4M7DD

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
b'VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 16
structure length 74
sequence length 74
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dD00
4C8QC 1Y96A 4X9DA 2EJ9A 4RCBA 5LJ5f 1YCYA 3RKXA 5GAMj 4PJOD 4C8QB 1WPYA 5GANh 4NL3A 3BY7A 5LJ3f 1JBMA 2DVEA 4EMGA 3JCMP 4C92C 5GAMf 5GAOr 1KQ2A 1KQ1A 3V8JA 4EMHA 4M75E 4M77D 4M78B 5LJ5h 4XU3A 4C92G 5GMKh 3JCMJ 3RUXA 4M7DD 4XTWA 4XTVA 4M77C 2DXTA 1N9SA 2DTOA 2FB7A 4M78D 4M77B 2E65A 4C8QF 3JCMf 5LJ3e 5GAMg 1H641 4M75C 2VC8A 5GANf 4A53A 2DZ9A 5GMKl 4JLIA 3JB9J 2VXEA 4M78C 4J6YA 4PJOG 5GMKm 5GAN3 2CGHA 4C92B 3JCMb 5GANd 2DJZA 4M78G 5GAN4 3QSUA 4XU0A 4M7AG 3INZA 3BDUA 3JB9D 3V8LA 5GMKi 3RKYA 3JCMg 4M7AC 3FJPA 5GMKj 1LNXA 4C92D 1Y96B 2EJGA 4J6WA 4M77E 3V7RA 2QTXA 1WQWA 1HK9A 4N0AC 5GAN2 4JRIA 2YLCA 4HT9A 3QUIA 3JCMh 3JB9G 4J6XA 2YLBA 3VU3C 4M75F 4XTUA 5GAMe 5LJ3g 4OP0A 1B34A 3FB9A 4F7UA 4XTYA 1I81A 2JN0A 4X9CA 4RCCA 3SB2A 2EJFA 3EFSA 1U1TA 3L1AA 2DTHA 3HFNA 5GAMd 4F7UE 3SWNB 5GAMh 1LOJA 1JRIA 4EMKC 5I21A 4M75A 2RB6A 5GMKe 1BIAA 5GANe 4EMKA 4C92F 4MMKA 1I8FA 5LJ3h 5GANg 3AHUA 2RA2A 3JCMX 4M77A 2K57A 3JCMe 1N9RA 3HFOA 2E64A 3JCMd 4Y91A 4C8QG 4HA8A 5GAN6 4M7DC 4M77F 4QVDA 3JCMQ 4JUVA 3L2ZA 3RESA 3PGGA 4M7DG 4DQ2A 2DKGA 4PJOB 4V2SA 4PJOF 3V7CA 4EMKB 4M78F 3SWNC 2E1HA 4XTXA 5LJ3d 5GAOl 4A54A 5GAOq 4XTZA 4M7DA 1LJOA 2RD1A 3JCMV 4C8QA 4M7AE 5CAIA 5LJ3j 1HXDA 2E10A 4PNOA 3JCMc 2EWNA 2VXFA 4MMLA 3EFRA 4M77G 4J5YA 4F7UF 5LJ5e 3RKWA 2EAYA 3V7SA 4M7DF 1U1SA 3GIBA 3JB9F 4M7AD 4M7DB 5GAN8 4HT8A 4M75G 2DXUA 4QVCA 4PJOA 4C92E 4WF2A 5LJ5g 4XU1A 4PJOC 3HSBA 3JB9I 3JCMW 1D3BB 2HNIA 4M7AB 5GAOn 3RIRA 3V8KA 2DZCA 4M75D 5DY9A 2DEQA 4NL2A 3M4GA 5GANj 5GAOm 4F7UG 1I5LA 3JB9H 4C92A 4PJOE 3QO3A 4M75B 4M78E 3QHSA 4N0AA 5GAOp 3SWNA 1WNLA 3BFMA 1M8VA 4XQ3A 4JRKA 5GAN5 4M7AF 2I2LA 2E41A 2FYKA 2YHTA 1D3BA 1WQ7A 4C8QE 3RERA 4M7AA 2RM4A 4F7UB 1B34B 5LJ5j 4M7DE 4NOYA 4M78A 1MGQA 1M5Q1 2Y90A 4XU2A 1I4K1 1X01A 2DTIA 3FIFA 5GAN7 4C8QD 1BIBA 5LJ5d 1TH7A 2ZGWA 3BW1A
chains in the Genus database with same CATH superfamily
2WSEE 2OAUA 1IGUA 4AFQC 3EGDA 2C0IA 1ZSZA 4PJLA 5LJ3f 5FU7C 3OS0A 1Q81R 2KT1A 3JCMJ 4M77C 4Y28E 1N9SA 2KY9A 1H641 2F2XA 4WCIA 4C92B 3EHQA 1SG5A 1GFCA 1TUGB 5KYYB 2J05A 3CCLT 4J6XA 4FSSA 3FDRA 4KH0B 4FYVB 4LD6A 2ZPHB 3CXCA 5GAMh 2OTLA 4EMKC 1PD0A 1S1NA 5FWCA 2ZAEA 4ORZA 1UUEA 4E2FB 4Y91A 2RQRA 1NG2A 1SSFA 4BD3A 2FO0A 2XD0A 2GFAA 1OYXA 4C8QA 5CAIA 1HXDA 2LQKA 3AT1B 2FVUA 3GIBA 1K0XA 5GAN8 1QMCA 1JJ2S 4C92E 1QP2A 4WF2A 3HP9A 4OMLA 4D6WA 1JXOA 4FU6A 1MMDA 4BY6B 4MZTA 2EQUA 2GNCA 4NL2A 3PE0A 1PSFA 2DFUA 4AMCA 4KUIA 2JW4A 1ARKA 2RQWA 2I2LA 3OYEA 1YJNA 2YHTA 3CQTA 2AKLA 3OMCA 1FMKA 1YWPA 1I0CA 2A28A 2HBPA 1ZBXA 4C8QD 4OB3B 3TQ7P 8AT1B 1QKWA 1A0NB 3MCAB 2QASA 2YUOA 2KK4A 4EMGA 4OMOA 4M78B 2CP7A 2QG9B 3PMIA 1WXUA 1OU8A 1JQQA 2MWOA 3JCMf 1D0ZA 1EZZB 3SHWA 1YI2Q 4J6YA 2RK2A 3EG1A 3TU4K 2QYZA 1YHQA 1GCQA 2RJDA 4M7AC 1Q82C 3VS0A 3CMAT 2O9SA 3FB9A 3CC4A 1KQSA 4IIOA 3LH0A 1P92A 2LT1A 5GAMd 2RHZA 4RTWA 3TSZA 4DOVA 2RB6A 1PSEA 2RJFA 4C92F 3HL8A 3EGXA 1I5OB 1WJQA 1VQ8T 2RQVA 2J6FA 4M7DC 2LJ3A 1AWXA 3OW2A 5FU6C 4A4KA 2K4YA 1D1CA 2CP5A 1VA7A 2D0QB 3GPLA 1YITA 4JJBA 3GNGA 3OYGA 3OA6A 3E9GA 2EWNA 1NYGA 4N4GA 4F7UF 1VQLQ 1LPLA 1OU9A 2QEXQ 1VQPT 1AT1B 1HSQA 4NS5A 2LJ0A 4PJOA 2L0AA 2F5KA 3JB9I 1V29B 3CBOA 3I56T 3JCMW 2AK5A 2A3LA 1JB0E 2PVGB 1MNDA 1KD1U 3H9NA 4PJOE 1UGQB 3QHSA 1T0JA 1M8VA 4PK4A 4XQ3A 1X27A 3OYKA 2DMOA 2KYBA 4Z88A 1K8AR 2FYKA 2A08A 2WACA 2KRNA 3E19A 4XU2A 1I4K1 5D7UA 4AG2C 1WIEA 4A63B 2E6NA 4PJOD 1M1KR 1OI1A 2ZPFB 4EMHA 2DL7A 4ZTFA 1AWJA 4XTWA 2QQRA 4HVVA 2X3WD 5LJ3e 1AVZC 3CCVQ 2ZZDA 3NTKA 3H41A 1TOVA 2RN8A 2GCXA 5GMKj 1VQ6Q 2L8DA 3EG9B 3RMQA 1O75A 3LWHA 1UFFA 1YN8A 1QVGS 2DO3A 3TEEA 2DVJA 1IZ6A 1YNZA 2DTHA 2AZSA 4F7UE 5GMKe 3ZBDA 3VRYA 1XOVA 2DF6A 4QVZA 4PFZA 2RA2A 4M77A 3T9NA 1N9RA 2PQWA 4C8QG 3JCMQ 5KYNA 2KYMA 1YJ9A 1VQMA 1YIJQ 4PJOF 2HAXA 1TUDA 4BDZA 2DBMA 4D8DA 2CT4A 2HDAA 3M0UA 3V7SA 3FC3A 8ATCB 3M0RA 3JB9F 3MP6A 3I9QA 1SKUB 3HSBA 4UC4A 2E12A 2HMAA 1WFWA 1K9MR 2QK0A 1I5LA 1RAAB 2QGFB 5M9OA 4F7UB 2DE0X 1PCXA 4Z8AA 1B34B 4NOYA 2K3XA 2R5MA 1MGQA 1M5Q1 1PC0A 5IAYA 1UTIA 1BIBA 4GLMA 4EIKA 3CCMT 1RACB 3WXMB 2J7IA 3A98A 5GJVB 3OBWA 1HJDA 4C5EA 3M9QA 3ZFJA 1AWWA 2RHXA 1KQ2A 4LUDA 1YIJT 1NLPC 3NTHA 5GMKh 5HY6A 5KYUB 3RUXA 3P8HA 4M78D 3CC7T 2O4XB 4LNPA 1PWTA 1XJWB 3CCET 4OMNA 4DOWA 3VS6A 5GANf 4A53A 1D1BA 5L8RE 5GMKm 4KUDK 3MEWA 3CD6T 5FLXE 4BY6C 2KAFA 3INZA 3PT9A 2L2PA 2L89A 3NPFA 2D8JA 2EYXA 2YLBA 1Q82R 4JZ4A 4XTUA 1VYUA 1Y7XA 1UB4A 1UGVA 1CSKA 3SB2A 1OPLA 2EJFA 3O8VA 4Q5WA 1UGSB 3TSWA 1VQNQ 2MCNA 3CCJA 3HRUA 3CCEA 1GCPA 2OJ2A 4XK8E 4HVWA 2YSQA 5KYUA 3OS2A 1UE9A 5A2QE 4FIBA 1Q95G 1SF9A 1W4SA 4EMKB 3L2VA 1Y0MA 2VGNA 5GAOl 4CRIA 3JCMV 2O2OA 4OGCA 4R0KA 4OMQA 2YRDA 2VYTA 2EAYA 4HT8A 4M75G 4QVCA 4II1A 3OYFA 3TREA 2HL5C 5CKHA 1FYNA 1BCMA 2DEQA 2F2VA 1U06A 4OVAA 3QO3A 2K5LA 3G1JA 1D09B 2DD5A 1UJYA 3BFMA 3QKJA 4HVUA 4E7JA 1G83A 1C0MA 1KC8C 2QDYB 3CCQQ 2H3JA 1ABQA 3DLLA 5LL6S 3I55Q 1BU1A 3JAME 1KC8R 3O5ZA 1FMWA 2PTKA 5IXFA 3EFOA 1VQPQ 4C92G 3HKSA 4ZGJB 1PRMC 4O5VA 4C5HA 3HRTA 1TU0B 2ESWA 3MEVA 3CD6A 2R58A 4M78C 3UWNA 5GANd 3GOXA 1UJ0A 4XU0A 3RKYA 3JCMg 1PG5B 2V1QA 4OMPA 2M0OA 3V7RA 4ELZC 1M9SA 2DL8A 1YIJA 1YITT 4KT0E 4BUGA 2LRQA 2KR3A 3QJYA 4OB2B 3L1AA 1M90C 2D0NA 3SWNB 3VV0A 1U5SA 1VQPA 3OS5A 1YJNQ 1KJWA 2E64A 2R5AA 2Y4XA 1WHKA 3G6EQ 3BDLA 4QT7A 3CCLQ 4PKCC 1IO6A 4HKEA 3OYHA 2VB6A 2V8JA 2LTOA 3NHNA 3CMET 3A8GB 3G71T 1NPRA 5FU6B 5I22A 4J5YA 4M7DB 1U1SA 3NFCA 4M7AD 1X2QA 2DXUA 3CCVT 4PJMA 1QCOA 2GTOA 1R8OB 2X3XD 1KFZA 3CC4Q 2LX9A 2KT8A 3A8MB 1VQ7Q 4IIMA 3VS4A 5KYWA 2XI9A 4JRKA 2LX7A 2DYBA 2CP3A 2P4RA 3MEUA 4RTYA 1RAEB 1YHQT 2Y90A 3EG9A 2CH4W 2EVRA 2DL3A 2DTIA 4PL6A 5LJ5d 1TH7A 1IB8A 3JSCA 1BYMA 1X6GA 1VUBA 1M27C 5KCHA 2DPPB 4CC7A 2EQMA 2FHDA 3PTAA 1J3TA 4C92C 2X51A 1NEGA 3CCJQ 3A1PA 4IKFA 2M0YA 4CC4B 1M2VA 2LMJA 5A0DA 4M77B 4C8QF 2E65A 1VQ8A 1E6GA 3HHTB 3THKA 4M75C 2MPXC 1NM7A 3JB9J 5FRNA 4JLIA 2VXEA 4PJOG 3VUBA 2JOYA 3QWXX 2P4TA 2XMFA 2DRMA 1QVGP 1JXMA 1LNXA 4C92D 3X26B 1WLPB 3OW2P 4JRIA 4K11A 4HT9A 3JB9G 4RTUA 1VQMT 4QW2A 2XDDA 3KUFA 2F1LA 4RTVA 5L23A 4E6RA 1ZSZC 2LQNA 1S72T 3CD6Q 1LOJA 1MV3A 1ABOA 1OX9A 1ZA2B 3EGUA 4XAXB 2RHUA 5GANe 4E7KA 1VQLT 1UGRB 2YDLA 2KROA 2XU8A 4QVDA 3M53A 2NUPA 1YJ9Q 2DKGA 1WDXA 3MP8A 3OYLA 2K6DA 4EDUA 5GAOq 4J8OA 1VQKA 4DEXA 3NGPA 4DBRA 1ZSGA 2XDBA 5LJ3j 2JTMA 4PNOA 3MP1A 3EFRA 2I0NA 3RMSA 1VQ6A 1QVFP 1GXIE 1WGSA 1YBYA 1G3SA 1D3BB 1QQJA 3GP8A 4M75D 1NLOC 4F7UG 1NEBA 1C1AA 4R55A 4N0AA 2E5QA 2ROTA 3S3OA 5CKEA 5GAN5 1VQ4T 