4M7DB

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 18
structure length 92
sequence length 92
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dB00
3JB9F 2DTIA 3PGGA 4M75E 4XU1A 2YLCA 2RD1A 1BIAA 1H641 2Y90A 3BFMA 4J5YA 5LJ3h 3JCMc 4C92F 2I2LA 4XTUA 5GMKh 1I4K1 4M7DB 4M78G 4M75C 3JCMX 1BIBA 5GANe 5LJ5j 4XTYA 4HT8A 5GMKe 5LJ5h 4PJOE 4M77A 4XTWA 5LJ3d 3JB9G 1B34A 1KQ1A 1HK9A 2RM4A 5GMKm 3JCMe 5GMKl 4F7UF 1LNXA 2DVEA 4M7DD 4N0AC 4C8QB 3HSBA 1M5Q1 4PJOC 3JCMJ 5GAMg 4M78F 3V8KA 3HFNA 4M7AG 3RESA 1WNLA 4M77B 4X9DA 5LJ5d 4XU3A 1B34B 4M75G 2E65A 3RKXA 3QHSA 5GAN2 4M7DC 5DY9A 3JCMg 5GAN6 4EMKA 4C92B 5GMKi 4C8QD 3EFRA 5GMKj 4F7UG 5GANh 1Y96B 5GAN8 2RA2A 2YLBA 4M77D 3INZA 4OP0A 4M7AB 5GAOm 3VU3C 3SWNB 5GAN7 4M7AF 5GAOl 5GAMe 4QVDA 5LJ3f 3JB9D 3JB9H 4C8QA 1N9SA 4M78A 4XQ3A 4M75F 3JCMh 4C92D 1WPYA 4EMKB 4NL3A 2DXTA 3V8JA 2E64A 4A54A 2DTOA 4M77C 3JCMQ 2FB7A 4F7UB 5GANd 2DEQA 4M7AD 1WQ7A 5GAOr 3RKWA 5I21A 5LJ5f 3RERA 4M78B 4C92A 3BY7A 4M7DE 1U1TA 1JBMA 4RCBA 1Y96A 4DQ2A 5GAN4 2FYKA 4NOYA 4HT9A 1WQWA 1KQ2A 4M7AA 4JUVA 3V7SA 3RKYA 2DKGA 3SWNA 1MGQA 3RIRA 4Y91A 5GANj 2DZCA 3FB9A 3V7CA 1LOJA 2ZGWA 1M8VA 2HNIA 2YHTA 4M78D 4EMKC 4NL2A 3JB9J 4V2SA 5GAMh 3V7RA 3M4GA 2EJFA 1D3BB 4PNOA 2DTHA 1I8FA 4C8QE 3QUIA 4F7UA 1I81A 3QSUA 4XTXA 2CGHA 3FJPA 1TH7A 4PJOG 4M77E 3V8LA 4J6YA 4M75B 2VXFA 4XTVA 1N9RA 5CAIA 5GANf 1I5LA 4XTZA 4C8QC 5GAOq 5LJ3g 4XU0A 2EWNA 4C92E 5GAMd 4RCCA 1U1SA 4M7DG 2EJ9A 2EJGA 4HA8A 3SB2A 3GIBA 4A53A 4M75D 4X9CA 2VXEA 4M7AE 3BDUA 4JLIA 4C92C 4PJOB 4JRIA 5GAOp 3JCMd 4PJOF 3RUXA 2E10A 3BW1A 3HFOA 5LJ5g 1D3BA 4J6XA 1YCYA 2QTXA 3JCMP 4MMLA 4M7AC 2K57A 1JRIA 2DXUA 3SWNC 1X01A 3FIFA 3L1AA 4M75A 5GAMj 3JCMW 4C8QG 5LJ3e 4F7UE 4M7DF 2E1HA 4PJOD 4EMGA 4M77G 4M78E 5GAOn 2DJZA 4J6WA 4QVCA 1HXDA 2VC8A 3L2ZA 4WF2A 2EAYA 2E41A 4C92G 5GAMf 5LJ5e 3JCMb 4M78C 4N0AA 4XU2A 2RB6A 4PJOA 3AHUA 4EMHA 1LJOA 4JRKA 5GAN3 3JB9I 3JCMV 4C8QF 5GANg 4MMKA 3JCMf 4M77F 2DZ9A 4M7DA 3QO3A 5LJ3j 2JN0A 5GAN5 3EFSA
chains in the Genus database with same CATH superfamily
1BI3A 1YITA 2EYXA 3LWHA 2LCLA 1QKXA 2HZYA 1GRIA 1K9AA 3QJ6A 2LJ0A 1WHKA 4PK4A 2K3XA 3X26B 3I55Q 3VYGA 1I07A 3EHRA 3I5RA 1ZA1B 1QP3A 2LCSA 3U23A 3F70A 2V8IA 2DJQA 4X9DA 2D6FA 2K5LA 4J9FA 3EAEA 4MZPA 5KYXB 4NS5A 2EGEA 1VQ6A 4GLKA 5GMKj 1ZHIA 4F7UG 4R55A 3CD6T 3EH1A 2NUPB 2CS7A 3VU3C 1NM7A 2JUFA 4QVDA 4BD3A 1K76A 4XQ3A 4M78A 3OW2A 4M75F 4GLMA 1BKBA 2O01E 2P4TA 3RKWA 4X34A 2FEIA 2EYQA 2V1QA 1S72T 1RAEB 3EG9B 2EIFA 2FHDA 2ZGWA 2IVWA 4M78D 4LDXA 4V2SA 4DBQA 4PFOA 4E7KA 1YIJT 3OYEA 2VGMA 3VYHB 1OQKA 4LUEA 2FZGB 4QVZA 3VS3A 4XU0A 5KYWA 1ZX6A 2M0OA 2JTEA 2LX7A 1Y7XA 3SB2A 1W2BS 4LDYA 1VQPQ 1BI0A 2RJDA 2KNBB 2MOXA 1X01A 2D1XA 1Y0MA 2YDLA 2LJ1A 3EG1A 4C5GA 4HXJA 5IHNA 3REAB 3LWIA 1KFZA 3M53A 1VQMA 1YHQQ 3M58A 1M4ZA 5IXFA 2DIGA 4ESRA 2ZAEA 2ZPGB 2GF7A 4JDSA 1U3OA 1K9MU 2JMCA 3FRNA 4A4EA 2CP0A 3HKSA 2BE9B 1VQ9T 1VQOA 3JCMc 2I2LA 3KXTA 2KVQG 1K8AU 3JCMX 2X4XA 3L2QA 2JVVA 5J39A 1YJWA 3CCSA 2NUZA 1ABOA 2CKKA 3OBWA 4XU3A 3CCVQ 2K2MA 2J7IA 1KG1A 5DY9A 2ECZA 1Q82U 3WXMB 4MZMA 1OZ3A 1V1CA 1GXIE 2YLBA 1X6BA 5GAN7 4ZGDB 3CXCA 3EGDB 5GAMe 4C0DB 1N5ZA 1DJ7B 4C92D 1VQLQ 2ZPEB 3QBYA 4BI8B 4J8OA 3CPWP 2KXCA 2DO3A 3L2WA 5J26A 2YRCA 1JJ2P 3OYMA 1PKSA 3M0TA 1GCPA 3S3OA 1YJ9Q 1QVPA 1JEGA 1HSQA 1PD0A 3TU4K 5GANj 3SDZA 4OGEA 4RUGA 2E4HA 2IG0A 4J6YA 5KCHA 4XTVA 3CMEQ 4D6WA 3CCMQ 4FCYA 1UGRB 3CCLQ 1NYFA 3KUFA 2KMTA 3VS2A 1OV3A 3RUXA 3M0PA 5I2SA 2G3RA 3JCMP 3HRSA 3FIFA 4M75A 3CC7T 2RMOA 5LJ3e 4M7DF 2QA4A 1AEYA 3JV3A 1TG0A 5J3BA 5LJ5e 1MMDA 4LD6A 1WJRA 1VQNT 4MMKA 2W10A 3JCMf 5IAYA 2RHUA 4ELYC 2DTIA 4J5YA 4ZN3A 3OYAA 4E7HA 3CCJQ 4A4HA 1G8XA 3CCEQ 3QXEB 5CKBA 2LC4A 1GFCA 1WXBA 3VS5A 4DEYA 1BK2A 2L2PA 3OYLA 2GTOA 2MAMA 1XQHA 1NG2A 3V8KA 2RPNA 3HFNA 3MP6A 4C0FA 4M7AG 3X28B 2VWFA 4F17A 1B34B 1PKTA 1VQOT 1FMWA 2X3XD 1UECA 5CR2A 1SRMA 4BI3A 1RABB 4ZGJB 1QVGA 2GFAA 2DE0X 1RUWA 4NL3A 2OTJT 4HCBA 4LUDA 2K5IA 4FU6A 1Y71A 2RJEA 3CD6Q 4M7AD 1H3ZA 1JBMA 3RKYA 5GJVB 2BZ8A 4OMQA 5HK0A 2F2WA 4PNOA 3QSUA 2P0KA 1S72Q 2GCXA 1D1AA 1IXDA 1WHHA 3A98A 1YIJQ 3M54A 4PJJA 3OS1A 1BBZA 3OQ5A 3VS7A 3A8HB 3M0UA 4E2FB 3E1SA 4N4HA 2D8JA 4HVUA 1KD1R 3GNFB 3M0QA 4QQGA 3GLXA 1YHQA 1WI7A 4C0DC 3QZ5B 4DBHA 1T3SA 4J6WA 4QW2A 2JW4A 5GAMf 4PJOA 3QYGB 3CBOA 4C8QF 1TUGB 1R0CB 2WACA 5HCKA 1QWEA 4M77F 3QO3A 3WVDB 4JJNK 4N4GA 1M30A 4BDYA 1BIAA 4FW1A 2YRDA 2KXDA 3OYYA 5GMKh 3EGUA 1GFDA 2K2VA 2QA4T 3OYHA 2DEUA 4RTVA 1AVZC 2GFUA 1VQ9Q 2XKOC 1T0JA 2RHZA 3PVQA 4CRIA 4ZTJA 3CCVA 3QZ9B 4IUUA 2EPDA 1C1AA 4J9EA 2E6NA 2XHCA 1SEMA 2WSEE 2KQWA 3ER0A 4M7DC 8AT1B 2RQTA 4EMKA 2C0OA 1VQLA 5GAN8 4OMPA 3FEOA 1ZBJA 5LJ3f 1YITQ 2QEXT 1K73U 2HDAA 4BUGA 1B7TA 2EBPA 2PNIA 4C5HA 1YJ9A 5GANd 2F5TX 2XMFA 1RAAB 2ROTA 3ASKA 5LJ5f 2KRMA 2EGAA 1AHJB 3ZL7C 1VQ5A 4J9GA 3QWYA 2PVGB 2KT1A 4L59A 3OSSC 1W6XA 1D3BB 4A4KA 2EVRA 5HKCA 3VRZA 1X2QA 2DNUA 3CCLA 4AFQC 2EWNA 1PNJA 2YSQA 2A7YA 2MWOA 1W2BP 3CPWA 2OAUA 1JJ2A 4A63B 5CQXA 4UC4A 4OVAA 1C0MA 1JRIA 1NBEB 2MK5A 4LDUA 3FDRA 3JSCA 2DRMA 3LGLA 2D8HA 3L2ZA 3QPHA 3CC7Q 5FROA 3JCMb 4XU2A 2HL5C 5CK9A 3OMCA 2PVDB 3CCJA 3AT1B 3CCEA 1KQSS 2CSIA 4EPCA 2JT4A 1VQNQ 2CUDA 1G3WA 2RD1A 3BFMA 1ZUYA 1QP2A 3S6WA 4MDXA 3J81E 3VRYA 4XAXB 1FMKA 3ZEHA 2HEQA 3JB9G 4E7ZA 1X43A 2YUOA 4F7UF 1J3TA 5DLOA 1UJYA 2DXCA 2E6ZA 1MMAA 3L2UA 5FU6B 4M78F 3RESA 2J6KA 5EG2A 2R58A 3P8HA 5GANh 2J6OA 2P84A 2CT4A 1VQOQ 1QW1A 1X6OA 2BKDN 3CD6A 3CMAT 3OYBA 3JB9D 1OZ2A 2KI7A 4C8QA 1NE8A 2DXTA 2P0QA 4LXCA 1WFWA 1QKWA 4AFSC 2X4WA 1SG5A 4M77C 2GQIA 2V8KA 1WHMA 3VS1A 2CUBA 2AZSA 3D7SB 4J7FA 1UJ0A 1Y96A 4DQ2A 2FRWA 5GAN4 2OTJQ 5KYWB 2DX1A 2VV5A 3SWNA 1QCNA 4IUVA 2K4YA 2DLPA 2E5KA 3V8LA 2D0QB 5KH6A 3BDLA 4IUTA 2LRQA 3H9NA 2X51A 1O75A 1JU5C 2F1LA 1VQ5T 1Z9ZA 2K79A 4RTTA 1HD3A 3QDRB 2HSPA 2VVKA 2EQMA 2A28A 2CP6A 2LNHB 2L3PA 1Q86R 2O31A 3CC2T 3G7ZA 2KROA 2M9UA 2COYA 2OTLT 4AFUC 3JCMV 4BI4A 1RAFB 2QQAA 3HHTB 3META 4FL6A 1AD5A 3VS0A 3SD4A 4N4IA 4C92F 1IB8A 1F1BB 1I4K1 2DL4A 2XIDA 1R0BG 2LP5A 4JLGA 5CQYA 4E47A 2QA4Q 2RF0A 2OJ2A 1QCOA 2MCNA 5CO7A 4ZGEB 4EIKA 1NPRA 2DF6A 4KRTA 2X3WD 3E9FA 1ZSZA 5FU7C 2GTJA 2K3BA 1RLPC 3TCJA 1AOJA 3FC3A 1NJIR 1Q86C 2K3YA 4J9HA 4KH1B 1IREB 3OS2A 1P92A 3R6OA 2QEXQ 3P8BB 4RCBA 2HSEB 3VS4A 4ATOA 3LLRA 2EQUA 1OULA 2DVJA 2DZCA 1YI2A 3L2VA 3C4SA 4Z02A 4F7UA 1OX9A 1XNIA 2CSQA 1X75C 2A08A 4M75B 4ORZA 4RTYA 5GAOq 3VV0A 2HKNA 5FU6C 4FSXA 3A8MB 1JXMA 2L5QA 2KT8A 1WGSA 4JJCA 1SPKA 2L8DA 1ZUUA 2RN8A 1FXXA 2YT6A 4CC4B 1VQKA 2EQIA 2J6FA 1BCMA 2CZ1B 2B86A 3OW2S 3CC7A 5FWBA 2YUQA 4PJNA 4QVCA 2VC8A 3MO8A 4EDUA 9ATCB 5CIUA 2E41A 4ZN1A 3H8ZA 3EH2A 4EMHA 3N5BB 2K7AA 2CT3A 1NJIC 1VQNA 2I0NA 