA 2Y90A 1LNXA 1N6AA 3OYCA 1N9SA 1VQNT 3HL8A 3NTIA 4BY6C 3M5AA 4XTZA 1W4SA 3G7ZA 2LCLA 4MZMA 2X35A 5FROA 4A4GA 3G6EA 3TCJA 1KC8C 1NPPA 4A54A 4ZTFA 1QP3A 4PLIA 4ELYC 4LDUA 3CCST 3QUIA 1N8RC 1AHJB 2RO0A 2WSEE 2MI6A 1NE8A 2JUFA 4C8QE 5CKDA 5KE2A 4C92E 1XQHA 3OYGA 4ZGEB 2PUOB 1Q81C 1Q86C 2LRQA 3FDRA 3CCUA 3FC3A 3V8LA 1IREB 5GAMe 3CBPA 3P8HA 1BIAA 2KDSA 2RM4A 2DXTA 3CCQT 3X26B 1LJOA 5CKHA 2K3YA 1B34A 2EJ9A 3LLRA 4M75A 5LJ5f 3JCMX 2OTJA 4EPCA 3CPWS 2LX9A 2DEQA 5D6XA 3VYHB 2XHCA 3BFMA 2FVUA 3PT9A 4IURA 1H641 3RERA 3OYJA 3URGA 4C5GA 4GLKA 4JDSA 2V8JA 4QVCA 2X4XA 3JCMd 3CC7T 2LTOA 3MHXA 1MHNA 1V29B 1U1SA 2MAMA 5LL6S 2LNVA 3GLXA 3QBYA 1PSEA 5D6WA 3GPLA 5GMKl 5DLQE 3ZBDA 1WJRA 3OYLA 5GMKi 1KC8U 5GAN2 1JBMA 1HXDA 5LJ3e 3HRUA 4E7KA 3JB9H 4KUDK 2PUKB 1Y07A 4M75F 5FU7C 3JCMW 4A4EA 2CGHA 2YLCA 3M53A 2EQMA 1Q82U 1BI2A 3QJYA 1KHCA 4JRIA 4ZGJB 2LT4A 4X34A 3O8VA 1GXIE 4ZN3A 2DKGA 2E5QA 1NPRA 3CPFA 4M75D 4EMKB 5GANg 3TU4K 1YHQT 1Q81U 1M1GA 2M1HA 5GAOq 4B9XA 3AHUA 4XQ3A 3CCVT 2DVEA 2A7YA 3RKWA 2XDDA 4HA8A 2H3JA 2RJDA 2KY9A 4J6YA 3MP6A 4BI8B 3OA6A 1D3BA 4M78C 5HKCA 3HPWA 3CPWA 4J7FA 3P8BB 3JCMV 3L2VA 4BI3A 1X6OA 4Y28E 2DAQA 3A8HB 3RESA 2BIVA 4RCBA 1M90C 1SSFA 4IUQA 1WPYA 3NFCA 1KG1A 3OS1A 3PMIA 4MMKA 4E7JA 3VYGA 2O4XB 1VQMA 5LJ5d 2YLBA 4E7HA 1I8FA 1QW1A 1BI1A 1NJIC 2E65A 4RG8A 1FX7A 4M7AE 1I4K1 2R5AA 4A4KA 2AHJB 5M9OA 1S72T 3VUZA 2VGMA 2FB7A 2ZCFB 1YCYA 2K5LA 5CO7A 2P4TA 4JRKA 4N4IA 1M9SA 1WGSA 3HKSA 3UDCA 4M77A 1HK9A 1U1TA 2LC4A 4QQDA 1YJ9A 4GY5A 3MO8A 3INZA 4C0DC 2BUDA 5CIUA 3RKXA 1Q7YU 1BI0A 4XAXB 3N5BB 1WNLA 2DTHA 3L1AA 1VQ7T 3OBWA 3HRTA 4YTLA 4OGEA 5CCAA 3ASKA 3KUFA 3PTAA 4OF1A 3EFSA 4Z02A 4VUBA 3L2QA 3M58A 2X4WA 2RI3A 4NL3A 4M7DG 3VV0A 4M78A 3PIOA 2QA4A 1ZQ1A 4M77F 3CC2T 2KSSA 3QG1A 5GAN6 3I56T 1U8RA 1S72A 3HSBA 3OY9A 3DLMA 4MDXA 4PJOB 4PL6A 2RB6A 4Q5WA 3V8JA 4F7UA 4E7LA 2DO3A 2L3RA 4M77D 3ZEHA 4C0ZA 2WACA 5KCHA 4OB1B 2DTIA 4ELZC 3X24B 3X25B 4FSXA 5CQYA 1BYMA 2RJFA 4M78F 2YHTA 4KT0E 3V7SA 3CC4A 3VKIA 1W2BS 4PJOA 3OBYA 2D9TA 3G6ET 5GAMj 5GANe 4J6WA 3OYFA 4HKEA 5FRNA 2P0QA 4F7UF 2XDPA 2DZ9A 4M78D 2E6NA 4C8QG 3JCMJ 4N0AA 5C0MA 4C92G 3QXEB 3JCMh 4FL6A 3JCMQ 4UC4A 5GAOl 1N27A 3QZ5B 2VV5A 1PSFA 3V8KA 2X4YA 4JJNK 5I2SA 2K4YA 4DQ2A 2G3RA 3CEYA 4PJOF 4M7DB 3M56A 3CCUT 4BE0A 1M8VA 2L89A 3P8DA 3FB9A 3LGLA 2MWOA 4LDYA 5LJ3j 2OTLT 2JZ2A 2QQRA 5HK3A 4BE1A 4PJOD 2OTJT 3OSSC 2GF7A 5DLOA 3L42A 1X75C 4JRPA 2HBPA 4RMOA 1Q82C 3QJ6A 1Y96B 2YRVA 3A5ZB 2F69A 4ZTJA 1KD1C 4PNOA 4B9WA 5CKFA 2D6FA 4ATOA 2XU8A 4V2SA 1W2BA 2KMTA 3CCLT 2XKOC 2QQ9A 5GMKm 1K9MU 1DJ7B 3JCMg 2GFUA 4XU0A 2F5KA 5KE3A 3GOXA 2LQ8A 3L2RA 5HY6A 4M75E 4XU2A 2RJCA 2VYTA 3OYHA 4C8QB 4EMKC 4C92B 2OTLA 2DPPB 4HCBA 2DIQA 3JB9G 2PVOB 4Y91A 5LJ5h 2O01E 4C5IA 4A4FA 4OB2B 3H6ZA 2M0OA 3WVDB 3A8MB 3FIFA 1UGRB 4J8OA 1FXXA 2RI5A 1OZ2A 3QYGB 4J83A 2F5TX 2DXBA 3SWNB 1M5Q1 2EYQA 2JVVA 3PGGA 3VJPA 5CK9A 3M59A 1K73C 4EMHA 3OB9A 2RK1A 4XU1A 2MMPA 1KQ1A 2PU9B 4X9DA 3DLLA 1KD1U 3OYMA 2KAFA 5J39A 2HQXA 4M77C 1XOVA 2LDMA 2E41A 3RMSA 4BY6B 3C4SA 3META 3SWNA 1K8AU 1VQMT 4JRQA 4BE2A 2PVGB 3S3MA 4M7AG 2QQAA 2PQWA 1OZ3A 4BI4A 1Q7YC 2XIDA 4EDUA 2ZPEB 1WJSA 3E9FA 4FT2A 4FU6A 3CXCS 2ZPGB 3OYYA 3S6WA 5LJ5g 4FT4A 1VQ6A 4C0FA 2WSCE 3FJPA 3TEEA 2VC8A 3S3NA 3F70A 4EMKA 2ZPFB 3L2UA 3SB2A 1YJ9T 5CQXA 2DJZA 3CBMA 3OYAA 2CZ7B 5KCOA 2JNGA 3HFOA 3QIIA 1N9RA 1M4ZA 1TH7A 1K73U 5J3BA 4LDVA 5J26A 1VQPA 2EJFA 2DIGA 1Y7XA 2A3LA 1UEBA 3C12A 2DXCA 2QA4T 3HHTB 5GAMf 4PJOC 3PNWC 3BY7A 3CD6T 3JCMc 5GANj 5GAMh 3LGFA 1KQSS 2QDYB 2KQWA 3MEUA 4N0AC 3EFRA 3JCMe 2O4XA 5GMKh 3G4SA 1OI1A 1EIFA 3HP9A 5FU7B 1ZBXA 5IAYA 5GAOn 3CXCA 3CCEA 5DY9A 4M7AB 4CI0C 5DM7R 3DB4A 2M16A 4BACA 2CZ1B 2XD0A 2RHIA 2VGNA 3CC4T 3SFMA 4M78E 1M1KU 2MF2A 3ME9A 5LJ3f 2K2VA 4KULA 3KBGA 3OW2S 4BDYA 3JAME 2DZCA 4F7UE 2IVWA 2C06A 2EWNA 3A8OB 4KUIA 3M57A 3CD6A 1YJNA 3GF5A 3ZFJA 5A2QE 2XICA 2OAUA 2FL7A 5GAOm 4JLGA 3E19A 1BKBA 4JLIA 1OYXA 3NTHA 4M7DC 2EQUA 1G3SA 1G3TA 2E12A 1O75A 1WQWA 3RMQA 2NLUA 3PMTA 4RG2A 4L59A 4C5HA 2R57A 3JSCA 2DTOA 1BIBA 1KQSA 3FLGA 5FLXE 4X9CA 1QVGS 4LDXA 1VUBA 3UT1A 3X28B 3G71A 1QVFS 2EQKA 1QP2A 2RHYA 1BI3A 4ZGDB 1K9MC 4JUVA 4NOYA 1VQ9A 2QEXA 4WF2A 2XI9A 2L8DA 2ZPHB 3OS0A 4FM4B 3OYEA 2RHXA 4DOWA 4E47A 1XTDA 5LJ5e 5GAMd 2KK4A 3JB9J 4MZPA 3CCMT 3GNGA 3OS2A 1YIJA 3MCAB 3QZ9B 3A8LB 4M75G 2CKKA 3CCJA 3OW2A 1Y71A 3CMAA 4E7IA 4ZN1A 5I21A 3LWHA 3QO3A 3FRNA 3OSVA 1WJQA 4C8QC 3WXMB 4C92C 3M9QA 3J81E 3NTKA 3RKYA 1VQKA 4L5GA 1YI2A 3I55A 4MZTA 1JB0E 4N4HA 5LJ3d 4IUTA 4J6XA 3QYHB 4BUGA 3SWNC 3UWNA 1UGQB 3OMGA 4M7DA 2K57A 3OYIA 3HFNA 5EG2A 4OGCA 1QVGA 1QVFA 3CMET 1YJWA 4FIBA 4R56A 