4ZGDB 4C8QE 1M2VB 3FEOA 4JJDA 4ME7A 3ULRB 1ZUKA 3OYCA 1YI2A 2ZGWA 5LJ5f 1YCYA 3QZ9B 2YUNA 1Y57A 3U23A 2PZ1A 1WPYA 2IIMA 3LX7A 1W1FA 1EX4A 2FL7A 4LE9A 4F14A 4HCBA 3CC7Q 4M7DD 1WHLA 2VGMA 1RL2A 2SEMA 3WVDB 1N6AA 2RI2A 2BZYA 1XQHA 3MEAA 1G5VA 4J6WA 1VQOT 2V1RA 5DLQE 4ZN3A 2NUTB 1SSHA 1VQKT 2ZPGB 2PUOB 5CKFA 4M75F 4PFOA 4OP0A 4KRTA 2CUDA 1YWOA 4XTYA 2EYZA 2PVOB 4X9CA 4RCCA 1VQ4Q 3OYBA 4KGZB 1VQLA 2DILA 5I2MA 3CEYA 3QXEB 1I8FA 3LW5E 2RJEA 2F5TX 2O4XA 2VWFA 1VQ5T 4CC3A 4V2SA 4M78F 5CKDA 2HSPA 4YTLA 5FWBA 2GQIA 2JM8A 2LC4A 2ZPEB 3JCMc 1K9AA 1X69A 4B9XA 4MMLA 1GBRA 5LJ5e 2K9GA 2RO0A 3CPFA 3REBB 2QAZA 4OMFB 3H0HA 1WA7A 3M58A 1VIEA 1M3CA 1CKAA 2GTJA 1IREB 1Q82U 2QEXT 5GAOp 2VUBA 1R0BG 1KD1R 2JT4A 4L6V5 1NJIC 3F70A 3M55A 1RAHB 2MMPA 2D8HA 3SD4A 4RG2A 1VQMQ 3X20B 4FYYB 4HCKA 2P84A 2CYZB 2EGAA 3FIFA 2KRMA 2W10A 4RCBA 3RKXA 3QYHB 2NLUA 4RUGA 3OYAA 2L3RA 5GAOr 2KQWA 4M75E 4WTOB 4OF1A 3ER0A 2ED0A 3URGA 4JJNK 2FZGB 1VQOQ 1VQOA 3M0QA 2DTOA 2GBQA 4FL6A 1M1GA 4MZPA 2EGCA 4J9HA 2LCCA 1D1AA 3CCVA 3Q1JA 4M4ZA 2JMAA 4M7AG 3BDUA 1K4US 2YUQA 1UHFA 1M90U 2ECZA 3C4SA 2KXCA 1I81A 2B8AA 1MMGA 2JN0A 1OZ3A 2J6KA 1KHCA 3EFSA 3TVTA 1ACMB 2EBPA 5CVIA 1K1ZA 1WYXA 2CP6A 2M51A 1YI2T 4BI8B 2RI5A 3JCMX 3G6ET 3OYIA 3E2UA 2HSEB 4AFUC 3M4YA 3OMGA 2MOXA 3ASKA 1Z9QA 3QWYA 2QI2A 1KQSS 1QLYA 2OTJQ 3IQLA 3QDRB 4PFPA 4ATOA 1K76A 3EG0A 2FZCB 2PNIA 1AHJB 2DJQA 4IUUA 2LNHB 3PMTA 2HNIA 3S3MA 5IHIA 3V8KA 2RMOA 1YITQ 4X34A 4J7IA 4JS4A 2H3EB 2NWMA 2M16A 1AZEA 1G8XA 1ZA1B 1HYOA 2AKKA 4L5GA 3H8ZA 1NBEB 5GAN7 2XICA 1LCKA 2AIRB 2QQSA 3EHRA 1VQ4A 1VYTA 2OTLQ 2XK0A 3CC4T 4X1VA 3CMAQ 4HXJA 3RDVA 1K8AC 1SRLA 2M1HA 1WHMA 3A8OB 3GBQA 2EKHA 4EPCA 1OULA 1X2KA 6AT1B 2DXTA 2FB7A 2VC8A 5CR2A 1OV3A 1VQ9T 1VOMA 3I35A 1PHTA 3OW2S 5IHKA 5GAN4 5CQYA 2EQIA 1GRIA 2JS2A 1WXTA 5DLOA 1YFNA 2QQAA 1M3AA 2ZPBB 3G7ZA 2RK1A 4M77E 5IH2A 3ZL7C 3JCMh 2HEQA 1RADB 1T3SA 4QQ6A 3QJ6A 1K9MU 2A36A 5FROA 4GY5A 1Q7YU 3CC2Q 2QGGA 1U1TA 4O6JA 1QVFA 4A4HA 1SHFA 2DX1A 1M90R 4CI0C 2ZPIB 2FPDA 1TWBA 1YP5A 4B9WA 3CCRT 4BB7A 3ZEHA 4JUVA 2X4JA 4FM4B 3OSVA 1W70A 4E7SA 2X35A 4XTZA 1Z9ZA 2BIVA 2IPOB 2JMCA 2VVKA 4RTXA 1BI1A 1M4ZA 2WSCE 4J9DA 4MZMA 4AT1B 2EYWA 3LWIA 2CZ7B 3VUZA 1G3WA 5EG2A 2QA4Q 4D8KA 2VKNA 2RH2A 5GANj 4M78E 1V1CA 2FRYA 2Y4YA 4FW2A 2GFUA 1MHNA 4C0ZA 2K5FA 2P0QA 2HQEA 2K2MA 1FX7A 1X43A 2A0FB 3RNJA 1QCNA 1IHVA 4JRPA 2JTEA 1UECA 5GANh 2H8HA 1JBMA 2P0KA 5GAMf 3CCUA 2DIGA 1R77A 2NUPB 5LJ5h 2CKKA 2P0PA 3OB9A 2ZCFB 2A7YA 1ZQ1A 4GLKA 5I11A 2L5QA 4LDVA 2X4YA 5GMKl 2RJCA 1QVGA 3JCMb 4J9CA 1T0HA 4CC2A 4DBQA 1TS9A 3FJPA 1KC8U 1Y96B 5D6XA 5KE3A 4IUTA 3MHXA 1G3TA 5C0MA 1UHCA 3NMZC 2V8IA 3H0IA 5LJ3g 1YJ9T 1GL5A 1TXQA 1TG0A 2BE7D 3UDCA 1Q81C 1JRIA 5I21A 1BIAA 3META 3HPWA 2ROLA 2X9HA 2K57A 5J39A 3JCMd 2CSIA 1PD1A 4M7DG 3G4SA 2DA9A 2KBTA 1R0CB 1M1FA 4PJOB 1JU5C 2YT6A 2GQVA 1MMNA 3KBGA 1OZ2A 5CK9A 2RD1A 1VQ7T 2BUDA 3EGDB 2VXFA 1BI0A 1ZX6A 3UPUA 3OYNA 1SHGA 1QVPA 2D6FA 1QP3A 3HRSA 1G2BA 2OAWA 2J06A 4OB1B 2K5IA 3CC2A 2E6ZA 5KYYA 2LCLA 3EGXB 1AEYA 3CCMQ 5ECAA 3FRNA 3WVEB 3CCEQ 2BZXA 5C6SA 4JLGA 1D3BA 3J80E 1KD1C 1C6VX 3OYMA 4ELYC 1X01A 3QG1A 1RLQC 2CZ0B 3BW1A 4C8QC 4C8QB 2JNGA 3VS3A 3JCMP 2LDMA 3CCUQ 4J83A 5KYXA 2PU9B 1NE8A 2DBKA 2KXDA 1ZHIA 4C5IA 2CZ6B 3SFMA 2JS0A 2HD0A 5GAN3 5KYWB 2RQTA 2DERA 2DJZA 1RAIB 4VUBA 3QSUA 2DEUA 3I55A 2BE9B 1RLPC 3M0PA 3NTIA 4J9IA 3VU3C 4J9FA 2JTFA 1RI9A 2DXCA 2DETA 2E3HA 2JUFA 4ZN1A 3VKIA 1YJWA 1RABB 5DM7R 4E7LA 3CMEA 1QWEA 1IGQA 2ENMA 2AT1B 3H6ZA 1MMAA 4M77F 2K3YA 2RQUA 2PUKB 2DD4A 3X28B 3GNFB 1VQ9Q 3R6NA 1UDLA 2K2VA 1LJOA 1ZSZB 4M7AE 2FEIA 5KCOA 1WHHA 3UA7A 1IHWA 1M1KC 4M7DF 3QIIA 4LN2A 5CQXA 4KBMB 1ZBJA 4XU1A 3OY9A 3CC7A 3M59A 4KULA 4LXCA 3KXTA 5KH6A 4MDXA 3UATA 1TSFA 3A8LB 1K73U 2DM1A 4C92A 2PVDB 3CCST 2E41A 2KE9A 2IG0A 3CMEQ 3CC2T 2JVVA 1CKBA 2MI6A 3VS1A 3C12A 2EPDA 3GF5A 4J9GA 3REAB 1W2BA 2C0TA 2ABLA 3TCJA 1YJNT 3DKMA 5FU7B 3I56Q 2BKDN 1TTHB 2L3QA 3R6OA 1M30A 3V8JA 1U8RA 4XU3A 4F16A 4AFSC 2XHCA 4N4IA 1K73C 5A0GA 4N4HA 1X75C 1VYVA 1WZOA 2DXBA 3LGFA 1B7TA 2FZKB 4B6MA 3V8LA 2C0OA 1S72A 5GMKi 1D0XA 2RHYA 2EQKA 4A4GA 1M1KU 1Q86U 1WQWA 5CIUA 1AZGB 1PRLC 4FW1A 5FW9A 4F7UA 4JRQA 1JEGA 4FSXA 4Y92A 4F04B 3LH5A 2EYYA 2EKOA 3AHUA 2JXBA 4BACA 1PNJA 2DIQA 1NYFA 1ZLMA 1G3YA 3SWNC 4ZGEB 5AYFA 2F2WA 1NPPA 2OX7A 5CKBA 5IN1A 4A54A 4A4FA 3HTRA 3LLRA 2MWPA 1FWZA 2DNUA 1I07A 4M77G 2XIDA 1WJRA 1NZ9A 2CP2A 4IUPA 1BKBA 1K73R 3EH2A 4PJOC 1YJWT 3CCSA 3BE3A 2DZCA 2OI3A 2LCSA 3EH1A 3PIPA 3JB9H 4J9EA 2G6FX 1IRXA 1LVKA 1QW1A 1W2BP 3QYGB 1PKSA 2LQWA 5KE2A 2DYIA 2EQJA 3OYYA 1N5ZA 2MIOA 3QZ5B 1M3BA 4BI4A 2B86A 3CCQA 2YRVA 3QPHA 3G71A 3CPWA 3UA6A 1SEMA 3GLXA 1F1BB 4LDUA 5IT9E 1QWFA 1OEBA 1OPKA 1NJIR 3I5SA 1K9MC 2CH4A 2X4XA 2MF2A 4OB0B 2E3IA 3N5BB 2EGEA 5KYXB 2EFIA 4J9BA 4RG8A 5IXBA 5GAMg 3LGLA 3MO8A 1E6HA 1ZUUA 2DK3A 1SRMA 4FYWB 2SRCA 4M78G 1YHQQ 3SEMA 2HCKA 1VQ5Q 2KI7A 3PFSA 1EIFA 2YLCA 3QUIA 1FMVA 1RUWA 1B3QA 1B34A 4DBFA 2HKNA 2DLPA 4PLLA 4HCZA 3C0CA 3L2WA 3DB4A 1BI2A 4DA4A 3I55T 3M56A 4JPBW 3CBMA 2OTJA 2QXFA 3E9FA 5GANg 4F17A 2JZ2A 1X6BA 2DL5A 4HA8A 1WXBA 3G4SQ 3EAEA 2O9VA 2L3PA 4C0DC 3V7CA 3EG3A 1AD5A 2KSSA 3G4ST 2CUBA 3VJPA 4LUEA 2ED1A 3RBBB 1B07A 3CCJT 1Q86R 1N8RU 3VS7A 3PVLA 5LJ5g 1KQSP 3LYIA 3RIRA 2LZ6B 4L59A 4BE1A 1WX6A 2D9TA 1Q86C 4R56A 2M02A 4E7IA 1WHGA 2R57A 2QQBA 3CBPA 2X4WA 3SDZA 1N8RC 4M7AF 2MYSA 4AFZC 3CCRQ 4M7AA 2EYQA 1UEBA 4M7DE 1W2BS 4M78A 3OS1A 4DBHA 4BE2A 4P5NA 1H8KA 4FT4A 3UF4A 1MV0B 1BBZA 1Y96A 1MNEA 2OTLT 5GJWB 3L2QA 2O01E 3QDFA 3X24B 2DAQA 2V26A 1KQ1A 2KVQG 5D6WA 3MPUB 4C0FA 1MUZA 3H0FA 3ME9A 2DZ9A 2M9UA 3CCMA 3A8HB 3PIOA 3PNWC 2KNBB 5HK0A 2QTVA 3KFVA 2XG8D 2DRKA 2EW3A 2HQHA 2EJGA 2XKOC 5GAN2 4N0AC 1ZUYA 4QKUA 4FT2A 2ATCB 1AOJA 5CO7A 1GFDA 2C06A 4BDYA 3G71Q 4RMOA 4DEYA 2CP0A 1RAGB 2D1XA 1GCQC 3P8DA 3HFNA 4FYXB 3S3NA 1Y07A 3CCQT 1N8RR 2V8KA 3QBYA 1DJ7B 5GAN6 1M2OA 1VIFA 3RESA 4RTTA 4HCCA 3CCLA 4XTXA 4M7DA 3J81E 1VQKQ 5A0LA 4C5GA 2E10A 2CT3A 2RNAA 3VRZA 3EG2A 1YCSB 2J6OA 2O88A 3CXCP 2FPEA 2VASA 2NUZA 3C95A 1X6OA 1EFNA 2HQXA 3M5AA 4JJCA 4IUVA 1BCOA 5J3BA 1O9SA 3E1SA 3SWNA 4RTZA 2FRWA 1K8AU 4TVRA 1I1JA 1BI3A 4ANJA 5LJ5j 1PKTA 2QQ9A 1OX8A 1VQ9A 4X9DA 2EJ9A 2VV5A 4KGVB 5GAMj 3OYJA 2GGRA 2KGTA 4NL3A 3CMAA 2DVEA 2LVMA 3MKDA 2HBWA 1H3ZA 3OBYA 4E7ZA 2E70A 1UGPB 2GF7A 2BZ8A 4MDWA 5CCAA 2FG0A 2CGHA 4KH1B 1RI0A 5EC7A 2AHJB 2L3SA 2LP5A 3VS5A 2CDTA 2W0ZA 3FLGA 2YXYA 2YWWA 1HK9A 2EIFA 2WSFE 2K3BA 1M8MA 5HKCA 3CCUT 2LNVA 2CZ1B 4OGEA 3I5RA 1RAFB 1H92A 2YUPA 4JDSA 3I56A 4E7HA 1PM3A 4LDWA 1OOTA 4QQDA 3CPWP 4MMKA 5LJ3h 1JJ2A 1N27A 3JCMe 3HFOA 1Y71A 1D0YA 3P8BB 9ATCB 3OYDA 2O31A 5J26A 4BI3A 4C0DB 3L2ZA 2COYA 1H3HA 2CS7A 