4M7DB

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 18
structure length 92
sequence length 92
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dB00
2DTIA 5GAN5 1B34A 5GAMf 3RERA 4EMKB 5GAN7 3M4GA 2YLCA 3V8LA 3L1AA 2RM4A 5GAN4 2VC8A 4OP0A 4X9DA 4V2SA 2E41A 2E1HA 1TH7A 3GIBA 2RB6A 2DEQA 4XTZA 4C8QC 1I8FA 4RCBA 4C8QG 5GANe 4MMKA 4EMHA 4QVDA 3JB9F 4C8QF 1U1TA 3FIFA 4XQ3A 1WPYA 4JUVA 5GMKl 2Y90A 5LJ5h 4PJOE 3JCMJ 3JCMP 4M78E 2QTXA 3FB9A 4PJOD 3L2ZA 4M78D 3RESA 4F7UG 2I2LA 3HSBA 1I5LA 3SWNB 5GAMd 5LJ3e 5GAOq 5LJ5f 3RKXA 4M77A 5CAIA 4PJOA 4NL2A 3BDUA 4M78A 4M77C 1MGQA 4M77G 4HA8A 1HK9A 3SB2A 4C8QE 5GAMj 4M78C 4M78G 4XTYA 4M77F 4C8QD 2DTHA 4PJOF 3HFOA 4M78F 3V8JA 2YLBA 5I21A 5GMKm 4PJOB 1M8VA 3BY7A 4F7UE 5GAOn 3RUXA 4C8QA 4HT9A 3JCMe 4MMLA 4J6YA 5GAN2 4NOYA 3V7SA 2DKGA 2ZGWA 3JCMb 5LJ5g 2EJGA 3RIRA 3EFRA 5LJ5d 3V7CA 4M77E 3JCMX 3QHSA 4F7UA 1B34B 3INZA 4M77D 2EJ9A 1JBMA 5GANh 2DJZA 5LJ5j 2VXEA 4M7AE 3BFMA 1N9RA 2HNIA 4F7UF 1Y96A 4C8QB 1KQ1A 4JRIA 3BW1A 5GMKe 2VXFA 5GANf 4WF2A 3QUIA 5LJ3g 4M7DC 4C92E 1U1SA 4M7DG 3JCMQ 4M7DF 4C92D 4XU1A 3JCMV 5LJ3h 1WQ7A 2EAYA 2EWNA 2FYKA 4M7AA 4J5YA 5GMKh 4N0AA 4XU0A 4M7AC 3SWNC 4M7AG 3EFSA 1LNXA 5DY9A 2DXUA 4N0AC 4DQ2A 1I4K1 1D3BA 4C92A 4M7AF 4XTWA 5LJ3f 1H641 4PJOG 3RKYA 3JB9I 4J6WA 4XU2A 4C92C 4C92G 1YCYA 4M77B 4A53A 5GAN3 1M5Q1 4M75C 4M75G 4EMKA 4C92F 3HFNA 4M78B 3JCMg 5GAMe 1I81A 4M7DE 2FB7A 4M75F 4EMKC 5GANg 4M7DD 4XTUA 5GANd 3JCMh 1WQWA 5GAOp 4NL3A 2E64A 2YHTA 3AHUA 2JN0A 2DZ9A 1KQ2A 5GANj 5GAOr 2K57A 3QO3A 1X01A 4Y91A 3V8KA 3JCMf 3JB9H 2E10A 4M7DA 2DTOA 4M7AD 1HXDA 2DXTA 4PNOA 5LJ3d 3QSUA 4X9CA 2RD1A 4JLIA 4M75E 4A54A 1BIBA 2EJFA 4M75D 3SWNA 4XTXA 3VU3C 4F7UB 3RKWA 5GAOl 3JB9G 5LJ3j 4J6XA 5LJ5e 2DZCA 5GMKj 1LJOA 4M7DB 3V7RA 3JCMW 3FJPA 4RCCA 1N9SA 1Y96B 4M75A 2E65A 1JRIA 2CGHA 3JB9J 4HT8A 3JCMc 3JCMd 3PGGA 5GAMg 4M7AB 5GAN6 5GMKi 2RA2A 4QVCA 4JRKA 4EMGA 1WNLA 5GAMh 1LOJA 2DVEA 5GAOm 1BIAA 1D3BB 4XU3A 4C92B 4XTVA 5GAN8 3JB9D 4PJOC 4M75B
chains in the Genus database with same CATH superfamily
4FL6A 2MYSA 1NJIU 3E9GA 3VKIA 4C5EA 3META 5KYWB 2O4XA 3ASKA 1QVFS 4HVUA 3PMIA 5CKHA 1M2VA 4IUQA 2B86A 3CMAA 1QCFA 3QKJA 2YRDA 3OSSC 4LDWA 4C0FA 3JCMJ 1Q81C 4KGVB 1TU0B 1SSFA 2LZ6B 3KFVA 1QCNA 2K2MA 4M77A 1T0HA 2AKKA 1M1FA 4C8QD 4R56A 2BZ8A 5GMKm 2E5KA 3I9QA 3EGDA 2EQUA 2G3RA 4DBHA 2DKGA 2ZGWA 1Q82R 1QVGP 3JCMX 1UHFA 3MPUB 3KBGA 1QKXA 2KGTA 2KRNA 1RAEB 3L2VA 4MZPA 3HHTB 3M0UA 1G3YA 2CH4W 3JCMQ 1D09B 4XU1A 5KYUB 4X1VA 4PLLA 1OU9A 1U06A 3EFSA 2RN8A 1GBRA 4C92A 2XICA 1UGVA 2M1HA 3CC4A 2X4WA 4PFPA 3OS1A 2MAMA 4HXJA 2C0OA 1JEGA 2XIDA 2EQMA 3M54A 2XMFA 3E19A 1KQ2A 2HKQB 2DTOA 5FRNA 2K79A 2DXTA 4JLIA 1UDLA 1M27C 3CCEA 4XTXA 4DEYA 1F1BB 2JZ2A 4M75A 3EG3A 3TEEA 3JCMc 2KY9A 5GMKi 2E3IA 1LOJA 2HL5C 4JJCA 5IHKA 3EH2A 3S3OA 3LLRA 2X51A 1W4SA 1ZBJA 4C0DB 2HCKA 1N27A 2DILA 1ABOA 2VWFA 4PLIA 1PM3A 2RM4A 4DEXA 5KCOA 2RJDA 3CC2A 2DXCA 1Q86U 1TH7A 2XK0A 2RI3A 2AK5A 2CZ0B 1D0XA 4XQ3A 5LJ5h 1VUBA 2QTXA 3RESA 2I2LA 1X27A 3L2WA 3G6EQ 2ABLA 1DJ7B 3CPWP 4HA8A 5GAMj 1KC8C 1R0CB 3CMET 4DOVA 2DBMA 4MZTA 3UT1A 3QJYA 4E7LA 5CVIA 1BBZA 1PD0A 2M51A 4AT1B 2O9VA 1VQNT 1K4US 2GFAA 3HPWA 3VS5A 1NBEB 4P5NA 5GJVB 2KT8A 2QGFB 2YUQA 2HNIA 2L3RA 4RG8A 2P0PA 2FHDA 1M3AA 5LL6S 3CCUT 2L5QA 4C92E 2F2VA 1FX7A 3CBMA 3OMCA 3TSZA 1SSHA 1O75A 1EFNA 4XU0A 2EQKA 2LT1A 4FM4B 3OBYA 4X34A 1VQ4Q 4OGEA 1WFWA 3PE0A 2RQRA 1G3SA 4PFZA 5J39A 2MCNA 4EMKC 5A0LA 5KYWA 2E64A 1N6AA 4M7DA 1HXDA 2JUFA 4M75E 1BIBA 1MHNA 4LUDA 3PMTA 1PRLC 2DZCA 1YFNA 1QVGS 7AT1B 2BTTA 3LH0A 1AT1B 3RNJA 4ZTJA 3FEOA 2JTMA 1PD1A 1AOJA 2COZA 4L5GA 1WXUA 4OMMA 1ZUYA 2C06A 4HCZA 3CC7Q 1IREB 2H3JA 3X28B 2QTVA 4C0GA 1OU8A 3M9QA 3I55A 1BKBA 3GIBA 5EC7A 4GBQA 4C8QF 2EIFA 1OV3A 3FIFA 1M90R 1NYGA 4ZNXA 2FPDA 1KD1R 1G3TA 1K76A 1YHQT 2ROTA 3DKMA 5KYNA 3OYEA 1GCPA 1GRIA 4KUDK 4M77G 3H9NA 4RKUE 4MDXA 3VS1A 1X2QA 5CQYA 1M8VA 2WSEE 2EKHA 2R5AA 4J9CA 2RHIA 4AFZC 1OX8A 1XOVA 3QPHA 1JBMA 5HY6A 1KQSP 2GF7A 1N9RA 3DB4A 5IXBA 3OYMA 2XD0A 3QUIA 4KT0E 4ELZC 1NYFA 3CCLQ 2EYYA 3DLMA 3GNFB 1YJWQ 4N0AC 2MIOA 2ZZDA 1MV3A 4C92G 1BB9A 4IUVA 3CXCA 3OYGA 4M7DE 3SEMA 1YCSB 5GAOp 3TQ7P 3ZBDA 1YIJQ 1UGQB 4EDUA 3ZL7C 1GL5A 4BD3A 1GBQA 1VQOQ 3CPWS 1NM7A 2EJFA 3QYGB 5L8RE 2SRCA 4F14A 2V1RA 3VUBA 5LJ5e 2P0QA 3MCAB 1RLQC 2EBPA 5FROA 2KNBB 2ZAEA 3GBQA 1KC8U 3LYIA 4BDYA 3H0IA 1X69A 4KULA 4QVZA 1C1AA 4JRKA 1Q81R 2AZSA 8AT1B 1WIEA 1QKWA 2V26A 4N4IA 3G6ET 3CD6A 4E7IA 2VC8A 1FWZA 1OEBA 2A0FB 2DJQA 4L6V5 2OJ2A 4JJNK 1S72A 2ED0A 1ZSGA 5J3BA 1X75C 5LJ5f 3ULRB 3A8LB 4OB2B 4M77C 5A0GA 2EGEA 1NLOC 2MF2A 1QQJA 4PJOF 3CCRT 2MMPA 1OZ3A 1U8RA 3EG1A 2YT6A 2WSFE 3QWYA 4GLMA 2QA4A 2JTEA 2JT4A 1G8XA 1VQ4T 2JXBA 1UHCA 3INZA 1ZX6A 1CKAA 2GQIA 3I5RA 2DM1A 2LP5A 2VB6A 2LRQA 1M1KC 2OX7A 1U5SA 5LJ3h 2EAYA 2CP5A 2CP6A 3OYLA 5GMKh 3NPFA 3QYHB 4KH0B 1H641 1OOTA 2A36A 3VJPA 3JB9I 1K9MR 4C92C 2OTLQ 2DIGA 4FU6A 5GAN3 2XU8A 1AWWA 1YITA 5GANg 5GANd 4OF1A 3JCMh 1MMNA 5KH6A 3M59A 2K9GA 8ATCB 3JB9H 2PUKB 5CR2A 2A28A 4F17A 1VQ5A 5DLQE 3JRZA 4LUEA 1WA7A 3CCJQ 3VU3C 3CC7T 2GFUA 3OS5A 5IHNA 4FCYA 1LJOA 2P84A 3RDVA 3JCMW 4HCBA 2CGHA 3M4YA 2WACA 2VUBA 2NUTA 3O5ZA 2RJCA 5GAMg 4KBMB 1KQSS 5D6WA 5FLXE 1D3BB 1Y0MA 4XTVA 1QWFA 4PJOG 4FW2A 2DTIA 1W2BA 3M4GA 2L8DA 5CK9A 2E41A 2M0YA 1VQLA 2RB6A 2DK3A 2E4HA 3A1PA 1PG5B 3OQ5A 4MMKA 2Y4YA 4DBRA 4KRTA 4HCCA 2GCXA 1AVZC 3CQTA 4BY6C 2AT1B 5J26A 5GAOq 3RKXA 2IPOB 3M0QA 4RTTA 3CCVA 1A0NB 2E70A 2DTHA 1PNJA 2K5IA 4M78F 1HJDA 3CCLT 3RUXA 2L0AA 3P8DA 4J8OA 1YJWT 2RK2A 4A4HA 1EZZB 2DJZA 2EKOA 2OAWA 3SFMA 4C8QB 3OYYA 2LC4A 3OMGA 3PT9A 1YIJT 4VUBA 4OMFB 1V29B 2V1QA 3IQLA 1VQOT 2D8HA 2KT1A 2XDPA 4QQGA 1M5Q1 1NEBA 4FYXB 2PQWA 1BI0A 3MKDA 1S1NA 1WQWA 1Z9QA 2JVVA 2YUPA 1WI7A 1Q86C 3QG1A 3N5BB 3TSWA 4M7AD 1IHVA 2EQIA 3U23A 3VUZA 1TUCA 2XDDA 1BK2A 2ESWA 1XNIA 9ATCB 3NTHA 2OI3A 1OULA 2Z0WA 1VQNQ 5KYYB 2ENMA 3FJPA 1JXMA 1AHJB 4BE1A 1I0CA 3M55A 5CCAA 2RQUA 2DL7A 1MNDA 2CT3A 5M9OA 1D1CA 4LDUA 4GY5A 1D0ZA 1YJ9Q 2DVEA 1BIAA 1UGPB 4JZ3A 2ROLA 4PJOC 2F5KA 1R77A 2SEMA 2QG9B 4OP0A 5KYXB 2DYIA 1G3WA 1S72Q 3EH1A 1EX4A 2ZPIB 2D9TA 1I8FA 1OPKA 2O88A 3JB9F 2A3LA 4ZN3A 1P92A 1WPYA 2W0ZA 3BE3A 1GXIE 3C0CA 3LWHA 3OSVA 4BI8B 1HSQA 1Q95G 4RTUA 1NPRA 2P4TA 5LJ3e 2DL5A 1NPPA 2G6FX 1QCOA 1K8AR 2O2OA 4O6JA 2C0IA 4JZ4A 4II1A 3RMSA 3DLLA 3JCMe 1WXBA 1GFDA 2E12A 2C0TA 2OTLT 1KHIA 3G4SA 1YI2Q 5LJ5j 6AT1B 4F7UF 3A8MB 2ECZA 2CKKA 4O5VA 4J7IA 2R58A 4IKFA 4JRIA 3BW1A 1U1SA 2EGCA 2CP2A 2DX1A 4C92D 2KRMA 1M8MA 1RAAB 2KAFA 4N4HA 2K5FA 3PTAA 1D3BA 2OAUA 5LJ3f 3CCJT 2X4JA 1M1GA 2RHUA 1YCYA 1TUGB 4C0DC 4PJOB 2KYBA 2LX7A 3VRZA 4PJMA 2YDLA 4C0ZA 1YHQQ 1FMKA 1RL2A 