4M7DD

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 16
structure length 74
sequence length 74
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dD00
2K57A 2FYKA 1HXDA 1X01A 3V7CA 5GAOp 4C8QC 5LJ5e 3RIRA 4JRIA 5GAN2 3JCMP 5GMKe 2RM4A 3RKYA 1HK9A 2DVEA 4M77B 1YCYA 3JCMc 4HT9A 3VU3C 1B34B 2EJFA 4JLIA 4C92C 5I21A 5GAMf 5LJ5f 2RB6A 4C92E 3JCMQ 5GAMg 5GANg 4M7DA 2DXTA 2DXUA 3JCMd 4M78F 2I2LA 1JRIA 2YLBA 2E10A 3HFOA 1Y96B 3HFNA 4J6XA 4C8QB 5LJ5g 4F7UE 5GAN8 4DQ2A 1JBMA 2YLCA 4N0AA 4C8QG 4EMKC 3L1AA 4C92A 5GANj 4C8QE 5GAMd 2DTHA 4RCBA 3JB9H 1M8VA 1U1SA 3BW1A 4M7DG 1Y96A 4XTWA 2E65A 3SWNB 4F7UA 4XU3A 4M78B 3JCMg 5GAN6 4M77D 4M78D 3BY7A 5GAN4 1N9SA 5GAMj 1MGQA 1LOJA 4XTYA 4C92G 4M75F 1D3BB 3AHUA 5GAMh 4N0AC 4EMKA 3FIFA 4J6WA 4EMHA 4MMLA 4M7AF 4J6YA 2E41A 4M75E 4M7DB 5GANd 3JCMX 2VXEA 4M78G 4M77G 5LJ3d 3FB9A 4A54A 5GMKl 1WNLA 4WF2A 5GAN5 2EJ9A 1BIAA 1M5Q1 4M75G 4JUVA 5GANe 3JCMJ 3RESA 5GAOm 2JN0A 2VC8A 3BFMA 4M7DF 2DZCA 1H641 2FB7A 4M77E 4M7AB 2DKGA 3JB9F 4XU0A 2DTOA 1WPYA 3PGGA 5LJ3f 4M78A 3INZA 4XQ3A 5GMKm 5LJ3h 3JCMb 3EFSA 2RA2A 2ZGWA 4HA8A 2EJGA 4J5YA 1D3BA 4X9CA 4M77F 3JB9J 4M77A 5GANh 3BDUA 5LJ3j 4M75C 2YHTA 4MMKA 5DY9A 4M7AD 2DTIA 4M7DD 5LJ5d 3JCMe 4M7AE 4C92F 4M7AC 2RD1A 3JB9G 4NOYA 3JCMV 5LJ3e 1KQ1A 4RCCA 4M78C 3JB9D 4QVCA 3M4GA 2EWNA 4F7UG 3JCMW 5CAIA 3FJPA 4XU2A 4M77C 3RKXA 3HSBA 4M75A 2DEQA 5GAN7 3L2ZA 4NL2A 5GMKh 4PJOG 2QTXA 4EMGA 5GAOq 4M7DE 4JRKA 4M7AA 5GAOn 4Y91A 4A53A 3V7SA 4M75D 4XTZA 5GAMe 4M75B 4PJOB 4QVDA 4XTXA 3JCMh 4NL3A 3V8LA 4C92B 4PJOE 4XTVA 3JB9I 2DZ9A 2CGHA 4OP0A 3QUIA 1WQWA 2E64A 3QO3A 1I5LA 5GAOr 4X9DA 3V8KA 5GMKi 1LNXA 1I8FA 4PJOF 5GAN3 3EFRA 3SWNC 4PJOA 4PJOD 3RUXA 4F7UF 5GANf 2DJZA 3V8JA 3GIBA 1N9RA 3QSUA 1U1TA 2HNIA 2E1HA 1KQ2A 4M78E 3RKWA 4EMKB 3QHSA 4C8QF 1B34A 4C8QA 4V2SA 2VXFA 1TH7A 3SB2A 5LJ5h 4XTUA 1I4K1 3RERA 4C92D 1BIBA 3V7RA 5LJ3g 5GAOl 4PJOC 4M7DC 5LJ5j 3SWNA 4F7UB 4HT8A 4PNOA 2EAYA 4C8QD 5GMKj 4M7AG 2Y90A 1LJOA 3JCMf 1WQ7A 4XU1A 1I81A
chains in the Genus database with same CATH superfamily
3MKDA 1C0MA 3OYFA 1KC8R 2DF6A 1VQPQ 1VIFA 1QQJA 3LX7A 4WTOB 1AEYA 1QVFP 2CREA 2K6DA 2EQMA 2MWPA 1KFZA 1QWFA 3QJ6A 2H3EB 1JBMA 1UEBA 4FYXB 2DTHA 4GLKA 1NG2A 3NGPA 3MEWA 4F7UA 2HDAA 3DB4A 5GAN4 5L8RE 5GAMj 4XTYA 4RKUE 3S3OA 4KUIA 1BKBA 2K7AA 4EMKA 3A8MB 2W10A 5FRNA 2CS7A 2ATCB 4BI8B 3OYAA 3CCEA 4Y28E 3CCMT 1IHVA 2FHDA 4IUUA 1M5Q1 1RI9A 3F70A 1CKAA 1PWTA 1KC8U 1N8RU 2RO0A 2DKGA 4XQ3A 1ZQ1A 5LJ3h 2EJGA 1X27A 5GANh 4BI4A 1HD3A 2KI7A 1VYVA 2L3QA 2DAQA 1IB8A 2L3SA 3G1JA 4AT1B 1AOJA 2FZKB 2F2VA 2HL3A 3J7AF 1QP3A 2PQWA 3CMEA 4F7UG 1ZUUA 4J9EA 2DILA 2M0OA 1UGVA 2X51A 3L2QA 4VUBA 1VQMT 1RAEB 2P4RA 2NWMA 4C0DC 1WHHA 3G6EQ 1VQ6A 4A4HA 3OYDA 3GOXA 2HNIA 5L23A 4V2SA 4BE0A 1PD1A 2DNUA 5IXBA 1YCSB 1VQ7A 2ROTA 3DLLA 2P4TA 2EAYA 5CQYA 1QP2A 2JOYA 4AFSC 2O2OA 1TUCA 4ME7A 3RIRA 3JCMP 1N8RC 1XNIA 1MMDA 4M7DA 1VQMQ 5GANg 2V1RA 3RR6A 4OMMA 2MYSA 2DA9A 2OI3A 1K76A 5GAN8 3I56Q 4J6XA 4K11A 1PG5B 4FW2A 2XG8D 2DK3A 4XTWA 2PVGB 2KE9A 3SWNB 4J9BA 5DLOA 2CP6A 3CMEQ 2Y4XA 3OYJA 4N0AC 4MMLA 3TU4K 4N4HA 2HEQA 4PL6A 2KNBB 4DBHA 4ANJA 4FT2A 2BZYA 1UUEA 1IZ6A 1LVKA 1T0HA 2X3XD 2QQBA 3BE3A 4OB1B 2OAWA 1OU8A 4Q5WA 3NMZC 2L3RA 2DTOA 3CCST 1OV3A 3CCMA 1K9AA 3U23A 1PM3A 1JXOA 4J9DA 1QW1A 3MPUB 2XDBA 1W6XA 2JS0A 2GBQA 1WLPB 2EBPA 2LQKA 4PJMA 2E6ZA 2CDTA 2DERA 3CCVQ 2X4XA 4LDUA 2NUPA 1YWPA 5CVIA 4C5GA 4OB0B 2AT1B 4XTVA 1ZSZA 3X26B 3J80E 2GQVA 2CGHA 3C94A 4C5HA 3S3NA 1U8RA 1B3QA 3SWNC 2ABLA 2FVUA 1YI2T 1H3HA 4WCIA 1XQHA 2SEMA 1RAFB 1G8XA 3QHSA 1VYUA 1I4K1 1KD1R 4C92D 3CCRA 3M0PA 5GMKj 4M7AG 1C6VX 3JCMf 3UA6A 1GBRA 1Z9ZA 2XDPA 3VS6A 2JW4A 2JMCA 1G5VA 4E7SA 2QYZA 4FU6A 3JCMd 2I2LA 2E10A 4C0FA 1WXUA 1RAHB 2OTJQ 1D0YA 3EFOB 2KR3A 3L1AA 4AFQC 4C8QE 1Y96A 4CRIA 2BTTA 3SHWA 4AG2C 1N9SA 5AT1B 1VQ8Q 2LJ1A 3AHUA 2R5AA 4RG2A 2FPFA 4J9CA 1VQOQ 2E4HA 1VQ4A 1RL2A 2QEXT 3LLRA 2L2PA 5GJVB 4JS5A 3RESA 5GAOm 2W0ZA 2E3IA 1IGUA 2CSQA 3PGGA 2V8KA 2K2MA 8AT1B 3VRYA 2RA2A 3PIOA 3OYHA 3A5ZB 5HK0A 4M7DD 1O75A 3UF4A 2FRWA 2K79A 5J3BA 1K0XA 4XU2A 1FMVA 2KVQG 1YHQA 3MCAB 1Q7YU 2EQKA 1T3LA 1QVFS 1R0CB 4M7DE 2DIQA 3VS5A 4UC4A 2F2WA 3M9QA 1VQKT 3QUIA 4MDXA 2QTVA 1XTDA 2LVMA 2DO3A 4FM4B 3CPFA 2CP3A 2LQWA 2DLPA 3FLGA 2JM9A 9ATCB 3E1SA 2IIMA 1WDXA 2RI2A 1BI3A 3PT9A 5GAOl 1QKXA 2DBMA 1LJOA 1NE8A 3OS5A 2JTMA 1X01A 3SDZA 1OOTA 3RDVA 3OYNA 3CCEQ 3JCMJ 3M0RA 5KH6A 2C0TA 3MEVA 3QWYA 1Y96B 2EQIA 3CBMA 1NYGA 1TUDA 2PU9B 2EYWA 4XU3A 3I56A 2YUOA 3X25B 1D0ZA 2L89A 5KYXB 1E6HA 5EG2A 1YIJT 1KD1U 4M7DB 4M78G 3BDLA 3E9FA 2LNHB 2KROA 1VQ7Q 3HRSA 1PC0A 3H9NA 3TCJA 1YI2A 1YWOA 3CCJT 4F14A 4ZTJA 1ZX6A 3I5RA 5C0MA 1M3CA 2P0KA 2AIRB 1M1KC 3RBBB 3QXEB 3G6EA 1VQ6T 2CZ6B 3M0QA 4LDXA 4LXCA 2D0NA 4NOYA 1F1BB 4II1A 1M1KR 4M78C 5IT9E 2H8HA 2K2VA 5KE3A 2WSFE 1TS9A 2RQWA 1SRLA 3VYGA 1Y7XA 2X9HA 2L0AA 3S3MA 1BI2A 2KT1A 3A8LB 2E64A 2QDLA 1I8FA 4ORZA 1RACB 2BKDN 3V8JA 2CSIA 3DLMA 4OMNA 3GNFB 4KBMB 4HKEA 3SEMA 1JJ2P 1UHCA 2LJ0A 3CCUT 3RNJA 4RTVA 3UPUA 1Y07A 3V7CA 2GCXA 3TEEA 1VUBA 3C0CA 4HT9A 4B9XA 4LNPA 4QT7A 1WHKA 3VU3C 5GAMf 2P0PA 1QLYA 4KGZB 1E6GA 2P0QA 3O5ZA 3M0SA 1JRIA 1TSFA 4J9HA 4TVRA 1G83A 4RTXA 3QYHB 4F17A 5FLXE 3P8BB 4M7AD 4C92A 5FROA 2LP5A 3JV3A 3EGXB 3J81E 4BDYA 1K9MR 4M78B 4AG1C 1MGQA 5DLQE 4B9WA 2E5QA 5GAMh 1N27A 1YITA 1Q81C 1RAGB 3CC4Q 3CCQA 1GL5A 2GTOA 4JLGA 1WHGA 3FB9A 2P84A 2DX1A 5CKFA 3EFOA 2DL7A 5FU6C 2EPDA 2J6FA 1IHWA 3BFMA 4OMFB 4X34A 2RHXA 3H6ZA 2KRSA 2OAUA 3MP8A 5LJ3j 2HZYA 1MUZA 1JO8A 5IAYA 2M02A 2DYBA 4XAXB 3JB9G 2C0IA 3JB9D 3EGUA 3VS4A 4BACA 1PRMC 1HSQA 1MV3A 3RMQA 2JZ2A 1QVGP 2RJFA 1BYMA 2QTXA 4KH1B 2CKKA 1AZEA 3V7SA 1R0BG 2DEUA 4XTXA 3UATA 1W2BA 2DPPB 2BUDA 3QO3A 3VUBA 1VQ5T 3MHXA 4X9DA 2NUPB 2MF2A 3I56T 2EGAA 4CC3A 1QVPA 1OZ3A 2EIFA 3VS1A 4Z89A 1NBEB 1TH7A 3SB2A 1E7OA 3KXTA 4BUGA 1WHLA 1BIBA 3OBWA 1WQ7A 5IXFA 5GAN2 4M77B 2KQWA 1Z9QA 5LJ5f 2KGTA 4PJJA 1GRIA 3LWHA 4LDYA 2EYXA 4ZNXA 3X20B 3EG9B 4C0GA 1S72Q 2GGRA 5KCHA 1X6BA 4J9GA 1OX8A 4E7LA 4JJCA 1M8VA 3GPLA 4RCBA 4Z88A 1YJWT 1ZSGA 4XK8E 1RAIB 3D7SB 3L42A 3M0UA 2A7YA 4FW1A 2J6OA 2D0QB 3A8HB 2RQRA 4E7HA 4B6MA 3I55Q 3PNWC 2EW3A 4BD3A 2HD0A 2Z0WA 1NJIC 1YHQT 4AMCA 4MZMA 4F16A 5CQXA 2VC8A 5CKHA 4M77E 4O5VA 4FT4A 2MOXA 3QWXX 2BE7D 7AT1B 2CT4A 2RMOA 3PE0A 3WXMB 1UJ0A 4ZN3A 1PHTA 1X69A 1QVFA 4OMPA 3JCMe 1UGSB 3VS7A 5FWCA 2PTKA 1YJ9T 1EX4A 1UECA 1NEBA 2KBTA 4PFPA 1WA7A 2AHJB 3M4GA 5FU6B 2YDLA 1AZGB 4M77C 4FSSA 3CD6A 1WI7A 3NTHA 1YHQQ 4HXJA 2LT1A 3CC2A 1WXTA 1K1ZA 3OYIA 5KYYB 3I55T 5KYNA 4C92B 1GXIE 1AWWA 1NJIU 1WQWA 2LCLA 2ZZDA 3QBYA 2WSCE 4KT0E 