1W6XA 4QQGA 3S6WA 2HKQB 4KGXB 2E1HA 5LJ3d 1VQNT 3M54A 1E7OA 2DL4A 2YRCA 2A37A 4ZNXA 2XDPA 3M0SA 1Q81U 3RKWA 1AWOA 1KSWA 3VYHB 5IHNA 5HCKA 1OQKA 4M7AB 2RF0A 3JV3A 1QVFS 3JRZA 3CXCS 3D7SB 5GAOm 1FXXA 1VQNA 3M57A 2K7AA 2MAMA 3VS2A 4M75B 3RR6A 2RPNA 2KRSA 4C0GA 2K79A 3CCRA 2KDSA 3RERA 2RM4A 4PJJA 1T3LA 3DB3A 2KEAA 2IVWA 1K0SA 3EFOB 5FRMA 2LQ8A 4LDYA 2COWA 1VQ6T 2AZVA 1SPKA 1GBQA 3X25B 3L42A 1YJWQ 3BY7A 1NJIU 4AG1C 2QEXA 2RI3A 4M77D 1V76A 4LDXA 1UG1A 5AT1B 2CSQA 3CCSQ 4XTVA 2NYSA 2QA4A 1KK7A 4ESRA 1BK2A 1BB9A 4PJNA 1WI7A 3JB9D 5HK3A 1KG1A 1QCFA 2QTXA 4FCYA 3OQ5A 4Z89A 5GAMe 1IXDA 2CREA 1XTDA 4ZTJA 2E4HA 4JZ3A 1WJSA 4PLIA 2G3RA 3PVQA 2E5KA 4M75A 2JJ9A 4EMKA 2Z0WA 3DLMA 1U3OA 2OTJT 4E47A 1KIKA 4J7FA 3UT1A 3A5ZB 1KHIA 2QA4T 3L2UA 3OSSC 1VQ8Q 3PGGA 2HZYA 1WHJA 4DQ2A 3CPWS 2HL3A 3M0TA 2FPFA 4A4EA 1TUCA 1Q7YR 1JJ2P 4BE0A 2JM9A 1S72Q 2QDLA 1VQ5A 5I2SA 1HD3A 3MJXA 1QKXA 1Q7YC 2COZA 1XNIA 2NUTA 3J7AF 4Z02A 5GAOn 3L2RA 3VYGA 3FJ5A 1VQ7A 2BTTA 5DY9A 3M4GA 4JS5A 2F69A 2MK5A 2RHIA 1WNLA 5D6YA 1JO8A 4OMMA 7AT1B 1WQ7A 2LJ1A 4IURA 3G6EA 2LT4A 3C94A 4RKUE 2KMTA 4LD9K 4IUQA 4GBQA
chains in the Genus database with same CATH topology
2WSEE 2OAUA 5LL6S 3CPWA 1VQ4A 2XK0A 3GLXA 3JAME 3CC4T 4LDUA 5IT9E 5LJ3f 5FU7C 3OS0A 1K8AC 4C92G 1K9MC 2X4XA 2MF2A 3JCMJ 2M1HA 3HKSA 4ZGJB 3A8OB 4OB0B 4EPCA 3N5BB 4O5VA 4C5HA 3HRTA 4M77C 2DXTA 1N9SA 2FB7A 2KY9A 4Y28E 2EFIA 4RG8A 5GAMg 1H641 3LGLA 3MEVA 2VC8A 5CR2A 3MO8A 2R58A 1VQ9T 3CD6A 2DK3A 4M78C 3OW2S 3UWNA 5GANd 4C92B 3GOXA 5GAN4 4M78G 1Q7YU 5CQYA 4XU0A 3RKYA 3JCMg 3PFSA 5DLOA 2QQAA 2ZPBB 4M77E 2M0OA 2RK1A 3G7ZA 3V7RA 4ELZC 1EIFA 1M9SA 2YLCA 3CCLT 3QUIA 3JCMh 1YIJA 4J6XA 4KT0E 4BUGA 1YITT 1B34A 2LRQA 3FDRA 4QQ6A 4PLLA 3QJ6A 1K9MU 5FROA 4HCZA 4GY5A 3QJYA 4LD6A 4OB2B 3L2WA 3DB4A 1BI2A 2ZPHB 3CXCA 1U1TA 3L1AA 4O6JA 3M56A 3I55T 4DA4A 1QVFA 3CBMA 4A4HA 5GAMh 2OTLA 1M90C 3SWNB 3VV0A 4EMKC 2OTJA 2QXFA 3E9FA 5GANg 4CI0C 1VQPA 3OS5A 2ZPIB 2JZ2A 4B9WA 2E64A 2R5AA 4Y91A 3CCRT 2Y4XA 4HA8A 4BB7A 3ZEHA 4JUVA 3EAEA 2X4JA 1SSFA 3BDLA 4FM4B 3OSVA 4C0DC 4BD3A 3V7CA 4PKCC 4HKEA 2X35A 3OYHA 4XTZA 2XD0A 2KSSA 2BIVA 3G4ST 2V8JA 2GFAA 1OYXA 2LTOA 4C8QA 5CAIA 1HXDA 2LQKA 3CMET 2FVUA 3A8GB 3VJPA 3G71T 1NPRA 5FU6B 4J5YA 4M7DB 1U1SA 1BI1A 3GIBA 3NFCA 4M7AD 1M4ZA 5GAN8 3CCJT 2DXUA 1JJ2S 2WSCE 4C92E 3CCVT 1QP2A 4WF2A 5LJ5g 1N8RU 3HP9A 4MZMA 4D6WA 1R8OB 3LYIA 4FU6A 2LX9A 3RIRA 3LWIA 2CZ7B 3VUZA 4L59A 4BE1A 4BY6B 3A8MB 1G3WA 4MZTA 2EQUA 2D9TA 4NL2A 5EG2A 5GANj 1PSFA 2RH2A 4R56A 1Q86C 4E7IA 4KUIA 2XI9A 4M78E 2R57A 2QQBA 2Y4YA 3CBPA 2X4WA 4JRKA 3SDZA 1N8RC 4M7AF 2I2LA 2GFUA 1MHNA 3OYEA 1YJNA 2YHTA 4C0ZA 4M7AA 3MEUA 2EYQA 3OMCA 1UEBA 2K5FA 1YHQT 2P0QA 1W2BS 4M78A 5A0DA 2Y90A 2HQEA 3OS1A 4M7DE 4BE2A 2DTIA 2HBPA 4P5NA 1ZBXA 4PL6A 4FT4A 4C8QD 5LJ5d 4OB3B 1FX7A 1TH7A 1BYMA 3JSCA 1Y96A 2OTLT 3MCAB 4JRPA 1VUBA 5KCHA 5GANh 3L2QA 2DPPB 2O01E 2EQMA 2FHDA 3PTAA 2KK4A 3X24B 1JBMA 2DAQA 4EMGA 2P0KA 4C92C 5GAMf 4IKFA 1KQ1A 2DIGA 2KVQG 3CCUA 4M78B 5LJ5h 2CKKA 2P0PA 3OB9A 3PMIA 5D6WA 4C0FA 2ZCFB 2A7YA 1ZQ1A 4GLKA 4M77B 4C8QF 2E65A 2MWOA 2L5QA 3HHTB 3ME9A 3JCMf 1VQ8A 4M75C 2DZ9A 2M9UA 2X4YA 3A8HB 2VXEA 4JLIA 2RJCA 2RK2A 4J6YA 4LDVA 4PJOG 2JOYA 3VUBA 1QVGA 2P4TA 3PNWC 3JCMb 3TU4K 1YHQA 2RJDA 5HK0A 2XG8D 4M7AC 1Q82C 3FJPA 1KC8U 1LNXA 4C92D 1Y96B 2EJGA 5D6XA 5KE3A 4IUTA 3X26B 3MHXA 2XKOC 5GMKl 5GAN2 4N0AC 1G3TA 4JRIA 4HT9A 5C0MA 3JB9G 4FT2A 1VQMT 5CO7A 4QW2A 2XDDA 2V8IA 3KUFA 5LJ3g 3CMAT 3FB9A 3CC4A 1YJ9T 2C06A 4BDYA 1KQSA 4RMOA 3CMEA 1S72T 3LH0A 3UDCA 1P92A 2LT1A 3P8DA 1Q81C 3HFNA 5GAMd 3S3NA 1Y07A 1LOJA 1JRIA 2RHZA 4XAXB 4DOVA 2RB6A 5I21A 3CCQT 1BIAA 2RHUA 3META 1PSEA 5GANe 2RJFA 2V8KA 3HPWA 3QBYA 4C92F 3HL8A 1DJ7B 4E7KA 1VQLT 1WJQA 1VQ8T 2K57A 5J39A 1UGRB 3JCMd 5GAN6 4M7DC 2XU8A 1VIFA 5FU6C 4QVDA 3OW2A 3RESA 4A4KA 4M7DG 3G4SA 3M53A 2K4YA 4HCCA 2DKGA 3MP8A 4PJOB 1M1FA 3CCLA 2D0QB 2GQVA 3GPLA 1YITA 3OYLA 4XTXA 4EDUA 3KBGA 5GAOq 5GAOl 4J8OA 3J81E 1VQKA 4M7DA 1OZ2A 3GNGA 5A0LA 2RD1A 5CK9A 3OYGA 1VQ7T 2XDBA 5LJ3j 2JTMA 4C5GA 2E10A 4PNOA 3MP1A 2BUDA 3E9GA 2EWNA 3OA6A 2VXFA 1BI0A 4N4GA 3UPUA 3EFRA 3OYNA 3RMSA 4F7UF 1QVPA 2D6FA 1VQ6A 1QP3A 1GXIE 1VQPT 1WGSA 1YBYA 3HRSA 4NS5A 4PJOA 1G3SA 2F5KA 4OB1B 1V29B 3CBOA 1D3BB 3JB9I 3I56T 3C95A 2K5IA 2A3LA 3GP8A 3JCMW 3CC2A 2E6ZA 1X6OA 1JB0E 2HQXA 4M75D 2PVGB 3M5AA 2LCLA 4IUVA 4F7UG 1KD1U 4PJOE 4R55A 5J3BA 1UGQB 3FRNA 1O9SA 2E5QA 3E1SA 3QHSA 4N0AA 3SWNA 3WVEB 3S3OA 1M8VA 4ZGEB 4XQ3A 3OYKA 5CKEA 1K8AU 5GAN5 1VQ4T 4TVRA 4ZGDB 2FYKA 5C6SA 1BI3A 2WACA 4JLGA 1D3BA 4C8QE 3J80E 1KD1C 3FEOA 3E19A 3CCMA 5LJ5j 3OYMA 4ME7A 4ELYC 4XU2A 3OYCA 1I4K1 1X01A 2QQ9A 3QG1A 1YI2A 1VQ9A 2ZGWA 2CZ0B 3BW1A 4C8QC 4X9DA 2EJ9A 2VV5A 1YCYA 2E6NA 3QZ9B 5LJ5f 5GAMj 3OYJA 4PJOD 4C8QB 1WPYA 1OI1A 4NL3A 2JNGA 3CMAA 3JCMP 2DVEA 2LVMA 3LX7A 2LDMA 1H3ZA 2ZPFB 4EMHA 3OBYA 2FL7A 4ZTFA 4J83A 4HCBA 4M7DD 2PU9B 4XTWA 1NE8A 2E70A 2QQRA 1UGPB 2GF7A 5LJ3e 3JB9J 4MDWA 5CCAA 1ZHIA 2VGMA 4C5IA 2CZ6B 1RL2A 3SFMA 2HD0A 3WVDB 1N6AA 2CGHA 5GAN3 2DJZA 1RI0A 2RI2A 2ZZDA 4VUBA 3QSUA 3NTKA 2AHJB 3I55A 1XQHA 2GCXA 3MEAA 5GMKj 1G5VA 4J6WA 1VQOT 3FLGA 5DLQE 4ZN3A 3NTIA 1HK9A 2EIFA 1VQKT 2L8DA 2WSFE 5HKCA 2ZPGB 3RMQA 2PUOB 5CKFA 3VU3C 3CCUT 1O75A 2LNVA 4M75F 4OP0A 2JTFA 3LWHA 2CZ1B 1QVGS 2DO3A 2DXCA 4OGEA 4XTYA 3TEEA 2JUFA 2PVOB 4X9CA 4RCCA 1IZ6A 4ZN1A 4JDSA 3VKIA 3OYBA 2DTHA 3I56A 4F7UE 4LDWA 4E7HA 1YJWA 5GMKe 3ZBDA 1VQLA 5I2MA 3CEYA 1XOVA 5DM7R 4QQDA 3QXEB 4MMKA 1I8FA 5LJ3h 3LW5E 4QVZA 1JJ2A 2RJEA 2F5TX 2RA2A 4E7LA 1N27A 4M77A 3T9NA 1N9RA 1Y71A 2O4XA 3HFOA 3P8BB 2PQWA 4C8QG 3JCMe 3H6ZA 3OYDA 1VQ5T 4M77F 5J26A 2K3YA 4BI3A 3JCMQ 4C0DB 3L2ZA 2CS7A 1YJ9A 1VQMA 4V2SA 4QQGA 2PUKB 4PJOF 3S6WA 2HAXA 2DD4A 3X28B 3GNFB 4BDZA 4M78F 5CKDA 2E1HA 4YTLA 5LJ3d 1VQNT 3M54A 2K2VA 1LJOA 2LC4A 4M7AE 2ZPEB 3JCMc 5KCOA 2XDPA 4B9XA 4MMLA 5LJ5e 1Q81U 2RO0A 3RKWA 3V7SA 1M1KC 3QIIA 3FC3A 3CPFA 3JB9F 4M7DF 3MP6A 5CQXA 3VYHB 4KBMB 4XU1A 4OMFB 3OY9A 3HSBA 3CC7A 4UC4A 2E12A 3M59A 4M7AB 3M58A 1VIEA 4KULA 3KXTA 5KH6A 4MDXA 1QVFS 3JRZA 3CXCS 3A8LB 1I5LA 5GAOm 1K73U 1IREB 1FXXA 4C92A 1Q82U 1VQNA 3M57A 2MAMA 4M75B 2QEXT 5GAOp 2PVDB 4C0GA 2VUBA 2E41A 3CCST 2IG0A 4L6V5 5M9OA 1NJIC 3CC2T 3CCRA 2KDSA 3F70A 2JVVA 2RM4A 3RERA 3M55A 4F7UB 2MMPA 1B34B 2MI6A 3DB3A 3SD4A 2IVWA 4NOYA 4RG2A 2K3XA 2R5MA 1MGQA 1M5Q1 3C12A 3X20B 5IAYA 3FIFA 2CYZB 1BIBA 5FRMA 2LQ8A 3GF5A 3CCMT 4LDYA 1VQ6T 3WXMB 1W2BA 4RCBA 3QYHB 3RKXA 3OBWA 3TCJA 2NLUA 3X25B 4C5EA 3L42A 3DKMA 5FU7B 1YJNT 3M9QA 3OYAA 3BY7A 2BKDN 3ZFJA 2L3RA 2RHXA 3R6OA 1NJIU 2QEXA 1KQ2A 5GAOr 2RI3A 3V8JA 1YIJT 2KQWA 4M75E 3NTHA 4M77D 1U8RA 4XU3A 4LDXA 4OF1A 3ER0A 3URGA 5GMKh 