1RI0A 1VQLA 2R58A 1K8AC 1G3WA 2QQBA 3L2ZA 5GAOp 3ER0A 4ME7A 3JRZA 3GNFB 4QQGA 3CCRA 4OMFB 2E6ZA 3MP1A 3QHSA 4XTVA 2FYKA 4DA4A 2EAYA 3PFSA 1Y96A 2QI2A 5FRMA 1RL2A 2JN0A 3Q1JA 4RCCA 2M9UA 2RI2A 1YITA 4M7DF 3RUXA 4D6WA 4RKUE 4OB0B 4C0GA 4EMGA 1WQ7A 1VQOA 2HAXA 3UPUA 1B34B 2E1HA 2D0QB 4M75B 2EQJA 2ZPIB 5FU6B 2CZ6B 4MMLA 5GAN3 4M7DD 2R5MA 1VQ6T 2GCXA 3CMEA 3S3OA 4C8QA 4BB7A 5KH6A 2E70A 4C92A 2HQEA 5GANf 3M54A 1VQ4T 5L8RE 3MEWA 2JTFA 3BW1A 5GANh 1VQNA 4XTYA 2KVQG 4XTUA 1MGQA 3OS5A 5CAIA 3JB9I 3L2WA 4PKCC 1NZ9A 2LVMA 2P0PA 1JJ2S 5GMKe 3WVEB 1VQPT 3MEVA 3OQ5A 2RK2A 4C8QF 2JTMA 4M77G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N0A C;  4C92 F;  3EFR A;  4M78 F;  4A54 A;  2YHT A;  5GMK h;  3V7S A;  3JCM e;  4C8Q D;  5GAO n;  3QUI A;  4PJO A;  5GAO r;  3GIB A;  5DY9 A;  4M7A B;  4C92 D;  4C8Q E;  5GAN e;  4J6W A;  5GAM j;  4C92 E;  1I5L A;  4F7U F;  4M78 D;  2DZ9 A;  4C8Q G;  3JCM J;  4N0A A;  4M78 E;  4C92 G;  4M7A C;  1I81 A;  2VXF A;  3JCM h;  1D3B B;  5LJ3 f;  4HT9 A;  3JCM Q;  4M78 G;  2E10 A;  3BDU A;  5GAO l;  2RD1 A;  3V8L A;  5GAM e;  2DZC A;  4F7U E;  1BIA A;  2RM4 A;  3V8K A;  2DXT A;  2EWN A;  3V7R A;  5GAN 5;  1LJO A;  3V7C A;  4F7U G;  4DQ2 A;  1B34 A;  2EJ9 A;  4PJO F;  4J5Y A;  4M75 A;  5LJ5 f;  2DXU A;  3JCM X;  5GAO m;  4M7D B;  1M8V A;  5GAN 8;  3FB9 A;  2DEQ A;  4JLI A;  4M77 E;  5LJ3 j;  3RER A;  3BFM A;  4M7D C;  1H64 1;  4PJO D;  1WQW A;  4QVC A;  3JCM d;  1X01 A;  1U1S A;  1BIB A;  2DTO A;  4XTW A;  4PJO G;  4X9C A;  5GMK l;  5LJ5 j;  5GAN d;  5GMK i;  1Y96 B;  5GAN 2;  1JBM A;  1HXD A;  5LJ3 e;  3JB9 H;  1JRI A;  4PNO A;  4JUV A;  4M77 B;  4M75 F;  4NOY A;  3JCM W;  2ZGW A;  4V2S A;  2CGH A;  2YLC A;  4NL2 A;  4WF2 A;  5GAN 4;  4XTX A;  5GMK m;  3JCM g;  4JRI A;  3JB9 F;  4XU0 A;  2DKG A;  4EMK B;  5LJ5 e;  4M75 D;  5GAM d;  5LJ3 h;  1LOJ A;  2QTX A;  5GAN g;  3JB9 J;  4M75 E;  4XU2 A;  5GAO q;  3JB9 D;  4C8Q B;  4EMK C;  4XQ3 A;  3AHU A;  4M75 G;  2DVE A;  2RA2 A;  4C92 B;  4M7A A;  3RKW A;  5I21 A;  3JB9 G;  4M78 B;  2VXE A;  2I2L A;  3QO3 A;  4HA8 A;  4Y91 A;  4C8Q C;  5LJ5 h;  4J6Y A;  4C92 C;  5GAM g;  3RKY A;  1D3B A;  3FIF A;  4M78 C;  3JCM V;  4F7U B;  4PJO E;  3SWN B;  4A53 A;  3RES A;  2EJG A;  1M5Q 1;  3JCM b;  3RIR A;  3PGG A;  4RCB A;  5LJ3 d;  4J6X A;  3QSU A;  3SWN C;  4EMH A;  1WPY A;  4XU1 A;  4M7D A;  2K57 A;  4XU3 A;  3HFN A;  4M7A F;  3M4G A;  1KQ1 A;  4X9D A;  4MMK A;  1KQ2 A;  4HT8 A;  5LJ5 d;  4M77 C;  2YLB A;  1I8F A;  2E41 A;  3L2Z A;  5GAO p;  2E65 A;  5LJ3 g;  4M7A D;  3SWN A;  4M7A E;  1I4K 1;  3QHS A;  4C8Q F;  4XTV A;  2FYK A;  3JCM P;  4M7A G;  2EAY A;  2HNI A;  4QVD A;  2FB7 A;  1Y96 A;  1YCY A;  4JRK A;  2JN0 A;  4RCC A;  4M77 A;  1HK9 A;  1U1T A;  5LJ5 g;  3RUX A;  3VU3 C;  4M7D F;  2E64 A;  4EMG A;  3FJP A;  3INZ A;  1WQ7 A;  3RKX A;  2VC8 A;  1WNL A;  2DTH A;  3L1A A;  1B34 B;  2E1H A;  4EMK A;  4M75 B;  4M7D D;  4MML A;  3SB2 A;  5GAN 7;  5GAN 3;  4M7D E;  3EFS A;  2DJZ A;  3JCM f;  4C8Q A;  4M75 C;  4NL3 A;  4M7D G;  5GMK j;  4C92 A;  3HFO A;  5GAN f;  1N9R A;  4M78 A;  4OP0 A;  1TH7 A;  5GAN h;  3BW1 A;  4M77 F;  4XTY A;  5GAN 6;  3JB9 I;  4XTU A;  1MGQ A;  2EJF A;  5CAI A;  3HSB A;  4PJO B;  2RB6 A;  3V8J A;  4F7U A;  2Y90 A;  5GMK e;  1LNX A;  4M77 D;  1N9S A;  5GAM f;  4PJO C;  3BY7 A;  3JCM c;  5GAN j;  5GAM h;  4XTZ A;  2DTI A;  4M77 G; 
#chains in the Genus database with same CATH topology
 4HCC A;  2HL3 A;  2VUB A;  3H8Z A;  2MWP A;  3QPH A;  1F1B B;  2MOX A;  1I5L A;  3H0I A;  1N8R U;  5HK0 A;  2LCC A;  3FEO A;  5KYN A;  4CRI A;  1I81 A;  2GFA A;  1NYF A;  1YJW Q;  2B8A A;  2IIM A;  4OML A;  3V7C A;  2NUP B;  1LVK A;  2FEI A;  3CC7 A;  4M77 E;  4JS5 A;  1PD0 A;  2AKK A;  1TU0 B;  1X27 A;  1VYU A;  5D6Y A;  4XTW A;  4PJO G;  2A0F B;  2DBK A;  3VUB A;  5A0D A;  1OPK A;  2ENM A;  4M77 B;  2XDB A;  1M3C A;  3JB9 F;  1M1F A;  2YRC A;  3I5R A;  3AT1 B;  2JMC A;  2RQV A;  2JS0 A;  3JB9 D;  2X4J A;  2FZK B;  2RA2 A;  4LXC A;  4NS5 A;  4M7A A;  2CT3 A;  3CCS Q;  2K2M A;  4LDW A;  2QQS A;  4PK4 A;  1UJ0 A;  1P92 A;  1ZHI A;  1MV3 A;  4RTU A;  4PJO E;  4DBR A;  2EJG A;  3BE3 A;  7AT1 B;  3CCQ Q;  1M27 C;  2ED0 A;  4E7S A;  1YI2 T;  4BDZ A;  4HVW A;  1WI7 A;  1KQ2 A;  2LNH B;  2V8I A;  2PVD B;  4R55 A;  1VQL T;  4PLL A;  3EG3 A;  2EPD A;  2J6O A;  1VQ7 A;  3CCR T;  1VQ8 Q;  1D1B A;  2EFI A;  1B07 A;  1K1Z A;  2X3X D;  2XK0 A;  1QCF A;  3OYB A;  5GAN 7;  3VS4 A;  2ZPB B;  3JCM f;  1VQO T;  3CC2 A;  1YHQ Q;  4D8D A;  4A4H A;  4M75 C;  3LYI A;  3OMC A;  4PJN A;  3CCV Q;  1XNI