2DJZA 3GIBA 3EH1A 5KYUA 2SRCA 3OYYA 2RI5A 2KT8A 5CR2A 1UFFA 1VQPT 2KAFA 2C06A 3SD4A 2QG9B 2DXCA 1VQOA 5LJ5e 5GMKe 2CUBA 3JCMc 1YIJA 3CCET 3X24B 4C92C 5GAMg 2RB6A 3M57A 3RMSA 1VQ8A 1CSKA 2X4JA 2F5KA 3EG0A 3EG3A 1M3BA 4BDZA 2L5QA 2RHZA 2A3LA 2JTFA 1B07A 5LL6S 4HCZA 3OW2P 1M90R 3QIIA 1SHFA 5CK9A 5FRMA 2LCSA 1AWJA 4PFOA 1YJ9A 2AZSA 3URGA 5GANd 3EG1A 1W4SA 5A0GA 5KYWA 5LJ3d 5D6XA 1LPLA 2MK5A 3DKMA 5GAN5 3ME9A 3OYBA 2VGNA 4C5EA 3HRUA 5CIUA 1M2VB 2ZPIB 2YUPA 1K9MC 3H8ZA 2IG0A 3JB9F 1JJ2S 1FMWA 4PJOD 4JJBA 3OS0A 1OU9A 1KQ1A 5IHIA 1YJNA 4QVCA 5CAIA 3PIPA 2RF0A 3CCVA 1YJ9Q 4C0DB 2QEXQ 2ZPFB 4LDWA 4L5GA 4CI0C 3V8LA 1SEMA 4OMQA 1O9SA 2R5MA 3V8KA 2OTLQ 1X75C 2J7IA 1VQ8T 2AK5A 1NZ9A 3HPWA 4PJLA 2HQXA 2ZPGB 2CZ0B 3CBPA 2WACA 3RERA 1UE9A 1Q82C 3HKSA 2DVJA 2O01E 1M2OA 1QKWA 1AHJB 4C8QC 1HK9A 3REAB 4BI3A 2CYZB 1B34B 1Q95G 2FL7A 5HCKA 1ZHIA 2M0YA 2HAXA 1BU1A 3TVTA 3HFOA 1NEGA 3ZEHA 2GTJA 2JNGA 4EMKC 4QQDA 5CKEA 5EC7A 1YN8A 3LYIA 2ESWA 5I22A 4ESRA 1Q86C 3CCQT 2VASA 3CPWS 2HCKA 3CD6T 5C6SA 1VQMA 4IKFA 3CC2Q 3ER0A 2CP7A 1MMGA 2XMFA 1OI1A 2KK4A 4A4EA 1WJSA 1Y71A 4WF2A 3CCVT 1BIAA 4KRTA 5KCOA 3H0FA 1Q86U 3N5BB 2K5LA 3WVEB 1K73C 4E7ZA 3UT1A 2F2XA 5LJ3f 3LGFA 2KRNA 4M77A 1Q82U 1VQ6Q 5DY9A 3I5SA 2DTIA 4A63B 2QA4Q 2DYIA 3QKJA 3QYGB 1KK7A 4IIOA 1M3AA 3JCMV 5LJ3e 3CQTA 3OQ5A 3CCSQ 2A08A 1BCMA 1TXQA 4A4GA 2VUBA 3FJPA 2DEQA 3PMTA 1KD1C 5GAOq 2DRKA 2F5TX 4JRKA 1N5ZA 2QQ9A 1M1GA 4M75D 2MIOA 1X2QA 5GAMe 2O4XB 4M75B 3PTAA 2AKKA 3JCMh 2CT3A 3C4SA 1OPKA 1NYFA 2FEIA 5GAN3 2RNAA 2R58A 5HY6A 4KUDK 1D0XA 3FDRA 4PKCC 4RUGA 3GLXA 8ATCB 3C12A 1ZA2B 2KSSA 1GFDA 3HP9A 1PCXA 4M7DC 3I35A 4HT8A 2PUOB 3CCRT 2K3XA 2ROLA 2D1XA 2IVWA 3DB3A 4BE2A 4JJDA 3E19A 1VQ4T 2RM4A 2CH4W 1N8RR 2K3YA 2FG0A 5KYXA 1PKSA 4F7UE 2DIGA 2RK1A 2HMAA 1P92A 3EHQA 2PNIA 2MAMA 2ZPHB 4A4FA 4N0AA 4GLMA 5GANj 2QGGA 1BI0A 1ZUYA 3MP1A 2HKNA 3OSSC 2XD0A 1IXDA 5HK3A 2M1HA 4M75F 2MCNA 2CUDA 1GBQA 4CC7A 3OYEA 2NUZA 1VQPA 4PJNA 3E9GA 4A4KA 2VXEA 4M77G 1FX7A 2VKNA 5GMKl 2FZGB 3G4SA 3NTKA 3S6WA 2DFUA 2NYSA 1H641 2FB7A 1ABOA 2DD4A 2VVKA 1ACMB 1Y0MA 4HA8A 2QK0A 4DA4A 1Q81U 4MMKA 2KY9A 1SPKA 2PVDB 1G3YA 2A36A 2LX9A 2KXCA 3P8HA 1XJWB 1UJYA 1QCOA 2OTLA 3CCQQ 3CC4A 2NLUA 2FPEA 5GAN7 3KFVA 1YITQ 4EMGA 4M7AA 1VQNA 3ZL7C 4GBQA 2M9UA 1N6AA 4X1VA 4NL3A 1IGQA 2DZ9A 1VQKA 2F1LA 2VGMA 1A0NB 3GBQA 4PLLA 5IHKA 1OPLA 2RJDA 2MMPA 1B34A 1GCQC 2AZVA 2XKOC 2K9GA 2BZ8A 2JUFA 4E7JA 4OVAA 4LDVA 2BE9B 4F04B 1WXBA 1UGRB 2F69A 1EFNA 4C92E 2EQUA 3CCJA 1K8AC 1G2BA 4C8QB 1G3SA 3G4ST 3E2UA 3OBYA 4DQ2A 3M5AA 2RQUA 1I07A 2HBWA 3EGXA 3WVDB 3CCLQ 2K3BA 1K73R 4QW2A 3JB9H 1EIFA 3OB9A 2E65A 1NLPC 2XIDA 3BY7A 4ZGDB 2VYTA 2LQ8A 2QQRA 4PFZA 4J6WA 2EFIA 1M8MA 1YBYA 4M75E 4D8KA 4DEXA 1GFCA 1WNLA 1M1FA 1YIJQ 4E7IA 1NPRA 3REBB 2JN0A 3FJ5A 2DZCA 3CMAT 2XHCA 4M7AB 1D1AA 3JCMb 4Z02A 5M9OA 2I0NA 2YRDA 1D3BA 4ATOA 3BDUA 1D1BA 2YHTA 2LC4A 1VQ5A 1U3OA 3QZ9B 2KRMA 2DE0X 4L59A 3A8GB 3CXCA 4RCCA 3CC7A 2X35A 2EWNA 5I2MA 1VQ9A 4RMOA 3NFCA 2CZ7B 4FYYB 1MNEA 1VQLQ 5A0LA 4XTZA 2HQEA 2D9TA 3VS0A 1MNDA 5GAOr 3TSZA 1K8AU 3CC7Q 1TUGB 4PLIA 1U1TA 1U5SA 3P8DA 3JSCA 2DRMA 4C8QF 3R6OA 1VQ5Q 2JS2A 2O88A 3OW2S 4F7UB 4C8QD 4HVVA 4EIKA 2K57A 1K0SA 1V1CA 1KHIA 3RKYA 1PD0A 4DOWA 2JM8A 2PZ1A 3JCMQ 3X28B 1X6OA 1ZBJA 1M27C 4M78F 4R55A 2E6NA 5LJ5g 3A8OB 5DM7R 4O6JA 1OZ2A 3JRZA 2HBPA 5GAN6 3EAEA 2EYYA 3OY9A 1X2KA 2YRCA 1WJQA 2V1QA 4DBRA 1VQNT 1WX6A 3LH0A 4LD6A 3OYCA 3H0IA 4BY6C 1VOMA 4JJNK 1Q86R 2D8HA 2DL4A 4RTUA 2ED0A 4XU0A 1WPYA 4NS5A 1H3ZA 1I5OB 1WZOA 4M75C 2EGEA 1TOVA 1WIEA 1MMAA 3G71T 3MEUA 1OULA 2YXYA 5FWBA 1SG5A 3ULRB 5CKBA 4DEYA 1TWBA 5GMKh 1M4ZA 1VQ9Q 2DJQA 3VRZA 2D6FA 2KYBA 5GAOn 4Y91A 4A53A 1UB4A 3M56A 1S72T 1OQKA 3CCUQ 2EVRA 4CC2A 4AFZC 5GMKi 2OTJA 1RABB 3QSUA 1AT1B 4M78E 4MDWA 1PSFA 4EMKB 4OF1A 3G71Q 1PNJA 1ZSZC 2CP2A 1FWZA 1UGPB 3ASKA 3QG1A 2VWFA 2YUNA 4KGVB 3SWNA 1TU0B 3CMET 2LZ6B 1NM7A 1BBZA 4XU1A 1ARKA 2QAZA 2YT6A 2X4YA 3M0TA 3CCRQ 3MJXA 1BB9A 4RTTA 1RLPC 3M4YA 4HVWA 4BB7A 3L2WA 1BK2A 2YLCA 4LUEA 1ZBXA 4M78D 3CCJQ 2ED1A 1M90C 3PVLA 1VQ9T 1M2VA 4RTWA 5KYUB 1WGSA 2G3RA 2CH4A 3UWNA 2XICA 2CZ1B 1WFWA 2RPNA 2GFAA 4A54A 2JT4A 5HKCA 3LWIA 2ZCFB 4RG8A 3L2RA 4E6RA 2EJ9A 1QVGA 2RJEA 4FIBA 3QDFA 3EHRA 3META 1QWEA 3FC3A 5ECAA 5J39A 4CC4B 4HCCA 4ELYC 2NUTA 5CO7A 2A37A 2X4WA 1NPPA 3NTIA 4JPBW 1ZA1B 4IUQA 1HJDA 4KULA 3VJPA 3QPHA 4N4GA 2ZPBB 1FYNA 3CXCS 4OMLA 1VQNQ 3CC7T 4GY5A 2O4XA 4M75A 4IURA 3EH2A 2XI9A 1H8KA 1W2BS 2LRQA 2RH2A 2RHYA 4PJOB 1UGQB 2EYQA 3FRNA 2ENMA 4PK4A 2KMTA 1I5LA 4PJOA 3GF5A 1KQSS 2DXBA 5GANf 4HVUA 4J9FA 4MZPA 2DL3A 2HL5C 2LCCA 1S72A 5I11A 2VXFA 5LJ5h 3OW2A 3OYMA 2QA4T 5LJ5j 2KDSA 2QDYB 2V8JA 2XU8A 5KYWB 3CXCP 1I0CA 3LW5E 4JLIA 2OX7A 4OB3B 2DMOA 2DXTA 2KYMA 1W2BP 2LX7A 1UTIA 4Y92A 2COWA 1K73U 2PVOB 4C8QG 4ELZC 3PMIA 2WSEE 3QJYA 3CC2T 1KHCA 4C5IA 4M77D 1KJWA 2XDDA 3OS2A 2EKOA 1D1CA 1LOJA 1S1NA 2YSQA 1KQSA 4BY6B 3CCLT 2BZXA 1BI1A 2CP0A 2AKLA 4KGXB 2E41A 2QI2A 3JCMX 1RADB 3NHNA 2YRVA 1WJRA 3TREA 4ZGEB 1RLQC 5GANe 2YWWA 2QXFA 4DBFA 2KEAA 1MHNA 2LNVA 2MWOA 1OYXA 2LJ3A 5GMKm 2ZGWA 4M77F 2RI3A 3KBGA 3M55A 3HL8A 5LJ5d 4M7AE 1EZZB 1FMKA 1JB0E 3RKXA 4HCBA 1X43A 4PJOG 3ZBDA 1W1FA 1T0JA 4FYVB 1M30A 4RTYA 3Q1JA 4JRPA 3CCSA 2GNCA 2JJ9A 1BCOA 4JZ3A 4LE9A 2H3JA 3UA7A 1KQSP 1PRLC 4FL6A 2B8AA 1YJNQ 2QQAA 2COZA 1KQ2A 2RN8A 4N4IA 2DETA 3EG9A 4P5NA 4ZTFA 1YNZA 1G3TA 2EKHA 4JRQA 2A0FB 1SKUB 4PJOC 5A0DA 3MO8A 4J7FA 1FXXA 4L6V5 1RAAB 2RQVA 1R77A 2FYKA 1ZSZB 1KC8C 5CCAA 5GAOp 4DBQA 1K8AR 1YCYA 1J3TA 3M58A 4C0ZA 1M9SA 3GNGA 4JDSA 2JMAA 2L3PA 4OGEA 4R56A 4E47A 5GJWB 1VQKQ 3TQ7P 2L8DA 2EQJA 4IIMA 4FYWB 4MZTA 1QCFA 2O9SA 1X6GA 5GAMd 4OGCA 1D09B 3OYGA 3JCMg 1H92A 1ABQA 2OTJT 4J8OA 3SFMA 4C92G 3AT1B 3VS3A 1WYXA 1JXMA 3FIFA 2DL8A 4EMHA 1Q81R 3G7ZA 4M7AF 3THKA 1MMNA 2LT4A 5KE2A 3PFSA 1MV0B 1AD5A 4JZ4A 4M7DF 3C95A 3G71A 4OB2B 1KIKA 2E70A 3UDCA 5D6YA 1Y57A 2C0OA 4M78A 5FU7B 3INZA 2XK0A 2DBKA 3EFSA 4J5YA 4IUTA 1YI2Q 2VB6A 4YTLA 5IN1A 3HTRA 2RD1A 1XOVA 3CCUA 1UHFA 1U06A 3NPFA 1V29B 3JCMW 1IREB 2QEXA 3HSBA 3OYKA 3L2ZA 1JU5C 4Z8AA 1GCPA 4LN2A 2X3WD 2LDMA 4QVZA 3M53A 1QMCA 1C1AA 4E2FB 3HRTA 3GP8A 3FEOA 4PJOE 1WHMA 2QASA 5FU7C 3PVQA 3LGLA 1AWOA 1NLOC 2VV5A 1V76A 3CMAA 1ZLMA 3CPWA 2MPXC 2RK2A 4C8QA 1SF9A 3G6ET 1IRXA 3EGDB 1W70A 3I9QA 2LTOA 4XTUA 1TTHB 3M54A 3V7RA 4LD9K 1Q7YC 1YITT 4BE1A 2OJ2A 1I1JA 4JRIA 2M51A 2O31A 4RTZA 5I21A 3JAME 4HCKA 2EGCA 3ZFJA 2DXUA 2YLBA 1Q82R 1VIEA 3CEYA 2M16A 1TG0A 3OA6A 1U1SA 1ZUKA 3BW1A 4J9IA 1NJIR 4M7DG 2JXBA 4LUDA 1YJNT 1PSEA 2G6FX 2RQTA 3VKIA 1D3BB 1YJWQ 1AVZC 2LQNA 1DJ7B 1QVGS 5D6WA 2IPOB 