2XHCA 5HY6A 4JJNK 3RUXA 3P8HA 1VQOA 4N4IA 4XTVA 2DTOA 4FL6A 4M78D 3CC7T 1M1GA 2O4XB 4MZPA 1K73C 3CCET 2QA4A 5A0GA 4DOWA 4N4HA 1X75C 5FRNA 5GANf 2LCCA 4A53A 3CCVA 5L8RE 2DXBA 3LGFA 5GMKm 4KUDK 3MEWA 3Q1JA 3CD6T 5FLXE 4BY6C 4M7AG 2KAFA 3BDUA 3INZA 3JB9D 3PT9A 3V8LA 5HK3A 1S72A 5GMKi 2RHYA 2EQKA 4A4GA 1KG1A 1M1KU 1Q86U 1M90U 2L89A 2QTXA 1WQWA 3OQ5A 5CIUA 2YLBA 4XTUA 5GAMe 3C4SA 1Y7XA 1UB4A 4F7UA 4ZTJA 1XTDA 4JRQA 1I81A 2B8AA 2JN0A 4FSXA 3SB2A 2EJFA 1OZ3A 1KHCA 3EFSA 3O8VA 1UGSB 1WJSA 4PLIA 4Q5WA 2G3RA 5CVIA 4M75A 2EKOA 3PIOA 1YI2T 4EMKA 3DLMA 4BI8B 3CCJA 2RI5A 3HRUA 3AHUA 4E47A 2OTJT 4J7FA 3UT1A 3A5ZB 3JCMX 3CCEA 1KHIA 2QA4T 3G6ET 3OYIA 3L2UA 4BACA 4XK8E 3OSSC 3OS2A 2DIQA 3PGGA 4DQ2A 3CPWS 5A2QE 4FIBA 3L2VA 1W4SA 4EMKB 1G3YA 2VGNA 3SWNC 3M4YA 3OMGA 1NPPA 5AYFA 5CKBA 5IN1A 4A54A 4A4EA 4A4FA 3LLRA 4CRIA 3ASKA 2MWPA 3JCMV 2QI2A 4BE0A 1KQSS 1FWZA 4OGCA 1VQ5A 4M77G 5I2SA 2VYTA 2EAYA 2XIDA 3QDRB 1WJRA 1NZ9A 4HT8A 4M75G 4QVCA 4II1A 1Q7YC 4IUPA 4ATOA 1BKBA 3OYFA 1XNIA 1AHJB 3TREA 4PJOC 4IUUA 3J7AF 1YJWT 4Z02A 3PMTA 2HNIA 3S3MA 5GAOn 3V8KA 3CCSA 3L2RA 2DZCA 3VYGA 5CKHA 1VQ7A 5DY9A 2DEQA 3M4GA 4JS5A 3PIPA 3JB9H 4OVAA 2F69A 3QO3A 2K5LA 4J7IA 4X34A 4JS4A 1QW1A 2RHIA 3QYGB 1WNLA 2DD5A 3BFMA 2M16A 5KE2A 3QKJA 5D6YA 2EQJA 1WQ7A 4E7JA 3OYYA 3QZ5B 4IURA 3G6EA 4BI4A 2LT4A 3C94A 3H8ZA 4L5GA 4RKUE 1KC8C 2QDYB 3CCQA 5GAN7 2YRVA 2XICA 2H3JA 2KMTA 3QPHA 3DLLA 4LD9K 4IUQA 3G71A 2QQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q C;  1Y96 A;  4X9D A;  2EJ9 A;  4RCB A;  5LJ5 f;  1YCY A;  3RKX A;  5GAM j;  4PJO D;  4C8Q B;  1WPY A;  5GAN h;  4NL3 A;  3BY7 A;  5LJ3 f;  1JBM A;  2DVE A;  4EMG A;  3JCM P;  4C92 C;  5GAM f;  5GAO r;  1KQ2 A;  1KQ1 A;  3V8J A;  4EMH A;  4M75 E;  4M77 D;  4M78 B;  5LJ5 h;  4XU3 A;  4C92 G;  5GMK h;  3JCM J;  3RUX A;  4M7D D;  4XTW A;  4XTV A;  4M77 C;  2DXT A;  1N9S A;  2DTO A;  2FB7 A;  4M78 D;  4M77 B;  2E65 A;  4C8Q F;  3JCM f;  5LJ3 e;  5GAM g;  1H64 1;  4M75 C;  2VC8 A;  5GAN f;  4A53 A;  2DZ9 A;  5GMK l;  4JLI A;  3JB9 J;  2VXE A;  4M78 C;  4J6Y A;  4PJO G;  5GMK m;  5GAN 3;  2CGH A;  4C92 B;  3JCM b;  5GAN d;  2DJZ A;  4M78 G;  5GAN 4;  3QSU A;  4XU0 A;  4M7A G;  3INZ A;  3BDU A;  3JB9 D;  3V8L A;  5GMK i;  3RKY A;  3JCM g;  4M7A C;  3FJP A;  5GMK j;  1LNX A;  4C92 D;  1Y96 B;  2EJG A;  4J6W A;  4M77 E;  3V7R A;  2QTX A;  1WQW A;  1HK9 A;  4N0A C;  5GAN 2;  4JRI A;  2YLC A;  4HT9 A;  3QUI A;  3JCM h;  3JB9 G;  4J6X A;  2YLB A;  3VU3 C;  4M75 F;  4XTU A;  5GAM e;  5LJ3 g;  4OP0 A;  1B34 A;  3FB9 A;  4F7U A;  4XTY A;  1I81 A;  2JN0 A;  4X9C A;  4RCC A;  3SB2 A;  2EJF A;  3EFS A;  1U1T A;  3L1A A;  2DTH A;  3HFN A;  5GAM d;  4F7U E;  3SWN B;  5GAM h;  1LOJ A;  1JRI A;  4EMK C;  5I21 A;  4M75 A;  2RB6 A;  5GMK e;  1BIA A;  5GAN e;  4EMK A;  4C92 F;  4MMK A;  1I8F A;  5LJ3 h;  5GAN g;  3AHU A;  2RA2 A;  3JCM X;  4M77 A;  2K57 A;  3JCM e;  1N9R A;  3HFO A;  2E64 A;  3JCM d;  4Y91 A;  4C8Q G;  4HA8 A;  5GAN 6;  4M7D C;  4M77 F;  4QVD A;  3JCM Q;  4JUV A;  3L2Z A;  3RES A;  3PGG A;  4M7D G;  4DQ2 A;  2DKG A;  4PJO B;  4V2S A;  4PJO F;  3V7C A;  4EMK B;  4M78 F;  3SWN C;  2E1H A;  4XTX A;  5LJ3 d;  5GAO l;  4A54 A;  5GAO q;  4XTZ A;  4M7D A;  1LJO A;  2RD1 A;  3JCM V;  4C8Q A;  4M7A E;  5CAI A;  5LJ3 j;  1HXD A;  2E10 A;  4PNO A;  3JCM c;  2EWN A;  2VXF A;  4MML A;  3EFR A;  4M77 G;  4J5Y A;  4F7U F;  5LJ5 e;  3RKW A;  2EAY A;  3V7S A;  4M7D F;  1U1S A;  3GIB A;  3JB9 F;  4M7A D;  4M7D B;  5GAN 8;  4HT8 A;  4M75 G;  2DXU A;  4QVC A;  4PJO A;  4C92 E;  4WF2 A;  5LJ5 g;  4XU1 A;  4PJO C;  3HSB A;  3JB9 I;  3JCM W;  1D3B B;  2HNI A;  4M7A B;  5GAO n;  3RIR A;  3V8K A;  2DZC A;  4M75 D;  5DY9 A;  2DEQ A;  4NL2 A;  3M4G A;  5GAN j;  5GAO m;  4F7U G;  1I5L A;  3JB9 H;  4C92 A;  4PJO E;  3QO3 A;  4M75 B;  4M78 E;  3QHS A;  4N0A A;  5GAO p;  3SWN A;  1WNL A;  3BFM A;  1M8V A;  4XQ3 A;  4JRK A;  5GAN 5;  4M7A F;  2I2L A;  2E41 A;  2FYK A;  2YHT A;  1D3B A;  1WQ7 A;  4C8Q E;  3RER A;  4M7A A;  2RM4 A;  4F7U B;  1B34 B;  5LJ5 j;  4M7D E;  4NOY A;  4M78 A;  1MGQ A;  1M5Q 1;  2Y90 A;  4XU2 A;  1I4K 1;  1X01 A;  2DTI A;  3FIF A;  5GAN 7;  4C8Q D;  1BIB A;  5LJ5 d;  1TH7 A;  2ZGW A;  3BW1 A; 
#chains in the Genus database with same CATH topology
 2WSE E;  2OAU A;  1IGU A;  4AFQ C;  3EGD A;  2C0I A;  1ZSZ A;  4PJL A;  5LJ3 f;  5FU7 C;  3OS0 A;  1Q81 R;  2KT1 A;  3JCM J;  4M77 C;  4Y28 E;  1N9S A;  2KY9 A;  1H64 1;  2F2X A;  4WCI A;  4C92 B;  3EHQ A;  1SG5 A;  1GFC A;  1TUG B;  5KYY B;  2J05 A;  3CCL T;  4J6X A;  4FSS A;  3FDR A;  4KH0 B;  4FYV B;  4LD6 A;  2ZPH B;  3CXC A;  5GAM h;  2OTL A;  4EMK C;  1PD0 A;  1S1N A;  5FWC A;  2ZAE A;  4ORZ A;  1UUE A;  4E2F B;  4Y91 A;  2RQR A;  1NG2 A;  1SSF A;  4BD3 A;  2FO0 A;  2XD0 A;  2GFA A;  1OYX A;  4C8Q A;  5CAI A;  1HXD A;  2LQK A;  3AT1 B;  2FVU A;  3GIB A;  1K0X A;  5GAN 8;  1QMC A;  1JJ2 S;  4C92 E;  1QP2 A;  4WF2 A;  3HP9 A;  4OML A;  4D6W A;  1JXO A;  4FU6 A;  1MMD A;  4BY6 B;  4MZT A;  2EQU A;  2GNC A;  4NL2 A;  3PE0 A;  1PSF A;  2DFU A;  4AMC A;  4KUI A;  2JW4 A;  1ARK A;  2RQW A;  2I2L A;  3OYE A;  1YJN A;  2YHT A;  3CQT A;  2AKL A;  3OMC A;  1FMK A;  1YWP A;  1I0C A;  2A28 A;  2HBP A;  1ZBX A;  4C8Q D;  4OB3 B;  3TQ7 P;  8AT1 B;  1QKW A;  1A0N B;  3MCA B;  2QAS A;  2YUO A;  2KK4 A;  4EMG A;  4OMO A;  4M78 B;  2CP7 A;  2QG9 B;  3PMI A;  1WXU A;  1OU8 A;  1JQQ A;  2MWO A;  3JCM f;  1D0Z A;  1EZZ B;  3SHW A;  1YI2 Q;  4J6Y A;  2RK2 A;  3EG1 A;  3TU4 K;  2QYZ A;  1YHQ A;  1GCQ A;  2RJD A;  4M7A C;  1Q82 C;  3VS0 A;  3CMA T;  2O9S A;  3FB9 A;  3CC4 A;  1KQS A;  4IIO A;  3LH0 A;  1P92 A;  2LT1 A;  5GAM d;  2RHZ A;  4RTW A;  3TSZ A;  4DOV A;  2RB6 A;  1PSE A;  2RJF A;  4C92 F;  3HL8 A;  3EGX A;  1I5O B;  1WJQ A;  1VQ8 T;  2RQV A;  2J6F A;  4M7D C;  2LJ3 A;  1AWX A;  3OW2 A;  5FU6 C;  4A4K A;  2K4Y A;  1D1C A;  2CP5 A;  1VA7 A;  2D0Q B;  3GPL A;  1YIT A;  4JJB A;  3GNG A;  3OYG A;  3OA6 A;  3E9G A;  2EWN A;  1NYG A;  4N4G A;  4F7U F;  1VQL Q;  1LPL A;  1OU9 A;  2QEX Q;  1VQP T;  1AT1 B;  1HSQ A;  4NS5 A;  2LJ0 A;  4PJO A;  2L0A A;  2F5K A;  3JB9 I;  1V29 B;  3CBO A;  3I56 T;  3JCM W;  2AK5 A;  2A3L A;  1JB0 E;  2PVG B;  1MND A;  1KD1 U;  3H9N A;  4PJO E;  1UGQ B;  3QHS A;  1T0J A;  1M8V A;  4PK4 A;  4XQ3 A;  1X27 A;  3OYK A;  2DMO A;  2KYB A;  4Z88 A;  1K8A R;  2FYK A;  2A08 A;  2WAC A;  2KRN A;  3E19 A;  4XU2 A;  1I4K 1;  5D7U A;  4AG2 C;  1WIE A;  4A63 B;  2E6N A;  4PJO D;  1M1K R;  1OI1 A;  2ZPF B;  4EMH A;  2DL7 A;  4ZTF A;  1AWJ A;  4XTW A;  2QQR A;  4HVV A;  2X3W D;  5LJ3 e;  