4M7DB

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 18
structure length 92
sequence length 92
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dB00
1X01A 5GANh 1I81A 3QSUA 4RCBA 2DXTA 3L2ZA 4M78E 4XU3A 1KQ2A 1TH7A 2DVEA 1LOJA 2K57A 4M7DE 4C8QD 5GAOq 1BIBA 3EFRA 5LJ5g 4EMHA 4M78A 4PJOD 3JCMJ 4HT9A 4XU1A 4OP0A 4C92F 4A53A 1YCYA 2RA2A 4M77F 3RKXA 3JCMh 4PJOC 5GAMe 5LJ5d 4JRIA 4J6WA 4M77D 4C92G 1I5LA 3JB9H 4XTZA 4F7UB 5GMKj 3JCMX 4M75B 4HT8A 1WQ7A 1MGQA 5LJ5e 1D3BB 3QHSA 3JB9I 1JRIA 5GANg 4XTVA 2EJGA 3FIFA 4C8QC 4NOYA 3JCMe 3JCMQ 5GAN7 1I8FA 3JB9F 2FYKA 2VXEA 4XTUA 4M7AB 1B34A 3V8LA 4M77G 3SWNB 2E1HA 1WQWA 4M75A 2I2LA 2DTOA 4C92E 5GAOm 5LJ3d 4QVCA 4M78C 1LNXA 3RKWA 1N9SA 3SB2A 4C8QE 2VXFA 5GANf 2JN0A 3FB9A 2EJ9A 4M7DD 4NL2A 5LJ3e 3JB9D 3RERA 4PNOA 3V7RA 4JRKA 3AHUA 4M7DB 4M78G 4C8QA 4M75F 3JCMg 5GAOp 5GAOn 4M75D 3V7CA 4XTWA 2YHTA 4JLIA 3BY7A 3HFNA 1U1SA 4M7AD 2DKGA 4M77B 4M7DF 2DEQA 1I4K1 2E65A 3VU3C 4M7DG 4M7AC 4M7AG 4M78B 1BIAA 4F7UE 4PJOF 1HXDA 4C8QG 3QO3A 3BW1A 2DJZA 5GAMj 5GANj 2DZ9A 3RIRA 3SWNC 4J6YA 4HA8A 4XTYA 3BDUA 5GAN6 4V2SA 1HK9A 4EMKB 1M5Q1 4M77A 3GIBA 4XQ3A 4F7UG 4C92C 4M7AE 4PJOG 4C8QF 3RKYA 5LJ5f 2EAYA 3INZA 4PJOB 4M75E 4N0AC 4J6XA 5GAN5 5LJ3h 1LJOA 2RD1A 2Y90A 5CAIA 5GMKm 3JCMb 4JUVA 2YLCA 3V7SA 3V8KA 2VC8A 3RUXA 2E64A 5DY9A 4EMKA 2DXUA 3SWNA 4M77C 2DZCA 4F7UA 4X9CA 5GAMh 4Y91A 1Y96A 1N9RA 5GMKl 1Y96B 2CGHA 3M4GA 3RESA 5GAMd 1U1TA 4C92D 2RB6A 4XTXA 2DTHA 4EMGA 1JBMA 2DTIA 5LJ5j 5GAN3 4DQ2A 3JCMV 4M7DA 2ZGWA 2YLBA 4M7AA 5GAMg 1B34B 4MMKA 3L1AA 5GAN2 5GAN8 5GAN4 5LJ5h 3FJPA 4NL3A 5LJ3g 1WNLA 4N0AA 1M8VA 2EWNA 2QTXA 4M7AF 3JCMf 3JB9G 3EFSA 4A54A 5GMKh 2EJFA 4WF2A 2RM4A 4M78F 4C92A 4PJOA 4M77E 4X9DA 2E41A 1H641 3JCMd 2E10A 5LJ3j 5GANd 3HFOA 3JB9J 2FB7A 4PJOE 5GAOr 4XU2A 5LJ3f 1WPYA 4EMKC 4F7UF 5I21A 5GMKi 1KQ1A 3JCMc 5GANe 3PGGA 4M75C 3V8JA 4MMLA 4QVDA 3QUIA 4C92B 4M78D 5GMKe 3BFMA 5GAMf 5GAOl 4XU0A 3HSBA 4RCCA 1D3BA 3JCMW 4C8QB 4M75G 4M7DC 2HNIA 4J5YA 3JCMP
chains in the Genus database with same CATH superfamily
1QCNA 3QPHA 2M1HA 1I81A 3L2ZA 1UDLA 4XU3A 3LLRA 4OMOA 2RQWA 2YUNA 1PSFA 2KNBB 1ZUYA 3OYLA 1SPKA 2NYSA 1Q86U 2MK5A 2C0TA 1ABQA 1VQOQ 1UG1A 2B86A 2LRQA 1VQMA 1Q7YR 2EPDA 2LQKA 4XTUA 2FO0A 1YITA 3O8VA 2CP5A 5GAOm 1UTIA 3A5ZB 2JZ2A 3KXTA 1EX4A 3FB9A 1T0HA 1YWPA 2ZPEB 4ZGDB 2L0AA 2O2OA 4JRKA 5CKHA 1LPLA 5GAOp 1Y7XA 2FEIA 3H0HA 2KMTA 1WFWA 3VU3C 4M7AC 2YSQA 1AOJA 2V8JA 5CKFA 4FM4B 4KGXB 3EFOB 1VYVA 1WJQA 4BB7A 4C5EA 4XTYA 2DIGA 1MV3A 4XQ3A 1YJ9T 1ABOA 1VQ6A 3RKYA 1C6VX 2A37A 2X4XA 4QQ6A 3U23A 1GFCA 1OZ2A 1FX7A 1V29B 2VB6A 1VQ9A 4FU6A 2IG0A 1ZLMA 5GAMh 2ZPFB 3META 4E47A 3QIIA 4ZTFA 2K3XA 4Y28E 3LH0A 3LGLA 4KGVB 1Y0MA 1D1AA 2OAWA 1NM7A 3LH5A 1VQ7T 1QMCA 5FLXE 2R58A 3JV3A 3OSSC 3ZFJA 2K2MA 4WF2A 4C92A 1IGUA 4RTZA 2LC4A 4OMPA 4D8KA 2PZ1A 3QKJA 2NUTB 3PGGA 3S3NA 4QVDA 2C0OA 2E12A 2KK4A 2OAUA 3M0SA 4AFQC 3QBYA 4F16A 3CPWP 1QVFS 4K11A 4OMMA 1N8RC 2ZPBB 1H8KA 3QZ9B 4E7SA 3H0FA 7AT1B 3TREA 2DFUA 2ESWA 2RI5A 1MGQA 1VQOA 3ZL7C 2EYWA 1B3QA 1NZ9A 1AWOA 2FYKA 2KR3A 3ZBDA 1VQ6T 4M75A 4HVWA 2GFUA 1QCFA 2KROA 4HXJA 3X28B 2EJ9A 3M9QA 4M7DD 5I11A 3GF5A 2EQUA 4MDXA 2M0OA 2QA4A 2L89A 1K0XA 1VQLA 2J6FA 2MWPA 4J9BA 4M7AD 1VIEA 4M7DF 2MCNA 2FHDA 2OX7A 1KG1A 4J9DA 3H6ZA 2RH2A 5DM7R 2K79A 1QP3A 2EGEA 2GFAA 5A0GA 1X27A 1M2VA 3H9NA 4F14A 2XK0A 4C0GA 3RUXA 3LW5E 4EMKA 4M77C 1M2OA 3HKSA 1BI1A 3C94A 4IURA 2BE9B 2LNVA 2QQBA 4HCZA 4EMGA 2DVJA 3J7AF 1Q7YC 1M27C 4MMKA 4LN2A 2HCKA 3EFSA 5GMKh 5KCOA 2K5FA 2GF7A 2BZYA 3FEOA 4RTUA 3SHWA 1K73R 1UGQB 1VQOT 1YJ9A 2Y4XA 1RAGB 2DLPA 3L2UA 2MAMA 4DBRA 2DD5A 3M0PA 2BZ8A 2CH4A 2AZSA 1RAHB 2F5TX 3WVDB 5J39A 4PFZA 1SRMA 3OYYA 4JRQA 3THKA 2L3PA 1GBQA 2YUOA 4NOYA 3VJPA 3OS0A 5LL6S 2X4JA 1QVFA 1F1BB 2E3HA 1FYNA 1NBEB 2KDSA 3RKWA 3SB2A 2MYSA 2VXFA 2E6ZA 3L42A 1KD1R 1VA7A 1C1AA 1O9SA 2LZ6B 3GPLA 5KH6A 3M58A 3MP8A 3RMQA 3OS1A 1ZA2B 3VS7A 1JEGA 1OU8A 2DEQA 1I4K1 5KYUB 3SWNC 3I56T 4CC3A 5GAN6 4LDYA 1YCSB 1A0NB 4JPBW 1OEBA 2LQ8A 4C8QF 2GQIA 2AZVA 2WSEE 3VS0A 3EH2A 2F1LA 2HZYA 1T3SA 4J9GA 3VUBA 2DL8A 1PHTA 1MMGA 1UFFA 2QGFB 1Q81C 1JBMA 1XOVA 1M1KR 5IT9E 3FDRA 3OYEA 1WA7A 2P0QA 4M7AF 3CCRA 3ULRB 2QAZA 4M78F 5I2SA 2PVGB 4M77E 1PM3A 4EDUA 2JJ9A 2KYMA 4A4EA 4KH1B 4RUGA 1AZEA 1CKAA 2LX9A 4M75C 4A63B 2O01E 4M78D 2D8JA 2X3XD 4ANJA 2J7IA 5D6WA 2F2VA 5GAOq 1RUWA 2J05A 2HSEB 1KHCA 3CCET 4PJOD 4M77F 1GCQA 3MO8A 1WHKA 2DE0X 4XTZA 1YI2Q 4GBQA 1KC8R 1S1NA 3CQTA 1YJWT 1PC0A 4LNPA 3EFOA 3JB9F 3G7ZA 2OTJQ 4QKUA 2K4YA 1YBYA 2KQWA 3UDCA 4OB1B 2QK0A 5FW9A 1K4US 2F2XA 4BE0A 3JB9D 2V1QA 2W0ZA 1UE9A 4M7DB 2JS2A 4M78G 4E7KA 1VQKQ 1N8RU 1RAIB 2DKGA 5FROA 2PU9B 1QLYA 1HXDA 1HYOA 1JXOA 2DPPB 1TXQA 4JLGA 3OYFA 2XG8D 2DX1A 2PNIA 4OGCA 4N0AC 3VS1A 4B9WA 2RD1A 1W70A 2HDAA 1RLQC 3FRNA 3RR6A 1VQ8Q 1OPLA 3OBWA 2R5AA 3RDVA 2DL7A 2Y4YA 1U1TA 1IO6A 4XTXA 2DTHA 2FRYA 4R56A 4OMLA 3NTIA 5CKBA 2EYXA 1TU0B 4DA4A 2BE7D 4RMOA 1LVKA 5FU7C 3OMGA 1WNLA 3VS5A 2RM4A 2LJ3A 1DJ7B 4X9DA 1TWBA 2JT4A 3JSCA 2H3EB 4AT1B 2QI2A 4F7UF 2AKLA 1KQ1A 1H92A 4C92B 1NJIU 2RK1A 1D0ZA 1PD1A 2XMFA 2QEXA 1D3BA 3JCMW 1BB9A 3EH1A 1YHQA 1YJWA 3A1PA 3EGXB 5FWCA 3CCSQ 2RK2A 3OYCA 1VQ9Q 3L2WA 1MNEA 1M90U 4JRIA 5FU6C 4VUBA 3G4ST 2HBPA 1QVGS 3A8LB 3JB9I 4XTVA 5AT1B 3LWHA 2LTOA 1N5ZA 4E7LA 3SWNB 3DKMA 4Z88A 3CC7T 4C92E 3CCSA 4M78C 2C06A 5KYWA 2DL5A 2LQNA 2QEXT 2DA9A 1VQ8A 1RABB 3LGFA 2EKOA 3P8DA 2P4RA 2FPFA 5M9OA 4M75F 3A8GB 2ED1A 3BY7A 4UC4A 4MZTA 2PUOB 4PJOF 3OYDA 2GNCA 3F70A 5CK9A 2COZA 3BDUA 1M1GA 2XU8A 2RI3A 1PD0A 2A3LA 5I2MA 2YRVA 2I0NA 2QQSA 3J81E 4JUVA 3KUFA 1QW1A 1YJNT 1IGQA 1WHGA 2AIRB 5A2QE 1PNJA 3RESA 4FW1A 2YT6A 1G3SA 5GAN3 1D1CA 3CMEQ 1B34B 4B6MA 2QEXQ 3FC3A 2BKDN 1JJ2P 2M9UA 1SF9A 1ZSGA 2WACA 4DBHA 2LT4A 4FSSA 1X6OA 3M5AA 4PJLA 3FJ5A 1MUZA 1NJIC 2DRKA 2A0FB 1H641 2HL5C 2RJCA 2FB7A 2HKQB 3EGUA 3EG0A 1M2VB 3G71A 1MMDA 1R77A 3TSWA 3EHQA 1WDXA 2CDTA 3OYIA 2KY9A 3MPUB 1IZ6A 3I56Q 1X75C 1N8RR 4L59A 1Q82U 2FZGB 4EIKA 4KH0B 4HCCA 1LCKA 4ESRA 1VQ4A 2YRDA 1S72T 1N6AA 1JXMA 1OYXA 1MMAA 1UHFA 3OW2P 4M77G 2C0IA 1WQWA 4Z89A 3QJ6A 1N27A 1Q95G 2RI2A 4CC2A 1TUDA 1M90C 4Z02A 3NTKA 3RERA 2W10A 1OI1A 2O4XB 4GLMA 1QVGA 5GJWB 3T9NA 2ZZDA 4RTTA 2KI7A 4LE9A 4BACA 1M3BA 4BI4A 2DRMA 4F7UE 3CCLA 4LD9K 3RBBB 1M3CA 2XHCA 1VQMQ 2JW4A 3P8BB 1R8OB 3I35A 1UJYA 4E7ZA 2DYBA 2K5IA 1GFDA 4X1VA 3IQLA 1G2BA 3M4GA 4IUPA 1XJWB 1OX8A 1AEYA 5A0LA 1ZX6A 2RJFA 1OU9A 3OYJA 2YWWA 5GAN8 3CCRQ 4NL3A 2RF0A 3CBPA 4PJMA 1Z9QA 2RQRA 1E7OA 1AVZC 4BE2A 1K9MR 4N4IA 3S3MA 2E10A 4PL6A 1UHCA 1ARKA 3JB9J 5FRMA 3VYHB 5GAOr 2AT1B 2QQAA 2X4WA 5J26A 3VS2A 2P0KA 4FT2A 2PVOB 2RHIA 4E7HA 4PK4A 3P8HA 1K0SA 3JRZA 4M7DE 