1JEGA 2QA4A 1G3WA 1KG1A 2HQHA 5CKDA 2QQSA 3OYLA 4M75G 3CPWP 4FCYA 1T3SA 2GF7A 3EG2A 5I2SA 4QKUA 2DL5A 2J06A 1IO6A 3IQLA 3JB9J 2K5IA 3T9NA 3MEAA 1K4US 1VQ4Q 1RI0A 2NUTB 3CBOA 1YFNA 2K4YA 3KUFA 4KH0B 1VQLA 1B7TA 2QGFB 3OS1A 4FSXA 3CC4T 1OX9A 2JTEA 3CD6Q 2DD5A 2A28A 3OSVA 1YJWA 1SHGA 2JVVA 1HYOA 1SSFA 2O9VA 3H41A 1UG1A 2EYZA 3JB9I 4J83A 4OP0A 1VA7A 3VYHB 1LNXA 4IUPA 4PJOF 3EFRA 5FW9A 1M1KU 1CKBA 4EDUA 2HSPA 3OMGA 2E1HA 3QZ5B 5D7UA 3RKWA 1R8OB 3MP6A 3H0HA 2R57A 2FPDA 3VV0A 1SRMA 4AFUC 3L2VA 1VQ7T 2GQIA 2J6KA 2MI6A 3M59A 4EPCA 1OEBA 2B86A 4PNOA 1HXDA 3I55A 2FRYA 4QQ6A 2DVEA 2Y4YA 2E12A 2EJFA 3VS2A 4DOVA 6AT1B 3TSWA 2OTLT 3HFNA 2DM1A 3CCLA 3CMAQ 5J26A 4D8DA 1LCKA 3L2UA 1JQQA 2CP5A 4ZGJB 4QQGA 3VUZA 2YUQA 4E7KA 4J6YA 3A1PA 2ECZA 1UDLA 3O8VA 1VQLT 4ZN1A 4JUVA 1K9MU 2BIVA 2J05A 1RUWA 2KXDA 2HKQB 2E5KA 2RHIA 2E3HA 3CCMQ 4X9CA 3OMCA 4J7IA 1QCNA 4R0KA 2D8JA 4C92F 1VYTA 4M7AC 1KSWA 1JJ2A 2RHUA 2V8IA 3R6NA 3HHTB 1SSHA 2K5FA 4NL2A 1M90U 5AYFA 1Q7YR 2FO0A 2RJCA 3LH5A 2FZCB 5IH2A 2HSEB 3EGDA 4QVDA 4OMOA 1GCQA 4D6WA 2PUKB 2V26A 4M4ZA 1WHJA 3RUXA 4F7UF 4IUVA 1N9RA 2ZPEB 5IHNA 3A98A 5A2QE 1YP5A 4JS4A 5KYYA 3QDRB 2ZAEA 5LJ3g 3G4SQ 2LMJA 1AWXA 1VQOT 2GFUA 2Y90A 1PKTA 2COYA 1I81A
chains in the Genus database with same CATH topology
3V7CA 2GCXA 2V8JA 2XU8A 3E19A 3TEEA 3OYFA 1VUBA 1VIFA 2RM4A 4B9XA 1VQ4T 4HT9A 3VU3C 2K3YA 3LW5E 4JLIA 4OB3B 2P0PA 3LX7A 5GAMf 2P0QA 2DXTA 1JRIA 2EQMA 2MWPA 4F7UE 2DIGA 2RK1A 1P92A 4TVRA 3QJ6A 2MAMA 2ZPHB 4A4FA 1K73U 3QYHB 1JBMA 2PVOB 4N0AA 1UEBA 3P8BB 4C8QG 3PMIA 5FROA 4C92A 5FLXE 2DTHA 4GLKA 4ELZC 2WSEE 3QJYA 3CC2T 3J81E 1BI0A 3MEWA 4F7UA 1KHCA 3MP1A 4BDYA 4M78B 3OSSC 4C5IA 4M77D 2XD0A 3DB4A 5GAN4 2XDDA 3OS2A 2EKOA 5L8RE 5GAMj 1MGQA 1LOJA 4RKUE 4XTYA 5DLQE 5HK3A 3S3OA 2M1HA 4M75F 4B9WA 4BY6B 2E5QA 1BKBA 4KUIA 5GAMh 3CCLT 3OYEA 4EMKA 3A8MB 1N27A 1BI1A 5FRNA 1YITA 2CS7A 1VQPA 1Q81C 2E41A 2QI2A 3E9GA 4A4KA 3JCMX 2VXEA 3CCQA 4M77G 1FX7A 4BI8B 3OYAA 4JLGA 3FB9A 5GMKl 3CCEA 2YRVA 4Y28E 3CCMT 1WJRA 3TREA 4ZGEB 3G4SA 2FHDA 3NTKA 4IUUA 1M5Q1 5CKFA 3S6WA 5GANe 3F70A 5FU6C 2QXFA 1KC8U 1MHNA 3BFMA 4OMFB 4X34A 1H641 2FB7A 2RO0A 1N8RU 2RHXA 2LNVA 2MWOA 2DD4A 1OYXA 2DKGA 3H6ZA 4XQ3A 5GMKm 1ZQ1A 5LJ3h 2ZGWA 4HA8A 2EJGA 4DA4A 4M77F 2RI3A 2OAUA 3KBGA 3MP8A 4BI4A 3M55A 2KY9A 4MMKA 5LJ3j 5GANh 1Q81U 2PVDB 1G3YA 2DAQA 3HL8A 5IAYA 5LJ5d 4M7AE 2LX9A 3P8HA 4XAXB 3JB9G 3J7AF 1QP3A 3JB9D 2PQWA 2OTLA 3CMEA 4BACA 4F7UG 3CC4A 2NLUA 1JB0E 3RMQA 2JZ2A 3RKXA 5GAN7 2RJFA 1BYMA 4HCBA 4PJOG 2QTXA 4EMGA 3ZBDA 2M0OA 4M7AA 2CKKA 3V7SA 1VQNA 3Q1JA 4JRPA 3L2QA 3CCSA 2M9UA 4VUBA 4XTXA 1N6AA 4NL3A 1VQMT 1W2BA 2DPPB 2BUDA 2H3JA 2DZ9A 3QO3A 3VUBA 4FL6A 4C0DC 3MHXA 4X9DA 1VQ5T 1VQKA 1VQ6A 2MF2A 3I56T 2B8AA 2VGMA 4A4HA 2QQAA 3OYDA 1QVPA 4PLLA 1OZ3A 2HNIA 3GOXA 1KQ2A 2RJDA 2MMPA 2EIFA 4N4IA 4P5NA 1B34A 4V2SA 4ZTFA 1G3TA 1TH7A 2XKOC 3SB2A 4BE0A 3KXTA 4BUGA 4JRQA 1BIBA 2JUFA 4PJOC 4E7JA 5A0DA 1VQ7A 3DLLA 2P4TA 4OVAA 2EAYA 3MO8A 1QP2A 3OBWA 4J7FA 5CQYA 1FXXA 4LDVA 4L6V5 2JOYA 1WQ7A 4ME7A 2FYKA 1KC8C 5CCAA 5GAOp 3RIRA 5GAN2 3JCMP 1N8RC 1UGRB 4M77B 1YCYA 3M58A 2KQWA 1XNIA 2F69A 4C0ZA 1M9SA 3GNGA 4JDSA 5LJ5f 4OGEA 4R56A 4C92E 4M7DA 4E47A 2EQUA 5GANg 4LDYA 3LWHA 3CCJA 2L8DA 3X20B 1K8AC 2EQJA 4C8QB 5GAN8 4C0GA 4J6XA 4MZTA 1G3SA 3G4ST 5KCHA 3OBYA 2XG8D 4DQ2A 4E7LA 3M5AA 2DK3A 3WVDB 1M8VA 5GAMd 3GPLA 4RCBA 3JB9H 4QW2A 1YJWT 4XTWA 1EIFA 2PVGB 3OB9A 2E65A 4OGCA 3L42A 4XK8E 3SWNB 3JCMg 3OYGA 2XIDA 3BY7A 2OTJT 2A7YA 5DLOA 4J8OA 3SFMA 4C92G 4ZGDB 2Y4XA 2VYTA 2D0QB 2LQ8A 2QQRA 3OYJA 4N0AC 3FIFA 4J6WA 2EFIA 4EMHA 3A8HB 4MMLA 3TU4K 3G7ZA 4M7AF 4N4HA 4E7HA 1YBYA 4M75E 4PL6A 3PNWC 4FT2A 4BD3A 2HD0A 1IZ6A 2LT4A 5KE2A 1NJIC 1YHQT 1WNLA 1M1FA 3PFSA 2QQBA 4E7IA 4MZMA 1NPRA 2JN0A 2VC8A 4OB1B 5CQXA 4Q5WA 4M7DF 2DZCA 3C95A 5CKHA 3CMAT 4M77E 2XHCA 4M7AB 2L3RA 4O5VA 4FT4A 4OB2B 2E70A 3UDCA 2DTOA 5D6YA 4M78A 3INZA 5FU7B 3JCMb 4Z02A 2XK0A 3EFSA 5M9OA 4J5YA 3CCST 1D3BA 3WXMB 3CCMA 4ATOA 3BDUA 2YHTA 2LC4A 4M7AD 4IUTA 4ZN3A 1VQ5A 1QVFA 4YTLA 3JCMe 1UGSB 5IN1A 1QW1A 1YJ9T 2RD1A 3QZ9B 1XOVA 3CCUA 4L59A 3A8GB 3CXCA 4RCCA 3CC7A 2XDBA 1V29B 2X35A 2AHJB 3M4GA 2EWNA 3JCMW 5FU6B 2LQKA 4M77C 1IREB 2QEXA 3HSBA 5I2MA 3OYKA 1VQ9A 3L2ZA 2E6ZA 4RMOA 3CD6A 3NFCA 2CZ7B 3NTHA 2LT1A 3CC2A 5A0LA 2LDMA 4XTZA 3OYIA 2X4XA 4LDUA 4QVZA 2HQEA 3I55T 3M53A 2D9TA 5CVIA 4C5GA 3HRTA 4OB0B 3FEOA 4C92B 4XTVA 3X26B 3J80E 3GP8A 4PJOE 1GXIE 2GQVA 5FU7C 2CGHA 3C94A 1NJIU 1WQWA 2LCLA 2ZZDA 3LGLA 3QBYA 4C5HA 3S3NA 5GAOr 2VV5A 2WSCE 4KT0E 1U8RA 3SWNC 1K8AU 3CMAA 2FVUA 2DJZA 4PLIA 1YI2T 3GIBA 1U1TA 3P8DA 1XQHA 3CPWA 2RK2A 3JSCA 3QHSA 3OYYA 2RI5A 3R6OA 4C8QA 4C8QF 3G6ET 5CR2A 3OW2S 2LTOA 4XTUA 1VQPT 2KAFA 1I4K1 3M54A 4C92D 3V7RA 2C06A 3CCRA 4F7UB 4LD9K 4C8QD 5GMKj 1Q7YC 4M7AG 3SD4A 1YITT 3JCMf 4BE1A 2DXCA 1VQOA 2K57A 5LJ5e 4JRIA 5GMKe 2XDPA 3RKYA 1KHIA 3JCMc 4DOWA 1YIJA 3CCET 3X24B 4C92C 5I21A 3JAME 5GAMg 2RB6A 3M57A 3JCMQ 3X28B 3ZFJA 3RMSA 1G5VA 2DXUA 1X6OA 1VQ8A 3JCMd 4FU6A 2X4JA 4M78F 2I2LA 2F5KA 2YLBA 2E10A 4C0FA 4R55A 2E6NA 5LJ5g 3A8OB 1VIEA 5DM7R 3CEYA 2M16A 3OA6A 4O6JA 1OZ2A 3L1AA 3JRZA 4C8QE 4BDZA 2L5QA 1U1SA 2HBPA 2A3LA 1Y96A 2RHZA 3BW1A 4M7DG 4CRIA 5GAN6 3EAEA 2JTFA 1KQSA 5LJ3e 1YJNT 1PSEA 5LL6S 1N9SA 4HCZA 3OY9A 3VKIA 1D3BB 3QIIA 5CK9A 5FRMA 3AHUA 1WJQA 2R5AA 1DJ7B 1QVGS 5D6WA 4RG2A 1VQNT 1YJ9A 3LH0A 3URGA 5GANd 2QA4A 1W4SA 4LD6A 5A0GA 3OYCA 1G3WA 5D6XA 5LJ3d 1VQ4A 1RL2A 3DKMA 4BY6C 1KG1A 2QEXT 5CKDA 2QQSA 5GAN5 3LLRA 3ME9A 3OYLA 3OYBA 4M75G 4JJNK 4JS5A 2VGNA 4C5EA 3RESA 5GAOm 3HRUA 5CIUA 2ZPIB 2GF7A 3H8ZA 1WPYA 2IG0A 2V8KA 3PGGA 4XU0A 5I2SA 1K9MC 3JB9F 4NS5A 2RA2A 3PIOA 3OYHA 1JJ2S 3A5ZB 5HK0A 3JB9J 2K5IA 4PJOD 1H3ZA 4M75C 3T9NA 4M7DD 3OS0A 1O75A 3MEAA 3G71T 3MEUA 1KQ1A 1YJNA 1RI0A 5J3BA 4QVCA 3CBOA 5CAIA 5CKBA 3PIPA 2K4YA 3KUFA 4XU2A 3CCVA 1VQLA 3OS1A 3CC4T 2KVQG 4FSXA 3MCAB 5GANj 2EQKA 1YHQA 1Q7YU 1QVFS 5GMKh 1M4ZA 2DD5A 2D6FA 4M7DE 3OSVA 4C0DB 1YJWA 5GAOn 2ZPFB 2DIQA 4LDWA 4Y91A 4A53A 4L5GA 1UB4A 3M56A 2JVVA 1S72T 4CI0C 1SSFA 4UC4A 3V8LA 3M9QA 1VQKT 3JB9I 1O9SA 2R5MA 4J83A 3QUIA 4OP0A 3VYHB 3V8KA 5GMKi 4MDXA 1LNXA 4IUPA 4PJOF 1XTDA 3EFRA 1X75C 2LVMA 2DO3A 4FM4B 1M1KU 3CPFA 1VQ8T 2OTJA 4EDUA 3QSUA 3OMGA 1NZ9A 2E1HA 3HPWA 3QZ5B 4M78E 3RKWA 3FLGA 4MDWA 1PSFA 4EMKB 4OF1A 1R8OB 1FWZA 3MP6A 1UGPB 2R57A 2HQXA 2ZPGB 3E1SA 3VV0A 2CZ0B 3L2VA 2RI2A 3CBPA 1VQ7T 2WACA 3ASKA 3QG1A 3RERA 1BI3A 3PT9A 5GAOl 3SWNA 4EPCA 2MI6A 3M59A 1Q82C 3HKSA 1LJOA 2O01E 3CMET 1NE8A 3OS5A 1AHJB 4XU1A 4PNOA 1HXDA 1X01A 2JTMA 3I55A 4C8QC 2X4YA 1HK9A 2DVEA 4QQ6A 3SDZA 