2K2VA 2D0QB 3VYGA 2BE7D 3MP8A 3MEAA 1RAGB 3V8KA 3JCMf 1BI1A 1VIEA 2XG8D 3QSUA 3OW2A 4M75D 2CUDA 2K4YA 5IH2A 3JB9G 5A2QE 1LCKA 2HSEB 2DRMA 1D0YA 1H3ZA 1K0SA 2J05A 2EGAA 3CCSQ 3HRSA 4LDXA 1VQ6A 1MV0B 4KGZB 1Q7YR 4E2FB 4BI4A 4QVCA 3JSCA 4EMGA 2VGMA 3QZ5B 2O9SA 2DE0X 5I2MA 1N8RR 1WHJA 3C94A 2QQ9A 4LDYA 4AG2C 3V8LA 1VQMQ 1VQ7A 3A98A 3NTKA 1KFZA 4E7HA 4QW2A 2X3WD 2IG0A 5IHIA 3REAB 4F7UG 2A37A 1QWEA 1VQ9Q 1ZBXA 2LMJA 4C5HA 3UPUA 1MGQA 1SF9A 3QZ9B 2E5QA 4XTYA 3OS0A 1M1KR 3EGXB 3BY7A 1K73R 3CBOA 1TSFA 4J6YA 1NZ9A 1ZQ1A 2RHZA 4ZGEB 4KUIA 4M77E 1VQ8A 1VQPQ 1B34B 1BU1A 1NJIR 3I56Q 3LX7A 4R0KA 5DLOA 5HCKA 3VS7A 4D8DA 3OYKA 1MMAA 3CCMQ 2HSPA 2P4RA 2DXUA 1BCMA 2MWOA 4M7AF 2HQHA 1VQKA 2DD4A 2JJ9A 2E6NA 3NFCA 4M78B 2FB7A 1E6HA 4M7DD 3H6ZA 5KYXA 4ESRA 2F5TX 2KSSA 3J81E 3G71A 2ZPEB 5AT1B 2JN0A 2LTOA 2RK1A 2J7IA 1X01A 2PZ1A 5KCHA 3G7ZA 2YRCA 3CCRQ 2OTJQ 4LD9K 1YJ9T 1V1CA 1I07A 2RD1A 3R6NA 1TG0A 1W2BP 1U3OA 1Y96B 1S72T 1JRIA 4L59A 4IUUA 1UUEA 1YJNA 3CXCS 3CCQA 3REBB 5FU6B 2QQRA 2YUNA 1AWOA 3RERA 1QP2A 2X4YA 2AHJB 3TREA 2PUOB 3GF5A 4XK8E 1YBYA 2FL7A 4OB0B 3QDFA 2PU9B 1WJQA 2DRKA 4FT4A 4N4GA 1YI2T 3VS2A 3EGUA 1RAFB 4PJOA 2BZXA 3BDUA 2DEUA 3PVQA 2YLBA 3CMAQ 2RI2A 3HP9A 2DF6A 4FSXA 3JCMb 2KI7A 5KYUA 5GANh 3L2UA 1NEGA 1RACB 1PWTA 1KQ1A 4JJDA 4Z89A 1IZ6A 2QDLA 1Q86R 4J7FA 2FPFA 2M02A 2LQ8A 3M56A 3C4SA 2GTJA 2FO0A 2ZCFB 2YRVA 2PTKA 1M3CA 4OMPA 4M75F 3L2RA 3CCST 4AFSC 3CPFA 4NL3A 1M30A 3EG9B 2M16A 2CP7A 3X26B 3AHUA 1WZOA 2CUBA 2DMOA 3CEYA 3LWIA 3CC4Q 2LT4A 4EIKA 4F7UB 1TS9A 5GAOl 5LJ3j 4A4GA 5GMKj 3P8BB 2BKDN 1VQMT 4LDVA 2CSQA 1CKBA 1TXQA 5ECAA 4DBQA 1J3TA 2HMAA 2ZPFB 1K9MU 4PJNA 4JRQA 3EGXA 3JAME 1RADB 4FSSA 4PFOA 4EPCA 1R8OB 4JJBA 3CCEQ 4HCKA 3M58A 2D0NA 2XKOC 3TCJA 1B34A 1VQ9T 2YWWA 5GAN4 2FEIA 2KDSA 4JS4A 2CZ6B 1PHTA 1IRXA 4C8QG 3QXEB 3MEWA 5HKCA 5GMKl 2KXDA 1TUDA 4PJOE 3CBPA 2KMTA 3HSBA 2FRWA 1VQPT 2RHYA 5CAIA 2JS0A 4M78A 3I56T 4JRPA 1E6GA 3CC2Q 4RTYA 3EFOB 3CMEA 3CCMT 1Q82C 2RQTA 3DB3A 3EAEA 5EG2A 1UJ0A 1X6BA 1W2BS 1YP5A 3OYAA 2RNAA 3MEUA 1SRLA 2PVGB 3QHSA 5CQXA 3SDZA 3KXTA 1Y96A 2K5LA 3EG0A 3CCUA 1WHLA 1KHCA 1VA7A 2KE9A 4M7DF 1WQ7A 2EWNA 3OYCA 2OTJT 5FU7B 3OW2P 1WJSA 3FDRA 4IUPA 4XTUA 3VRYA 1TOVA 2YHTA 3AT1B 4MZMA 4AFQC 2V8JA 3E2UA 4X9CA 2L2PA 3OYJA 1NLPC 3MJXA 3GNGA 5GJWB 2JMAA 4OB1B 4NS5A 2DXBA 1X6OA 2DNUA 3S6WA 4M7AB 3PIPA 3OYBA 4J9GA 4MDWA 4J9FA 4XU3A 4J9EA 5CKEA 2KYMA 3OBWA 1R0BG 2DIQA 4FYWB 2PVDB 2DEQA 2QXFA 4C8QC 5GANe 4QT7A 5CKFA 2RMOA 2DETA 3HRTA 3CMAT 1VOMA 4M78E 3FB9A 2CDTA 3QJ6A 1WGSA 1NE8A 5GAMd 1YWPA 4E6RA 3G1JA 3MP1A 3I55Q 1ZSZC 3X24B 4ME7A 3EG9A 3OYFA 2GGRA 1KC8R 1W70A 5CKBA 4HT9A 1X43A 2EQJA 2VVKA 4F7UA 2QASA 4YTLA 2CS7A 2LNHB 4KGXB 3ZFJA 1EIFA 2L89A 2YXYA 5I2SA 2CP3A 2LJ3A 1W6XA 2Y4XA 1K0XA 1RI9A 2GBQA 5GANf 4WF2A 2CT4A 1MMDA 3QBYA 1FMVA 4DBFA 2MK5A 1OZ2A 4CC7A 1I4K1 3UA7A 4AMCA 3CC4T 1ZA1B 3UDCA 2CZ7B 4ZGDB 1OX9A 3C95A 3SD4A 2RI5A 2XHCA 2MWPA 3OS2A 3URGA 4Y91A 3MP6A 5C6SA 3Q1JA 4JLGA 3UA6A 4HVWA 3CCET 2VV5A 3VS3A 2JM9A 4GLKA 2F1LA 4CC3A 1VYTA 3LW5E 2PVOB 1ZSZB 3EFOA 4LD6A 1W1FA 2A08A 1T3SA 5GAN6 1SRMA 1Q82U 2LVMA 3NTIA 2LQKA 2BIVA 2HKNA 2HEQA 4M75B 2D8JA 2F69A 3G6EA 4QKUA 3THKA 3CC2T 1PRMC 2CZ1B 3M0PA 2JOYA 1BYMA 1M90C 4ZGJB 4CC4B 3M0RA 1HYOA 2D1XA 4QVDA 4R55A 4OGCA 5CIUA 1KD1C 3OW2S 1VQ8T 2Y90A 2O01E 2E6ZA 2KR3A 2BE9B 3CD6Q 1K9AA 2H8HA 1GFCA 2QQAA 4M78G 2RF0A 1BI2A 4FYYB 1MNEA 2JMCA 1PSEA 1VQKT 4F7UE 1VIFA 4JS5A 2IIMA 3RIRA 4Q5WA 1VQ4A 2GNCA 4M77D 3PNWC 2RJFA 1H92A 5D6XA 3OA6A 5GMKe 5LJ3g 2DFUA 5DM7R 2H3EB 4HKEA 3GOXA 4CC2A 2JNGA 1ACMB 4Z02A 3JCMV 1NG2A 2QA4Q 4M7AA 2QQSA 1FYNA 2M9UA 1B7TA 4OVAA 4RTZA 2NUPB 5HK0A 3JCMg 1M3BA 1K73U 1TTHB 2DL8A 1I1JA 2KVQG 3A8OB 2DZ9A 4ATOA 5GAOr 1QP3A 2GTOA 2K57A 2O31A 2J6KA 4D8KA 3CXCP 2E10A 4J9DA 2JM8A 3HTRA 1UGSB 1UE9A 5FW9A 3CC7A 2MPXC 1YITQ 1TWBA 1VYVA 4RTWA 1G2BA 4M7DB 4OMLA 1RAIB 4FIBA 4HT8A 3RBBB 3PIOA 5IAYA 2QAZA 4LNPA 2VYTA 3PGGA 1VQ5Q 1Y07A 3QWXX 4UC4A 2E3HA 4J9IA 3I55T 2MI6A 2V8KA 4XTZA 3L2QA 2LQWA 4CI0C 4EMHA 1JU5C 4RMOA 1X6GA 4BI3A 3M53A 2D6FA 1PCXA 2DO3A 2M0OA 3GLXA 2EPDA 4QQDA 2CH4A 4AG1C 3WVEB 4NL2A 1AWJA 2K6DA 4Z88A 4M78C 3UATA 1VQLQ 1LVKA 3CCLA 3S3NA 2JS2A 4ANJA 4OMOA 1C0MA 4C8QA 2DERA 3FJ5A 1C6VX 1YJWA 1AZEA 3V7CA 1RAHB 2KXCA 2NWMA 3GP8A 3H0HA 3CCVQ 2X9HA 4M7AE 2B8AA 2AKLA 2QYZA 4J83A 5IXFA 4BACA 1ZSZA 2HBWA 4ELYC 1YIJA 2FYKA 4E7KA 2FG0A 1K9MC 4J5YA 1VQOA 1LNXA 4RUGA 3J80E 2XDBA 5FU6C 4C5GA 2ED1A 2YUOA 4D6WA 3OYIA 1GCQC 2LNVA 1JJ2S 3MHXA 2EFIA 1ZLMA 4XAXB 4A4FA 1YWOA 1M90U 5KYYA 5GANj 1QVFA 3A8HB 4ORZA 2HD0A 4E7JA 1KD1U 4DA4A 4A4KA 3RKWA 1ZHIA 4J6XA 3A8GB 4RCCA 2LQNA 2LJ1A 4ZTFA 3H0FA 2DL4A 1UTIA 2MOXA 3M0SA 2FZGB 2IVWA 1WX6A 2COWA 1D1BA 1OYXA 4E7SA 3CD6T 4LXCA 2YLCA 2EYQA 1XQHA 2HL3A 3RMQA 4V2SA 1WHKA 2E1HA 3WVDB 1WYXA 3OYHA 3JCMP 2CP0A 4PJOD 2K7AA 2VGNA 3I35A 3F70A 2NYSA 2QEXA 2FRYA 2CREA 2RQVA 2NUPA 2FVUA 3EHRA 3SB2A 1MUZA 3ZEHA 4C8QE 4M77F 2LX9A 4F16A 3M0TA 4PJJA 3V8JA 3X20B 2J6FA 1JQQA 4OMNA 5KE2A 2QA4T 4WCIA 2LCCA 2ZPGB 1AD5A 1IGQA 4OMQA 2OTLA 3BFMA 1LPLA 3H8ZA 3MO8A 1SPKA 1H3HA 1M2OA 4KH1B 1Q81U 5A0DA 1QLYA 2DBKA 4M7AG 1QMCA 2DLPA 4HVVA 3G4SQ 1JJ2A 2R5MA 4J6WA 3CCJA 4PL6A 2F2WA 3OY9A 4A53A 2XI9A 4C92F 3HFNA 2K3YA 1YITT 2DVJA 2JW4A 4RG2A 2RPNA 2ZPHB 4BUGA 1BCOA 3FRNA 1SKUB 3SHWA 3QO3A 1VQ5T 1RABB 1AZGB 1O9SA 3VYHB 4PNOA 4A4EA 4FYVB 4LE9A 4Y28E 1MMGA 1Y71A 5I22A 1RUWA 2HAXA 4PK4A 1V76A 2L3SA 3A5ZB 3BDLA 4BE0A 1ABQA 2DD5A 2DL3A 5GAMh 2W10A 2LCSA 4A63B 2AIRB 2P0KA 1M4ZA 2VASA 4EMKB 5GAN7 2BUDA 1UG1A 2NUTB 3L1AA 4PJLA 2J6OA 3R6OA 4X9DA 1UEBA 1VQLT 1VQ6Q 3NMZC 4K11A 4RCBA 3FLGA 4M4ZA 1QW1A 1OI1A 4BB7A 4IUTA 1SG5A 5L23A 2HBPA 4JPBW 4M78D 3L2ZA 1SHFA 1I5LA 1K8AC 5FU7C 1XJWB 1BI3A 3CCVT 1HK9A 1VQ7Q 1N5ZA 4JDSA 3KUFA 4E47A 5I21A 4OB3B 2KRSA 5GAOn 2VKNA 2DYBA 5D6YA 5GAN2 4NOYA 2I0NA 4CRIA 1UB4A 2K3BA 5LJ5g 5FRMA 1FMWA 1T3LA 3RR6A 2EYXA 5LJ5d 3I5SA 2EJ9A 5KE3A 3E1SA 1IB8A 2BZYA 3GPLA 2L3QA 3VS6A 3L42A 4IIMA 1B3QA 2LCLA 1QVGA 4M7AC 3SWNC 5DY9A 4DQ2A 1KSWA 3RKYA 1VQ8Q 2FPEA 2NLUA 2RH2A 4XU2A 4M75G 5IT9E 1VQNA 4J9HA 1IO6A 2DAQA 1M9SA 3P8HA 2DPPB 1XTDA 1H8KA 1ARKA 1PKTA 3VS4A 1VYUA 1YJ9A 1VQKQ 4A54A 4QQ6A 2HZYA 1UFFA 1IGUA 4AFUC 1JO8A 2QI2A 4Y92A 3V7RA 1Q7YC 3G71Q 1E7OA 2E65A 2ATCB 5FWCA 1GCQA 4FT2A 1RI0A 1N8RC 1WNLA 3QIIA 2F2XA 1I5OB 3JB9D 5GAN5 3MEVA 1KIKA 1IXDA 1G83A 2J06A 2EYWA 1KJWA 2LDMA 1U1TA 2QEXQ 1YJNQ 1WLPB 3CCQQ 1YN8A 2EYZA 3S3MA 3SWNB 1PSFA 3M57A 5I11A 1YI2A 3FC3A 5D7UA 2A7YA 1K73C 5CKDA 2FZCB 2FZKB 2EVRA 3HFOA 4PKCC 3ER0A 2GQVA 4MMLA 1QVPA 3V7SA 3HKSA 1NJIC 3E9FA 2KQWA 3G4ST 4B9XA 2DA9A 3CPWA 3X25B 1K1ZA 2VXEA 2O4XB 1YHQA 1UECA 2VXFA 4M7DG 2KK4A 1WHMA 