2OTLA 2DVEA 3M0TA 2KYBA 5L8RE 1YITT 2RHXA 2HEQA 1WIEA 2FRWA 1H3HA 5LJ5d 2JUFA 2JNGA 3RNJA 1NYFA 4M75B 4E7IA 1OX9A 3E19A 2VWFA 4J9FA 5D6XA 4C8QC 1YNZA 5GAN7 1Q82R 2CREA 2L5QA 4HKEA 4LDXA 1RL2A 1BK2A 3CBMA 2O9VA 1FWZA 3UWNA 3ME9A 3TCJA 5C0MA 2O31A 2LJ0A 2DL3A 4JJCA 1Y71A 3CCMQ 1K8AU 1VQ4Q 3CBOA 4M78B 4M7AG 2CP0A 2DJZA 2DZ9A 2OTJA 1B07A 3VS3A 3CCJT 3I55T 2GQVA 4M7AE 5KCHA 3CCUA 2EAYA 2Z0WA 4J6XA 5LJ3h 4ORZA 2LCSA 2VGNA 2HQXA 2YLCA 3V8KA 4F7UA 1M8MA 3KFVA 3VV0A 4FYVB 1NLOC 5KYNA 2NWMA 5DLOA 1B7TA 2CZ6B 4M7DA 3MJXA 4KGZB 5GAMg 2CUDA 1PRMC 4DBQA 2HMAA 3CCUQ 1GXIE 3QJYA 3R6NA 1BU1A 1SSHA 2X4YA 1YN8A 3OYBA 1UGVA 5GANd 4WTOB 1M90R 4HCKA 1D0YA 5LJ3f 1WXBA 4MMLA 4DOWA 1RACB 1G3TA 1D0XA 3BFMA 5GAOl 3G6EQ 3HSBA 3UA7A 2LMJA 4F17A 1ZSZC 2E4HA 1AWWA 1K8AR 3CC4Q 4A4FA 1BIBA 3QYHB 4AFZC 5KYYB 3KBGA 1KC8U 5LJ5e 1V1CA 1IRXA 3FIFA 3CCJQ 4GLKA 1MHNA 2VXEA 3L2VA 4BY6C 2RJEA 2ENMA 1N9SA 4E7JA 1VQNQ 1J3TA 2RHUA 1BI0A 2DXCA 2EYZA 4LD6A 1I07A 1Q86C 4XTWA 4QVZA 4JLIA 4M77B 2GCXA 2LQWA 3QO3A 3RMSA 1T3LA 1IHVA 4LDUA 4AMCA 2B8AA 1RAFB 2CP3A 1M5Q1 2IVWA 5CQYA 3CD6T 4F7UG 2V1RA 4PJOG 5KYXA 5LJ5f 2KSSA 2XI9A 4LXCA 4PJOB 1YJNQ 2DM1A 2CZ1B 1QKXA 2WSFE 4FT4A 3G71Q 1U5SA 2M51A 2OTLQ 2D0QB 1UGPB 4PFOA 3PTAA 1VQ5A 2BTTA 3MEWA 5D7UA 4OF1A 5GAN4 4J9CA 1WJRA 1M8VA 3HRTA 3JCMf 3DLMA 3OA6A 4OB0B 4PJOE 4HVUA 1WPYA 1QVPA 2KXDA 3QUIA 3LYIA 1VQLQ 3TSZA 3CMEA 2GGRA 4HVVA 2DMOA 3DLLA 2RN8A 3M56A 2P84A 4XU1A 4DEXA 3RKXA 3JCMh 2LVMA 4M77D 3QG1A 4F7UB 2K2VA 2KE9A 1BCOA 1WQ7A 1X69A 2X51A 5GJVB 2E5KA 3QHSA 2JTMA 2YDLA 3JCMe 3CPFA 1M1FA 1U06A 3CCVT 3MEAA 2J6KA 3QDFA 1UUEA 3QWYA 1VQNA 2DXBA 3SDZA 2RJDA 3L2QA 4NL2A 5LJ3e 1K9MC 3L2RA 3V7RA 3AHUA 5HKCA 2DETA 1JU5C 4ELYC 3JCMg 3CCJA 1KIKA 3OSVA 4AG1C 3QYGB 3URGA 2KBTA 3CCEA 3EG9A 3TU4K 3HL8A 1HK9A 3CCEQ 3ASKA 4OMNA 3DB4A 1X43A 2E5QA 5IHIA 1MNDA 1RI9A 2LCCA 5GMKm 2HD0A 1YIJQ 1FMVA 4Y92A 2RHZA 3G6ET 1SKUB 1G8XA 1AD5A 3GP8A 2JM8A 1ZBJA 3ER0A 1BKBA 2RO0A 1Y96B 4C0ZA 2PTKA 1ZHIA 1ZSZA 4DQ2A 3EG9B 5GAN2 4IIMA 4L6V5 3FJPA 2DD4A 5LJ3g 2FVUA 4JJBA 1VQ6Q 1HJDA 1UGRB 4J8OA 2DO3A 1S72Q 2F5KA 1NJIR 2QASA 2KRNA 4RTXA 3H41A 5DLQE 5GANe 6AT1B 1QP2A 2CSQA 1VQ7Q 3NGPA 4PJJA 2XDBA 2K5LA 3SEMA 4O5VA 2DXTA 2CS7A 1LOJA 2K57A 3M55A 1NE8A 3MEVA 4JDSA 3FLGA 1K9MU 2JTEA 3OMCA 1X6BA 3C4SA 1IHWA 4JJNK 1YI2A 4M7AB 3X24B 1WXTA 1RAAB 1EIFA 2M0YA 2VKNA 5CQXA 1OZ3A 3HHTB 5KYWB 1T0JA 4J7IA 2KRSA 1MMNA 5L23A 4C8QA 3PFSA 4ME7A 3I5RA 4M75D 3V7CA 2QGGA 5IAYA 3M4YA 1RADB 1NPPA 2MMPA 2R5MA 2DJQA 4LUEA 3CCQT 1UJ0A 2VGMA 2CUBA 2WSCE 1KQSA 3OW2S 3OYGA 3A8HB 3V7SA 2A36A 1VQ9T 4Y91A 1N9RA 1TOVA 2J6OA 2A08A 2J06A 3OW2A 4JJDA 2DTIA 5IHNA 2ZGWA 1JB0E 2QTXA 1YHQT 2L3RA 1K1ZA 1SHFA 3QDRB 3NTHA 1U3OA 5EG2A 1XQHA 4N4GA 1EZZB 1C0MA 3HFOA 4BUGA 4XU2A 2JXBA 2JVVA 1O75A 1SG5A 3O5ZA 4QQGA 2E6NA 2DBMA 2VV5A 1KQ2A 2H3JA 1WXUA 1G5VA 1Y57A 3PMIA 3JAME 1G3WA 4MZMA 2KVQG 2RA2A 3CC2T 1FXXA 1PCXA 4C92G 3CXCA 4Z8AA 1K9AA 1PRLC 1VQPT 5FWBA 2ZPHB 3HRUA 3X25B 3AT1B 2QA4Q 2JMAA 1ACMB 1UB4A 2KGTA 3OYMA 2I2LA 2IIMA 2QQ9A 2ROTA 4JZ3A 2FPDA 1QWFA 4QVCA 3REAB 1W2BS 4M4ZA 1KFZA 3REBB 2PQWA 5IXBA 3G6EA 2ZCFB 1YWOA 3OYAA 2NUTA 4IKFA 4ZN3A 2V26A 1R0CB 3BW1A 1BYMA 2RHYA 3RIRA 5KYYA 4FSXA 3UA6A 4R55A 4OB3B 2E3IA 3GIBA 3I56A 1WHLA 5CIUA 2MI6A 2KRMA 2R57A 2LX7A 2V8KA 4MZPA 3JCMb 4L5GA 4C0DC 2DL4A 2FZCB 1QKWA 2DXUA 1VQ4T 2MOXA 5GMKl 5AYFA 3TVTA 1IREB 1YJ9Q 2FG0A 3JCMV 4CC7A 2YLBA 4RTWA 2DF6A 3PVQA 2QDLA 3E9GA 1M30A 2MPXC 2K3YA 2DILA 3UF4A 4J9IA 3JB9G 2L3QA 2KXCA 1SEMA 1GCQC 2E41A 2CZ0B 3SD4A 1GL5A 4LUDA 5GMKi 1QVGP 4R0KA 3PVLA 1W1FA 2GBQA 4OB2B 5GMKe 1WGSA 2DEUA 2EGAA 3WVEB 4OGEA 1UEBA 2LDMA 2V8IA 4M78E 3CXCP 3CCVQ 2XKOC 3EFRA 4C5HA 4DEYA 1R0BG 2BUDA 3GNFB 4M78A 2K3BA 3SFMA 1BBZA 1NPRA 4A53A 1YCYA 2ATCB 3BDLA 2DK3A 4IUTA 3EG3A 1KK7A 3I5SA 5GANg 2FZKB 1TG0A 3DB3A 3I55Q 1B34A 2YRCA 3C95A 2SEMA 1LNXA 1AT1B 3C0CA 2FPEA 4C8QE 3CCRT 4J9EA 2HKNA 4DOVA 4PNOA 5CCAA 1EFNA 2QG9B 4IUVA 5KE3A 1Q86R 2KEAA 2LP5A 2YHTA 2O88A 1AWJA 1ZSZB 4D8DA 2E70A 3A98A 3GLXA 4EPCA 1QCOA 1WYXA 2CSIA 2JTFA 3ZEHA 4J6YA 4J9HA 2EQIA 4V2SA 4C92C 5GAN5 2MWOA 2EVRA 1I0CA 3G4SA 2ZPGB 4LDWA 4XAXB 5EC7A 3EAEA 4A4KA 3GOXA 1SSFA 3OS5A 2XIDA 1S72A 2QQRA 1VOMA 2D9TA 2RPNA 1D09B 1Q82C 3EGDA 2RQUA 4CI0C 5J3BA 1XTDA 3VS4A 1WZOA 2EJFA 2K6DA 5CR2A 1K76A 2GTOA 4JZ4A 3OYHA 2O4XA 2ZPIB 1VIFA 3OYKA 3C12A 5I21A 3N5BB 2XDPA 4AFUC 3V8JA 5IXFA 1QQJA 1NEBA 1VQPA 4F04B 3E1SA 1VQ8T 4RCCA 4M75G 2L8DA 5IN1A 2CT3A 2EW3A 3CEYA 3M0RA 1HD3A 3S6WA 5C6SA 4OMFB 1KD1U 2D6FA 5GANh 4ZGJB 1WI7A 2EBPA 4B9XA 1X6GA 8ATCB 4PLIA 4OMQA 3D7SB 3JCMJ 4HT9A 4KUIA 1E6HA 5GAMe 3JB9H 4C5IA 1VQKT 1VQMT 4J83A 2F69A 1Q81R 4BDZA 4BY6B 1OULA 3VRZA 1VUBA 2OI3A 3TEEA 5GANf 2JN0A 2DERA 5CVIA 1K73C 4ZNXA 2ECZA 1ZUUA 1YJWQ 4ZGEB 5GAOn 2VASA 1PWTA 4YTLA 2CYZB 1FMWA 2DYIA 1NYGA 4RG8A 2EIFA 1JO8A 3LX7A 1YIJT 1NEGA 3G1JA 3OQ5A 3R6OA 2BIVA 3NPFA 1AHJB 1WHJA 2FL7A 1LJOA 2Y90A 4C5GA 5CAIA 2EYYA 2ZAEA 1JJ2A 4A4GA 3PT9A 5DY9A 2K9GA 2KT8A 3NFCA 1TUGB 3UT1A 2DIQA 4FW2A 3PE0A 3EHRA 4C92D 2RB6A 3M0QA 5LJ5j 1YIJA 1KC8C 1M1KU 4ZN1A 1M3AA 3L1AA 5LJ5h 1CKBA 1ZBXA 1TSFA 4N0AA 1KD1C 2K7AA 2AHJB 4A54A 4BI8B 3CC7Q 4JS4A 1GBRA 3CCMT 4BD3A 4KUDK 2CP6A 4E6RA 4C0FA 3CC2A 3CC4A 3G4SQ 2COYA 4KT0E 5GAMf 1W2BP 1TS9A 2HNIA 1X01A 5HK3A 2RMOA 5IH2A 3QSUA 4IUQA 1TH7A 2EQMA 2L2PA 3CMET 2QA4T 2PUKB 1BCMA 4EMHA 2LT1A 3QWXX 1SRLA 1WJSA 4OP0A 1K73U 3A8MB 2VUBA 1QWEA 4J6WA 1I5LA 3GBQA 8AT1B 3S3OA 2JMCA 1WLPB 1OOTA 4HT8A 1AZGB 2LJ1A 1D3BB 3CC4T 3V8LA 4KBMB 3H0IA 1GCPA 1VQKA 3QZ5B 5CKDA 3CD6A 1E6GA 4BI3A 1NG2A 5FU7B 3MEUA 2QTVA 1VQPQ 3CCLT 1HSQA 3MP1A 2E65A 1KQSP 4X34A 3G71T 1JQQA 2CH4W 4FYYB 5GANj 2IPOB 3VS6A 1YITQ 2XD0A 1RLPC 2YUQA 1IXDA 3PNWC 1KHIA 2P0PA 1GRIA 4M77A 4IIOA 3OBYA 1I1JA 3CCMA 1NLPC 2HQHA 1W4SA 1ZQ1A 2VC8A 2E64A 2QYZA 3QXEB 3EGXA 4X9CA 5KYXB 1Y96A 2M02A 1G3YA 1SHGA 2NUPB 4ZTJA 3LWIA 2NUPA 2NLUA 2EQJA 1YHQQ 1W2BA 3CCQQ 2HBWA 3EG1A 4NS5A 4QW2A 1TTHB 1YJNA 4C0DB 5A0DA 1Z9ZA 1Q7YU 2YUPA 2LNHB 2DAQA 1OPKA 3CPWS 3BE3A 4PKCC 1PKTA 3JCMd 3MHXA 4BDYA 3CMAQ 3JCMc 5I22A 3OB9A 3CPWA 3OY9A 1PG5B 4C8QB 4FCYA 2AKKA 2DBKA 1VQ5Q 2D1XA 2CT4A 9ATCB 2EKHA 4D6WA 4N4HA 4RCBA 4E2FB 5FRNA 4O6JA 2KAFA 2P4TA 5LJ5g 4QT7A 5KE2A 3X26B 4HCBA 2PVDB 1AWXA 2OTLT 4C92F 1K8AC 3VUZA 4PJOC 2CKKA 5HCKA 3CCLQ 3JCMX 3NMZC 4P5NA 2ROLA 1JRIA 2EJGA 3MKDA 3M59A 2CZ7B 4CRIA 3MP6A 4II1A 3CD6Q 2E1HA 1CSKA 5ECAA 5LJ3d 3VRYA 4OVAA 1TUCA 3EG2A 1WX6A 4IUUA 2D8HA 2KT1A 3CMAT 1PKSA 1W6XA 2M16A 2VYTA 1M9SA 3OS2A 4MDWA 4DBFA 3Q1JA 2EQKA 1KQSS 2EGCA 3PMTA 3OYNA 1D1BA 5CKEA 4M7DG 2F2WA 4FL6A 4KRTA 1BIAA 4QQDA 4LDVA 3I55A 4HA8A 2COWA 2JM9A 4EMKB 3HTRA 2OTJT 1UGSB 3INZA 4M75E 