4M7DB

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 18
structure length 92
sequence length 92
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dB00
1B34B 2ZGWA 3V8KA 3RESA 4M75A 4C92E 1I81A 4EMHA 5GAOm 5GANj 4PJOC 4WF2A 4XU2A 4C8QF 4F7UA 5GAMe 5GANf 2EWNA 4XU3A 4C8QB 5GAMf 5GANe 5GAMh 1YCYA 1HK9A 4M75G 3JCMh 4M7DF 4M78E 1KQ1A 3JCMX 4M7DB 4JRIA 1WNLA 4J5YA 2YLBA 1I4K1 2EJ9A 5GMKj 3JCMW 3JB9D 4XTYA 4PJOF 3HSBA 1LOJA 4M78C 4M7DD 3QSUA 1WQ7A 4DQ2A 4RCCA 5GAN4 3JCMf 5GAN8 3JB9F 3L1AA 3JCMe 5GAOl 4M78G 4A53A 5GANh 5LJ3e 4M7DE 3PGGA 4XTZA 4N0AC 5LJ3f 4F7UF 4QVCA 3EFSA 4M75E 4C92C 3QHSA 5GMKi 4NL2A 3JCMJ 3RUXA 5LJ5f 5GAN7 4PJOD 2QTXA 3BY7A 4PJOA 2E41A 3JCMc 4JLIA 4M75C 1U1TA 3BW1A 4X9CA 3M4GA 4M77E 5DY9A 4XU1A 3SWNA 4EMKA 5GAOq 5LJ5j 3JB9J 4M7AG 1D3BA 2FB7A 2VC8A 4OP0A 5GAN3 1Y96B 4A54A 4PJOB 3V7SA 3EFRA 5GAMg 1KQ2A 3JCMP 3AHUA 1M5Q1 4M78F 4HT9A 4JUVA 3V7RA 3V8JA 2JN0A 4X9DA 3RIRA 1N9SA 4Y91A 4QVDA 4PNOA 1H641 2VXFA 4C92G 2I2LA 4M77G 4PJOG 4F7UB 4XU0A 3BDUA 5GANd 2RD1A 4XTWA 4C8QA 4C92D 3INZA 4EMKB 2E1HA 3JB9G 4C8QD 4C8QC 3QUIA 4M77C 1D3BB 4JRKA 4XTVA 5GAN5 2EAYA 4M7DA 2CGHA 4MMKA 5LJ3g 5GAMj 1Y96A 4M7DC 2DZ9A 4C8QG 1LJOA 1N9RA 2RM4A 2DXUA 2HNIA 2VXEA 4XQ3A 5GMKe 5LJ5g 3GIBA 2YLCA 4M7DG 5CAIA 3RKWA 3RERA 4PJOE 1JBMA 2RB6A 2Y90A 3FIFA 3QO3A 5GMKm 1M8VA 4M77A 1LNXA 4M7AA 4M7AF 5GMKl 4M75B 3JCMV 3FJPA 4M78B 5LJ3j 2DJZA 3VU3C 1BIBA 4C8QE 2DTHA 2E65A 2YHTA 5GMKh 1I8FA 2DTOA 3SWNC 1JRIA 4NL3A 2DVEA 4C92A 3V8LA 2DTIA 1MGQA 4MMLA 4XTXA 5GAN6 3JCMd 4EMGA 4RCBA 2DEQA 1U1SA 5LJ5d 5GANg 4M7AB 5I21A 4HA8A 4N0AA 2K57A 4M78A 5LJ3d 5GAN2 3L2ZA 3SB2A 2EJGA 3HFOA 1I5LA 2RA2A 1B34A 3RKYA 2E10A 4F7UE 2EJFA 3JCMg 4M77D 3JCMQ 3BFMA 4HT8A 5LJ5e 4J6XA 4M75F 4C92F 4C92B 5LJ5h 2DKGA 1HXDA 5GAOp 3JB9I 1TH7A 3RKXA 1BIAA 3FB9A 3JB9H 4M78D 3SWNB 4M75D 3V7CA 3HFNA 4M7AE 5GAOn 2FYKA 5GAMd 5LJ3h 1WPYA 4EMKC 4M77F 3JCMb 5GAOr 1X01A 4M7AC 4M7AD 4XTUA 4V2SA 2E64A 4M77B 2DZCA 4NOYA 4J6WA 4F7UG 4J6YA 1WQWA 2DXTA
chains in the Genus database with same CATH superfamily
1VQ7T 1WFWA 2CP5A 5C0MA 3ZL7C 3PE0A 1VQNA 5FLXE 3NHNA 4XU3A 1JXMA 1PRLC 3CCJA 1FWZA 2EGEA 5GAN4 2JM9A 1PHTA 2IIMA 4C0ZA 4RTWA 1NJIR 4F14A 2GCXA 2B86A 2OTJA 1MMAA 2G6FX 2K6DA 2MMPA 5KYXB 3GNFB 4OMNA 1K8AC 4IIMA 1PWTA 2ZPGB 2QA4Q 2CP3A 3V7SA 4LDWA 3EFRA 4RUGA 2L5QA 2HMAA 4FW2A 2K2MA 1TOVA 4YTLA 2I2LA 2AZVA 4C5EA 3HP9A 1YITT 2VVKA 1D3BB 1I07A 3KXTA 4AG2C 3HRUA 1W1FA 2LCSA 3CMEA 1N9RA 2EW3A 1W6XA 3GIBA 3VYHB 1JBMA 1ABQA 1GFCA 2OTLA 3JCMV 4M78B 4HCCA 2X4JA 2DJZA 3VU3C 3G4SA 1YJ9Q 3RMQA 2YXYA 4ZGEB 2X3XD 2E65A 3UF4A 2GNCA 2XDPA 2E5KA 5CKEA 2DETA 2JOYA 2DTIA 3L2QA 5LJ5d 4C0FA 2DL5A 4Y92A 2C0IA 3OA6A 2FZKB 1DJ7B 3FJ5A 4R0KA 3REBB 2BZYA 5FU6C 4LXCA 2RA2A 1B34A 2EFIA 3PVLA 4J6XA 2R57A 4LUEA 4QQDA 3FB9A 2EGAA 3TCJA 3M0TA 2EGCA 2L2PA 5LJ3h 4M7AD 1SRLA 4C0DB 1CKAA 4M77F 1WQWA 3DB4A 3CPFA 3QDRB 1UHCA 4E7JA 1PSFA 1M30A 1Q82R 2KRSA 5KYYA 3ULRB 1YI2A 1D0ZA 3HSBA 2BE9B 2JS0A 2KY9A 1WQ7A 4DQ2A 2K79A 2BE7D 4JPBW 4RG8A 5I2MA 1UG1A 2GFUA 1WHJA 2XIDA 1RABB 4LDVA 3CCET 4FT2A 1YJWQ 3SWNA 1QVFA 2MCNA 5I11A 1KHCA 1AD5A 2RPNA 3CCLQ 1M8MA 3R6NA 1BCOA 1U06A 1RAHB 2A7YA 3C94A 3X28B 2DXCA 3KUFA 1PCXA 2M16A 2KEAA 1Q86U 2EYWA 3VS5A 1EZZB 3EG0A 5GAN5 2OTLQ 2Y4XA 2GQVA 2DZ9A 5KYWA 2RM4A 3H0IA 2CDTA 3NMZC 2KXCA 1TUDA 3SFMA 2LT1A 4J9DA 3FIFA 1M8VA 2XICA 1N6AA 4IIOA 3PIPA 1ACMB 2EYXA 3CC4A 1XOVA 4C8QE 2KROA 1RLQC 3I56T 3SWNC 3CCJQ 1NG2A 1RL2A 2L89A 2JW4A 4M78A 2RJCA 1WI7A 4F7UE 3CCMT 1YFNA 1U5SA 1QVGP 4JZ3A 4ANJA 1OULA 1SF9A 2KT8A 1YJNA 3TQ7P 2GTJA 4L5GA 4RG2A 1V76A 3CD6A 1X6BA 4F7UG 1YIJQ 2WSEE 4MZMA 4EMHA 3I55Q 1KJWA 1BCMA 4AFUC 3HTRA 5GAMf 5GAMh 2GFAA 2RI5A 4M75G 1Q81U 3JCMX 3VS1A 2NWMA 2YLBA 1E7OA 1K0XA 3OSSC 1ZQ1A 2RJDA 3JCMf 2JTMA 3RMSA 4BUGA 2FO0A 2D9TA 1J3TA 1SEMA 3CCVQ 3L42A 2LJ0A 4PJOD 4OMLA 4HVUA 4PJOA 2KBTA 2ZPIB 1K4US 2NUTA 2VGNA 3QJYA 3JB9J 2FB7A 3VS3A 4ZTJA 2LX9A 4F04B 1M5Q1 4M78F 1G8XA 4OB3B 1QP3A 1H3HA 2QXFA 3QJ6A 3X20B 2MK5A 4LE9A 3EHQA 3Q1JA 1UUEA 4C8QC 2R5AA 1UGSB 4E47A 3CCUQ 3SHWA 4M7DC 1TUGB 2RO0A 2EIFA 2QQAA 1U8RA 2O4XA 3RERA 2NUPB 2Y90A 3PT9A 3QO3A 4N4GA 4J7FA 2ESWA 1P92A 1SSHA 1WHKA 3F70A 2QQRA 3G1JA 3OMGA 2RN8A 1YI2Q 1KK7A 4BY6B 1MGQA 5GAN6 2K3XA 1UB4A 2CH4A 2DE0X 1Q7YR 1JB0E 1QCNA 2E10A 3TSWA 4C92B 2YRDA 1T0JA 2E70A 1D1AA 1UHFA 4KH1B 2E64A 2YRVA 2LJ1A 2CSQA 4LDXA 2CZ7B 2KYMA 1VQ9Q 2JUFA 4WF2A 5GAMe 5CVIA 4C8QB 1OPKA 1KC8U 4JRIA 5GMKj 4KGXB 5KYNA 1SRMA 3CCSQ 4DEXA 4BI8B 3CMAQ 1D1BA 4LUDA 1HYOA 4NL2A 1N8RR 1RAFB 3BY7A 1SG5A 3QIIA 4M75C 4X9CA 5GAOq 1VQLQ 4EMKA 3CCLT 2DK3A 5ECAA 1YITA 5IHKA 2QK0A 1MNDA 1CSKA 3CCUA 4A54A 1EIFA 5FU7C 3NPFA 1G3TA 1VQPA 1Y7XA 3CEYA 3FEOA 2ROLA 2PZ1A 4D6WA 3H0FA 1TUCA 2KNBB 5CIUA 2A08A 4J8OA 4J9HA 2CSIA 3OYIA 5HY6A 3LWIA 4PK4A 1LJOA 2PUKB 2DXUA 4PFPA 4JS5A 4B9XA 2RHIA 2VXEA 4XQ3A 2FEIA 1K73C 1ZSGA 2RB6A 1VQ4Q 3OYHA 5IAYA 3KFVA 1UJ0A 3IQLA 2KVQG 5LJ3j 2B8AA 1X27A 3OYMA 5EG2A 2A36A 4E2FB 1VQOA 4FCYA 2V1RA 3MP1A 3LLRA 1PC0A 5GANg 2L8DA 2XG8D 2K5LA 1UGVA 1VQMQ 3CMET 3CMEQ 3A8HB 4PJNA 4AFZC 4BY6C 2P0PA 2R58A 1BIAA 4Z8AA 1VIEA 4PJJA 2KT1A 2V26A 2A3LA 2O9VA 3EG3A 2DZCA 2SRCA 3M5AA 3QZ9B 1QMCA 1B34B 4Z02A 1SHGA 1RI9A 1YWPA 2VGMA 1GRIA 3TVTA 4PJOC 4KH0B 2CZ1B 3M54A 3MHXA 2QDLA 4M78E 4M7DB 4BDYA 1I4K1 1FXXA 4ZGDB 2CT4A 3G7ZA 1VQ4T 1H92A 3JB9F 1XNIA 4BE1A 3PGGA 1BU1A 3EFSA 3N5BB 1JXOA 5HK0A 3PTAA 3GLXA 1SKUB 1EX4A 2CP6A 3WVDB 2HSEB 4XU1A 1GFDA 1X2KA 1BI0A 1K1ZA 4E7HA 2F5KA 2HCKA 1OPLA 3GPLA 5IH2A 2LTOA 1R0CB 3AHUA 1MV0B 1JO8A 4X9DA 3CCQA 1ZBJA 4PJOG 5C6SA 8ATCB 3SDZA 4JRKA 2KK4A 4Y28E 4C8QG 2PUOB 1VQOQ 1X6OA 5KYUA 1TU0B 3HL8A 5GMKe 3OYFA 1QVFS 4PJOE 3G4SQ 1K8AR 1YJ9A 1C6VX 2RHXA 2ZPBB 3FC3A 1VQ7Q 4HVWA 4ZN1A 2X35A 1WA7A 5HK3A 4R55A 2VKNA 5KYWB 2H8HA 1RAGB 1UGQB 5FU6B 1K76A 2KR3A 2EBPA 1FYNA 2DFUA 1QQJA 3DLLA 1W2BS 1IO6A 2AK5A 3H0HA 2X4YA 2L3PA 1QKXA 2MWPA 5IHNA 3DB3A 2K2VA 3JB9H 3MEWA 4M78D 3SWNB 3OYJA 2DM1A 4JRPA 1H3ZA 3QG1A 4FYWB 2DXTA 3J7AF 3EGXA 1M3BA 3OS5A 4L6V5 3U23A 2RK1A 3D7SB 1HSQA 1I0CA 2DA9A 3WXMB 3OYYA 1HK9A 3JCMh 1ARKA 3JCMW 2RI2A 4ELYC 2DILA 3P8DA 2V8KA 3CC4T 4GLKA 3JCMe 2HKQB 2RMOA 4C92C 4HKEA 2D6FA 3EFOA 2WSFE 2J06A 2PNIA 5LJ5f 4FSSA 2ZCFB 2Z0WA 5A0DA 1AWJA 1RACB 1D3BA 2A0FB 1SHFA 5GAN3 4J9EA 1T0HA 2IG0A 2HDAA 4KUDK 2RI3A 1O75A 1MNEA 2PVGB 4M77G 3MPUB 8AT1B 4C8QD 1OU8A 4FU6A 3THKA 1FMWA 3O8VA 2A37A 2X51A 3CCVA 4DBHA 2HNIA 4M7DG 2NLUA 1WXTA 3EH1A 1BIBA 2X3WD 2BIVA 1AEYA 2W0ZA 2O9SA 3G71T 3OW2P 2LQ8A 1VQ9T 5GMKh 1I8FA 2EYYA 1JRIA 2DMOA 2FZGB 1XQHA 3RBBB 1M90R 4OVAA 3URGA 1NLOC 3H8ZA 2DNUA 3H6ZA 1VYUA 3TSZA 1I5LA 1R77A 5LJ5e 2FRWA 1YJNQ 2YDLA 2HBWA 2LNHB 5GAOn 