2Y4YA 2CYZB 4BI3A 3OYNA 2E12A 1B34B 2EJFA 3JCMJ 4DOVA 2FL7A 3UPUA 5KH6A 3MEVA 3M4YA 1ZHIA 2HAXA 4BB7A 3HFOA 2OTLT 3HFNA 1Y96B 3L2WA 3CBMA 3ZEHA 3CCLA 2PU9B 2JNGA 4EMKC 2YLCA 4QQDA 5J26A 5CKEA 1ZBXA 3LYIA 4XU3A 3L2UA 3I56A 4M78D 3CCQT 1Q86C 3CPWS 4ZGJB 4QQGA 3VUZA 1M90C 3X25B 1VQ9T 3CD6T 2L89A 5C6SA 1VQMA 4IKFA 4E7KA 3ER0A 5EG2A 1WGSA 2G3RA 1YIJT 1KD1U 3UWNA 4J6YA 2XICA 4M7DB 2CZ1B 4M78G 1OI1A 2KK4A 3BDLA 3E9FA 2GFAA 1WJSA 1Y71A 4A54A 4A4EA 5HKCA 4WF2A 2ZCFB 4RG8A 3O8VA 3LWIA 3CCVT 1VQLT 3L2RA 2EJ9A 1BIAA 4ZN1A 1QVGA 2RJEA 3HRSA 4FIBA 4JUVA 2BIVA 1K9MU 5KCOA 1Q86U 3N5BB 2K5LA 3TCJA 3META 3WVEB 3CCJT 1YI2A 4ZTJA 1K73C 2RHIA 3UT1A 3FC3A 5C0MA 5J39A 5LJ3f 4X9CA 3OMCA 4J7IA 3LGFA 2P0KA 4M77A 1Q82U 1M1KC 5DY9A 4HCCA 3QXEB 4ELYC 2DTIA 3G6EA 1VQ6T 3QKJA 5CO7A 2CZ6B 2X4WA 4C92F 1NPPA 3QYGB 3NTIA 4LDXA 4M7AC 4IUQA 1JJ2A 2RHUA 4KULA 4NOYA 2V8IA 3OQ5A 3QPHA 4II1A 4N4GA 2ZPBB 4M78C 3JCMV 3CXCS 5IT9E 4A4GA 2VUBA 3CC7T 3FJPA 4GY5A 3HHTB 2O4XA 2DEQA 3PMTA 4M75A 1KD1C 2K2VA 2K5FA 4IURA 4NL2A 1M90U 5KE3A 2F5TX 5GAOq 2XI9A 4JRKA 5AYFA 1W2BS 2RJCA 2WSFE 2QQ9A 2LRQA 1M1GA 4M75D 3VYGA 1Y7XA 5GAMe 2O4XB 2RH2A 2RHYA 1UGQB 4M75B 4QVDA 3PTAA 3G71A 4PJOB 3JCMh 2EYQA 3C4SA 3FRNA 3S3MA 4D6WA 1BI2A 3A8LB 2E64A 2KMTA 2PUKB 1I5LA 5GAN3 4PJOA 1I8FA 2R58A 3GF5A 1KQSS 2DXBA 5HY6A 3RUXA 4F7UF 2BKDN 5GANf 4KUDK 4IUVA 4MZPA 3V8JA 4PKCC 1N9RA 2LCCA 3DLMA 3FDRA 3GLXA 3VJPA 3GNFB 1S72A 2ZPEB 4KBMB 3C12A 5A2QE 2VXFA 4JS4A 4HKEA 3QDRB 5LJ5h 2KSSA 3OW2A 3HP9A 3OYMA 5LJ3g 4M7DC 2QA4T 5LJ5j 2KDSA 3CCUT 1VQOT 4HT8A 2PUOB 2GFUA 2Y90A 2QDYB 2K3XA 3CCRT 2IVWA 3DB3A 4BE2A 1Y07A 1I81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K57 A;  2FYK A;  1HXD A;  1X01 A;  3V7C A;  5GAO p;  4C8Q C;  5LJ5 e;  3RIR A;  4JRI A;  5GAN 2;  3JCM P;  5GMK e;  2RM4 A;  3RKY A;  1HK9 A;  2DVE A;  4M77 B;  1YCY A;  3JCM c;  4HT9 A;  3VU3 C;  1B34 B;  2EJF A;  4JLI A;  4C92 C;  5I21 A;  5GAM f;  5LJ5 f;  2RB6 A;  4C92 E;  3JCM Q;  5GAM g;  5GAN g;  4M7D A;  2DXT A;  2DXU A;  3JCM d;  4M78 F;  2I2L A;  1JRI A;  2YLB A;  2E10 A;  3HFO A;  1Y96 B;  3HFN A;  4J6X A;  4C8Q B;  5LJ5 g;  4F7U E;  5GAN 8;  4DQ2 A;  1JBM A;  2YLC A;  4N0A A;  4C8Q G;  4EMK C;  3L1A A;  4C92 A;  5GAN j;  4C8Q E;  5GAM d;  2DTH A;  4RCB A;  3JB9 H;  1M8V A;  1U1S A;  3BW1 A;  4M7D G;  1Y96 A;  4XTW A;  2E65 A;  3SWN B;  4F7U A;  4XU3 A;  4M78 B;  3JCM g;  5GAN 6;  4M77 D;  4M78 D;  3BY7 A;  5GAN 4;  1N9S A;  5GAM j;  1MGQ A;  1LOJ A;  4XTY A;  4C92 G;  4M75 F;  1D3B B;  3AHU A;  5GAM h;  4N0A C;  4EMK A;  3FIF A;  4J6W A;  4EMH A;  4MML A;  4M7A F;  4J6Y A;  2E41 A;  4M75 E;  4M7D B;  5GAN d;  3JCM X;  2VXE A;  4M78 G;  4M77 G;  5LJ3 d;  3FB9 A;  4A54 A;  5GMK l;  1WNL A;  4WF2 A;  5GAN 5;  2EJ9 A;  1BIA A;  1M5Q 1;  4M75 G;  4JUV A;  5GAN e;  3JCM J;  3RES A;  5GAO m;  2JN0 A;  2VC8 A;  3BFM A;  4M7D F;  2DZC A;  1H64 1;  2FB7 A;  4M77 E;  4M7A B;  2DKG A;  3JB9 F;  4XU0 A;  2DTO A;  1WPY A;  3PGG A;  5LJ3 f;  4M78 A;  3INZ A;  4XQ3 A;  5GMK m;  5LJ3 h;  3JCM b;  3EFS A;  2RA2 A;  2ZGW A;  4HA8 A;  2EJG A;  4J5Y A;  1D3B A;  4X9C A;  4M77 F;  3JB9 J;  4M77 A;  5GAN h;  3BDU A;  5LJ3 j;  4M75 C;  2YHT A;  4MMK A;  5DY9 A;  4M7A D;  2DTI A;  4M7D D;  5LJ5 d;  3JCM e;  4M7A E;  4C92 F;  4M7A C;  2RD1 A;  3JB9 G;  4NOY A;  3JCM V;  5LJ3 e;  1KQ1 A;  4RCC A;  4M78 C;  3JB9 D;  4QVC A;  3M4G A;  2EWN A;  4F7U G;  3JCM W;  5CAI A;  3FJP A;  4XU2 A;  4M77 C;  3RKX A;  3HSB A;  4M75 A;  2DEQ A;  5GAN 7;  3L2Z A;  4NL2 A;  5GMK h;  4PJO G;  2QTX A;  4EMG A;  5GAO q;  4M7D E;  4JRK A;  4M7A A;  5GAO n;  4Y91 A;  4A53 A;  3V7S A;  4M75 D;  4XTZ A;  5GAM e;  4M75 B;  4PJO B;  4QVD A;  4XTX A;  3JCM h;  4NL3 A;  3V8L A;  4C92 B;  4PJO E;  4XTV A;  3JB9 I;  2DZ9 A;  2CGH A;  4OP0 A;  3QUI A;  1WQW A;  2E64 A;  3QO3 A;  1I5L A;  5GAO r;  4X9D A;  3V8K A;  5GMK i;  1LNX A;  1I8F A;  4PJO F;  5GAN 3;  3EFR A;  3SWN C;  4PJO A;  4PJO D;  3RUX A;  4F7U F;  5GAN f;  2DJZ A;  3V8J A;  3GIB A;  1N9R A;  3QSU A;  1U1T A;  2HNI A;  2E1H A;  1KQ2 A;  4M78 E;  3RKW A;  4EMK B;  3QHS A;  4C8Q F;  1B34 A;  4C8Q A;  4V2S A;  2VXF A;  1TH7 A;  3SB2 A;  5LJ5 h;  4XTU A;  1I4K 1;  3RER A;  4C92 D;  1BIB A;  3V7R A;  5LJ3 g;  5GAO l;  4PJO C;  4M7D C;  5LJ5 j;  3SWN A;  4F7U B;  4HT8 A;  4PNO A;  2EAY A;  4C8Q D;  5GMK j;  4M7A G;  2Y90 A;  1LJO A;  3JCM f;  1WQ7 A;  4XU1 A;  1I81 A; 
#chains in the Genus database with same CATH topology
 3MKD A;  1C0M A;  3OYF A;  1KC8 R;  2DF6 A;  1VQP Q;  1VIF A;  1QQJ A;  3LX7 A;  4WTO B;  1AEY A;  1QVF P;  2CRE A;  2K6D A;  2EQM A;  2MWP A;  1KFZ A;  1QWF A;  3QJ6 A;  2H3E B;  1JBM A;  1UEB A;  4FYX B;  2DTH A;  4GLK A;  1NG2 A;  3NGP A;  3MEW A;  4F7U A;  2HDA A;  3DB4 A;  5GAN 4;  5L8R E;  5GAM j;  4XTY A;  4RKU E;  3S3O A;  4KUI A;  1BKB A;  2K7A A;  4EMK A;  3A8M B;  2W10 A;  5FRN A;  2CS7 A;  2ATC B;  4BI8 B;  3OYA A;  3CCE A;  4Y28 E;  3CCM T;  1IHV A;  2FHD A;  4IUU A;  1M5Q 1;  1RI9 A;  3F70 A;  1CKA A;  1PWT A;  1KC8 U;  1N8R U;  2RO0 A;  2DKG A;  4XQ3 A;  1ZQ1 A;  5LJ3 h;  2EJG A;  1X27 A;  5GAN h;  4BI4 A;  1HD3 A;  2KI7 A;  1VYV A;  2L3Q A;  2DAQ A;  1IB8 A;  2L3S A;  3G1J A;  4AT1 B;  1AOJ A;  2FZK B;  2F2V A;  2HL3 A;  3J7A F;  1QP3 A;  2PQW A;  3CME A;  4F7U G;  1ZUU A;  4J9E A;  2DIL A;  2M0O A;  1UGV A;  2X51 A;  3L2Q A;  4VUB A;  1VQM T;  1RAE B;  2P4R A;  2NWM A;  4C0D C;  1WHH A;  3G6E Q;  1VQ6 A;  4A4H A;  3OYD A;  3GOX A;  2HNI A;  5L23 A;  4V2S A;  4BE0 A;  1PD1 A;  2DNU A;  5IXB A;  1YCS B;  1VQ7 A;  2ROT A;  3DLL A;  2P4T A;  2EAY A;  5CQY A;  1QP2 A;  2JOY A;  4AFS C;  2O2O A;  1TUC A;  4ME7 A;  3RIR A;  3JCM P;  1N8R C;  1XNI A;  1MMD A;  4M7D A;  1VQM Q;  5GAN g;  2V1R A;  3RR6 A;  4OMM A;  2MYS A;  2DA9 A;  2OI3 A;  1K76 A;  5GAN 8;  3I56 Q;  4J6X A;  4K11 A;  1PG5 B;  4FW2 A;  2XG8 D;  2DK3 A;  4XTW A;  2PVG B;  2KE9 A;  3SWN B;  4J9B A;  5DLO A;  2CP6 A;  3CME Q;  2Y4X A;  3OYJ A;  4N0A C;  4MML A;  3TU4 K;  4N4H A;  2HEQ A;  4PL6 A;  2KNB B;  4DBH A;  4ANJ A;  4FT2 A;  2BZY A;  1UUE A;  1IZ6 A;  1LVK A;  1T0H A;  2X3X D;  2QQB A;  3BE3 A;  4OB1 B;  2OAW A;  1OU8 A;  4Q5W A;  3NMZ C;  2L3R A;  2DTO A;  3CCS T;  1OV3 A;  3CCM A;  1K9A A;  3U23 A;  1PM3 A;  1JXO A;  4J9D A;  1QW1 A;  3MPU B;  2XDB A;  1W6X A;  2JS0 A;  2GBQ A;  1WLP B;  2EBP A;  2LQK A;  4PJM A;  2E6Z A;  2CDT A;  2DER A;  3CCV Q;  2X4X A;  4LDU A;  2NUP A;  1YWP A;  5CVI A;  4C5G A;  4OB0 B;  2AT1 B;  4XTV A;  1ZSZ A;  3X26 