3PT9A 1ZLMA 2V26A 3P8DA 5LJ3j 2PU9B 5KYYA 3EFSA 2MF2A 4CI0C 3FLGA 1U8RA 4JJDA 3CCUA 5IT9E 1BIBA 5LJ5j 1KK7A 2DIQA 2ROLA 2HBWA 3T9NA 3PNWC 5A2QE 1CKAA 1PRLC 2CP7A 1WNLA 1W4SA 5FRMA 4FT2A 1KC8U 1PD1A 3OS5A 3E9GA 2SRCA 3G6ET 3RBBB 1N6AA 3PTAA 2BUDA 3UPUA 2ED1A 3V8JA 4AMCA 2OTJA 2F69A 3REBB 3CMAQ 1UEBA 4C92A 5C6SA 3OA6A 3LGFA 1U1TA 1OPLA 2HQHA 4NOYA 3EGXA 4ZNXA 4Y91A 1M90U 2RH2A 2VYTA 3TEEA 1N27A 2EJFA 1V76A 1I81A 1X27A 2CGHA 5I2MA 1TTHB 1M1KR 2GBQA 1QVFA 2KYBA 2EYYA 2FG0A 1ZA2B 3CCQT 5I11A 1BCOA 3BDUA 4PJOB 2DM1A 4PJOF 5KYUA 1LCKA 1QCFA 1YI2T 4KUIA 1MV3A 1G3SA 3CXCS 1BU1A 1RI9A 1VQ5Q 2OX7A 2O88A 1I1JA 1XOVA 5GAOn 4RG2A 4YTLA 4OF1A 4LDWA 4IIMA 4WF2A 2P4RA 3UWNA 4J9IA 3CC2Q 1UTIA 2VUBA 2OTLQ 1UGPB 4XU1A 1VQKT 3A8OB 4Y92A 1YWOA 3NTHA 4Y28E 4M7DB 4M75C 1WZOA 4A4FA 2QGFB 3L2RA 2FVUA 1H3HA 4OB2B 4QQ6A 1PC0A 1Q7YR 1KQ1A 1M1KC 2K6DA 1VUBA 2J06A 1NLPC 4M75G 2E65A 1OI1A 3RKXA 3A1PA 2HL3A 3JCMg 3CCUT 3NMZC 3RR6A 2O9VA 3CC4A 2CZ0B 3JB9H 3JCMh 1KHCA 4PLLA 2QEXA 2RJCA 4BB7A 3JCMQ 3TQ7P 2EGCA 5FW9A 4J7IA 2L3QA 2A36A 4M7AA 3M0SA 4KT0E 4AFZC 1Z9QA 1MMGA 3V7CA 1SF9A 1QWFA 2A0FB 2EW3A 3OYJA 5FLXE 1PHTA 2LNVA 2JNGA 4OMLA 1Q7YC 2EJ9A 1RAGB 2FRYA 1GCQC 3BW1A 2JXBA 3MEVA 4Q5WA 4L5GA 1QVGS 2LX9A 3EFOA 3L1AA 4JRQA 1MV0B 1T0HA 2RI2A 2H3EB 1OOTA 4ZTFA 1U5SA 1BI2A 5FWCA 1M3CA 2EAYA 2AHJB 1R77A 5GAN3 4JRKA 4OMOA 2KEAA 4LN2A 4PJLA 1ACMB 2JN0A 3JB9F 4DOWA 3G71A 2QASA 3NPFA 3DB4A 1W1FA 1M3BA 2DYIA 3J80E 5GANe 3OYFA 2DYBA 2E3IA 1AZEA 2RJFA 4C8QB 4PJOC 2VB6A 5GAMg 4RTXA 2BIVA 2CREA 4M77B 1G5VA 3H6ZA 3EGDA 2R5MA 2AKKA 4KH0B 1Y96B 1U06A 3SWNB 2XK0A 5KYNA 2NUTA 4HKEA 3CMAA 2B8AA 2RK2A 4BY6B 2E64A 2WSFE 5IH2A 5DM7R 4AG1C 3NTIA 2RHIA 4IURA 1MUZA 2QDLA 5L23A 4HCZA 4MZTA 2XG8D 1BI1A 2X35A 3V7SA 5IHIA 2EKOA 2PQWA 1MNEA 5IXBA 4EMKC 1UGQB 3IQLA 1UE9A 3V7RA 3ME9A 2CP3A 3CC4T 1KD1C 3VUBA 2MI6A 3C95A 2LMJA 5LJ3g 1RADB 4B9XA 4FIBA 4M7DG 2M02A 5FRNA 1YJNA 1PRMC 5CKHA 3C12A 5LJ5g 2DILA 2KRNA 2DL3A 4MMLA 1H8KA 4JS5A 3CCQQ 3OW2P 1X69A 2KRSA 4FSSA 3DKMA 1PCXA 2ATCB 1YI2Q 4N0AA 3LH0A 2DXBA 3CC2A 2LQ8A 1WHJA 3PFSA 2OTLA 1KHIA 2AT1B 2BZYA 3M55A 2M16A 2J05A 5CKFA 2L3SA 4M75E 2ABLA 1H641 1Q7YU 1QLYA 4FYWB 4O5VA 3OMGA 1WJSA 3M0RA 3TREA 5IHKA 2MPXC 2A37A 2DD5A 2KYMA 4FYVB 1VQKQ 3O5ZA 3PIOA 5FU7B 1B34A 2AKLA 1VIEA 4RTZA 3CCRA 3CPWS 4CC7A 1Q95G 3JAME 4Z89A 1JJ2S 2ENMA 2LQNA 2MIOA 3G71T 1YNZA 1D0YA 4FT4A 5I22A 4VUBA 2IPOB 3I9QA 1GBQA 4FYYB 1ZBXA 5CKEA 3H0FA 3CCUQ 2D9TA 2MYSA 5HY6A 4F7UB 3LX7A 3GNGA 1QQJA 2HCKA 4M78B 3MJXA 3H0HA 1D0ZA 2LCCA 2FYKA 2FZCB 3EG0A 1RACB 2YUPA 4HVWA 4NL2A 5A0LA 2QQBA 2CZ6B 3M4GA 3VUZA 1I8FA 3QUIA 1BYMA 3M59A 1VQ8T 1IZ6A 3QWXX 3CQTA 5GANf 4XTZA 4IUPA 4C8QC 3UDCA 1UHCA 4J83A 3NFCA 2JOYA 2E3HA 4IIOA 2ZPIB 2VXEA 3OY9A 5GAOp 2MWPA 3MP8A 3MPUB 1NYGA 4C0ZA 3CXCP 3SWNC 1ZUKA 4C8QG 2GQVA 2YRVA 4FYXB 4JZ4A 4HCCA 2F5KA 5KYYB 4M77G 3PIPA 1MHNA 1TXQA 4P5NA 4BY6C 1WDXA 3OYCA 1IGQA 1KSWA 1SSFA 1WLPB 1K8AR 1OEBA 3JB9I 1KD1U 3ULRB 1YJNT 4KGVB 4XK8E 4KBMB 5GAN5 3PGGA 1TU0B 2E70A 2Y90A 3PMIA 2SEMA 2KK4A 1MNDA 4XTUA 4AT1B 1D1CA 1B3QA 3C0CA 1VQ4T 2DERA 3M56A 4PJOE 2RM4A 5GMKl 1LNXA 3M57A 4LE9A 4Z88A 2KGTA 3JCMJ 2QK0A 3I56T 1T3LA 5GAN6 4C92B 2DK3A 4C5EA 1WYXA 1FYNA 2RI3A 3G6EA 3INZA 3EGXB 4LDVA 5GAOl 1OPKA 2PVOB 1N9SA 2YXYA 3EG3A 4OGCA 1R8OB 2R5AA 3CCRT 3A8LB 4PL6A 1EIFA 2HD0A 1K8AC 2COWA 4M7DE 5GJWB 5IN1A 2ZPBB 2X4YA 2JM8A 1TUCA 5ECAA 3TSZA 4ANJA 2CH4A 4X1VA 1ZSZC 2OI3A 5KYUB 3RMSA 1S1NA 3CPFA 2ED0A 3CC4Q 2NLUA 1VA7A 4OMMA 4WCIA 3OYNA 2DL7A 3MCAB 3CCQA 1CKBA 1QVGP 1WXTA 1XTDA 2JTMA 2LTOA 5KCOA 5GAMj 4BE0A 1N8RR 1V29B 5AYFA 2G6FX 3THKA 2O9SA 2WSCE 4M78C 2F2XA 3PE0A 3AHUA 2K5FA 1LJOA 1RI0A 2KSSA 3G1JA 1VQ7T 1D09B 1IGUA 1IHWA 3RDVA 1VYUA 4Z8AA 4M78G 2QQ9A 4RTUA 2M51A 3DLMA 1NZ9A 2EFIA 4HVVA 1JO8A 2XDDA 3JCMe 4CC3A 4PJMA 4JZ3A 2D0NA 1IRXA 5M9OA 1VYTA 2O4XA 2ZPHB 4E7IA 1KIKA 2LJ3A 1W2BA 4WTOB 2KR3A 1SSHA 4M7AB 1FX7A 4M7AF 1N8RC 1ABQA 3G71Q 1AWWA 2CDTA 2DTOA 3UA7A 2C06A 1K0XA 3URGA 5GAOr 2HMAA 3QKJA 2DETA 3A8GB 2KDSA 1M9SA 1X2KA 2DKGA 3UF4A 1UGSB 2YHTA 4RMOA 4C8QE 2DTHA 4QQDA 1AT1B 1C6VX 3UA6A 3EFOB 4M77E 2K9GA 1I5LA 1UHFA 4QKUA 2IIMA 1D1BA 4E7JA 4HA8A 1VQ8Q 1AWOA 4R56A 4C92C 2CP5A 4JRIA 4E7SA 2F2VA 3JCMd 1I5OB 2QTXA 2K57A 3M9QA 3MEUA 4KGZB 3MKDA 3JCMW 2CZ7B 1K0SA 1OU9A 3VKIA 5CKDA 1RAIB 1TOVA 4F14A 1Q81R 4C92G 5HK3A 4KGXB 5A0DA 2HQXA 1OU8A 3RMQA 1M1FA 4BDZA 4J9CA 1M2VA 5AT1B 1YITT 2ZZDA 1Q86U 1YJNQ 4OB3B 2EKHA 1QVFS 1XJWB 3HRTA 3I35A 5GMKe 1UUEA 3PMTA 1PG5B 2EYWA 4XTWA 1JB0E 4MDWA 1HK9A 3OS0A 3S3MA 2DVEA 3QG1A 1NLOC 3OYKA 2RHYA 2VGNA 2NUTB 3MEAA 1YFNA 3G4SA 1VQ4Q 1K73R 3GBQA 1RLQC 1KQSP 3GPLA 1Y07A 3FJ5A 3QHSA 1VQ6T 2XDPA 4E7LA 4R0KA 1Y57A 3X25B 4AG2C 4OMNA 1E6HA 2AZVA 3R6NA 4DA4A 3OBYA 2DBMA 3QIIA 2RA2A 3I56Q 1M3AA 3X20B 4EMKB 1WPYA 1G3TA 2XD0A 3GF5A 4FM4B 2DEQA 1Q81C 5DLQE 5KYXA 3RERA 2DL8A 4PFPA 2GGRA 1IHVA 2NUPA 3CCRQ 1MGQA 1BB9A 1TWBA 2QAZA 3FB9A 3KFVA 2RI5A 1NJIU 5CVIA 1SHGA 1M2OA 2FZKB 1ARKA 1GBRA 3S3NA 1IO6A 1M27C 1WA7A 2JMAA 2JS0A 3H0IA 2Y4YA 1HYOA 5GAMd 3X24B 1U1SA 1N8RU 3SHWA 3EG9A 4A53A 3GIBA 4M75D 2VASA 4QT7A 2DD4A 3I55A 1K73C 4J6XA 1YCYA 2DPPB 4M7AC 2DXUA 2DRKA 4TVRA 2RQUA 1WHLA 3SEMA 4F7UE 1ZSGA 1E6GA 1OYXA 1VQMT 4M78E 2L0AA 7AT1B 3NTKA 2DMOA 3NGPA 1M1GA 2ZCFB 3VJPA 2CP2A 4PFZA 2E12A 2E5QA 1W70A 2FPDA 3E2UA 1A0NB 2CH4W 3MEWA 1NEBA 1PSEA 1VQ7Q 2JM9A 4KULA 4HT8A 2HAXA 1O9SA 6AT1B 3CCST 1YJWT 2MMPA 5LJ3d 5D6YA 5GMKm 3QYHB 2AK5A 3M5AA 3PVLA 1GCQA 4JJBA 1G83A 4OMFB 1PWTA 5LJ5d 2QTVA 3LH5A 4FW2A 4OB0B 2RQVA 3EFRA 1UFFA 4F16A 2DBKA 1VOMA 2YUNA 5GAOm 3KBGA 2ZPFB 2A3LA 5EC7A 1EFNA 3NHNA 1TUDA 2RNAA 4J9DA 4A54A 1VQPA 2HQEA 1SHFA 2JJ9A 8ATCB 3G4ST 1WXUA 3OYGA 2C0IA 2EQKA 1X6GA 2KY9A 1WX6A 4IUQA 4E6RA 2LQKA 1B07A 2PZ1A 2XDBA 2R57A 2DL5A 2HNIA 2LDMA 5GAMh 2QI2A 4XTXA 1TH7A 4PJOG 1PSFA 5L8RE 2VXFA 1N9RA 1VQ8A 4OB1B 2HBPA 2YWWA 4PLIA 4RG8A 3G6EQ 2M0YA 3CBMA 4BE1A 4C92E 2AIRB 5C0MA 1G2BA 2LQWA 4DEXA 3EHQA 4DBRA 4X9CA 3VS6A 2KE9A 1VYVA 1PM3A 3C94A 2E10A 1M1KU 1TS9A 1Q81U 2X4JA 2OAWA 2E1HA 1I0CA 3BE3A 3L42A 4PJOD 4EMGA 3HPWA 1WHGA 2Z0WA 2FPEA 1HXDA 3DB3A 4JS4A 1UDLA 3Q1JA 2RB6A 1H92A 1NPPA 4M7DA 1LPLA 3I55T 2JTFA 5D6WA 1WJQA 2YLCA 5LJ3h 1SRLA 4C0GA 1GL5A 4LNPA 2H8HA 4XTYA 5LJ5h 1UGVA 1VQ4A 4M7DD 2XU8A 4N0AC 3HSBA 1M5Q1 4RKUE 3TVTA 5GAN2 4D8DA 4JRPA 3QJYA 4BE2A 2Y4XA 2NWMA 1JXOA 5GMKi 1RL2A 3I56A 2RQWA 1WIEA 4OP0A 2QGGA 1EZZB 3CMEA 3CCMA 3SFMA 1G3YA 1VQ6Q 2DFUA 1ZSZB 4BACA 3GP8A 4A4GA 1LVKA 4IKFA 1UG1A 1YBYA 1AWXA 3BY7A 4DBFA 3QDFA 4ELZC 1WQWA 1KQ2A 1RAHB 4JUVA 2LT1A 1KQSA 2RO0A 3MHXA 4J9BA 3UT1A 3RNJA 1K4US 4ME7A 2LVMA 3FJPA 3CEYA 5CAIA 4GY5A 1YWPA 4M4ZA 1VQPT 2ESWA 2FPFA 