1AWWA 2FPDA 4F16A 3JCMb 1X01A 2EKOA 1ZUUA 4BE2A 3VS0A 1B3QA 2JXBA 2RHZA 5FROA 4OGCA 1S72T 2LT4A 1RAEB 3CCEA 3I35A 3X25B 4D8DA 2K9GA 1AVZC 2KRNA 3ZFJA 4M7DD 5D6XA 2DYIA 2OAWA 2F2VA 3VRYA 2AZSA 2ABLA 1FMVA 2QTXA 4LNPA 3JRZA 5FWCA 3I5SA 1PRMC 2HL3A 2X4WA 2JMAA 1KFZA 1IREB 1UFFA 5IHIA 1QCOA 3UPUA 4JUVA 1WJQA 3RDVA 3M0SA 1G3YA 4C92D 4EMKB 1H8KA 4ATOA 2HQEA 2EPDA 3GP8A 3EH2A 5AYFA 2CZ0B 2QAZA 5GMKm 3OYNA 3OQ5A 4OB2B 1WHLA 2DTHA 2AKKA 5D6WA 2AKLA 4OMOA 5KH6A 4PL6A 2GTOA 3HRTA 4KT0E 4PLIA 1RAAB 2RQVA 1VQKT 1M1GA 2XHCA 4MDXA 3CPWA 3VS2A 5L23A 4RTZA 2DL8A 2QASA 4HT8A 5FU7B 2DKGA 3FLGA 1M27C 3HFNA 2HQHA 3QYGB 2FYKA 2MOXA 5KYUB 1VQMT 1O9SA 2F5TX 1RLPC 4DBRA 1WPYA 2NUPA 1VQKQ 4J6YA 3M0UA 4OGEA 1M9SA 1M3CA 4OMPA 4XU2A 1K9MR 3BDLA 1ZSZC 3LH0A 1KQ1A 1VQ9A 1VQMA 4J5YA 4C0DC 4J9CA 4Z89A 4QW2A 5J39A 4A53A 1KD1R 3CC2A 4M7DE 4UC4A 2CZ6B 4QVCA 5KCHA 1IRXA 4M75E 4J9GA 1TG0A 4C0GA 1YITQ 1D09B 2M02A 3OYAA 3JCMc 3MO8A 3EG2A 4OB1B 3ZEHA 5CO7A 1OOTA 3ME9A 1IHVA 2ED1A 1QWEA 1D0XA 3M59A 3G6ET 1KQ2A 3EGXB 2QA4T 1YNZA 1MMDA 1VUBA 2CP2A 2RQUA 1KQSP 1BI3A 2DXBA 4XTWA 2LZ6B 4M77C 2EAYA 2XDDA 1N27A 1Y07A 2LC4A 5LJ5g 1G83A 2O31A 4M77A 5AT1B 2LCLA 5GJWB 4JDSA 3VS6A 4RTVA 2K3YA 2RJEA 2FZCB 2J05A 1ZHIA 4GLMA 3CBOA 5IN1A 2LQNA 3A8MB 4P5NA 2L3SA 4TVRA 4Z88A 4NL3A 4EPCA 2JMCA 3J81E 4XTXA 3CCLA 1R0BG 2VWFA 3EAEA 1M2VA 2F1LA 2F2WA 3FRNA 2HZYA 1ABOA 4BB7A 5GAN2 5J3BA 3SEMA 3VUZA 4RMOA 1JJ2P 1K9AA 3QPHA 1YJNT 2F69A 4QVZA 4EDUA 5HKCA 4KUIA 3RKXA 2J6FA 4M75D 4FSXA 2P0QA 4JJNK 3QZ5B 1TTHB 2KAFA 2RQRA 4J6WA 1S72A 1TSFA 4N4IA 1LVKA 2DVJA 1I81A 2J7IA 2LDMA 3CC2Q 4BI3A 3EHRA 2EWNA 1PG5B 2C0OA 2DPPB 1M3AA 2XU8A 1Z9QA 1Y71A 2EQKA 3E1SA 2L0AA 1KSWA 2V1QA 5FRNA 1VQPT 3DLMA 1LPLA 1BYMA 1RAIB 3QHSA 2K5IA 2LCCA 5GMKi 1MHNA 7AT1B 1GBQA 3QKJA 1KIKA 1YHQT 2MI6A 3M4GA 4M77E 2BKDN 5CK9A 2K7AA 4K11A 2Y4YA 4RTYA 3G6EQ 3G71A 3CD6T 4DOWA 3CD6Q 3VUBA 4QVDA 3RIRA 2P4TA 4F17A 2KRMA 4XU0A 2CT3A 1YHQQ 4FYYB 3LGFA 4MMKA 3M56A 2CYZB 3OW2S 2QQSA 1K0SA 1VQNT 4HVVA 5KCOA 1PD1A 4E7IA 4ME7A 1KD1U 1X69A 3I5RA 1QW1A 3A8GB 1UTIA 2LJ3A 1G2BA 1SSFA 3OSVA 2DD4A 2LX7A 2XI9A 1VQ5Q 1WHGA 2DTOA 2RK2A 3I55T 1K8AU 2QG9B 4FT4A 4LDUA 4ELZC 2CKKA 3MEUA 2K3BA 1BKBA 5LJ3d 1Q82C 4WCIA 3RR6A 4FL6A 5CKFA 1GL5A 1I5OB 4LD9K 3RKYA 4AFQC 3A1PA 4FYVB 4DBFA 3EG1A 1B07A 5LJ5h 3TEEA 2M0YA 4CC3A 4CC7A 1KD1C 4FM4B 1M2OA 3OYDA 3META 2VV5A 2EQIA 2ZAEA 3M53A 1Q7YU 2LRQA 5GAN7 4C92E 4IUUA 4R56A 1BK2A 1YWOA 2OX7A 2QTVA 4F7UA 5GANf 2MF2A 1WDXA 1XTDA 2OTJQ 2YUNA 1VQOT 3CCQQ 3JB9D 1PD0A 3CPWP 2CH4W 4RCCA 1X43A 1ZUKA 2ZPHB 3PFSA 1E6GA 3CCMA 1MMGA 3GNGA 2IVWA 2RHUA 3EG9A 1Q82U 4OMQA 2RQTA 5CKBA 4II1A 2DL3A 5DY9A 4Q5WA 4DBQA 2JVVA 2RHYA 2GF7A 3S6WA 5LL6S 3OYLA 1N5ZA 3GF5A 3H41A 1VQLT 3QYHB 1S1NA 3MEAA 1NJIU 3QWYA 2HD0A 1Y0MA 4C92G 1D1CA 1VOMA 3UA7A 1YN8A 3QBYA 1YJWT 2M0OA 3OS2A 4XTVA 3L2UA 2KI7A 1OI1A 1YBYA 1R8OB 2OTJT 1M1FA 2ECZA 2LNVA 2J6KA 3MCAB 1S72Q 1JJ2A 1LNXA 1OU9A 4FW1A 3LYIA 4VUBA 2DX1A 2C0TA 4DA4A 3FJPA 2HL5C 2FPFA 2VASA 1T3SA 3M0RA 4C92A 2QQ9A 3I9QA 5DM7R 4RCBA 2DEQA 2QDYB 5I22A 1GCPA 1NM7A 3EGDB 2K57A 3VS4A 2ZPFB 2JJ9A 4RTUA 3MP8A 3JAME 2MWOA 1M1KR 1PKTA 4M7AE 1UDLA 2LP5A 1B7TA 3VRZA 3MEVA 4E7KA 4EMKC 5GAOr 4V2SA 1AWOA 1NYGA 1VA7A 3OYGA 1YJ9T 3V8KA 3RESA 4J83A 4B9WA 5GAOm 1KQSA 2L3QA 1PNJA 1AZEA 1QVGA 3H9NA 2QQBA 1WLPB 3EFOB 4HCKA 1T3LA 1QCFA 2RNAA 1OZ2A 4XTYA 1NEGA 1ZLMA 1TS9A 1M2VB 4RTXA 4ESRA 3CXCA 2E4HA 5LJ3e 1WIEA 1ZSZB 1VQKA 3LWHA 3L2RA 1U1TA 4M7AG 1QVGS 2D8HA 2YRCA 2DRMA 2VC8A 4E7ZA 1Y96B 1AZGB 1D0YA 3LH5A 1Q86R 1OV3A 3HRSA 4QKUA 3P8BB 2JN0A 1WJRA 2VXFA 3C0CA 1VQLA 1RI0A 5FW9A 3A8OB 3JB9G 3CC4Q 3M9QA 2MAMA 2PVOB 3QWXX 3KBGA 4C5GA 1QVPA 2H3JA 2FVUA 5CAIA 1BI2A 1MUZA 4KRTA 1NZ9A 2HSPA 4M7AA 3WVEB 5GMKl 4GY5A 2K5FA 5CKDA 2YUPA 5CCAA 2O01E 5KYXA 1A0NB 3OYCA 4E7LA 4C5HA 4PLLA 4PJMA 1X75C 3M0PA 1IGQA 4GBQA 3UWNA 3OS1A 3SB2A 1K9MC 2EJFA 4M77D 3JCMQ 3X26B 1VYVA 4ZN3A 3NTKA 2MYSA 4OB0B 3CCJT 1WHMA 3EGDA 1F1BB 1YCSB 2ROTA 4XTUA 2DO3A 4N4HA 2OAUA 3CCRQ 4M75A 1VQ7A 1VQ8Q 3R6OA 4AMCA 4M7DF 1RUWA 2BUDA 3I56A 3PMIA 2D0QB 2ENMA 4XAXB 3A5ZB 1M1KU 2RH2A 1IGUA 2JZ2A 2DD5A 3QSUA 1GCQC 4XTZA 1W70A 4QQ6A 5DLQE 1KHIA 2LVMA 1C1AA 3ZBDA 1ZA1B 1K73U 3CCUT 1Z9ZA 2RJFA 3QDFA 2EYQA 4ZNXA 3OMCA 1ZBXA 1AWXA 4KGVB 4OP0A 1OX9A 2E6NA 2D0NA 1KQSS 5A2QE 3UT1A 3E9FA 3V7RA 1IZ6A 3E9GA 1H641 1LCKA 2E3IA 4CC4B 4RKUE 4IUVA 3CCVT 4XK8E 3MJXA 1AHJB 2O88A 1V1CA 2YLCA 1NEBA 3REAB 4CC2A 4DOVA 4JZ4A 5CQXA 2JM8A 3CC7T 4JJBA 5I2SA 5HCKA 2JTFA 3I55A 5KE3A 2BZ8A 4AG1C 1Q86C 2RQWA 4FIBA 1EFNA 5A0LA 3BE3A 1OEBA 2HEQA 1WZOA 4KBMB 2M51A 1U1SA 5A0GA 1OZ3A 1YHQA 1M1KC 4A4FA 1QWFA 4A4HA 3HFOA 3M55A 1W4SA 4AT1B 3JB9I 1GCQA 1VQ8A 3VJPA 1FX7A 2AT1B 4ZTFA 2XKOC 4M77B 1WXUA 1QKWA 4M7AF 2QYZA 3HKSA 5L8RE 3A8LB 1MV3A 3UATA 5GANe 1VQNQ 1G3WA 1WNLA 2EJ9A 4PJOF 3CC7Q 1QVFP 2E12A 4J7IA 3G4ST 1M90C 2OTLT 2DRKA 5GAOl 1VQ6A 1AOJA 4O6JA 3MKDA 2D8JA 4IUQA 2K4YA 2XDBA 3ER0A 3OYKA 1NYFA 2KMTA 3BW1A 2DL7A 4QT7A 1W2BP 4QQGA 1UGPB 1NBEB 3NTIA 3JCMP 3EGUA 2QA4A 2JTEA 2DL4A 2FHDA 2WSCE 3V8JA 3G6EA 4PNOA 1PKSA 4OMMA 3BDUA 2H3EB 2MPXC 2LQKA 3INZA 3CCEQ 3CMAT 1NPRA 5IXFA 3A98A 1YP5A 2FRYA 3LGLA 1BBZA 1N8RU 2I0NA 2GQIA 2GBQA 2BTTA 3CCQT 4FYXB 2EQUA 4KULA 2RF0A 3CCRT 2G3RA 3JV3A 2NYSA 3QXEB 4X1VA 1VQ8T 1GXIE 3LX7A 1I1JA 1NPPA 3S3OA 5FWBA 2DVEA 4MZTA 3JCMd 2COZA 4EMGA 2JS2A 3CCSA 1CKBA 2KE9A 4PFZA 1U3OA 4A4KA 2HQXA 3L2VA 2L3RA 4JJDA 2EJGA 1G3SA 2DBMA 2YUOA 1N8RC 3GBQA 3BFMA 4M75F 5D6YA 1UE9A 4MDWA 3CXCS 3TREA 1KG1A 3P8HA 4BACA 3CC7A 9ATCB 2M1HA 4M4ZA 2P0KA 3L2WA 3E19A 3M4YA 3G71Q 1K9MU 4LN2A 3CPWS 1VYTA 1LOJA 1X2QA 1TWBA 3M0QA 5CKHA 3L1AA 4M78G 1Q95G 1VQ4A 4N0AC 5LJ3f 2EQMA 1M4ZA 3OYEA 3LW5E 3MP6A 1KC8C 4OF1A 2JT4A 2QEXA 2SEMA 3T9NA 1YJWA 1Q81R 1JU5C 4O5VA 4A63B 4CI0C 4PKCC 5M9OA 4ZGJB 2KQWA 2YT6A 2COYA 3C12A 4HT9A 1AT1B 4L59A 1ZSZA 4F7UB 3J80E 5GANd 2RD1A 3VS7A 4C8QA 2X4XA 4BE0A 3QUIA 1WGSA 1Y96A 4EIKA 1HD3A 2FPEA 2CP7A 2PU9B 1NLPC 1ZA2B 4A4EA 4LD6A 2V8IA 3CCST 4PJLA 2CUBA 3EG9B 3JSCA 2ZPEB 3NGPA 2GGRA 2HBPA 3PMTA 4IKFA 1IHWA 1G5VA 2BZXA 2YHTA 2C06A 3OYBA 2AIRB 3V8LA 4HXJA 2O4XB 4MMLA 5IT9E 2EQJA 1VIFA 4M7AB 2QEXT 5I21A 1VQ6Q 4HA8A 4N0AA 2LMJA 4LDYA 1ZX6A 3L2ZA 3GOXA 5CQYA 2DJQA 3CCMQ 3SD4A 2MIOA 2O2OA 4C92F 2YWWA 2W10A 1HXDA 4PJOB 2DEUA 3DKMA 4D8KA 2QGFB 1ZUYA 5KYYB 5GAMd 2X9HA 3HHTB 4M7AC 4JJCA 3O5ZA 5GANj 2KSSA 4HCBA 5FRMA 3X24B 1YIJA 1UEBA 4C8QF 1YCYA 4JS4A 1PSEA 2FL7A 1Y57A 2FG0A 4M78C 3E2UA 3VYGA 2OI3A 5GANh 3NFCA 1OYXA 3ASKA 3NTHA 1UJYA 2COWA 2YSQA 2DF6A 2PQWA 5GJVB 1JJ2S 3OW2A 3RUXA 2KXDA 1HJDA 2AHJB 4NS5A 2VUBA 1WXBA 3OBWA 2DLPA 2CREA 1JEGA 4J9IA 4E6RA 5CR2A 5GAMg 2KGTA 1UECA 5KE2A 