1M2VB 3PFSA 1PC0A 1QVFP 1OPLA 2RJEA 2HQXA 4XTWA 4M77B 4M75C 4EMKA 2KEAA 5GAMe 3NHNA 2CSIA 3CCSA 1SEMA 1D1AA 1WDXA 3EGDB 3OYNA 2QDYB 4IIOA 1WHHA 3LGFA 2V8IA 1K8AU 3H41A 2QQBA 2NUZA 1FXXA 1IHWA 2KROA 4Z8AA 1VQMA 1VQ6T 1OQKA 1WHGA 3HL8A 1UJYA 3EG2A 1Z9ZA 3OB9A 1Y7XA 5FWBA 2EW3A 3TVTA 2HQEA 4E7ZA 3T9NA 4C92B 5GAN8 1JB0E 1ZA2B 5GAMf 5AYFA 3TU4K 1VQ9A 1VQ7T 5HK3A 1KK7A 3ME9A 2COYA 2X3XD 3PVLA 3HRUA 4JUVA 2AZVA 1ZUUA 3QDRB 1G5VA 4TVRA 2RQWA 2K3XA 3C12A 3JV3A 1VQPA 1AWXA 4BDZA 3I56A 2QK0A 4FW1A 1PKSA 1AEYA 1ZUKA 4RTVA 2HDAA 2WSCE 4B6MA 3CCMA 2RO0A 1JXOA 2CYZB 4C5IA 1WXTA 4WTOB 2EJGA 3EFRA 1YNZA 3NGPA 1JJ2P 1SHGA 5IN1A 1WJRA 3UWNA 3VS0A 4M7DC 3UF4A 3CMEQ 1Q7YU 5C0MA 1RLPC 2X4XA 3J7AF 4BY6B 4N0AA 3LH5A 3CCRA 2OTJA 2RHXA 1N8RU 1T0JA 2R57A 2KBTA 1KG1A 1KQSA 3O8VA 1HD3A 4LN2A 1I81A 3G71T 3EHQA 3CCUQ 4ZN1A 5LJ3d 2PNIA 2LJ0A 4J9BA 2QGGA 5CO7A 3SWNA 4B9WA 1B07A 1UGRB 4F04B 2ZPBB 1N9SA 1X2KA 1CSKA 1M1KU 3JB9J 2L3PA 4RTXA 3JCMd 2JTFA 2X35A 3D7SB 3OYDA 3VV0A 2YSQA 2RA2A 3WXMB 4DOWA 2QEXT 1YJNT 4BE2A 3LGLA 5GAOm 4IURA 3CCQT 1Y57A 3M5AA
chains in the Genus database with same CATH topology
2DTIA 2XKOC 4FL6A 1OYXA 3TCJA 1B34A 1W2BA 3E9GA 3VKIA 1VQ9T 3M4GA 1NJIU 2L8DA 2YLCA 2EYQA 4C5EA 5GAN4 3META 1XQHA 5CK9A 4V2SA 3RMQA 2E41A 2O4XA 2E1HA 2KDSA 3ASKA 4JS4A 2CZ6B 1VQLA 1QVFS 2RB6A 3WVDB 2DK3A 3PMIA 4C8QG 5CKHA 3OQ5A 4MMKA 3QXEB 2Y4YA 4IUQA 3MEWA 5HKCA 5GMKl 3OYHA 3CMAA 3QKJA 4LDWA 3OSSC 4C0FA 3JCMJ 3JCMP 2GCXA 3CBPA 1Q81C 4HCCA 4BY6C 2KMTA 4PJOD 3HSBA 1SSFA 2VGNA 5J26A 5GAOq 1VQPT 3F70A 3RKXA 2QEXA 2RHYA 4M77A 5CAIA 2FVUA 4M78A 3I56T 3CCVA 4JRPA 3SB2A 3ZEHA 2E70A 1M1FA 4C8QE 4M77F 4C8QD 2DTHA 2LX9A 4R56A 2K5IA 3V8JA 4M78F 3X20B 5GMKm 3CMEA 3CCMT 3CCLT 1Q82C 5EG2A 2EQUA 3DB3A 3EAEA 2G3RA 5KE2A 3RUXA 2QA4T 3P8DA 2LCCA 4J8OA 1W2BS 1YJWT 2RK2A 2ZPGB 2DKGA 2ZGWA 3OYAA 4A4HA 3MEUA 3JCMX 2PVGB 3QHSA 3KBGA 2OTLA 5CQXA 3SDZA 2DJZA 3L2VA 2EKOA 3KXTA 3BFMA 4MZPA 3HHTB 3SFMA 1Y96A 4C8QB 2K5LA 1G3YA 3H8ZA 3MO8A 3OYYA 2LC4A 3OMGA 3CCUA 3JCMQ 1KHCA 3PT9A 1YIJT 4VUBA 4M7DF 4OMFB 4XU1A 1V29B 1WQ7A 2EWNA 3OYCA 1Q81U 5A0DA 1VQOT 2OTJT 4PLLA 4M7AG 3EFSA 5FU7B 4C92A 2XICA 2M1HA 2XDPA 2R5MA 4J6WA 4QQGA 4PL6A 3OY9A 3CCJA 1JJ2A 2X4WA 3CC4A 4A53A 1M5Q1 2XI9A 4C92F 3HFNA 1WJSA 2K3YA 1YITT 2PQWA 3FDRA 3OS1A 2MAMA 4RG2A 4IUPA 1BI0A 2ZPHB 4BUGA 4XTUA 2XIDA 1WQWA 2EQMA 3FRNA 3M54A 2JVVA 3M58A 3E19A 2YHTA 1Q86C 4MZMA 1KQ2A 3QG1A 3N5BB 3QO3A 4M7AD 1VQ5T 2DTOA 5FRNA 1O9SA 3VYHB 2DXTA 4PNOA 3VUZA 4A4EA 2V8JA 4X9CA 2XDDA 4JLIA 3OYJA 4Y28E 3CCEA 4XTXA 1XNIA 1Y71A 3NTHA 3GNGA 2HAXA 2JZ2A 3FJPA 4M75A 3A5ZB 3OS2A 1AHJB 4OB1B 4BE1A 3BDLA 3M55A 5CCAA 4NS5A 4BE0A 3TEEA 3JCMc 2DD5A 2DXBA 2KY9A 1X6OA 5M9OA 3S6WA 4M7AB 3PIPA 4LDUA 5GMKi 3OYBA 4GY5A 5GAMh 1LOJA 2DVEA 1BIAA 4MDWA 1UGPB 4XU3A 3S3OA 3LLRA 1W4SA 5CKEA 4PJOC 4C0DB 1N27A 2P0KA 3OBWA 1M4ZA 2F5KA 4EMKB 2DIQA 4PLIA 5GAN7 2BUDA 3L1AA 2RM4A 5KCOA 2RJDA 4OP0A 3R6OA 1G3WA 1UEBA 4X9DA 1VQLT 3CC2A 2DXCA 2PVDB 1Q86U 1TH7A 2ZPIB 2DEQA 2D9TA 2QXFA 4C8QC 1I8FA 2XK0A 4RCBA 5GANe 2A3LA 2RI3A 5CKFA 3FLGA 4ZN3A 3JB9F 3HRTA 1P92A 2CZ0B 3CMAT 1QW1A 1WPYA 4XQ3A 1OI1A 5LJ5h 4BB7A 4IUTA 4M78E 1VUBA 2HBPA 2QTXA 3FB9A 1GXIE 3L2ZA 3OSVA 3QJ6A 4M78D 2I2LA 1WGSA 3RESA 4BI8B 3LWHA 1NE8A 3L2WA 1NPRA 1K8AC 1I5LA 5GAMd 2P4TA 5FU7C 5LJ3e 1BI3A 1NPPA 1DJ7B 3CCVT 4HA8A 1HK9A 3MP1A 5GAMj 1KC8C 3X24B 4JDSA 3KUFA 4O6JA 4E47A 5I21A 4ME7A 4DOVA 3CMET 3OYFA 4OB3B 4MZTA 4II1A 3RMSA 5GAOn 5CKBA 3QJYA 3UT1A 3DLLA 4HT9A 3JCMe 5D6YA 5CVIA 5GAN2 4NOYA 4E7LA 2EQJA 4CRIA 1UB4A 5LJ5g 1VQNT 2E12A 5FRMA 2GFAA 5LJ5d 3HPWA 2OTLT 1KHIA 4F7UA 4YTLA 3G4SA 4ATOA 2CS7A 3ZFJA 2EJ9A 1EIFA 2L89A 4P5NA 5I2SA 5KE3A 5LJ5j 2Y4XA 2HNIA 2L3RA 3E1SA 3A8MB 4RG8A 2P0PA 2CKKA 4J7IA 2FHDA 2R58A 4O5VA 4F7UF 4IKFA 4JRIA 3BW1A 5LL6S 3CCUT 5GANf 2L5QA 4WF2A 3GPLA 4PJOE 4C92E 1U1SA 3QBYA 3L42A 1FX7A 2LCLA 4C92D 2KAFA 3CBMA 3OMCA 4N4HA 1OZ2A 1QVGA 1O75A 4XU0A 2EQKA 2LT1A 2K5FA 4FM4B 3SWNC 5DY9A 3PTAA 4M7AC 4DQ2A 3OBYA 1I4K1 1D3BA 4X34A 2OAUA 5LJ3f 3CC4T 3RKYA 4OGEA 2X4JA 3CCJT 1G3SA 1M1GA 2NLUA 2RH2A 2RHUA 4XU2A 3UDCA 1YCYA 2CZ7B 5J39A 4ZGDB 4C0DC 4PJOB 4M75G 5IT9E 4C0ZA 4EMKC 3C95A 1VQNA 5A0LA 1RL2A 3SD4A 2K2VA 2RI5A 2D0QB 3VYGA 2E64A 1N6AA 1M9SA 2DAQA 2MWPA 2XHCA 3P8HA 3MP8A 3MEAA 2DPPB 4Y91A 3MP6A 3URGA 3JCMf 1XTDA 3V8KA 5C6SA 4M7DA 3Q1JA 1HXDA 4JLGA 1BI1A 1VIEA 1YJ9A 2JUFA 2XG8D 3QSUA 4M75E 4A54A 3OW2A 4QQ6A 1BIBA 3CCET 4M75D 2K4YA 1MHNA 3PMTA 3JB9G 5A2QE 2VV5A 2DZCA 1H3ZA 2QI2A 3V7RA 1Q7YC 4GLKA 3HRSA 4LDXA 2E65A 3LW5E 1QVGS 2PVOB 1VQ6A 3LH0A 4LD6A 4ZTJA 4FT2A 4BI4A 3FEOA 1RI0A 2JTMA 5GAN6 1N8RC 4QVCA 3JSCA 2LVMA 3NTIA 1WNLA 2VGMA 3QIIA 2LQKA 3QZ5B 4EMGA 1Q82U 2BIVA 5I2MA 3JB9D 4L5GA 4M75B 2C06A 4HCZA 1IREB 3C94A 2H3JA 2QQ9A 4LDYA 5GAN5 2F69A 3MEVA 3G6EA 3X28B 3V8LA 4C0GA 3CC2T 3M9QA 2CZ1B 1VQ7A 3I55A 1BKBA 2JOYA 1BYMA 1M90C 3NTKA 3GIBA 4ZGJB 4E7HA 4QW2A 2LDMA 4QVDA 4R55A 4OGCA 5CIUA 1KD1C 3OW2S 4C8QF 2EIFA 1VQ8T 1U1TA 3FIFA 2IG0A 2Y90A 2O01E 2E6ZA 4F7UG 1G3TA 3S3MA 1YHQT 3SWNB 1PSFA 3M57A 3DKMA 1YI2A 3FC3A 1ZBXA 3OYEA 4C5HA 3UPUA 1MGQA 2A7YA 2QQAA 4M77G 4KUDK 3QZ9B 4RKUE 2E5QA 4M78G 4XTYA 5CKDA 1BI2A 1K73C 4MDXA 3HFOA 4PKCC 5CQYA 3OS0A 1M8VA 3ER0A 1PSEA 3BY7A 1VQKT 2GQVA 4F7UE 3CBOA 2WSEE 1VIFA 4MMLA 1QVPA 4J6YA 3V7SA 2R5AA 1NZ9A 2RHIA 4JS5A 1ZQ1A 2RHZA 3HKSA 4ZGEB 1NJIC 4KUIA 3RIRA 3E9FA 4Q5WA 1VQ4A 2KQWA 3G4ST 4M77E 4B9XA 1VQ8A 1XOVA 3QPHA 1B34B 3CPWA 4M77D 3PNWC 1JBMA 2RJFA 5HY6A 3X25B 3CD6T 2VXEA 3LX7A 2GF7A 5D6XA 1N9RA 5DLOA 2O4XB 3DB4A 3OYMA 3OYKA 3OA6A 1YHQA 2XD0A 5GMKe 2VXFA 4M7DG 2KK4A 3QUIA 4KT0E 4ELZC 5LJ3g 5DM7R 4HKEA 3GOXA 2JNGA 4Z02A 3JCMV 3DLMA 4M7AA 3PFSA 3GNFB 2QQSA 2DXUA 2M9UA 2RJEA 4N0AC 4OVAA 2HQXA 2MWOA 4M7AF 4XTWA 1VQKA 2ZZDA 2DD4A 2E6NA 3NFCA 4C92G 4M77B 4IUVA 4M75C 4EMKA 3CXCA 5GAMe 4M78B 3JCMg 5HK0A 3OYGA 1K73U 4M7DE 2FB7A 4M7DD 3H6ZA 5GAOp 3CCSA 2F5TX 2KSSA 3J81E 3G71A 2ZPEB 2KVQG 3A8OB 3ZBDA 2JN0A 1UGQB 2DZ9A 2RK1A 2LTOA 1QP3A 2K57A 1X01A 2QDYB 4EDUA 3OYNA 5GAOr 2E10A 4BD3A 5KCHA 3G7ZA 3CPWS 4LD9K 1YJ9T 1UGSB 2RD1A 2EJFA 3LGFA 3QYGB 5L8RE 2V8IA 3CC7A 3VUBA 5LJ5e 1K8AU 2P0QA 2QQBA 3MCAB 1FXXA 4M7DB 1Y96B 1VQMA 1S72T 5FROA 1VQ6T 1JRIA 3HL8A 4FIBA 4HT8A 3PIOA 1KC8U 3LYIA 4L59A 5IAYA 4BDYA 2VYTA 3OB9A 3PGGA 4IUUA 4KULA 1Y7XA 4QVZA 4JRKA 2HQEA 1YJNA 3CXCS 3T9NA 1Y07A 4C92B 5GAN8 4UC4A 1JB0E 3CCQA 4N4IA 5FU6B 2QQRA 3G6ET 5GAMf 1QP2A 5AYFA 3CD6A 2X4YA 4E7IA 3TU4K 3RERA 1VQ9A 2AHJB 1VQ7T 2VC8A 3I55T 1FWZA 5HK3A 3ME9A 2MI6A 3TREA 2PUOB 2V8KA 4XTZA 3GF5A 4L6V5 4XK8E 3L2QA 1YBYA 4CI0C 2FL7A 4OB0B 4EMHA 3HRUA 4JJNK 4JUVA 4RMOA 1S72A 2PU9B 1WJQA 4BI3A 3QDRB 3M53A 4FT4A 