1YN8A 2FL7A 3WVEB 4C5IA 2EJGA 1EX4A 2COZA 2DA9A 2W0ZA 2BZXA 1SKUB 5KE3A 2V1RA 2X9HA 1KJWA 4M7AE 4CC2A 3HFOA 2HKQB 1YHQT 5A0GA 4L6V5 2BE7D 3DLLA 3HTRA 2DJZA 4D8KA 2H3JA 2DAQA 2C0TA 1UB4A 3UATA 1FWZA 4LD9K 5GANg 1YP5A 2RQRA 1VQMQ 3EG2A 2DZ9A 5D7UA 1VQ7A 1QMCA 3E19A 2O4XB 2EYZA 3O8VA 1QVFP 3LW5E 1HJDA 2QQRA 3A5ZB 1K9MR 3CBPA 1KC8R 3TSWA 2CYZB 2L89A 2EQJA 2RHXA 4M77A 3CCVT 2XI9A 1K1ZA 2O2OA 3HP9A 4O6JA 2QQSA 1YJWQ 3CCSQ 3ZFJA 2XICA 2JS2A 2BTTA 2FO0A 1S72A 1VQLT 4C8QD 1E7OA 4M77D 3H41A 4JPBW 1FMVA 3GOXA 1YIJA 2KAFA 2LT4A 3I5SA 1YCSB 1YJ9T 4HCKA 4F04B 1Q82R 1M90R 5KE2A 3OYDA 3OYIA 1ZQ1A 2FB7A 2JZ2A 2QXFA 1WQ7A 2PUKB 3J7AF 5I21A 2KBTA 3ZBDA 2V8JA 2RK1A 4GBQA 4B9WA 4II1A 3RIRA 1NEGA 3G4SQ 1LOJA 1VIFA 1M8VA 2GNCA 3LYIA 3JB9J 2QG9B 3CMET 3CCMT 1D0XA 2P0PA 3M4YA 1CSKA 3CCLT 2L3RA 1K9MC 1KC8C 1OX8A 2QDYB 4RTWA 3HL8A 4RCCA 3OB9A 5LL6S 4PKCC 4JLIA 1D3BA 2VKNA 1AWJA 1JQQA 1VQ9A 5D6XA 1M2VB 2LZ6B 1M8MA 4K11A 2PTKA 2QYZA 4DOVA 2NYSA 3HRUA 5CCAA 1TSFA 4B6MA 1MMNA 3MP1A 2M1HA 1AZGB 1Q82C 1M90C 3CCJT 3JRZA 3CCET 3OSVA 2PUOB 4KUDK 4HT9A
chains in the Genus database with same CATH topology
3JB9F 4DOWA 1BI3A 1G3WA 1YITA 2RD1A 3BFMA 1Q86U 3G71A 3LWHA 1QP2A 3DB4A 2LCLA 3S6WA 4MDXA 4OB3B 3J81E 3QJ6A 3J80E 1QVFS 3X26B 2K3XA 5GANe 3OYFA 4XAXB 3HRTA 5GMKe 3PMTA 3ZEHA 4XTWA 1JB0E 3VYGA 2RJFA 4MDWA 1HK9A 3JB9G 3OS0A 4F7UF 2DVEA 3QG1A 3S3MA 5DLOA 3OYKA 2RHYA 1QP3A 2DXCA 2E6ZA 2VGNA 4C8QB 4PJOC 3MEAA 5GAMg 5FU6B 4M78F 3L2UA 3G4SA 3RESA 2BIVA 3F70A 4M77B 2V8IA 4X9DA 3GPLA 1Y07A 5EG2A 2D6FA 3H6ZA 3QHSA 2K5LA 1G5VA 1VQ6T 2XDPA 4E7LA 2R5MA 3EAEA 2R58A 3P8HA 4MZPA 3X25B 4NS5A 1VQ6A 4GLKA 5GMKj 1ZHIA 4F7UG 3OBYA 5GANh 4DA4A 1Y96B 4R55A 3QIIA 2RA2A 3CD6T 2CS7A 1QW1A 1X6OA 2BKDN 3SWNB 3VU3C 2XK0A 2JUFA 4QVDA 3OYBA 3CMAT 4BD3A 3JB9D 1OZ2A 3X20B 4HKEA 4M78A 4XQ3A 1NE8A 4M75F 4C8QA 1WPYA 4EMKB 3CMAA 3OW2A 2DXTA 1G3TA 2B8AA 2P0QA 2XD0A 2RK2A 4BY6B 2E64A 2WSFE 3GF5A 2X4WA 4FM4B 4M77C 5DM7R 3NTIA 2RHIA 2DEQA 1BKBA 2O01E 2V8KA 2P4TA 1Q81C 5DLQE 4IURA 3RKWA 3RERA 4J7FA 4X34A 4HCZA 4MZTA 1Y96A 2EYQA 2XG8D 4DQ2A 5GAN4 1BI1A 2X35A 1S72T 3V7SA 2EKOA 2PQWA 1MGQA 2VV5A 3SWNA 3FB9A 2EIFA 2FHDA 2ZGWA 2RI5A 2IVWA 4M78D 4EMKC 1NJIU 5CVIA 4LDXA 1UGQB 1YIJT 4E7KA 4V2SA 3V7RA 3ME9A 4IUVA 3OYEA 3CC4T 2VGMA 1KD1C 3VUBA 2K4YA 3VYHB 3S3NA 3V8LA 2D0QB 2MI6A 4QVZA 5KH6A 3BDLA 3C95A 4IUTA 2LRQA 5LJ3g 4XU0A 2Y4YA 4B9XA 4FIBA 2M0OA 5GAMd 3X24B 1U1SA 4M7DG 1Y7XA 3SB2A 1N8RU 5FRNA 1O75A 1YJNA 4A53A 3GIBA 4M75D 1VQ5T 1W2BS 4LDYA 5CKHA 3C12A 2DD4A 5LJ5g 1BI0A 3I55A 1K73C 4J6XA 2RJDA 1YCYA 2DPPB 3QDRB 4MMLA 4M7AC 2DXUA 2EQMA 4TVRA 1X01A 4JS5A 4C5GA 4F7UE 3LWIA 1VQMT 1OYXA 3DKMA 4M78E 3M53A 1VQMA 3M58A 1M4ZA 3NTKA 3CC2T 3G7ZA 2M9UA 2DIGA 4N0AA 3LH0A 2DXBA 2OTLT 3CC2A 2LQ8A 3PFSA 3JCMV 1M1GA 2ZPGB 1KHIA 2GF7A 2ZCFB 3M55A 3VJPA 4BI4A 2OTLA 4JDSA 2M16A 5CKFA 2QQAA 3HHTB 3META 2E12A 4FL6A 2E5QA 1K9MU 3FRNA 4A4EA 1VQOA 3HKSA 1VQ9T 3SD4A 4M75E 4N4IA 1H641 3JCMc 4C92F 3MEWA 1Q7YU 2I2LA 4O5VA 3KXTA 3OMGA 1PSEA 1WJSA 2KVQG 1I4K1 1K8AU 3JCMX 3TREA 4KULA 2X4XA 3L2QA 2XIDA 4HT8A 2DD5A 2HAXA 1O9SA 2JVVA 1YJWT 3CCST 5J39A 2MMPA 4JLGA 5LJ3d 5D6YA 3PIOA 5FU7B 1B34A 5CQYA 5GMKm 1YJWA 3CCSA 3QYHB 4E47A 1VIEA 3M5AA 3CCRA 3CPWS 3JAME 2CKKA 1JJ2S 4OMFB 3OBWA 5CO7A 5LJ5d 4XU3A 4ZGEB 1NPRA 1KG1A 5DY9A 3G71T 1Q82U 3WXMB 4OB0B 4FT4A 4MZMA 3E9FA 1OZ3A 3EFRA 4VUBA 1GXIE 2YLBA 3CD6A 5FU7C 5GAOm 5GAN7 4ZGDB 3CXCA 3KBGA 5GAMe 4C0DB 2ZPFB 1DJ7B 2A3LA 1ZBXA 3TCJA 2ZPEB 4C92D 3FC3A 3QBYA 5CKEA 4BI8B 4J8OA 2D9TA 4A54A 1VQPA 5HY6A 4F7UB 1Q86C 2HQEA 2K3YA 3LX7A 2DO3A 3GNGA 3L2WA 5J26A 1IREB 3OS2A 1P92A 3OYGA 3OYMA 3G4ST 4M78B 3R6OA 3P8BB 2LCCA 2EQKA 4RCBA 3S3OA 4ATOA 3LLRA 2FYKA 2EQUA 2KY9A 4IUQA 1QVPA 2LQKA 3TU4K 5GANj 2DZCA 1YI2A 2R57A 2XDBA 3SDZA 2HNIA 3L2VA 4OGEA 2LDMA 4NL2A 5A0LA 3C4SA 2QQBA 5GAMh 4Z02A 2CZ6B 3M4GA 3VUZA 1I8FA 4F7UA 3QUIA 2IG0A 2QI2A 1BYMA 1XNIA 4XTXA 3M59A 1VQ8T 1IZ6A 1X75C 1TH7A 4PJOG 1PSFA 4J6YA 4M75B 2VXFA 4XTVA 1N9RA 5L8RE 5KCHA 5GANf 4XTZA 4IUPA 2HBPA 4OB1B 3VV0A 4PLIA 4RG8A 5FU6C 4C8QC 4FSXA 3CBMA 4BE1A 3A8MB 4J83A 3UDCA 4C92E 4D6WA 2L5QA 3NFCA 1WGSA 2JOYA 5C0MA 1UGRB 2ZPIB 2L8DA 2VXEA 4X9CA 3KUFA 2KMTA 3OY9A 5GAOp 2MWPA 3C94A 3RUXA 2E10A 1FXXA 3MP8A 5I2SA 1M1KU 2G3RA 3JCMP 3HRSA 4C0ZA 1Q81U 1VQKA 3SWNC 2X4JA 3FIFA 2CZ1B 4M75A 3CC7T 4C8QG 2GQVA 2YRVA 5LJ3e 4HCCA 4M7DF 2E1HA 2F5KA 3L42A 3CC7A 5GAOq 4EMGA 3OW2S 4PJOD 4M77G 3HPWA 1MHNA 4P5NA 3PIPA 4BY6C 2QA4A 4QVCA 1HXDA 2VC8A 3MO8A 5J3BA 3DB3A 4EDUA 3OYCA 5CIUA 2E41A 4ZN1A 3Q1JA 3H8ZA 5LJ5e 4JS4A 1SSFA 2RB6A 4LD6A 1WJRA 1VQNT 4EMHA 3N5BB 3JB9I 1NJIC 1KD1U 1VQNA 1YJNT 4MMKA 3PT9A 1NPPA 3JCMf 5IAYA 3P8DA 4M7DA 3I55T 4XK8E 5LJ3j 2PU9B 4KBMB 2JTFA 5D6WA 5GAN5 2RHUA 3EFSA 4ELYC 2DTIA 2MF2A 3PGGA 4CI0C 1WJQA 2YLCA 2E70A 3FLGA 4J5YA 2Y90A 5LJ3h 3PMIA 4ZN3A 3OYAA 4E7HA 1U8RA 2KK4A 1YHQA 4A4HA 4XTUA 4C0GA 3CCUA 3QXEB 5CKBA 2LC4A 5IT9E 1BIBA 5LJ5j 2DIQA 4XTYA 1VQ4T 3M56A 5LJ5h 4PJOE 1VQ4A 3OYLA 3T9NA 2RM4A 3PNWC 5GMKl 2MAMA 1LNXA 2XU8A 3M57A 4M7DD 5A2QE 4N0AC 1XQHA 3HSBA 1M5Q1 4RKUE 3JCMJ 3V8KA 3HFNA 3MP6A 4C0FA 4M7AG 1WNLA 1W4SA 3X28B 5FRMA 4FT2A 1B34B 1VQOT 1KC8U 3OS5A 3I56T 5GAN2 4JRPA 3QJYA 3E9GA 5GAN6 2Y4XA 4BE2A 5CR2A 4C92B 1RL2A 2DK3A 4BI3A 4C5EA 5GMKi 3I56A 3G6ET 4ZGJB 2RI3A 3G6EA 3INZA 4OP0A 1QVGA 3CMEA 3CCMA 3SFMA 4LDVA 5GAOl 1G3YA 1N6AA 2GFAA 2BUDA 2PVOB 3PTAA 1N9SA 4OGCA 4NL3A 1R8OB 3UPUA 2R5AA 2OTJT 4HCBA 3V8JA 2K5IA 4BACA 4FU6A 1Y71A 3CCRT 2RJEA 2OTJA 2F69A 4A4GA 3GP8A 4M7AD 4IKFA 3A8LB 4PL6A 1H3ZA 1EIFA 1YBYA 2HD0A 1UEBA 4C92A 5C6SA 3OA6A 3BY7A 3LGFA 1K8AC 1U1TA 4M7DE 1JBMA 5IN1A 2ZPBB 2X4YA 4ELZC 4NOYA 1WQWA 1KQ2A 4JUVA 2LT1A 3RKYA 1KQSA 4Y91A 1M90U 2RH2A 2RO0A 5HK0A 2VYTA 3MHXA 3TEEA 1N27A 3UT1A 2EJFA 4PNOA 3QSUA 2P0KA 4ME7A 2LVMA 1I81A 2CGHA 2GCXA 3FJPA 5I2MA 3CEYA 3RMSA 5CAIA 1QVFA 4GY5A 1VQPT 3CPFA 3M54A 2FL7A 2NLUA 3WVEB 4C5IA 2EJGA 3CCQT 3OS1A 3OQ5A 5KE3A 3OYNA 3MCAB 3A8HB 4M7AE 3CCQA 3BDUA 4PJOB 4PJOF 3HFOA 3E1SA 4N4HA 1YHQT 1XTDA 5A0GA 1YI2T 4L6V5 3DLLA 4KUIA 3GNFB 1G3SA 2JTMA 2LTOA 3GLXA 4QQGA 5KCOA 5GAMj 3CXCS 4BE0A 4C0DC 3QZ5B 1V29B 1XOVA 5GAOn 5AYFA 4RG2A 4YTLA 2DJZA 4J6WA 4OF1A 4QW2A 2H3JA 4LDWA 2DAQA 4WF2A 5GAMf 2WSCE 4M78C 1UB4A 4PJOA 3AHUA 2K5FA 1FWZA 1LJOA 3CBOA 3QYGB 4LD9K 5GANg 1RI0A 4C8QF 2KSSA 2WACA 1VQ7T 3UWNA 4M77F 2DZ9A 3QO3A 3WVDB 4JJNK 4N4GA 1VQ7A 2VUBA 4BDYA 1UGPB 4XU1A 1VQKT 1BIAA 3A8OB 3E19A 2O4XB 3O8VA 3NTHA 4Y28E 1VQ8A 3LW5E 3OYYA 5GMKh 4M7DB 4M78G 4M75C 2QQ9A 2QQRA 2K2VA 3A5ZB 4A4FA 3CBPA 3OYHA 3L2RA 2FVUA 3DLMA 2QA4T 2GFUA 1NZ9A 2EFIA 2CYZB 2XKOC 2L89A 2EQJA 2RHZA 2RHXA 4OB2B 4M77A 4QQ6A 4CRIA 3CCVT 