3M58A 4IUTA 1N9SA 4Y91A 1WYXA 2E3HA 5D7UA 4J9BA 4M7DA 4X34A 2OJ2A 5GAMj 3OBYA 1RADB 2QGGA 2CP0A 4HCZA 3VV0A 1QP2A 2PTKA 1BI1A 2ZZDA 3OB9A 4M75B 2DIQA 3UA6A 2E6ZA 3CBMA 4IUPA 2J6OA 1PM3A 2KYBA 1OX8A 3HPWA 5DLOA 5EC7A 2EKHA 2XK0A 2D1XA 1OQKA 4RTTA 1NE8A 2VYTA 1MMNA 2YUQA 1YIJT 2XD0A 2CUDA 3VKIA 3AT1B 3PNWC 4BDZA 4JLGA 1SPKA 1X6GA 1VQ6T 4J9FA 3C4SA 2QEXQ 2WACA 2NUZA 1TH7A 5IXBA 3FDRA 3UDCA 1QLYA 4IURA 3CCRA 1VQ5T 3C95A 3OY9A 2DBKA 2ZGWA 1IXDA 2LQWA 3I56Q 1C0MA 6AT1B 4WTOB 4DEYA 1K73R 5J26A 1VQ5A 1WJSA 3CMAA 2NUTB 5GAN8 2KDSA 1BB9A 1NJIC 2V8JA 4F7UF 4E7SA 3JCMJ 3CXCP 2E41A 4JLIA 1GBRA 3TU4K 5LJ5j 1XJWB 2ATCB 1FMKA 3CBPA 4KGZB 4JRQA 1V29B 1JQQA 4CRIA 3PIOA 3M57A 4AFSC 3S3MA 2VB6A 1VQPQ 2XMFA 4BD3A 2E1HA 4ORZA 2CGHA 2HKNA 5LJ3g 1E6HA 3S3NA 1IB8A 2R5MA 3RKWA 1WX6A 1W2BA 3CC2T 4A4GA 2CS7A 2DERA 4C5IA 4B6MA 2EYZA 1TXQA 2P84A 2M9UA 2F2XA 1UGRB 4OMFB 1WHHA 4MZPA 1Q7YC 2P4RA 2A28A 3PVQA 1KC8R 3JCMg 2QI2A 2DAQA 2IPOB 1M90U 4PFOA 5GAOp 2ED0A 3V7CA 4BI4A 3CQTA 2HAXA 2DIGA 1Q81C 1YI2T 2JNGA 2EVRA 2E5QA 2DYBA 4NOYA 3RNJA 3OS0A 2PVDB
chains in the Genus database with same CATH topology
1B34B 4Z02A 1I81A 2LDMA 1VQ7T 2VGMA 3HKSA 5C0MA 4PJOC 5L8RE 4BI3A 3A8LB 1VQNA 5FLXE 2EWNA 4XU3A 2CZ1B 5GANe 3M54A 3MHXA 4M78E 2DPPB 3CCJA 4M7DB 1G3WA 1WNLA 2XU8A 4BDYA 1I4K1 2EJ9A 1FXXA 4PJOF 4ZGDB 1FWZA 2EQKA 1Y71A 2E12A 3G7ZA 4J7IA 5GAN4 3G4ST 1VQ4T 1M90C 3E1SA 2OTLT 4C0ZA 3JB9F 1XNIA 5GAOl 4BE1A 1VQ6A 5FRNA 1VQPT 3PGGA 4O6JA 3DLMA 2GCXA 3EFSA 3N5BB 1BYMA 5HK0A 2OTJA 3PTAA 3QHSA 2K5IA 2LCCA 3GLXA 5GMKi 1MHNA 4IUQA 2K4YA 3QKJA 2XDBA 3ER0A 1YHQT 2MI6A 2MMPA 3OYKA 2KMTA 3BW1A 3GNFB 3M4GA 4M77E 2BKDN 4XU1A 3WVDB 5CK9A 1K8AC 1BI0A 4E7HA 2F5KA 2Y4YA 2ZPGB 4QQGA 3GPLA 1UGPB 3V7SA 3G71A 4LDWA 3EFRA 3CD6T 2LTOA 3NTIA 4DOWA 2L5QA 3JCMP 3AHUA 3VUBA 2QA4A 2WSCE 2FHDA 3V8JA 4X9DA 3RIRA 4QVDA 4YTLA 3G6EA 4PNOA 3CCQA 2I2LA 2P4TA 4PJOG 4C5EA 4XU0A 3BDUA 2LQKA 3INZA 5C6SA 3CMAT 1NPRA 3HP9A 1YITT 3SDZA 1D3BB 4JRKA 3LGFA 4MMKA 3LGLA 3M56A 2CYZB 2KK4A 3KXTA 1N8RU 3OW2S 3HRUA 4Y28E 4C8QG 2QQSA 3CMEA 1N9RA 2PUOB 1VQNT 5KCOA 1X6OA 4E7IA 3HL8A 5GMKe 3OYFA 4ME7A 3VYHB 1QVFS 3GIBA 1KD1U 4PJOE 1JBMA 1YJ9A 2RHXA 2ZPBB 1QW1A 3A8GB 3FC3A 3CCQT 2EQUA 4KULA 2OTLA 3JCMV 4M78B 4ZN1A 2X4JA 2DJZA 3VU3C 2X35A 3G4SA 3RMQA 3CCRT 4HCCA 2G3RA 1SSFA 5HK3A 3OSVA 4ZGEB 2DD4A 4R55A 2E65A 2XI9A 2XDPA 3QXEB 1VQ8T 1GXIE 1UGQB 1NPPA 3LX7A 3S3OA 2DTOA 2RK2A 5CKEA 5FU6B 3I55T 2DVEA 1K8AU 2JOYA 4MZTA 4FT4A 2DTIA 3JCMd 3L2QA 4BE0A 4EMGA 5LJ5d 4C0FA 3DLLA 3CCSA 1W2BS 4LDUA 4ELZC 3OA6A 2CKKA 1DJ7B 3MEUA 2X4YA 4A4KA 1BKBA 5LJ3d 1Q82C 2HQXA 3L2VA 4FL6A 5CKFA 2L3RA 4LD9K 2EJGA 5FU6C 1G3SA 2RA2A 1B34A 2MWPA 3RKYA 1N8RC 2EFIA 3BFMA 4J6XA 2R57A 2K2VA 3DB3A 4M75F 4QQDA 5LJ5h 5D6YA 3TEEA 3JB9H 3FB9A 3MEWA 4M78D 3SWNB 3TCJA 1KD1C 4MDWA 3CXCS 4FM4B 3RERA 3OYDA 3OYJA 3TREA 5LJ3h 1KG1A 3META 3P8HA 4JRPA 2VV5A 1H3ZA 4M7AD 3QG1A 4BACA 3M53A 4C0DB 3CC7A 1Q7YU 4M77F 2LRQA 1WQWA 3DB4A 2DXTA 5GAN7 3J7AF 3CPFA 3OS5A 2M1HA 3QDRB 4IUUA 4L6V5 2P0KA 4C92E 2RK1A 3E19A 4R56A 3L2WA 4E7JA 1PSFA 3M4YA 3WXMB 4F7UA 5GANf 2MF2A 1K9MU 1XTDA 3CPWS 3OYYA 1HK9A 3JCMh 1VQOT 1YI2A 3JCMW 3JB9D 2RI2A 4ELYC 3HSBA 1LOJA 2KY9A 1WQ7A 3P8DA 4RCCA 4DQ2A 2V8KA 2ZPHB 3PFSA 5CKHA 3CC4T 3L1AA 4GLKA 3JCMe 3CCMA 4M78G 1VQ4A 3GNGA 4RG8A 4N0AC 5LJ3f 2EQMA 2IVWA 2RHUA 1M4ZA 5I2MA 3LW5E 3OYEA 1Q82U 4C92C 2GFUA 3MP6A 4HKEA 5CKBA 4II1A 2D6FA 2WSFE 1KC8C 5LJ5f 2XIDA 4LDVA 4OF1A 3CCET 4FT2A 2QEXA 2ZCFB 3SWNA 5DY9A 3T9NA 5A0DA 1QVFA 4Q5WA 2JVVA 2RHYA 1D3BA 2GF7A 3S6WA 5GAN3 1KHCA 5LL6S 3OYLA 1YJWA 3GF5A 4O5VA 1VQLT 2IG0A 3QYHB 4PKCC 4CI0C 4ZGJB 2KQWA 5M9OA 4KUDK 3MEAA 3C12A 2A7YA 2RI3A 4HT9A 1NJIU 3C94A 3X28B 2HD0A 2DXCA 3KUFA 1O75A 4L59A 2M16A 2PVGB 4C92G 4M77G 4F7UB 3J80E 1Q86U 5GANd 2RD1A 4C8QA 3QBYA 1YJWT 2X4XA 2M0OA 4C8QD 3OS2A 3QUIA 4XTVA 5GAN5 1WGSA 2Y4XA 4FU6A 2GQVA 3L2UA 1Y96A 3O8VA 2DZ9A 3CCVA 2RM4A 1OI1A 2HNIA 1YBYA 2PU9B 4M7DG 1R8OB 3SFMA 4LD6A 2LT1A 2V8IA 4A4EA 3CCST 1M1FA 2LNVA 3FIFA 2OTJT 1M8VA 3MCAB 2XICA 1LNXA 1JJ2A 1N6AA 3LYIA 3JSCA 4VUBA 3PIPA 2ZPEB 4DA4A 2NLUA 3CC4A 3FJPA 1XOVA 1BIBA 2HBPA 3PMTA 4C8QE 4IKFA 1G5VA 2BIVA 3G71T 2YHTA 2LQ8A 3I56T 5GMKh 1VQ9T 1I8FA 3SWNC 2C06A 3OYBA 1JRIA 4C92A 2QQ9A 3V8LA 1XQHA 2O4XB 1RL2A 4MMLA 5IT9E 2EQJA 4OVAA 4RCBA 2DEQA 1VIFA 2L89A 5DM7R 2QDYB 4M7AB 3URGA 2QEXT 5I21A 4HA8A 4N0AA 2K57A 4M78A 2ZPFB 3H8ZA 4LDYA 3L2ZA 3MP8A 3JAME 2RJCA 3GOXA 3H6ZA 1I5LA 4F7UE 5CQYA 2MWOA 3SD4A 5LJ5e 4C92F 3CCMT 1HXDA 4PJOB 4M7AE 3DKMA 5GAOn 1YJNA 5GAMd 4L5GA 3MEVA 4RG2A 4E7KA 4EMKC 5GAOr 3JCMb 4V2SA 1X01A 3HHTB 4M7AC 2EKOA 3CD6A 4F7UG 3OYGA 1YJ9T 4BE2A 2WSEE 4MZMA 3V8KA 3RESA 4J83A 4B9WA 4EMHA 2KSSA 5GAOm 5GANj 1KQSA 4HCBA 5FRMA 2RHZA 5FROA 3X24B 1YIJA 4OGCA 1UEBA 2LT4A 4C8QF 1S72T 1QVGA 3CCEA 2QQBA 5GAMf 5GAMh 1YCYA 3X25B 4JS4A 2GFAA 2RI5A 4M75G 1Q81U 1PSEA 3JCMX 2FL7A 2YLBA 1OZ2A 3ZFJA 4M7DD 4XTYA 4M78C 3OSSC 3VYGA 1ZQ1A 2RJDA 5D6XA 2JTMA 3RMSA 3JCMf 4BUGA 3CXCA 5GANh 3NFCA 5LJ3e 2D9TA 1OYXA 3ASKA 3NTHA 3L42A 2PQWA 1JJ2S 3OW2A 3RUXA 4PJOD 2QTXA 1VQKA 3LWHA 2AHJB 4PJOA 4NS5A 3L2RA 1U1TA 2VUBA 2ZPIB 3JRZA 3OBWA 2VGNA 3QJYA 3JB9J 1QVGS 4M7AG 2FB7A 2VC8A 1Y96B 5CR2A 2X4WA 4ZTJA 5GAMg 1IREB 2LX9A 5KE2A 3UPUA 3HRSA 1M5Q1 4M78F 3P8BB 4JUVA 3M58A 2JN0A 4IUTA 4OB3B 1N9SA 4Y91A 1WJRA 1QP3A 1WJQA 2VXFA 2QXFA 3QJ6A 1VQLA 3X20B 1G3YA 1RI0A 3OS0A 4C92D 3A8OB 3Q1JA 4EMKB 3JB9G 4C8QC 2R5AA 4ATOA 1UGSB 2HQEA 3M9QA 4E47A 4X34A 5GAMj 4M7DA 4M7DC 2MAMA 3OBYA 2RO0A 2EIFA 2PVOB 3KBGA 4C5GA 3GP8A 2QQAA 1QVPA 2H3JA 2FVUA 4HCZA 3VV0A 1U8RA 5CAIA 2O4XA 1BI2A 2CZ0B 2Y90A 3PT9A 3QO3A 4N4GA 1QP2A 4J7FA 5AYFA 5GMKm 1BI1A 1NZ9A 2ZZDA 3OB9A 3OYNA 4M7AA 3WVEB 3OQ5A 5GMKl 4OB2B 4GY5A 4M75B 2DIQA 2K5FA 1P92A 2E6ZA 3CBMA 4IUPA 2DTHA 5CKDA 3F70A 2QQRA 5CCAA 2O01E 3HPWA 3OMGA 5D6WA 5DLOA 3OYCA 4E7LA 2XK0A 4C5HA 5KH6A 4PL6A 1NE8A 2VYTA 4PLLA 4BY6B 1MGQA 5GAN6 2K3XA 3HRTA 4KT0E 4PLIA 1YIJT 2XD0A 1UB4A 1VQKT 3VKIA 1X75C 1M1GA 2XHCA 3PNWC 4BDZA 4JLGA 3UWNA 4MDXA 3OS1A 3CPWA 3SB2A 1K9MC 1JB0E 2E10A 2EJFA 4M77D 3JCMQ 4HT8A 1VQ6T 5FU7B 3C4SA 2WACA 4C92B 3X26B 2DKGA 4ZN3A 1TH7A 2E70A 3FLGA 3HFNA 3QYGB 2FYKA 3NTKA 3FDRA 4OB0B 3UDCA 3CCJT 1O9SA 1VQMT 2F5TX 4IURA 3CCRA 1WPYA 1VQ5T 3C95A 4XTUA 2E64A 3OY9A 2YRVA 2DO3A 4J6YA 4N4HA 2OAUA 2ZGWA 4M75A 1VQ7A 4LDXA 2CZ7B 4OGEA 1M9SA 2JUFA 4WF2A 4XU2A 5GAMe 3BDLA 5CVIA 4C8QB 3LH0A 3R6OA 5J26A 1VQ5A 4M7DF 1KQ1A 1WJSA 2BUDA 3I56A 1KC8U 1VQ9A 4JRIA 1VQMA 3PMIA 2D0QB 4J5YA 4XAXB 3A5ZB 5GMKj 4C0DC 2RH2A 3CMAA 2JZ2A 1M1KU 2DD5A 3QSUA 4QW2A 5GAN8 2KDSA 5J39A 1NJIC 4BI8B 4A53A 3CC2A 4M7DE 4XTZA 2V8JA 4UC4A 4F7UF 2CZ6B 4QQ6A 5DLQE 