3UPUA 1VYTA 2H8HA 4BE1A 1YI2T 1OQKA 2A28A 3PIOA 2BZXA 1KJWA 3VKIA 1P92A 2CP2A 2ABLA 3A8OB 3CCVA 1VYUA 2CGHA 5GAMd 2HL3A 2SRCA 4CC4B 3CMAA 3M57A 1Q81U 2X35A 2EYQA 2D0NA 1VQNT 1OV3A 5D6YA 2YXYA 5HK0A 3CC7A 4XK8E 2VVKA 2DNUA 2X3WD 4KULA 5HY6A 1YFNA 2CP7A 1X2QA 2OJ2A 3H8ZA 2A7YA 2XICA 2ED0A 3PIPA 4Q5WA 2L3SA 3CCUT 3GNGA 2LCLA 4J5YA 3JCMP 1ZA1B 1VQ7A 4FYXB 4GY5A 2EFIA 4C8QD 5KYUA 2QXFA 4FYWB 3M54A 5GMKj 4AG2C 1QVFP 4JS5A 3EGDB 3M0UA 3VYGA 3E2UA 3HRSA 1PSEA 1UECA 3I9QA 3JCMQ 1BI3A 1I8FA 4ELZC 4FIBA 2MF2A 3WXMB 2DTOA 1ZUKA 2AK5A 2HQEA 1BI2A 3MCAB 2QDYB 1H3ZA 5FU6B 4WCIA 3HPWA 4ATOA 4A4HA 3E9FA 2RNAA 3HFNA 1U1SA 3CXCS 2HSPA 1JJ2S 4C8QG 5GAMj 2RQVA 2XDDA 1XNIA 3NHNA 3CCST 1M4ZA 2X9HA 4AFSC 2RQTA 2G6FX 4RTVA 1RAEB 4PFPA 4JRPA 3HP9A 1VQLT 5CO7A 1I5OB 3SWNA 1X2KA 2DZCA 2JOYA 1KSWA 2NUZA 3M53A 3CC2Q 1M1KC 1WHHA 1YP5A 2GTJA 1V76A 3TQ7P 4PJNA 4M7AA 4J7FA 4RTYA 1VQ5T 1MV0B 1RI0A 2EWNA 4RG2A 5IHKA 1U8RA 4TVRA 1IB8A 4PLLA 4PJOA 3X20B 3J80E 1G83A 5LJ3j 2G3RA 3UATA 1Y07A 4EMKC 2HAXA 2O9SA 1FMKA 2MIOA 2JS0A 4XU0A 4RKUE 4M7DC 3CCQA 1WHMA
chains in the Genus database with same CATH topology
1YHQA 5C6SA 3CEYA 3QPHA 3S6WA 2M1HA 1YJWA 4OMFB 1KD1U 2D6FA 5GANh 1I81A 4ZGJB 3L2ZA 4XU3A 3DLLA 3LLRA 4B9XA 3M56A 1PSFA 2RK2A 4PLIA 3OYCA 3JCMJ 4HT9A 4XU1A 3L2WA 4KUIA 3RKXA 3JCMh 1M90U 5GAMe 2LVMA 4JRIA 4M77D 3OYLA 3JB9H 5FU6C 3QG1A 4F7UB 1Q86U 2K2VA 4VUBA 3G4ST 1WQ7A 2HBPA 4C5IA 1QVGS 3A8LB 3QHSA 3JB9I 1VQKT 2JTMA 2LRQA 4XTVA 3JCMe 1VQMA 1VQMT 4J83A 2F69A 2LQKA 3CPFA 3LWHA 1M1FA 2LTOA 4XTUA 3CCVT 1YITA 3MEAA 4BDZA 3O8VA 4E7LA 4BY6B 3SWNB 3DKMA 3CC7T 5GAOm 1VUBA 4C92E 3A5ZB 3CCSA 4M78C 2C06A 3TEEA 2JZ2A 2DXBA 3KXTA 1VQNA 3SDZA 2JN0A 2RJDA 3FB9A 5GANf 3L2QA 4NL2A 5CVIA 5LJ3e 2QEXT 1K73C 1K9MC 2ZPEB 1VQ8A 3L2RA 3V7RA 4ZGDB 3LGFA 4JRKA 3AHUA 2EKOA 3P8DA 5HKCA 5CKHA 4ELYC 5M9OA 4M75F 3JCMg 4ZGEB 3CCJA 3A8GB 5GAOp 1Y7XA 5GAOn 3OSVA 3BY7A 4UC4A 2KMTA 4YTLA 2CYZB 3QYGB 3URGA 3VU3C 3CCEA 4RG8A 4M7AC 4MZTA 2PUOB 2EIFA 2V8JA 3LX7A 4PJOF 1YIJT 3OYDA 5CKFA 4FM4B 3F70A 4C5EA 4BB7A 1WJQA 5CK9A 3TU4K 3HL8A 3OQ5A 3BDUA 3R6OA 2DIGA 4XTYA 1HK9A 1M1GA 3ASKA 3DB4A 2XU8A 4XQ3A 2BIVA 1YJ9T 1VQ6A 2RI3A 2E5QA 1AHJB 2A3LA 3RKYA 5I2MA 2YRVA 2X4XA 4QQ6A 2QQSA 2FL7A 1OZ2A 2LCCA 1LJOA 1FX7A 2Y90A 4C5GA 1V29B 2HD0A 5CAIA 4JUVA 5GMKm 3J81E 3KUFA 1JJ2A 2RHZA 4A4GA 1QW1A 3PT9A 2IG0A 4FU6A 5DY9A 3G6ET 5GAMh 2ZPFB 3META 3GP8A 1YJNT 4E47A 3NFCA 3QIIA 3ER0A 3UT1A 1BKBA 2RO0A 5A2QE 1Y96B 4ZTFA 2DIQA 2K3XA 3RESA 4C0ZA 4C92D 2RB6A 4Y28E 3JB9F 1G3SA 1ZHIA 3LH0A 3LGLA 4DQ2A 5LJ5j 5GAN3 1YIJA 1KC8C 1B34B 1VQ9A 1M1KU 4ZN1A 3L1AA 5GAN2 4L6V5 5LJ5h 3FC3A 3FJPA 2DD4A 1VQ7T 1ZBXA 2BKDN 2FVUA 2M9UA 5FLXE 2R58A 4N0AA 5LJ3g 1KD1C 1UGRB 2AHJB 2WACA 3OSSC 2LT4A 3ZFJA 4A54A 4BI8B 1X6OA 4WF2A 3M5AA 4JS4A 4C92A 4J8OA 2DO3A 1NJIC 3CCMT 2LC4A 4BD3A 1H641 2F5KA 2RJCA 4KUDK 2FB7A 5DLQE 3QKJA 5GANe 1QP2A 3PGGA 4C0FA 3S3NA 3CC2A 4QVDA 3CC4A 2E12A 2KK4A 4KT0E 5GAMf 2OAUA 3G71A 2HNIA 2XDBA 2K5LA 1X01A 5HK3A 3QSUA 3QBYA 4IUQA 2DXTA 4O5VA 3OYIA 2CS7A 2KY9A 1TH7A 2EQMA 1LOJA 2K57A 3CMET 1IZ6A 3M55A 2PUKB 1NE8A 2QA4T 4EMHA 2LT1A 3MEVA 4JDSA 1QVFS 1X75C 3FLGA 1WJSA 4OP0A 4L59A 1K73U 1K9MU 3OMCA 3A8MB 2VUBA 2ZPBB 1Q82U 1N8RC 4J6WA 3QZ9B 1I5LA 3S3OA 4HCCA 3TREA 3C4SA 1VQ4A 4HT8A 2RI5A 1MGQA 1VQOA 1S72T 1D3BB 1N6AA 3CC4T 4JJNK 1NZ9A 1OYXA 1YI2A 2FYKA 4M7AB 3X24B 3ZBDA 3V8LA 4M77G 1EIFA 1VQ6T 1WQWA 4M75A 5CQXA 4KBMB 1OZ3A 3HHTB 3QJ6A 1N27A 2GFUA 2RI2A 3X28B 1M90C 2EJ9A 3M9QA 5IN1A 1VQKA 4Z02A 4M7DD 3GF5A 3NTKA 3RERA 3QZ5B 5CKDA 4J7IA 2EQUA 3CD6A 1OI1A 4MDXA 4C8QA 2M0OA 2O4XB 3PFSA 2QA4A 4BI3A 1QVGA 5FU7B 2L89A 4ME7A 2ZZDA 3MEUA 4M75D 2MWPA 3T9NA 3V7CA 1VQLA 5IAYA 4M7AD 4BACA 1VIEA 3CCLT 4M7DF 3M4YA 3MP1A 4BI4A 2FHDA 1NPPA 2E65A 2MMPA 2R5MA 4X34A 3G71T 4F7UE 5GANj 3CCLA 1KG1A 4LD9K 3H6ZA 2RH2A 2XD0A 2XHCA 3PNWC 1KHIA 2P0PA 5DM7R 4M77A 3CCQT 1QP3A 3P8BB 1R8OB 2GFAA 3OBYA 3CCMA 5A0GA 2VGMA 2WSCE 1KQSA 3OW2S 1W4SA 3OYGA 2XK0A 3A8HB 3V7SA 1ZQ1A 2VC8A 4C0GA 3RUXA 2E64A 3LW5E 2K5IA 4EMKA 1VQ9T 4M77C 3QXEB 4X9CA 4Y91A 1Y96A 3HKSA 1N9RA 1BI1A 1G3YA 3C94A 3M4GA 4IURA 4IUPA 2LNVA 2QQBA 4ZTJA 3LWIA 4HCZA 2NLUA 4EMGA 3OW2A 2DTIA 2EQJA 1W2BA 5A0LA 3J7AF 1Q7YC 2ZGWA 2RJFA 3OYJA 4NS5A 4MMKA 4QW2A 5GAN8 1YJNA 4C0DB 5A0DA 4NL3A 1Q7YU 1JB0E 3CBPA 2QTXA 2DAQA 1YHQT 3EFSA 2L3RA 5GMKh 5KCOA 3CPWS 2K5FA 2GF7A 3FEOA 3NTHA 3QDRB 4BE2A 1UGQB 4N4IA 4PKCC 3S3MA 1VQOT 5EG2A 1YJ9A 3JCMd 1XQHA 2E10A 4N4GA 3MHXA 4PL6A 3HFOA 4BDYA 3JB9J 3VYHB 5FRMA 4BUGA 5GAOr 4XU2A 2Y4XA 3JCMc 2QQAA 3OB9A 2X4WA 5J26A 3CPWA 2P0KA 4FT2A 3OY9A 2JVVA 1O75A 2PVOB 2RHIA 4E7HA 4C8QB 3L2UA 2MAMA 4QQGA 3P8HA 2E6NA 2DD5A 4D6WA 2VV5A 4N4HA 4RCBA 3JRZA 4M7DE 5FRNA 1KQ2A 2OTLA 2DVEA 2F5TX 2H3JA 2KAFA 2P4TA 4O6JA 2RHXA 5L8RE 1YITT 1G5VA 5LJ5g 3PMIA 5KE2A 3JAME 1G3WA 3X26B 4MZMA 3WVDB 2KVQG 2PVDB 4HCBA 5J39A 2OTLT 4C92F 1K8AC 2RA2A 3VUZA 3CC2T 4PJOC 2CKKA 5LJ5d 1FXXA 2JUFA 4C92G 2JNGA 3OYYA 3CXCA 4JRQA 3JCMX 4M75B 4E7IA 4P5NA 3E19A 1VQPT 1JRIA 2EJGA 2ZPHB 3HRUA 4NOYA 5D6XA 3VJPA 4C8QC 3M59A 2CZ7B 5GAN7 3X25B 2L5QA 4HKEA 3MP6A 4CRIA 3OS0A 4II1A 5LL6S 4LDXA 2X4JA 1UB4A 1RL2A 1QVFA 2E1HA 3OYMA 2I2LA 2QQ9A 2KDSA 5LJ3d 4OVAA 3RKWA 4QVCA 1W2BS 3SB2A 3CBMA 2VXFA 4IUUA 2E6ZA 1FWZA 3UWNA 3L42A 3ME9A 3TCJA 3CMAT 1O9SA 5C0MA 2PQWA 2M16A 2VYTA 3GPLA 1M9SA 3OS2A 5KH6A 4MDWA 3M58A 3MP8A 3RMQA 3G6EA 1Y71A 2EQKA 2ZCFB 3Q1JA 3OS1A 3PMTA 3OYAA 1KQSS 3OYNA 1K8AU 2DEQA 4IKFA 1I4K1 4M7DG 5CKEA 3CBOA 4M78B 4M7AG 4FL6A 4QQDA 1BIAA 4ZN3A 4LDVA 3BW1A 2DJZA 2RHYA 1BYMA 2DZ9A 3RIRA 3SWNC 3I55A 4FSXA 3I56T 2OTJA 4HA8A 5GAN6 4R55A 3CCJT 4OB3B 4EMKB 4LDYA 3GIBA 3I55T 2GQVA 3I56A 5CIUA 2OTJT 2LQ8A 1UGSB 2MI6A 5KCHA 4C8QF 3CCUA 2R57A 4M7AE 2EAYA 3INZA 2V8KA 4M75E 4BE1A 3UPUA 1YI2T 4MZPA 4J6XA 5LJ3h 3JCMb 3PIOA 4L5GA 4C0DC 2VGNA 2HQXA 2WSEE 2YLCA 3V8KA 3VKIA 4F7UA 1P92A 2DXUA 1VQ4T 3A8OB 3VV0A 3CCVA 5GMKl 2CGHA 5GAMd 3VUBA 3CMAA 5AYFA 5DLOA 3M57A 1Q81C 1IREB 2X35A 1JBMA 1Q81U 2EYQA 2CZ6B 3JCMV 4M7DA 2YLBA 1VQNT 1XOVA 5GAMg 5D6YA 5HK0A 5IT9E 3CC7A 1GXIE 3FDRA 3QJYA 3E9GA 3OYEA 4XK8E 2K3YA 2P0QA 4M7AF 3JB9G 2X4YA 3CCRA 4KULA 4M78F 5HY6A 5I2SA 2PVGB 4M77E 3OYBA 2E41A 2CZ0B 3SD4A 4EDUA 5GANd 4A4EA 3H8ZA 2A7YA 2XICA 5GMKi 5LJ3f 3PIPA 2LX9A 4M75C 4Q5WA 4MMLA 4DOWA 4OB2B 1G3TA 2O01E 4M78D 5GMKe 1WGSA 3BFMA 5GAOl 3WVEB 3CCUT 3HSBA 3GNGA 2LCLA 4OGEA 1UEBA 2LDMA 4J5YA 3JCMP 5D6WA 2V8IA 1VQ7A 4GY5A 4M78E 2EFIA 4C8QD 5GAOq 2XKOC 1BIBA 3EFRA 4A4FA 4C5HA 1KHCA 3CCET 3GNFB 2BUDA 3SFMA 4M78A 4PJOD 1NPRA 4A53A 1YCYA 4M77F 2QXFA 3QYHB 3M54A 3MO8A 3BDLA 4XTZA 5GMKj 3KBGA 2DK3A 4IUTA 1KC8U 4JS5A 5LJ5e 3VYGA 3HRSA 1PSEA 5GANg 