2D6FA 1G5VA 2M0OA 2DO3A 3GLXA 4N4GA 4QQDA 4TVRA 5J3BA 2K3XA 1X75C 5LJ5f 3C12A 1YI2T 3A8LB 1VQPA 4OB2B 4BDZA 3WVEB 4PJOA 4NL2A 3BDUA 4M77C 5A0GA 3I56A 4M78C 2MF2A 4PJOF 3CCRT 2MMPA 1OZ3A 2YLBA 1U8RA 2WSCE 2WSFE 3CCMA 3CCLA 3S3NA 2RI2A 3HP9A 4C8QA 2QA4A 2RO0A 2CYZB 1YJWA 4FSXA 3JCMb 4C5IA 1VQ4T 2EJGA 3EFRA 3V7CA 3INZA 3GP8A 5GANh 3L2UA 4M7AE 5IN1A 2B8AA 1WJRA 1KQ1A 3UWNA 4M7DC 1IZ6A 1Q7YU 4BACA 4J83A 2LRQA 1M1KC 4J7FA 5C0MA 4ELYC 1YIJA 5LJ3h 2FYKA 2EAYA 2X4XA 4E7KA 1K9MC 4J5YA 4BY6B 3J7AF 3OYLA 5GMKh 4N0AA 1VQOA 3CCRA 2OTJA 1LNXA 3QYHB 2RHXA 1N8RU 1H641 2R57A 3VJPA 3JB9I 3J80E 1KG1A 2LQ8A 4C92C 1KQSA 2DIGA 3M56A 4FU6A 3O8VA 5GAN3 3C4SA 2XDBA 5FU6C 2ZCFB 4C5GA 1I81A 2XU8A 2YRVA 4D6WA 4M75F 3L2RA 5GANg 3CCST 3OYIA 1YITA 3CPFA 4OF1A 3JCMh 5GANd 2LNVA 5KH6A 4NL3A 3G71T 3MHXA 2EFIA 1JJ2S 2M16A 4XAXB 3X26B 4A4FA 3M59A 3AHUA 1M90U 5GANj 3JB9H 2PUKB 4ZN1A 5CR2A 1QVFA 3A8HB 4E7JA 2HD0A 1VQ5A 1KD1U 5DLQE 3JRZA 5LJ3d 3CEYA 3LWIA 4DA4A 2LT4A 5CO7A 3SWNA 3VU3C 4A4KA 4F7UB 2GFUA 3RKWA 5GAOl 3CC7T 4B9WA 1ZHIA 3OS5A 4J6XA 5LJ3j 4A4GA 5GMKj 1LJOA 1UGRB 3P8BB 2BKDN 3A8GB 2ZPBB 4LDVA 4RCCA 1N9SA 3JCMW 1VQMT 4ZTFA 4HCBA 1M1KU 2CGHA 3M4YA 3JB9J 2WACA 2ZPFB 2VUBA 1K9MU 3JCMd 4JRQA 2JTFA 2X35A 2RJCA 5GAMg 3OYDA 4KBMB 3VV0A 2RA2A 3WXMB 4DOWA 3JAME 2QEXT 1KQSS 5D6WA 1YJNT 4BE2A 3LGLA 5GAOm 4IURA 3CCQT 5FLXE 1D3BB 2IVWA 1R8OB 4XTVA 4EPCA 3M5AA 4PJOG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTI A;  5GAN 5;  1B34 A;  5GAM f;  3RER A;  4EMK B;  5GAN 7;  3M4G A;  2YLC A;  3V8L A;  3L1A A;  2RM4 A;  5GAN 4;  2VC8 A;  4OP0 A;  4X9D A;  4V2S A;  2E41 A;  2E1H A;  1TH7 A;  3GIB A;  2RB6 A;  2DEQ A;  4XTZ A;  4C8Q C;  1I8F A;  4RCB A;  4C8Q G;  5GAN e;  4MMK A;  4EMH A;  4QVD A;  3JB9 F;  4C8Q F;  1U1T A;  3FIF A;  4XQ3 A;  1WPY A;  4JUV A;  5GMK l;  2Y90 A;  5LJ5 h;  4PJO E;  3JCM J;  3JCM P;  4M78 E;  2QTX A;  3FB9 A;  4PJO D;  3L2Z A;  4M78 D;  3RES A;  4F7U G;  2I2L A;  3HSB A;  1I5L A;  3SWN B;  5GAM d;  5LJ3 e;  5GAO q;  5LJ5 f;  3RKX A;  4M77 A;  5CAI A;  4PJO A;  4NL2 A;  3BDU A;  4M78 A;  4M77 C;  1MGQ A;  4M77 G;  4HA8 A;  1HK9 A;  3SB2 A;  4C8Q E;  5GAM j;  4M78 C;  4M78 G;  4XTY A;  4M77 F;  4C8Q D;  2DTH A;  4PJO F;  3HFO A;  4M78 F;  3V8J A;  2YLB A;  5I21 A;  5GMK m;  4PJO B;  1M8V A;  3BY7 A;  4F7U E;  5GAO n;  3RUX A;  4C8Q A;  4HT9 A;  3JCM e;  4MML A;  4J6Y A;  5GAN 2;  4NOY A;  3V7S A;  2DKG A;  2ZGW A;  3JCM b;  5LJ5 g;  2EJG A;  3RIR A;  3EFR A;  5LJ5 d;  3V7C A;  4M77 E;  3JCM X;  3QHS A;  4F7U A;  1B34 B;  3INZ A;  4M77 D;  2EJ9 A;  1JBM A;  5GAN h;  2DJZ A;  5LJ5 j;  2VXE A;  4M7A E;  3BFM A;  1N9R A;  2HNI A;  4F7U F;  1Y96 A;  4C8Q B;  1KQ1 A;  4JRI A;  3BW1 A;  5GMK e;  2VXF A;  5GAN f;  4WF2 A;  3QUI A;  5LJ3 g;  4M7D C;  4C92 E;  1U1S A;  4M7D G;  3JCM Q;  4M7D F;  4C92 D;  4XU1 A;  3JCM V;  5LJ3 h;  1WQ7 A;  2EAY A;  2EWN A;  2FYK A;  4M7A A;  4J5Y A;  5GMK h;  4N0A A;  4XU0 A;  4M7A C;  3SWN C;  4M7A G;  3EFS A;  1LNX A;  5DY9 A;  2DXU A;  4N0A C;  4DQ2 A;  1I4K 1;  1D3B A;  4C92 A;  4M7A F;  4XTW A;  5LJ3 f;  1H64 1;  4PJO G;  3RKY A;  3JB9 I;  4J6W A;  4XU2 A;  4C92 C;  4C92 G;  1YCY A;  4M77 B;  4A53 A;  5GAN 3;  1M5Q 1;  4M75 C;  4M75 G;  4EMK A;  4C92 F;  3HFN A;  4M78 B;  3JCM g;  5GAM e;  1I81 A;  4M7D E;  2FB7 A;  4M75 F;  4EMK C;  5GAN g;  4M7D D;  4XTU A;  5GAN d;  3JCM h;  1WQW A;  5GAO p;  4NL3 A;  2E64 A;  2YHT A;  3AHU A;  2JN0 A;  2DZ9 A;  1KQ2 A;  5GAN j;  5GAO r;  2K57 A;  3QO3 A;  1X01 A;  4Y91 A;  3V8K A;  3JCM f;  3JB9 H;  2E10 A;  4M7D A;  2DTO A;  4M7A D;  1HXD A;  2DXT A;  4PNO A;  5LJ3 d;  3QSU A;  4X9C A;  2RD1 A;  4JLI A;  4M75 E;  4A54 A;  1BIB A;  2EJF A;  4M75 D;  3SWN A;  4XTX A;  3VU3 C;  4F7U B;  3RKW A;  5GAO l;  3JB9 G;  5LJ3 j;  4J6X A;  5LJ5 e;  2DZC A;  5GMK j;  1LJO A;  4M7D B;  3V7R A;  3JCM W;  3FJP A;  4RCC A;  1N9S A;  1Y96 B;  4M75 A;  2E65 A;  1JRI A;  2CGH A;  3JB9 J;  4HT8 A;  3JCM c;  3JCM d;  3PGG A;  5GAM g;  4M7A B;  5GAN 6;  5GMK i;  2RA2 A;  4QVC A;  4JRK A;  4EMG A;  1WNL A;  5GAM h;  1LOJ A;  2DVE A;  5GAO m;  1BIA A;  1D3B B;  4XU3 A;  4C92 B;  4XTV A;  5GAN 8;  3JB9 D;  4PJO C;  4M75 B; 
#chains in the Genus database with same CATH topology
 4FL6 A;  2MYS A;  1NJI U;  3E9G A;  3VKI A;  4C5E A;  3MET A;  5KYW B;  2O4X A;  3ASK A;  1QVF S;  4HVU A;  3PMI A;  5CKH A;  1M2V A;  4IUQ A;  2B86 A;  3CMA A;  1QCF A;  3QKJ A;  2YRD A;  3OSS C;  4LDW A;  4C0F A;  3JCM J;  1Q81 C;  4KGV B;  1TU0 B;  1SSF A;  2LZ6 B;  3KFV A;  1QCN A;  2K2M A;  4M77 A;  1T0H A;  2AKK A;  1M1F A;  4C8Q D;  4R56 A;  2BZ8 A;  5GMK m;  2E5K A;  3I9Q A;  3EGD A;  2EQU A;  2G3R A;  4DBH A;  2DKG A;  2ZGW A;  1Q82 R;  1QVG P;  3JCM X;  1UHF A;  3MPU B;  3KBG A;  1QKX A;  2KGT A;  2KRN A;  1RAE B;  3L2V A;  4MZP A;  3HHT B;  3M0U A;  1G3Y A;  2CH4 W;  3JCM Q;  1D09 B;  4XU1 A;  5KYU B;  4X1V A;  4PLL A;  1OU9 A;  1U06 A;  3EFS A;  2RN8 A;  1GBR A;  4C92 A;  2XIC A;  1UGV A;  2M1H A;  3CC4 A;  2X4W A;  4PFP A;  3OS1 A;  2MAM A;  4HXJ A;  2C0O A;  1JEG A;  2XID A;  2EQM A;  3M54 A;  2XMF A;  3E19 A;  1KQ2 A;  2HKQ B;  2DTO A;  5FRN A;  2K79 A;  2DXT A;  4JLI A;  1UDL A;  1M27 C;  3CCE A;  4XTX A;  4DEY A;  1F1B B;  2JZ2 A;  4M75 A;  3EG3 A;  3TEE A;  3JCM c;  2KY9 A;  5GMK i;  2E3I A;  1LOJ A;  2HL5 C;  4JJC A;  5IHK A;  3EH2 A;  3S3O A;  3LLR A;  2X51 A;  1W4S A;  1ZBJ A;  4C0D B;  2HCK A;  1N27 A;  2DIL A;  1ABO A;  2VWF A;  4PLI A;  1PM3 A;  2RM4 A;  4DEX A;  5KCO A;  2RJD A;  3CC2 A;  2DXC A;  1Q86 U;  1TH7 A;  2XK0 A;  2RI3 A;  2AK5 A;  2CZ0 B;  1D0X A;  4XQ3 A;  5LJ5 h;  1VUB A;  2QTX A;  3RES A;  2I2L A;  1X27 A;  3L2W A;  3G6E Q;  2ABL A;  1DJ7 B;  3CPW P;  4HA8 A;  5GAM j;  1KC8 C;  1R0C B;  3CME T;  4DOV A;  2DBM A;  4MZT A;  3UT1 A;  3QJY A;  4E7L A;  5CVI A;  1BBZ A;  1PD0 A;  2M51 A;  4AT1 B;  2O9V A;  1VQN T;  1K4U S;  2GFA A;  3HPW A;  3VS5 A;  1NBE B;  4P5N A;  5GJV B;  2KT8 A;  2QGF B;  2YUQ A;  2HNI A;  2L3R A;  4RG8 A;  2P0P A;  2FHD A;  1M3A A;  5LL6 S;  3CCU T;  2L5Q A;  4C92 E;  2F2V A;  1FX7 A;  3CBM A;  3OMC A;  3TSZ A;  1SSH A;  1O75 A;  1EFN A;  4XU0 A;  2EQK A;  2LT1 A;  4FM4 B;  3OBY A;  4X34 A;  1VQ4 Q;  4OGE A;  1WFW A;  3PE0 A;  2RQR A;  1G3S A;  4PFZ A;  5J39 A;  2MCN A;  4EMK C;  5A0L A;  5KYW A;  2E64 A;  1N6A A;  4M7D A;  1HXD A;  2JUF A;  4M75 E;  1BIB A;  1MHN A;  4LUD A;  3PMT A;  1PRL C;  2DZC A;  1YFN A;  1QVG S;  7AT1 B;  2BTT A;  3LH0 A;  1AT1 B;  3RNJ A;  4ZTJ A;  3FEO A;  2JTM A;  1PD1 A;  1AOJ A;  2COZ A;  4L5G A;  1WXU A;  4OMM A;  1ZUY A;  