4QVCA 5KCHA 1KHIA 4M75E 2LVMA 3ZBDA 1K73U 3CCUT 4NL2A 2RJFA 3JCMJ 4C0GA 3BY7A 3OYAA 2E41A 2EYQA 3MO8A 3QIIA 4JLIA 4M75C 4X9CA 3JCMc 5GAOq 3OMCA 4EMKA 1ZBXA 2DK3A 3CCLT 5LJ5j 3TU4K 4OB1B 1YITA 3ZEHA 5CO7A 4OP0A 3ME9A 4A54A 3CCUA 1EIFA 2E6NA 5FU7C 3CBPA 1KQSS 5A2QE 3M59A 3UT1A 3G6ET 4JRQA 1KQ2A 1V29B 1G3TA 2QA4T 3E9FA 1VQPA 1Y7XA 1IZ6A 1VUBA 3CEYA 3V7RA 3E9GA 3FEOA 4CRIA 3PIOA 3M57A 1H641 4D6WA 1BI3A 3S3MA 2DXBA 5CIUA 4XTWA 4RKUE 2E1HA 4J8OA 4BD3A 4M77C 4IUVA 2EAYA 2XDDA 2CGHA 1N27A 5LJ3g 3OYIA 3S3NA 5HY6A 3LWIA 2R5MA 3CCVT 1LJOA 4XK8E 2PUKB 1Y07A 1AHJB 2DXUA 4JS5A 4B9XA 2LC4A 2RHIA 2VXEA 4XQ3A 5LJ5g 2YLCA 3RKWA 1K73C 2RB6A 4DOVA 4M77A 5CQXA 3OYHA 1W2BA 3CC2T 3CC7T 5IAYA 4A4GA 2CS7A 2LCLA 5I2SA 4C5IA 3I55A 2JTFA 2KVQG 5LJ3j 2B8AA 4JDSA 5KE3A 3OYMA 5EG2A 2K3YA 2RJEA 1Q86C 1ZHIA 1VQOA 3CBOA 4FIBA 5IN1A 4P5NA 3A8MB 4TVRA 5A0LA 4NL3A 3MP1A 4EPCA 2M9UA 3J81E 3LLRA 4XTXA 3CCLA 4KBMB 1UGRB 1U1SA 3EAEA 5GANg 5A0GA 2L8DA 1OZ3A 1YHQA 1M1KC 4OMFB 3FRNA 4MZPA 2XG8D 2K5LA 4BB7A 5GAN2 5J3BA 4A4FA 3CMET 1Q7YC 3VUZA 4RMOA 4A4HA 3HFOA 3A8HB 4M7AF 3M55A 1W4SA 2QI2A 3QPHA 3JCMg 1YJNT 2DAQA 2F69A 4BY6C 2P0PA 1M90U 5GAOp 2R58A 4QVZA 4EDUA 4KUIA 3RKXA 1BIAA 5HKCA 3JB9I 1VQ8A 3VJPA 4M75D 3V7CA 4BI4A 4FSXA 1VIEA 1FX7A 2HAXA 2DIGA 2P0QA 4ZTFA 1Q81C 1YI2T 2JNGA 4JJNK 3QZ5B 2XKOC 2KAFA 2A3LA 2E5QA 4M77B 2DZCA 4NOYA 4J6WA 1S72A 3M5AA 3QZ9B 4N4IA 2PVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B34 B;  2ZGW A;  3V8K A;  3RES A;  4M75 A;  4C92 E;  1I81 A;  4EMH A;  5GAO m;  5GAN j;  4PJO C;  4WF2 A;  4XU2 A;  4C8Q F;  4F7U A;  5GAM e;  5GAN f;  2EWN A;  4XU3 A;  4C8Q B;  5GAM f;  5GAN e;  5GAM h;  1YCY A;  1HK9 A;  4M75 G;  3JCM h;  4M7D F;  4M78 E;  1KQ1 A;  3JCM X;  4M7D B;  4JRI A;  1WNL A;  4J5Y A;  2YLB A;  1I4K 1;  2EJ9 A;  5GMK j;  3JCM W;  3JB9 D;  4XTY A;  4PJO F;  3HSB A;  1LOJ A;  4M78 C;  4M7D D;  3QSU A;  1WQ7 A;  4DQ2 A;  4RCC A;  5GAN 4;  3JCM f;  5GAN 8;  3JB9 F;  3L1A A;  3JCM e;  5GAO l;  4M78 G;  4A53 A;  5GAN h;  5LJ3 e;  4M7D E;  3PGG A;  4XTZ A;  4N0A C;  5LJ3 f;  4F7U F;  4QVC A;  3EFS A;  4M75 E;  4C92 C;  3QHS A;  5GMK i;  4NL2 A;  3JCM J;  3RUX A;  5LJ5 f;  5GAN 7;  4PJO D;  2QTX A;  3BY7 A;  4PJO A;  2E41 A;  3JCM c;  4JLI A;  4M75 C;  1U1T A;  3BW1 A;  4X9C A;  3M4G A;  4M77 E;  5DY9 A;  4XU1 A;  3SWN A;  4EMK A;  5GAO q;  5LJ5 j;  3JB9 J;  4M7A G;  1D3B A;  2FB7 A;  2VC8 A;  4OP0 A;  5GAN 3;  1Y96 B;  4A54 A;  4PJO B;  3V7S A;  3EFR A;  5GAM g;  1KQ2 A;  3JCM P;  3AHU A;  1M5Q 1;  4M78 F;  4HT9 A;  4JUV A;  3V7R A;  3V8J A;  2JN0 A;  4X9D A;  3RIR A;  1N9S A;  4Y91 A;  4QVD A;  4PNO A;  1H64 1;  2VXF A;  4C92 G;  2I2L A;  4M77 G;  4PJO G;  4F7U B;  4XU0 A;  3BDU A;  5GAN d;  2RD1 A;  4XTW A;  4C8Q A;  4C92 D;  3INZ A;  4EMK B;  2E1H A;  3JB9 G;  4C8Q D;  4C8Q C;  3QUI A;  4M77 C;  1D3B B;  4JRK A;  4XTV A;  5GAN 5;  2EAY A;  4M7D A;  2CGH A;  4MMK A;  5LJ3 g;  5GAM j;  1Y96 A;  4M7D C;  2DZ9 A;  4C8Q G;  1LJO A;  1N9R A;  2RM4 A;  2DXU A;  2HNI A;  2VXE A;  4XQ3 A;  5GMK e;  5LJ5 g;  3GIB A;  2YLC A;  4M7D G;  5CAI A;  3RKW A;  3RER A;  4PJO E;  1JBM A;  2RB6 A;  2Y90 A;  3FIF A;  3QO3 A;  5GMK m;  1M8V A;  4M77 A;  1LNX A;  4M7A A;  4M7A F;  5GMK l;  4M75 B;  3JCM V;  3FJP A;  4M78 B;  5LJ3 j;  2DJZ A;  3VU3 C;  1BIB A;  4C8Q E;  2DTH A;  2E65 A;  2YHT A;  5GMK h;  1I8F A;  2DTO A;  3SWN C;  1JRI A;  4NL3 A;  2DVE A;  4C92 A;  3V8L A;  2DTI A;  1MGQ A;  4MML A;  4XTX A;  5GAN 6;  3JCM d;  4EMG A;  4RCB A;  2DEQ A;  1U1S A;  5LJ5 d;  5GAN g;  4M7A B;  5I21 A;  4HA8 A;  4N0A A;  2K57 A;  4M78 A;  5LJ3 d;  5GAN 2;  3L2Z A;  3SB2 A;  2EJG A;  3HFO A;  1I5L A;  2RA2 A;  1B34 A;  3RKY A;  2E10 A;  4F7U E;  2EJF A;  3JCM g;  4M77 D;  3JCM Q;  3BFM A;  4HT8 A;  5LJ5 e;  4J6X A;  4M75 F;  4C92 F;  4C92 B;  5LJ5 h;  2DKG A;  1HXD A;  5GAO p;  3JB9 I;  1TH7 A;  3RKX A;  1BIA A;  3FB9 A;  3JB9 H;  4M78 D;  3SWN B;  4M75 D;  3V7C A;  3HFN A;  4M7A E;  5GAO n;  2FYK A;  5GAM d;  5LJ3 h;  1WPY A;  4EMK C;  4M77 F;  3JCM b;  5GAO r;  1X01 A;  4M7A C;  4M7A D;  4XTU A;  4V2S A;  2E64 A;  4M77 B;  2DZC A;  4NOY A;  4J6W A;  4F7U G;  4J6Y A;  1WQW A;  2DXT A; 
#chains in the Genus database with same CATH topology
 1VQ7 T;  1WFW A;  2CP5 A;  5C0M A;  3ZL7 C;  3PE0 A;  1VQN A;  5FLX E;  3NHN A;  4XU3 A;  1JXM A;  1PRL C;  3CCJ A;  1FWZ A;  2EGE A;  5GAN 4;  2JM9 A;  1PHT A;  2IIM A;  4C0Z A;  4RTW A;  1NJI R;  4F14 A;  2GCX A;  2B86 A;  2OTJ A;  1MMA A;  2G6F X;  2K6D A;  2MMP A;  5KYX B;  3GNF B;  4OMN A;  1K8A C;  4IIM A;  1PWT A;  2ZPG B;  2QA4 Q;  2CP3 A;  3V7S A;  4LDW A;  3EFR A;  4RUG A;  2L5Q A;  2HMA A;  4FW2 A;  2K2M A;  1TOV A;  4YTL A;  2I2L A;  2AZV A;  4C5E A;  3HP9 A;  1YIT T;  2VVK A;  1D3B B;  1I07 A;  3KXT A;  4AG2 C;  3HRU A;  1W1F A;  2LCS A;  3CME A;  1N9R A;  2EW3 A;  1W6X A;  3GIB A;  3VYH B;  1JBM A;  1ABQ A;  1GFC A;  2OTL A;  3JCM V;  4M78 B;  4HCC A;  2X4J A;  2DJZ A;  3VU3 C;  3G4S A;  1YJ9 Q;  3RMQ A;  2YXY A;  4ZGE B;  2X3X D;  2E65 A;  3UF4 A;  2GNC A;  2XDP A;  2E5K A;  5CKE A;  2DET A;  2JOY A;  2DTI A;  3L2Q A;  5LJ5 d;  4C0F A;  2DL5 A;  4Y92 A;  2C0I A;  3OA6 A;  2FZK B;  1DJ7 B;  3FJ5 A;  4R0K A;  3REB B;  2BZY A;  5FU6 C;  4LXC A;  2RA2 A;  1B34 A;  2EFI A;  3PVL A;  4J6X A;  2R57 A;  4LUE A;  4QQD A;  3FB9 A;  2EGA A;  3TCJ A;  3M0T A;  2EGC A;  2L2P A;  5LJ3 h;  4M7A D;  1SRL A;  4C0D B;  1CKA A;  4M77 F;  1WQW A;  3DB4 A;  3CPF A;  3QDR B;  1UHC A;  4E7J A;  1PSF A;  1M30 A;  1Q82 R;  2KRS A;  5KYY A;  3ULR B;  1YI2 A;  1D0Z A;  3HSB A;  2BE9 B;  2JS0 A;  2KY9 A;  1WQ7 A;  4DQ2 A;  2K79 A;  2BE7 D;  4JPB W;  4RG8 A;  5I2M A;  1UG1 A;  2GFU A;  1WHJ A;  2XID A;  1RAB B;  4LDV A;  3CCE T;  4FT2 A;  1YJW Q;  3SWN A;  1QVF A;  2MCN A;  5I11 A;  1KHC A;  1AD5 A;  2RPN A;  3CCL Q;  1M8M A;  3R6N A;  1BCO A;  1U06 A;  1RAH B;  2A7Y A;  3C94 A;  3X28 B;  2DXC A;  3KUF A;  1PCX A;  2M16 A;  2KEA A;  1Q86 U;  2EYW A;  3VS5 A;  1EZZ B;  3EG0 A;  5GAN 5;  2OTL Q;  2Y4X A;  2GQV A;  2DZ9 A;  5KYW A;  2RM4 A;  3H0I A;  2CDT A;  3NMZ C;  2KXC A;  1TUD A;  3SFM A;  2LT1 A;  4J9D A;  3FIF A;  1M8V A;  2XIC A;  1N6A A;  4IIO A;  3PIP A;  1ACM B;  2EYX A;  3CC4 A;  1XOV A;  4C8Q E;  2KRO A;  1RLQ C;  3I56 T;  3SWN C;  3CCJ Q;  1NG2 A;  1RL2 A;  2L89 A;  2JW4 A;  4M78 A;  2RJC A;  1WI7 A;  4F7U E;  3CCM T;  1YFN A;  1U5S A;  1QVG P;  4JZ3 A;  4ANJ A;  1OUL A;  1SF9 A;  2KT8 A;  1YJN A;  3TQ7 P;  2GTJ A;  4L5G A;  4RG2 A;  1V76 A;  3CD6 A;  1X6B A;  4F7U G;  1YIJ Q;  2WSE E;  4MZM A;  4EMH A;  3I55 Q;  