2XDDA 1KQ1A 4ZTJA 3JCMe 2XI9A 1M1KC 3CCVA 3QZ9B 4IUUA 1VUBA 4O6JA 3HP9A 5M9OA 2E6NA 2QQSA 2O4XA 2WSEE 2XHCA 2ZPHB 4E7IA 3ZFJA 4M75G 2E65A 1OI1A 2XICA 3RKXA 2KQWA 3ER0A 4M7DC 3JCMg 1W2BA 1S72A 4EMKA 1VQLT 4C8QD 3CCUT 1VQLA 5GAN8 4M77D 3FEOA 3GOXA 4M7AB 1YIJA 1FX7A 4M7AF 2KAFA 1N8RC 3CC4A 2LT4A 5LJ3f 2CZ0B 2QEXT 1K73U 3JB9H 3JCMh 4BUGA 1YJ9T 1KHCA 5KE2A 4PLLA 2QEXA 2RJCA 4C5HA 4BB7A 3OYDA 3OYIA 1YJ9A 2DTOA 1ZQ1A 3JCMQ 2FB7A 2JZ2A 2F5TX 5GANd 2C06A 2QXFA 1WQ7A 2PUKB 3URGA 5GAOr 3J7AF 3ASKA 5I21A 5LJ5f 3QKJA 4J7IA 1AHJB 3ZBDA 2V8JA 3A8GB 2KDSA 1VQ5A 2RK1A 1M9SA 4M7AA 4B9WA 2DKGA 4II1A 4KT0E 3RIRA 2PVGB 3V7CA 1LOJA 1VIFA 1M8VA 1UGSB 2YHTA 3LYIA 3OSSC 4L59A 3JB9J 4RMOA 3OYJA 3CMET 3CCMT 2P0PA 1D3BB 4A4KA 2DTHA 4C8QE 5HKCA 3M4YA 4QQDA 5FLXE 3CCLT 4M77E 2L3RA 1I5LA 2LNVA 1KC8C 1K9MC 2JNGA 2QDYB 3CCLA 2EWNA 3HL8A 4RCCA 1Q7YC 4E7JA 2EJ9A 2A7YA 4HA8A 2MWOA 4R56A 3OB9A 5LL6S 4PKCC 3CPWA 4JLIA 2OAUA 4C92C 4JRIA 3JCMd 1JJ2A 3BW1A 1D3BA 2QTXA 3MEVA 4Q5WA 4UC4A 5CQXA 4OVAA 5D6XA 1VQ9A 2K57A 1JRIA 2LX9A 4L5GA 3M9QA 1QVGS 3L1AA 3MEUA 4JRQA 3JCMW 2CZ7B 2RI2A 4LDUA 4DOVA 3VKIA 5CKDA 3FDRA 3JSCA 3HRUA 5CCAA 3LGLA 3MP1A 4ZTFA 1BI2A 3L2ZA 2EAYA 2AHJB 3QPHA 4C92G 5FROA 3JCMb 4XU2A 2M1HA 5A0DA 5HK3A 2HQXA 3RMQA 5GAN3 5CK9A 4JRKA 1Q82C 1M90C 1M1FA 4BDZA 3OMCA 3CCJT 3JRZA 3CCET 2PVDB 3OSVA 3CCJA 3CCEA 1KQSS 2PUOB 4KUDK 1YITT 2ZZDA 2JN0A 4EPCA 4HT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 F;  2DTI A;  3PGG A;  4M75 E;  4XU1 A;  2YLC A;  2RD1 A;  1BIA A;  1H64 1;  2Y90 A;  3BFM A;  4J5Y A;  5LJ3 h;  3JCM c;  4C92 F;  2I2L A;  4XTU A;  5GMK h;  1I4K 1;  4M7D B;  4M78 G;  4M75 C;  3JCM X;  1BIB A;  5GAN e;  5LJ5 j;  4XTY A;  4HT8 A;  5GMK e;  5LJ5 h;  4PJO E;  4M77 A;  4XTW A;  5LJ3 d;  3JB9 G;  1B34 A;  1KQ1 A;  1HK9 A;  2RM4 A;  5GMK m;  3JCM e;  5GMK l;  4F7U F;  1LNX A;  2DVE A;  4M7D D;  4N0A C;  4C8Q B;  3HSB A;  1M5Q 1;  4PJO C;  3JCM J;  5GAM g;  4M78 F;  3V8K A;  3HFN A;  4M7A G;  3RES A;  1WNL A;  4M77 B;  4X9D A;  5LJ5 d;  4XU3 A;  1B34 B;  4M75 G;  2E65 A;  3RKX A;  3QHS A;  5GAN 2;  4M7D C;  5DY9 A;  3JCM g;  5GAN 6;  4EMK A;  4C92 B;  5GMK i;  4C8Q D;  3EFR A;  5GMK j;  4F7U G;  5GAN h;  1Y96 B;  5GAN 8;  2RA2 A;  2YLB A;  4M77 D;  3INZ A;  4OP0 A;  4M7A B;  5GAO m;  3VU3 C;  3SWN B;  5GAN 7;  4M7A F;  5GAO l;  5GAM e;  4QVD A;  5LJ3 f;  3JB9 D;  3JB9 H;  4C8Q A;  1N9S A;  4M78 A;  4XQ3 A;  4M75 F;  3JCM h;  4C92 D;  1WPY A;  4EMK B;  4NL3 A;  2DXT A;  3V8J A;  2E64 A;  4A54 A;  2DTO A;  4M77 C;  3JCM Q;  2FB7 A;  4F7U B;  5GAN d;  2DEQ A;  4M7A D;  1WQ7 A;  5GAO r;  3RKW A;  5I21 A;  5LJ5 f;  3RER A;  4M78 B;  4C92 A;  3BY7 A;  4M7D E;  1U1T A;  1JBM A;  4RCB A;  1Y96 A;  4DQ2 A;  5GAN 4;  2FYK A;  4NOY A;  4HT9 A;  1WQW A;  1KQ2 A;  4M7A A;  4JUV A;  3V7S A;  3RKY A;  2DKG A;  3SWN A;  1MGQ A;  3RIR A;  4Y91 A;  5GAN j;  2DZC A;  3FB9 A;  3V7C A;  1LOJ A;  2ZGW A;  1M8V A;  2HNI A;  2YHT A;  4M78 D;  4EMK C;  4NL2 A;  3JB9 J;  4V2S A;  5GAM h;  3V7R A;  3M4G A;  2EJF A;  1D3B B;  4PNO A;  2DTH A;  1I8F A;  4C8Q E;  3QUI A;  4F7U A;  1I81 A;  3QSU A;  4XTX A;  2CGH A;  3FJP A;  1TH7 A;  4PJO G;  4M77 E;  3V8L A;  4J6Y A;  4M75 B;  2VXF A;  4XTV A;  1N9R A;  5CAI A;  5GAN f;  1I5L A;  4XTZ A;  4C8Q C;  5GAO q;  5LJ3 g;  4XU0 A;  2EWN A;  4C92 E;  5GAM d;  4RCC A;  1U1S A;  4M7D G;  2EJ9 A;  2EJG A;  4HA8 A;  3SB2 A;  3GIB A;  4A53 A;  4M75 D;  4X9C A;  2VXE A;  4M7A E;  3BDU A;  4JLI A;  4C92 C;  4PJO B;  4JRI A;  5GAO p;  3JCM d;  4PJO F;  3RUX A;  2E10 A;  3BW1 A;  3HFO A;  5LJ5 g;  1D3B A;  4J6X A;  1YCY A;  2QTX A;  3JCM P;  4MML A;  4M7A C;  2K57 A;  1JRI A;  2DXU A;  3SWN C;  1X01 A;  3FIF A;  3L1A A;  4M75 A;  5GAM j;  3JCM W;  4C8Q G;  5LJ3 e;  4F7U E;  4M7D F;  2E1H A;  4PJO D;  4EMG A;  4M77 G;  4M78 E;  5GAO n;  2DJZ A;  4J6W A;  4QVC A;  1HXD A;  2VC8 A;  3L2Z A;  4WF2 A;  2EAY A;  2E41 A;  4C92 G;  5GAM f;  5LJ5 e;  3JCM b;  4M78 C;  4N0A A;  4XU2 A;  2RB6 A;  4PJO A;  3AHU A;  4EMH A;  1LJO A;  4JRK A;  5GAN 3;  3JB9 I;  3JCM V;  4C8Q F;  5GAN g;  4MMK A;  3JCM f;  4M77 F;  2DZ9 A;  4M7D A;  3QO3 A;  5LJ3 j;  2JN0 A;  5GAN 5;  3EFS A; 
#chains in the Genus database with same CATH topology
 1BI3 A;  1YIT A;  2EYX A;  3LWH A;  2LCL A;  1QKX A;  2HZY A;  1GRI A;  1K9A A;  3QJ6 A;  2LJ0 A;  1WHK A;  4PK4 A;  2K3X A;  3X26 B;  3I55 Q;  3VYG A;  1I07 A;  3EHR A;  3I5R A;  1ZA1 B;  1QP3 A;  2LCS A;  3U23 A;  3F70 A;  2V8I A;  2DJQ A;  4X9D A;  2D6F A;  2K5L A;  4J9F A;  3EAE A;  4MZP A;  5KYX B;  4NS5 A;  2EGE A;  1VQ6 A;  4GLK A;  5GMK j;  1ZHI A;  4F7U G;  4R55 A;  3CD6 T;  3EH1 A;  2NUP B;  2CS7 A;  3VU3 C;  1NM7 A;  2JUF A;  4QVD A;  4BD3 A;  1K76 A;  4XQ3 A;  4M78 A;  3OW2 A;  4M75 F;  4GLM A;  1BKB A;  2O01 E;  2P4T A;  3RKW A;  4X34 A;  2FEI A;  2EYQ A;  2V1Q A;  1S72 T;  1RAE B;  3EG9 B;  2EIF A;  2FHD A;  2ZGW A;  2IVW A;  4M78 D;  4LDX A;  4V2S A;  4DBQ A;  4PFO A;  4E7K A;  1YIJ T;  3OYE A;  2VGM A;  3VYH B;  1OQK A;  4LUE A;  2FZG B;  4QVZ A;  3VS3 A;  4XU0 A;  5KYW A;  1ZX6 A;  2M0O A;  2JTE A;  2LX7 A;  1Y7X A;  3SB2 A;  1W2B S;  4LDY A;  1VQP Q;  1BI0 A;  2RJD A;  2KNB B;  2MOX A;  1X01 A;  2D1X A;  1Y0M A;  2YDL A;  2LJ1 A;  3EG1 A;  4C5G A;  4HXJ A;  5IHN A;  3REA B;  3LWI A;  1KFZ A;  3M53 A;  1VQM A;  1YHQ Q;  3M58 A;  1M4Z A;  5IXF A;  2DIG A;  4ESR A;  2ZAE A;  2ZPG B;  2GF7 A;  4JDS A;  1U3O A;  1K9M U;  2JMC A;  3FRN A;  4A4E A;  2CP0 A;  3HKS A;  2BE9 B;  1VQ9 T;  1VQO A;  3JCM c;  2I2L A;  3KXT A;  2KVQ G;  1K8A U;  3JCM X;  2X4X A;  3L2Q A;  2JVV A;  5J39 A;  1YJW A;  3CCS A;  2NUZ A;  1ABO A;  2CKK A;  3OBW A;  4XU3 A;  3CCV Q;  2K2M A;  2J7I A;  1KG1 A;  5DY9 A;  2ECZ A;  1Q82 U;  3WXM B;  4MZM A;  1OZ3 A;  1V1C A;  1GXI E;  2YLB A;  1X6B A;  5GAN 7;  4ZGD B;  3CXC A;  3EGD B;  5GAM e;  4C0D B;  1N5Z A;  1DJ7 B;  4C92 D;  1VQL Q;  2ZPE B;  3QBY A;  4BI8 B;  4J8O A;  3CPW P;  2KXC A;  2DO3 A;  3L2W A;  5J26 A;  2YRC A;  1JJ2 P;  3OYM A;  1PKS A;  3M0T A;  1GCP A;  3S3O A;  1YJ9 Q;  1QVP A;  1JEG A;  1HSQ A;  1PD0 A;  3TU4 K;  5GAN j;  3SDZ A;  4OGE A;  4RUG A;  2E4H A;  2IG0 A;  4J6Y A;  5KCH A;  4XTV A;  3CME Q;  4D6W A;  3CCM Q;  4FCY A;  1UGR B;  3CCL Q;  1NYF A;  3KUF A;  2KMT A;  3VS2 A;  1OV3 A;  3RUX A;  3M0P A;  5I2S A;  2G3R A;  3JCM P;  3HRS A;  3FIF A;  4M75 A;  3CC7 T;  2RMO A;  5LJ3 e;  4M7D F;  2QA4 A;  1AEY A;  3JV3 A;  1TG0 A;  5J3B A;  5LJ5 e;  1MMD A;  4LD6 A;  1WJR A;  1VQN T;  4MMK A;  2W10 A;  3JCM f;  5IAY A;  2RHU A;  4ELY C;  2DTI A;  4J5Y A;  4ZN3 A;  