B;  3J80 E;  2GQV A;  2CGH A;  3C94 A;  4C5H A;  3S3N A;  1U8R A;  1B3Q A;  3SWN C;  2ABL A;  2FVU A;  1YI2 T;  1H3H A;  4WCI A;  1XQH A;  2SEM A;  1RAF B;  1G8X A;  3QHS A;  1VYU A;  1I4K 1;  1KD1 R;  4C92 D;  3CCR A;  3M0P A;  5GMK j;  4M7A G;  1C6V X;  3JCM f;  3UA6 A;  1GBR A;  1Z9Z A;  2XDP A;  3VS6 A;  2JW4 A;  2JMC A;  1G5V A;  4E7S A;  2QYZ A;  4FU6 A;  3JCM d;  2I2L A;  2E10 A;  4C0F A;  1WXU A;  1RAH B;  2OTJ Q;  1D0Y A;  3EFO B;  2KR3 A;  3L1A A;  4AFQ C;  4C8Q E;  1Y96 A;  4CRI A;  2BTT A;  3SHW A;  4AG2 C;  1N9S A;  5AT1 B;  1VQ8 Q;  2LJ1 A;  3AHU A;  2R5A A;  4RG2 A;  2FPF A;  4J9C A;  1VQO Q;  2E4H A;  1VQ4 A;  1RL2 A;  2QEX T;  3LLR A;  2L2P A;  5GJV B;  4JS5 A;  3RES A;  5GAO m;  2W0Z A;  2E3I A;  1IGU A;  2CSQ A;  3PGG A;  2V8K A;  2K2M A;  8AT1 B;  3VRY A;  2RA2 A;  3PIO A;  3OYH A;  3A5Z B;  5HK0 A;  4M7D D;  1O75 A;  3UF4 A;  2FRW A;  2K79 A;  5J3B A;  1K0X A;  4XU2 A;  1FMV A;  2KVQ G;  1YHQ A;  3MCA B;  1Q7Y U;  2EQK A;  1T3L A;  1QVF S;  1R0C B;  4M7D E;  2DIQ A;  3VS5 A;  4UC4 A;  2F2W A;  3M9Q A;  1VQK T;  3QUI A;  4MDX A;  2QTV A;  1XTD A;  2LVM A;  2DO3 A;  4FM4 B;  3CPF A;  2CP3 A;  2LQW A;  2DLP A;  3FLG A;  2JM9 A;  9ATC B;  3E1S A;  2IIM A;  1WDX A;  2RI2 A;  1BI3 A;  3PT9 A;  5GAO l;  1QKX A;  2DBM A;  1LJO A;  1NE8 A;  3OS5 A;  2JTM A;  1X01 A;  3SDZ A;  1OOT A;  3RDV A;  3OYN A;  3CCE Q;  3JCM J;  3M0R A;  5KH6 A;  2C0T A;  3MEV A;  3QWY A;  1Y96 B;  2EQI A;  3CBM A;  1NYG A;  1TUD A;  2PU9 B;  2EYW A;  4XU3 A;  3I56 A;  2YUO A;  3X25 B;  1D0Z A;  2L89 A;  5KYX B;  1E6H A;  5EG2 A;  1YIJ T;  1KD1 U;  4M7D B;  4M78 G;  3BDL A;  3E9F A;  2LNH B;  2KRO A;  1VQ7 Q;  3HRS A;  1PC0 A;  3H9N A;  3TCJ A;  1YI2 A;  1YWO A;  3CCJ T;  4F14 A;  4ZTJ A;  1ZX6 A;  3I5R A;  5C0M A;  1M3C A;  2P0K A;  2AIR B;  1M1K C;  3RBB B;  3QXE B;  3G6E A;  1VQ6 T;  2CZ6 B;  3M0Q A;  4LDX A;  4LXC A;  2D0N A;  4NOY A;  1F1B B;  4II1 A;  1M1K R;  4M78 C;  5IT9 E;  2H8H A;  2K2V A;  5KE3 A;  2WSF E;  1TS9 A;  2RQW A;  1SRL A;  3VYG A;  1Y7X A;  2X9H A;  2L0A A;  3S3M A;  1BI2 A;  2KT1 A;  3A8L B;  2E64 A;  2QDL A;  1I8F A;  4ORZ A;  1RAC B;  2BKD N;  3V8J A;  2CSI A;  3DLM A;  4OMN A;  3GNF B;  4KBM B;  4HKE A;  3SEM A;  1JJ2 P;  1UHC A;  2LJ0 A;  3CCU T;  3RNJ A;  4RTV A;  3UPU A;  1Y07 A;  3V7C A;  2GCX A;  3TEE A;  1VUB A;  3C0C A;  4HT9 A;  4B9X A;  4LNP A;  4QT7 A;  1WHK A;  3VU3 C;  5GAM f;  2P0P A;  1QLY A;  4KGZ B;  1E6G A;  2P0Q A;  3O5Z A;  3M0S A;  1JRI A;  1TSF A;  4J9H A;  4TVR A;  1G83 A;  4RTX A;  3QYH B;  4F17 A;  5FLX E;  3P8B B;  4M7A D;  4C92 A;  5FRO A;  2LP5 A;  3JV3 A;  3EGX B;  3J81 E;  4BDY A;  1K9M R;  4M78 B;  4AG1 C;  1MGQ A;  5DLQ E;  4B9W A;  2E5Q A;  5GAM h;  1N27 A;  1YIT A;  1Q81 C;  1RAG B;  3CC4 Q;  3CCQ A;  1GL5 A;  2GTO A;  4JLG A;  1WHG A;  3FB9 A;  2P84 A;  2DX1 A;  5CKF A;  3EFO A;  2DL7 A;  5FU6 C;  2EPD A;  2J6F A;  1IHW A;  3BFM A;  4OMF B;  4X34 A;  2RHX A;  3H6Z A;  2KRS A;  2OAU A;  3MP8 A;  5LJ3 j;  2HZY A;  1MUZ A;  1JO8 A;  5IAY A;  2M02 A;  2DYB A;  4XAX B;  3JB9 G;  2C0I A;  3JB9 D;  3EGU A;  3VS4 A;  4BAC A;  1PRM C;  1HSQ A;  1MV3 A;  3RMQ A;  2JZ2 A;  1QVG P;  2RJF A;  1BYM A;  2QTX A;  4KH1 B;  2CKK A;  1AZE A;  3V7S A;  1R0B G;  2DEU A;  4XTX A;  3UAT A;  1W2B A;  2DPP B;  2BUD A;  3QO3 A;  3VUB A;  1VQ5 T;  3MHX A;  4X9D A;  2NUP B;  2MF2 A;  3I56 T;  2EGA A;  4CC3 A;  1QVP A;  1OZ3 A;  2EIF A;  3VS1 A;  4Z89 A;  1NBE B;  1TH7 A;  3SB2 A;  1E7O A;  3KXT A;  4BUG A;  1WHL A;  1BIB A;  3OBW A;  1WQ7 A;  5IXF A;  5GAN 2;  4M77 B;  2KQW A;  1Z9Q A;  5LJ5 f;  2KGT A;  4PJJ A;  1GRI A;  3LWH A;  4LDY A;  2EYX A;  4ZNX A;  3X20 B;  3EG9 B;  4C0G A;  1S72 Q;  2GGR A;  5KCH A;  1X6B A;  4J9G A;  1OX8 A;  4E7L A;  4JJC A;  1M8V A;  3GPL A;  4RCB A;  4Z88 A;  1YJW T;  1ZSG A;  4XK8 E;  1RAI B;  3D7S B;  3L42 A;  3M0U A;  2A7Y A;  4FW1 A;  2J6O A;  2D0Q B;  3A8H B;  2RQR A;  4E7H A;  4B6M A;  3I55 Q;  3PNW C;  2EW3 A;  4BD3 A;  2HD0 A;  2Z0W A;  1NJI C;  1YHQ T;  4AMC A;  4MZM A;  4F16 A;  5CQX A;  2VC8 A;  5CKH A;  4M77 E;  4O5V A;  4FT4 A;  2MOX A;  3QWX X;  2BE7 D;  7AT1 B;  2CT4 A;  2RMO A;  3PE0 A;  3WXM B;  1UJ0 A;  4ZN3 A;  1PHT A;  1X69 A;  1QVF A;  4OMP A;  3JCM e;  1UGS B;  3VS7 A;  5FWC A;  2PTK A;  1YJ9 T;  1EX4 A;  1UEC A;  1NEB A;  2KBT A;  4PFP A;  1WA7 A;  2AHJ B;  3M4G A;  5FU6 B;  2YDL A;  1AZG B;  4M77 C;  4FSS A;  3CD6 A;  1WI7 A;  3NTH A;  1YHQ Q;  4HXJ A;  2LT1 A;  3CC2 A;  1WXT A;  1K1Z A;  3OYI A;  5KYY B;  3I55 T;  5KYN A;  4C92 B;  1GXI E;  1AWW A;  1NJI U;  1WQW A;  2LCL A;  2ZZD A;  3QBY A;  2WSC E;  4KT0 E;  2DJZ A;  3GIB A;  3EH1 A;  5KYU A;  2SRC A;  3OYY A;  2RI5 A;  2KT8 A;  5CR2 A;  1UFF A;  1VQP T;  2KAF A;  2C06 A;  3SD4 A;  2QG9 B;  2DXC A;  1VQO A;  5LJ5 e;  5GMK e;  2CUB A;  3JCM c;  1YIJ A;  3CCE T;  3X24 B;  4C92 C;  5GAM g;  2RB6 A;  3M57 A;  3RMS A;  1VQ8 A;  1CSK A;  2X4J A;  2F5K A;  3EG0 A;  3EG3 A;  1M3B A;  4BDZ A;  2L5Q A;  2RHZ A;  2A3L A;  2JTF A;  1B07 A;  5LL6 S;  4HCZ A;  3OW2 P;  1M90 R;  3QII A;  1SHF A;  5CK9 A;  5FRM A;  2LCS A;  1AWJ A;  4PFO A;  1YJ9 A;  2AZS A;  3URG A;  5GAN d;  3EG1 A;  1W4S A;  5A0G A;  5KYW A;  5LJ3 d;  5D6X A;  1LPL A;  2MK5 A;  3DKM A;  5GAN 5;  3ME9 A;  3OYB A;  2VGN A;  4C5E A;  3HRU A;  5CIU A;  1M2V B;  2ZPI B;  2YUP A;  1K9M C;  3H8Z A;  2IG0 A;  3JB9 F;  1JJ2 S;  1FMW A;  4PJO D;  4JJB A;  3OS0 A;  1OU9 A;  1KQ1 A;  5IHI A;  1YJN A;  4QVC A;  5CAI A;  3PIP A;  2RF0 A;  3CCV A;  1YJ9 Q;  4C0D B;  2QEX Q;  2ZPF B;  4LDW A;  4L5G A;  4CI0 C;  3V8L A;  1SEM A;  4OMQ A;  1O9S A;  2R5M A;  3V8K A;  2OTL Q;  1X75 C;  2J7I A;  1VQ8 T;  2AK5 A;  1NZ9 A;  3HPW A;  4PJL A;  2HQX A;  2ZPG B;  2CZ0 B;  3CBP A;  2WAC A;  3RER A;  1UE9 A;  1Q82 C;  3HKS A;  2DVJ A;  2O01 E;  1M2O A;  1QKW A;  1AHJ B;  4C8Q C;  1HK9 A;  3REA B;  4BI3 A;  2CYZ B;  1B34 B;  1Q95 G;  2FL7 A;  5HCK A;  1ZHI A;  2M0Y A;  2HAX A;  1BU1 A;  3TVT A;  3HFO A;  1NEG A;  3ZEH A;  2GTJ A;  2JNG A;  4EMK C;  4QQD A;  5CKE A;  5EC7 A;  1YN8 A;  3LYI A;  2ESW A;  5I22 A;  4ESR A;  1Q86 C;  3CCQ T;  2VAS A;  3CPW S;  2HCK A;  3CD6 T;  5C6S A;  1VQM A;  4IKF A;  3CC2 Q;  3ER0 A;  2CP7 A;  1MMG A;  2XMF A;  1OI1 A;  2KK4 A;  4A4E A;  1WJS A;  1Y71 A;  4WF2 A;  3CCV T;  1BIA A;  4KRT A;  5KCO A;  3H0F A;  1Q86 U;  3N5B B;  2K5L A;  3WVE B;  1K73 C;  4E7Z A;  3UT1 A;  2F2X A;  5LJ3 f;  3LGF A;  2KRN A;  4M77 A;  1Q82 U;  1VQ6 Q;  5DY9 A;  3I5S A;  