A;  3T9N A;  2K5I A;  3REA B;  2CT4 A;  2LJ3 A;  2L3P A;  4P5N A;  2GQV A;  1LNX A;  1U06 A;  1XJW B;  2LCL A;  2DX1 A;  2COZ A;  4PFP A;  1MNE A;  1QP3 A;  4PLI A;  1N8R C;  1JO8 A;  3QUI A;  2WSE E;  2RO0 A;  1NE8 A;  3OYG A;  1Q81 C;  1Y0M A;  2LRQ A;  3CCU A;  1R0C B;  5GAM e;  3X26 B;  2K3Y A;  5LJ5 f;  3JCM X;  5D6X A;  4IUR A;  3OW2 P;  4C5G A;  4JDS A;  2LTO A;  3MHX A;  1HJD A;  4D8K A;  3QBY A;  1PSE A;  4KRT A;  5DLQ E;  1WJR A;  3OYL A;  1AVZ C;  1KC8 U;  1HXD A;  5LJ3 e;  3I56 Q;  3JB9 H;  1TTH B;  4M75 F;  1ZA2 B;  1X2Q A;  2DKG A;  2OJ2 A;  4M75 D;  1QVG P;  1AT1 B;  3AHU A;  3RKW A;  2W10 A;  1D3B A;  3JCM V;  3A8H B;  1SSF A;  4J9I A;  1WPY A;  3RBB B;  3NFC A;  1KG1 A;  4E7J A;  2KEA A;  3VYG A;  2YLB A;  4GBQ A;  5IXF A;  4HCK A;  4RG8 A;  2OTJ Q;  1RAC B;  2ZCF B;  2K5L A;  1OX8 A;  1WGS A;  5FWB A;  1YJ9 A;  2L2P A;  3OBW A;  2CP7 A;  3ASK A;  3EFS A;  9ATC B;  2RMO A;  4KH1 B;  1PCX A;  1W70 A;  4M7D G;  4M78 A;  3VS1 A;  2MPX C;  3DLM A;  4Q5W A;  4F7U A;  1IB8 A;  2L3R A;  1SKU B;  1BCM A;  4AG1 C;  5I11 A;  2ED1 A;  2RJF A;  2YHT A;  3V7S A;  1W2B S;  3GBQ A;  3G6E T;  5GAM j;  2P84 A;  1D0X A;  2D1X A;  2KRM A;  3JCM J;  4C92 G;  3QXE B;  3JCM h;  4RTT A;  4UC4 A;  1N27 A;  3QZ5 B;  3V8K A;  5I2S A;  3IQL A;  2K4Y A;  2ROL A;  3CEY A;  1AEY A;  4M7D B;  3P8D A;  3FB9 A;  5LJ3 j;  1WHH A;  5HK3 A;  2E3H A;  3EH1 A;  1QKW A;  5DLO A;  2HBP A;  4RMO A;  2DNU A;  1Y96 B;  3A5Z B;  4ZTJ A;  5CKF A;  1OV3 A;  2HMA A;  4ATO A;  3CCL T;  2QQ9 A;  1K9M U;  3CD6 Q;  1WFW A;  2HL5 C;  3GOX A;  2EGE A;  4LUE A;  5HY6 A;  1I07 A;  3EG9 B;  2RJC A;  4M75 E;  1SG5 A;  4C92 B;  2DIQ A;  4Y91 A;  5LJ5 h;  2O01 E;  4A4F A;  3FIF A;  4J8O A;  4J83 A;  2F5T X;  2DXB A;  2EYQ A;  3EG9 A;  3VS2 A;  3OB9 A;  2BE7 D;  2HZY A;  3OYM A;  2EYW A;  5J39 A;  1GRI A;  2HQX A;  2LDM A;  3EGD A;  4FYV B;  1K8A U;  4JRQ A;  2QQA A;  2PQW A;  2XID A;  2M51 A;  1KD1 R;  4FT2 A;  3CXC S;  3S6W A;  4C0F A;  3L2U A;  2C0T A;  2C0O A;  2JNG A;  3I35 A;  4LDV A;  2EJF A;  2A3L A;  3PVL A;  1H92 A;  3C12 A;  2DXC A;  5HCK A;  1GL5 A;  4HVV A;  3LGF A;  1KQS S;  2NUZ A;  1G83 A;  2DL3 A;  3G4S A;  1OI1 A;  5IAY A;  3DB4 A;  2K2V A;  1QCN A;  4KUL A;  3KBG A;  1RI9 A;  2DYI A;  1AWW A;  2EWN A;  3A8O B;  4KUI A;  3GF5 A;  5A2Q E;  2FL7 A;  4JLI A;  3NTH A;  2EQU A;  1G3S A;  2E12 A;  5KYW A;  1ARK A;  3RMQ A;  2NLU A;  3PMT A;  4RG2 A;  5I22 A;  4LDX A;  1VUB A;  3X28 B;  1QVF S;  1QP2 A;  4ZGD B;  1K9M C;  3D7S B;  2EVR A;  4NOY A;  2QEX A;  2J6F A;  4AFZ C;  4WF2 A;  2L8D A;  2KK4 A;  3OS2 A;  3CMA A;  2YUN A;  3OSV A;  1RAH B;  2QTV A;  3M9Q A;  2GQI A;  4J9G A;  3CCE Q;  2LQN A;  4N4H A;  2RPN A;  2DIL A;  1TWB A;  1RLQ C;  3OMG A;  3OYI A;  3HFN A;  2OX7 A;  1YJW A;  1K8A C;  3L2Z A;  5GAO p;  1LPL A;  1YJN Q;  2J7I A;  1Q95 G;  3GNF B;  2I0N A;  2E6Z A;  4XTV A;  2KT8 A;  4DA4 A;  2EAY A;  2QI2 A;  3Q1J A;  2RI2 A;  4C0G A;  2EGA A;  3UPU A;  1TS9 A;  2F2W A;  2E1H A;  3G71 Q;  1VQ6 T;  2GCX A;  2FRW A;  4C8Q A;  3M0T A;  5KH6 A;  3NMZ C;  4E7Z A;  1B7T A;  1VQ4 T;  4FSS A;  2KGT A;  1GCQ A;  5GAN h;  2QDL A;  5CAI A;  3L2W A;  4DBF A;  1YIJ Q;  1JJ2 S;  1VQP T;  3OQ5 A;  2JVV A;  3CCS A;  1H3Z A;  5C0M A;  5IHK A;  2DL5 A;  2C0I A;  2L5Q A;  4L6V 5;  3R6O A;  4FW1 A;  1WX6 A;  4BD3 A;  3OYN A;  1FWZ A;  1VQ4 A;  1VQ8 T;  3A8G B;  3J7A F;  3CCQ A;  4M7A C;  4HT9 A;  4II1 A;  1LCK A;  1VQ5 T;  1UTI A;  3BDL A;  4Z88 A;  1JXM A;  1KFZ A;  1N8R R;  5IT9 E;  4J5Y A;  2QXF A;  1YIT Q;  2CS7 A;  2YUQ A;  1UUE A;  1X01 A;  1VQ8 A;  1V1C A;  4OVA A;  1YN8 A;  2BZY A;  2XMF A;  1JRI A;  1SEM A;  3SD4 A;  4F17 A;  1YHQ A;  2ZGW A;  4XTX A;  1VQ5 A;  1PHT A;  1VQN Q;  3CCV A;  1VQ9 T;  2QTX A;  2ZZD A;  3A98 A;  1PG5 B;  1D0Y A;  4KBM B;  2I2L A;  2K3X A;  3CCJ T;  1I1J A;  4A53 A;  1G5V A;  2Y4X A;  3C95 A;  1VQK T;  2DMO A;  2DFU A;  3I55 T;  4QW2 A;  3TSZ A;  4M7A F;  3M4G A;  5IXB A;  4HT8 A;  4M7A D;  4JS4 A;  3JCM P;  1NJI U;  3TRE A;  4QVD A;  3LW5 E;  4C0D B;  3EHR A;  3CCM Q;  5CKB A;  3VRY A;  2EYZ A;  2IG0 A;  3VU3 C;  1GFC A;  4MDW A;  3J80 E;  3H41 A;  3I56 A;  1PKT A;  3E1S A;  4J7I A;  1N5Z A;  5CVI A;  4LN2 A;  3VRZ A;  1ZSZ A;  2JOY A;  3M4Y A;  3REB B;  1UGS B;  3QKJ A;  3EAE A;  3PIP A;  4PJL A;  2FZC B;  3QDF A;  2K9G A;  2PTK A;  3HL8 A;  4XTZ A;  1W4S A;  4MZM A;  5FRO A;  1TG0 A;  5IHN A;  4J9B A;  2LQW A;  4LE9 A;  4LDU A;  4Z8A A;  5CKD A;  1XQH A;  2VB6 A;  3FDR A;  3FC3 A;  1IRE B;  4F14 A;  3P8H A;  2DXT A;  1GBQ A;  2EJ9 