1AVZ C;  3CCV Q;  2ZZD A;  3NTK A;  3H41 A;  1TOV A;  2RN8 A;  2GCX A;  5GMK j;  1VQ6 Q;  2L8D A;  3EG9 B;  3RMQ A;  1O75 A;  3LWH A;  1UFF A;  1YN8 A;  1QVG S;  2DO3 A;  3TEE A;  2DVJ A;  1IZ6 A;  1YNZ A;  2DTH A;  2AZS A;  4F7U E;  5GMK e;  3ZBD A;  3VRY A;  1XOV A;  2DF6 A;  4QVZ A;  4PFZ A;  2RA2 A;  4M77 A;  3T9N A;  1N9R A;  2PQW A;  4C8Q G;  3JCM Q;  5KYN A;  2KYM A;  1YJ9 A;  1VQM A;  1YIJ Q;  4PJO F;  2HAX A;  1TUD A;  4BDZ A;  2DBM A;  4D8D A;  2CT4 A;  2HDA A;  3M0U A;  3V7S A;  3FC3 A;  8ATC B;  3M0R A;  3JB9 F;  3MP6 A;  3I9Q A;  1SKU B;  3HSB A;  4UC4 A;  2E12 A;  2HMA A;  1WFW A;  1K9M R;  2QK0 A;  1I5L A;  1RAA B;  2QGF B;  5M9O A;  4F7U B;  2DE0 X;  1PCX A;  4Z8A A;  1B34 B;  4NOY A;  2K3X A;  2R5M A;  1MGQ A;  1M5Q 1;  1PC0 A;  5IAY A;  1UTI A;  1BIB A;  4GLM A;  4EIK A;  3CCM T;  1RAC B;  3WXM B;  2J7I A;  3A98 A;  5GJV B;  3OBW A;  1HJD A;  4C5E A;  3M9Q A;  3ZFJ A;  1AWW A;  2RHX A;  1KQ2 A;  4LUD A;  1YIJ T;  1NLP C;  3NTH A;  5GMK h;  5HY6 A;  5KYU B;  3RUX A;  3P8H A;  4M78 D;  3CC7 T;  2O4X B;  4LNP A;  1PWT A;  1XJW B;  3CCE T;  4OMN A;  4DOW A;  3VS6 A;  5GAN f;  4A53 A;  1D1B A;  5L8R E;  5GMK m;  4KUD K;  3MEW A;  3CD6 T;  5FLX E;  4BY6 C;  2KAF A;  3INZ A;  3PT9 A;  2L2P A;  2L89 A;  3NPF A;  2D8J A;  2EYX A;  2YLB A;  1Q82 R;  4JZ4 A;  4XTU A;  1VYU A;  1Y7X A;  1UB4 A;  1UGV A;  1CSK A;  3SB2 A;  1OPL A;  2EJF A;  3O8V A;  4Q5W A;  1UGS B;  3TSW A;  1VQN Q;  2MCN A;  3CCJ A;  3HRU A;  3CCE A;  1GCP A;  2OJ2 A;  4XK8 E;  4HVW A;  2YSQ A;  5KYU A;  3OS2 A;  1UE9 A;  5A2Q E;  4FIB A;  1Q95 G;  1SF9 A;  1W4S A;  4EMK B;  3L2V A;  1Y0M A;  2VGN A;  5GAO l;  4CRI A;  3JCM V;  2O2O A;  4OGC A;  4R0K A;  4OMQ A;  2YRD A;  2VYT A;  2EAY A;  4HT8 A;  4M75 G;  4QVC A;  4II1 A;  3OYF A;  3TRE A;  2HL5 C;  5CKH A;  1FYN A;  1BCM A;  2DEQ A;  2F2V A;  1U06 A;  4OVA A;  3QO3 A;  2K5L A;  3G1J A;  1D09 B;  2DD5 A;  1UJY A;  3BFM A;  3QKJ A;  4HVU A;  4E7J A;  1G83 A;  1C0M A;  1KC8 C;  2QDY B;  3CCQ Q;  2H3J A;  1ABQ A;  3DLL A;  5LL6 S;  3I55 Q;  1BU1 A;  3JAM E;  1KC8 R;  3O5Z A;  1FMW A;  2PTK A;  5IXF A;  3EFO A;  1VQP Q;  4C92 G;  3HKS A;  4ZGJ B;  1PRM C;  4O5V A;  4C5H A;  3HRT A;  1TU0 B;  2ESW A;  3MEV A;  3CD6 A;  2R58 A;  4M78 C;  3UWN A;  5GAN d;  3GOX A;  1UJ0 A;  4XU0 A;  3RKY A;  3JCM g;  1PG5 B;  2V1Q A;  4OMP A;  2M0O A;  3V7R A;  4ELZ C;  1M9S A;  2DL8 A;  1YIJ A;  1YIT T;  4KT0 E;  4BUG A;  2LRQ A;  2KR3 A;  3QJY A;  4OB2 B;  3L1A A;  1M90 C;  2D0N A;  3SWN B;  3VV0 A;  1U5S A;  1VQP A;  3OS5 A;  1YJN Q;  1KJW A;  2E64 A;  2R5A A;  2Y4X A;  1WHK A;  3G6E Q;  3BDL A;  4QT7 A;  3CCL Q;  4PKC C;  1IO6 A;  4HKE A;  3OYH A;  2VB6 A;  2V8J A;  2LTO A;  3NHN A;  3CME T;  3A8G B;  3G71 T;  1NPR A;  5FU6 B;  5I22 A;  4J5Y A;  4M7D B;  1U1S A;  3NFC A;  4M7A D;  1X2Q A;  2DXU A;  3CCV T;  4PJM A;  1QCO A;  2GTO A;  1R8O B;  2X3X D;  1KFZ A;  3CC4 Q;  2LX9 A;  2KT8 A;  3A8M B;  1VQ7 Q;  4IIM A;  3VS4 A;  5KYW A;  2XI9 A;  4JRK A;  2LX7 A;  2DYB A;  2CP3 A;  2P4R A;  3MEU A;  4RTY A;  1RAE B;  1YHQ T;  2Y90 A;  3EG9 A;  2CH4 W;  2EVR A;  2DL3 A;  2DTI A;  4PL6 A;  5LJ5 d;  1TH7 A;  1IB8 A;  3JSC A;  1BYM A;  1X6G A;  1VUB A;  1M27 C;  5KCH A;  2DPP B;  4CC7 A;  2EQM A;  2FHD A;  3PTA A;  1J3T A;  4C92 C;  2X51 A;  1NEG A;  3CCJ Q;  3A1P A;  4IKF A;  2M0Y A;  4CC4 B;  1M2V A;  2LMJ A;  5A0D A;  4M77 B;  4C8Q F;  2E65 A;  1VQ8 A;  1E6G A;  3HHT B;  3THK A;  4M75 C;  2MPX C;  1NM7 A;  3JB9 J;  5FRN A;  4JLI A;  2VXE A;  4PJO G;  3VUB A;  2JOY A;  3QWX X;  2P4T A;  2XMF A;  2DRM A;  1QVG P;  1JXM A;  1LNX A;  4C92 D;  3X26 B;  1WLP B;  3OW2 P;  4JRI A;  4K11 A;  4HT9 A;  3JB9 G;  4RTU A;  1VQM T;  4QW2 A;  2XDD A;  3KUF A;  2F1L A;  4RTV A;  5L23 A;  4E6R A;  1ZSZ C;  2LQN A;  1S72 T;  3CD6 Q;  1LOJ A;  1MV3 A;  1ABO A;  1OX9 A;  1ZA2 B;  3EGU A;  4XAX B;  2RHU A;  5GAN e;  4E7K A;  1VQL T;  1UGR B;  2YDL A;  2KRO A;  2XU8 A;  4QVD A;  3M53 A;  2NUP A;  1YJ9 Q;  2DKG A;  1WDX A;  3MP8 A;  3OYL A;  2K6D A;  4EDU A;  5GAO q;  4J8O A;  1VQK A;  4DEX A;  3NGP A;  4DBR A;  1ZSG A;  2XDB A;  5LJ3 j;  2JTM A;  4PNO A;  3MP1 A;  3EFR A;  2I0N A;  3RMS A;  1VQ6 A;  1QVF P;  1GXI E;  1WGS A;  1YBY A;  1G3S A;  1D3B B;  1QQJ A;  3GP8 A;  4M75 D;  1NLO C;  4F7U G;  1NEB A;  1C1A A;  4R55 A;  4N0A A;  2E5Q A;  2ROT A;  3S3O A;  5CKE A;  5GAN 5;  1VQ4 T;  4ZGD B;  4C8Q E;  1M2V B;  3FEO A;  4JJD A;  4ME7 A;  3ULR B;  1ZUK A;  3OYC A;  1YI2 A;  2ZGW A;  5LJ5 f;  1YCY A;  3QZ9 B;  2YUN A;  1Y57 A;  3U23 A;  2PZ1 A;  1WPY A;  2IIM A;  3LX7 A;  1W1F A;  1EX4 A;  2FL7 A;  4LE9 A;  4F14 A;  4HCB A;  3CC7 Q;  4M7D D;  1WHL A;  2VGM A;  1RL2 A;  2SEM A;  3WVD B;  1N6A A;  2RI2 A;  2BZY A;  1XQH A;  3MEA A;  1G5V A;  4J6W A;  1VQO T;  2V1R A;  5DLQ E;  4ZN3 A;  2NUT B;  1SSH A;  1VQK T;  2ZPG B;  2PUO B;  5CKF A;  4M75 F;  4PFO A;  4OP0 A;  4KRT A;  2CUD A;  1YWO A;  4XTY A;  2EYZ A;  2PVO B;  4X9C A;  4RCC A;  1VQ4 Q;  3OYB A;  4KGZ B;  1VQL A;  2DIL A;  5I2M A;  3CEY A;  3QXE B;  1I8F A;  3LW5 E;  2RJE A;  2F5T X;  2O4X A;  2VWF A;  1VQ5 T;  4CC3 A;  4V2S A;  4M78 F;  5CKD A;  2HSP A;  4YTL A;  5FWB A;  2GQI A;  2JM8 A;  2LC4 A;  2ZPE B;  3JCM c;  1K9A A;  1X69 A;  4B9X A;  4MML A;  1GBR A;  5LJ5 e;  2K9G A;  2RO0 A;  3CPF A;  3REB B;  2QAZ A;  4OMF B;  3H0H A;  1WA7 A;  3M58 A;  1VIE A;  1M3C A;  1CKA A;  2GTJ A;  1IRE B;  1Q82 U;  2QEX T;  5GAO p;  2VUB A;  1R0B G;  1KD1 R;  2JT4 A;  4L6V 5;  1NJI C;  3F70 A;  3M55 A;  1RAH B;  2MMP A;  2D8H A;  3SD4 A;  4RG2 A;  1VQM Q;  3X20 B;  4FYY B;  4HCK A;  2P84 A;  2CYZ B;  2EGA A;  3FIF A;  2KRM A;  2W10 A;  4RCB A;  3RKX A;  3QYH B;  2NLU A;  4RUG A;  3OYA A;  2L3R A;  5GAO r;  2KQW A;  4M75 E;  4WTO B;  4OF1 A;  3ER0 A;  2ED0 A;  3URG A;  4JJN K;  2FZG B;  1VQO Q;  1VQO A;  3M0Q A;  2DTO A;  2GBQ A;  4FL6 A;  1M1G A;  4MZP A;  2EGC A;  4J9H A;  2LCC A;  1D1A A;  3CCV A;  3Q1J A;  4M4Z A;  2JMA A;  4M7A G;  3BDU A;  1K4U S;  2YUQ A;  1UHF A;  1M90 U;  2ECZ A;  3C4S A;  2KXC A;  1I81 A;  2B8A A;  1MMG A;  2JN0 A;  1OZ3 A;  2J6K A;  1KHC A;  3EFS A;  3TVT A;  1ACM B;  2EBP A;  5CVI A;  1K1Z A;  1WYX A;  2CP6 A;  2M51 A;  1YI2 T;  4BI8 B;  2RI5 A;  3JCM X;  3G6E T;  3OYI A;  3E2U A;  2HSE B;  4AFU C;  3M4Y A;  3OMG A;  2MOX A;  3ASK A;  1Z9Q A;  3QWY A;  2QI2 A;  1KQS S;  1QLY A;  2OTJ Q;  3IQL A;  3QDR B;  4PFP A;  4ATO A;  1K76 A;  3EG0 A;  2FZC B;  2PNI A;  1AHJ B;  2DJQ A;  4IUU A;  2LNH B;  3PMT A;  2HNI A;  3S3M A;  5IHI A;  3V8K A;  2RMO A;  1YIT Q;  4X34 A;  4J7I