3OYA A;  4E7H A;  3CCJ Q;  4A4H A;  1G8X A;  3CCE Q;  3QXE B;  5CKB A;  2LC4 A;  1GFC A;  1WXB A;  3VS5 A;  4DEY A;  1BK2 A;  2L2P A;  3OYL A;  2GTO A;  2MAM A;  1XQH A;  1NG2 A;  3V8K A;  2RPN A;  3HFN A;  3MP6 A;  4C0F A;  4M7A G;  3X28 B;  2VWF A;  4F17 A;  1B34 B;  1PKT A;  1VQO T;  1FMW A;  2X3X D;  1UEC A;  5CR2 A;  1SRM A;  4BI3 A;  1RAB B;  4ZGJ B;  1QVG A;  2GFA A;  2DE0 X;  1RUW A;  4NL3 A;  2OTJ T;  4HCB A;  4LUD A;  2K5I A;  4FU6 A;  1Y71 A;  2RJE A;  3CD6 Q;  4M7A D;  1H3Z A;  1JBM A;  3RKY A;  5GJV B;  2BZ8 A;  4OMQ A;  5HK0 A;  2F2W A;  4PNO A;  3QSU A;  2P0K A;  1S72 Q;  2GCX A;  1D1A A;  1IXD A;  1WHH A;  3A98 A;  1YIJ Q;  3M54 A;  4PJJ A;  3OS1 A;  1BBZ A;  3OQ5 A;  3VS7 A;  3A8H B;  3M0U A;  4E2F B;  3E1S A;  4N4H A;  2D8J A;  4HVU A;  1KD1 R;  3GNF B;  3M0Q A;  4QQG A;  3GLX A;  1YHQ A;  1WI7 A;  4C0D C;  3QZ5 B;  4DBH A;  1T3S A;  4J6W A;  4QW2 A;  2JW4 A;  5GAM f;  4PJO A;  3QYG B;  3CBO A;  4C8Q F;  1TUG B;  1R0C B;  2WAC A;  5HCK A;  1QWE A;  4M77 F;  3QO3 A;  3WVD B;  4JJN K;  4N4G A;  1M30 A;  4BDY A;  1BIA A;  4FW1 A;  2YRD A;  2KXD A;  3OYY A;  5GMK h;  3EGU A;  1GFD A;  2K2V A;  2QA4 T;  3OYH A;  2DEU A;  4RTV A;  1AVZ C;  2GFU A;  1VQ9 Q;  2XKO C;  1T0J A;  2RHZ A;  3PVQ A;  4CRI A;  4ZTJ A;  3CCV A;  3QZ9 B;  4IUU A;  2EPD A;  1C1A A;  4J9E A;  2E6N A;  2XHC A;  1SEM A;  2WSE E;  2KQW A;  3ER0 A;  4M7D C;  8AT1 B;  2RQT A;  4EMK A;  2C0O A;  1VQL A;  5GAN 8;  4OMP A;  3FEO A;  1ZBJ A;  5LJ3 f;  1YIT Q;  2QEX T;  1K73 U;  2HDA A;  4BUG A;  1B7T A;  2EBP A;  2PNI A;  4C5H A;  1YJ9 A;  5GAN d;  2F5T X;  2XMF A;  1RAA B;  2ROT A;  3ASK A;  5LJ5 f;  2KRM A;  2EGA A;  1AHJ B;  3ZL7 C;  1VQ5 A;  4J9G A;  3QWY A;  2PVG B;  2KT1 A;  4L59 A;  3OSS C;  1W6X A;  1D3B B;  4A4K A;  2EVR A;  5HKC A;  3VRZ A;  1X2Q A;  2DNU A;  3CCL A;  4AFQ C;  2EWN A;  1PNJ A;  2YSQ A;  2A7Y A;  2MWO A;  1W2B P;  3CPW A;  2OAU A;  1JJ2 A;  4A63 B;  5CQX A;  4UC4 A;  4OVA A;  1C0M A;  1JRI A;  1NBE B;  2MK5 A;  4LDU A;  3FDR A;  3JSC A;  2DRM A;  3LGL A;  2D8H A;  3L2Z A;  3QPH A;  3CC7 Q;  5FRO A;  3JCM b;  4XU2 A;  2HL5 C;  5CK9 A;  3OMC A;  2PVD B;  3CCJ A;  3AT1 B;  3CCE A;  1KQS S;  2CSI A;  4EPC A;  2JT4 A;  1VQN Q;  2CUD A;  1G3W A;  2RD1 A;  3BFM A;  1ZUY A;  1QP2 A;  3S6W A;  4MDX A;  3J81 E;  3VRY A;  4XAX B;  1FMK A;  3ZEH A;  2HEQ A;  3JB9 G;  4E7Z A;  1X43 A;  2YUO A;  4F7U F;  1J3T A;  5DLO A;  1UJY A;  2DXC A;  2E6Z A;  1MMA A;  3L2U A;  5FU6 B;  4M78 F;  3RES A;  2J6K A;  5EG2 A;  2R58 A;  3P8H A;  5GAN h;  2J6O A;  2P84 A;  2CT4 A;  1VQO Q;  1QW1 A;  1X6O A;  2BKD N;  3CD6 A;  3CMA T;  3OYB A;  3JB9 D;  1OZ2 A;  2KI7 A;  4C8Q A;  1NE8 A;  2DXT A;  2P0Q A;  4LXC A;  1WFW A;  1QKW A;  4AFS C;  2X4W A;  1SG5 A;  4M77 C;  2GQI A;  2V8K A;  1WHM A;  3VS1 A;  2CUB A;  2AZS A;  3D7S B;  4J7F A;  1UJ0 A;  1Y96 A;  4DQ2 A;  2FRW A;  5GAN 4;  2OTJ Q;  5KYW B;  2DX1 A;  2VV5 A;  3SWN A;  1QCN A;  4IUV A;  2K4Y A;  2DLP A;  2E5K A;  3V8L A;  2D0Q B;  5KH6 A;  3BDL A;  4IUT A;  2LRQ A;  3H9N A;  2X51 A;  1O75 A;  1JU5 C;  2F1L A;  1VQ5 T;  1Z9Z A;  2K79 A;  4RTT A;  1HD3 A;  3QDR B;  2HSP A;  2VVK A;  2EQM A;  2A28 A;  2CP6 A;  2LNH B;  2L3P A;  1Q86 R;  2O31 A;  3CC2 T;  3G7Z A;  2KRO A;  2M9U A;  2COY A;  2OTL T;  4AFU C;  3JCM V;  4BI4 A;  1RAF B;  2QQA A;  3HHT B;  3MET A;  4FL6 A;  1AD5 A;  3VS0 A;  3SD4 A;  4N4I A;  4C92 F;  1IB8 A;  1F1B B;  1I4K 1;  2DL4 A;  2XID A;  1R0B G;  2LP5 A;  4JLG A;  5CQY A;  4E47 A;  2QA4 Q;  2RF0 A;  2OJ2 A;  1QCO A;  2MCN A;  5CO7 A;  4ZGE B;  4EIK A;  1NPR A;  2DF6 A;  4KRT A;  2X3W D;  3E9F A;  1ZSZ A;  5FU7 C;  2GTJ A;  2K3B A;  1RLP C;  3TCJ A;  1AOJ A;  3FC3 A;  1NJI R;  1Q86 C;  2K3Y A;  4J9H A;  4KH1 B;  1IRE B;  3OS2 A;  1P92 A;  3R6O A;  2QEX Q;  3P8B B;  4RCB A;  2HSE B;  3VS4 A;  4ATO A;  3LLR A;  2EQU A;  1OUL A;  2DVJ A;  2DZC A;  1YI2 A;  3L2V A;  3C4S A;  4Z02 A;  4F7U A;  1OX9 A;  1XNI A;  2CSQ A;  1X75 C;  2A08 A;  4M75 B;  4ORZ A;  4RTY A;  5GAO q;  3VV0 A;  2HKN A;  5FU6 C;  4FSX A;  3A8M B;  1JXM A;  2L5Q A;  2KT8 A;  1WGS A;  4JJC A;  1SPK A;  2L8D A;  1ZUU A;  2RN8 A;  1FXX A;  2YT6 A;  4CC4 B;  1VQK A;  2EQI A;  2J6F A;  1BCM A;  2CZ1 B;  2B86 A;  3OW2 S;  3CC7 A;  5FWB A;  2YUQ A;  4PJN A;  4QVC A;  2VC8 A;  3MO8 A;  4EDU A;  9ATC B;  5CIU A;  2E41 A;  4ZN1 A;  3H8Z A;  3EH2 A;  4EMH A;  3N5B B;  2K7A A;  2CT3 A;  1NJI C;  1VQN A;  2I0N A;  3PT9 A;  1ZLM A;  2V26 A;  3P8D A;  5LJ3 j;  2PU9 B;  5KYY A;  3EFS A;  2MF2 A;  4CI0 C;  3FLG A;  1U8R A;  4JJD A;  3CCU A;  5IT9 E;  1BIB A;  5LJ5 j;  1KK7 A;  2DIQ A;  2ROL A;  2HBW A;  3T9N A;  3PNW C;  5A2Q E;  1CKA A;  1PRL C;  2CP7 A;  1WNL A;  1W4S A;  5FRM A;  4FT2 A;  1KC8 U;  1PD1 A;  3OS5 A;  3E9G A;  2SRC A;  3G6E T;  3RBB B;  1N6A A;  3PTA A;  2BUD A;  3UPU A;  2ED1 A;  3V8J A;  4AMC A;  2OTJ A;  2F69 A;  3REB B;  3CMA Q;  1UEB A;  4C92 A;  5C6S A;  3OA6 A;  3LGF A;  1U1T A;  1OPL A;  2HQH A;  4NOY A;  3EGX A;  4ZNX A;  4Y91 A;  1M90 U;  2RH2 A;  2VYT A;  3TEE A;  1N27 A;  2EJF A;  1V76 A;  1I81 A;  1X27 A;  2CGH A;  5I2M A;  1TTH B;  1M1K R;  2GBQ A;  1QVF A;  2KYB A;  2EYY A;  2FG0 A;  1ZA2 B;  3CCQ T;  5I11 A;  1BCO A;  3BDU A;  4PJO B;  2DM1 A;  4PJO F;  5KYU A;  1LCK A;  1QCF A;  1YI2 T;  4KUI A;  1MV3 A;  1G3S A;  3CXC S;  1BU1 A;  1RI9 A;  1VQ5 Q;  2OX7 A;  2O88 A;  1I1J A;  1XOV A;  5GAO n;  4RG2 A;  4YTL A;  4OF1 A;  4LDW A;  4IIM A;  4WF2 A;  2P4R A;  3UWN A;  4J9I A;  3CC2 Q;  1UTI A;  2VUB A;  2OTL Q;  1UGP B;  4XU1 A;  1VQK T;  3A8O B;  4Y92 A;  1YWO A;  3NTH A;  4Y28 E;  4M7D B;  4M75 C;  1WZO A;  4A4F A;  2QGF B;  3L2R A;  2FVU A;  1H3H A;  4OB2 B;  4QQ6 A;  1PC0 A;  1Q7Y R;  1KQ1 A;  1M1K C;  2K6D A;  1VUB A;  2J06 A;  1NLP C;  4M75 G;  2E65 A;  1OI1 A;  3RKX A;  3A1P A;  2HL3 A;  3JCM g;  3CCU T;  3NMZ C;  3RR6 A;  2O9V A;  3CC4 A;  2CZ0 B;  3JB9 H;  3JCM h;  1KHC A;  4PLL A;  2QEX A;  2RJC A;  4BB7 A;  3JCM Q;  3TQ7 P;  2EGC A;  5FW9 A;  4J7I A;  2L3Q A;  2A36 A;  4M7A A;  3M0S A;  4KT0 E;  4AFZ C;  1Z9Q A;  1MMG A;  3V7C A;  1SF9 A;  1QWF A;  2A0F B;  2EW3 A;  3OYJ A;  5FLX E;  1PHT A;  2LNV A;  2JNG A;  4OML A;  1Q7Y C;  2EJ9 A;  1RAG B;  2FRY A;  1GCQ C;  3BW1 A;  2JXB A;  3MEV A;  4Q5W A;  4L5G A;  1QVG S;  2LX9 A;  3EFO A;  3L1A A;  4JRQ A;  1MV0 B;  1T0H A;  2RI2 A;  2H3E B;  1OOT A;  4ZTF A;  1U5S A;  1BI2 A;  5FWC A;  1M3C A;  2EAY A;  2AHJ B;  1R77 A;  5GAN 3;  4JRK A;  4OMO A;  2KEA A;  4LN2 A;  4PJL A;  1ACM B;  2JN0 A;  3JB9 F;  4DOW A;  3G71 A;  2QAS A;  3NPF