2C06 A;  4HCZ A;  3CC7 Q;  1IRE B;  2H3J A;  3X28 B;  2QTV A;  4C0G A;  1OU8 A;  3M9Q A;  3I55 A;  1BKB A;  3GIB A;  5EC7 A;  4GBQ A;  4C8Q F;  2EIF A;  1OV3 A;  3FIF A;  1M90 R;  1NYG A;  4ZNX A;  2FPD A;  1KD1 R;  1G3T A;  1K76 A;  1YHQ T;  2ROT A;  3DKM A;  5KYN A;  3OYE A;  1GCP A;  1GRI A;  4KUD K;  4M77 G;  3H9N A;  4RKU E;  4MDX A;  3VS1 A;  1X2Q A;  5CQY A;  1M8V A;  2WSE E;  2EKH A;  2R5A A;  4J9C A;  2RHI A;  4AFZ C;  1OX8 A;  1XOV A;  3QPH A;  1JBM A;  5HY6 A;  1KQS P;  2GF7 A;  1N9R A;  3DB4 A;  5IXB A;  3OYM A;  2XD0 A;  3QUI A;  4KT0 E;  4ELZ C;  1NYF A;  3CCL Q;  2EYY A;  3DLM A;  3GNF B;  1YJW Q;  4N0A C;  2MIO A;  2ZZD A;  1MV3 A;  4C92 G;  1BB9 A;  4IUV A;  3CXC A;  3OYG A;  4M7D E;  3SEM A;  1YCS B;  5GAO p;  3TQ7 P;  3ZBD A;  1YIJ Q;  1UGQ B;  4EDU A;  3ZL7 C;  1GL5 A;  4BD3 A;  1GBQ A;  1VQO Q;  3CPW S;  1NM7 A;  2EJF A;  3QYG B;  5L8R E;  2SRC A;  4F14 A;  2V1R A;  3VUB A;  5LJ5 e;  2P0Q A;  3MCA B;  1RLQ C;  2EBP A;  5FRO A;  2KNB B;  2ZAE A;  3GBQ A;  1KC8 U;  3LYI A;  4BDY A;  3H0I A;  1X69 A;  4KUL A;  4QVZ A;  1C1A A;  4JRK A;  1Q81 R;  2AZS A;  8AT1 B;  1WIE A;  1QKW A;  2V26 A;  4N4I A;  3G6E T;  3CD6 A;  4E7I A;  2VC8 A;  1FWZ A;  1OEB A;  2A0F B;  2DJQ A;  4L6V 5;  2OJ2 A;  4JJN K;  1S72 A;  2ED0 A;  1ZSG A;  5J3B A;  1X75 C;  5LJ5 f;  3ULR B;  3A8L B;  4OB2 B;  4M77 C;  5A0G A;  2EGE A;  1NLO C;  2MF2 A;  1QQJ A;  4PJO F;  3CCR T;  2MMP A;  1OZ3 A;  1U8R A;  3EG1 A;  2YT6 A;  2WSF E;  3QWY A;  4GLM A;  2QA4 A;  2JTE A;  2JT4 A;  1G8X A;  1VQ4 T;  2JXB A;  1UHC A;  3INZ A;  1ZX6 A;  1CKA A;  2GQI A;  3I5R A;  2DM1 A;  2LP5 A;  2VB6 A;  2LRQ A;  1M1K C;  2OX7 A;  1U5S A;  5LJ3 h;  2EAY A;  2CP5 A;  2CP6 A;  3OYL A;  5GMK h;  3NPF A;  3QYH B;  4KH0 B;  1H64 1;  1OOT A;  2A36 A;  3VJP A;  3JB9 I;  1K9M R;  4C92 C;  2OTL Q;  2DIG A;  4FU6 A;  5GAN 3;  2XU8 A;  1AWW A;  1YIT A;  5GAN g;  5GAN d;  4OF1 A;  3JCM h;  1MMN A;  5KH6 A;  3M59 A;  2K9G A;  8ATC B;  3JB9 H;  2PUK B;  5CR2 A;  2A28 A;  4F17 A;  1VQ5 A;  5DLQ E;  3JRZ A;  4LUE A;  1WA7 A;  3CCJ Q;  3VU3 C;  3CC7 T;  2GFU A;  3OS5 A;  5IHN A;  4FCY A;  1LJO A;  2P84 A;  3RDV A;  3JCM W;  4HCB A;  2CGH A;  3M4Y A;  2WAC A;  2VUB A;  2NUT A;  3O5Z A;  2RJC A;  5GAM g;  4KBM B;  1KQS S;  5D6W A;  5FLX E;  1D3B B;  1Y0M A;  4XTV A;  1QWF A;  4PJO G;  4FW2 A;  2DTI A;  1W2B A;  3M4G A;  2L8D A;  5CK9 A;  2E41 A;  2M0Y A;  1VQL A;  2RB6 A;  2DK3 A;  2E4H A;  3A1P A;  1PG5 B;  3OQ5 A;  4MMK A;  2Y4Y A;  4DBR A;  4KRT A;  4HCC A;  2GCX A;  1AVZ C;  3CQT A;  4BY6 C;  2AT1 B;  5J26 A;  5GAO q;  3RKX A;  2IPO B;  3M0Q A;  4RTT A;  3CCV A;  1A0N B;  2E70 A;  2DTH A;  1PNJ A;  2K5I A;  4M78 F;  1HJD A;  3CCL T;  3RUX A;  2L0A A;  3P8D A;  4J8O A;  1YJW T;  2RK2 A;  4A4H A;  1EZZ B;  2DJZ A;  2EKO A;  2OAW A;  3SFM A;  4C8Q B;  3OYY A;  2LC4 A;  3OMG A;  3PT9 A;  1YIJ T;  4VUB A;  4OMF B;  1V29 B;  2V1Q A;  3IQL A;  1VQO T;  2D8H A;  2KT1 A;  2XDP A;  4QQG A;  1M5Q 1;  1NEB A;  4FYX B;  2PQW A;  1BI0 A;  3MKD A;  1S1N A;  1WQW A;  1Z9Q A;  2JVV A;  2YUP A;  1WI7 A;  1Q86 C;  3QG1 A;  3N5B B;  3TSW A;  4M7A D;  1IHV A;  2EQI A;  3U23 A;  3VUZ A;  1TUC A;  2XDD A;  1BK2 A;  2ESW A;  1XNI A;  9ATC B;  3NTH A;  2OI3 A;  1OUL A;  2Z0W A;  1VQN Q;  5KYY B;  2ENM A;  3FJP A;  1JXM A;  1AHJ B;  4BE1 A;  1I0C A;  3M55 A;  5CCA A;  2RQU A;  2DL7 A;  1MND A;  2CT3 A;  5M9O A;  1D1C A;  4LDU A;  4GY5 A;  1D0Z A;  1YJ9 Q;  2DVE A;  1BIA A;  1UGP B;  4JZ3 A;  2ROL A;  4PJO C;  2F5K A;  1R77 A;  2SEM A;  2QG9 B;  4OP0 A;  5KYX B;  2DYI A;  1G3W A;  1S72 Q;  3EH1 A;  1EX4 A;  2ZPI B;  2D9T A;  1I8F A;  1OPK A;  2O88 A;  3JB9 F;  2A3L A;  4ZN3 A;  1P92 A;  1WPY A;  2W0Z A;  3BE3 A;  1GXI E;  3C0C A;  3LWH A;  3OSV A;  4BI8 B;  1HSQ A;  1Q95 G;  4RTU A;  1NPR A;  2P4T A;  5LJ3 e;  2DL5 A;  1NPP A;  2G6F X;  1QCO A;  1K8A R;  2O2O A;  4O6J A;  2C0I A;  4JZ4 A;  4II1 A;  3RMS A;  3DLL A;  3JCM e;  1WXB A;  1GFD A;  2E12 A;  2C0T A;  2OTL T;  1KHI A;  3G4S A;  1YI2 Q;  5LJ5 j;  6AT1 B;  4F7U F;  3A8M B;  2ECZ A;  2CKK A;  4O5V A;  4J7I A;  2R58 A;  4IKF A;  4JRI A;  3BW1 A;  1U1S A;  2EGC A;  2CP2 A;  2DX1 A;  4C92 D;  2KRM A;  1M8M A;  1RAA B;  2KAF A;  4N4H A;  2K5F A;  3PTA A;  1D3B A;  2OAU A;  5LJ3 f;  3CCJ T;  2X4J A;  1M1G A;  2RHU A;  1YCY A;  1TUG B;  4C0D C;  4PJO B;  2KYB A;  2LX7 A;  3VRZ A;  4PJM A;  2YDL A;  4C0Z A;  1YHQ Q;  1FMK A;  1RL2 A;  2K2V A;  2D0Q B;  3VYG A;  2BE7 D;  3MP8 A;  3MEA A;  1RAG B;  3V8K A;  3JCM f;  1BI1 A;  1VIE A;  2XG8 D;  3QSU A;  3OW2 A;  4M75 D;  2CUD A;  2K4Y A;  5IH2 A;  3JB9 G;  5A2Q E;  1LCK A;  2HSE B;  2DRM A;  1D0Y A;  1H3Z A;  1K0S A;  2J05 A;  2EGA A;  3CCS Q;  3HRS A;  4LDX A;  1VQ6 A;  1MV0 B;  4KGZ B;  1Q7Y R;  4E2F B;  4BI4 A;  4QVC A;  3JSC A;  4EMG A;  2VGM A;  3QZ5 B;  2O9S A;  2DE0 X;  5I2M A;  1N8R R;  1WHJ A;  3C94 A;  2QQ9 A;  4LDY A;  4AG2 C;  3V8L A;  1VQM Q;  1VQ7 A;  3A98 A;  3NTK A;  1KFZ A;  4E7H A;  4QW2 A;  2X3W D;  2IG0 A;  5IHI A;  3REA B;  4F7U G;  2A37 A;  1QWE A;  1VQ9 Q;  1ZBX A;  2LMJ A;  4C5H A;  3UPU A;  1MGQ A;  1SF9 A;  3QZ9 B;  2E5Q A;  4XTY A;  3OS0 A;  1M1K R;  3EGX B;  3BY7 A;  1K73 R;  3CBO A;  1TSF A;  4J6Y A;  1NZ9 A;  1ZQ1 A;  2RHZ A;  4ZGE B;  4KUI A;  4M77 E;  1VQ8 A;  1VQP Q;  1B34 B;  1BU1 A;  1NJI R;  3I56 Q;  3LX7 A;  4R0K A;  5DLO A;  5HCK A;  3VS7 A;  4D8D A;  3OYK A;  1MMA A;  3CCM Q;  2HSP A;  2P4R A;  2DXU A;  1BCM A;  2MWO A;  4M7A F;  2HQH A;  1VQK A;  2DD4 A;  2JJ9 A;  2E6N A;  3NFC A;  4M78 B;  2FB7 A;  1E6H A;  4M7D D;  3H6Z A;  5KYX A;  4ESR A;  2F5T X;  2KSS A;  3J81 E;  3G71 A;  2ZPE B;  5AT1 B;  2JN0 A;  2LTO A;  2RK1 A;  2J7I A;  1X01 A;  2PZ1 A;  5KCH A;  3G7Z A;  2YRC A;  3CCR Q;  2OTJ Q;  4LD9 K;  1YJ9 T;  1V1C A;  1I07 A;  2RD1 A;  3R6N A;  1TG0 A;  1W2B P;  1U3O A;  1Y96 B;  1S72 T;  1JRI A;  4L59 A;  4IUU A;  1UUE A;  1YJN A;  3CXC S;  3CCQ A;  3REB B;  5FU6 B;  2QQR A;  2YUN A;  1AWO A;  3RER A;  1QP2 A;  2X4Y A;  2AHJ B;  3TRE A;  2PUO B;  3GF5 A;  4XK8 E;  1YBY A;  2FL7 A;  4OB0 B;  3QDF A;  2PU9 B;  1WJQ A;  2DRK A;  4FT4 A;  4N4G A;  1YI2 T;  3VS2 A;  3EGU A;  1RAF B;  4PJO A;  2BZX A;  3BDU A;  2DEU A;  3PVQ A;  2YLB A;  3CMA Q;  2RI2 A;  3HP9 A;  2DF6 A;  4FSX A;  3JCM b;  2KI7 A;  5KYU A;  5GAN h;  3L2U A;  1NEG A;  1RAC B;  1PWT A;  1KQ1 A;  4JJD A;  4Z89 A;  1IZ6 A;  2QDL A;  1Q86 R;  4J7F A;  2FPF A;  2M02 A;  2LQ8 A;  3M56 A;  3C4S A;  2GTJ A;  2FO0 A;  2ZCF B;  2YRV A;  2PTK A;  1M3C A;  4OMP A;  4M75 F;  3L2R A;  3CCS T;  4AFS