2DTI A;  4A63 B;  2QA4 Q;  2DYI A;  3QKJ A;  3QYG B;  1KK7 A;  4IIO A;  1M3A A;  3JCM V;  5LJ3 e;  3CQT A;  3OQ5 A;  3CCS Q;  2A08 A;  1BCM A;  1TXQ A;  4A4G A;  2VUB A;  3FJP A;  2DEQ A;  3PMT A;  1KD1 C;  5GAO q;  2DRK A;  2F5T X;  4JRK A;  1N5Z A;  2QQ9 A;  1M1G A;  4M75 D;  2MIO A;  1X2Q A;  5GAM e;  2O4X B;  4M75 B;  3PTA A;  2AKK A;  3JCM h;  2CT3 A;  3C4S A;  1OPK A;  1NYF A;  2FEI A;  5GAN 3;  2RNA A;  2R58 A;  5HY6 A;  4KUD K;  1D0X A;  3FDR A;  4PKC C;  4RUG A;  3GLX A;  8ATC B;  3C12 A;  1ZA2 B;  2KSS A;  1GFD A;  3HP9 A;  1PCX A;  4M7D C;  3I35 A;  4HT8 A;  2PUO B;  3CCR T;  2K3X A;  2ROL A;  2D1X A;  2IVW A;  3DB3 A;  4BE2 A;  4JJD A;  3E19 A;  1VQ4 T;  2RM4 A;  2CH4 W;  1N8R R;  2K3Y A;  2FG0 A;  5KYX A;  1PKS A;  4F7U E;  2DIG A;  2RK1 A;  2HMA A;  1P92 A;  3EHQ A;  2PNI A;  2MAM A;  2ZPH B;  4A4F A;  4N0A A;  4GLM A;  5GAN j;  2QGG A;  1BI0 A;  1ZUY A;  3MP1 A;  2HKN A;  3OSS C;  2XD0 A;  1IXD A;  5HK3 A;  2M1H A;  4M75 F;  2MCN A;  2CUD A;  1GBQ A;  4CC7 A;  3OYE A;  2NUZ A;  1VQP A;  4PJN A;  3E9G A;  4A4K A;  2VXE A;  4M77 G;  1FX7 A;  2VKN A;  5GMK l;  2FZG B;  3G4S A;  3NTK A;  3S6W A;  2DFU A;  2NYS A;  1H64 1;  2FB7 A;  1ABO A;  2DD4 A;  2VVK A;  1ACM B;  1Y0M A;  4HA8 A;  2QK0 A;  4DA4 A;  1Q81 U;  4MMK A;  2KY9 A;  1SPK A;  2PVD B;  1G3Y A;  2A36 A;  2LX9 A;  2KXC A;  3P8H A;  1XJW B;  1UJY A;  1QCO A;  2OTL A;  3CCQ Q;  3CC4 A;  2NLU A;  2FPE A;  5GAN 7;  3KFV A;  1YIT Q;  4EMG A;  4M7A A;  1VQN A;  3ZL7 C;  4GBQ A;  2M9U A;  1N6A A;  4X1V A;  4NL3 A;  1IGQ A;  2DZ9 A;  1VQK A;  2F1L A;  2VGM A;  1A0N B;  3GBQ A;  4PLL A;  5IHK A;  1OPL A;  2RJD A;  2MMP A;  1B34 A;  1GCQ C;  2AZV A;  2XKO C;  2K9G A;  2BZ8 A;  2JUF A;  4E7J A;  4OVA A;  4LDV A;  2BE9 B;  4F04 B;  1WXB A;  1UGR B;  2F69 A;  1EFN A;  4C92 E;  2EQU A;  3CCJ A;  1K8A C;  1G2B A;  4C8Q B;  1G3S A;  3G4S T;  3E2U A;  3OBY A;  4DQ2 A;  3M5A A;  2RQU A;  1I07 A;  2HBW A;  3EGX A;  3WVD B;  3CCL Q;  2K3B A;  1K73 R;  4QW2 A;  3JB9 H;  1EIF A;  3OB9 A;  2E65 A;  1NLP C;  2XID A;  3BY7 A;  4ZGD B;  2VYT A;  2LQ8 A;  2QQR A;  4PFZ A;  4J6W A;  2EFI A;  1M8M A;  1YBY A;  4M75 E;  4D8K A;  4DEX A;  1GFC A;  1WNL A;  1M1F A;  1YIJ Q;  4E7I A;  1NPR A;  3REB B;  2JN0 A;  3FJ5 A;  2DZC A;  3CMA T;  2XHC A;  4M7A B;  1D1A A;  3JCM b;  4Z02 A;  5M9O A;  2I0N A;  2YRD A;  1D3B A;  4ATO A;  3BDU A;  1D1B A;  2YHT A;  2LC4 A;  1VQ5 A;  1U3O A;  3QZ9 B;  2KRM A;  2DE0 X;  4L59 A;  3A8G B;  3CXC A;  4RCC A;  3CC7 A;  2X35 A;  2EWN A;  5I2M A;  1VQ9 A;  4RMO A;  3NFC A;  2CZ7 B;  4FYY B;  1MNE A;  1VQL Q;  5A0L A;  4XTZ A;  2HQE A;  2D9T A;  3VS0 A;  1MND A;  5GAO r;  3TSZ A;  1K8A U;  3CC7 Q;  1TUG B;  4PLI A;  1U1T A;  1U5S A;  3P8D A;  3JSC A;  2DRM A;  4C8Q F;  3R6O A;  1VQ5 Q;  2JS2 A;  2O88 A;  3OW2 S;  4F7U B;  4C8Q D;  4HVV A;  4EIK A;  2K57 A;  1K0S A;  1V1C A;  1KHI A;  3RKY A;  1PD0 A;  4DOW A;  2JM8 A;  2PZ1 A;  3JCM Q;  3X28 B;  1X6O A;  1ZBJ A;  1M27 C;  4M78 F;  4R55 A;  2E6N A;  5LJ5 g;  3A8O B;  5DM7 R;  4O6J A;  1OZ2 A;  3JRZ A;  2HBP A;  5GAN 6;  3EAE A;  2EYY A;  3OY9 A;  1X2K A;  2YRC A;  1WJQ A;  2V1Q A;  4DBR A;  1VQN T;  1WX6 A;  3LH0 A;  4LD6 A;  3OYC A;  3H0I A;  4BY6 C;  1VOM A;  4JJN K;  1Q86 R;  2D8H A;  2DL4 A;  4RTU A;  2ED0 A;  4XU0 A;  1WPY A;  4NS5 A;  1H3Z A;  1I5O B;  1WZO A;  4M75 C;  2EGE A;  1TOV A;  1WIE A;  1MMA A;  3G71 T;  3MEU A;  1OUL A;  2YXY A;  5FWB A;  1SG5 A;  3ULR B;  5CKB A;  4DEY A;  1TWB A;  5GMK h;  1M4Z A;  1VQ9 Q;  2DJQ A;  3VRZ A;  2D6F A;  2KYB A;  5GAO n;  4Y91 A;  4A53 A;  1UB4 A;  3M56 A;  1S72 T;  1OQK A;  3CCU Q;  2EVR A;  4CC2 A;  4AFZ C;  5GMK i;  2OTJ A;  1RAB B;  3QSU A;  1AT1 B;  4M78 E;  4MDW A;  1PSF A;  4EMK B;  4OF1 A;  3G71 Q;  1PNJ A;  1ZSZ C;  2CP2 A;  1FWZ A;  1UGP B;  3ASK A;  3QG1 A;  2VWF A;  2YUN A;  4KGV B;  3SWN A;  1TU0 B;  3CME T;  2LZ6 B;  1NM7 A;  1BBZ A;  4XU1 A;  1ARK A;  2QAZ A;  2YT6 A;  2X4Y A;  3M0T A;  3CCR Q;  3MJX A;  1BB9 A;  4RTT A;  1RLP C;  3M4Y A;  4HVW A;  4BB7 A;  3L2W A;  1BK2 A;  2YLC A;  4LUE A;  1ZBX A;  4M78 D;  3CCJ Q;  2ED1 A;  1M90 C;  3PVL A;  1VQ9 T;  1M2V A;  4RTW A;  5KYU B;  1WGS A;  2G3R A;  2CH4 A;  3UWN A;  2XIC A;  2CZ1 B;  1WFW A;  2RPN A;  2GFA A;  4A54 A;  2JT4 A;  5HKC A;  3LWI A;  2ZCF B;  4RG8 A;  3L2R A;  4E6R A;  2EJ9 A;  1QVG A;  2RJE A;  4FIB A;  3QDF A;  3EHR A;  3MET A;  1QWE A;  3FC3 A;  5ECA A;  5J39 A;  4CC4 B;  4HCC A;  4ELY C;  2NUT A;  5CO7 A;  2A37 A;  2X4W A;  1NPP A;  3NTI A;  4JPB W;  1ZA1 B;  4IUQ A;  1HJD A;  4KUL A;  3VJP A;  3QPH A;  4N4G A;  2ZPB B;  1FYN A;  3CXC S;  4OML A;  1VQN Q;  3CC7 T;  4GY5 A;  2O4X A;  4M75 A;  4IUR A;  3EH2 A;  2XI9 A;  1H8K A;  1W2B S;  2LRQ A;  2RH2 A;  2RHY A;  4PJO B;  1UGQ B;  2EYQ A;  3FRN A;  2ENM A;  4PK4 A;  2KMT A;  1I5L A;  4PJO A;  3GF5 A;  1KQS S;  2DXB A;  5GAN f;  4HVU A;  4J9F A;  4MZP A;  2DL3 A;  2HL5 C;  2LCC A;  1S72 A;  5I11 A;  2VXF A;  5LJ5 h;  3OW2 A;  3OYM A;  2QA4 T;  5LJ5 j;  2KDS A;  2QDY B;  2V8J A;  2XU8 A;  5KYW B;  3CXC P;  1I0C A;  3LW5 E;  4JLI A;  2OX7 A;  4OB3 B;  2DMO A;  2DXT A;  2KYM A;  1W2B P;  2LX7 A;  1UTI A;  4Y92 A;  2COW A;  1K73 U;  2PVO B;  4C8Q G;  4ELZ C;  3PMI A;  2WSE E;  3QJY A;  3CC2 T;  1KHC A;  4C5I A;  4M77 D;  1KJW A;  2XDD A;  3OS2 A;  2EKO A;  1D1C A;  1LOJ A;  1S1N A;  2YSQ A;  1KQS A;  4BY6 B;  3CCL T;  2BZX A;  1BI1 A;  2CP0 A;  2AKL A;  4KGX B;  2E41 A;  2QI2 A;  3JCM X;  1RAD B;  3NHN A;  2YRV A;  1WJR A;  3TRE A;  4ZGE B;  1RLQ C;  5GAN e;  2YWW A;  2QXF A;  4DBF A;  2KEA A;  1MHN A;  2LNV A;  2MWO A;  1OYX A;  2LJ3 A;  5GMK m;  2ZGW A;  4M77 F;  2RI3 A;  3KBG A;  3M55 A;  3HL8 A;  5LJ5 d;  4M7A E;  1EZZ B;  1FMK A;  1JB0 E;  3RKX A;  4HCB A;  1X43 A;  4PJO G;  3ZBD A;  1W1F A;  1T0J A;  4FYV B;  1M30 A;  4RTY A;  3Q1J A;  4JRP A;  3CCS A;  2GNC A;  2JJ9 A;  1BCO A;  4JZ3 A;  4LE9 A;  2H3J A;  3UA7 A;  1KQS P;  1PRL C;  4FL6 A;  2B8A A;  1YJN Q;  2QQA A;  2COZ A;  1KQ2 A;  2RN8 A;  4N4I A;  2DET A;  3EG9 A;  4P5N A;  4ZTF A;  1YNZ A;  1G3T A;  2EKH A;  4JRQ A;  2A0F B;  1SKU B;  4PJO C;  5A0D A;  3MO8 A;  4J7F A;  1FXX A;  4L6V 5;  1RAA B;  2RQV A;  1R77 A;  2FYK A;  1ZSZ B;  1KC8 C;  5CCA A;  5GAO p;  4DBQ A;  1K8A R;  1YCY A;  1J3T A;  3M58 A;  4C0Z A;  1M9S A;  3GNG A;  4JDS A;  2JMA A;  2L3P A;  4OGE A;  4R56 A;  4E47 A;  5GJW B;  1VQK Q;  3TQ7 P;  2L8D A;  2EQJ A;  4IIM A;  4FYW B;  4MZT A;  1QCF A;  2O9S A;  1X6G A;  5GAM