A;  3DB4 A;  1W1F A;  1M3B A;  2DYI A;  3J80 E;  5GAN e;  3OYF A;  2DYB A;  2E3I A;  1AZE A;  2RJF A;  4C8Q B;  4PJO C;  2VB6 A;  5GAM g;  4RTX A;  2BIV A;  2CRE A;  4M77 B;  1G5V A;  3H6Z A;  3EGD A;  2R5M A;  2AKK A;  4KH0 B;  1Y96 B;  1U06 A;  3SWN B;  2XK0 A;  5KYN A;  2NUT A;  4HKE A;  3CMA A;  2B8A A;  2RK2 A;  4BY6 B;  2E64 A;  2WSF E;  5IH2 A;  5DM7 R;  4AG1 C;  3NTI A;  2RHI A;  4IUR A;  1MUZ A;  2QDL A;  5L23 A;  4HCZ A;  4MZT A;  2XG8 D;  1BI1 A;  2X35 A;  3V7S A;  5IHI A;  2EKO A;  2PQW A;  1MNE A;  5IXB A;  4EMK C;  1UGQ B;  3IQL A;  1UE9 A;  3V7R A;  3ME9 A;  2CP3 A;  3CC4 T;  1KD1 C;  3VUB A;  2MI6 A;  3C95 A;  2LMJ A;  5LJ3 g;  1RAD B;  4B9X A;  4FIB A;  4M7D G;  2M02 A;  5FRN A;  1YJN A;  1PRM C;  5CKH A;  3C12 A;  5LJ5 g;  2DIL A;  2KRN A;  2DL3 A;  4MML A;  1H8K A;  4JS5 A;  3CCQ Q;  3OW2 P;  1X69 A;  2KRS A;  4FSS A;  3DKM A;  1PCX A;  2ATC B;  1YI2 Q;  4N0A A;  3LH0 A;  2DXB A;  3CC2 A;  2LQ8 A;  1WHJ A;  3PFS A;  2OTL A;  1KHI A;  2AT1 B;  2BZY A;  3M55 A;  2M16 A;  2J05 A;  5CKF A;  2L3S A;  4M75 E;  2ABL A;  1H64 1;  1Q7Y U;  1QLY A;  4FYW B;  4O5V A;  3OMG A;  1WJS A;  3M0R A;  3TRE A;  5IHK A;  2MPX C;  2A37 A;  2DD5 A;  2KYM A;  4FYV B;  1VQK Q;  3O5Z A;  3PIO A;  5FU7 B;  1B34 A;  2AKL A;  1VIE A;  4RTZ A;  3CCR A;  3CPW S;  4CC7 A;  1Q95 G;  3JAM E;  4Z89 A;  1JJ2 S;  2ENM A;  2LQN A;  2MIO A;  3G71 T;  1YNZ A;  1D0Y A;  4FT4 A;  5I22 A;  4VUB A;  2IPO B;  3I9Q A;  1GBQ A;  4FYY B;  1ZBX A;  5CKE A;  3H0F A;  3CCU Q;  2D9T A;  2MYS A;  5HY6 A;  4F7U B;  3LX7 A;  3GNG A;  1QQJ A;  2HCK A;  4M78 B;  3MJX A;  3H0H A;  1D0Z A;  2LCC A;  2FYK A;  2FZC B;  3EG0 A;  1RAC B;  2YUP A;  4HVW A;  4NL2 A;  5A0L A;  2QQB A;  2CZ6 B;  3M4G A;  3VUZ A;  1I8F A;  3QUI A;  1BYM A;  3M59 A;  1VQ8 T;  1IZ6 A;  3QWX X;  3CQT A;  5GAN f;  4XTZ A;  4IUP A;  4C8Q C;  3UDC A;  1UHC A;  4J83 A;  3NFC A;  2JOY A;  2E3H A;  4IIO A;  2ZPI B;  2VXE A;  3OY9 A;  5GAO p;  2MWP A;  3MP8 A;  3MPU B;  1NYG A;  4C0Z A;  3CXC P;  3SWN C;  1ZUK A;  4C8Q G;  2GQV A;  2YRV A;  4FYX B;  4JZ4 A;  4HCC A;  2F5K A;  5KYY B;  4M77 G;  3PIP A;  1MHN A;  1TXQ A;  4P5N A;  4BY6 C;  1WDX A;  3OYC A;  1IGQ A;  1KSW A;  1SSF A;  1WLP B;  1K8A R;  1OEB A;  3JB9 I;  1KD1 U;  3ULR B;  1YJN T;  4KGV B;  4XK8 E;  4KBM B;  5GAN 5;  3PGG A;  1TU0 B;  2E70 A;  2Y90 A;  3PMI A;  2SEM A;  2KK4 A;  1MND A;  4XTU A;  4AT1 B;  1D1C A;  1B3Q A;  3C0C A;  1VQ4 T;  2DER A;  3M56 A;  4PJO E;  2RM4 A;  5GMK l;  1LNX A;  3M57 A;  4LE9 A;  4Z88 A;  2KGT A;  3JCM J;  2QK0 A;  3I56 T;  1T3L A;  5GAN 6;  4C92 B;  2DK3 A;  4C5E A;  1WYX A;  1FYN A;  2RI3 A;  3G6E A;  3INZ A;  3EGX B;  4LDV A;  5GAO l;  1OPK A;  2PVO B;  1N9S A;  2YXY A;  3EG3 A;  4OGC A;  1R8O B;  2R5A A;  3CCR T;  3A8L B;  4PL6 A;  1EIF A;  2HD0 A;  1K8A C;  2COW A;  4M7D E;  5GJW B;  5IN1 A;  2ZPB B;  2X4Y A;  2JM8 A;  1TUC A;  5ECA A;  3TSZ A;  4ANJ A;  2CH4 A;  4X1V A;  1ZSZ C;  2OI3 A;  5KYU B;  3RMS A;  1S1N A;  3CPF A;  2ED0 A;  3CC4 Q;  2NLU A;  1VA7 A;  4OMM A;  4WCI A;  3OYN A;  2DL7 A;  3MCA B;  3CCQ A;  1CKB A;  1QVG P;  1WXT A;  1XTD A;  2JTM A;  2LTO A;  5KCO A;  5GAM j;  4BE0 A;  1N8R R;  1V29 B;  5AYF A;  2G6F X;  3THK A;  2O9S A;  2WSC E;  4M78 C;  2F2X A;  3PE0 A;  3AHU A;  2K5F A;  1LJO A;  1RI0 A;  2KSS A;  3G1J A;  1VQ7 T;  1D09 B;  1IGU A;  1IHW A;  3RDV A;  1VYU A;  4Z8A A;  4M78 G;  2QQ9 A;  4RTU A;  2M51 A;  3DLM A;  1NZ9 A;  2EFI A;  4HVV A;  1JO8 A;  2XDD A;  3JCM e;  4CC3 A;  4PJM A;  4JZ3 A;  2D0N A;  1IRX A;  5M9O A;  1VYT A;  2O4X A;  2ZPH B;  4E7I A;  1KIK A;  2LJ3 A;  1W2B A;  4WTO B;  2KR3 A;  1SSH A;  4M7A B;  1FX7 A;  4M7A F;  1N8R C;  1ABQ A;  3G71 Q;  1AWW A;  2CDT A;  2DTO A;  3UA7 A;  2C06 A;  1K0X A;  3URG A;  5GAO r;  2HMA A;  3QKJ A;  2DET A;  3A8G B;  2KDS A;  1M9S A;  1X2K A;  2DKG A;  3UF4 A;  1UGS B;  2YHT A;  4RMO A;  4C8Q E;  2DTH A;  4QQD A;  1AT1 B;  1C6V X;  3UA6 A;  3EFO B;  4M77 E;  2K9G A;  1I5L A;  1UHF A;  4QKU A;  2IIM A;  1D1B A;  4E7J A;  4HA8 A;  1VQ8 Q;  1AWO A;  4R56 A;  4C92 C;  2CP5 A;  4JRI A;  4E7S A;  2F2V A;  3JCM d;  1I5O B;  2QTX A;  2K57 A;  3M9Q A;  3MEU A;  4KGZ B;  3MKD A;  3JCM W;  2CZ7 B;  1K0S A;  1OU9 A;  3VKI A;  5CKD A;  1RAI B;  1TOV A;  4F14 A;  1Q81 R;  4C92 G;  5HK3 A;  4KGX B;  5A0D A;  2HQX A;  1OU8 A;  3RMQ A;  1M1F A;  4BDZ A;  4J9C A;  1M2V A;  5AT1 B;  1YIT T;  2ZZD A;  1Q86 U;  1YJN Q;  4OB3 B;  2EKH A;  1QVF S;  1XJW B;  3HRT A;  3I35 A;  5GMK e;  1UUE A;  3PMT A;  1PG5 B;  2EYW A;  4XTW A;  1JB0 E;  4MDW A;  1HK9 A;  3OS0 A;  3S3M A;  2DVE A;  3QG1 A;  1NLO C;  3OYK A;  2RHY A;  2VGN A;  2NUT B;  3MEA A;  1YFN A;  3G4S A;  1VQ4 Q;  1K73 R;  3GBQ A;  1RLQ C;  1KQS P;  3GPL A;  1Y07 A;  3FJ5 A;  3QHS A;  1VQ6 T;  2XDP A;  4E7L A;  4R0K A;  1Y57 A;  3X25 B;  4AG2 C;  4OMN A;  1E6H A;  2AZV A;  3R6N A;  4DA4 A;  3OBY A;  2DBM A;  3QII A;  2RA2 A;  3I56 Q;  1M3A A;  3X20 B;  4EMK B;  1WPY A;  1G3T A;  2XD0 A;  3GF5 A;  4FM4 B;  2DEQ A;  1Q81 C;  5DLQ E;  5KYX A;  3RER A;  2DL8 A;  4PFP A;  2GGR A;  1IHV A;  2NUP A;  3CCR Q;  1MGQ A;  1BB9 A;  1TWB A;  2QAZ A;  3FB9 A;  3KFV A;  2RI5 A;  1NJI U;  5CVI A;  1SHG A;  1M2O A;  2FZK B;  1ARK A;  1GBR A;  3S3N A;  1IO6 A;  1M27 C;  1WA7 A;  2JMA A;  2JS0 A;  3H0I A;  2Y4Y A;  1HYO A;  5GAM d;  3X24 B;  1U1S A;  1N8R U;  3SHW A;  3EG9 A;  4A53 A;  3GIB A;  4M75 D;  2VAS A;  4QT7 A;  2DD4 A;  3I55 A;  1K73 C;  4J6X A;  1YCY A;  2DPP B;  4M7A C;  2DXU A;  2DRK A;  4TVR A;  2RQU A;  1WHL A;  3SEM A;  4F7U E;  1ZSG A;  1E6G A;  1OYX A;  1VQM T;  4M78 E;  2L0A A;  7AT1 B;  3NTK A;  2DMO A;  3NGP A;  1M1G A;  2ZCF B;  3VJP A;  2CP2 A;  4PFZ A;  2E12 A;  2E5Q A;  1W70 A;  2FPD A;  3E2U A;  1A0N B;  2CH4 W;  3MEW A;  1NEB A;  1PSE A;  1VQ7 Q;  2JM9 A;  4KUL A;  4HT8 A;  2HAX A;  1O9S A;  6AT1 B;  3CCS T;  1YJW T;  2MMP A;  5LJ3 d;  5D6Y A;  5GMK m;  3QYH B;  2AK5 A;  3M5A A;  3PVL A;  1GCQ A;  4JJB A;  1G83 A;  4OMF B;  1PWT A;  5LJ5 d;  2QTV A;  3LH5 A;  4FW2 A;  4OB0 B;  2RQV A;  3EFR A;  1UFF A;  4F16 A;  2DBK A;  1VOM A;  2YUN A;  5GAO m;  3KBG A;  2ZPF B;  2A3L A;  5EC7 A;  1EFN A;  3NHN A;  1TUD A;  2RNA A;  4J9D A;  4A54 A;  1VQP A;  2HQE A;  1SHF A;  2JJ9 A;  8ATC B;  3G4S T;  1WXU A;  3OYG A;  2C0I A;  2EQK A;  1X6G A;  2KY9 A;  1WX6 A;  4IUQ A;  4E6R A;  2LQK A;  1B07 A;  2PZ1 A;  2XDB A;  2R57 A;  2DL5 A;  2HNI A;  2LDM A;  5GAM h;  2QI2 A;  4XTX A;  1TH7 A;  4PJO G;  1PSF A;  5L8R E;  2VXF A;  1N9R A;  1VQ8 A;  4OB1 B;  2HBP A;  2YWW A;  4PLI A;  4RG8 