C;  3CPF A;  4NL3 A;  1M30 A;  3EG9 B;  2M16 A;  2CP7 A;  3X26 B;  3AHU A;  1WZO A;  2CUB A;  2DMO A;  3CEY A;  3LWI A;  3CC4 Q;  2LT4 A;  4EIK A;  4F7U B;  1TS9 A;  5GAO l;  5LJ3 j;  4A4G A;  5GMK j;  3P8B B;  2BKD N;  1VQM T;  4LDV A;  2CSQ A;  1CKB A;  1TXQ A;  5ECA A;  4DBQ A;  1J3T A;  2HMA A;  2ZPF B;  1K9M U;  4PJN A;  4JRQ A;  3EGX A;  3JAM E;  1RAD B;  4FSS A;  4PFO A;  4EPC A;  1R8O B;  4JJB A;  3CCE Q;  4HCK A;  3M58 A;  2D0N A;  2XKO C;  3TCJ A;  1B34 A;  1VQ9 T;  2YWW A;  5GAN 4;  2FEI A;  2KDS A;  4JS4 A;  2CZ6 B;  1PHT A;  1IRX A;  4C8Q G;  3QXE B;  3MEW A;  5HKC A;  5GMK l;  2KXD A;  1TUD A;  4PJO E;  3CBP A;  2KMT A;  3HSB A;  2FRW A;  1VQP T;  2RHY A;  5CAI A;  2JS0 A;  4M78 A;  3I56 T;  4JRP A;  1E6G A;  3CC2 Q;  4RTY A;  3EFO B;  3CME A;  3CCM T;  1Q82 C;  2RQT A;  3DB3 A;  3EAE A;  5EG2 A;  1UJ0 A;  1X6B A;  1W2B S;  1YP5 A;  3OYA A;  2RNA A;  3MEU A;  1SRL A;  2PVG B;  3QHS A;  5CQX A;  3SDZ A;  3KXT A;  1Y96 A;  2K5L A;  3EG0 A;  3CCU A;  1WHL A;  1KHC A;  1VA7 A;  2KE9 A;  4M7D F;  1WQ7 A;  2EWN A;  3OYC A;  2OTJ T;  5FU7 B;  3OW2 P;  1WJS A;  3FDR A;  4IUP A;  4XTU A;  3VRY A;  1TOV A;  2YHT A;  3AT1 B;  4MZM A;  4AFQ C;  2V8J A;  3E2U A;  4X9C A;  2L2P A;  3OYJ A;  1NLP C;  3MJX A;  3GNG A;  5GJW B;  2JMA A;  4OB1 B;  4NS5 A;  2DXB A;  1X6O A;  2DNU A;  3S6W A;  4M7A B;  3PIP A;  3OYB A;  4J9G A;  4MDW A;  4J9F A;  4XU3 A;  4J9E A;  5CKE A;  2KYM A;  3OBW A;  1R0B G;  2DIQ A;  4FYW B;  2PVD B;  2DEQ A;  2QXF A;  4C8Q C;  5GAN e;  4QT7 A;  5CKF A;  2RMO A;  2DET A;  3HRT A;  3CMA T;  1VOM A;  4M78 E;  3FB9 A;  2CDT A;  3QJ6 A;  1WGS A;  1NE8 A;  5GAM d;  1YWP A;  4E6R A;  3G1J A;  3MP1 A;  3I55 Q;  1ZSZ C;  3X24 B;  4ME7 A;  3EG9 A;  3OYF A;  2GGR A;  1KC8 R;  1W70 A;  5CKB A;  4HT9 A;  1X43 A;  2EQJ A;  2VVK A;  4F7U A;  2QAS A;  4YTL A;  2CS7 A;  2LNH B;  4KGX B;  3ZFJ A;  1EIF A;  2L89 A;  2YXY A;  5I2S A;  2CP3 A;  2LJ3 A;  1W6X A;  2Y4X A;  1K0X A;  1RI9 A;  2GBQ A;  5GAN f;  4WF2 A;  2CT4 A;  1MMD A;  3QBY A;  1FMV A;  4DBF A;  2MK5 A;  1OZ2 A;  4CC7 A;  1I4K 1;  3UA7 A;  4AMC A;  3CC4 T;  1ZA1 B;  3UDC A;  2CZ7 B;  4ZGD B;  1OX9 A;  3C95 A;  3SD4 A;  2RI5 A;  2XHC A;  2MWP A;  3OS2 A;  3URG A;  4Y91 A;  3MP6 A;  5C6S A;  3Q1J A;  4JLG A;  3UA6 A;  4HVW A;  3CCE T;  2VV5 A;  3VS3 A;  2JM9 A;  4GLK A;  2F1L A;  4CC3 A;  1VYT A;  3LW5 E;  2PVO B;  1ZSZ B;  3EFO A;  4LD6 A;  1W1F A;  2A08 A;  1T3S A;  5GAN 6;  1SRM A;  1Q82 U;  2LVM A;  3NTI A;  2LQK A;  2BIV A;  2HKN A;  2HEQ A;  4M75 B;  2D8J A;  2F69 A;  3G6E A;  4QKU A;  3THK A;  3CC2 T;  1PRM C;  2CZ1 B;  3M0P A;  2JOY A;  1BYM A;  1M90 C;  4ZGJ B;  4CC4 B;  3M0R A;  1HYO A;  2D1X A;  4QVD A;  4R55 A;  4OGC A;  5CIU A;  1KD1 C;  3OW2 S;  1VQ8 T;  2Y90 A;  2O01 E;  2E6Z A;  2KR3 A;  2BE9 B;  3CD6 Q;  1K9A A;  2H8H A;  1GFC A;  2QQA A;  4M78 G;  2RF0 A;  1BI2 A;  4FYY B;  1MNE A;  2JMC A;  1PSE A;  1VQK T;  4F7U E;  1VIF A;  4JS5 A;  2IIM A;  3RIR A;  4Q5W A;  1VQ4 A;  2GNC A;  4M77 D;  3PNW C;  2RJF A;  1H92 A;  5D6X A;  3OA6 A;  5GMK e;  5LJ3 g;  2DFU A;  5DM7 R;  2H3E B;  4HKE A;  3GOX A;  4CC2 A;  2JNG A;  1ACM B;  4Z02 A;  3JCM V;  1NG2 A;  2QA4 Q;  4M7A A;  2QQS A;  1FYN A;  2M9U A;  1B7T A;  4OVA A;  4RTZ A;  2NUP B;  5HK0 A;  3JCM g;  1M3B A;  1K73 U;  1TTH B;  2DL8 A;  1I1J A;  2KVQ G;  3A8O B;  2DZ9 A;  4ATO A;  5GAO r;  1QP3 A;  2GTO A;  2K57 A;  2O31 A;  2J6K A;  4D8K A;  3CXC P;  2E10 A;  4J9D A;  2JM8 A;  3HTR A;  1UGS B;  1UE9 A;  5FW9 A;  3CC7 A;  2MPX C;  1YIT Q;  1TWB A;  1VYV A;  4RTW A;  1G2B A;  4M7D B;  4OML A;  1RAI B;  4FIB A;  4HT8 A;  3RBB B;  3PIO A;  5IAY A;  2QAZ A;  4LNP A;  2VYT A;  3PGG A;  1VQ5 Q;  1Y07 A;  3QWX X;  4UC4 A;  2E3H A;  4J9I A;  3I55 T;  2MI6 A;  2V8K A;  4XTZ A;  3L2Q A;  2LQW A;  4CI0 C;  4EMH A;  1JU5 C;  4RMO A;  1X6G A;  4BI3 A;  3M53 A;  2D6F A;  1PCX A;  2DO3 A;  2M0O A;  3GLX A;  2EPD A;  4QQD A;  2CH4 A;  4AG1 C;  3WVE B;  4NL2 A;  1AWJ A;  2K6D A;  4Z88 A;  4M78 C;  3UAT A;  1VQL Q;  1LVK A;  3CCL A;  3S3N A;  2JS2 A;  4ANJ A;  4OMO A;  1C0M A;  4C8Q A;  2DER A;  3FJ5 A;  1C6V X;  1YJW A;  1AZE A;  3V7C A;  1RAH B;  2KXC A;  2NWM A;  3GP8 A;  3H0H A;  3CCV Q;  2X9H A;  4M7A E;  2B8A A;  2AKL A;  2QYZ A;  4J83 A;  5IXF A;  4BAC A;  1ZSZ A;  2HBW A;  4ELY C;  1YIJ A;  2FYK A;  4E7K A;  2FG0 A;  1K9M C;  4J5Y A;  1VQO A;  1LNX A;  4RUG A;  3J80 E;  2XDB A;  5FU6 C;  4C5G A;  2ED1 A;  2YUO A;  4D6W A;  3OYI A;  1GCQ C;  2LNV A;  1JJ2 S;  3MHX A;  2EFI A;  1ZLM A;  4XAX B;  4A4F A;  1YWO A;  1M90 U;  5KYY A;  5GAN j;  1QVF A;  3A8H B;  4ORZ A;  2HD0 A;  4E7J A;  1KD1 U;  4DA4 A;  4A4K A;  3RKW A;  1ZHI A;  4J6X A;  3A8G B;  4RCC A;  2LQN A;  2LJ1 A;  4ZTF A;  3H0F A;  2DL4 A;  1UTI A;  2MOX A;  3M0S A;  2FZG B;  2IVW A;  1WX6 A;  2COW A;  1D1B A;  1OYX A;  4E7S A;  3CD6 T;  4LXC A;  2YLC A;  2EYQ A;  1XQH A;  2HL3 A;  3RMQ A;  4V2S A;  1WHK A;  2E1H A;  3WVD B;  1WYX A;  3OYH A;  3JCM P;  2CP0 A;  4PJO D;  2K7A A;  2VGN A;  3I35 A;  3F70 A;  2NYS A;  2QEX A;  2FRY A;  2CRE A;  2RQV A;  2NUP A;  2FVU A;  3EHR A;  3SB2 A;  1MUZ A;  3ZEH A;  4C8Q E;  4M77 F;  2LX9 A;  4F16 A;  3M0T A;  4PJJ A;  3V8J A;  3X20 B;  2J6F A;  1JQQ A;  4OMN A;  5KE2 A;  2QA4 T;  4WCI A;  2LCC A;  2ZPG B;  1AD5 A;  1IGQ A;  4OMQ A;  2OTL A;  3BFM A;  1LPL A;  3H8Z A;  3MO8 A;  1SPK A;  1H3H A;  1M2O A;  4KH1 B;  1Q81 U;  5A0D A;  1QLY A;  2DBK A;  4M7A G;  1QMC A;  2DLP A;  4HVV A;  3G4S Q;  1JJ2 A;  2R5M A;  4J6W A;  3CCJ A;  4PL6 A;  2F2W A;  3OY9 A;  4A53 A;  2XI9 A;  4C92 F;  3HFN A;  2K3Y A;  1YIT T;  2DVJ A;  2JW4 A;  4RG2 A;  2RPN A;  2ZPH B;  4BUG A;  1BCO A;  3FRN A;  1SKU B;  3SHW A;  3QO3 A;  1VQ5 T;  1RAB B;  1AZG B;  1O9S A;  3VYH B;  4PNO A;  4A4E A;  4FYV B;  4LE9 A;  4Y28 E;  1MMG A;  1Y71 A;  5I22 A;  1RUW A;  2HAX A;  4PK4 A;  1V76 A;  2L3S A;  3A5Z B;  3BDL A;  4BE0 A;  1ABQ A;  2DD5 A;  2DL3 A;  5GAM h;  2W10 A;  2LCS A;  4A63 B;  2AIR B;  2P0K A;  1M4Z A;  2VAS A;  4EMK B;  5GAN 7;  2BUD A;  1UG1 A;  2NUT B;  3L1A A;  4PJL A;  2J6O A;  3R6O A;  4X9D A;  1UEB A;  1VQL T;  1VQ6 Q;  3NMZ C;  4K11 A;  4RCB A;  3FLG A;  4M4Z A;  1QW1 A;  1OI1 A;  4BB7 A;  4IUT A;  1SG5 A;  5L23 A;  2HBP A;  4JPB W;  4M78 D;  3L2Z A;  1SHF A;  1I5L A;  1K8A C;  5FU7 C;  1XJW B;  1BI3 A;  3CCV T;  1HK9 A;  1VQ7 Q;  1N5Z A;  4JDS A;  3KUF A;  4E47 A;  5I21 A;  4OB3 B;  2KRS A;  5GAO n;  2VKN A;  2DYB A;  5D6Y A;  5GAN 2;  4NOY A;  2I0N A;  4CRI A;  1UB4 A;  2K3B A;  5LJ5 g;  5FRM A;  1FMW A;  1T3L A;  3RR6 