1YJWT 3FIFA 3JCMQ 1BI3A 1I8FA 3DB3A 4GLKA 4ELZC 4FIBA 1MHNA 2VXEA 3G7ZA 1B34A 3L2VA 4BY6C 2K4YA 2MF2A 3WXMB 2DTOA 1YBYA 2KQWA 2RJEA 3C95A 3UDCA 4OB1B 2HQEA 1LNXA 1N9SA 4E7JA 4C8QE 1BI2A 3CCRT 3MCAB 4BE0A 2RHUA 1BI0A 3JB9D 2QDYB 4DOVA 2DXCA 4PNOA 5CCAA 4IUVA 1H3ZA 4M7DB 5KE3A 5FU6B 4M78G 4E7KA 3HPWA 4ATOA 4LD6A 4A4HA 1Q86C 4XTWA 4QVZA 2YHTA 3E9FA 4JLIA 3HFNA 1N8RU 1U1SA 3CXCS 2DKGA 4M77B 5FROA 4EPCA 2E70A 3GLXA 2PU9B 1JJ2S 2GCXA 4C8QG 1HXDA 5GAMj 3QO3A 3RMSA 2JTFA 3ZEHA 4J6YA 4LDUA 2XDDA 2B8AA 4V2SA 1XNIA 3CCST 1M5Q1 2DPPB 2IVWA 1M4ZA 4JLGA 5CQYA 3OYFA 3CD6T 4F7UG 4C92C 2XG8D 4PJOG 5LJ5f 4PJOB 2KSSA 2XI9A 4OGCA 4N0AC 2CZ1B 5GAN5 4B9WA 2RD1A 2WSFE 2MWOA 4JRPA 3FRNA 4FT4A 3HP9A 1VQLT 5CO7A 3OBWA 3SWNA 2DZCA 2R5AA 2JOYA 3G4SA 2ZPGB 4LDWA 4XAXB 3EAEA 3M53A 2Y4YA 1M1KC 4A4KA 3GOXA 1SSFA 1U1TA 2D0QB 1UGPB 3OS5A 4XTXA 2DTHA 3PTAA 2XIDA 4R56A 5CKBA 2QQRA 3NTIA 3MEWA 4DA4A 1S72A 1VQ5A 4OF1A 4M7AA 4J7FA 4RMOA 5FU7C 5GAN4 2D9TA 1Q82C 1VQ5T 3OMGA 1WNLA 1WJRA 4CI0C 1M8VA 1RI0A 2EWNA 3HRTA 3JCMf 5J3BA 1XTDA 4RG2A 2EJFA 3DLMA 2RM4A 5CR2A 1DJ7B 4TVRA 1U8RA 4PLLA 3OA6A 4PJOA 3OYHA 4X9DA 2O4XA 3X20B 3J80E 2ZPIB 3JSCA 5LJ3j 4OB0B 2G3RA 1VIFA 2QI2A 3OYKA 4PJOE 3C12A 1Y07A 1WPYA 4EMKC 1QVPA 4F7UF 5I21A 1KQ1A 3N5BB 2HAXA 2XDPA 3V8JA 3QUIA 4C92B 1VQPA 1NJIU 3LYIA 3E1SA 1VQ8T 2RK1A 4XU0A 4RCCA 4RKUE 2QEXA 1D3BA 3JCMW 4M75G 4M7DC 3CCQA 2L8DA 3CMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X01 A;  5GAN h;  1I81 A;  3QSU A;  4RCB A;  2DXT A;  3L2Z A;  4M78 E;  4XU3 A;  1KQ2 A;  1TH7 A;  2DVE A;  1LOJ A;  2K57 A;  4M7D E;  4C8Q D;  5GAO q;  1BIB A;  3EFR A;  5LJ5 g;  4EMH A;  4M78 A;  4PJO D;  3JCM J;  4HT9 A;  4XU1 A;  4OP0 A;  4C92 F;  4A53 A;  1YCY A;  2RA2 A;  4M77 F;  3RKX A;  3JCM h;  4PJO C;  5GAM e;  5LJ5 d;  4JRI A;  4J6W A;  4M77 D;  4C92 G;  1I5L A;  3JB9 H;  4XTZ A;  4F7U B;  5GMK j;  3JCM X;  4M75 B;  4HT8 A;  1WQ7 A;  1MGQ A;  5LJ5 e;  1D3B B;  3QHS A;  3JB9 I;  1JRI A;  5GAN g;  4XTV A;  2EJG A;  3FIF A;  4C8Q C;  4NOY A;  3JCM e;  3JCM Q;  5GAN 7;  1I8F A;  3JB9 F;  2FYK A;  2VXE A;  4XTU A;  4M7A B;  1B34 A;  3V8L A;  4M77 G;  3SWN B;  2E1H A;  1WQW A;  4M75 A;  2I2L A;  2DTO A;  4C92 E;  5GAO m;  5LJ3 d;  4QVC A;  4M78 C;  1LNX A;  3RKW A;  1N9S A;  3SB2 A;  4C8Q E;  2VXF A;  5GAN f;  2JN0 A;  3FB9 A;  2EJ9 A;  4M7D D;  4NL2 A;  5LJ3 e;  3JB9 D;  3RER A;  4PNO A;  3V7R A;  4JRK A;  3AHU A;  4M7D B;  4M78 G;  4C8Q A;  4M75 F;  3JCM g;  5GAO p;  5GAO n;  4M75 D;  3V7C A;  4XTW A;  2YHT A;  4JLI A;  3BY7 A;  3HFN A;  1U1S A;  4M7A D;  2DKG A;  4M77 B;  4M7D F;  2DEQ A;  1I4K 1;  2E65 A;  3VU3 C;  4M7D G;  4M7A C;  4M7A G;  4M78 B;  1BIA A;  4F7U E;  4PJO F;  1HXD A;  4C8Q G;  3QO3 A;  3BW1 A;  2DJZ A;  5GAM j;  5GAN j;  2DZ9 A;  3RIR A;  3SWN C;  4J6Y A;  4HA8 A;  4XTY A;  3BDU A;  5GAN 6;  4V2S A;  1HK9 A;  4EMK B;  1M5Q 1;  4M77 A;  3GIB A;  4XQ3 A;  4F7U G;  4C92 C;  4M7A E;  4PJO G;  4C8Q F;  3RKY A;  5LJ5 f;  2EAY A;  3INZ A;  4PJO B;  4M75 E;  4N0A C;  4J6X A;  5GAN 5;  5LJ3 h;  1LJO A;  2RD1 A;  2Y90 A;  5CAI A;  5GMK m;  3JCM b;  4JUV A;  2YLC A;  3V7S A;  3V8K A;  2VC8 A;  3RUX A;  2E64 A;  5DY9 A;  4EMK A;  2DXU A;  3SWN A;  4M77 C;  2DZC A;  4F7U A;  4X9C A;  5GAM h;  4Y91 A;  1Y96 A;  1N9R A;  5GMK l;  1Y96 B;  2CGH A;  3M4G A;  3RES A;  5GAM d;  1U1T A;  4C92 D;  2RB6 A;  4XTX A;  2DTH A;  4EMG A;  1JBM A;  2DTI A;  5LJ5 j;  5GAN 3;  4DQ2 A;  3JCM V;  4M7D A;  2ZGW A;  2YLB A;  4M7A A;  5GAM g;  1B34 B;  4MMK A;  3L1A A;  5GAN 2;  5GAN 8;  5GAN 4;  5LJ5 h;  3FJP A;  4NL3 A;  5LJ3 g;  1WNL A;  4N0A A;  1M8V A;  2EWN A;  2QTX A;  4M7A F;  3JCM f;  3JB9 G;  3EFS A;  4A54 A;  5GMK h;  2EJF A;  4WF2 A;  2RM4 A;  4M78 F;  4C92 A;  4PJO A;  4M77 E;  4X9D A;  2E41 A;  1H64 1;  3JCM d;  2E10 A;  5LJ3 j;  5GAN d;  3HFO A;  3JB9 J;  2FB7 A;  4PJO E;  5GAO r;  4XU2 A;  5LJ3 f;  1WPY A;  4EMK C;  4F7U F;  5I21 A;  5GMK i;  1KQ1 A;  3JCM c;  5GAN e;  3PGG A;  4M75 C;  3V8J A;  4MML A;  4QVD A;  3QUI A;  4C92 B;  4M78 D;  5GMK e;  3BFM A;  5GAM f;  5GAO l;  4XU0 A;  3HSB A;  4RCC A;  1D3B A;  3JCM W;  4C8Q B;  4M75 G;  4M7D C;  2HNI A;  4J5Y A;  3JCM P; 
#chains in the Genus database with same CATH topology
 1QCN A;  3QPH A;  2M1H A;  1I81 A;  3L2Z A;  1UDL A;  4XU3 A;  3LLR A;  4OMO A;  2RQW A;  2YUN A;  1PSF A;  2KNB B;  1ZUY A;  3OYL A;  1SPK A;  2NYS A;  1Q86 U;  2MK5 A;  2C0T A;  1ABQ A;  1VQO Q;  1UG1 A;  2B86 A;  2LRQ A;  1VQM A;  1Q7Y R;  2EPD A;  2LQK A;  4XTU A;  2FO0 A;  1YIT A;  3O8V A;  2CP5 A;  5GAO m;  1UTI A;  3A5Z B;  2JZ2 A;  3KXT A;  1EX4 A;  3FB9 A;  1T0H A;  1YWP A;  2ZPE B;  4ZGD B;  2L0A A;  2O2O A;  4JRK A;  5CKH A;  1LPL A;  5GAO p;  1Y7X A;  2FEI A;  3H0H A;  2KMT A;  1WFW A;  3VU3 C;  4M7A C;  2YSQ A;  1AOJ A;  2V8J A;  5CKF A;  4FM4 B;  4KGX B;  3EFO B;  1VYV A;  1WJQ A;  4BB7 A;  4C5E A;  4XTY A;  2DIG A;  1MV3 A;  4XQ3 A;  1YJ9 T;  1ABO A;  1VQ6 A;  3RKY A;  1C6V X;  2A37 A;  2X4X A;  4QQ6 A;  3U23 A;  1GFC A;  1OZ2 A;  1FX7 A;  1V29 B;  2VB6 A;  1VQ9 A;  4FU6 A;  2IG0 A;  1ZLM A;  5GAM h;  2ZPF B;  3MET A;  4E47 A;  3QII A;  4ZTF A;  2K3X A;  4Y28 E;  3LH0 A;  3LGL A;  4KGV B;  1Y0M A;  1D1A A;  2OAW A;  1NM7 A;  3LH5 A;  1VQ7 T;  1QMC A;  5FLX E;  2R58 A;  3JV3 A;  3OSS C;  3ZFJ A;  2K2M A;  4WF2 A;  4C92 A;  1IGU A;  4RTZ A;  2LC4 A;  4OMP A;  4D8K A;  2PZ1 A;  3QKJ A;  2NUT B;  3PGG A;  3S3N A;  4QVD A;  2C0O A;  2E12 A;  2KK4 A;  2OAU A;  3M0S A;  4AFQ C;  3QBY A;  4F16 A;  3CPW P;  1QVF S;  4K11 A;  4OMM A;  1N8R C;  2ZPB B;  1H8K A;  3QZ9 B;  4E7S A;  3H0F A;  7AT1 B;  3TRE A;  2DFU A;  2ESW A;  2RI5 A;  1MGQ A;  1VQO A;  3ZL7 C;  2EYW A;  1B3Q A;  1NZ9 A;  1AWO A;  2FYK A;  2KR3 A;  3ZBD A;  1VQ6 T;  4M75 A;  4HVW A;  2GFU A;  1QCF A;  2KRO A;  4HXJ A;  3X28 B;  2EJ9 A;  3M9Q A;  4M7D D;  5I11 A;  3GF5 A;  2EQU A;  4MDX A;  2M0O A;  2QA4 A;  2L89 A;  1K0X A;  1VQL A;  2J6F A;  2MWP A;  4J9B A;  4M7A D;  1VIE A;  4M7D F;  2MCN A;  2FHD A;  2OX7 A;  1KG1 A;  4J9D A;  3H6Z A;  2RH2 A;  5DM7 R;  2K79 A;  1QP3 A;  2EGE A;  2GFA A;  5A0G A;  1X27 A;  1M2V A;  3H9N A;  4F14 A;  2XK0 A;  4C0G A;  3RUX A;  3LW5 E;  4EMK A;  4M77 C;  1M2O A;  3HKS A;  1BI1 A;  3C94 A;  4IUR A;  2BE9 B;  2LNV A;  2QQB A;  4HCZ A;  4EMG A;  2DVJ A;  3J7A F;  1Q7Y C;  1M27 C;  4MMK A;  4LN2 A;  2HCK A;  3EFS A;  5GMK h;  5KCO A;  2K5F A;  2GF7 A;  2BZY A;  3FEO A;  4RTU A;  3SHW A;  1K73 R;  1UGQ B;  1VQO T;  1YJ9 A;  2Y4X A;  1RAG B;  2DLP A;  3L2U A;  2MAM A;  4DBR A;  2DD5 A;  3M0P A;  2BZ8 A;  2CH4 A;  