1KJW A;  1BCM A;  4AFU C;  3HTR A;  5GAM f;  5GAM h;  2GFA A;  2RI5 A;  4M75 G;  1Q81 U;  3JCM X;  3VS1 A;  2NWM A;  2YLB A;  1E7O A;  1K0X A;  3OSS C;  1ZQ1 A;  2RJD A;  3JCM f;  2JTM A;  3RMS A;  4BUG A;  2FO0 A;  2D9T A;  1J3T A;  1SEM A;  3CCV Q;  3L42 A;  2LJ0 A;  4PJO D;  4OML A;  4HVU A;  4PJO A;  2KBT A;  2ZPI B;  1K4U S;  2NUT A;  2VGN A;  3QJY A;  3JB9 J;  2FB7 A;  3VS3 A;  4ZTJ A;  2LX9 A;  4F04 B;  1M5Q 1;  4M78 F;  1G8X A;  4OB3 B;  1QP3 A;  1H3H A;  2QXF A;  3QJ6 A;  3X20 B;  2MK5 A;  4LE9 A;  3EHQ A;  3Q1J A;  1UUE A;  4C8Q C;  2R5A A;  1UGS B;  4E47 A;  3CCU Q;  3SHW A;  4M7D C;  1TUG B;  2RO0 A;  2EIF A;  2QQA A;  1U8R A;  2O4X A;  3RER A;  2NUP B;  2Y90 A;  3PT9 A;  3QO3 A;  4N4G A;  4J7F A;  2ESW A;  1P92 A;  1SSH A;  1WHK A;  3F70 A;  2QQR A;  3G1J A;  3OMG A;  2RN8 A;  1YI2 Q;  1KK7 A;  4BY6 B;  1MGQ A;  5GAN 6;  2K3X A;  1UB4 A;  2CH4 A;  2DE0 X;  1Q7Y R;  1JB0 E;  1QCN A;  2E10 A;  3TSW A;  4C92 B;  2YRD A;  1T0J A;  2E70 A;  1D1A A;  1UHF A;  4KH1 B;  2E64 A;  2YRV A;  2LJ1 A;  2CSQ A;  4LDX A;  2CZ7 B;  2KYM A;  1VQ9 Q;  2JUF A;  4WF2 A;  5GAM e;  5CVI A;  4C8Q B;  1OPK A;  1KC8 U;  4JRI A;  5GMK j;  4KGX B;  5KYN A;  1SRM A;  3CCS Q;  4DEX A;  4BI8 B;  3CMA Q;  1D1B A;  4LUD A;  1HYO A;  4NL2 A;  1N8R R;  1RAF B;  3BY7 A;  1SG5 A;  3QII A;  4M75 C;  4X9C A;  5GAO q;  1VQL Q;  4EMK A;  3CCL T;  2DK3 A;  5ECA A;  1YIT A;  5IHK A;  2QK0 A;  1MND A;  1CSK A;  3CCU A;  4A54 A;  1EIF A;  5FU7 C;  3NPF A;  1G3T A;  1VQP A;  1Y7X A;  3CEY A;  3FEO A;  2ROL A;  2PZ1 A;  4D6W A;  3H0F A;  1TUC A;  2KNB B;  5CIU A;  2A08 A;  4J8O A;  4J9H A;  2CSI A;  3OYI A;  5HY6 A;  3LWI A;  4PK4 A;  1LJO A;  2PUK B;  2DXU A;  4PFP A;  4JS5 A;  4B9X A;  2RHI A;  2VXE A;  4XQ3 A;  2FEI A;  1K73 C;  1ZSG A;  2RB6 A;  1VQ4 Q;  3OYH A;  5IAY A;  3KFV A;  1UJ0 A;  3IQL A;  2KVQ G;  5LJ3 j;  2B8A A;  1X27 A;  3OYM A;  5EG2 A;  2A36 A;  4E2F B;  1VQO A;  4FCY A;  2V1R A;  3MP1 A;  3LLR A;  1PC0 A;  5GAN g;  2L8D A;  2XG8 D;  2K5L A;  1UGV A;  1VQM Q;  3CME T;  3CME Q;  3A8H B;  4PJN A;  4AFZ C;  4BY6 C;  2P0P A;  2R58 A;  1BIA A;  4Z8A A;  1VIE A;  4PJJ A;  2KT1 A;  2V26 A;  2A3L A;  2O9V A;  3EG3 A;  2DZC A;  2SRC A;  3M5A A;  3QZ9 B;  1QMC A;  1B34 B;  4Z02 A;  1SHG A;  1RI9 A;  1YWP A;  2VGM A;  1GRI A;  3TVT A;  4PJO C;  4KH0 B;  2CZ1 B;  3M54 A;  3MHX A;  2QDL A;  4M78 E;  4M7D B;  4BDY A;  1I4K 1;  1FXX A;  4ZGD B;  2CT4 A;  3G7Z A;  1VQ4 T;  1H92 A;  3JB9 F;  1XNI A;  4BE1 A;  3PGG A;  1BU1 A;  3EFS A;  3N5B B;  1JXO A;  5HK0 A;  3PTA A;  3GLX A;  1SKU B;  1EX4 A;  2CP6 A;  3WVD B;  2HSE B;  4XU1 A;  1GFD A;  1X2K A;  1BI0 A;  1K1Z A;  4E7H A;  2F5K A;  2HCK A;  1OPL A;  3GPL A;  5IH2 A;  2LTO A;  1R0C B;  3AHU A;  1MV0 B;  1JO8 A;  4X9D A;  3CCQ A;  1ZBJ A;  4PJO G;  5C6S A;  8ATC B;  3SDZ A;  4JRK A;  2KK4 A;  4Y28 E;  4C8Q G;  2PUO B;  1VQO Q;  1X6O A;  5KYU A;  1TU0 B;  3HL8 A;  5GMK e;  3OYF A;  1QVF S;  4PJO E;  3G4S Q;  1K8A R;  1YJ9 A;  1C6V X;  2RHX A;  2ZPB B;  3FC3 A;  1VQ7 Q;  4HVW A;  4ZN1 A;  2X35 A;  1WA7 A;  5HK3 A;  4R55 A;  2VKN A;  5KYW B;  2H8H A;  1RAG B;  1UGQ B;  5FU6 B;  1K76 A;  2KR3 A;  2EBP A;  1FYN A;  2DFU A;  1QQJ A;  3DLL A;  1W2B S;  1IO6 A;  2AK5 A;  3H0H A;  2X4Y A;  2L3P A;  1QKX A;  2MWP A;  5IHN A;  3DB3 A;  2K2V A;  3JB9 H;  3MEW A;  4M78 D;  3SWN B;  3OYJ A;  2DM1 A;  4JRP A;  1H3Z A;  3QG1 A;  4FYW B;  2DXT A;  3J7A F;  3EGX A;  1M3B A;  3OS5 A;  4L6V 5;  3U23 A;  2RK1 A;  3D7S B;  1HSQ A;  1I0C A;  2DA9 A;  3WXM B;  3OYY A;  1HK9 A;  3JCM h;  1ARK A;  3JCM W;  2RI2 A;  4ELY C;  2DIL A;  3P8D A;  2V8K A;  3CC4 T;  4GLK A;  3JCM e;  2HKQ B;  2RMO A;  4C92 C;  4HKE A;  2D6F A;  3EFO A;  2WSF E;  2J06 A;  2PNI A;  5LJ5 f;  4FSS A;  2ZCF B;  2Z0W A;  5A0D A;  1AWJ A;  1RAC B;  1D3B A;  2A0F B;  1SHF A;  5GAN 3;  4J9E A;  1T0H A;  2IG0 A;  2HDA A;  4KUD K;  2RI3 A;  1O75 A;  1MNE A;  2PVG B;  4M77 G;  3MPU B;  8AT1 B;  4C8Q D;  1OU8 A;  4FU6 A;  3THK A;  1FMW A;  3O8V A;  2A37 A;  2X51 A;  3CCV A;  4DBH A;  2HNI A;  4M7D G;  2NLU A;  1WXT A;  3EH1 A;  1BIB A;  2X3W D;  2BIV A;  1AEY A;  2W0Z A;  2O9S A;  3G71 T;  3OW2 P;  2LQ8 A;  1VQ9 T;  5GMK h;  1I8F A;  2EYY A;  1JRI A;  2DMO A;  2FZG B;  1XQH A;  3RBB B;  1M90 R;  4OVA A;  3URG A;  1NLO C;  3H8Z A;  2DNU A;  3H6Z A;  1VYU A;  3TSZ A;  1I5L A;  1R77 A;  5LJ5 e;  2FRW A;  1YJN Q;  2YDL A;  2HBW A;  2LNH B;  5GAO n;  1AWW A;  2FPD A;  4F16 A;  3JCM b;  1X01 A;  2EKO A;  1ZUU A;  4BE2 A;  3VS0 A;  1B3Q A;  2JXB A;  2RHZ A;  5FRO A;  4OGC A;  1S72 T;  2LT4 A;  1RAE B;  3CCE A;  3I35 A;  3X25 B;  4D8D A;  2K9G A;  1AVZ C;  2KRN A;  3ZFJ A;  4M7D D;  5D6X A;  2DYI A;  2OAW A;  2F2V A;  3VRY A;  2AZS A;  2ABL A;  1FMV A;  2QTX A;  4LNP A;  3JRZ A;  5FWC A;  3I5S A;  1PRM C;  2HL3 A;  2X4W A;  2JMA A;  1KFZ A;  1IRE B;  1UFF A;  5IHI A;  1QCO A;  3UPU A;  4JUV A;  1WJQ A;  3RDV A;  3M0S A;  1G3Y A;  4C92 D;  4EMK B;  1H8K A;  4ATO A;  2HQE A;  2EPD A;  3GP8 A;  3EH2 A;  5AYF A;  2CZ0 B;  2QAZ A;  5GMK m;  3OYN A;  3OQ5 A;  4OB2 B;  1WHL A;  2DTH A;  2AKK A;  5D6W A;  2AKL A;  4OMO A;  5KH6 A;  4PL6 A;  2GTO A;  3HRT A;  4KT0 E;  4PLI A;  1RAA B;  2RQV A;  1VQK T;  1M1G A;  2XHC A;  4MDX A;  3CPW A;  3VS2 A;  5L23 A;  4RTZ A;  2DL8 A;  2QAS A;  4HT8 A;  5FU7 B;  2DKG A;  3FLG A;  1M27 C;  3HFN A;  2HQH A;  3QYG B;  2FYK A;  2MOX A;  5KYU B;  1VQM T;  1O9S A;  2F5T X;  1RLP C;  4DBR A;  1WPY A;  2NUP A;  1VQK Q;  4J6Y A;  3M0U A;  4OGE A;  1M9S A;  1M3C A;  4OMP A;  4XU2 A;  1K9M R;  3BDL A;  1ZSZ C;  3LH0 A;  1KQ1 A;  1VQ9 A;  1VQM A;  4J5Y A;  4C0D C;  4J9C A;  4Z89 A;  4QW2 A;  5J39 A;  4A53 A;  1KD1 R;  3CC2 A;  4M7D E;  4UC4 A;  2CZ6 B;  4QVC A;  5KCH A;  1IRX A;  4M75 E;  4J9G A;  1TG0 A;  4C0G A;  1YIT Q;  1D09 B;  2M02 A;  3OYA A;  3JCM c;  3MO8 A;  3EG2 A;  4OB1 B;  3ZEH A;  5CO7 A;  1OOT A;  3ME9 A;  1IHV A;  2ED1 A;  1QWE A;  1D0X A;  3M59 A;  3G6E T;  1KQ2 A;  3EGX B;  2QA4 T;  1YNZ A;  1MMD A;  1VUB A;  2CP2 A;  2RQU A;  1KQS P;  1BI3 A;  2DXB A;  4XTW A;  2LZ6 B;  4M77 C;  2EAY A;  2XDD A;  1N27 A;  1Y07 A;  2LC4 A;  5LJ5 g;  1G83 A;  2O31 A;  4M77 A;  5AT1 B;  2LCL A;  5GJW B;  4JDS A;  3VS6 A;  4RTV A;  2K3Y A;  2RJE A;  2FZC B;  2J05 A;  1ZHI A;  4GLM A;  3CBO A;  5IN1 A;  2LQN A;  3A8M B;  4P5N A;  2L3S A;  4TVR A;  4Z88 A;  4NL3 A;  4EPC A;  2JMC A;  3J81 E;  4XTX A;  3CCL A;  1R0B G;  2VWF A;  3EAE A;  1M2V A;  2F1L A;  2F2W A;  3FRN A;  2HZY A;  1ABO A;  4BB7 A;  5GAN 2;  5J3B A;  3SEM A;  3VUZ A;  4RMO