A;  2EYX A;  5LJ5 d;  3I5S A;  2EJ9 A;  5KE3 A;  3E1S A;  1IB8 A;  2BZY A;  3GPL A;  2L3Q A;  3VS6 A;  3L42 A;  4IIM A;  1B3Q A;  2LCL A;  1QVG A;  4M7A C;  3SWN C;  5DY9 A;  4DQ2 A;  1KSW A;  3RKY A;  1VQ8 Q;  2FPE A;  2NLU A;  2RH2 A;  4XU2 A;  4M75 G;  5IT9 E;  1VQN A;  4J9H A;  1IO6 A;  2DAQ A;  1M9S A;  3P8H A;  2DPP B;  1XTD A;  1H8K A;  1ARK A;  1PKT A;  3VS4 A;  1VYU A;  1YJ9 A;  1VQK Q;  4A54 A;  4QQ6 A;  2HZY A;  1UFF A;  1IGU A;  4AFU C;  1JO8 A;  2QI2 A;  4Y92 A;  3V7R A;  1Q7Y C;  3G71 Q;  1E7O A;  2E65 A;  2ATC B;  5FWC A;  1GCQ A;  4FT2 A;  1RI0 A;  1N8R C;  1WNL A;  3QII A;  2F2X A;  1I5O B;  3JB9 D;  5GAN 5;  3MEV A;  1KIK A;  1IXD A;  1G83 A;  2J06 A;  2EYW A;  1KJW A;  2LDM A;  1U1T A;  2QEX Q;  1YJN Q;  1WLP B;  3CCQ Q;  1YN8 A;  2EYZ A;  3S3M A;  3SWN B;  1PSF A;  3M57 A;  5I11 A;  1YI2 A;  3FC3 A;  5D7U A;  2A7Y A;  1K73 C;  5CKD A;  2FZC B;  2FZK B;  2EVR A;  3HFO A;  4PKC C;  3ER0 A;  2GQV A;  4MML A;  1QVP A;  3V7S A;  3HKS A;  1NJI C;  3E9F A;  2KQW A;  3G4S T;  4B9X A;  2DA9 A;  3CPW A;  3X25 B;  1K1Z A;  2VXE A;  2O4X B;  1YHQ A;  1UEC A;  2VXF A;  4M7D G;  2KK4 A;  1WHM A;  1M2V B;  3PFS A;  1PC0 A;  1QVF P;  1OPL A;  2RJE A;  2HQX A;  4XTW A;  4M77 B;  4M75 C;  4EMK A;  2KEA A;  5GAM e;  3NHN A;  2CSI A;  3CCS A;  1SEM A;  1D1A A;  1WDX A;  3EGD B;  3OYN A;  2QDY B;  4IIO A;  1WHH A;  3LGF A;  2V8I A;  1K8A U;  3H41 A;  2QQB A;  2NUZ A;  1FXX A;  1IHW A;  2KRO A;  4Z8A A;  1VQM A;  1VQ6 T;  1OQK A;  1WHG A;  3HL8 A;  1UJY A;  3EG2 A;  1Z9Z A;  3OB9 A;  1Y7X A;  5FWB A;  2EW3 A;  3TVT A;  2HQE A;  4E7Z A;  3T9N A;  4C92 B;  5GAN 8;  1JB0 E;  1ZA2 B;  5GAM f;  5AYF A;  3TU4 K;  1VQ9 A;  1VQ7 T;  5HK3 A;  1KK7 A;  3ME9 A;  2COY A;  2X3X D;  3PVL A;  3HRU A;  4JUV A;  2AZV A;  1ZUU A;  3QDR B;  1G5V A;  4TVR A;  2RQW A;  2K3X A;  3C12 A;  3JV3 A;  1VQP A;  1AWX A;  4BDZ A;  3I56 A;  2QK0 A;  4FW1 A;  1PKS A;  1AEY A;  1ZUK A;  4RTV A;  2HDA A;  2WSC E;  4B6M A;  3CCM A;  2RO0 A;  1JXO A;  2CYZ B;  4C5I A;  1WXT A;  4WTO B;  2EJG A;  3EFR A;  1YNZ A;  3NGP A;  1JJ2 P;  1SHG A;  5IN1 A;  1WJR A;  3UWN A;  3VS0 A;  4M7D C;  3UF4 A;  3CME Q;  1Q7Y U;  5C0M A;  1RLP C;  2X4X A;  3J7A F;  4BY6 B;  4N0A A;  3LH5 A;  3CCR A;  2OTJ A;  2RHX A;  1N8R U;  1T0J A;  2R57 A;  2KBT A;  1KG1 A;  1KQS A;  3O8V A;  1HD3 A;  4LN2 A;  1I81 A;  3G71 T;  3EHQ A;  3CCU Q;  4ZN1 A;  5LJ3 d;  2PNI A;  2LJ0 A;  4J9B A;  2QGG A;  5CO7 A;  3SWN A;  4B9W A;  1B07 A;  1UGR B;  4F04 B;  2ZPB B;  1N9S A;  1X2K A;  1CSK A;  1M1K U;  3JB9 J;  2L3P A;  4RTX A;  3JCM d;  2JTF A;  2X35 A;  3D7S B;  3OYD A;  3VV0 A;  2YSQ A;  2RA2 A;  3WXM B;  4DOW A;  2QEX T;  1YJN T;  4BE2 A;  3LGL A;  5GAO m;  4IUR A;  3CCQ T;  1Y57 A;  3M5A A; 
#chains in the Genus database with same CATH homology
 2DTI A;  2XKO C;  4FL6 A;  1OYX A;  3TCJ A;  1B34 A;  1W2B A;  3E9G A;  3VKI A;  1VQ9 T;  3M4G A;  1NJI U;  2L8D A;  2YLC A;  2EYQ A;  4C5E A;  5GAN 4;  3MET A;  1XQH A;  5CK9 A;  4V2S A;  3RMQ A;  2E41 A;  2O4X A;  2E1H A;  2KDS A;  3ASK A;  4JS4 A;  2CZ6 B;  1VQL A;  1QVF S;  2RB6 A;  3WVD B;  2DK3 A;  3PMI A;  4C8Q G;  5CKH A;  3OQ5 A;  4MMK A;  3QXE B;  2Y4Y A;  4IUQ A;  3MEW A;  5HKC A;  5GMK l;  3OYH A;  3CMA A;  3QKJ A;  4LDW A;  3OSS C;  4C0F A;  3JCM J;  3JCM P;  2GCX A;  3CBP A;  1Q81 C;  4HCC A;  4BY6 C;  2KMT A;  4PJO D;  3HSB A;  1SSF A;  2VGN A;  5J26 A;  5GAO q;  1VQP T;  3F70 A;  3RKX A;  2QEX A;  2RHY A;  4M77 A;  5CAI A;  2FVU A;  4M78 A;  3I56 T;  3CCV A;  4JRP A;  3SB2 A;  3ZEH A;  2E70 A;  1M1F A;  4C8Q E;  4M77 F;  4C8Q D;  2DTH A;  2LX9 A;  4R56 A;  2K5I A;  3V8J A;  4M78 F;  3X20 B;  5GMK m;  3CME A;  3CCM T;  3CCL T;  1Q82 C;  5EG2 A;  2EQU A;  3DB3 A;  3EAE A;  2G3R A;  5KE2 A;  3RUX A;  2QA4 T;  3P8D A;  2LCC A;  4J8O A;  1W2B S;  1YJW T;  2RK2 A;  2ZPG B;  2DKG A;  2ZGW A;  3OYA A;  4A4H A;  3MEU A;  3JCM X;  2PVG B;  3QHS A;  3KBG A;  2OTL A;  5CQX A;  3SDZ A;  2DJZ A;  3L2V A;  2EKO A;  3KXT A;  3BFM A;  4MZP A;  3HHT B;  3SFM A;  1Y96 A;  4C8Q B;  2K5L A;  1G3Y A;  3H8Z A;  3MO8 A;  3OYY A;  2LC4 A;  3OMG A;  3CCU A;  3JCM Q;  1KHC A;  3PT9 A;  1YIJ T;  4VUB A;  4M7D F;  4OMF B;  4XU1 A;  1V29 B;  1WQ7 A;  2EWN A;  3OYC A;  1Q81 U;  5A0D A;  1VQO T;  2OTJ T;  4PLL A;  4M7A G;  3EFS A;  5FU7 B;  4C92 A;  2XIC A;  2M1H A;  2XDP A;  2R5M A;  4J6W A;  4QQG A;  4PL6 A;  3OY9 A;  3CCJ A;  1JJ2 A;  2X4W A;  3CC4 A;  4A53 A;  1M5Q 1;  2XI9 A;  4C92 F;  3HFN A;  1WJS A;  2K3Y A;  1YIT T;  2PQW A;  3FDR A;  3OS1 A;  2MAM A;  4RG2 A;  4IUP A;  1BI0 A;  2ZPH B;  4BUG A;  4XTU A;  2XID A;  1WQW A;  2EQM A;  3FRN A;  3M54 A;  2JVV A;  3M58 A;  3E19 A;  2YHT A;  1Q86 C;  4MZM A;  1KQ2 A;  3QG1 A;  3N5B B;  3QO3 A;  4M7A D;  1VQ5 T;  2DTO A;  5FRN A;  1O9S A;  3VYH B;  2DXT A;  4PNO A;  3VUZ A;  4A4E A;  2V8J A;  4X9C A;  2XDD A;  4JLI A;  3OYJ A;  4Y28 E;  3CCE A;  4XTX A;  1XNI A;  1Y71 A;  3NTH A;  3GNG A;  2HAX A;  2JZ2 A;  3FJP A;  4M75 A;  3A5Z B;  3OS2 A;  1AHJ B;  4OB1 B;  4BE1 A;  3BDL A;  3M55 A;  5CCA A;  4NS5 A;  4BE0 A;  3TEE A;  3JCM c;  2DD5 A;  2DXB A;  2KY9 A;  1X6O A;  5M9O A;  3S6W A;  4M7A B;  3PIP A;  4LDU A;  5GMK i;  3OYB A;  4GY5 A;  5GAM h;  1LOJ A;  2DVE A;  1BIA A;  4MDW A;  1UGP B;  4XU3 A;  3S3O A;  3LLR A;  1W4S A;  5CKE A;  4PJO C;  4C0D B;  1N27 A;  2P0K A;  3OBW A;  1M4Z A;  2F5K A;  4EMK B;  2DIQ A;  4PLI A;  5GAN 7;  2BUD A;  3L1A A;  2RM4 A;  5KCO A;  2RJD A;  4OP0 A;  3R6O A;  1G3W A;  1UEB A;  4X9D A;  1VQL T;  3CC2 A;  2DXC A;  2PVD B;  1Q86 U;  1TH7 A;  2ZPI B;  2DEQ A;  2D9T A;  2QXF A;  4C8Q C;  1I8F A;  2XK0 A;  4RCB A;  5GAN e;  2A3L A;  2RI3 A;  5CKF A;  3FLG A;  4ZN3 A;  3JB9 F;  3HRT A;  1P92 A;  2CZ0 B;  3CMA T;  1QW1 A;  1WPY A;  4XQ3 A;  1OI1 A;  5LJ5 h;  4BB7 A;  4IUT A;  4M78 E;  1VUB A;  2HBP A;  2QTX A;  3FB9 A;  1GXI E;  3L2Z A;  3OSV A;  3QJ6 A;  4M78 D;  2I2L A;  1WGS A;  3RES A;  4BI8 B;  3LWH A;  1NE8 A;  3L2W A;  1NPR A;  1K8A C;  1I5L A;  5GAM d;  2P4T A;  5FU7 C;  5LJ3 e;  1BI3 A;  1NPP A;  1DJ7 B;  3CCV T;  4HA8 A;  1HK9 A;  3MP1 A;  5GAM j;  1KC8 C;  3X24 B;  4JDS A;  3KUF A;  4O6J A;  4E47 A;  5I21 A;  4ME7 A;  4DOV A;  3CME T;  3OYF A;  4OB3 B;  4MZT A;  4II1 A;  3RMS A;  5GAO n;  5CKB A;  3QJY A;  3UT1 A;  3DLL A;  4HT9 A;  3JCM e;  5D6Y A;  5CVI A;  5GAN 2;  4NOY A;  4E7L A;  2EQJ A;  4CRI A;  1UB4 A;  5LJ5 g;  1VQN T;  2E12 A;  5FRM A;  2GFA A;  5LJ5 d;  3HPW A;  2OTL T;  1KHI A;  4F7U A;  4YTL A;  3G4S A;  4ATO A;  2CS7 A;  3ZFJ A;  2EJ9 A;  1EIF A;  