A;  4JS4 A;  2H3E B;  2NWM A;  2M16 A;  1AZE A;  1G8X A;  1ZA1 B;  1HYO A;  2AKK A;  4L5G A;  3H8Z A;  1NBE B;  5GAN 7;  2XIC A;  1LCK A;  2AIR B;  2QQS A;  3EHR A;  1VQ4 A;  1VYT A;  2OTL Q;  2XK0 A;  3CC4 T;  4X1V A;  3CMA Q;  4HXJ A;  3RDV A;  1K8A C;  1SRL A;  2M1H A;  1WHM A;  3A8O B;  3GBQ A;  2EKH A;  4EPC A;  1OUL A;  1X2K A;  6AT1 B;  2DXT A;  2FB7 A;  2VC8 A;  5CR2 A;  1OV3 A;  1VQ9 T;  1VOM A;  3I35 A;  1PHT A;  3OW2 S;  5IHK A;  5GAN 4;  5CQY A;  2EQI A;  1GRI A;  2JS2 A;  1WXT A;  5DLO A;  1YFN A;  2QQA A;  1M3A A;  2ZPB B;  3G7Z A;  2RK1 A;  4M77 E;  5IH2 A;  3ZL7 C;  3JCM h;  2HEQ A;  1RAD B;  1T3S A;  4QQ6 A;  3QJ6 A;  1K9M U;  2A36 A;  5FRO A;  4GY5 A;  1Q7Y U;  3CC2 Q;  2QGG A;  1U1T A;  4O6J A;  1QVF A;  4A4H A;  1SHF A;  2DX1 A;  1M90 R;  4CI0 C;  2ZPI B;  2FPD A;  1TWB A;  1YP5 A;  4B9W A;  3CCR T;  4BB7 A;  3ZEH A;  4JUV A;  2X4J A;  4FM4 B;  3OSV A;  1W70 A;  4E7S A;  2X35 A;  4XTZ A;  1Z9Z A;  2BIV A;  2IPO B;  2JMC A;  2VVK A;  4RTX A;  1BI1 A;  1M4Z A;  2WSC E;  4J9D A;  4MZM A;  4AT1 B;  2EYW A;  3LWI A;  2CZ7 B;  3VUZ A;  1G3W A;  5EG2 A;  2QA4 Q;  4D8K A;  2VKN A;  2RH2 A;  5GAN j;  4M78 E;  1V1C A;  2FRY A;  2Y4Y A;  4FW2 A;  2GFU A;  1MHN A;  4C0Z A;  2K5F A;  2P0Q A;  2HQE A;  2K2M A;  1FX7 A;  1X43 A;  2A0F B;  3RNJ A;  1QCN A;  1IHV A;  4JRP A;  2JTE A;  1UEC A;  5GAN h;  2H8H A;  1JBM A;  2P0K A;  5GAM f;  3CCU A;  2DIG A;  1R77 A;  2NUP B;  5LJ5 h;  2CKK A;  2P0P A;  3OB9 A;  2ZCF B;  2A7Y A;  1ZQ1 A;  4GLK A;  5I11 A;  2L5Q A;  4LDV A;  2X4Y A;  5GMK l;  2RJC A;  1QVG A;  3JCM b;  4J9C A;  1T0H A;  4CC2 A;  4DBQ A;  1TS9 A;  3FJP A;  1KC8 U;  1Y96 B;  5D6X A;  5KE3 A;  4IUT A;  3MHX A;  1G3T A;  5C0M A;  1UHC A;  3NMZ C;  2V8I A;  3H0I A;  5LJ3 g;  1YJ9 T;  1GL5 A;  1TXQ A;  1TG0 A;  2BE7 D;  3UDC A;  1Q81 C;  1JRI A;  5I21 A;  1BIA A;  3MET A;  3HPW A;  2ROL A;  2X9H A;  2K57 A;  5J39 A;  3JCM d;  2CSI A;  1PD1 A;  4M7D G;  3G4S A;  2DA9 A;  2KBT A;  1R0C B;  1M1F A;  4PJO B;  1JU5 C;  2YT6 A;  2GQV A;  1MMN A;  3KBG A;  1OZ2 A;  5CK9 A;  2RD1 A;  1VQ7 T;  2BUD A;  3EGD B;  2VXF A;  1BI0 A;  1ZX6 A;  3UPU A;  3OYN A;  1SHG A;  1QVP A;  2D6F A;  1QP3 A;  3HRS A;  1G2B A;  2OAW A;  2J06 A;  4OB1 B;  2K5I A;  3CC2 A;  2E6Z A;  5KYY A;  2LCL A;  3EGX B;  1AEY A;  3CCM Q;  5ECA A;  3FRN A;  3WVE B;  3CCE Q;  2BZX A;  5C6S A;  4JLG A;  1D3B A;  3J80 E;  1KD1 C;  1C6V X;  3OYM A;  4ELY C;  1X01 A;  3QG1 A;  1RLQ C;  2CZ0 B;  3BW1 A;  4C8Q C;  4C8Q B;  2JNG A;  3VS3 A;  3JCM P;  2LDM A;  3CCU Q;  4J83 A;  5KYX A;  2PU9 B;  1NE8 A;  2DBK A;  2KXD A;  1ZHI A;  4C5I A;  2CZ6 B;  3SFM A;  2JS0 A;  2HD0 A;  5GAN 3;  5KYW B;  2RQT A;  2DER A;  2DJZ A;  1RAI B;  4VUB A;  3QSU A;  2DEU A;  3I55 A;  2BE9 B;  1RLP C;  3M0P A;  3NTI A;  4J9I A;  3VU3 C;  4J9F A;  2JTF A;  1RI9 A;  2DXC A;  2DET A;  2E3H A;  2JUF A;  4ZN1 A;  3VKI A;  1YJW A;  1RAB B;  5DM7 R;  4E7L A;  3CME A;  1QWE A;  1IGQ A;  2ENM A;  2AT1 B;  3H6Z A;  1MMA A;  4M77 F;  2K3Y A;  2RQU A;  2PUK B;  2DD4 A;  3X28 B;  3GNF B;  1VQ9 Q;  3R6N A;  1UDL A;  2K2V A;  1LJO A;  1ZSZ B;  4M7A E;  2FEI A;  5KCO A;  1WHH A;  3UA7 A;  1IHW A;  1M1K C;  4M7D F;  3QII A;  4LN2 A;  5CQX A;  4KBM B;  1ZBJ A;  4XU1 A;  3OY9 A;  3CC7 A;  3M59 A;  4KUL A;  4LXC A;  3KXT A;  5KH6 A;  4MDX A;  3UAT A;  1TSF A;  3A8L B;  1K73 U;  2DM1 A;  4C92 A;  2PVD B;  3CCS T;  2E41 A;  2KE9 A;  2IG0 A;  3CME Q;  3CC2 T;  2JVV A;  1CKB A;  2MI6 A;  3VS1 A;  3C12 A;  2EPD A;  3GF5 A;  4J9G A;  3REA B;  1W2B A;  2C0T A;  2ABL A;  3TCJ A;  1YJN T;  3DKM A;  5FU7 B;  3I56 Q;  2BKD N;  1TTH B;  2L3Q A;  3R6O A;  1M30 A;  3V8J A;  1U8R A;  4XU3 A;  4F16 A;  4AFS C;  2XHC A;  4N4I A;  1K73 C;  5A0G A;  4N4H A;  1X75 C;  1VYV A;  1WZO A;  2DXB A;  3LGF A;  1B7T A;  2FZK B;  4B6M A;  3V8L A;  2C0O A;  1S72 A;  5GMK i;  1D0X A;  2RHY A;  2EQK A;  4A4G A;  1M1K U;  1Q86 U;  1WQW A;  5CIU A;  1AZG B;  1PRL C;  4FW1 A;  5FW9 A;  4F7U A;  4JRQ A;  1JEG A;  4FSX A;  4Y92 A;  4F04 B;  3LH5 A;  2EYY A;  2EKO A;  3AHU A;  2JXB A;  4BAC A;  1PNJ A;  2DIQ A;  1NYF A;  1ZLM A;  1G3Y A;  3SWN C;  4ZGE B;  5AYF A;  2F2W A;  1NPP A;  2OX7 A;  5CKB A;  5IN1 A;  4A54 A;  4A4F A;  3HTR A;  3LLR A;  2MWP A;  1FWZ A;  2DNU A;  1I07 A;  4M77 G;  2XID A;  1WJR A;  1NZ9 A;  2CP2 A;  4IUP A;  1BKB A;  1K73 R;  3EH2 A;  4PJO C;  1YJW T;  3CCS A;  3BE3 A;  2DZC A;  2OI3 A;  2LCS A;  3EH1 A;  3PIP A;  3JB9 H;  4J9E A;  2G6F X;  1IRX A;  1LVK A;  1QW1 A;  1W2B P;  3QYG B;  1PKS A;  2LQW A;  5KE2 A;  2DYI A;  2EQJ A;  3OYY A;  1N5Z A;  2MIO A;  3QZ5 B;  1M3B A;  4BI4 A;  2B86 A;  3CCQ A;  2YRV A;  3QPH A;  3G71 A;  3CPW A;  3UA6 A;  1SEM A;  3GLX A;  1F1B B;  4LDU A;  5IT9 E;  1QWF A;  1OEB A;  1OPK A;  1NJI R;  3I5S A;  1K9M C;  2CH4 A;  2X4X A;  2MF2 A;  4OB0 B;  2E3I A;  3N5B B;  2EGE A;  5KYX B;  2EFI A;  4J9B A;  4RG8 A;  5IXB A;  5GAM g;  3LGL A;  3MO8 A;  1E6H A;  1ZUU A;  2DK3 A;  1SRM A;  4FYW B;  2SRC A;  4M78 G;  1YHQ Q;  3SEM A;  2HCK A;  1VQ5 Q;  2KI7 A;  3PFS A;  1EIF A;  2YLC A;  3QUI A;  1FMV A;  1RUW A;  1B3Q A;  1B34 A;  4DBF A;  2HKN A;  2DLP A;  4PLL A;  4HCZ A;  3C0C A;  3L2W A;  3DB4 A;  1BI2 A;  4DA4 A;  3I55 T;  3M56 A;  4JPB W;  3CBM A;  2OTJ A;  2QXF A;  3E9F A;  5GAN g;  4F17 A;  2JZ2 A;  1X6B A;  2DL5 A;  4HA8 A;  1WXB A;  3G4S Q;  3EAE A;  2O9V A;  2L3P A;  4C0D C;  3V7C A;  3EG3 A;  1AD5 A;  2KSS A;  3G4S T;  2CUB A;  3VJP A;  4LUE A;  2ED1 A;  3RBB B;  1B07 A;  3CCJ T;  1Q86 R;  1N8R U;  3VS7 A;  3PVL A;  5LJ5 g;  1KQS P;  3LYI A;  3RIR A;  2LZ6 B;  4L59 A;  4BE1 A;  1WX6 A;  2D9T A;  1Q86 C;  4R56 A;  2M02 A;  4E7I A;  1WHG A;  2R57 A;  2QQB A;  3CBP A;  2X4W A;  3SDZ A;  1N8R C;  4M7A F;  2MYS A;  4AFZ C;  3CCR Q;  4M7A A;  2EYQ A;  1UEB A;  4M7D E;  1W2B S;  4M78 A;  3OS1 A;  4DBH A;  4BE2 A;  4P5N A;  1H8K A;  4FT4 A;  3UF4 A;  1MV0 B;  1BBZ A;  1Y96 A;  1MNE A;  2OTL T;  5GJW B;  3L2Q A;  2O01 E;  3QDF A;  3X24 B;  2DAQ A;  2V26 A;  1KQ1 A;  2KVQ G;  5D6W A;  3MPU B;  4C0F A;  1MUZ A;  3H0F A;  3ME9 A;  2DZ9 A;  2M9U A;  3CCM A;  3A8H B;  3PIO A;  3PNW C;  2KNB B;  5HK0 A;  2QTV A;  3KFV A;  2XG8 D;  2DRK A;  2EW3 A;  2HQH A;  2EJG A;  2XKO C;  5GAN 2;  4N0A C;  1ZUY A;  4QKU A;  4FT2 A;  2ATC B;  1AOJ A;  5CO7 A;  1GFD A;  2C06 A;  4BDY A;  3G71 Q;  4RMO A;  4DEY A;  2CP0 A;  1RAG B;  2D1X A;  1GCQ C;  3P8D A;  3HFN A;  4FYX B;  3S3N A;  1Y07 A;  3CCQ T;  1N8R R;  2V8K A;  3QBY A;  1DJ7 B;  5GAN 6;  1M2O A;  1VIF A;  3RES A;  4RTT A;  4HCC A;  3CCL A;  4XTX