A;  1JJ2 P;  1K9A A;  3QPH A;  1YJN T;  2F69 A;  4QVZ A;  4EDU A;  5HKC A;  4KUI A;  3RKX A;  2J6F A;  4M75 D;  4FSX A;  2P0Q A;  4JJN K;  3QZ5 B;  1TTH B;  2KAF A;  2RQR A;  4J6W A;  1S72 A;  1TSF A;  4N4I A;  1LVK A;  2DVJ A;  1I81 A;  2J7I A;  2LDM A;  3CC2 Q;  4BI3 A;  3EHR A;  2EWN A;  1PG5 B;  2C0O A;  2DPP B;  1M3A A;  2XU8 A;  1Z9Q A;  1Y71 A;  2EQK A;  3E1S A;  2L0A A;  1KSW A;  2V1Q A;  5FRN A;  1VQP T;  3DLM A;  1LPL A;  1BYM A;  1RAI B;  3QHS A;  2K5I A;  2LCC A;  5GMK i;  1MHN A;  7AT1 B;  1GBQ A;  3QKJ A;  1KIK A;  1YHQ T;  2MI6 A;  3M4G A;  4M77 E;  2BKD N;  5CK9 A;  2K7A A;  4K11 A;  2Y4Y A;  4RTY A;  3G6E Q;  3G71 A;  3CD6 T;  4DOW A;  3CD6 Q;  3VUB A;  4QVD A;  3RIR A;  2P4T A;  4F17 A;  2KRM A;  4XU0 A;  2CT3 A;  1YHQ Q;  4FYY B;  3LGF A;  4MMK A;  3M56 A;  2CYZ B;  3OW2 S;  2QQS A;  1K0S A;  1VQN T;  4HVV A;  5KCO A;  1PD1 A;  4E7I A;  4ME7 A;  1KD1 U;  1X69 A;  3I5R A;  1QW1 A;  3A8G B;  1UTI A;  2LJ3 A;  1G2B A;  1SSF A;  3OSV A;  2DD4 A;  2LX7 A;  2XI9 A;  1VQ5 Q;  1WHG A;  2DTO A;  2RK2 A;  3I55 T;  1K8A U;  2QG9 B;  4FT4 A;  4LDU A;  4ELZ C;  2CKK A;  3MEU A;  2K3B A;  1BKB A;  5LJ3 d;  1Q82 C;  4WCI A;  3RR6 A;  4FL6 A;  5CKF A;  1GL5 A;  1I5O B;  4LD9 K;  3RKY A;  4AFQ C;  3A1P A;  4FYV B;  4DBF A;  3EG1 A;  1B07 A;  5LJ5 h;  3TEE A;  2M0Y A;  4CC3 A;  4CC7 A;  1KD1 C;  4FM4 B;  1M2O A;  3OYD A;  3MET A;  2VV5 A;  2EQI A;  2ZAE A;  3M53 A;  1Q7Y U;  2LRQ A;  5GAN 7;  4C92 E;  4IUU A;  4R56 A;  1BK2 A;  1YWO A;  2OX7 A;  2QTV A;  4F7U A;  5GAN f;  2MF2 A;  1WDX A;  1XTD A;  2OTJ Q;  2YUN A;  1VQO T;  3CCQ Q;  3JB9 D;  1PD0 A;  3CPW P;  2CH4 W;  4RCC A;  1X43 A;  1ZUK A;  2ZPH B;  3PFS A;  1E6G A;  3CCM A;  1MMG A;  3GNG A;  2IVW A;  2RHU A;  3EG9 A;  1Q82 U;  4OMQ A;  2RQT A;  5CKB A;  4II1 A;  2DL3 A;  5DY9 A;  4Q5W A;  4DBQ A;  2JVV A;  2RHY A;  2GF7 A;  3S6W A;  5LL6 S;  3OYL A;  1N5Z A;  3GF5 A;  3H41 A;  1VQL T;  3QYH B;  1S1N A;  3MEA A;  1NJI U;  3QWY A;  2HD0 A;  1Y0M A;  4C92 G;  1D1C A;  1VOM A;  3UA7 A;  1YN8 A;  3QBY A;  1YJW T;  2M0O A;  3OS2 A;  4XTV A;  3L2U A;  2KI7 A;  1OI1 A;  1YBY A;  1R8O B;  2OTJ T;  1M1F A;  2ECZ A;  2LNV A;  2J6K A;  3MCA B;  1S72 Q;  1JJ2 A;  1LNX A;  1OU9 A;  4FW1 A;  3LYI A;  4VUB A;  2DX1 A;  2C0T A;  4DA4 A;  3FJP A;  2HL5 C;  2FPF A;  2VAS A;  1T3S A;  3M0R A;  4C92 A;  2QQ9 A;  3I9Q A;  5DM7 R;  4RCB A;  2DEQ A;  2QDY B;  5I22 A;  1GCP A;  1NM7 A;  3EGD B;  2K57 A;  3VS4 A;  2ZPF B;  2JJ9 A;  4RTU A;  3MP8 A;  3JAM E;  2MWO A;  1M1K R;  1PKT A;  4M7A E;  1UDL A;  2LP5 A;  1B7T A;  3VRZ A;  3MEV A;  4E7K A;  4EMK C;  5GAO r;  4V2S A;  1AWO A;  1NYG A;  1VA7 A;  3OYG A;  1YJ9 T;  3V8K A;  3RES A;  4J83 A;  4B9W A;  5GAO m;  1KQS A;  2L3Q A;  1PNJ A;  1AZE A;  1QVG A;  3H9N A;  2QQB A;  1WLP B;  3EFO B;  4HCK A;  1T3L A;  1QCF A;  2RNA A;  1OZ2 A;  4XTY A;  1NEG A;  1ZLM A;  1TS9 A;  1M2V B;  4RTX A;  4ESR A;  3CXC A;  2E4H A;  5LJ3 e;  1WIE A;  1ZSZ B;  1VQK A;  3LWH A;  3L2R A;  1U1T A;  4M7A G;  1QVG S;  2D8H A;  2YRC A;  2DRM A;  2VC8 A;  4E7Z A;  1Y96 B;  1AZG B;  1D0Y A;  3LH5 A;  1Q86 R;  1OV3 A;  3HRS A;  4QKU A;  3P8B B;  2JN0 A;  1WJR A;  2VXF A;  3C0C A;  1VQL A;  1RI0 A;  5FW9 A;  3A8O B;  3JB9 G;  3CC4 Q;  3M9Q A;  2MAM A;  2PVO B;  3QWX X;  3KBG A;  4C5G A;  1QVP A;  2H3J A;  2FVU A;  5CAI A;  1BI2 A;  1MUZ A;  4KRT A;  1NZ9 A;  2HSP A;  4M7A A;  3WVE B;  5GMK l;  4GY5 A;  2K5F A;  5CKD A;  2YUP A;  5CCA A;  2O01 E;  5KYX A;  1A0N B;  3OYC A;  4E7L A;  4C5H A;  4PLL A;  4PJM A;  1X75 C;  3M0P A;  1IGQ A;  4GBQ A;  3UWN A;  3OS1 A;  3SB2 A;  1K9M C;  2EJF A;  4M77 D;  3JCM Q;  3X26 B;  1VYV A;  4ZN3 A;  3NTK A;  2MYS A;  4OB0 B;  3CCJ T;  1WHM A;  3EGD A;  1F1B B;  1YCS B;  2ROT A;  4XTU A;  2DO3 A;  4N4H A;  2OAU A;  3CCR Q;  4M75 A;  1VQ7 A;  1VQ8 Q;  3R6O A;  4AMC A;  4M7D F;  1RUW A;  2BUD A;  3I56 A;  3PMI A;  2D0Q B;  2ENM A;  4XAX B;  3A5Z B;  1M1K U;  2RH2 A;  1IGU A;  2JZ2 A;  2DD5 A;  3QSU A;  1GCQ C;  4XTZ A;  1W70 A;  4QQ6 A;  5DLQ E;  1KHI A;  2LVM A;  1C1A A;  3ZBD A;  1ZA1 B;  1K73 U;  3CCU T;  1Z9Z A;  2RJF A;  3QDF A;  2EYQ A;  4ZNX A;  3OMC A;  1ZBX A;  1AWX A;  4KGV B;  4OP0 A;  1OX9 A;  2E6N A;  2D0N A;  1KQS S;  5A2Q E;  3UT1 A;  3E9F A;  3V7R A;  1IZ6 A;  3E9G A;  1H64 1;  1LCK A;  2E3I A;  4CC4 B;  4RKU E;  4IUV A;  3CCV T;  4XK8 E;  3MJX A;  1AHJ B;  2O88 A;  1V1C A;  2YLC A;  1NEB A;  3REA B;  4CC2 A;  4DOV A;  4JZ4 A;  5CQX A;  2JM8 A;  3CC7 T;  4JJB A;  5I2S A;  5HCK A;  2JTF A;  3I55 A;  5KE3 A;  2BZ8 A;  4AG1 C;  1Q86 C;  2RQW A;  4FIB A;  1EFN A;  5A0L A;  3BE3 A;  1OEB A;  2HEQ A;  1WZO A;  4KBM B;  2M51 A;  1U1S A;  5A0G A;  1OZ3 A;  1YHQ A;  1M1K C;  4A4F A;  1QWF A;  4A4H A;  3HFO A;  3M55 A;  1W4S A;  4AT1 B;  3JB9 I;  1GCQ A;  1VQ8 A;  3VJP A;  1FX7 A;  2AT1 B;  4ZTF A;  2XKO C;  4M77 B;  1WXU A;  1QKW A;  4M7A F;  2QYZ A;  3HKS A;  5L8R E;  3A8L B;  1MV3 A;  3UAT A;  5GAN e;  1VQN Q;  1G3W A;  1WNL A;  2EJ9 A;  4PJO F;  3CC7 Q;  1QVF P;  2E12 A;  4J7I A;  3G4S T;  1M90 C;  2OTL T;  2DRK A;  5GAO l;  1VQ6 A;  1AOJ A;  4O6J A;  3MKD A;  2D8J A;  4IUQ A;  2K4Y A;  2XDB A;  3ER0 A;  3OYK A;  1NYF A;  2KMT A;  3BW1 A;  2DL7 A;  4QT7 A;  1W2B P;  4QQG A;  1UGP B;  1NBE B;  3NTI A;  3JCM P;  3EGU A;  2QA4 A;  2JTE A;  2DL4 A;  2FHD A;  2WSC E;  3V8J A;  3G6E A;  4PNO A;  1PKS A;  4OMM A;  3BDU A;  2H3E B;  2MPX C;  2LQK A;  3INZ A;  3CCE Q;  3CMA T;  1NPR A;  5IXF A;  3A98 A;  1YP5 A;  2FRY A;  3LGL A;  1BBZ A;  1N8R U;  2I0N A;  2GQI A;  2GBQ A;  2BTT A;  3CCQ T;  4FYX B;  2EQU A;  4KUL A;  2RF0 A;  3CCR T;  2G3R A;  3JV3 A;  2NYS A;  3QXE B;  4X1V A;  1VQ8 T;  1GXI E;  3LX7 A;  1I1J A;  1NPP A;  3S3O A;  5FWB A;  2DVE A;  4MZT A;  3JCM d;  2COZ A;  4EMG A;  2JS2 A;  3CCS A;  1CKB A;  2KE9 A;  4PFZ A;  1U3O A;  4A4K A;  2HQX A;  3L2V A;  2L3R A;  4JJD A;  2EJG A;  1G3S A;  2DBM A;  2YUO A;  1N8R C;  3GBQ A;  3BFM A;  4M75 F;  5D6Y A;  1UE9 A;  4MDW A;  3CXC S;  3TRE A;  1KG1 A;  3P8H A;  4BAC A;  3CC7 A;  9ATC B;  2M1H A;  4M4Z A;  2P0K A;  3L2W A;  3E19 A;  3M4Y A;  3G71 Q;  1K9M U;  4LN2 A;  3CPW S;  1VYT A;  1LOJ A;  1X2Q A;  1TWB A;  3M0Q A;  5CKH A;  3L1A A;  4M78 G;  1Q95 G;  1VQ4 A;  4N0A C;  5LJ3 f;  2EQM A;  1M4Z A;  3OYE A;  3LW5 E;  3MP6 A;  1KC8 C;  4OF1 A;  2JT4 A;  2QEX A;  2SEM A;  3T9N A;  1YJW A;  1Q81 R;  1JU5 C;  4O5V A;  4A63 B;  4CI0 C;  4PKC C;  5M9O A;  4ZGJ B;  2KQW A;  2YT6 A;  2COY A;  3C12 A;  4HT9 A;  1AT1 B;  4L59 A;  1ZSZ A;  4F7U B;  3J80 E;  5GAN d;  2RD1 A;  