A;  3G6E Q;  2M0Y A;  3CBM A;  4BE1 A;  4C92 E;  2AIR B;  5C0M A;  1G2B A;  2LQW A;  4DEX A;  3EHQ A;  4DBR A;  4X9C A;  3VS6 A;  2KE9 A;  1VYV A;  1PM3 A;  3C94 A;  2E10 A;  1M1K U;  1TS9 A;  1Q81 U;  2X4J A;  2OAW A;  2E1H A;  1I0C A;  3BE3 A;  3L42 A;  4PJO D;  4EMG A;  3HPW A;  1WHG A;  2Z0W A;  2FPE A;  1HXD A;  3DB3 A;  4JS4 A;  1UDL A;  3Q1J A;  2RB6 A;  1H92 A;  1NPP A;  4M7D A;  1LPL A;  3I55 T;  2JTF A;  5D6W A;  1WJQ A;  2YLC A;  5LJ3 h;  1SRL A;  4C0G A;  1GL5 A;  4LNP A;  2H8H A;  4XTY A;  5LJ5 h;  1UGV A;  1VQ4 A;  4M7D D;  2XU8 A;  4N0A C;  3HSB A;  1M5Q 1;  4RKU E;  3TVT A;  5GAN 2;  4D8D A;  4JRP A;  3QJY A;  4BE2 A;  2Y4X A;  2NWM A;  1JXO A;  5GMK i;  1RL2 A;  3I56 A;  2RQW A;  1WIE A;  4OP0 A;  2QGG A;  1EZZ B;  3CME A;  3CCM A;  3SFM A;  1G3Y A;  1VQ6 Q;  2DFU A;  1ZSZ B;  4BAC A;  3GP8 A;  4A4G A;  1LVK A;  4IKF A;  1UG1 A;  1YBY A;  1AWX A;  3BY7 A;  4DBF A;  3QDF A;  4ELZ C;  1WQW A;  1KQ2 A;  1RAH B;  4JUV A;  2LT1 A;  1KQS A;  2RO0 A;  3MHX A;  4J9B A;  3UT1 A;  3RNJ A;  1K4U S;  4ME7 A;  2LVM A;  3FJP A;  3CEY A;  5CAI A;  4GY5 A;  1YWP A;  4M4Z A;  1VQP T;  2ESW A;  2FPF A;  1YN8 A;  2FL7 A;  3WVE B;  4C5I A;  2EJG A;  1EX4 A;  2COZ A;  2DA9 A;  2W0Z A;  2BZX A;  1SKU B;  5KE3 A;  2V1R A;  2X9H A;  1KJW A;  4M7A E;  4CC2 A;  3HFO A;  2HKQ B;  1YHQ T;  5A0G A;  4L6V 5;  2BE7 D;  3DLL A;  3HTR A;  2DJZ A;  4D8K A;  2H3J A;  2DAQ A;  2C0T A;  1UB4 A;  3UAT A;  1FWZ A;  4LD9 K;  5GAN g;  1YP5 A;  2RQR A;  1VQM Q;  3EG2 A;  2DZ9 A;  5D7U A;  1VQ7 A;  1QMC A;  3E19 A;  2O4X B;  2EYZ A;  3O8V A;  1QVF P;  3LW5 E;  1HJD A;  2QQR A;  3A5Z B;  1K9M R;  3CBP A;  1KC8 R;  3TSW A;  2CYZ B;  2L89 A;  2EQJ A;  2RHX A;  4M77 A;  3CCV T;  2XI9 A;  1K1Z A;  2O2O A;  3HP9 A;  4O6J A;  2QQS A;  1YJW Q;  3CCS Q;  3ZFJ A;  2XIC A;  2JS2 A;  2BTT A;  2FO0 A;  1S72 A;  1VQL T;  4C8Q D;  1E7O A;  4M77 D;  3H41 A;  4JPB W;  1FMV A;  3GOX A;  1YIJ A;  2KAF A;  2LT4 A;  3I5S A;  1YCS B;  1YJ9 T;  4HCK A;  4F04 B;  1Q82 R;  1M90 R;  5KE2 A;  3OYD A;  3OYI A;  1ZQ1 A;  2FB7 A;  2JZ2 A;  2QXF A;  1WQ7 A;  2PUK B;  3J7A F;  5I21 A;  2KBT A;  3ZBD A;  2V8J A;  2RK1 A;  4GBQ A;  4B9W A;  4II1 A;  3RIR A;  1NEG A;  3G4S Q;  1LOJ A;  1VIF A;  1M8V A;  2GNC A;  3LYI A;  3JB9 J;  2QG9 B;  3CME T;  3CCM T;  1D0X A;  2P0P A;  3M4Y A;  1CSK A;  3CCL T;  2L3R A;  1K9M C;  1KC8 C;  1OX8 A;  2QDY B;  4RTW A;  3HL8 A;  4RCC A;  3OB9 A;  5LL6 S;  4PKC C;  4JLI A;  1D3B A;  2VKN A;  1AWJ A;  1JQQ A;  1VQ9 A;  5D6X A;  1M2V B;  2LZ6 B;  1M8M A;  4K11 A;  2PTK A;  2QYZ A;  4DOV A;  2NYS A;  3HRU A;  5CCA A;  1TSF A;  4B6M A;  1MMN A;  3MP1 A;  2M1H A;  1AZG B;  1Q82 C;  1M90 C;  3CCJ T;  3JRZ A;  3CCE T;  3OSV A;  2PUO B;  4KUD K;  4HT9 A; 
#chains in the Genus database with same CATH homology
 3JB9 F;  4DOW A;  1BI3 A;  1G3W A;  1YIT A;  2RD1 A;  3BFM A;  1Q86 U;  3G71 A;  3LWH A;  1QP2 A;  3DB4 A;  2LCL A;  3S6W A;  4MDX A;  4OB3 B;  3J81 E;  3QJ6 A;  3J80 E;  1QVF S;  3X26 B;  2K3X A;  5GAN e;  3OYF A;  4XAX B;  3HRT A;  5GMK e;  3PMT A;  3ZEH A;  4XTW A;  1JB0 E;  3VYG A;  2RJF A;  4MDW A;  1HK9 A;  3JB9 G;  3OS0 A;  4F7U F;  2DVE A;  3QG1 A;  3S3M A;  5DLO A;  3OYK A;  2RHY A;  1QP3 A;  2DXC A;  2E6Z A;  2VGN A;  4C8Q B;  4PJO C;  3MEA A;  5GAM g;  5FU6 B;  4M78 F;  3L2U A;  3G4S A;  3RES A;  2BIV A;  3F70 A;  4M77 B;  2V8I A;  4X9D A;  3GPL A;  1Y07 A;  5EG2 A;  2D6F A;  3H6Z A;  3QHS A;  2K5L A;  1G5V A;  1VQ6 T;  2XDP A;  4E7L A;  2R5M A;  3EAE A;  2R58 A;  3P8H A;  4MZP A;  3X25 B;  4NS5 A;  1VQ6 A;  4GLK A;  5GMK j;  1ZHI A;  4F7U G;  3OBY A;  5GAN h;  4DA4 A;  1Y96 B;  4R55 A;  3QII A;  2RA2 A;  3CD6 T;  2CS7 A;  1QW1 A;  1X6O A;  2BKD N;  3SWN B;  3VU3 C;  2XK0 A;  2JUF A;  4QVD A;  3OYB A;  3CMA T;  4BD3 A;  3JB9 D;  1OZ2 A;  3X20 B;  4HKE A;  4M78 A;  4XQ3 A;  1NE8 A;  4M75 F;  4C8Q A;  1WPY A;  4EMK B;  3CMA A;  3OW2 A;  2DXT A;  1G3T A;  2B8A A;  2P0Q A;  2XD0 A;  2RK2 A;  4BY6 B;  2E64 A;  2WSF E;  3GF5 A;  2X4W A;  4FM4 B;  4M77 C;  5DM7 R;  3NTI A;  2RHI A;  2DEQ A;  1BKB A;  2O01 E;  2V8K A;  2P4T A;  1Q81 C;  5DLQ E;  4IUR A;  3RKW A;  3RER A;  4J7F A;  4X34 A;  4HCZ A;  4MZT A;  1Y96 A;  2EYQ A;  2XG8 D;  4DQ2 A;  5GAN 4;  1BI1 A;  2X35 A;  1S72 T;  3V7S A;  2EKO A;  2PQW A;  1MGQ A;  2VV5 A;  3SWN A;  3FB9 A;  2EIF A;  2FHD A;  2ZGW A;  2RI5 A;  2IVW A;  4M78 D;  4EMK C;  1NJI U;  5CVI A;  4LDX A;  1UGQ B;  1YIJ T;  4E7K A;  4V2S A;  3V7R A;  3ME9 A;  4IUV A;  3OYE A;  3CC4 T;  2VGM A;  1KD1 C;  3VUB A;  2K4Y A;  3VYH B;  3S3N A;  3V8L A;  2D0Q B;  2MI6 A;  4QVZ A;  5KH6 A;  3BDL A;  3C95 A;  4IUT A;  2LRQ A;  5LJ3 g;  4XU0 A;  2Y4Y A;  4B9X A;  4FIB A;  2M0O A;  5GAM d;  3X24 B;  1U1S A;  4M7D G;  1Y7X A;  3SB2 A;  1N8R U;  5FRN A;  1O75 A;  1YJN A;  4A53 A;  3GIB A;  4M75 D;  1VQ5 T;  1W2B S;  4LDY A;  5CKH A;  3C12 A;  2DD4 A;  5LJ5 g;  1BI0 A;  3I55 A;  1K73 C;  4J6X A;  2RJD A;  1YCY A;  2DPP B;  3QDR B;  4MML A;  4M7A C;  2DXU A;  2EQM A;  4TVR A;  1X01 A;  4JS5 A;  4C5G A;  4F7U E;  3LWI A;  1VQM T;  1OYX A;  3DKM A;  4M78 E;  3M53 A;  1VQM A;  3M58 A;  1M4Z A;  3NTK A;  3CC2 T;  3G7Z A;  2M9U A;  2DIG A;  4N0A A;  3LH0 A;  2DXB A;  2OTL T;  3CC2 A;  2LQ8 A;  3PFS A;  3JCM V;  1M1G A;  2ZPG B;  1KHI A;  2GF7 A;  2ZCF B;  3M55 A;  3VJP A;  4BI4 A;  2OTL A;  4JDS A;  2M16 A;  5CKF A;  2QQA A;  3HHT B;  3MET A;  2E12 A;  4FL6 A;  2E5Q A;  1K9M U;  3FRN A;  4A4E A;  1VQO A;  3HKS A;  1VQ9 T;  3SD4 A;  4M75 E;  4N4I A;  1H64 1;  3JCM c;  4C92 F;  3MEW A;  1Q7Y U;  2I2L A;  4O5V A;  3KXT A;  3OMG A;  1PSE A;  1WJS A;  2KVQ G;  1I4K 1;  1K8A U;  3JCM X;  3TRE A;  4KUL A;  2X4X A;  3L2Q A;  2XID A;  4HT8 A;  2DD5 A;  2HAX A;  1O9S A;  2JVV A;  1YJW T;  3CCS T;  5J39 A;  2MMP A;  4JLG A;  5LJ3 d;  5D6Y A;  3PIO A;  5FU7 B;  1B34 A;  5CQY A;  5GMK m;  1YJW A;  3CCS A;  3QYH B;  4E47 A;  1VIE A;  3M5A A;  3CCR A;  3CPW S;  3JAM E;  2CKK A;  1JJ2 S;  4OMF B;  3OBW A;  5CO7 A;  5LJ5 d;  4XU3 A;  4ZGE B;  1NPR A;  1KG1 A;  5DY9 A;  3G71 T;  1Q82 U;  3WXM B;  4OB0 B;  4FT4 A;  4MZM A;  3E9F A;  1OZ3 A;  3EFR A;  4VUB A;  1GXI E;  2YLB A;  3CD6 A;  5FU7 C;  5GAO m;  5GAN 7;  4ZGD B;  3CXC A;  3KBG A;  5GAM e;  4C0D B;  2ZPF B;  1DJ7 B;  2A3L A;  1ZBX A;  3TCJ A;  2ZPE B;  4C92 D;  3FC3 A;  3QBY A;  5CKE A;  4BI8 B;  4J8O A;  2D9T A;  4A54 A;  1VQP A;  5HY6 A;  4F7U B;  1Q86 C;  2HQE A;  2K3Y A;  3LX7 A;  2DO3 A;  3GNG A;  3L2W A;  5J26 A;  1IRE B;  3OS2 A;  1P92 A;  3OYG A;  3OYM A;  3G4S T;  4M78 B;  3R6O A;  