d;  4OGC A;  1D09 B;  3OYG A;  3JCM g;  1H92 A;  1ABQ A;  2OTJ T;  4J8O A;  3SFM A;  4C92 G;  3AT1 B;  3VS3 A;  1WYX A;  1JXM A;  3FIF A;  2DL8 A;  4EMH A;  1Q81 R;  3G7Z A;  4M7A F;  3THK A;  1MMN A;  2LT4 A;  5KE2 A;  3PFS A;  1MV0 B;  1AD5 A;  4JZ4 A;  4M7D F;  3C95 A;  3G71 A;  4OB2 B;  1KIK A;  2E70 A;  3UDC A;  5D6Y A;  1Y57 A;  2C0O A;  4M78 A;  5FU7 B;  3INZ A;  2XK0 A;  2DBK A;  3EFS A;  4J5Y A;  4IUT A;  1YI2 Q;  2VB6 A;  4YTL A;  5IN1 A;  3HTR A;  2RD1 A;  1XOV A;  3CCU A;  1UHF A;  1U06 A;  3NPF A;  1V29 B;  3JCM W;  1IRE B;  2QEX A;  3HSB A;  3OYK A;  3L2Z A;  1JU5 C;  4Z8A A;  1GCP A;  4LN2 A;  2X3W D;  2LDM A;  4QVZ A;  3M53 A;  1QMC A;  1C1A A;  4E2F B;  3HRT A;  3GP8 A;  3FEO A;  4PJO E;  1WHM A;  2QAS A;  5FU7 C;  3PVQ A;  3LGL A;  1AWO A;  1NLO C;  2VV5 A;  1V76 A;  3CMA A;  1ZLM A;  3CPW A;  2MPX C;  2RK2 A;  4C8Q A;  1SF9 A;  3G6E T;  1IRX A;  3EGD B;  1W70 A;  3I9Q A;  2LTO A;  4XTU A;  1TTH B;  3M54 A;  3V7R A;  4LD9 K;  1Q7Y C;  1YIT T;  4BE1 A;  2OJ2 A;  1I1J A;  4JRI A;  2M51 A;  2O31 A;  4RTZ A;  5I21 A;  3JAM E;  4HCK A;  2EGC A;  3ZFJ A;  2DXU A;  2YLB A;  1Q82 R;  1VIE A;  3CEY A;  2M16 A;  1TG0 A;  3OA6 A;  1U1S A;  1ZUK A;  3BW1 A;  4J9I A;  1NJI R;  4M7D G;  2JXB A;  4LUD A;  1YJN T;  1PSE A;  2G6F X;  2RQT A;  3VKI A;  1D3B B;  1YJW Q;  1AVZ C;  2LQN A;  1DJ7 B;  1QVG S;  5D6W A;  2IPO B;  1JEG A;  2QA4 A;  1G3W A;  1KG1 A;  2HQH A;  5CKD A;  2QQS A;  3OYL A;  4M75 G;  3CPW P;  4FCY A;  1T3S A;  2GF7 A;  3EG2 A;  5I2S A;  4QKU A;  2DL5 A;  2J06 A;  1IO6 A;  3IQL A;  3JB9 J;  2K5I A;  3T9N A;  3MEA A;  1K4U S;  1VQ4 Q;  1RI0 A;  2NUT B;  3CBO A;  1YFN A;  2K4Y A;  3KUF A;  4KH0 B;  1VQL A;  1B7T A;  2QGF B;  3OS1 A;  4FSX A;  3CC4 T;  1OX9 A;  2JTE A;  3CD6 Q;  2DD5 A;  2A28 A;  3OSV A;  1YJW A;  1SHG A;  2JVV A;  1HYO A;  1SSF A;  2O9V A;  3H41 A;  1UG1 A;  2EYZ A;  3JB9 I;  4J83 A;  4OP0 A;  1VA7 A;  3VYH B;  1LNX A;  4IUP A;  4PJO F;  3EFR A;  5FW9 A;  1M1K U;  1CKB A;  4EDU A;  2HSP A;  3OMG A;  2E1H A;  3QZ5 B;  5D7U A;  3RKW A;  1R8O B;  3MP6 A;  3H0H A;  2R57 A;  2FPD A;  3VV0 A;  1SRM A;  4AFU C;  3L2V A;  1VQ7 T;  2GQI A;  2J6K A;  2MI6 A;  3M59 A;  4EPC A;  1OEB A;  2B86 A;  4PNO A;  1HXD A;  3I55 A;  2FRY A;  4QQ6 A;  2DVE A;  2Y4Y A;  2E12 A;  2EJF A;  3VS2 A;  4DOV A;  6AT1 B;  3TSW A;  2OTL T;  3HFN A;  2DM1 A;  3CCL A;  3CMA Q;  5J26 A;  4D8D A;  1LCK A;  3L2U A;  1JQQ A;  2CP5 A;  4ZGJ B;  4QQG A;  3VUZ A;  2YUQ A;  4E7K A;  4J6Y A;  3A1P A;  2ECZ A;  1UDL A;  3O8V A;  1VQL T;  4ZN1 A;  4JUV A;  1K9M U;  2BIV A;  2J05 A;  1RUW A;  2KXD A;  2HKQ B;  2E5K A;  2RHI A;  2E3H A;  3CCM Q;  4X9C A;  3OMC A;  4J7I A;  1QCN A;  4R0K A;  2D8J A;  4C92 F;  1VYT A;  4M7A C;  1KSW A;  1JJ2 A;  2RHU A;  2V8I A;  3R6N A;  3HHT B;  1SSH A;  2K5F A;  4NL2 A;  1M90 U;  5AYF A;  1Q7Y R;  2FO0 A;  2RJC A;  3LH5 A;  2FZC B;  5IH2 A;  2HSE B;  3EGD A;  4QVD A;  4OMO A;  1GCQ A;  4D6W A;  2PUK B;  2V26 A;  4M4Z A;  1WHJ A;  3RUX A;  4F7U F;  4IUV A;  1N9R A;  2ZPE B;  5IHN A;  3A98 A;  5A2Q E;  1YP5 A;  4JS4 A;  5KYY A;  3QDR B;  2ZAE A;  5LJ3 g;  3G4S Q;  2LMJ A;  1AWX A;  1VQO T;  2GFU A;  2Y90 A;  1PKT A;  2COY A;  1I81 A; 
#chains in the Genus database with same CATH homology
 3V7C A;  2GCX A;  2V8J A;  2XU8 A;  3E19 A;  3TEE A;  3OYF A;  1VUB A;  1VIF A;  2RM4 A;  4B9X A;  1VQ4 T;  4HT9 A;  3VU3 C;  2K3Y A;  3LW5 E;  4JLI A;  4OB3 B;  2P0P A;  3LX7 A;  5GAM f;  2P0Q A;  2DXT A;  1JRI A;  2EQM A;  2MWP A;  4F7U E;  2DIG A;  2RK1 A;  1P92 A;  4TVR A;  3QJ6 A;  2MAM A;  2ZPH B;  4A4F A;  1K73 U;  3QYH B;  1JBM A;  2PVO B;  4N0A A;  1UEB A;  3P8B B;  4C8Q G;  3PMI A;  5FRO A;  4C92 A;  5FLX E;  2DTH A;  4GLK A;  4ELZ C;  2WSE E;  3QJY A;  3CC2 T;  3J81 E;  1BI0 A;  3MEW A;  4F7U A;  1KHC A;  3MP1 A;  4BDY A;  4M78 B;  3OSS C;  4C5I A;  4M77 D;  2XD0 A;  3DB4 A;  5GAN 4;  2XDD A;  3OS2 A;  2EKO A;  5L8R E;  5GAM j;  1MGQ A;  1LOJ A;  4RKU E;  4XTY A;  5DLQ E;  5HK3 A;  3S3O A;  2M1H A;  4M75 F;  4B9W A;  4BY6 B;  2E5Q A;  1BKB A;  4KUI A;  5GAM h;  3CCL T;  3OYE A;  4EMK A;  3A8M B;  1N27 A;  1BI1 A;  5FRN A;  1YIT A;  2CS7 A;  1VQP A;  1Q81 C;  2E41 A;  2QI2 A;  3E9G A;  4A4K A;  3JCM X;  2VXE A;  3CCQ A;  4M77 G;  1FX7 A;  4BI8 B;  3OYA A;  4JLG A;  3FB9 A;  5GMK l;  3CCE A;  2YRV A;  4Y28 E;  3CCM T;  1WJR A;  3TRE A;  4ZGE B;  3G4S A;  2FHD A;  3NTK A;  4IUU A;  1M5Q 1;  5CKF A;  3S6W A;  5GAN e;  3F70 A;  5FU6 C;  2QXF A;  1KC8 U;  1MHN A;  3BFM A;  4OMF B;  4X34 A;  1H64 1;  2FB7 A;  2RO0 A;  1N8R U;  2RHX A;  2LNV A;  2MWO A;  2DD4 A;  1OYX A;  2DKG A;  3H6Z A;  4XQ3 A;  5GMK m;  1ZQ1 A;  5LJ3 h;  2ZGW A;  4HA8 A;  2EJG A;  4DA4 A;  4M77 F;  2RI3 A;  2OAU A;  3KBG A;  3MP8 A;  4BI4 A;  3M55 A;  2KY9 A;  4MMK A;  5LJ3 j;  5GAN h;  1Q81 U;  2PVD B;  1G3Y A;  2DAQ A;  3HL8 A;  5IAY A;  5LJ5 d;  4M7A E;  2LX9 A;  3P8H A;  4XAX B;  3JB9 G;  3J7A F;  1QP3 A;  3JB9 D;  2PQW A;  2OTL A;  3CME A;  4BAC A;  4F7U G;  3CC4 A;  2NLU A;  1JB0 E;  3RMQ A;  2JZ2 A;  3RKX A;  5GAN 7;  2RJF A;  1BYM A;  4HCB A;  4PJO G;  2QTX A;  4EMG A;  3ZBD A;  2M0O A;  4M7A A;  2CKK A;  3V7S A;  1VQN A;  3Q1J A;  4JRP A;  3L2Q A;  3CCS A;  2M9U A;  4VUB A;  4XTX A;  1N6A A;  4NL3 A;  1VQM T;  1W2B A;  2DPP B;  2BUD A;  2H3J A;  2DZ9 A;  3QO3 A;  3VUB A;  4FL6 A;  4C0D C;  3MHX A;  4X9D A;  1VQ5 T;  1VQK A;  1VQ6 A;  2MF2 A;  3I56 T;  2B8A A;  2VGM A;  4A4H A;  2QQA A;  3OYD A;  1QVP A;  4PLL A;  1OZ3 A;  2HNI A;  3GOX A;  1KQ2 A;  2RJD A;  2MMP A;  2EIF A;  4N4I A;  4P5N A;  1B34 A;  4V2S A;  4ZTF A;  1G3T A;  1TH7 A;  2XKO C;  3SB2 A;  4BE0 A;  3KXT A;  4BUG A;  4JRQ A;  1BIB A;  2JUF A;  4PJO C;  4E7J A;  5A0D A;  1VQ7 A;  3DLL A;  2P4T A;  4OVA A;  2EAY A;  3MO8 A;  1QP2 A;  3OBW A;  4J7F A;  5CQY A;  1FXX A;  4LDV A;  4L6V 5;  2JOY A;  1WQ7 A;  4ME7 A;  2FYK A;  1KC8 C;  5CCA A;  5GAO p;  3RIR A;  5GAN 2;  3JCM P;  1N8R C;  1UGR B;  4M77 B;  1YCY A;  3M58 A;  2KQW A;  1XNI A;  2F69 A;  4C0Z A;  1M9S A;  3GNG A;  4JDS A;  5LJ5 f;  4OGE A;  4R56 A;  4C92 E;  4M7D A;  4E47 A;  2EQU A;  5GAN g;  4LDY A;  3LWH A;  3CCJ A;  2L8D A;  3X20 B;  1K8A C;  2EQJ A;  4C8Q B;  5GAN 8;  4C0G A;  4J6X A;  4MZT A;  1G3S A;  3G4S T;  5KCH A;  3OBY A;  2XG8 D;  4DQ2 A;  4E7L A;  3M5A A;  2DK3 A;  3WVD B;  1M8V A;  5GAM d;  3GPL A;  4RCB A;  3JB9 H;  4QW2 A;  1YJW T;  4XTW A;  1EIF A;  2PVG B;  3OB9 A;  2E65 A;  4OGC A;  3L42 A;  4XK8 E;  3SWN B;  