3VS7 A;  4C8Q A;  2X4X A;  4BE0 A;  3QUI A;  1WGS A;  1Y96 A;  4EIK A;  1HD3 A;  2FPE A;  2CP7 A;  2PU9 B;  1NLP C;  1ZA2 B;  4A4E A;  4LD6 A;  2V8I A;  3CCS T;  4PJL A;  2CUB A;  3EG9 B;  3JSC A;  2ZPE B;  3NGP A;  2GGR A;  2HBP A;  3PMT A;  4IKF A;  1IHW A;  1G5V A;  2BZX A;  2YHT A;  2C06 A;  3OYB A;  2AIR B;  3V8L A;  4HXJ A;  2O4X B;  4MML A;  5IT9 E;  2EQJ A;  1VIF A;  4M7A B;  2QEX T;  5I21 A;  1VQ6 Q;  4HA8 A;  4N0A A;  2LMJ A;  4LDY A;  1ZX6 A;  3L2Z A;  3GOX A;  5CQY A;  2DJQ A;  3CCM Q;  3SD4 A;  2MIO A;  2O2O A;  4C92 F;  2YWW A;  2W10 A;  1HXD A;  4PJO B;  2DEU A;  3DKM A;  4D8K A;  2QGF B;  1ZUY A;  5KYY B;  5GAM d;  2X9H A;  3HHT B;  4M7A C;  4JJC A;  3O5Z A;  5GAN j;  2KSS A;  4HCB A;  5FRM A;  3X24 B;  1YIJ A;  1UEB A;  4C8Q F;  1YCY A;  4JS4 A;  1PSE A;  2FL7 A;  1Y57 A;  2FG0 A;  4M78 C;  3E2U A;  3VYG A;  2OI3 A;  5GAN h;  3NFC A;  1OYX A;  3ASK A;  3NTH A;  1UJY A;  2COW A;  2YSQ A;  2DF6 A;  2PQW A;  5GJV B;  1JJ2 S;  3OW2 A;  3RUX A;  2KXD A;  1HJD A;  2AHJ B;  4NS5 A;  2VUB A;  1WXB A;  3OBW A;  2DLP A;  2CRE A;  1JEG A;  4J9I A;  4E6R A;  5CR2 A;  5GAM g;  2KGT A;  1UEC A;  5KE2 A;  3M58 A;  4IUT A;  1N9S A;  4Y91 A;  1WYX A;  2E3H A;  5D7U A;  4J9B A;  4M7D A;  4X34 A;  2OJ2 A;  5GAM j;  3OBY A;  1RAD B;  2QGG A;  2CP0 A;  4HCZ A;  3VV0 A;  1QP2 A;  2PTK A;  1BI1 A;  2ZZD A;  3OB9 A;  4M75 B;  2DIQ A;  3UA6 A;  2E6Z A;  3CBM A;  4IUP A;  2J6O A;  1PM3 A;  2KYB A;  1OX8 A;  3HPW A;  5DLO A;  5EC7 A;  2EKH A;  2XK0 A;  2D1X A;  1OQK A;  4RTT A;  1NE8 A;  2VYT A;  1MMN A;  2YUQ A;  1YIJ T;  2XD0 A;  2CUD A;  3VKI A;  3AT1 B;  3PNW C;  4BDZ A;  4JLG A;  1SPK A;  1X6G A;  1VQ6 T;  4J9F A;  3C4S A;  2QEX Q;  2WAC A;  2NUZ A;  1TH7 A;  5IXB A;  3FDR A;  3UDC A;  1QLY A;  4IUR A;  3CCR A;  1VQ5 T;  3C95 A;  3OY9 A;  2DBK A;  2ZGW A;  1IXD A;  2LQW A;  3I56 Q;  1C0M A;  6AT1 B;  4WTO B;  4DEY A;  1K73 R;  5J26 A;  1VQ5 A;  1WJS A;  3CMA A;  2NUT B;  5GAN 8;  2KDS A;  1BB9 A;  1NJI C;  2V8J A;  4F7U F;  4E7S A;  3JCM J;  3CXC P;  2E41 A;  4JLI A;  1GBR A;  3TU4 K;  5LJ5 j;  1XJW B;  2ATC B;  1FMK A;  3CBP A;  4KGZ B;  4JRQ A;  1V29 B;  1JQQ A;  4CRI A;  3PIO A;  3M57 A;  4AFS C;  3S3M A;  2VB6 A;  1VQP Q;  2XMF A;  4BD3 A;  2E1H A;  4ORZ A;  2CGH A;  2HKN A;  5LJ3 g;  1E6H A;  3S3N A;  1IB8 A;  2R5M A;  3RKW A;  1WX6 A;  1W2B A;  3CC2 T;  4A4G A;  2CS7 A;  2DER A;  4C5I A;  4B6M A;  2EYZ A;  1TXQ A;  2P84 A;  2M9U A;  2F2X A;  1UGR B;  4OMF B;  1WHH A;  4MZP A;  1Q7Y C;  2P4R A;  2A28 A;  3PVQ A;  1KC8 R;  3JCM g;  2QI2 A;  2DAQ A;  2IPO B;  1M90 U;  4PFO A;  5GAO p;  2ED0 A;  3V7C A;  4BI4 A;  3CQT A;  2HAX A;  2DIG A;  1Q81 C;  1YI2 T;  2JNG A;  2EVR A;  2E5Q A;  2DYB A;  4NOY A;  3RNJ A;  3OS0 A;  2PVD B; 
#chains in the Genus database with same CATH homology
 1B34 B;  4Z02 A;  1I81 A;  2LDM A;  1VQ7 T;  2VGM A;  3HKS A;  5C0M A;  4PJO C;  5L8R E;  4BI3 A;  3A8L B;  1VQN A;  5FLX E;  2EWN A;  4XU3 A;  2CZ1 B;  5GAN e;  3M54 A;  3MHX A;  4M78 E;  2DPP B;  3CCJ A;  4M7D B;  1G3W A;  1WNL A;  2XU8 A;  4BDY A;  1I4K 1;  2EJ9 A;  1FXX A;  4PJO F;  4ZGD B;  1FWZ A;  2EQK A;  1Y71 A;  2E12 A;  3G7Z A;  4J7I A;  5GAN 4;  3G4S T;  1VQ4 T;  1M90 C;  3E1S A;  2OTL T;  4C0Z A;  3JB9 F;  1XNI A;  5GAO l;  4BE1 A;  1VQ6 A;  5FRN A;  1VQP T;  3PGG A;  4O6J A;  3DLM A;  2GCX A;  3EFS A;  3N5B B;  1BYM A;  5HK0 A;  2OTJ A;  3PTA A;  3QHS A;  2K5I A;  2LCC A;  3GLX A;  5GMK i;  1MHN A;  4IUQ A;  2K4Y A;  3QKJ A;  2XDB A;  3ER0 A;  1YHQ T;  2MI6 A;  2MMP A;  3OYK A;  2KMT A;  3BW1 A;  3GNF B;  3M4G A;  4M77 E;  2BKD N;  4XU1 A;  3WVD B;  5CK9 A;  1K8A C;  1BI0 A;  4E7H A;  2F5K A;  2Y4Y A;  2ZPG B;  4QQG A;  3GPL A;  1UGP B;  3V7S A;  3G71 A;  4LDW A;  3EFR A;  3CD6 T;  2LTO A;  3NTI A;  4DOW A;  2L5Q A;  3JCM P;  3AHU A;  3VUB A;  2QA4 A;  2WSC E;  2FHD A;  3V8J A;  4X9D A;  3RIR A;  4QVD A;  4YTL A;  3G6E A;  4PNO A;  3CCQ A;  2I2L A;  2P4T A;  4PJO G;  4C5E A;  4XU0 A;  3BDU A;  2LQK A;  3INZ A;  5C6S A;  3CMA T;  1NPR A;  3HP9 A;  1YIT T;  3SDZ A;  1D3B B;  4JRK A;  3LGF A;  4MMK A;  3LGL A;  3M56 A;  2CYZ B;  2KK4 A;  3KXT A;  1N8R U;  3OW2 S;  3HRU A;  4Y28 E;  4C8Q G;  2QQS A;  3CME A;  1N9R A;  2PUO B;  1VQN T;  5KCO A;  1X6O A;  4E7I A;  3HL8 A;  5GMK e;  3OYF A;  4ME7 A;  3VYH B;  1QVF S;  3GIB A;  1KD1 U;  4PJO E;  1JBM A;  1YJ9 A;  2RHX A;  2ZPB B;  1QW1 A;  3A8G B;  3FC3 A;  3CCQ T;  2EQU A;  4KUL A;  2OTL A;  3JCM V;  4M78 B;  4ZN1 A;  2X4J A;  2DJZ A;  3VU3 C;  2X35 A;  3G4S A;  3RMQ A;  3CCR T;  4HCC A;  2G3R A;  1SSF A;  5HK3 A;  3OSV A;  4ZGE B;  2DD4 A;  4R55 A;  2E65 A;  2XI9 A;  2XDP A;  3QXE B;  1VQ8 T;  1GXI E;  1UGQ B;  1NPP A;  3LX7 A;  3S3O A;  2DTO A;  2RK2 A;  5CKE A;  5FU6 B;  3I55 T;  2DVE A;  1K8A U;  2JOY A;  4MZT A;  4FT4 A;  2DTI A;  3JCM d;  3L2Q A;  4BE0 A;  4EMG A;  5LJ5 d;  4C0F A;  3DLL A;  3CCS A;  1W2B S;  4LDU A;  4ELZ C;  3OA6 A;  2CKK A;  1DJ7 B;  3MEU A;  2X4Y A;  4A4K A;  1BKB A;  5LJ3 d;  1Q82 C;  2HQX A;  3L2V A;  4FL6 A;  5CKF A;  2L3R A;  4LD9 K;  2EJG A;  5FU6 C;  1G3S A;  2RA2 A;  1B34 A;  2MWP A;  3RKY A;  1N8R C;  2EFI A;  3BFM A;  4J6X A;  2R57 A;  2K2V A;  3DB3 A;  4M75 F;  4QQD A;  5LJ5 h;  5D6Y A;  3TEE A;  3JB9 H;  3FB9 A;  3MEW A;  4M78 D;  3SWN B;  3TCJ A;  1KD1 C;  4MDW A;  3CXC S;  4FM4 B;  3RER A;  3OYD A;  3OYJ A;  3TRE A;  5LJ3 h;  1KG1 A;  3MET A;  3P8H A;  4JRP A;  2VV5 A;  1H3Z A;  4M7A D;  3QG1 A;  4BAC A;  3M53 A;  4C0D B;  3CC7 A;  1Q7Y U;  4M77 F;  2LRQ A;  1WQW A;  3DB4 A;  2DXT A;  5GAN 7;  3J7A F;  3CPF A;  3OS5 A;  2M1H A;  3QDR B;  4IUU A;  4L6V 5;  2P0K A;  4C92 E;  2RK1 A;  3E19 A;  4R56 A;  3L2W A;  4E7J A;  1PSF A;  3M4Y A;  3WXM B;  4F7U A;  5GAN f;  2MF2 A;  1K9M U;  1XTD A;  3CPW S;  3OYY A;  1HK9 A;  3JCM h;  1VQO T;  1YI2 A;  3JCM W;  3JB9 D;  2RI2 A;  4ELY C;  3HSB A;  1LOJ A;  2KY9 A;  1WQ7 A;  3P8D A;  4RCC A;  4DQ2 A;  2V8K A;  2ZPH B;  3PFS A;  5CKH A;  3CC4 T;  3L1A A;  4GLK A;  3JCM e;  3CCM A;  4M78 G;  1VQ4 A;  3GNG A;  4RG8 A;  4N0A C;  5LJ3 f;  2EQM A;  2IVW A;  2RHU A;  1M4Z A;  5I2M A;  3LW5 E;  3OYE A;  1Q82 U;  4C92 C;  2GFU A;  3MP6 A;  4HKE A;  5CKB A;  4II1 A;  2D6F A;  2WSF E;  1KC8 C;  5LJ5 f;  2XID A;  4LDV A;  4OF1 A;  3CCE T;  4FT2 A;  2QEX A;  2ZCF B;  3SWN A;  5DY9 A;  3T9N A;  5A0D A;  1QVF A;  4Q5W A;  2JVV A;  2RHY A;  1D3B A;  2GF7 A;  3S6W A;  5GAN 3;  1KHC A;  5LL6 S;  3OYL A;  1YJW A;  3GF5 A;  4O5V A;  1VQL T;  2IG0 A;  3QYH B;  4PKC C;  4CI0 C;  4ZGJ B;  2KQW A;  5M9O A;  4KUD K;  3MEA A;  