A;  2OTJ A;  2LX9 A;  2DEQ A;  3VYH B;  3RER A;  3PT9 A;  2FVU A;  1H64 1;  3OYJ A;  3URG A;  1CKA A;  4K11 A;  2CP6 A;  3JCM d;  3CC7 T;  1V29 B;  1U1S A;  2MAM A;  2QAS A;  2LNV A;  3GLX A;  3GPL A;  1M3B A;  4KGV B;  5D6W A;  5IH2 A;  5ECA A;  5GMK i;  4KUD K;  1M8M A;  2KRO A;  1Q82 U;  3M53 A;  2YLC A;  1HSQ A;  3RDV A;  1BI2 A;  2K7A A;  4JRI A;  4ZGJ B;  4X34 A;  1WHM A;  4KH0 B;  4RTZ A;  4EMK B;  1U5S A;  5GAN g;  1Q81 U;  3E2U A;  1ZUU A;  1KC8 R;  1M1G A;  5GAO q;  4IIO A;  2A7Y A;  4LNP A;  4J6Y A;  3MP6 A;  4BI8 B;  2DL8 A;  4M78 C;  3EFO B;  4J7F A;  3P8B B;  2ABL A;  4JPB W;  3TSW A;  2NUP A;  1SRM A;  2OAW A;  3OS1 A;  2DF6 A;  1YWP A;  1NYG A;  2NWM A;  1M2V B;  5LJ5 d;  1D1A A;  3UA6 A;  1I8F A;  1QW1 A;  4DBQ A;  1NJI C;  2OTL Q;  4M7A E;  1S72 T;  3VUZ A;  1YCY A;  4JRK A;  4N4I A;  4M77 A;  1U1T A;  2LC4 A;  2LCS A;  1Q7Y U;  3MO8 A;  5CIU A;  3RKX A;  4XAX B;  3N5B B;  1WNL A;  3L1A A;  1VQ7 T;  4YTL A;  4OGE A;  4AFQ C;  4Z02 A;  4VUB A;  4FW2 A;  1X43 A;  1AD5 A;  3VV0 A;  1ZQ1 A;  3CC2 T;  1S72 A;  3HSB A;  4PJO B;  1AOJ A;  4PL6 A;  3V8J A;  4C0Z A;  4RUG A;  1KK7 A;  1UG1 A;  3X25 B;  4J9C A;  1BYM A;  4M78 F;  4KT0 E;  3VKI A;  1WHK A;  4PJO A;  4HKE A;  5FRN A;  4F7U F;  4M78 D;  2CP5 A;  2E6N A;  1VQM Q;  3HTR A;  1I0C A;  1FMW A;  5GAO l;  1PSF A;  2X4Y A;  2ESW A;  2HCK A;  4DQ2 A;  2J06 A;  2G3R A;  3CCU T;  1M8V A;  4BE0 A;  3VS6 A;  2QQR A;  3L42 A;  2X9H A;  4CC3 A;  4FYX B;  4JRP A;  2KE9 A;  1Q82 C;  1OUL A;  4PNO A;  2XU8 A;  4DEX A;  1TOV A;  1W2B A;  2QA4 Q;  4RTY A;  2GFU A;  1TUC A;  3NPF A;  1K9M R;  3JB9 G;  3LH5 A;  1UHC A;  3WVD B;  1MUZ A;  3CC4 Q;  1UGR B;  1OZ2 A;  1UEC A;  3QYG B;  3PGG A;  4JJB A;  3VJP A;  5CK9 A;  2X51 A;  3M59 A;  1K73 C;  4EMH A;  1W1F A;  3VS0 A;  2PU9 B;  1IRX A;  2KAF A;  2KRN A;  2RQT A;  2PVG B;  3S3M A;  4ORZ A;  4BI4 A;  1Q7Y C;  2HKN A;  2V26 A;  3E9F A;  4FU6 A;  2ZPG B;  1GFD A;  1NBE B;  3FJP A;  2VC8 A;  1YJ9 T;  2CZ7 B;  3HFO A;  3QII A;  1TH7 A;  1X6B A;  4CC2 A;  5J3B A;  2EKH A;  5J26 A;  2DIG A;  1Y7X A;  1UEB A;  4E2F B;  2M0Y A;  3JCM c;  5GAM h;  2RF0 A;  1EFN A;  4N0A C;  3EG1 A;  2DVJ A;  5GMK h;  3JCM e;  3CCE A;  1EIF A;  5GAO n;  3CXC A;  3CME Q;  4B6M A;  2JTE A;  2A08 A;  5DM7 R;  4BAC A;  2M16 A;  1V76 A;  2XD0 A;  2RHI A;  2VGN A;  4M78 E;  3ME9 A;  1PC0 A;  1BCO A;  2EYY A;  2JS2 A;  2AZV A;  3JAM E;  4F7U E;  2D0N A;  1C1A A;  3M57 A;  1YJN A;  4JJD A;  5GAO m;  4JLG A;  3E19 A;  1AWO A;  1YNZ A;  1G3T A;  1WQW A;  2EQI A;  4C5H A;  1BIB A;  1KQS A;  3FLG A;  4X9C A;  1HD3 A;  3G71 A;  2RHY A;  1BI3 A;  2MIO A;  4R0K A;  3PE0 A;  3ULR B;  4E47 A;  5LJ5 e;  4FYW B;  5GJV B;  3GNG A;  1YIJ A;  1NEB A;  3A8L B;  4M75 G;  2CKK A;  1Y71 A;  4OMN A;  1ZA1 B;  5I21 A;  1WHG A;  3LWH A;  4C8Q C;  3H0F A;  4GLM A;  2JT4 A;  4LUD A;  1BU1 A;  3QYH B;  3SWN C;  4M7D A;  1G8X A;  1QVF A;  4R56 A;  1RI0 A;  2DET A;  4JJC A;  1MMA A;  2KT1 A;  3C0C A;  3U23 A;  4QQG A;  3QHS A;  2JXB A;  2CH4 W;  1Y96 A;  2DEU A;  1I5O B;  4RCC A;  1YIT A;  1YP5 A;  2JJ9 A;  4RKU E;  3VS7 A;  3I9Q A;  1B34 B;  2D0Q B;  4M75 B;  4C92 A;  2HQE A;  5GAN f;  3M54 A;  3ZL7 C;  1S1N A;  1VQN A;  2KVQ G;  4PKC C;  2KYB A;  3A1P A;  1RAB B;  4C8Q F;  1YI2 Q;  1G2B A;  3M0R A;  2ZAE A;  2HD0 A;  4C8Q D;  2RHZ A;  3GIB A;  4Y92 A;  3G4S T;  1M30 A;  1QKX A;  1RAE B;  2VXF A;  1VQL Q;  2E10 A;  3BDU A;  4OMM A;  2K5F A;  2RD1 A;  1Q86 U;  1W2B P;  4LD9 K;  2LT1 A;  3LH0 A;  3CCR Q;  3V7R A;  3GP8 A;  5AYF A;  2RJE A;  5A0L A;  1BBZ A;  4DBH A;  5GAN 8;  3M0P A;  3CCM A;  3H9N A;  1JJ2 A;  1VQO Q;  4LD6 A;  2CP2 A;  1KSW A;  1ZSG A;  2KXC A;  1D09 B;  2EIF A;  5LJ5 j;  3SDZ A;  1IGQ A;  2D8H A;  3KXT A;  1MV0 B;  2F2V A;  2QEX T;  2DD5 A;  1HYO A;  1KHI A;  1SF9 A;  3C94 A;  1VIF A;  4IKF A;  1Y57 A;  3DKM A;  2VXE A;  3EG0 A;  5GAM g;  1ZSZ C;  3CMA T;  3MPU B;  1D0Z A;  3JCM b;  1AZG B;  4O6J A;  3RIR A;  1IZ6 A;  3SHW A;  1M90 U;  1UGP B;  5I2M A;  4O5V A;  2DD4 A;  2FHD A;  4OB3 B;  1M2O A;  1AWJ A;  2XG8 D;  3CBO A;  2AKL A;  5LJ3 g;  2M02 A;  2LQK A;  4IUU A;  1YJW T;  2DER A;  1RLP C;  2DK3 A;  1JEG A;  4XK8 E;  2V8K A;  2QG9 B;  1ABQ A;  1X69 A;  2DM1 A;  3EGX B;  1EZZ B;  2HDA A;  3MEA A;  2LMJ A;  3DB3 A;  4J9F A;  5FU6 C;  5C6S A;  3CXC P;  1RAI B;  1MMN A;  4QQ6 A;  1YBY A;  4C5E A;  3EGX A;  2LP5 A;  2GBQ A;  1C6V X;  4E6R A;  3OYC A;  1N6A A;  1N9S A;  1K0S A;  3NTI A;  4A4G A;  3SEM A;  3TCJ A;  1NPP A;  2X3W D;  4ELY C;  3CCS T;  3M0U A;  2JUF A;  3MJX