2AZS A;  1RAH B;  2F5T X;  3WVD B;  5J39 A;  4PFZ A;  1SRM A;  3OYY A;  4JRQ A;  3THK A;  2L3P A;  1GBQ A;  2YUO A;  4NOY A;  3VJP A;  3OS0 A;  5LL6 S;  2X4J A;  1QVF A;  1F1B B;  2E3H A;  1FYN A;  1NBE B;  2KDS A;  3RKW A;  3SB2 A;  2MYS A;  2VXF A;  2E6Z A;  3L42 A;  1KD1 R;  1VA7 A;  1C1A A;  1O9S A;  2LZ6 B;  3GPL A;  5KH6 A;  3M58 A;  3MP8 A;  3RMQ A;  3OS1 A;  1ZA2 B;  3VS7 A;  1JEG A;  1OU8 A;  2DEQ A;  1I4K 1;  5KYU B;  3SWN C;  3I56 T;  4CC3 A;  5GAN 6;  4LDY A;  1YCS B;  1A0N B;  4JPB W;  1OEB A;  2LQ8 A;  4C8Q F;  2GQI A;  2AZV A;  2WSE E;  3VS0 A;  3EH2 A;  2F1L A;  2HZY A;  1T3S A;  4J9G A;  3VUB A;  2DL8 A;  1PHT A;  1MMG A;  1UFF A;  2QGF B;  1Q81 C;  1JBM A;  1XOV A;  1M1K R;  5IT9 E;  3FDR A;  3OYE A;  1WA7 A;  2P0Q A;  4M7A F;  3CCR A;  3ULR B;  2QAZ A;  4M78 F;  5I2S A;  2PVG B;  4M77 E;  1PM3 A;  4EDU A;  2JJ9 A;  2KYM A;  4A4E A;  4KH1 B;  4RUG A;  1AZE A;  1CKA A;  2LX9 A;  4M75 C;  4A63 B;  2O01 E;  4M78 D;  2D8J A;  2X3X D;  4ANJ A;  2J7I A;  5D6W A;  2F2V A;  5GAO q;  1RUW A;  2J05 A;  2HSE B;  1KHC A;  3CCE T;  4PJO D;  4M77 F;  1GCQ A;  3MO8 A;  1WHK A;  2DE0 X;  4XTZ A;  1YI2 Q;  4GBQ A;  1KC8 R;  1S1N A;  3CQT A;  1YJW T;  1PC0 A;  4LNP A;  3EFO A;  3JB9 F;  3G7Z A;  2OTJ Q;  4QKU A;  2K4Y A;  1YBY A;  2KQW A;  3UDC A;  4OB1 B;  2QK0 A;  5FW9 A;  1K4U S;  2F2X A;  4BE0 A;  3JB9 D;  2V1Q A;  2W0Z A;  1UE9 A;  4M7D B;  2JS2 A;  4M78 G;  4E7K A;  1VQK Q;  1N8R U;  1RAI B;  2DKG A;  5FRO A;  2PU9 B;  1QLY A;  1HXD A;  1HYO A;  1JXO A;  2DPP B;  1TXQ A;  4JLG A;  3OYF A;  2XG8 D;  2DX1 A;  2PNI A;  4OGC A;  4N0A C;  3VS1 A;  4B9W A;  2RD1 A;  1W70 A;  2HDA A;  1RLQ C;  3FRN A;  3RR6 A;  1VQ8 Q;  1OPL A;  3OBW A;  2R5A A;  3RDV A;  2DL7 A;  2Y4Y A;  1U1T A;  1IO6 A;  4XTX A;  2DTH A;  2FRY A;  4R56 A;  4OML A;  3NTI A;  5CKB A;  2EYX A;  1TU0 B;  4DA4 A;  2BE7 D;  4RMO A;  1LVK A;  5FU7 C;  3OMG A;  1WNL A;  3VS5 A;  2RM4 A;  2LJ3 A;  1DJ7 B;  4X9D A;  1TWB A;  2JT4 A;  3JSC A;  2H3E B;  4AT1 B;  2QI2 A;  4F7U F;  2AKL A;  1KQ1 A;  1H92 A;  4C92 B;  1NJI U;  2RK1 A;  1D0Z A;  1PD1 A;  2XMF A;  2QEX A;  1D3B A;  3JCM W;  1BB9 A;  3EH1 A;  1YHQ A;  1YJW A;  3A1P A;  3EGX B;  5FWC A;  3CCS Q;  2RK2 A;  3OYC A;  1VQ9 Q;  3L2W A;  1MNE A;  1M90 U;  4JRI A;  5FU6 C;  4VUB A;  3G4S T;  2HBP A;  1QVG S;  3A8L B;  3JB9 I;  4XTV A;  5AT1 B;  3LWH A;  2LTO A;  1N5Z A;  4E7L A;  3SWN B;  3DKM A;  4Z88 A;  3CC7 T;  4C92 E;  3CCS A;  4M78 C;  2C06 A;  5KYW A;  2DL5 A;  2LQN A;  2QEX T;  2DA9 A;  1VQ8 A;  1RAB B;  3LGF A;  2EKO A;  3P8D A;  2P4R A;  2FPF A;  5M9O A;  4M75 F;  3A8G B;  2ED1 A;  3BY7 A;  4UC4 A;  4MZT A;  2PUO B;  4PJO F;  3OYD A;  2GNC A;  3F70 A;  5CK9 A;  2COZ A;  3BDU A;  1M1G A;  2XU8 A;  2RI3 A;  1PD0 A;  2A3L A;  5I2M A;  2YRV A;  2I0N A;  2QQS A;  3J81 E;  4JUV A;  3KUF A;  1QW1 A;  1YJN T;  1IGQ A;  1WHG A;  2AIR B;  5A2Q E;  1PNJ A;  3RES A;  4FW1 A;  2YT6 A;  1G3S A;  5GAN 3;  1D1C A;  3CME Q;  1B34 B;  4B6M A;  2QEX Q;  3FC3 A;  2BKD N;  1JJ2 P;  2M9U A;  1SF9 A;  1ZSG A;  2WAC A;  4DBH A;  2LT4 A;  4FSS A;  1X6O A;  3M5A A;  4PJL A;  3FJ5 A;  1MUZ A;  1NJI C;  2DRK A;  2A0F B;  1H64 1;  2HL5 C;  2RJC A;  2FB7 A;  2HKQ B;  3EGU A;  3EG0 A;  1M2V B;  3G71 A;  1MMD A;  1R77 A;  3TSW A;  3EHQ A;  1WDX A;  2CDT A;  3OYI A;  2KY9 A;  3MPU B;  1IZ6 A;  3I56 Q;  1X75 C;  1N8R R;  4L59 A;  1Q82 U;  2FZG B;  4EIK A;  4KH0 B;  4HCC A;  1LCK A;  4ESR A;  1VQ4 A;  2YRD A;  1S72 T;  1N6A A;  1JXM A;  1OYX A;  1MMA A;  1UHF A;  3OW2 P;  4M77 G;  2C0I A;  1WQW A;  4Z89 A;  3QJ6 A;  1N27 A;  1Q95 G;  2RI2 A;  4CC2 A;  1TUD A;  1M90 C;  4Z02 A;  3NTK A;  3RER A;  2W10 A;  1OI1 A;  2O4X B;  4GLM A;  1QVG A;  5GJW B;  3T9N A;  2ZZD A;  4RTT A;  2KI7 A;  4LE9 A;  4BAC A;  1M3B A;  4BI4 A;  2DRM A;  4F7U E;  3CCL A;  4LD9 K;  3RBB B;  1M3C A;  2XHC A;  1VQM Q;  2JW4 A;  3P8B B;  1R8O B;  3I35 A;  1UJY A;  4E7Z A;  2DYB A;  2K5I A;  1GFD A;  4X1V A;  3IQL A;  1G2B A;  3M4G A;  4IUP A;  1XJW B;  1OX8 A;  1AEY A;  5A0L A;  1ZX6 A;  2RJF A;  1OU9 A;  3OYJ A;  2YWW A;  5GAN 8;  3CCR Q;  4NL3 A;  2RF0 A;  3CBP A;  4PJM A;  1Z9Q A;  2RQR A;  1E7O A;  1AVZ C;  4BE2 A;  1K9M R;  4N4I A;  3S3M A;  2E10 A;  4PL6 A;  1UHC A;  1ARK A;  3JB9 J;  5FRM A;  3VYH B;  5GAO r;  2AT1 B;  2QQA A;  2X4W A;  5J26 A;  3VS2 A;  2P0K A;  4FT2 A;  2PVO B;  2RHI A;  4E7H A;  4PK4 A;  3P8H A;  1K0S A;  3JRZ A;  4M7D E;  2OTL A;  2DVE A;  3M0T A;  2KYB A;  5L8R E;  1YIT T;  2RHX A;  2HEQ A;  1WIE A;  2FRW A;  1H3H A;  5LJ5 d;  2JUF A;  2JNG A;  3RNJ A;  1NYF A;  4M75 B;  4E7I A;  1OX9 A;  3E19 A;  2VWF A;  4J9F A;  5D6X A;  4C8Q C;  1YNZ A;  5GAN 7;  1Q82 R;  2CRE A;  2L5Q A;  4HKE A;  4LDX A;  1RL2 A;  1BK2 A;  3CBM A;  2O9V A;  1FWZ A;  3UWN A;  3ME9 A;  3TCJ A;  5C0M A;  2O31 A;  2LJ0 A;  2DL3 A;  4JJC A;  1Y71 A;  3CCM Q;  1K8A U;  1VQ4 Q;  3CBO A;  4M78 B;  4M7A G;  2CP0 A;  2DJZ A;  2DZ9 A;  2OTJ A;  1B07 A;  3VS3 A;  3CCJ T;  3I55 T;  2GQV A;  4M7A E;  5KCH A;  3CCU A;  2EAY A;  2Z0W A;  4J6X A;  5LJ3 h;  4ORZ A;  2LCS A;  2VGN A;  2HQX A;  2YLC A;  3V8K A;  4F7U A;  1M8M A;  3KFV A;  3VV0 A;  4FYV B;  1NLO C;  5KYN A;  2NWM A;  5DLO A;  1B7T A;  2CZ6 B;  4M7D A;  3MJX A;  4KGZ B;  5GAM g;  2CUD A;  1PRM C;  4DBQ A;  2HMA A;  3CCU Q;  1GXI E;  3QJY A;  3R6N A;  1BU1 A;  1SSH A;  2X4Y A;  1YN8 A;  3OYB A;  1UGV A;  5GAN d;  4WTO B;  1M90 R;  4HCK A;  1D0Y A;  5LJ3 f;  1WXB A;  4MML A;  4DOW A;  1RAC B;  1G3T A;  1D0X A;  3BFM A;  5GAO l;  3G6E Q;  3HSB A;  3UA7 A;  2LMJ A;  4F17 A;  1ZSZ C;  2E4H A;  1AWW A;  1K8A R;  3CC4 Q;  4A4F A;  1BIB A;  3QYH B;  4AFZ C;  5KYY B;  3KBG A;  1KC8 U;  5LJ5 e;  1V1C A;  1IRX A;  3FIF A;  3CCJ Q;  4GLK A;  1MHN A;  2VXE A;  3L2V A;  4BY6 C;  2RJE A;  2ENM A;  1N9S A;  4E7J A;  1VQN Q;  1J3T A;  2RHU A;  1BI0 A;  2DXC A;  2EYZ A;  4LD6 A;  1I07 A;  1Q86 C;  4XTW A;  4QVZ A;  4JLI A;  4M77 B;  2GCX A;  2LQW A;  3QO3 A;  3RMS A;  1T3L A;  1IHV A;  4LDU A;  4AMC A;  2B8A A;  1RAF B;  2CP3 A;  1M5Q 1;  2IVW A;  5CQY A;  3CD6 T;  4F7U G;  2V1R A;  4PJO G;  5KYX A;  5LJ5 f;  2KSS A;  2XI9 A;  4LXC A;  4PJO B;  1YJN Q;  2DM1 A;  2CZ1 B;  1QKX A;  2WSF E;  4FT4 A;  3G71 Q;  1U5S A;  2M51 A;  2OTL Q;  2D0Q B;  1UGP B;  4PFO A;  3PTA A;  1VQ5 A;  2BTT A;  3MEW A;  5D7U A;  4OF1 A;  5GAN 4;  4J9C A;  1WJR A;  1M8V A;  3HRT A;  3JCM f;  3DLM A;  3OA6 A;  4OB0 B;  4PJO E;  4HVU A;  1WPY A;  1QVP A;  2KXD A;  3QUI A;  3LYI A;  1VQL Q;  3TSZ A;  3CME A;  2GGR A;  4HVV A;  2DMO A;  3DLL A;  2RN8 