A;  4M7D A;  3J81 E;  1VQK Q;  5A0L A;  4C5G A;  2E10 A;  2CT3 A;  2RNA A;  3VRZ A;  3EG2 A;  1YCS B;  2J6O A;  2O88 A;  3CXC P;  2FPE A;  2VAS A;  2NUZ A;  3C95 A;  1X6O A;  1EFN A;  2HQX A;  3M5A A;  4JJC A;  4IUV A;  1BCO A;  5J3B A;  1O9S A;  3E1S A;  3SWN A;  4RTZ A;  2FRW A;  1K8A U;  4TVR A;  1I1J A;  1BI3 A;  4ANJ A;  5LJ5 j;  1PKT A;  2QQ9 A;  1OX8 A;  1VQ9 A;  4X9D A;  2EJ9 A;  2VV5 A;  4KGV B;  5GAM j;  3OYJ A;  2GGR A;  2KGT A;  4NL3 A;  3CMA A;  2DVE A;  2LVM A;  3MKD A;  2HBW A;  1H3Z A;  3OBY A;  4E7Z A;  2E70 A;  1UGP B;  2GF7 A;  2BZ8 A;  4MDW A;  5CCA A;  2FG0 A;  2CGH A;  4KH1 B;  1RI0 A;  5EC7 A;  2AHJ B;  2L3S A;  2LP5 A;  3VS5 A;  2CDT A;  2W0Z A;  3FLG A;  2YXY A;  2YWW A;  1HK9 A;  2EIF A;  2WSF E;  2K3B A;  1M8M A;  5HKC A;  3CCU T;  2LNV A;  2CZ1 B;  4OGE A;  3I5R A;  1RAF B;  1H92 A;  2YUP A;  4JDS A;  3I56 A;  4E7H A;  1PM3 A;  4LDW A;  1OOT A;  4QQD A;  3CPW P;  4MMK A;  5LJ3 h;  1JJ2 A;  1N27 A;  3JCM e;  3HFO A;  1Y71 A;  1D0Y A;  3P8B B;  9ATC B;  3OYD A;  2O31 A;  5J26 A;  4BI3 A;  4C0D B;  3L2Z A;  2COY A;  1H3H A;  2CS7 A;  1W6X A;  4QQG A;  3S6W A;  2HKQ B;  4KGX B;  2E1H A;  5LJ3 d;  1VQN T;  3M54 A;  1E7O A;  2DL4 A;  2YRC A;  2A37 A;  4ZNX A;  2XDP A;  3M0S A;  1Q81 U;  3RKW A;  1AWO A;  1KSW A;  3VYH B;  5IHN A;  5HCK A;  1OQK A;  4M7A B;  2RF0 A;  3JV3 A;  1QVF S;  3JRZ A;  3CXC S;  3D7S B;  5GAO m;  1FXX A;  1VQN A;  3M57 A;  2K7A A;  2MAM A;  3VS2 A;  4M75 B;  3RR6 A;  2RPN A;  2KRS A;  4C0G A;  2K79 A;  3CCR A;  2KDS A;  3RER A;  2RM4 A;  4PJJ A;  1T3L A;  3DB3 A;  2KEA A;  2IVW A;  1K0S A;  3EFO B;  5FRM A;  2LQ8 A;  4LDY A;  2COW A;  1VQ6 T;  2AZV A;  1SPK A;  1GBQ A;  3X25 B;  3L42 A;  1YJW Q;  3BY7 A;  1NJI U;  4AG1 C;  2QEX A;  2RI3 A;  4M77 D;  1V76 A;  4LDX A;  1UG1 A;  5AT1 B;  2CSQ A;  3CCS Q;  4XTV A;  2NYS A;  2QA4 A;  1KK7 A;  4ESR A;  1BK2 A;  1BB9 A;  4PJN A;  1WI7 A;  3JB9 D;  5HK3 A;  1KG1 A;  1QCF A;  2QTX A;  4FCY A;  3OQ5 A;  4Z89 A;  5GAM e;  1IXD A;  2CRE A;  1XTD A;  4ZTJ A;  2E4H A;  4JZ3 A;  1WJS A;  4PLI A;  2G3R A;  3PVQ A;  2E5K A;  4M75 A;  2JJ9 A;  4EMK A;  2Z0W A;  3DLM A;  1U3O A;  2OTJ T;  4E47 A;  1KIK A;  4J7F A;  3UT1 A;  3A5Z B;  1KHI A;  2QA4 T;  3L2U A;  3OSS C;  1VQ8 Q;  3PGG A;  2HZY A;  1WHJ A;  4DQ2 A;  3CPW S;  2HL3 A;  3M0T A;  2FPF A;  4A4E A;  1TUC A;  1Q7Y R;  1JJ2 P;  4BE0 A;  2JM9 A;  1S72 Q;  2QDL A;  1VQ5 A;  5I2S A;  1HD3 A;  3MJX A;  1QKX A;  1Q7Y C;  2COZ A;  1XNI A;  2NUT A;  3J7A F;  4Z02 A;  5GAO n;  3L2R A;  3VYG A;  3FJ5 A;  1VQ7 A;  2BTT A;  5DY9 A;  3M4G A;  4JS5 A;  2F69 A;  2MK5 A;  2RHI A;  1WNL A;  5D6Y A;  1JO8 A;  4OMM A;  7AT1 B;  1WQ7 A;  2LJ1 A;  4IUR A;  3G6E A;  2LT4 A;  3C94 A;  4RKU E;  2KMT A;  4LD9 K;  4IUQ A;  4GBQ A; 
#chains in the Genus database with same CATH homology
 2WSE E;  2OAU A;  5LL6 S;  3CPW A;  1VQ4 A;  2XK0 A;  3GLX A;  3JAM E;  3CC4 T;  4LDU A;  5IT9 E;  5LJ3 f;  5FU7 C;  3OS0 A;  1K8A C;  4C92 G;  1K9M C;  2X4X A;  2MF2 A;  3JCM J;  2M1H A;  3HKS A;  4ZGJ B;  3A8O B;  4OB0 B;  4EPC A;  3N5B B;  4O5V A;  4C5H A;  3HRT A;  4M77 C;  2DXT A;  1N9S A;  2FB7 A;  2KY9 A;  4Y28 E;  2EFI A;  4RG8 A;  5GAM g;  1H64 1;  3LGL A;  3MEV A;  2VC8 A;  5CR2 A;  3MO8 A;  2R58 A;  1VQ9 T;  3CD6 A;  2DK3 A;  4M78 C;  3OW2 S;  3UWN A;  5GAN d;  4C92 B;  3GOX A;  5GAN 4;  4M78 G;  1Q7Y U;  5CQY A;  4XU0 A;  3RKY A;  3JCM g;  3PFS A;  5DLO A;  2QQA A;  2ZPB B;  4M77 E;  2M0O A;  2RK1 A;  3G7Z A;  3V7R A;  4ELZ C;  1EIF A;  1M9S A;  2YLC A;  3CCL T;  3QUI A;  3JCM h;  1YIJ A;  4J6X A;  4KT0 E;  4BUG A;  1YIT T;  1B34 A;  2LRQ A;  3FDR A;  4QQ6 A;  4PLL A;  3QJ6 A;  1K9M U;  5FRO A;  4HCZ A;  4GY5 A;  3QJY A;  4LD6 A;  4OB2 B;  3L2W A;  3DB4 A;  1BI2 A;  2ZPH B;  3CXC A;  1U1T A;  3L1A A;  4O6J A;  3M56 A;  3I55 T;  4DA4 A;  1QVF A;  3CBM A;  4A4H A;  5GAM h;  2OTL A;  1M90 C;  3SWN B;  3VV0 A;  4EMK C;  2OTJ A;  2QXF A;  3E9F A;  5GAN g;  4CI0 C;  1VQP A;  3OS5 A;  2ZPI B;  2JZ2 A;  4B9W A;  2E64 A;  2R5A A;  4Y91 A;  3CCR T;  2Y4X A;  4HA8 A;  4BB7 A;  3ZEH A;  4JUV A;  3EAE A;  2X4J A;  1SSF A;  3BDL A;  4FM4 B;  3OSV A;  4C0D C;  4BD3 A;  3V7C A;  4PKC C;  4HKE A;  2X35 A;  3OYH A;  4XTZ A;  2XD0 A;  2KSS A;  2BIV A;  3G4S T;  2V8J A;  2GFA A;  1OYX A;  2LTO A;  4C8Q A;  5CAI A;  1HXD A;  2LQK A;  3CME T;  2FVU A;  3A8G B;  3VJP A;  3G71 T;  1NPR A;  5FU6 B;  4J5Y A;  4M7D B;  1U1S A;  1BI1 A;  3GIB A;  3NFC A;  4M7A D;  1M4Z A;  5GAN 8;  3CCJ T;  2DXU A;  1JJ2 S;  2WSC E;  4C92 E;  3CCV T;  1QP2 A;  4WF2 A;  5LJ5 g;  1N8R U;  3HP9 A;  4MZM A;  4D6W A;  1R8O B;  3LYI A;  4FU6 A;  2LX9 A;  3RIR A;  3LWI A;  2CZ7 B;  3VUZ A;  4L59 A;  4BE1 A;  4BY6 B;  3A8M B;  1G3W A;  4MZT A;  2EQU A;  2D9T A;  4NL2 A;  5EG2 A;  5GAN j;  1PSF A;  2RH2 A;  4R56 A;  1Q86 C;  4E7I A;  4KUI A;  2XI9 A;  4M78 E;  2R57 A;  2QQB A;  2Y4Y A;  3CBP A;  2X4W A;  4JRK A;  3SDZ A;  1N8R C;  4M7A F;  2I2L A;  2GFU A;  1MHN A;  3OYE A;  1YJN A;  2YHT A;  4C0Z A;  4M7A A;  3MEU A;  2EYQ A;  3OMC A;  1UEB A;  2K5F A;  1YHQ T;  2P0Q A;  1W2B S;  4M78 A;  5A0D A;  2Y90 A;  2HQE A;  3OS1 A;  4M7D E;  4BE2 A;  2DTI A;  2HBP A;  4P5N A;  1ZBX A;  4PL6 A;  4FT4 A;  4C8Q D;  5LJ5 d;  4OB3 B;  1FX7 A;  1TH7 A;  1BYM A;  3JSC A;  1Y96 A;  2OTL T;  3MCA B;  4JRP A;  1VUB A;  5KCH A;  5GAN h;  3L2Q A;  2DPP B;  2O01 E;  2EQM A;  2FHD A;  3PTA A;  2KK4 A;  3X24 B;  1JBM A;  2DAQ A;  4EMG A;  2P0K A;  4C92 C;  5GAM f;  4IKF A;  1KQ1 A;  2DIG A;  2KVQ G;  3CCU A;  4M78 B;  5LJ5 h;  2CKK A;  2P0P A;  3OB9 A;  3PMI A;  5D6W A;  4C0F A;  2ZCF B;  2A7Y A;  1ZQ1 A;  4GLK A;  4M77 B;  4C8Q F;  2E65 A;  2MWO A;  2L5Q A;  3HHT B;  3ME9 A;  3JCM f;  1VQ8 A;  4M75 C;  2DZ9 A;  2M9U A;  2X4Y A;  3A8H B;  2VXE A;  4JLI A;  2RJC A;  2RK2 A;  4J6Y A;  4LDV A;  4PJO G;  2JOY A;  3VUB A;  1QVG A;  2P4T A;  3PNW C;  3JCM b;  3TU4 K;  1YHQ A;  2RJD A;  5HK0 A;  2XG8 D;  4M7A C;  1Q82 C;  3FJP A;  1KC8 U;  1LNX A;  4C92 D;  1Y96 B;  2EJG A;  5D6X A;  5KE3 A;  4IUT A;  3X26 B;  3MHX A;  2XKO C;  5GMK l;  5GAN 2;  4N0A C;  1G3T A;  4JRI A;  4HT9 A;  5C0M A;  3JB9 G;  4FT2 A;  1VQM T;  5CO7 A;  4QW2 A;  2XDD A;  2V8I A;  3KUF A;  5LJ3 g;  3CMA T;  3FB9 A;  3CC4 A;  1YJ9 T;  2C06 A;  4BDY A;  1KQS A;  4RMO A;  3CME A;  1S72 T;  3LH0 A;  3UDC A;  1P92 A;  2LT1 A;  3P8D A;  1Q81 C;  3HFN A;  5GAM d;  3S3N A;  1Y07 A;  1LOJ A;  1JRI A;  2RHZ A;  4XAX B;  4DOV A;  2RB6 A;  5I21 A;  3CCQ T;  1BIA A;  2RHU A;  3MET A;  1PSE A;  5GAN e;  2RJF A;  2V8K A;  3HPW A;  3QBY A;  