A;  4C8Q E;  5KE2 A;  1KQS P;  2COY A;  4ZGE B;  1Q86 C;  5FWC A;  3CCQ T;  2W0Z A;  1BIA A;  5CKH A;  5GJW B;  4FCY A;  4EPC A;  3CPW S;  2DLP A;  3BFM A;  4GLK A;  2V8J A;  2X4X A;  2VAS A;  4ANJ A;  5GAN 2;  2PUK B;  5FU7 C;  3JCM W;  1KIK A;  2V1R A;  3QJY A;  1OX9 A;  2LT4 A;  4ZN3 A;  3TU4 K;  1YHQ T;  4J9D A;  1QVF P;  2M1H A;  4XQ3 A;  3CCV T;  2DVE A;  3G6E Q;  4CC4 B;  2H3J A;  2RJD A;  4AG2 C;  2K3B A;  2NUT B;  3OA6 A;  1Q81 R;  4J9E A;  5HKC A;  3L2V A;  2YT6 A;  4BI3 A;  1X6O A;  2DAQ A;  1D1C A;  1UGV A;  4RCB A;  1M90 C;  2FRY A;  4X1V A;  4F16 A;  5KYU B;  3PMI A;  1VQM A;  2O4X B;  1PM3 A;  1FX7 A;  2R5A A;  4A4K A;  2AHJ B;  5M9O A;  2FB7 A;  5CO7 A;  2P4T A;  3UDC A;  1HK9 A;  1K0X A;  4QQD A;  4GY5 A;  3INZ A;  2J6K A;  3CCL Q;  3HRT A;  3PTA A;  3L2Q A;  4OF1 A;  4PFO A;  2X4W A;  4NL3 A;  1Q7Y R;  2QA4 A;  2KRS A;  4M77 F;  2KSS A;  5GAN 6;  3I56 T;  1U8R A;  2O9S A;  4M77 D;  3ZEH A;  4OB1 B;  2KI7 A;  4ELZ C;  3X24 B;  5CQY A;  1JU5 C;  3CC4 A;  5KYY B;  1JJ2 P;  1VOM A;  4J6W A;  1X6G A;  2P0Q A;  2A28 A;  2VWF A;  2HKQ B;  3JCM Q;  2VV5 A;  2DA9 A;  1K4U S;  2LJ0 A;  4PJO F;  3M56 A;  1PWT A;  2L89 A;  4LDY A;  3LGL A;  1JXO A;  2JZ2 A;  4BE1 A;  4PJO D;  2OTJ T;  1CSK A;  2GF7 A;  3NHN A;  1EX4 A;  3O5Z A;  1B3Q A;  2YRV A;  1KD1 C;  2D6F A;  2KMT A;  1PRM C;  2LQ8 A;  4WCI A;  4XU2 A;  3OYH A;  1QQJ A;  2Z0W A;  2DPP B;  2KR3 A;  1PRL C;  4OB2 B;  3H6Z A;  2M0O A;  3A8M B;  2FPD A;  1QLY A;  2G6F X;  2JW4 A;  2RK1 A;  4XU1 A;  2MMP A;  4X9D A;  3DLL A;  1MMD A;  3KFV A;  3C4S A;  2FO0 A;  1MND A;  4M7A G;  2MYS A;  1OZ3 A;  4KGX B;  1WZO A;  1WJS A;  2ZPE B;  2K6D A;  3OYY A;  4FT4 A;  1T3L A;  2BZ8 A;  2CSI A;  2H3E B;  3F70 A;  4EMK A;  2ZPF B;  2A37 A;  3CBM A;  1N9R A;  1M4Z A;  3QWY A;  1K73 U;  1AWX A;  1JQQ A;  3EFO A;  2MCN A;  3QWX X;  3HHT B;  2AIR B;  5GAM f;  3PNW C;  3BY7 A;  3CD6 T;  2DBM A;  3MEU A;  1M2V A;  2H8H A;  5FU7 B;  1ZBX A;  5DY9 A;  4M7A B;  4CI0 C;  2CZ1 B;  1RAD B;  1SRL A;  3SFM A;  1M1K U;  1NLP C;  2MF2 A;  5LJ3 f;  1OPL A;  3OW2 S;  4BDY A;  2DZC A;  2C06 A;  2RQR A;  3CD6 A;  3ZFJ A;  2OAU A;  1WXU A;  1OYX A;  4M7D C;  1VQ6 Q;  1OEB A;  2AK5 A;  4L59 A;  2R57 A;  2DTO A;  1VQ4 Q;  2P4R A;  1QVG S;  1BB9 A;  1YFN A;  3EHQ A;  3UT1 A;  1FYN A;  4JUV A;  1E7O A;  1T3S A;  2L3S A;  2DL4 A;  2ZPH B;  3OS0 A;  1VQP Q;  3JB9 J;  2ATC B;  3MCA B;  4KGZ B;  3FRN A;  4M4Z A;  3WXM B;  4C92 C;  1OU8 A;  1NG2 A;  3RKY A;  1GCP A;  1YI2 A;  4MZT A;  4RTX A;  1JB0 E;  4IUT A;  4J6X A;  4BUG A;  2CSQ A;  1VQ5 Q;  2HEQ A;  1Z9Q A;  2K57 A;  5EG2 A;  4OGC A;  1VQL A;  4FIB A;  2R58 A;  1G3W A;  2QQB A;  3JV3 A;  4OMO A;  1W6X A;  3ER0 A;  4A63 B;  4ME7 A;  3JRZ A;  1K76 A;  4QT7 A;  4OMQ A;  3CCR A;  2FYK A;  4IIM A;  3PFS A;  1NEG A;  1RL2 A;  2JN0 A;  2KNB B;  2M9U A;  4M7D F;  3M0S A;  2BTT A;  1VQO A;  2HAX A;  4M7D D;  5GAN 3;  2R5M A;  1VQ9 Q;  1J3T A;  3UA7 A;  2SEM A;  1GBR A;  5L8R E;  3BW1 A;  3CQT A;  2ROT A;  3FJ5 A;  2HSE B;  3JB9 I;  1MGQ A;  1OOT A;  1NZ9 A;  2P0P A;  3CCJ Q;  5GMK e;  1FMK A;  3EGU A;  1WA7 A;  2O31 A;  1VQK Q;  4C92 F;  2CH4 A;  1O9S A;  4HCZ A;  4OMP A;  3I55 Q;  1K9A A;  2E4H A;  5IN1 A;  2F2X A;  1K8A R;  5GAO r;  4C92 D;  1M1K C;  1WDX A;  1WXB A;  1U3O A;  2EKO A;  3CCE T;  3LWI A;  1D3B B;  2AZS A;  4M78 G;  1FMV A;  1PNJ A;  5D7U A;  3TQ7 P;  5FW9 A;  5GAN 5;  1NM7 A;  4QKU A;  4F7U G;  3HRS A;  4FYY B;  1VIE A;  2DXU A;  3MP8 A;  2ECZ A;  4ZNX A;  1YJN T;  2BKD N;  4IUV A;  1Q86 R;  1WYX A;  1H8K A;  1G3Y A;  1MMG A;  2EW3 A;  3PVQ A;  2YUP A;  2CUD A;  5GAN d;  2CYZ B;  3E9G A;  1Z9Z A;  4NL2 A;  5GAN 4;  3G71 T;  2DYB A;  5CKE A;  5A0G A;  5LJ3 h;  1LOJ A;  1TSF A;  2KBT A;  2YWW A;  1A0N B;  4M78 B;  4IUP A;  4AFU C;  3RNJ A;  2Y4Y A;  2WSF E;  4DOV A;  1YIJ T;  2RHU A;  2F1L A;  2BE9 B;  1TUG B;  4F7U B;  1ZX6 A;  4TVR A;  1RAF B;  3QDR B;  1QVP A;  3QSU A;  2JMA A;  3LX7 A;  2KYM A;  4XU3 A;  3OYD A;  2EYX A;  2P0K A;  3NGP A;  1WXT A;  1WHL A;  5CR2 A;  4QVZ A;  1PD1 A;  3CC7 Q;  1BK2 A;  1M90 R;  2HNI A;  2CZ0 B;  3OYK A;  3X20 B;  2E64 A;  4N4G A;  3UF4 A;  4J9H A;  1R0B G;  1GCQ C;  1YIT T;  1UJY A;  2RH2 A;  1TXQ A;  4M7D E;  4JZ3 A;  3M55 A;  2HSP A;  5GMK j;  1H3H A;  2J05 A;  4OP0 A;  1UB4 A;  1R8O B;  5KYX B;  2Y90 A;  1VA7 A;  1VQN T;  1R77 A;  3G1J A;  4BY6 C;  3M5A A;  3G7Z A;  1SPK A;  3VS5 A;  2X35 A;  3G6E A;  3TVT A;  1KC8 C;  1WIE A;  4A54 A;  4ZTF A;  1AHJ B;  2VVK A;  2MI6 A;  5KYX A;  4C92 E;  2V1Q A;  2PUO B;  1S72 