A;  3M56 A;  2P84 A;  4XU1 A;  4DEX A;  3RKX A;  3JCM h;  2LVM A;  4M77 D;  3QG1 A;  4F7U B;  2K2V A;  2KE9 A;  1BCO A;  1WQ7 A;  1X69 A;  2X51 A;  5GJV B;  2E5K A;  3QHS A;  2JTM A;  2YDL A;  3JCM e;  3CPF A;  1M1F A;  1U06 A;  3CCV T;  3MEA A;  2J6K A;  3QDF A;  1UUE A;  3QWY A;  1VQN A;  2DXB A;  3SDZ A;  2RJD A;  3L2Q A;  4NL2 A;  5LJ3 e;  1K9M C;  3L2R A;  3V7R A;  3AHU A;  5HKC A;  2DET A;  1JU5 C;  4ELY C;  3JCM g;  3CCJ A;  1KIK A;  3OSV A;  4AG1 C;  3QYG B;  3URG A;  2KBT A;  3CCE A;  3EG9 A;  3TU4 K;  3HL8 A;  1HK9 A;  3CCE Q;  3ASK A;  4OMN A;  3DB4 A;  1X43 A;  2E5Q A;  5IHI A;  1MND A;  1RI9 A;  2LCC A;  5GMK m;  2HD0 A;  1YIJ Q;  1FMV A;  4Y92 A;  2RHZ A;  3G6E T;  1SKU B;  1G8X A;  1AD5 A;  3GP8 A;  2JM8 A;  1ZBJ A;  3ER0 A;  1BKB A;  2RO0 A;  1Y96 B;  4C0Z A;  2PTK A;  1ZHI A;  1ZSZ A;  4DQ2 A;  3EG9 B;  5GAN 2;  4IIM A;  4L6V 5;  3FJP A;  2DD4 A;  5LJ3 g;  2FVU A;  4JJB A;  1VQ6 Q;  1HJD A;  1UGR B;  4J8O A;  2DO3 A;  1S72 Q;  2F5K A;  1NJI R;  2QAS A;  2KRN A;  4RTX A;  3H41 A;  5DLQ E;  5GAN e;  6AT1 B;  1QP2 A;  2CSQ A;  1VQ7 Q;  3NGP A;  4PJJ A;  2XDB A;  2K5L A;  3SEM A;  4O5V A;  2DXT A;  2CS7 A;  1LOJ A;  2K57 A;  3M55 A;  1NE8 A;  3MEV A;  4JDS A;  3FLG A;  1K9M U;  2JTE A;  3OMC A;  1X6B A;  3C4S A;  1IHW A;  4JJN K;  1YI2 A;  4M7A B;  3X24 B;  1WXT A;  1RAA B;  1EIF A;  2M0Y A;  2VKN A;  5CQX A;  1OZ3 A;  3HHT B;  5KYW B;  1T0J A;  4J7I A;  2KRS A;  1MMN A;  5L23 A;  4C8Q A;  3PFS A;  4ME7 A;  3I5R A;  4M75 D;  3V7C A;  2QGG A;  5IAY A;  3M4Y A;  1RAD B;  1NPP A;  2MMP A;  2R5M A;  2DJQ A;  4LUE A;  3CCQ T;  1UJ0 A;  2VGM A;  2CUB A;  2WSC E;  1KQS A;  3OW2 S;  3OYG A;  3A8H B;  3V7S A;  2A36 A;  1VQ9 T;  4Y91 A;  1N9R A;  1TOV A;  2J6O A;  2A08 A;  2J06 A;  3OW2 A;  4JJD A;  2DTI A;  5IHN A;  2ZGW A;  1JB0 E;  2QTX A;  1YHQ T;  2L3R A;  1K1Z A;  1SHF A;  3QDR B;  3NTH A;  1U3O A;  5EG2 A;  1XQH A;  4N4G A;  1EZZ B;  1C0M A;  3HFO A;  4BUG A;  4XU2 A;  2JXB A;  2JVV A;  1O75 A;  1SG5 A;  3O5Z A;  4QQG A;  2E6N A;  2DBM A;  2VV5 A;  1KQ2 A;  2H3J A;  1WXU A;  1G5V A;  1Y57 A;  3PMI A;  3JAM E;  1G3W A;  4MZM A;  2KVQ G;  2RA2 A;  3CC2 T;  1FXX A;  1PCX A;  4C92 G;  3CXC A;  4Z8A A;  1K9A A;  1PRL C;  1VQP T;  5FWB A;  2ZPH B;  3HRU A;  3X25 B;  3AT1 B;  2QA4 Q;  2JMA A;  1ACM B;  1UB4 A;  2KGT A;  3OYM A;  2I2L A;  2IIM A;  2QQ9 A;  2ROT A;  4JZ3 A;  2FPD A;  1QWF A;  4QVC A;  3REA B;  1W2B S;  4M4Z A;  1KFZ A;  3REB B;  2PQW A;  5IXB A;  3G6E A;  2ZCF B;  1YWO A;  3OYA A;  2NUT A;  4IKF A;  4ZN3 A;  2V26 A;  1R0C B;  3BW1 A;  1BYM A;  2RHY A;  3RIR A;  5KYY A;  4FSX A;  3UA6 A;  4R55 A;  4OB3 B;  2E3I A;  3GIB A;  3I56 A;  1WHL A;  5CIU A;  2MI6 A;  2KRM A;  2R57 A;  2LX7 A;  2V8K A;  4MZP A;  3JCM b;  4L5G A;  4C0D C;  2DL4 A;  2FZC B;  1QKW A;  2DXU A;  1VQ4 T;  2MOX A;  5GMK l;  5AYF A;  3TVT A;  1IRE B;  1YJ9 Q;  2FG0 A;  3JCM V;  4CC7 A;  2YLB A;  4RTW A;  2DF6 A;  3PVQ A;  2QDL A;  3E9G A;  1M30 A;  2MPX C;  2K3Y A;  2DIL A;  3UF4 A;  4J9I A;  3JB9 G;  2L3Q A;  2KXC A;  1SEM A;  1GCQ C;  2E41 A;  2CZ0 B;  3SD4 A;  1GL5 A;  4LUD A;  5GMK i;  1QVG P;  4R0K A;  3PVL A;  1W1F A;  2GBQ A;  4OB2 B;  5GMK e;  1WGS A;  2DEU A;  2EGA A;  3WVE B;  4OGE A;  1UEB A;  2LDM A;  2V8I A;  4M78 E;  3CXC P;  3CCV Q;  2XKO C;  3EFR A;  4C5H A;  4DEY A;  1R0B G;  2BUD A;  3GNF B;  4M78 A;  2K3B A;  3SFM A;  1BBZ A;  1NPR A;  4A53 A;  1YCY A;  2ATC B;  3BDL A;  2DK3 A;  4IUT A;  3EG3 A;  1KK7 A;  3I5S A;  5GAN g;  2FZK B;  1TG0 A;  3DB3 A;  3I55 Q;  1B34 A;  2YRC A;  3C95 A;  2SEM A;  1LNX A;  1AT1 B;  3C0C A;  2FPE A;  4C8Q E;  3CCR T;  4J9E A;  2HKN A;  4DOV A;  4PNO A;  5CCA A;  1EFN A;  2QG9 B;  4IUV A;  5KE3 A;  1Q86 R;  2KEA A;  2LP5 A;  2YHT A;  2O88 A;  1AWJ A;  1ZSZ B;  4D8D A;  2E70 A;  3A98 A;  3GLX A;  4EPC A;  1QCO A;  1WYX A;  2CSI A;  2JTF A;  3ZEH A;  4J6Y A;  4J9H A;  2EQI A;  4V2S A;  4C92 C;  5GAN 5;  2MWO A;  2EVR A;  1I0C A;  3G4S A;  2ZPG B;  4LDW A;  4XAX B;  5EC7 A;  3EAE A;  4A4K A;  3GOX A;  1SSF A;  3OS5 A;  2XID A;  1S72 A;  2QQR A;  1VOM A;  2D9T A;  2RPN A;  1D09 B;  1Q82 C;  3EGD A;  2RQU A;  4CI0 C;  5J3B A;  1XTD A;  3VS4 A;  1WZO A;  2EJF A;  2K6D A;  5CR2 A;  1K76 A;  2GTO A;  4JZ4 A;  3OYH A;  2O4X A;  2ZPI B;  1VIF A;  3OYK A;  3C12 A;  5I21 A;  3N5B B;  2XDP A;  4AFU C;  3V8J A;  5IXF A;  1QQJ A;  1NEB A;  1VQP A;  4F04 B;  3E1S A;  1VQ8 T;  4RCC A;  4M75 G;  2L8D A;  5IN1 A;  2CT3 A;  2EW3 A;  3CEY A;  3M0R A;  1HD3 A;  3S6W A;  5C6S A;  4OMF B;  1KD1 U;  2D6F A;  5GAN h;  4ZGJ B;  1WI7 A;  2EBP A;  4B9X A;  1X6G A;  8ATC B;  4PLI A;  4OMQ A;  3D7S B;  3JCM J;  4HT9 A;  4KUI A;  1E6H A;  5GAM e;  3JB9 H;  4C5I A;  1VQK T;  1VQM T;  4J83 A;  2F69 A;  1Q81 R;  4BDZ A;  4BY6 B;  1OUL A;  3VRZ A;  1VUB A;  2OI3 A;  3TEE A;  5GAN f;  2JN0 A;  2DER A;  5CVI A;  1K73 C;  4ZNX A;  2ECZ A;  1ZUU A;  1YJW Q;  4ZGE B;  5GAO n;  2VAS A;  1PWT A;  4YTL A;  2CYZ B;  1FMW A;  2DYI A;  1NYG A;  4RG8 A;  2EIF A;  1JO8 A;  3LX7 A;  1YIJ T;  1NEG A;  3G1J A;  3OQ5 A;  3R6O A;  2BIV A;  3NPF A;  1AHJ B;  1WHJ A;  2FL7 A;  1LJO A;  2Y90 A;  4C5G A;  5CAI A;  2EYY A;  2ZAE A;  1JJ2 A;  4A4G A;  3PT9 A;  5DY9 A;  2K9G A;  2KT8 A;  3NFC A;  1TUG B;  3UT1 A;  2DIQ A;  4FW2 A;  3PE0 A;  3EHR A;  4C92 D;  2RB6 A;  3M0Q A;  5LJ5 j;  1YIJ A;  1KC8 C;  1M1K U;  4ZN1 A;  1M3A A;  3L1A A;  5LJ5 h;  1CKB A;  1ZBX A;  1TSF A;  4N0A A;  1KD1 C;  2K7A A;  2AHJ B;  4A54 A;  4BI8 B;  3CC7 Q;  4JS4 A;  1GBR A;  3CCM T;  4BD3 A;  4KUD K;  2CP6 A;  4E6R A;  4C0F A;  3CC2 A;  3CC4 A;  3G4S Q;  2COY A;  4KT0 E;  5GAM f;  1W2B P;  1TS9 A;  2HNI A;  1X01 A;  5HK3 A;  2RMO A;  5IH2 A;  3QSU A;  4IUQ A;  1TH7 A;  2EQM A;  2L2P A;  3CME T;  2QA4 T;  2PUK B;  1BCM A;  4EMH A;  2LT1 A;  3QWX X;  1SRL A;  1WJS A;  4OP0 A;  1K73 U;  3A8M B;  2VUB A;  1QWE A;  4J6W A;  1I5L A;  3GBQ A;  8AT1 B;  3S3O A;  2JMC A;  1WLP B;  1OOT A;  4HT8 A;  1AZG B;  2LJ1 A;  1D3B B;  3CC4 T;  3V8L A;  4KBM B;  3H0I A;  1GCP A;  1VQK A;  3QZ5 B;  5CKD A;  3CD6 A;  1E6G A;  4BI3 A;  1NG2 A;  5FU7 B;  3MEU A;  2QTV A;  1VQP Q;  3CCL T;  1HSQ A;  3MP1 A;  2E65 A;  1KQS P;  4X34 A;  3G71 T;  1JQQ A;  2CH4 W;  4FYY B;  5GAN j;  2IPO B;  3VS6 A;  1YIT Q;  2XD0 A;  1RLP C;  2YUQ A;  1IXD A;  3PNW C;  1KHI A;  2P0P A;  1GRI A;  4M77 A;  4IIO A;  3OBY A;  1I1J A;  3CCM A;  1NLP C;  2HQH A;  1W4S A;  1ZQ1 A;  2VC8 A;  2E64 A;  2QYZ A;  3QXE B;  3EGX A;  4X9C A;  5KYX B;  1Y96 A;  2M02 A;  1G3Y A;  1SHG A;  2NUP B;  4ZTJ A;  3LWI A;  2NUP