3C12 A;  2A7Y A;  2RI3 A;  4HT9 A;  1NJI U;  3C94 A;  3X28 B;  2HD0 A;  2DXC A;  3KUF A;  1O75 A;  4L59 A;  2M16 A;  2PVG B;  4C92 G;  4M77 G;  4F7U B;  3J80 E;  1Q86 U;  5GAN d;  2RD1 A;  4C8Q A;  3QBY A;  1YJW T;  2X4X A;  2M0O A;  4C8Q D;  3OS2 A;  3QUI A;  4XTV A;  5GAN 5;  1WGS A;  2Y4X A;  4FU6 A;  2GQV A;  3L2U A;  1Y96 A;  3O8V A;  2DZ9 A;  3CCV A;  2RM4 A;  1OI1 A;  2HNI A;  1YBY A;  2PU9 B;  4M7D G;  1R8O B;  3SFM A;  4LD6 A;  2LT1 A;  2V8I A;  4A4E A;  3CCS T;  1M1F A;  2LNV A;  3FIF A;  2OTJ T;  1M8V A;  3MCA B;  2XIC A;  1LNX A;  1JJ2 A;  1N6A A;  3LYI A;  3JSC A;  4VUB A;  3PIP A;  2ZPE B;  4DA4 A;  2NLU A;  3CC4 A;  3FJP A;  1XOV A;  1BIB A;  2HBP A;  3PMT A;  4C8Q E;  4IKF A;  1G5V A;  2BIV A;  3G71 T;  2YHT A;  2LQ8 A;  3I56 T;  5GMK h;  1VQ9 T;  1I8F A;  3SWN C;  2C06 A;  3OYB A;  1JRI A;  4C92 A;  2QQ9 A;  3V8L A;  1XQH A;  2O4X B;  1RL2 A;  4MML A;  5IT9 E;  2EQJ A;  4OVA A;  4RCB A;  2DEQ A;  1VIF A;  2L89 A;  5DM7 R;  2QDY B;  4M7A B;  3URG A;  2QEX T;  5I21 A;  4HA8 A;  4N0A A;  2K57 A;  4M78 A;  2ZPF B;  3H8Z A;  4LDY A;  3L2Z A;  3MP8 A;  3JAM E;  2RJC A;  3GOX A;  3H6Z A;  1I5L A;  4F7U E;  5CQY A;  2MWO A;  3SD4 A;  5LJ5 e;  4C92 F;  3CCM T;  1HXD A;  4PJO B;  4M7A E;  3DKM A;  5GAO n;  1YJN A;  5GAM d;  4L5G A;  3MEV A;  4RG2 A;  4E7K A;  4EMK C;  5GAO r;  3JCM b;  4V2S A;  1X01 A;  3HHT B;  4M7A C;  2EKO A;  3CD6 A;  4F7U G;  3OYG A;  1YJ9 T;  4BE2 A;  2WSE E;  4MZM A;  3V8K A;  3RES A;  4J83 A;  4B9W A;  4EMH A;  2KSS A;  5GAO m;  5GAN j;  1KQS A;  4HCB A;  5FRM A;  2RHZ A;  5FRO A;  3X24 B;  1YIJ A;  4OGC A;  1UEB A;  2LT4 A;  4C8Q F;  1S72 T;  1QVG A;  3CCE A;  2QQB A;  5GAM f;  5GAM h;  1YCY A;  3X25 B;  4JS4 A;  2GFA A;  2RI5 A;  4M75 G;  1Q81 U;  1PSE A;  3JCM X;  2FL7 A;  2YLB A;  1OZ2 A;  3ZFJ A;  4M7D D;  4XTY A;  4M78 C;  3OSS C;  3VYG A;  1ZQ1 A;  2RJD A;  5D6X A;  2JTM A;  3RMS A;  3JCM f;  4BUG A;  3CXC A;  5GAN h;  3NFC A;  5LJ3 e;  2D9T A;  1OYX A;  3ASK A;  3NTH A;  3L42 A;  2PQW A;  1JJ2 S;  3OW2 A;  3RUX A;  4PJO D;  2QTX A;  1VQK A;  3LWH A;  2AHJ B;  4PJO A;  4NS5 A;  3L2R A;  1U1T A;  2VUB A;  2ZPI B;  3JRZ A;  3OBW A;  2VGN A;  3QJY A;  3JB9 J;  1QVG S;  4M7A G;  2FB7 A;  2VC8 A;  1Y96 B;  5CR2 A;  2X4W A;  4ZTJ A;  5GAM g;  1IRE B;  2LX9 A;  5KE2 A;  3UPU A;  3HRS A;  1M5Q 1;  4M78 F;  3P8B B;  4JUV A;  3M58 A;  2JN0 A;  4IUT A;  4OB3 B;  1N9S A;  4Y91 A;  1WJR A;  1QP3 A;  1WJQ A;  2VXF A;  2QXF A;  3QJ6 A;  1VQL A;  3X20 B;  1G3Y A;  1RI0 A;  3OS0 A;  4C92 D;  3A8O B;  3Q1J A;  4EMK B;  3JB9 G;  4C8Q C;  2R5A A;  4ATO A;  1UGS B;  2HQE A;  3M9Q A;  4E47 A;  4X34 A;  5GAM j;  4M7D A;  4M7D C;  2MAM A;  3OBY A;  2RO0 A;  2EIF A;  2PVO B;  3KBG A;  4C5G A;  3GP8 A;  2QQA A;  1QVP A;  2H3J A;  2FVU A;  4HCZ A;  3VV0 A;  1U8R A;  5CAI A;  2O4X A;  1BI2 A;  2CZ0 B;  2Y90 A;  3PT9 A;  3QO3 A;  4N4G A;  1QP2 A;  4J7F A;  5AYF A;  5GMK m;  1BI1 A;  1NZ9 A;  2ZZD A;  3OB9 A;  3OYN A;  4M7A A;  3WVE B;  3OQ5 A;  5GMK l;  4OB2 B;  4GY5 A;  4M75 B;  2DIQ A;  2K5F A;  1P92 A;  2E6Z A;  3CBM A;  4IUP A;  2DTH A;  5CKD A;  3F70 A;  2QQR A;  5CCA A;  2O01 E;  3HPW A;  3OMG A;  5D6W A;  5DLO A;  3OYC A;  4E7L A;  2XK0 A;  4C5H A;  5KH6 A;  4PL6 A;  1NE8 A;  2VYT A;  4PLL A;  4BY6 B;  1MGQ A;  5GAN 6;  2K3X A;  3HRT A;  4KT0 E;  4PLI A;  1YIJ T;  2XD0 A;  1UB4 A;  1VQK T;  3VKI A;  1X75 C;  1M1G A;  2XHC A;  3PNW C;  4BDZ A;  4JLG A;  3UWN A;  4MDX A;  3OS1 A;  3CPW A;  3SB2 A;  1K9M C;  1JB0 E;  2E10 A;  2EJF A;  4M77 D;  3JCM Q;  4HT8 A;  1VQ6 T;  5FU7 B;  3C4S A;  2WAC A;  4C92 B;  3X26 B;  2DKG A;  4ZN3 A;  1TH7 A;  2E70 A;  3FLG A;  3HFN A;  3QYG B;  2FYK A;  3NTK A;  3FDR A;  4OB0 B;  3UDC A;  3CCJ T;  1O9S A;  1VQM T;  2F5T X;  4IUR A;  3CCR A;  1WPY A;  1VQ5 T;  3C95 A;  4XTU A;  2E64 A;  3OY9 A;  2YRV A;  2DO3 A;  4J6Y A;  4N4H A;  2OAU A;  2ZGW A;  4M75 A;  1VQ7 A;  4LDX A;  2CZ7 B;  4OGE A;  1M9S A;  2JUF A;  4WF2 A;  4XU2 A;  5GAM e;  3BDL A;  5CVI A;  4C8Q B;  3LH0 A;  3R6O A;  5J26 A;  1VQ5 A;  4M7D F;  1KQ1 A;  1WJS A;  2BUD A;  3I56 A;  1KC8 U;  1VQ9 A;  4JRI A;  1VQM A;  3PMI A;  2D0Q B;  4J5Y A;  4XAX B;  3A5Z B;  5GMK j;  4C0D C;  2RH2 A;  3CMA A;  2JZ2 A;  1M1K U;  2DD5 A;  3QSU A;  4QW2 A;  5GAN 8;  2KDS A;  5J39 A;  1NJI C;  4BI8 B;  4A53 A;  3CC2 A;  4M7D E;  4XTZ A;  2V8J A;  4UC4 A;  4F7U F;  2CZ6 B;  4QQ6 A;  5DLQ E;  4QVC A;  5KCH A;  1KHI A;  4M75 E;  2LVM A;  3ZBD A;  1K73 U;  3CCU T;  4NL2 A;  2RJF A;  3JCM J;  4C0G A;  3BY7 A;  3OYA A;  2E41 A;  2EYQ A;  3MO8 A;  3QII A;  4JLI A;  4M75 C;  4X9C A;  3JCM c;  5GAO q;  3OMC A;  4EMK A;  1ZBX A;  2DK3 A;  3CCL T;  5LJ5 j;  3TU4 K;  4OB1 B;  1YIT A;  3ZEH A;  5CO7 A;  4OP0 A;  3ME9 A;  4A54 A;  3CCU A;  1EIF A;  2E6N A;  5FU7 C;  3CBP A;  1KQS S;  5A2Q E;  3M59 A;  3UT1 A;  3G6E T;  4JRQ A;  1KQ2 A;  1V29 B;  1G3T A;  2QA4 T;  3E9F A;  1VQP A;  1Y7X A;  1IZ6 A;  1VUB A;  3CEY A;  3V7R A;  3E9G A;  3FEO A;  4CRI A;  3PIO A;  3M57 A;  1H64 1;  4D6W A;  1BI3 A;  3S3M A;  2DXB A;  5CIU A;  4XTW A;  4RKU E;  2E1H A;  4J8O A;  4BD3 A;  4M77 C;  4IUV A;  2EAY A;  2XDD A;  2CGH A;  1N27 A;  5LJ3 g;  3OYI A;  3S3N A;  5HY6 A;  3LWI A;  2R5M A;  3CCV T;  1LJO A;  4XK8 E;  2PUK B;  1Y07 A;  1AHJ B;  2DXU A;  4JS5 A;  4B9X A;  2LC4 A;  2RHI A;  2VXE A;  4XQ3 A;  5LJ5 g;  2YLC A;  3RKW A;  1K73 C;  2RB6 A;  4DOV A;  4M77 A;  5CQX A;  3OYH A;  1W2B A;  3CC2 T;  3CC7 T;  5IAY A;  4A4G A;  2CS7 A;  2LCL A;  5I2S A;  4C5I A;  3I55 A;  2JTF A;  2KVQ G;  5LJ3 j;  2B8A A;  4JDS A;  5KE3 A;  3OYM A;  5EG2 A;  2K3Y A;  2RJE A;  1Q86 C;  1ZHI A;  1VQO A;  3CBO A;  4FIB A;  5IN1 A;  4P5N A;  3A8M B;  4TVR A;  5A0L A;  4NL3 A;  3MP1 A;  4EPC A;  2M9U A;  3J81 E;  3LLR A;  4XTX A;  3CCL A;  4KBM B;  1UGR B;  1U1S A;  3EAE A;  5GAN g;  5A0G A;  2L8D A;  1OZ3 A;  1YHQ A;  1M1K C;  4OMF B;  3FRN A;  4MZP A;  2XG8 D;  2K5L A;  4BB7 A;  5GAN 2;  5J3B A;  4A4F A;  3CME T;  1Q7Y C;  3VUZ A;  4RMO A;  4A4H A;  3HFO A;  3A8H B;  4M7A F;  3M55 A;  1W4S A;  2QI2 A;  3QPH A;  3JCM g;  1YJN T;  2DAQ A;  2F69 A;  4BY6 C;  2P0P A;  1M90 U;  5GAO p;  2R58 A;  4QVZ A;  4EDU A;  4KUI A;  3RKX A;  1BIA A;  5HKC A;  3JB9 I;  1VQ8 A;  3VJP A;  4M75 D;  3V7C A;  4BI4 A;  4FSX A;  1VIE A;  1FX7 A;  2HAX A;  2DIG A;  2P0Q A;  4ZTF A;  1Q81 C;  1YI2 T;  2JNG A;  4JJN K;  3QZ5 B;  2XKO C;  2KAF A;  2A3L A;  2E5Q A;  4M77 B;  2DZC A;  4NOY A;  4J6W A;  1S72 A;  3M5A A;  3QZ9 B;  4N4I A;  2PVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...