Q;  3V8L A;  3CBP A;  2EGC A;  2KDS A;  2RM4 A;  1LJO A;  8AT1 B;  3LLR A;  1B34 A;  4M75 A;  1VQ7 Q;  2XHC A;  2DRK A;  3EGD B;  4QVC A;  1CKB A;  1YCS B;  1MHN A;  5LL6 S;  3CCM T;  3CCL A;  1QMC A;  1ZUY A;  3ZBD A;  5GMK l;  3CC2 Q;  1JBM A;  3HRU A;  4E7K A;  3EH2 A;  2GGR A;  1Y07 A;  4A4E A;  2CGH A;  2COW A;  4Z89 A;  2EQM A;  1KHC A;  1GXI E;  3O8V A;  2FG0 A;  2E5Q A;  3CPF A;  1NPR A;  4B9X A;  2XDD A;  4HA8 A;  2KY9 A;  2QAZ A;  2YSQ A;  3THK A;  3HPW A;  3CPW A;  4Y28 E;  3RES A;  2BIV A;  4IUQ A;  2O2O A;  1T0H A;  4MMK A;  1IHV A;  3CCU Q;  4E7H A;  1BI1 A;  2E65 A;  1I4K 1;  4PJJ A;  2VGM A;  4AT1 B;  1M9S A;  3HKS A;  4C0D C;  2BUD A;  1BI0 A;  2DTH A;  2YDL A;  1C0M A;  5CCA A;  3KUF A;  1TUD A;  3M58 A;  2RI3 A;  5KYW B;  3PIO A;  2YXY A;  2CP0 A;  3MKD A;  3QG1 A;  3OY9 A;  4MDX A;  2RB6 A;  1IXD A;  4E7L A;  2DO3 A;  2VKN A;  2RQU A;  2WAC A;  1AZE A;  5KCH A;  2DTI A;  2DRM A;  4FSX A;  2JM8 A;  2QYZ A;  1UDL A;  4F04 B;  2YUO A;  3OBY A;  2D9T A;  5GAN e;  3OYF A;  4AFS C;  1NJI R;  2HBW A;  2XDP A;  2DZ9 A;  4C8Q G;  4N0A A;  1VYT A;  4FL6 A;  4JJN K;  1UE9 A;  2DE0 X;  2FZG B;  1QWF A;  1VYV A;  2MWO A;  1X2K A;  1YJ9 Q;  2OTL T;  4RTW A;  3I5S A;  3OSS C;  2DL7 A;  1X75 C;  3QJ6 A;  2F69 A;  3UAT A;  4B9W A;  4V2S A;  2XKO C;  1PKS A;  5GMK m;  1DJ7 B;  3JCM g;  4XU0 A;  1ABO A;  2F5K A;  5KE3 A;  3L2R A;  2KXD A;  2VYT A;  4C8Q B;  4EMK C;  2OTL A;  4HCB A;  2CDT A;  2PVO B;  4C5I A;  1SHF A;  2DJQ A;  1FXX A;  2RI5 A;  4HVU A;  3SWN B;  4CC7 A;  1M5Q 1;  1IO6 A;  1M3A A;  1RUW A;  1IGU A;  1KQ1 A;  1KD1 U;  2EBP A;  4WTO B;  4M77 C;  1QCO A;  1XOV A;  5EC7 A;  2E41 A;  3RMS A;  4BY6 B;  3MET A;  3SWN A;  3M0Q A;  1VQM T;  4BE2 A;  2FPF A;  1Q82 R;  4EDU A;  2CUB A;  5LJ5 g;  1VQ6 A;  2WSC E;  5AT1 B;  2E3I A;  3TEE A;  2FPE A;  4RTV A;  3S3N A;  3SB2 A;  5CQX A;  2DJZ A;  2PZ1 A;  3OYA A;  5KCO A;  2GNC A;  1NLO C;  4AMC A;  3RR6 A;  4PJM A;  1VQP A;  2NUT A;  1ZLM A;  1ZUK A;  1OQK A;  5L23 A;  2O88 A;  2QA4 T;  2OI3 A;  4PJO C;  5GAN j;  2GTJ A;  1K73 R;  2QDY B;  2KQW A;  3EFR A;  5KYU A;  2PNI A;  1UHF A;  1ZBJ A;  2LZ6 B;  2O4X A;  2O9V A;  2YRD A;  3HP9 A;  4HXJ A;  3H0H A;  2B86 A;  3CC4 T;  1ACM B;  1SHG A;  2CP3 A;  2D8J A;  8ATC B;  2IVW A;  3VS3 A;  1SSH A;  2XIC A;  1M1K R;  1BKB A;  4JZ4 A;  4DEY A;  2K79 A;  3R6N A;  1O75 A;  2CRE A;  2BZX A;  3EG2 A;  3JSC A;  2NYS A;  5FLX E;  2EQK A;  2QGF B;  3CPW P;  1VQ9 A;  2MK5 A;  2XI9 A;  2QGG A;  4FM4 B;  3OYE A;  2RHX A;  4DOW A;  1XTD A;  5GAM d;  4MZP A;  2IPO B;  3QZ9 B;  5KYY A;  2L3Q A;  3CCJ A;  3OW2 A;  2JM9 A;  4E7I A;  4ZN1 A;  1ZSZ B;  3QO3 A;  1UFF A;  1WJQ A;  2LX7 A;  1WHJ A;  3J81 E;  3NTK A;  1VQK A;  3G4S Q;  4L5G A;  3I55 A;  2QK0 A;  2GTO A;  2L0A A;  1QWE A;  5LJ3 d;  4ESR A;  1WLP B;  3UWN A;  1UGQ B;  1QVG A;  1OU9 A;  3CME T;  2AT1 B;  4OMF B;  1T0J A;  2RN8 A;  3MP1 A;  1IHW A;  2LJ1 A;  2RQW A;  5FRM A;  1KJW A;  2SRC A;  3RUX A;  2A36 A;  4D6W A;  4EMG A;  4OB0 B;  1WQ7 A;  2E5K A;  1RAG B;  5FU6 B;  1RAA B;  2EQJ A;  2ZPI B;  5IHI A;  2CZ6 B;  4MML A;  1YWO A;  3CME A;  2QEX Q;  3S3O A;  4BB7 A;  2E70 A;  4PFZ A;  3MEW A;  2JTF A;  2HQH A;  4XTY A;  4EIK A;  4XTU A;  3OS5 A;  1E6G A;  6AT1 B;  1E6H A;  2LVM A;  3CMA Q;  2RNA A;  3WVE B;  3MEV A;  2RK2 A;  2JTM A;  4M77 G; 
#chains in the Genus database with same CATH homology
 4HCC A;  4C92 F;  2L5Q A;  1O9S A;  4HCZ A;  4L6V 5;  2VUB A;  2HD0 A;  3H8Z A;  2MWP A;  3QPH A;  5IN1 A;  4C8Q D;  2RHZ A;  3R6O A;  5GAO r;  3GIB A;  4BD3 A;  4C92 D;  1FWZ A;  3OYN A;  3CCS A;  1VQ4 A;  1M1K C;  1VQ8 T;  1H3Z A;  1I5L A;  1N8R U;  3A8G B;  3G4S T;  5HK0 A;  2EKO A;  2LCC A;  3FEO A;  3CCQ A;  4CRI A;  3CCE T;  3J7A F;  4M7A C;  1I81 A;  2GFA A;  2VXF A;  1D3B B;  3LWI A;  4HT9 A;  4M78 G;  2B8A A;  2E10 A;  4II1 A;  3BDU A;  2K5F A;  2RD1 A;  1Q86 U;  4LD9 K;  1VQ5 T;  3BDL A;  2LT1 A;  3LH0 A;  3V7R A;  5GAN 5;  3V7C A;  3GP8 A;  4F7U G;  3HRS A;  1VIE A;  5IT9 E;  5AYF A;  4J5Y A;  2RJE A;  5A0L A;  2DXU A;  3CC7 A;  2QXF A;  5GAN 8;  4M77 E;  4JS5 A;  3MP8 A;  3CCM A;  1YJN T;  2CS7 A;  1JJ2 A;  2BKD N;  4IUV A;  4LD6 A;  1X01 A;  1VQ8 A;  5D6Y A;  4XTW A;  1G3Y A;  2EIF A;  4PJO G;  5LJ5 j;  5GAN d;  2CYZ B;  4OVA A;  3SDZ A;  1JRI A;  3VUB A;  5A0D A;  3SD4 A;  4M77 B;  3E9G A;  1YHQ A;  2XDB A;  2ZGW A;  3KXT A;  4NL2 A;  5GAN 4;  4XTX A;  1VQ5 A;  3G71 T;  3JB9 F;  1M1F A;  5CKE A;  3CCV A;  1VQ9 T;  5A0G A;  5LJ3 h;  1LOJ A;  2DD5 A;  2QTX A;  2QEX T;  1KHI A;  