A;  2NLU A;  2EQJ A;  1YHQ Q;  1W2B A;  3CCQ Q;  2HBW A;  3EG1 A;  4NS5 A;  4QW2 A;  1TTH B;  1YJN A;  4C0D B;  5A0D A;  1Z9Z A;  1Q7Y U;  2YUP A;  2LNH B;  2DAQ A;  1OPK A;  3CPW S;  3BE3 A;  4PKC C;  1PKT A;  3JCM d;  3MHX A;  4BDY A;  3CMA Q;  3JCM c;  5I22 A;  3OB9 A;  3CPW A;  3OY9 A;  1PG5 B;  4C8Q B;  4FCY A;  2AKK A;  2DBK A;  1VQ5 Q;  2D1X A;  2CT4 A;  9ATC B;  2EKH A;  4D6W A;  4N4H A;  4RCB A;  4E2F B;  5FRN A;  4O6J A;  2KAF A;  2P4T A;  5LJ5 g;  4QT7 A;  5KE2 A;  3X26 B;  4HCB A;  2PVD B;  1AWX A;  2OTL T;  4C92 F;  1K8A C;  3VUZ A;  4PJO C;  2CKK A;  5HCK A;  3CCL Q;  3JCM X;  3NMZ C;  4P5N A;  2ROL A;  1JRI A;  2EJG A;  3MKD A;  3M59 A;  2CZ7 B;  4CRI A;  3MP6 A;  4II1 A;  3CD6 Q;  2E1H A;  1CSK A;  5ECA A;  5LJ3 d;  3VRY A;  4OVA A;  1TUC A;  3EG2 A;  1WX6 A;  4IUU A;  2D8H A;  2KT1 A;  3CMA T;  1PKS A;  1W6X A;  2M16 A;  2VYT A;  1M9S A;  3OS2 A;  4MDW A;  4DBF A;  3Q1J A;  2EQK A;  1KQS S;  2EGC A;  3PMT A;  3OYN A;  1D1B A;  5CKE A;  4M7D G;  2F2W A;  4FL6 A;  4KRT A;  1BIA A;  4QQD A;  4LDV A;  3I55 A;  4HA8 A;  2COW A;  2JM9 A;  4EMK B;  3HTR A;  2OTJ T;  1UGS B;  3INZ A;  4M75 E;  3UPU A;  1VYT A;  2H8H A;  4BE1 A;  1YI2 T;  1OQK A;  2A28 A;  3PIO A;  2BZX A;  1KJW A;  3VKI A;  1P92 A;  2CP2 A;  2ABL A;  3A8O B;  3CCV A;  1VYU A;  2CGH A;  5GAM d;  2HL3 A;  2SRC A;  4CC4 B;  3CMA A;  3M57 A;  1Q81 U;  2X35 A;  2EYQ A;  2D0N A;  1VQN T;  1OV3 A;  5D6Y A;  2YXY A;  5HK0 A;  3CC7 A;  4XK8 E;  2VVK A;  2DNU A;  2X3W D;  4KUL A;  5HY6 A;  1YFN A;  2CP7 A;  1X2Q A;  2OJ2 A;  3H8Z A;  2A7Y A;  2XIC A;  2ED0 A;  3PIP A;  4Q5W A;  2L3S A;  3CCU T;  3GNG A;  2LCL A;  4J5Y A;  3JCM P;  1ZA1 B;  1VQ7 A;  4FYX B;  4GY5 A;  2EFI A;  4C8Q D;  5KYU A;  2QXF A;  4FYW B;  3M54 A;  5GMK j;  4AG2 C;  1QVF P;  4JS5 A;  3EGD B;  3M0U A;  3VYG A;  3E2U A;  3HRS A;  1PSE A;  1UEC A;  3I9Q A;  3JCM Q;  1BI3 A;  1I8F A;  4ELZ C;  4FIB A;  2MF2 A;  3WXM B;  2DTO A;  1ZUK A;  2AK5 A;  2HQE A;  1BI2 A;  3MCA B;  2QDY B;  1H3Z A;  5FU6 B;  4WCI A;  3HPW A;  4ATO A;  4A4H A;  3E9F A;  2RNA A;  3HFN A;  1U1S A;  3CXC S;  2HSP A;  1JJ2 S;  4C8Q G;  5GAM j;  2RQV A;  2XDD A;  1XNI A;  3NHN A;  3CCS T;  1M4Z A;  2X9H A;  4AFS C;  2RQT A;  2G6F X;  4RTV A;  1RAE B;  4PFP A;  4JRP A;  3HP9 A;  1VQL T;  5CO7 A;  1I5O B;  3SWN A;  1X2K A;  2DZC A;  2JOY A;  1KSW A;  2NUZ A;  3M53 A;  3CC2 Q;  1M1K C;  1WHH A;  1YP5 A;  2GTJ A;  1V76 A;  3TQ7 P;  4PJN A;  4M7A A;  4J7F A;  4RTY A;  1VQ5 T;  1MV0 B;  1RI0 A;  2EWN A;  4RG2 A;  5IHK A;  1U8R A;  4TVR A;  1IB8 A;  4PLL A;  4PJO A;  3X20 B;  3J80 E;  1G83 A;  5LJ3 j;  2G3R A;  3UAT A;  1Y07 A;  4EMK C;  2HAX A;  2O9S A;  1FMK A;  2MIO A;  2JS0 A;  4XU0 A;  4RKU E;  4M7D C;  3CCQ A;  1WHM A; 
#chains in the Genus database with same CATH homology
 1YHQ A;  5C6S A;  3CEY A;  3QPH A;  3S6W A;  2M1H A;  1YJW A;  4OMF B;  1KD1 U;  2D6F A;  5GAN h;  1I81 A;  4ZGJ B;  3L2Z A;  4XU3 A;  3DLL A;  3LLR A;  4B9X A;  3M56 A;  1PSF A;  2RK2 A;  4PLI A;  3OYC A;  3JCM J;  4HT9 A;  4XU1 A;  3L2W A;  4KUI A;  3RKX A;  3JCM h;  1M90 U;  5GAM e;  2LVM A;  4JRI A;  4M77 D;  3OYL A;  3JB9 H;  5FU6 C;  3QG1 A;  4F7U B;  1Q86 U;  2K2V A;  4VUB A;  3G4S T;  1WQ7 A;  2HBP A;  4C5I A;  1QVG S;  3A8L B;  3QHS A;  3JB9 I;  1VQK T;  2JTM A;  2LRQ A;  4XTV A;  3JCM e;  1VQM A;  1VQM T;  4J83 A;  2F69 A;  2LQK A;  3CPF A;  3LWH A;  1M1F A;  2LTO A;  4XTU A;  3CCV T;  1YIT A;  3MEA A;  4BDZ A;  3O8V A;  4E7L A;  4BY6 B;  3SWN B;  3DKM A;  3CC7 T;  5GAO m;  1VUB A;  4C92 E;  3A5Z B;  3CCS A;  4M78 C;  2C06 A;  3TEE A;  2JZ2 A;  2DXB A;  3KXT A;  1VQN A;  3SDZ A;  2JN0 A;  2RJD A;  3FB9 A;  5GAN f;  3L2Q A;  4NL2 A;  5CVI A;  5LJ3 e;  2QEX T;  1K73 C;  1K9M C;  2ZPE B;  1VQ8 A;  3L2R A;  3V7R A;  4ZGD B;  3LGF A;  4JRK A;  3AHU A;  2EKO A;  3P8D A;  5HKC A;  5CKH A;  4ELY C;  5M9O A;  4M75 F;  3JCM g;  4ZGE B;  3CCJ A;  3A8G B;  5GAO p;  1Y7X A;  5GAO n;  3OSV A;  3BY7 A;  4UC4 A;  2KMT A;  4YTL A;  2CYZ B;  3QYG B;  3URG A;  3VU3 C;  3CCE A;  4RG8 A;  4M7A C;  4MZT A;  2PUO B;  2EIF A;  2V8J A;  3LX7 A;  4PJO F;  1YIJ T;  3OYD A;  5CKF A;  4FM4 B;  3F70 A;  4C5E A;  4BB7 A;  1WJQ A;  5CK9 A;  3TU4 K;  3HL8 A;  3OQ5 A;  3BDU A;  3R6O A;  2DIG A;  4XTY A;  1HK9 A;  1M1G A;  3ASK A;  3DB4 A;  2XU8 A;  4XQ3 A;  2BIV A;  1YJ9 T;  1VQ6 A;  2RI3 A;  2E5Q A;  1AHJ B;  2A3L A;  3RKY A;  5I2M A;  2YRV A;  2X4X A;  4QQ6 A;  2QQS A;  2FL7 A;  1OZ2 A;  2LCC A;  1LJO A;  1FX7 A;  2Y90 A;  4C5G A;  1V29 B;  2HD0 A;  5CAI A;  4JUV A;  5GMK m;  3J81 E;  3KUF A;  1JJ2 A;  2RHZ A;  4A4G A;  1QW1 A;  3PT9 A;  2IG0 A;  4FU6 A;  5DY9 A;  3G6E T;  5GAM h;  2ZPF B;  3MET A;  3GP8 A;  1YJN T;  4E47 A;  3NFC A;  3QII A;  3ER0 A;  3UT1 A;  1BKB A;  2RO0 A;  5A2Q E;  1Y96 B;  4ZTF A;  2DIQ A;  2K3X A;  3RES A;  4C0Z A;  4C92 D;  2RB6 A;  4Y28 E;  3JB9 F;  1G3S A;  1ZHI A;  3LH0 A;  3LGL A;  4DQ2 A;  5LJ5 j;  5GAN 3;  1YIJ A;  1KC8 C;  1B34 B;  1VQ9 A;  1M1K U;  4ZN1 A;  3L1A A;  5GAN 2;  4L6V 5;  5LJ5 h;  3FC3 A;  3FJP A;  2DD4 A;  1VQ7 T;  1ZBX A;  2BKD N;  2FVU A;  2M9U A;  5FLX E;  2R58 A;  4N0A A;  5LJ3 g;  1KD1 C;  1UGR B;  2AHJ B;  2WAC A;  3OSS C;  2LT4 A;  3ZFJ A;  4A54 A;  4BI8 B;  1X6O A;  4WF2 A;  3M5A A;  4JS4 A;  4C92 A;  4J8O A;  2DO3 A;  1NJI C;  3CCM T;  2LC4 A;  4BD3 A;  1H64 1;  2F5K A;  2RJC A;  4KUD K;  2FB7 A;  5DLQ E;  3QKJ A;  5GAN e;  1QP2 A;  3PGG A;  4C0F A;  3S3N A;  3CC2 A;  4QVD A;  3CC4 A;  2E12 A;  2KK4 A;  4KT0 E;  5GAM f;  2OAU A;  3G71 A;  2HNI A;  2XDB A;  2K5L A;  1X01 A;  5HK3 A;  3QSU A;  3QBY A;  4IUQ A;  2DXT A;  4O5V A;  3OYI A;  2CS7 A;  2KY9 A;  1TH7 A;  2EQM A;  1LOJ A;  2K57 A;  3CME T;  1IZ6 A;  3M55 A;  2PUK B;  1NE8 A;  2QA4 T;  4EMH A;  2LT1 A;  3MEV A;  4JDS A;  1QVF S;  1X75 C;  3FLG A;  1WJS A;  4OP0 A;  4L59 A;  1K73 U;  1K9M U;  3OMC A;  3A8M B;  2VUB A;  2ZPB B;  1Q82 U;  1N8R C;  4J6W A;  3QZ9 B;  1I5L A;  3S3O A;  4HCC A;  3TRE A;  3C4S A;  1VQ4 A;  4HT8 A;  2RI5 A;  1MGQ A;  1VQO A;  1S72 T;  1D3B B;  1N6A A;  3CC4 T;  4JJN K;  1NZ9 A;  1OYX A;  1YI2 A;  2FYK A;  4M7A B;  3X24 B;  3ZBD A;  3V8L A;  4M77 G;  1EIF A;  1VQ6 T;  1WQW A;  4M75 A;  5CQX A;  4KBM B;  1OZ3 A;  3HHT B;  3QJ6 A;  1N27 A;  2GFU A;  2RI2 A;  3X28 B;  1M90 C;  2EJ9 A;  3M9Q A;  5IN1 A;  1VQK A;  4Z02 A;  4M7D D;  3GF5 A;  3NTK A;  3RER A;  3QZ5 B;  5CKD A;  4J7I A;  2EQU A;  3CD6 A;  1OI1 A;  4MDX A;  4C8Q A;  2M0O A;  2O4X B;  3PFS A;  2QA4 A;  4BI3 A;  1QVG A;  5FU7 B;  2L89 A;  4ME7 A;  2ZZD A;  3MEU A;  