3P8B B;  2LCC A;  2EQK A;  4RCB A;  3S3O A;  4ATO A;  3LLR A;  2FYK A;  2EQU A;  2KY9 A;  4IUQ A;  1QVP A;  2LQK A;  3TU4 K;  5GAN j;  2DZC A;  1YI2 A;  2R57 A;  2XDB A;  3SDZ A;  2HNI A;  3L2V A;  4OGE A;  2LDM A;  4NL2 A;  5A0L A;  3C4S A;  2QQB A;  5GAM h;  4Z02 A;  2CZ6 B;  3M4G A;  3VUZ A;  1I8F A;  4F7U A;  3QUI A;  2IG0 A;  2QI2 A;  1BYM A;  1XNI A;  4XTX A;  3M59 A;  1VQ8 T;  1IZ6 A;  1X75 C;  1TH7 A;  4PJO G;  1PSF A;  4J6Y A;  4M75 B;  2VXF A;  4XTV A;  1N9R A;  5L8R E;  5KCH A;  5GAN f;  4XTZ A;  4IUP A;  2HBP A;  4OB1 B;  3VV0 A;  4PLI A;  4RG8 A;  5FU6 C;  4C8Q C;  4FSX A;  3CBM A;  4BE1 A;  3A8M B;  4J83 A;  3UDC A;  4C92 E;  4D6W A;  2L5Q A;  3NFC A;  1WGS A;  2JOY A;  5C0M A;  1UGR B;  2ZPI B;  2L8D A;  2VXE A;  4X9C A;  3KUF A;  2KMT A;  3OY9 A;  5GAO p;  2MWP A;  3C94 A;  3RUX A;  2E10 A;  1FXX A;  3MP8 A;  5I2S A;  1M1K U;  2G3R A;  3JCM P;  3HRS A;  4C0Z A;  1Q81 U;  1VQK A;  3SWN C;  2X4J A;  3FIF A;  2CZ1 B;  4M75 A;  3CC7 T;  4C8Q G;  2GQV A;  2YRV A;  5LJ3 e;  4HCC A;  4M7D F;  2E1H A;  2F5K A;  3L42 A;  3CC7 A;  5GAO q;  4EMG A;  3OW2 S;  4PJO D;  4M77 G;  3HPW A;  1MHN A;  4P5N A;  3PIP A;  4BY6 C;  2QA4 A;  4QVC A;  1HXD A;  2VC8 A;  3MO8 A;  5J3B A;  3DB3 A;  4EDU A;  3OYC A;  5CIU A;  2E41 A;  4ZN1 A;  3Q1J A;  3H8Z A;  5LJ5 e;  4JS4 A;  1SSF A;  2RB6 A;  4LD6 A;  1WJR A;  1VQN T;  4EMH A;  3N5B B;  3JB9 I;  1NJI C;  1KD1 U;  1VQN A;  1YJN T;  4MMK A;  3PT9 A;  1NPP A;  3JCM f;  5IAY A;  3P8D A;  4M7D A;  3I55 T;  4XK8 E;  5LJ3 j;  2PU9 B;  4KBM B;  2JTF A;  5D6W A;  5GAN 5;  2RHU A;  3EFS A;  4ELY C;  2DTI A;  2MF2 A;  3PGG A;  4CI0 C;  1WJQ A;  2YLC A;  2E70 A;  3FLG A;  4J5Y A;  2Y90 A;  5LJ3 h;  3PMI A;  4ZN3 A;  3OYA A;  4E7H A;  1U8R A;  2KK4 A;  1YHQ A;  4A4H A;  4XTU A;  4C0G A;  3CCU A;  3QXE B;  5CKB A;  2LC4 A;  5IT9 E;  1BIB A;  5LJ5 j;  2DIQ A;  4XTY A;  1VQ4 T;  3M56 A;  5LJ5 h;  4PJO E;  1VQ4 A;  3OYL A;  3T9N A;  2RM4 A;  3PNW C;  5GMK l;  2MAM A;  1LNX A;  2XU8 A;  3M57 A;  4M7D D;  5A2Q E;  4N0A C;  1XQH A;  3HSB A;  1M5Q 1;  4RKU E;  3JCM J;  3V8K A;  3HFN A;  3MP6 A;  4C0F A;  4M7A G;  1WNL A;  1W4S A;  3X28 B;  5FRM A;  4FT2 A;  1B34 B;  1VQO T;  1KC8 U;  3OS5 A;  3I56 T;  5GAN 2;  4JRP A;  3QJY A;  3E9G A;  5GAN 6;  2Y4X A;  4BE2 A;  5CR2 A;  4C92 B;  1RL2 A;  2DK3 A;  4BI3 A;  4C5E A;  5GMK i;  3I56 A;  3G6E T;  4ZGJ B;  2RI3 A;  3G6E A;  3INZ A;  4OP0 A;  1QVG A;  3CME A;  3CCM A;  3SFM A;  4LDV A;  5GAO l;  1G3Y A;  1N6A A;  2GFA A;  2BUD A;  2PVO B;  3PTA A;  1N9S A;  4OGC A;  4NL3 A;  1R8O B;  3UPU A;  2R5A A;  2OTJ T;  4HCB A;  3V8J A;  2K5I A;  4BAC A;  4FU6 A;  1Y71 A;  3CCR T;  2RJE A;  2OTJ A;  2F69 A;  4A4G A;  3GP8 A;  4M7A D;  4IKF A;  3A8L B;  4PL6 A;  1H3Z A;  1EIF A;  1YBY A;  2HD0 A;  1UEB A;  4C92 A;  5C6S A;  3OA6 A;  3BY7 A;  3LGF A;  1K8A C;  1U1T A;  4M7D E;  1JBM A;  5IN1 A;  2ZPB B;  2X4Y A;  4ELZ C;  4NOY A;  1WQW A;  1KQ2 A;  4JUV A;  2LT1 A;  3RKY A;  1KQS A;  4Y91 A;  1M90 U;  2RH2 A;  2RO0 A;  5HK0 A;  2VYT A;  3MHX A;  3TEE A;  1N27 A;  3UT1 A;  2EJF A;  4PNO A;  3QSU A;  2P0K A;  4ME7 A;  2LVM A;  1I81 A;  2CGH A;  2GCX A;  3FJP A;  5I2M A;  3CEY A;  3RMS A;  5CAI A;  1QVF A;  4GY5 A;  1VQP T;  3CPF A;  3M54 A;  2FL7 A;  2NLU A;  3WVE B;  4C5I A;  2EJG A;  3CCQ T;  3OS1 A;  3OQ5 A;  5KE3 A;  3OYN A;  3MCA B;  3A8H B;  4M7A E;  3CCQ A;  3BDU A;  4PJO B;  4PJO F;  3HFO A;  3E1S A;  4N4H A;  1YHQ T;  1XTD A;  5A0G A;  1YI2 T;  4L6V 5;  3DLL A;  4KUI A;  3GNF B;  1G3S A;  2JTM A;  2LTO A;  3GLX A;  4QQG A;  5KCO A;  5GAM j;  3CXC S;  4BE0 A;  4C0D C;  3QZ5 B;  1V29 B;  1XOV A;  5GAO n;  5AYF A;  4RG2 A;  4YTL A;  2DJZ A;  4J6W A;  4OF1 A;  4QW2 A;  2H3J A;  4LDW A;  2DAQ A;  4WF2 A;  5GAM f;  2WSC E;  4M78 C;  1UB4 A;  4PJO A;  3AHU A;  2K5F A;  1FWZ A;  1LJO A;  3CBO A;  3QYG B;  4LD9 K;  5GAN g;  1RI0 A;  4C8Q F;  2KSS A;  2WAC A;  1VQ7 T;  3UWN A;  4M77 F;  2DZ9 A;  3QO3 A;  3WVD B;  4JJN K;  4N4G A;  1VQ7 A;  2VUB A;  4BDY A;  1UGP B;  4XU1 A;  1VQK T;  1BIA A;  3A8O B;  3E19 A;  2O4X B;  3O8V A;  3NTH A;  4Y28 E;  1VQ8 A;  3LW5 E;  3OYY A;  5GMK h;  4M7D B;  4M78 G;  4M75 C;  2QQ9 A;  2QQR A;  2K2V A;  3A5Z B;  4A4F A;  3CBP A;  3OYH A;  3L2R A;  2FVU A;  3DLM A;  2QA4 T;  2GFU A;  1NZ9 A;  2EFI A;  2CYZ B;  2XKO C;  2L89 A;  2EQJ A;  2RHZ A;  2RHX A;  4OB2 B;  4M77 A;  4QQ6 A;  4CRI A;  3CCV T;  2XDD A;  1KQ1 A;  4ZTJ A;  3JCM e;  2XI9 A;  1M1K C;  3CCV A;  3QZ9 B;  4IUU A;  1VUB A;  4O6J A;  3HP9 A;  5M9O A;  2E6N A;  2QQS A;  2O4X A;  2WSE E;  2XHC A;  2ZPH B;  4E7I A;  3ZFJ A;  4M75 G;  2E65 A;  1OI1 A;  2XIC A;  3RKX A;  2KQW A;  3ER0 A;  4M7D C;  3JCM g;  1W2B A;  1S72 A;  4EMK A;  1VQL T;  4C8Q D;  3CCU T;  1VQL A;  5GAN 8;  4M77 D;  3FEO A;  3GOX A;  4M7A B;  1YIJ A;  1FX7 A;  4M7A F;  2KAF A;  1N8R C;  3CC4 A;  2LT4 A;  5LJ3 f;  2CZ0 B;  2QEX T;  1K73 U;  3JB9 H;  3JCM h;  4BUG A;  1YJ9 T;  1KHC A;  5KE2 A;  4PLL A;  2QEX A;  2RJC A;  4C5H A;  4BB7 A;  3OYD A;  3OYI A;  1YJ9 A;  2DTO A;  1ZQ1 A;  3JCM Q;  2FB7 A;  2JZ2 A;  2F5T X;  5GAN d;  2C06 A;  2QXF A;  1WQ7 A;  2PUK B;  3URG A;  5GAO r;  3J7A F;  3ASK A;  5I21 A;  5LJ5 f;  3QKJ A;  4J7I A;  1AHJ B;  3ZBD A;  2V8J A;  3A8G B;  2KDS A;  1VQ5 A;  2RK1 A;  1M9S A;  4M7A A;  4B9W A;  2DKG A;  4II1 A;  4KT0 E;  3RIR A;  2PVG B;  3V7C A;  1LOJ A;  1VIF A;  1M8V A;  1UGS B;  2YHT A;  3LYI A;  3OSS C;  4L59 A;  3JB9 J;  4RMO A;  3OYJ A;  3CME T;  3CCM T;  2P0P A;  1D3B B;  4A4K A;  2DTH A;  4C8Q E;  5HKC A;  3M4Y A;  4QQD A;  5FLX E;  3CCL T;  4M77 E;  2L3R A;  1I5L A;  2LNV A;  1KC8 C;  1K9M C;  2JNG A;  2QDY B;  3CCL A;  2EWN A;  3HL8 A;  4RCC A;  1Q7Y C;  4E7J A;  2EJ9 A;  2A7Y A;  4HA8 A;  2MWO A;  4R56 A;  3OB9 A;  5LL6 S;  4PKC C;  3CPW A;  4JLI A;  2OAU A;  4C92 C;  4JRI A;  3JCM d;  1JJ2 A;  3BW1 A;  1D3B A;  2QTX A;  3MEV A;  4Q5W A;  4UC4 A;  5CQX A;  4OVA A;  5D6X A;  1VQ9 A;  2K57 A;  1JRI A;  2LX9 A;  4L5G A;  3M9Q A;  1QVG S;  3L1A A;  3MEU A;  4JRQ A;  3JCM W;  2CZ7 B;  2RI2 A;  4LDU A;  4DOV A;  3VKI A;  5CKD A;  3FDR A;  3JSC A;  3HRU A;  5CCA A;  3LGL A;  3MP1 A;  4ZTF A;  1BI2 A;  3L2Z A;  2EAY A;  2AHJ B;  3QPH A;  4C92 G;  5FRO A;  3JCM b;  4XU2 A;  2M1H A;  5A0D A;  5HK3 A;  2HQX A;  3RMQ A;  5GAN 3;  5CK9 A;  4JRK A;  1Q82 C;  1M90 C;  1M1F A;  4BDZ A;  3OMC A;  3CCJ T;  3JRZ A;  3CCE T;  2PVD B;  3OSV A;  3CCJ A;  3CCE A;  1KQS S;  2PUO B;  4KUD K;  1YIT T;  2ZZD A;  2JN0 A;  4EPC A;  4HT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...