2ZZD A;  3JB9 D;  3C94 A;  2X4J A;  3CCL A;  1VIF A;  4IKF A;  2RA2 A;  4NS5 A;  4M7A A;  3DKM A;  2VXE A;  2I2L A;  4IUP A;  4KBM B;  2Y4Y A;  2WSF E;  4LDW A;  2K3X A;  4M78 B;  4DOV A;  5GAM g;  1YIJ T;  3CCJ T;  2QQS A;  2RHU A;  1P92 A;  1ZHI A;  3CMA T;  4F7U B;  4PJO E;  4A53 A;  4TVR A;  2EJG A;  4O6J A;  3JCM b;  3RIR A;  1G5V A;  1IZ6 A;  3QDR B;  1QVP A;  2Y4X A;  3C95 A;  1VQK T;  3QSU A;  3LX7 A;  1YI2 T;  3I55 T;  4BDZ A;  4QW2 A;  1M90 U;  1UGP B;  4XU3 A;  5I2M A;  3OYD A;  4O5V A;  4M7A F;  2DD4 A;  2FHD A;  3M4G A;  4OB3 B;  2P0K A;  1KQ2 A;  4HT8 A;  5CR2 A;  2XG8 D;  3CBO A;  4M7A D;  4QVZ A;  5LJ3 g;  2V8I A;  2LQK A;  4IUU A;  2PVD B;  4R55 A;  4JS4 A;  1YJW T;  1VQL T;  3JCM P;  1NJI U;  2HNI A;  3TRE A;  4PLL A;  4QVD A;  3LW5 E;  4C0D B;  2DK3 A;  2CZ0 B;  5CKB A;  1VQ7 A;  4XK8 E;  2V8K A;  3OYK A;  3X20 B;  3CCR T;  2IG0 A;  3VU3 C;  2E64 A;  4N4G A;  2EFI A;  2XK0 A;  1YIT T;  3OYB A;  4MDW A;  2RH2 A;  3MEA A;  5GAN 7;  3J80 E;  4M7D E;  2ZPB B;  3M55 A;  3DB3 A;  3JCM f;  1VQO T;  3CC2 A;  5FU6 C;  4A4H A;  5C6S A;  4M75 C;  3LYI A;  3I56 A;  3E1S A;  3OMC A;  4J7I A;  5GMK j;  5CVI A;  1XNI A;  4OP0 A;  3T9N A;  1UB4 A;  2JOY A;  3M4Y A;  1YBY A;  4QQ6 A;  2K5I A;  1R8O B;  4C5E A;  1UGS B;  3QKJ A;  4P5N A;  3EAE A;  3PIP A;  2GQV A;  2Y90 A;  1LNX A;  1N6A A;  3OYC A;  1N9S A;  1VQN T;  3HL8 A;  3NTI A;  4BY6 C;  3M5A A;  4XTZ A;  1W4S A;  3G7Z A;  2LCL A;  4MZM A;  2X35 A;  5FRO A;  4A4G A;  3G6E A;  3TCJ A;  1KC8 C;  1NPP A;  4A54 A;  4ZTF A;  1QP3 A;  4PLI A;  4ELY C;  4LDU A;  3CCS T;  3QUI A;  1N8R C;  1AHJ B;  2RO0 A;  2WSE E;  2MI6 A;  1NE8 A;  2JUF A;  4C8Q E;  5CKD A;  5KE2 A;  4C92 E;  1XQH A;  3OYG A;  4ZGE B;  2PUO B;  1Q81 C;  1Q86 C;  2LRQ A;  3FDR A;  3CCU A;  3FC3 A;  3V8L A;  1IRE B;  5GAM e;  3CBP A;  3P8H A;  1BIA A;  2KDS A;  2RM4 A;  2DXT A;  3CCQ T;  3X26 B;  1LJO A;  5CKH A;  2K3Y A;  1B34 A;  2EJ9 A;  3LLR A;  4M75 A;  5LJ5 f;  3JCM X;  2OTJ A;  4EPC A;  3CPW S;  2LX9 A;  2DEQ A;  5D6X A;  3VYH B;  2XHC A;  3BFM A;  2FVU A;  3PT9 A;  4IUR A;  1H64 1;  3RER A;  3OYJ A;  3URG A;  4C5G A;  4GLK A;  4JDS A;  2V8J A;  4QVC A;  2X4X A;  3JCM d;  3CC7 T;  2LTO A;  3MHX A;  1MHN A;  1V29 B;  1U1S A;  2MAM A;  5LL6 S;  2LNV A;  3GLX A;  3QBY A;  1PSE A;  5D6W A;  3GPL A;  5GMK l;  5DLQ E;  3ZBD A;  1WJR A;  3OYL A;  5GMK i;  1KC8 U;  5GAN 2;  1JBM A;  1HXD A;  5LJ3 e;  3HRU A;  4E7K A;  3JB9 H;  4KUD K;  2PUK B;  1Y07 A;  4M75 F;  5FU7 C;  3JCM W;  4A4E A;  2CGH A;  2YLC A;  3M53 A;  2EQM A;  1Q82 U;  1BI2 A;  3QJY A;  1KHC A;  4JRI A;  4ZGJ B;  2LT4 A;  4X34 A;  3O8V A;  1GXI E;  4ZN3 A;  2DKG A;  2E5Q A;  1NPR A;  3CPF A;  4M75 D;  4EMK B;  5GAN g;  3TU4 K;  1YHQ T;  1Q81 U;  1M1G A;  2M1H A;  5GAO q;  4B9X A;  3AHU A;  4XQ3 A;  3CCV T;  2DVE A;  2A7Y A;  3RKW A;  2XDD A;  4HA8 A;  2H3J A;  2RJD A;  2KY9 A;  4J6Y A;  3MP6 A;  4BI8 B;  3OA6 A;  1D3B A;  4M78 C;  5HKC A;  3HPW A;  3CPW A;  4J7F A;  3P8B B;  3JCM V;  3L2V A;  4BI3 A;  1X6O A;  4Y28 E;  2DAQ A;  3A8H B;  3RES A;  2BIV A;  4RCB A;  1M90 C;  1SSF A;  4IUQ A;  1WPY A;  3NFC A;  1KG1 A;  3OS1 A;  3PMI A;  4MMK A;  4E7J A;  3VYG A;  2O4X B;  1VQM A;  5LJ5 d;  2YLB A;  4E7H A;  1I8F A;  1QW1 A;  1BI1 A;  1NJI C;  2E65 A;  4RG8 A;  1FX7 A;  4M7A E;  1I4K 1;  2R5A A;  4A4K A;  2AHJ B;  5M9O A;  1S72 T;  3VUZ A;  2VGM A;  2FB7 A;  2ZCF B;  1YCY A;  2K5L A;  5CO7 A;  2P4T A;  4JRK A;  4N4I A;  1M9S A;  1WGS A;  3HKS A;  3UDC A;  4M77 A;  1HK9 A;  1U1T A;  2LC4 A;  4QQD A;  1YJ9 A;  4GY5 A;  3MO8 A;  3INZ A;  4C0D C;  2BUD A;  5CIU A;  3RKX A;  1Q7Y U;  1BI0 A;  4XAX B;  3N5B B;  1WNL A;  2DTH A;  3L1A A;  1VQ7 T;  3OBW A;  3HRT A;  4YTL A;  4OGE A;  5CCA A;  3ASK A;  3KUF A;  3PTA A;  4OF1 A;  3EFS A;  4Z02 A;  4VUB A;  3L2Q A;  3M58 A;  2X4W A;  2RI3 A;  4NL3 A;  4M7D G;  3VV0 A;  4M78 A;  3PIO A;  2QA4 A;  1ZQ1 A;  4M77 F;  3CC2 T;  2KSS A;  3QG1 A;  5GAN 6;  3I56 T;  1U8R A;  1S72 A;  3HSB A;  3OY9 A;  3DLM A;  4MDX A;  4PJO B;  4PL6 A;  2RB6 A;  4Q5W A;  3V8J A;  4F7U A;  4E7L A;  2DO3 A;  2L3R A;  4M77 D;  3ZEH A;  4C0Z A;  2WAC A;  5KCH A;  4OB1 B;  2DTI A;  4ELZ C;  3X24 B;  3X25 B;  4FSX A;  5CQY A;  1BYM A;  2RJF A;  4M78 F;  2YHT A;  4KT0 E;  3V7S A;  3CC4 A;  3VKI A;  1W2B S;  4PJO A;  3OBY A;  2D9T A;  3G6E T;  5GAM j;  5GAN e;  4J6W A;  3OYF A;  4HKE A;  5FRN A;  2P0Q A;  4F7U F;  2XDP A;  2DZ9 A;  4M78 D;  2E6N A;  4C8Q G;  3JCM J;  4N0A A;  5C0M A;  4C92 G;  3QXE B;  3JCM h;  4FL6 A;  3JCM Q;  4UC4 A;  5GAO l;  