2L89 A;  4P5N A;  5I2S A;  5KE3 A;  5LJ5 j;  2Y4X A;  2HNI A;  2L3R A;  3E1S A;  3A8M B;  4RG8 A;  2P0P A;  2CKK A;  4J7I A;  2FHD A;  2R58 A;  4O5V A;  4F7U F;  4IKF A;  4JRI A;  3BW1 A;  5LL6 S;  3CCU T;  5GAN f;  2L5Q A;  4WF2 A;  3GPL A;  4PJO E;  4C92 E;  1U1S A;  3QBY A;  3L42 A;  1FX7 A;  2LCL A;  4C92 D;  2KAF A;  3CBM A;  3OMC A;  4N4H A;  1OZ2 A;  1QVG A;  1O75 A;  4XU0 A;  2EQK A;  2LT1 A;  2K5F A;  4FM4 B;  3SWN C;  5DY9 A;  3PTA A;  4M7A C;  4DQ2 A;  3OBY A;  1I4K 1;  1D3B A;  4X34 A;  2OAU A;  5LJ3 f;  3CC4 T;  3RKY A;  4OGE A;  2X4J A;  3CCJ T;  1G3S A;  1M1G A;  2NLU A;  2RH2 A;  2RHU A;  4XU2 A;  3UDC A;  1YCY A;  2CZ7 B;  5J39 A;  4ZGD B;  4C0D C;  4PJO B;  4M75 G;  5IT9 E;  4C0Z A;  4EMK C;  3C95 A;  1VQN A;  5A0L A;  1RL2 A;  3SD4 A;  2K2V A;  2RI5 A;  2D0Q B;  3VYG A;  2E64 A;  1N6A A;  1M9S A;  2DAQ A;  2MWP A;  2XHC A;  3P8H A;  3MP8 A;  3MEA A;  2DPP B;  4Y91 A;  3MP6 A;  3URG A;  3JCM f;  1XTD A;  3V8K A;  5C6S A;  4M7D A;  3Q1J A;  1HXD A;  4JLG A;  1BI1 A;  1VIE A;  1YJ9 A;  2JUF A;  2XG8 D;  3QSU A;  4M75 E;  4A54 A;  3OW2 A;  4QQ6 A;  1BIB A;  3CCE T;  4M75 D;  2K4Y A;  1MHN A;  3PMT A;  3JB9 G;  5A2Q E;  2VV5 A;  2DZC A;  1H3Z A;  2QI2 A;  3V7R A;  1Q7Y C;  4GLK A;  3HRS A;  4LDX A;  2E65 A;  3LW5 E;  1QVG S;  2PVO B;  1VQ6 A;  3LH0 A;  4LD6 A;  4ZTJ A;  4FT2 A;  4BI4 A;  3FEO A;  1RI0 A;  2JTM A;  5GAN 6;  1N8R C;  4QVC A;  3JSC A;  2LVM A;  3NTI A;  1WNL A;  2VGM A;  3QII A;  2LQK A;  3QZ5 B;  4EMG A;  1Q82 U;  2BIV A;  5I2M A;  3JB9 D;  4L5G A;  4M75 B;  2C06 A;  4HCZ A;  1IRE B;  3C94 A;  2H3J A;  2QQ9 A;  4LDY A;  5GAN 5;  2F69 A;  3MEV A;  3G6E A;  3X28 B;  3V8L A;  4C0G A;  3CC2 T;  3M9Q A;  2CZ1 B;  1VQ7 A;  3I55 A;  1BKB A;  2JOY A;  1BYM A;  1M90 C;  3NTK A;  3GIB A;  4ZGJ B;  4E7H A;  4QW2 A;  2LDM A;  4QVD A;  4R55 A;  4OGC A;  5CIU A;  1KD1 C;  3OW2 S;  4C8Q F;  2EIF A;  1VQ8 T;  1U1T A;  3FIF A;  2IG0 A;  2Y90 A;  2O01 E;  2E6Z A;  4F7U G;  1G3T A;  3S3M A;  1YHQ T;  3SWN B;  1PSF A;  3M57 A;  3DKM A;  1YI2 A;  3FC3 A;  1ZBX A;  3OYE A;  4C5H A;  3UPU A;  1MGQ A;  2A7Y A;  2QQA A;  4M77 G;  4KUD K;  3QZ9 B;  4RKU E;  2E5Q A;  4M78 G;  4XTY A;  5CKD A;  1BI2 A;  1K73 C;  4MDX A;  3HFO A;  4PKC C;  5CQY A;  3OS0 A;  1M8V A;  3ER0 A;  1PSE A;  3BY7 A;  1VQK T;  2GQV A;  4F7U E;  3CBO A;  2WSE E;  1VIF A;  4MML A;  1QVP A;  4J6Y A;  3V7S A;  2R5A A;  1NZ9 A;  2RHI A;  4JS5 A;  1ZQ1 A;  2RHZ A;  3HKS A;  4ZGE B;  1NJI C;  4KUI A;  3RIR A;  3E9F A;  4Q5W A;  1VQ4 A;  2KQW A;  3G4S T;  4M77 E;  4B9X A;  1VQ8 A;  1XOV A;  3QPH A;  1B34 B;  3CPW A;  4M77 D;  3PNW C;  1JBM A;  2RJF A;  5HY6 A;  3X25 B;  3CD6 T;  2VXE A;  3LX7 A;  2GF7 A;  5D6X A;  1N9R A;  5DLO A;  2O4X B;  3DB4 A;  3OYM A;  3OYK A;  3OA6 A;  1YHQ A;  2XD0 A;  5GMK e;  2VXF A;  4M7D G;  2KK4 A;  3QUI A;  4KT0 E;  4ELZ C;  5LJ3 g;  5DM7 R;  4HKE A;  3GOX A;  2JNG A;  4Z02 A;  3JCM V;  3DLM A;  4M7A A;  3PFS A;  3GNF B;  2QQS A;  2DXU A;  2M9U A;  2RJE A;  4N0A C;  4OVA A;  2HQX A;  2MWO A;  4M7A F;  4XTW A;  1VQK A;  2ZZD A;  2DD4 A;  2E6N A;  3NFC A;  4C92 G;  4M77 B;  4IUV A;  4M75 C;  4EMK A;  3CXC A;  5GAM e;  4M78 B;  3JCM g;  5HK0 A;  3OYG A;  1K73 U;  4M7D E;  2FB7 A;  4M7D D;  3H6Z A;  5GAO p;  3CCS A;  2F5T X;  2KSS A;  3J81 E;  3G71 A;  2ZPE B;  2KVQ G;  3A8O B;  3ZBD A;  2JN0 A;  1UGQ B;  2DZ9 A;  2RK1 A;  2LTO A;  1QP3 A;  2K57 A;  1X01 A;  2QDY B;  4EDU A;  3OYN A;  5GAO r;  2E10 A;  4BD3 A;  5KCH A;  3G7Z A;  3CPW S;  4LD9 K;  1YJ9 T;  1UGS B;  2RD1 A;  2EJF A;  3LGF A;  3QYG B;  5L8R E;  2V8I A;  3CC7 A;  3VUB A;  5LJ5 e;  1K8A U;  2P0Q A;  2QQB A;  3MCA B;  1FXX A;  4M7D B;  1Y96 B;  1VQM A;  1S72 T;  5FRO A;  1VQ6 T;  1JRI A;  3HL8 A;  4FIB A;  4HT8 A;  3PIO A;  1KC8 U;  3LYI A;  4L59 A;  5IAY A;  4BDY A;  2VYT A;  3OB9 A;  3PGG A;  4IUU A;  4KUL A;  1Y7X A;  4QVZ A;  4JRK A;  2HQE A;  1YJN A;  3CXC S;  3T9N A;  1Y07 A;  4C92 B;  5GAN 8;  4UC4 A;  1JB0 E;  3CCQ A;  4N4I A;  5FU6 B;  2QQR A;  3G6E T;  5GAM f;  1QP2 A;  5AYF A;  3CD6 A;  2X4Y A;  4E7I A;  3TU4 K;  3RER A;  1VQ9 A;  2AHJ B;  1VQ7 T;  2VC8 A;  3I55 T;  1FWZ A;  5HK3 A;  3ME9 A;  2MI6 A;  3TRE A;  2PUO B;  2V8K A;  4XTZ A;  3GF5 A;  4L6V 5;  4XK8 E;  3L2Q A;  1YBY A;  4CI0 C;  2FL7 A;  4OB0 B;  4EMH A;  3HRU A;  4JJN K;  4JUV A;  4RMO A;  1S72 A;  2PU9 B;  1WJQ A;  4BI3 A;  3QDR B;  3M53 A;  4FT4 A;  2D6F A;  1G5V A;  2M0O A;  2DO3 A;  3GLX A;  4N4G A;  4QQD A;  4TVR A;  5J3B A;  2K3X A;  1X75 C;  5LJ5 f;  3C12 A;  1YI2 T;  3A8L B;  1VQP A;  4OB2 B;  4BDZ A;  3WVE B;  4PJO A;  4NL2 A;  3BDU A;  4M77 C;  5A0G A;  3I56 A;  4M78 C;  2MF2 A;  4PJO F;  3CCR T;  2MMP A;  1OZ3 A;  2YLB A;  1U8R A;  2WSC E;  2WSF E;  3CCM A;  3CCL A;  3S3N A;  2RI2 A;  3HP9 A;  4C8Q A;  2QA4 A;  2RO0 A;  2CYZ B;  1YJW A;  4FSX A;  3JCM b;  4C5I A;  1VQ4 T;  2EJG A;  3EFR A;  3V7C A;  3INZ A;  3GP8 A;  5GAN h;  3L2U A;  4M7A E;  5IN1 A;  2B8A A;  1WJR A;  1KQ1 A;  3UWN A;  4M7D C;  1IZ6 A;  1Q7Y U;  4BAC A;  4J83 A;  2LRQ A;  1M1K C;  4J7F A;  5C0M A;  4ELY C;  1YIJ A;  5LJ3 h;  2FYK A;  2EAY A;  2X4X A;  4E7K A;  1K9M C;  4J5Y A;  4BY6 B;  3J7A F;  3OYL A;  5GMK h;  4N0A A;  1VQO A;  3CCR A;  2OTJ A;  1LNX A;  3QYH B;  2RHX A;  1N8R U;  1H64 1;  2R57 A;  3VJP A;  3JB9 I;  3J80 E;  1KG1 A;  2LQ8 A;  4C92 C;  1KQS A;  2DIG A;  3M56 A;  4FU6 A;  3O8V A;  5GAN 3;  3C4S A;  2XDB A;  5FU6 C;  2ZCF B;  4C5G A;  1I81 A;  2XU8 A;  2YRV A;  4D6W A;  4M75 F;  3L2R A;  5GAN g;  3CCS T;  3OYI A;  1YIT A;  3CPF A;  4OF1 A;  3JCM h;  5GAN d;  2LNV A;  5KH6 A;  4NL3 A;  3G71 T;  3MHX A;  2EFI A;  1JJ2 S;  2M16 A;  4XAX B;  3X26 B;  4A4F A;  3M59 A;  3AHU A;  1M90 U;  5GAN j;  3JB9 H;  2PUK B;  4ZN1 A;  5CR2 A;  1QVF A;  3A8H B;  4E7J A;  2HD0 A;  1VQ5 A;  1KD1 U;  5DLQ E;  3JRZ A;  5LJ3 d;  3CEY A;  3LWI A;  4DA4 A;  2LT4 A;  5CO7 A;  3SWN A;  3VU3 C;  4A4K A;  4F7U B;  2GFU A;  3RKW A;  5GAO l;  3CC7 T;  4B9W A;  1ZHI A;  3OS5 A;  4J6X A;  5LJ3 j;  4A4G A;  5GMK j;  1LJO A;  1UGR B;  3P8B B;  2BKD N;  3A8G B;  2ZPB B;  4LDV A;  4RCC A;  1N9S A;  3JCM W;  1VQM T;  4ZTF A;  4HCB A;  1M1K U;  2CGH A;  3M4Y A;  3JB9 J;  2WAC A;  2ZPF B;  2VUB A;  1K9M U;  3JCM d;  4JRQ A;  2JTF A;  2X35 A;  2RJC A;  5GAM g;  3OYD A;  4KBM B;  3VV0 A;  2RA2 A;  3WXM B;  4DOW A;  3JAM E;  2QEX T;  1KQS S;  5D6W A;  1YJN T;  4BE2 A;  3LGL A;  5GAO m;  4IUR A;  3CCQ T;  5FLX E;  1D3B B;  2IVW A;  1R8O B;  4XTV A;  4EPC A;  3M5A A;  4PJO G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...