4C92 F;  3HL8 A;  1DJ7 B;  4E7K A;  1VQL T;  1WJQ A;  1VQ8 T;  2K57 A;  5J39 A;  1UGR B;  3JCM d;  5GAN 6;  4M7D C;  2XU8 A;  1VIF A;  5FU6 C;  4QVD A;  3OW2 A;  3RES A;  4A4K A;  4M7D G;  3G4S A;  3M53 A;  2K4Y A;  4HCC A;  2DKG A;  3MP8 A;  4PJO B;  1M1F A;  3CCL A;  2D0Q B;  2GQV A;  3GPL A;  1YIT A;  3OYL A;  4XTX A;  4EDU A;  3KBG A;  5GAO q;  5GAO l;  4J8O A;  3J81 E;  1VQK A;  4M7D A;  1OZ2 A;  3GNG A;  5A0L A;  2RD1 A;  5CK9 A;  3OYG A;  1VQ7 T;  2XDB A;  5LJ3 j;  2JTM A;  4C5G A;  2E10 A;  4PNO A;  3MP1 A;  2BUD A;  3E9G A;  2EWN A;  3OA6 A;  2VXF A;  1BI0 A;  4N4G A;  3UPU A;  3EFR A;  3OYN A;  3RMS A;  4F7U F;  1QVP A;  2D6F A;  1VQ6 A;  1QP3 A;  1GXI E;  1VQP T;  1WGS A;  1YBY A;  3HRS A;  4NS5 A;  4PJO A;  1G3S A;  2F5K A;  4OB1 B;  1V29 B;  3CBO A;  1D3B B;  3JB9 I;  3I56 T;  3C95 A;  2K5I A;  2A3L A;  3GP8 A;  3JCM W;  3CC2 A;  2E6Z A;  1X6O A;  1JB0 E;  2HQX A;  4M75 D;  2PVG B;  3M5A A;  2LCL A;  4IUV A;  4F7U G;  1KD1 U;  4PJO E;  4R55 A;  5J3B A;  1UGQ B;  3FRN A;  1O9S A;  2E5Q A;  3E1S A;  3QHS A;  4N0A A;  3SWN A;  3WVE B;  3S3O A;  1M8V A;  4ZGE B;  4XQ3 A;  3OYK A;  5CKE A;  1K8A U;  5GAN 5;  1VQ4 T;  4TVR A;  4ZGD B;  2FYK A;  5C6S A;  1BI3 A;  2WAC A;  4JLG A;  1D3B A;  4C8Q E;  3J80 E;  1KD1 C;  3FEO A;  3E19 A;  3CCM A;  5LJ5 j;  3OYM A;  4ME7 A;  4ELY C;  4XU2 A;  3OYC A;  1I4K 1;  1X01 A;  2QQ9 A;  3QG1 A;  1YI2 A;  1VQ9 A;  2ZGW A;  2CZ0 B;  3BW1 A;  4C8Q C;  4X9D A;  2EJ9 A;  2VV5 A;  1YCY A;  2E6N A;  3QZ9 B;  5LJ5 f;  5GAM j;  3OYJ A;  4PJO D;  4C8Q B;  1WPY A;  1OI1 A;  4NL3 A;  2JNG A;  3CMA A;  3JCM P;  2DVE A;  2LVM A;  3LX7 A;  2LDM A;  1H3Z A;  2ZPF B;  4EMH A;  3OBY A;  2FL7 A;  4ZTF A;  4J83 A;  4HCB A;  4M7D D;  2PU9 B;  4XTW A;  1NE8 A;  2E70 A;  2QQR A;  1UGP B;  2GF7 A;  5LJ3 e;  3JB9 J;  4MDW A;  5CCA A;  1ZHI A;  2VGM A;  4C5I A;  2CZ6 B;  1RL2 A;  3SFM A;  2HD0 A;  3WVD B;  1N6A A;  2CGH A;  5GAN 3;  2DJZ A;  1RI0 A;  2RI2 A;  2ZZD A;  4VUB A;  3QSU A;  3NTK A;  2AHJ B;  3I55 A;  1XQH A;  2GCX A;  3MEA A;  5GMK j;  1G5V A;  4J6W A;  1VQO T;  3FLG A;  5DLQ E;  4ZN3 A;  3NTI A;  1HK9 A;  2EIF A;  1VQK T;  2L8D A;  2WSF E;  5HKC A;  2ZPG B;  3RMQ A;  2PUO B;  5CKF A;  3VU3 C;  3CCU T;  1O75 A;  2LNV A;  4M75 F;  4OP0 A;  2JTF A;  3LWH A;  2CZ1 B;  1QVG S;  2DO3 A;  2DXC A;  4OGE A;  4XTY A;  3TEE A;  2JUF A;  2PVO B;  4X9C A;  4RCC A;  1IZ6 A;  4ZN1 A;  4JDS A;  3VKI A;  3OYB A;  2DTH A;  3I56 A;  4F7U E;  4LDW A;  4E7H A;  1YJW A;  5GMK e;  3ZBD A;  1VQL A;  5I2M A;  3CEY A;  1XOV A;  5DM7 R;  4QQD A;  3QXE B;  4MMK A;  1I8F A;  5LJ3 h;  3LW5 E;  4QVZ A;  1JJ2 A;  2RJE A;  2F5T X;  2RA2 A;  4E7L A;  1N27 A;  4M77 A;  3T9N A;  1N9R A;  1Y71 A;  2O4X A;  3HFO A;  3P8B B;  2PQW A;  4C8Q G;  3JCM e;  3H6Z A;  3OYD A;  1VQ5 T;  4M77 F;  5J26 A;  2K3Y A;  4BI3 A;  3JCM Q;  4C0D B;  3L2Z A;  2CS7 A;  1YJ9 A;  1VQM A;  4V2S A;  4QQG A;  2PUK B;  4PJO F;  3S6W A;  2HAX A;  2DD4 A;  3X28 B;  3GNF B;  4BDZ A;  4M78 F;  5CKD A;  2E1H A;  4YTL A;  5LJ3 d;  1VQN T;  3M54 A;  2K2V A;  1LJO A;  2LC4 A;  4M7A E;  2ZPE B;  3JCM c;  5KCO A;  2XDP A;  4B9X A;  4MML A;  5LJ5 e;  1Q81 U;  2RO0 A;  3RKW A;  3V7S A;  1M1K C;  3QII A;  3FC3 A;  3CPF A;  3JB9 F;  4M7D F;  3MP6 A;  5CQX A;  3VYH B;  4KBM B;  4XU1 A;  4OMF B;  3OY9 A;  3HSB A;  3CC7 A;  4UC4 A;  2E12 A;  3M59 A;  4M7A B;  3M58 A;  1VIE A;  4KUL A;  3KXT A;  5KH6 A;  4MDX A;  1QVF S;  3JRZ A;  3CXC S;  3A8L B;  1I5L A;  5GAO m;  1K73 U;  1IRE B;  1FXX A;  4C92 A;  1Q82 U;  1VQN A;  3M57 A;  2MAM A;  4M75 B;  2QEX T;  5GAO p;  2PVD B;  4C0G A;  2VUB A;  2E41 A;  3CCS T;  2IG0 A;  4L6V 5;  5M9O A;  1NJI C;  3CC2 T;  3CCR A;  2KDS A;  3F70 A;  2JVV A;  2RM4 A;  3RER A;  3M55 A;  4F7U B;  2MMP A;  1B34 B;  2MI6 A;  3DB3 A;  3SD4 A;  2IVW A;  4NOY A;  4RG2 A;  2K3X A;  2R5M A;  1MGQ A;  1M5Q 1;  3C12 A;  3X20 B;  5IAY A;  3FIF A;  2CYZ B;  1BIB A;  5FRM A;  2LQ8 A;  3GF5 A;  3CCM T;  4LDY A;  1VQ6 T;  3WXM B;  1W2B A;  4RCB A;  3QYH B;  3RKX A;  3OBW A;  3TCJ A;  2NLU A;  3X25 B;  4C5E A;  3L42 A;  3DKM A;  5FU7 B;  1YJN T;  3M9Q A;  3OYA A;  3BY7 A;  2BKD N;  3ZFJ A;  2L3R A;  2RHX A;  3R6O A;  1NJI U;  2QEX A;  1KQ2 A;  5GAO r;  2RI3 A;  3V8J A;  1YIJ T;  2KQW A;  4M75 E;  3NTH A;  4M77 D;  1U8R A;  4XU3 A;  4LDX A;  4OF1 A;  3ER0 A;  3URG A;  5GMK h;  2XHC A;  5HY6 A;  4JJN K;  3RUX A;  3P8H A;  1VQO A;  4N4I A;  4XTV A;  2DTO A;  4FL6 A;  4M78 D;  3CC7 T;  1M1G A;  2O4X B;  4MZP A;  1K73 C;  3CCE T;  2QA4 A;  5A0G A;  4DOW A;  4N4H A;  1X75 C;  5FRN A;  5GAN f;  2LCC A;  4A53 A;  3CCV A;  5L8R E;  2DXB A;  3LGF A;  5GMK m;  4KUD K;  3MEW A;  3Q1J A;  3CD6 T;  5FLX E;  4BY6 C;  4M7A G;  2KAF A;  3BDU A;  3INZ A;  3JB9 D;  3PT9 A;  3V8L A;  5HK3 A;  1S72 A;  5GMK i;  2RHY A;  2EQK A;  4A4G A;  1KG1 A;  1M1K U;  1Q86 U;  1M90 U;  2L89 A;  2QTX A;  1WQW A;  3OQ5 A;  5CIU A;  2YLB A;  4XTU A;  5GAM e;  3C4S A;  1Y7X A;  1UB4 A;  4F7U A;  4ZTJ A;  1XTD A;  4JRQ A;  1I81 A;  2B8A A;  2JN0 A;  4FSX A;  3SB2 A;  2EJF A;  1OZ3 A;  1KHC A;  3EFS A;  3O8V A;  1UGS B;  1WJS A;  4PLI A;  4Q5W A;  2G3R A;  5CVI A;  4M75 A;  2EKO A;  3PIO A;  1YI2 T;  4EMK A;  3DLM A;  4BI8 B;  3CCJ A;  2RI5 A;  3HRU A;  3AHU A;  4E47 A;  2OTJ T;  4J7F A;  3UT1 A;  3A5Z B;  3JCM X;  3CCE A;  1KHI A;  2QA4 T;  3G6E T;  3OYI A;  3L2U A;  4BAC A;  4XK8 E;  3OSS C;  3OS2 A;  2DIQ A;  3PGG A;  4DQ2 A;  3CPW S;  5A2Q E;  4FIB A;  3L2V A;  1W4S A;  4EMK B;  1G3Y A;  2VGN A;  3SWN C;  3M4Y A;  3OMG A;  1NPP A;  5AYF A;  5CKB A;  5IN1 A;  4A54 A;  4A4E A;  4A4F A;  3LLR A;  4CRI A;  3ASK A;  2MWP A;  3JCM V;  2QI2 A;  4BE0 A;  1KQS S;  1FWZ A;  4OGC A;  1VQ5 A;  4M77 G;  5I2S A;  2VYT A;  2EAY A;  2XID A;  3QDR B;  1WJR A;  1NZ9 A;  4HT8 A;  4M75 G;  4QVC A;  4II1 A;  1Q7Y C;  4IUP A;  4ATO A;  1BKB A;  3OYF A;  1XNI A;  1AHJ B;  3TRE A;  4PJO C;  4IUU A;  3J7A F;  1YJW T;  4Z02 A;  3PMT A;  2HNI A;  3S3M A;  5GAO n;  3V8K A;  3CCS A;  3L2R A;  2DZC A;  3VYG A;  5CKH A;  1VQ7 A;  5DY9 A;  2DEQ A;  3M4G A;  4JS5 A;  3PIP A;  3JB9 H;  4OVA A;  2F69 A;  3QO3 A;  2K5L A;  4J7I A;  4X34 A;  4JS4 A;  1QW1 A;  2RHI A;  3QYG B;  1WNL A;  2DD5 A;  3BFM A;  2M16 A;  5KE2 A;  3QKJ A;  5D6Y A;  2EQJ A;  1WQ7 A;  4E7J A;  3OYY A;  3QZ5 B;  4IUR A;  3G6E A;  4BI4 A;  2LT4 A;  3C94 A;  3H8Z A;  4L5G A;  4RKU E;  1KC8 C;  2QDY B;  3CCQ A;  5GAN 7;  2YRV A;  2XIC A;  2H3J A;  2KMT A;  3QPH A;  3DLL A;  4LD9 K;  4IUQ A;  3G71 A;  2QQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...