1N27 A;  3QZ5 B;  2VV5 A;  1PSF A;  3V8K A;  2X4Y A;  4JJN K;  5I2S A;  2K4Y A;  4DQ2 A;  2G3R A;  3CEY A;  4PJO F;  4M7D B;  3M56 A;  3CCU T;  4BE0 A;  1M8V A;  2L89 A;  3P8D A;  3FB9 A;  3LGL A;  2MWO A;  4LDY A;  5LJ3 j;  2OTL T;  2JZ2 A;  2QQR A;  5HK3 A;  4BE1 A;  4PJO D;  2OTJ T;  3OSS C;  2GF7 A;  5DLO A;  3L42 A;  1X75 C;  4JRP A;  2HBP A;  4RMO A;  1Q82 C;  3QJ6 A;  1Y96 B;  2YRV A;  3A5Z B;  2F69 A;  4ZTJ A;  1KD1 C;  4PNO A;  4B9W A;  5CKF A;  2D6F A;  4ATO A;  2XU8 A;  4V2S A;  1W2B A;  2KMT A;  3CCL T;  2XKO C;  2QQ9 A;  5GMK m;  1K9M U;  1DJ7 B;  3JCM g;  2GFU A;  4XU0 A;  2F5K A;  5KE3 A;  3GOX A;  2LQ8 A;  3L2R A;  5HY6 A;  4M75 E;  4XU2 A;  2RJC A;  2VYT A;  3OYH A;  4C8Q B;  4EMK C;  4C92 B;  2OTL A;  2DPP B;  4HCB A;  2DIQ A;  3JB9 G;  2PVO B;  4Y91 A;  5LJ5 h;  2O01 E;  4C5I A;  4A4F A;  4OB2 B;  3H6Z A;  2M0O A;  3WVD B;  3A8M B;  3FIF A;  1UGR B;  4J8O A;  1FXX A;  2RI5 A;  1OZ2 A;  3QYG B;  4J83 A;  2F5T X;  2DXB A;  3SWN B;  1M5Q 1;  2EYQ A;  2JVV A;  3PGG A;  3VJP A;  5CK9 A;  3M59 A;  1K73 C;  4EMH A;  3OB9 A;  2RK1 A;  4XU1 A;  2MMP A;  1KQ1 A;  2PU9 B;  4X9D A;  3DLL A;  1KD1 U;  3OYM A;  2KAF A;  5J39 A;  2HQX A;  4M77 C;  1XOV A;  2LDM A;  2E41 A;  3RMS A;  4BY6 B;  3C4S A;  3MET A;  3SWN A;  1K8A U;  1VQM T;  4JRQ A;  4BE2 A;  2PVG B;  3S3M A;  4M7A G;  2QQA A;  2PQW A;  1OZ3 A;  4BI4 A;  1Q7Y C;  2XID A;  4EDU A;  2ZPE B;  1WJS A;  3E9F A;  4FT2 A;  4FU6 A;  3CXC S;  2ZPG B;  3OYY A;  3S6W A;  5LJ5 g;  4FT4 A;  1VQ6 A;  4C0F A;  2WSC E;  3FJP A;  3TEE A;  2VC8 A;  3S3N A;  3F70 A;  4EMK A;  2ZPF B;  3L2U A;  3SB2 A;  1YJ9 T;  5CQX A;  2DJZ A;  3CBM A;  3OYA A;  2CZ7 B;  5KCO A;  2JNG A;  3HFO A;  3QII A;  1N9R A;  1M4Z A;  1TH7 A;  1K73 U;  5J3B A;  4LDV A;  5J26 A;  1VQP A;  2EJF A;  2DIG A;  1Y7X A;  2A3L A;  1UEB A;  3C12 A;  2DXC A;  2QA4 T;  3HHT B;  5GAM f;  4PJO C;  3PNW C;  3BY7 A;  3CD6 T;  3JCM c;  5GAN j;  5GAM h;  3LGF A;  1KQS S;  2QDY B;  2KQW A;  3MEU A;  4N0A C;  3EFR A;  3JCM e;  2O4X A;  5GMK h;  3G4S A;  1OI1 A;  1EIF A;  3HP9 A;  5FU7 B;  1ZBX A;  5IAY A;  5GAO n;  3CXC A;  3CCE A;  5DY9 A;  4M7A B;  4CI0 C;  5DM7 R;  3DB4 A;  2M16 A;  4BAC A;  2CZ1 B;  2XD0 A;  2RHI A;  2VGN A;  3CC4 T;  3SFM A;  4M78 E;  1M1K U;  2MF2 A;  3ME9 A;  5LJ3 f;  2K2V A;  4KUL A;  3KBG A;  3OW2 S;  4BDY A;  3JAM E;  2DZC A;  4F7U E;  2IVW A;  2C06 A;  2EWN A;  3A8O B;  4KUI A;  3M57 A;  3CD6 A;  1YJN A;  3GF5 A;  3ZFJ A;  5A2Q E;  2XIC A;  2OAU A;  2FL7 A;  5GAO m;  4JLG A;  3E19 A;  1BKB A;  4JLI A;  1OYX A;  3NTH A;  4M7D C;  2EQU A;  1G3S A;  1G3T A;  2E12 A;  1O75 A;  1WQW A;  3RMQ A;  2NLU A;  3PMT A;  4RG2 A;  4L59 A;  4C5H A;  2R57 A;  3JSC A;  2DTO A;  1BIB A;  1KQS A;  3FLG A;  5FLX E;  4X9C A;  1QVG S;  4LDX A;  1VUB A;  3UT1 A;  3X28 B;  3G71 A;  1QVF S;  2EQK A;  1QP2 A;  2RHY A;  1BI3 A;  4ZGD B;  1K9M C;  4JUV A;  4NOY A;  1VQ9 A;  2QEX A;  4WF2 A;  2XI9 A;  2L8D A;  2ZPH B;  3OS0 A;  4FM4 B;  3OYE A;  2RHX A;  4DOW A;  4E47 A;  1XTD A;  5LJ5 e;  5GAM d;  2KK4 A;  3JB9 J;  4MZP A;  3CCM T;  3GNG A;  3OS2 A;  1YIJ A;  3MCA B;  3QZ9 B;  3A8L B;  4M75 G;  2CKK A;  3CCJ A;  3OW2 A;  1Y71 A;  3CMA A;  4E7I A;  4ZN1 A;  5I21 A;  3LWH A;  3QO3 A;  3FRN A;  3OSV A;  1WJQ A;  4C8Q C;  3WXM B;  4C92 C;  3M9Q A;  3J81 E;  3NTK A;  3RKY A;  1VQK A;  4L5G A;  1YI2 A;  3I55 A;  4MZT A;  1JB0 E;  4N4H A;  5LJ3 d;  4IUT A;  4J6X A;  3QYH B;  4BUG A;  3SWN C;  3UWN A;  1UGQ B;  3OMG A;  4M7D A;  2K57 A;  3OYI A;  3HFN A;  5EG2 A;  4OGC A;  1QVG A;  1QVF A;  3CME T;  1YJW A;  4FIB A;  4R56 A;  1RI0 A;  1VQL A;  2R58 A;  1K8A C;  1G3W A;  2QQB A;  3L2Z A;  5GAO p;  3ER0 A;  4ME7 A;  3JRZ A;  3GNF B;  4QQG A;  3CCR A;  4OMF B;  2E6Z A;  3MP1 A;  3QHS A;  4XTV A;  2FYK A;  4DA4 A;  2EAY A;  3PFS A;  1Y96 A;  2QI2 A;  5FRM A;  1RL2 A;  2JN0 A;  3Q1J A;  4RCC A;  2M9U A;  2RI2 A;  1YIT A;  4M7D F;  3RUX A;  4D6W A;  4RKU E;  4OB0 B;  4C0G A;  4EMG A;  1WQ7 A;  1VQO A;  2HAX A;  3UPU A;  1B34 B;  2E1H A;  2D0Q B;  4M75 B;  2EQJ A;  2ZPI B;  5FU6 B;  2CZ6 B;  4MML A;  5GAN 3;  4M7D D;  2R5M A;  1VQ6 T;  2GCX A;  3CME A;  3S3O A;  4C8Q A;  4BB7 A;  5KH6 A;  2E70 A;  4C92 A;  2HQE A;  5GAN f;  3M54 A;  1VQ4 T;  5L8R E;  3MEW A;  2JTF A;  3BW1 A;  5GAN h;  1VQN A;  4XTY A;  2KVQ G;  4XTU A;  1MGQ A;  3OS5 A;  5CAI A;  3JB9 I;  3L2W A;  4PKC C;  1NZ9 A;  2LVM A;  2P0P A;  1JJ2 S;  5GMK e;  3WVE B;  1VQP T;  3MEV A;  3OQ5 A;  2RK2 A;  4C8Q F;  2JTM A;  4M77 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...