4M75 D;  2MWP A;  3T9N A;  3V7C A;  1VQL A;  5IAY A;  4M7A D;  4BAC A;  1VIE A;  3CCL T;  4M7D F;  3M4Y A;  3MP1 A;  4BI4 A;  2FHD A;  1NPP A;  2E65 A;  2MMP A;  2R5M A;  4X34 A;  3G71 T;  4F7U E;  5GAN j;  3CCL A;  1KG1 A;  4LD9 K;  3H6Z A;  2RH2 A;  2XD0 A;  2XHC A;  3PNW C;  1KHI A;  2P0P A;  5DM7 R;  4M77 A;  3CCQ T;  1QP3 A;  3P8B B;  1R8O B;  2GFA A;  3OBY A;  3CCM A;  5A0G A;  2VGM A;  2WSC E;  1KQS A;  3OW2 S;  1W4S A;  3OYG A;  2XK0 A;  3A8H B;  3V7S A;  1ZQ1 A;  2VC8 A;  4C0G A;  3RUX A;  2E64 A;  3LW5 E;  2K5I A;  4EMK A;  1VQ9 T;  4M77 C;  3QXE B;  4X9C A;  4Y91 A;  1Y96 A;  3HKS A;  1N9R A;  1BI1 A;  1G3Y A;  3C94 A;  3M4G A;  4IUR A;  4IUP A;  2LNV A;  2QQB A;  4ZTJ A;  3LWI A;  4HCZ A;  2NLU A;  4EMG A;  3OW2 A;  2DTI A;  2EQJ A;  1W2B A;  5A0L A;  3J7A F;  1Q7Y C;  2ZGW A;  2RJF A;  3OYJ A;  4NS5 A;  4MMK A;  4QW2 A;  5GAN 8;  1YJN A;  4C0D B;  5A0D A;  4NL3 A;  1Q7Y U;  1JB0 E;  3CBP A;  2QTX A;  2DAQ A;  1YHQ T;  3EFS A;  2L3R A;  5GMK h;  5KCO A;  3CPW S;  2K5F A;  2GF7 A;  3FEO A;  3NTH A;  3QDR B;  4BE2 A;  1UGQ B;  4N4I A;  4PKC C;  3S3M A;  1VQO T;  5EG2 A;  1YJ9 A;  3JCM d;  1XQH A;  2E10 A;  4N4G A;  3MHX A;  4PL6 A;  3HFO A;  4BDY A;  3JB9 J;  3VYH B;  5FRM A;  4BUG A;  5GAO r;  4XU2 A;  2Y4X A;  3JCM c;  2QQA A;  3OB9 A;  2X4W A;  5J26 A;  3CPW A;  2P0K A;  4FT2 A;  3OY9 A;  2JVV A;  1O75 A;  2PVO B;  2RHI A;  4E7H A;  4C8Q B;  3L2U A;  2MAM A;  4QQG A;  3P8H A;  2E6N A;  2DD5 A;  4D6W A;  2VV5 A;  4N4H A;  4RCB A;  3JRZ A;  4M7D E;  5FRN A;  1KQ2 A;  2OTL A;  2DVE A;  2F5T X;  2H3J A;  2KAF A;  2P4T A;  4O6J A;  2RHX A;  5L8R E;  1YIT T;  1G5V A;  5LJ5 g;  3PMI A;  5KE2 A;  3JAM E;  1G3W A;  3X26 B;  4MZM A;  3WVD B;  2KVQ G;  2PVD B;  4HCB A;  5J39 A;  2OTL T;  4C92 F;  1K8A C;  2RA2 A;  3VUZ A;  3CC2 T;  4PJO C;  2CKK A;  5LJ5 d;  1FXX A;  2JUF A;  4C92 G;  2JNG A;  3OYY A;  3CXC A;  4JRQ A;  3JCM X;  4M75 B;  4E7I A;  4P5N A;  3E19 A;  1VQP T;  1JRI A;  2EJG A;  2ZPH B;  3HRU A;  4NOY A;  5D6X A;  3VJP A;  4C8Q C;  3M59 A;  2CZ7 B;  5GAN 7;  3X25 B;  2L5Q A;  4HKE A;  3MP6 A;  4CRI A;  3OS0 A;  4II1 A;  5LL6 S;  4LDX A;  2X4J A;  1UB4 A;  1RL2 A;  1QVF A;  2E1H A;  3OYM A;  2I2L A;  2QQ9 A;  2KDS A;  5LJ3 d;  4OVA A;  3RKW A;  4QVC A;  1W2B S;  3SB2 A;  3CBM A;  2VXF A;  4IUU A;  2E6Z A;  1FWZ A;  3UWN A;  3L42 A;  3ME9 A;  3TCJ A;  3CMA T;  1O9S A;  5C0M A;  2PQW A;  2M16 A;  2VYT A;  3GPL A;  1M9S A;  3OS2 A;  5KH6 A;  4MDW A;  3M58 A;  3MP8 A;  3RMQ A;  3G6E A;  1Y71 A;  2EQK A;  2ZCF B;  3Q1J A;  3OS1 A;  3PMT A;  3OYA A;  1KQS S;  3OYN A;  1K8A U;  2DEQ A;  4IKF A;  1I4K 1;  4M7D G;  5CKE A;  3CBO A;  4M78 B;  4M7A G;  4FL6 A;  4QQD A;  1BIA A;  4ZN3 A;  4LDV A;  3BW1 A;  2DJZ A;  2RHY A;  1BYM A;  2DZ9 A;  3RIR A;  3SWN C;  3I55 A;  4FSX A;  3I56 T;  2OTJ A;  4HA8 A;  5GAN 6;  4R55 A;  3CCJ T;  4OB3 B;  4EMK B;  4LDY A;  3GIB A;  3I55 T;  2GQV A;  3I56 A;  5CIU A;  2OTJ T;  2LQ8 A;  1UGS B;  2MI6 A;  5KCH A;  4C8Q F;  3CCU A;  2R57 A;  4M7A E;  2EAY A;  3INZ A;  2V8K A;  4M75 E;  4BE1 A;  3UPU A;  1YI2 T;  4MZP A;  4J6X A;  5LJ3 h;  3JCM b;  3PIO A;  4L5G A;  4C0D C;  2VGN A;  2HQX A;  2WSE E;  2YLC A;  3V8K A;  3VKI A;  4F7U A;  1P92 A;  2DXU A;  1VQ4 T;  3A8O B;  3VV0 A;  3CCV A;  5GMK l;  2CGH A;  5GAM d;  3VUB A;  3CMA A;  5AYF A;  5DLO A;  3M57 A;  1Q81 C;  1IRE B;  2X35 A;  1JBM A;  1Q81 U;  2EYQ A;  2CZ6 B;  3JCM V;  4M7D A;  2YLB A;  1VQN T;  1XOV A;  5GAM g;  5D6Y A;  5HK0 A;  5IT9 E;  3CC7 A;  1GXI E;  3FDR A;  3QJY A;  3E9G A;  3OYE A;  4XK8 E;  2K3Y A;  2P0Q A;  4M7A F;  3JB9 G;  2X4Y A;  3CCR A;  4KUL A;  4M78 F;  5HY6 A;  5I2S A;  2PVG B;  4M77 E;  3OYB A;  2E41 A;  2CZ0 B;  3SD4 A;  4EDU A;  5GAN d;  4A4E A;  3H8Z A;  2A7Y A;  2XIC A;  5GMK i;  5LJ3 f;  3PIP A;  2LX9 A;  4M75 C;  4Q5W A;  4MML A;  4DOW A;  4OB2 B;  1G3T A;  2O01 E;  4M78 D;  5GMK e;  1WGS A;  3BFM A;  5GAO l;  3WVE B;  3CCU T;  3HSB A;  3GNG A;  2LCL A;  4OGE A;  1UEB A;  2LDM A;  4J5Y A;  3JCM P;  5D6W A;  2V8I A;  1VQ7 A;  4GY5 A;  4M78 E;  2EFI A;  4C8Q D;  5GAO q;  2XKO C;  1BIB A;  3EFR A;  4A4F A;  4C5H A;  1KHC A;  3CCE T;  3GNF B;  2BUD A;  3SFM A;  4M78 A;  4PJO D;  1NPR A;  4A53 A;  1YCY A;  4M77 F;  2QXF A;  3QYH B;  3M54 A;  3MO8 A;  3BDL A;  4XTZ A;  5GMK j;  3KBG A;  2DK3 A;  4IUT A;  1KC8 U;  4JS5 A;  5LJ5 e;  3VYG A;  3HRS A;  1PSE A;  5GAN g;  1YJW T;  3FIF A;  3JCM Q;  1BI3 A;  1I8F A;  3DB3 A;  4GLK A;  4ELZ C;  4FIB A;  1MHN A;  2VXE A;  3G7Z A;  1B34 A;  3L2V A;  4BY6 C;  2K4Y A;  2MF2 A;  3WXM B;  2DTO A;  1YBY A;  2KQW A;  2RJE A;  3C95 A;  3UDC A;  4OB1 B;  2HQE A;  1LNX A;  1N9S A;  4E7J A;  4C8Q E;  1BI2 A;  3CCR T;  3MCA B;  4BE0 A;  2RHU A;  1BI0 A;  3JB9 D;  2QDY B;  4DOV A;  2DXC A;  4PNO A;  5CCA A;  4IUV A;  1H3Z A;  4M7D B;  5KE3 A;  5FU6 B;  4M78 G;  4E7K A;  3HPW A;  4ATO A;  4LD6 A;  4A4H A;  1Q86 C;  4XTW A;  4QVZ A;  2YHT A;  3E9F A;  4JLI A;  3HFN A;  1N8R U;  1U1S A;  3CXC S;  2DKG A;  4M77 B;  5FRO A;  4EPC A;  2E70 A;  3GLX A;  2PU9 B;  1JJ2 S;  2GCX A;  4C8Q G;  1HXD A;  5GAM j;  3QO3 A;  3RMS A;  2JTF A;  3ZEH A;  4J6Y A;  4LDU A;  2XDD A;  2B8A A;  4V2S A;  1XNI A;  3CCS T;  1M5Q 1;  2DPP B;  2IVW A;  1M4Z A;  4JLG A;  5CQY A;  3OYF A;  3CD6 T;  4F7U G;  4C92 C;  2XG8 D;  4PJO G;  5LJ5 f;  4PJO B;  2KSS A;  2XI9 A;  4OGC A;  4N0A C;  2CZ1 B;  5GAN 5;  4B9W A;  2RD1 A;  2WSF E;  2MWO A;  4JRP A;  3FRN A;  4FT4 A;  3HP9 A;  1VQL T;  5CO7 A;  3OBW A;  3SWN A;  2DZC A;  2R5A A;  2JOY A;  3G4S A;  2ZPG B;  4LDW A;  4XAX B;  3EAE A;  3M53 A;  2Y4Y A;  1M1K C;  4A4K A;  3GOX A;  1SSF A;  1U1T A;  2D0Q B;  1UGP B;  3OS5 A;  4XTX A;  2DTH A;  3PTA A;  2XID A;  4R56 A;  5CKB A;  2QQR A;  3NTI A;  3MEW A;  4DA4 A;  1S72 A;  1VQ5 A;  4OF1 A;  4M7A A;  4J7F A;  4RMO A;  5FU7 C;  5GAN 4;  2D9T A;  1Q82 C;  1VQ5 T;  3OMG A;  1WNL A;  1WJR A;  4CI0 C;  1M8V A;  1RI0 A;  2EWN A;  3HRT A;  3JCM f;  5J3B A;  1XTD A;  4RG2 A;  2EJF A;  3DLM A;  2RM4 A;  5CR2 A;  1DJ7 B;  4TVR A;  1U8R A;  4PLL A;  3OA6 A;  4PJO A;  3OYH A;  4X9D A;  2O4X A;  3X20 B;  3J80 E;  2ZPI B;  3JSC A;  5LJ3 j;  4OB0 B;  2G3R A;  1VIF A;  2QI2 A;  3OYK A;  4PJO E;  3C12 A;  1Y07 A;  1WPY A;  4EMK C;  1QVP A;  4F7U F;  5I21 A;  1KQ1 A;  3N5B B;  2HAX A;  2XDP A;  3V8J A;  3QUI A;  4C92 B;  1VQP A;  1NJI U;  3LYI A;  3E1S A;  1VQ8 T;  2RK1 A;  4XU0 A;  4RCC A;  4RKU E;  2QEX A;  1D3B A;  3JCM W;  4M75 G;  4M7D C;  3CCQ A;  2L8D A;  3CME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...