3JCM g;  3OYG A;  2XID A;  3BY7 A;  2OTJ T;  2A7Y A;  5DLO A;  4J8O A;  3SFM A;  4C92 G;  4ZGD B;  2Y4X A;  2VYT A;  2D0Q B;  2LQ8 A;  2QQR A;  3OYJ A;  4N0A C;  3FIF A;  4J6W A;  2EFI A;  4EMH A;  3A8H B;  4MML A;  3TU4 K;  3G7Z A;  4M7A F;  4N4H A;  4E7H A;  1YBY A;  4M75 E;  4PL6 A;  3PNW C;  4FT2 A;  4BD3 A;  2HD0 A;  1IZ6 A;  2LT4 A;  5KE2 A;  1NJI C;  1YHQ T;  1WNL A;  1M1F A;  3PFS A;  2QQB A;  4E7I A;  4MZM A;  1NPR A;  2JN0 A;  2VC8 A;  4OB1 B;  5CQX A;  4Q5W A;  4M7D F;  2DZC A;  3C95 A;  5CKH A;  3CMA T;  4M77 E;  2XHC A;  4M7A B;  2L3R A;  4O5V A;  4FT4 A;  4OB2 B;  2E70 A;  3UDC A;  2DTO A;  5D6Y A;  4M78 A;  3INZ A;  5FU7 B;  3JCM b;  4Z02 A;  2XK0 A;  3EFS A;  5M9O A;  4J5Y A;  3CCS T;  1D3B A;  3WXM B;  3CCM A;  4ATO A;  3BDU A;  2YHT A;  2LC4 A;  4M7A D;  4IUT A;  4ZN3 A;  1VQ5 A;  1QVF A;  4YTL A;  3JCM e;  1UGS B;  5IN1 A;  1QW1 A;  1YJ9 T;  2RD1 A;  3QZ9 B;  1XOV A;  3CCU A;  4L59 A;  3A8G B;  3CXC A;  4RCC A;  3CC7 A;  2XDB A;  1V29 B;  2X35 A;  2AHJ B;  3M4G A;  2EWN A;  3JCM W;  5FU6 B;  2LQK A;  4M77 C;  1IRE B;  2QEX A;  3HSB A;  5I2M A;  3OYK A;  1VQ9 A;  3L2Z A;  2E6Z A;  4RMO A;  3CD6 A;  3NFC A;  2CZ7 B;  3NTH A;  2LT1 A;  3CC2 A;  5A0L A;  2LDM A;  4XTZ A;  3OYI A;  2X4X A;  4LDU A;  4QVZ A;  2HQE A;  3I55 T;  3M53 A;  2D9T A;  5CVI A;  4C5G A;  3HRT A;  4OB0 B;  3FEO A;  4C92 B;  4XTV A;  3X26 B;  3J80 E;  3GP8 A;  4PJO E;  1GXI E;  2GQV A;  5FU7 C;  2CGH A;  3C94 A;  1NJI U;  1WQW A;  2LCL A;  2ZZD A;  3LGL A;  3QBY A;  4C5H A;  3S3N A;  5GAO r;  2VV5 A;  2WSC E;  4KT0 E;  1U8R A;  3SWN C;  1K8A U;  3CMA A;  2FVU A;  2DJZ A;  4PLI A;  1YI2 T;  3GIB A;  1U1T A;  3P8D A;  1XQH A;  3CPW A;  2RK2 A;  3JSC A;  3QHS A;  3OYY A;  2RI5 A;  3R6O A;  4C8Q A;  4C8Q F;  3G6E T;  5CR2 A;  3OW2 S;  2LTO A;  4XTU A;  1VQP T;  2KAF A;  1I4K 1;  3M54 A;  4C92 D;  3V7R A;  2C06 A;  3CCR A;  4F7U B;  4LD9 K;  4C8Q D;  5GMK j;  1Q7Y C;  4M7A G;  3SD4 A;  1YIT T;  3JCM f;  4BE1 A;  2DXC A;  1VQO A;  2K57 A;  5LJ5 e;  4JRI A;  5GMK e;  2XDP A;  3RKY A;  1KHI A;  3JCM c;  4DOW A;  1YIJ A;  3CCE T;  3X24 B;  4C92 C;  5I21 A;  3JAM E;  5GAM g;  2RB6 A;  3M57 A;  3JCM Q;  3X28 B;  3ZFJ A;  3RMS A;  1G5V A;  2DXU A;  1X6O A;  1VQ8 A;  3JCM d;  4FU6 A;  2X4J A;  4M78 F;  2I2L A;  2F5K A;  2YLB A;  2E10 A;  4C0F A;  4R55 A;  2E6N A;  5LJ5 g;  3A8O B;  1VIE A;  5DM7 R;  3CEY A;  2M16 A;  3OA6 A;  4O6J A;  1OZ2 A;  3L1A A;  3JRZ A;  4C8Q E;  4BDZ A;  2L5Q A;  1U1S A;  2HBP A;  2A3L A;  1Y96 A;  2RHZ A;  3BW1 A;  4M7D G;  4CRI A;  5GAN 6;  3EAE A;  2JTF A;  1KQS A;  5LJ3 e;  1YJN T;  1PSE A;  5LL6 S;  1N9S A;  4HCZ A;  3OY9 A;  3VKI A;  1D3B B;  3QII A;  5CK9 A;  5FRM A;  3AHU A;  1WJQ A;  2R5A A;  1DJ7 B;  1QVG S;  5D6W A;  4RG2 A;  1VQN T;  1YJ9 A;  3LH0 A;  3URG A;  5GAN d;  2QA4 A;  1W4S A;  4LD6 A;  5A0G A;  3OYC A;  1G3W A;  5D6X A;  5LJ3 d;  1VQ4 A;  1RL2 A;  3DKM A;  4BY6 C;  1KG1 A;  2QEX T;  5CKD A;  2QQS A;  5GAN 5;  3LLR A;  3ME9 A;  3OYL A;  3OYB A;  4M75 G;  4JJN K;  4JS5 A;  2VGN A;  4C5E A;  3RES A;  5GAO m;  3HRU A;  5CIU A;  2ZPI B;  2GF7 A;  3H8Z A;  1WPY A;  2IG0 A;  2V8K A;  3PGG A;  4XU0 A;  5I2S A;  1K9M C;  3JB9 F;  4NS5 A;  2RA2 A;  3PIO A;  3OYH A;  1JJ2 S;  3A5Z B;  5HK0 A;  3JB9 J;  2K5I A;  4PJO D;  1H3Z A;  4M75 C;  3T9N A;  4M7D D;  3OS0 A;  1O75 A;  3MEA A;  3G71 T;  3MEU A;  1KQ1 A;  1YJN A;  1RI0 A;  5J3B A;  4QVC A;  3CBO A;  5CAI A;  5CKB A;  3PIP A;  2K4Y A;  3KUF A;  4XU2 A;  3CCV A;  1VQL A;  3OS1 A;  3CC4 T;  2KVQ G;  4FSX A;  3MCA B;  5GAN j;  2EQK A;  1YHQ A;  1Q7Y U;  1QVF S;  5GMK h;  1M4Z A;  2DD5 A;  2D6F A;  4M7D E;  3OSV A;  4C0D B;  1YJW A;  5GAO n;  2ZPF B;  2DIQ A;  4LDW A;  4Y91 A;  4A53 A;  4L5G A;  1UB4 A;  3M56 A;  2JVV A;  1S72 T;  4CI0 C;  1SSF A;  4UC4 A;  3V8L A;  3M9Q A;  1VQK T;  3JB9 I;  1O9S A;  2R5M A;  4J83 A;  3QUI A;  4OP0 A;  3VYH B;  3V8K A;  5GMK i;  4MDX A;  1LNX A;  4IUP A;  4PJO F;  1XTD A;  3EFR A;  1X75 C;  2LVM A;  2DO3 A;  4FM4 B;  1M1K U;  3CPF A;  1VQ8 T;  2OTJ A;  4EDU A;  3QSU A;  3OMG A;  1NZ9 A;  2E1H A;  3HPW A;  3QZ5 B;  4M78 E;  3RKW A;  3FLG A;  4MDW A;  1PSF A;  4EMK B;  4OF1 A;  1R8O B;  1FWZ A;  3MP6 A;  1UGP B;  2R57 A;  2HQX A;  2ZPG B;  3E1S A;  3VV0 A;  2CZ0 B;  3L2V A;  2RI2 A;  3CBP A;  1VQ7 T;  2WAC A;  3ASK A;  3QG1 A;  3RER A;  1BI3 A;  3PT9 A;  5GAO l;  3SWN A;  4EPC A;  2MI6 A;  3M59 A;  1Q82 C;  3HKS A;  1LJO A;  2O01 E;  3CME T;  1NE8 A;  3OS5 A;  1AHJ B;  4XU1 A;  4PNO A;  1HXD A;  1X01 A;  2JTM A;  3I55 A;  4C8Q C;  2X4Y A;  1HK9 A;  2DVE A;  4QQ6 A;  3SDZ A;  2Y4Y A;  2CYZ B;  4BI3 A;  3OYN A;  2E12 A;  1B34 B;  2EJF A;  3JCM J;  4DOV A;  2FL7 A;  3UPU A;  5KH6 A;  3MEV A;  3M4Y A;  1ZHI A;  2HAX A;  4BB7 A;  3HFO A;  2OTL T;  3HFN A;  1Y96 B;  3L2W A;  3CBM A;  3ZEH A;  3CCL A;  2PU9 B;  2JNG A;  4EMK C;  2YLC A;  4QQD A;  5J26 A;  5CKE A;  1ZBX A;  3LYI A;  4XU3 A;  3L2U A;  3I56 A;  4M78 D;  3CCQ T;  1Q86 C;  3CPW S;  4ZGJ B;  4QQG A;  3VUZ A;  1M90 C;  3X25 B;  1VQ9 T;  3CD6 T;  2L89 A;  5C6S A;  1VQM A;  4IKF A;  4E7K A;  3ER0 A;  5EG2 A;  1WGS A;  2G3R A;  1YIJ T;  1KD1 U;  3UWN A;  4J6Y A;  2XIC A;  4M7D B;  2CZ1 B;  4M78 G;  1OI1 A;  2KK4 A;  3BDL A;  3E9F A;  2GFA A;  1WJS A;  1Y71 A;  4A54 A;  4A4E A;  5HKC A;  4WF2 A;  2ZCF B;  4RG8 A;  3O8V A;  3LWI A;  3CCV T;  1VQL T;  3L2R A;  2EJ9 A;  1BIA A;  4ZN1 A;  1QVG A;  2RJE A;  3HRS A;  4FIB A;  4JUV A;  2BIV A;  1K9M U;  5KCO A;  1Q86 U;  3N5B B;  2K5L A;  3TCJ A;  3MET A;  3WVE B;  3CCJ T;  1YI2 A;  4ZTJ A;  1K73 C;  2RHI A;  3UT1 A;  3FC3 A;  5C0M A;  5J39 A;  5LJ3 f;  4X9C A;  3OMC A;  4J7I A;  3LGF A;  2P0K A;  4M77 A;  1Q82 U;  1M1K C;  5DY9 A;  4HCC A;  3QXE B;  4ELY C;  2DTI A;  3G6E A;  1VQ6 T;  3QKJ A;  5CO7 A;  2CZ6 B;  2X4W A;  4C92 F;  1NPP A;  3QYG B;  3NTI A;  4LDX A;  4M7A C;  4IUQ A;  1JJ2 A;  2RHU A;  4KUL A;  4NOY A;  2V8I A;  3OQ5 A;  3QPH A;  4II1 A;  4N4G A;  2ZPB B;  4M78 C;  3JCM V;  3CXC S;  5IT9 E;  4A4G A;  2VUB A;  3CC7 T;  3FJP A;  4GY5 A;  3HHT B;  2O4X A;  2DEQ A;  3PMT A;  4M75 A;  1KD1 C;  2K2V A;  2K5F A;  4IUR A;  4NL2 A;  1M90 U;  5KE3 A;  2F5T X;  5GAO q;  2XI9 A;  4JRK A;  5AYF A;  1W2B S;  2RJC A;  2WSF E;  2QQ9 A;  2LRQ A;  1M1G A;  4M75 D;  3VYG A;  1Y7X A;  5GAM e;  2O4X B;  2RH2 A;  2RHY A;  1UGQ B;  4M75 B;  4QVD A;  3PTA A;  3G71 A;  4PJO B;  3JCM h;  2EYQ A;  3C4S A;  3FRN A;  3S3M A;  4D6W A;  1BI2 A;  3A8L B;  2E64 A;  2KMT A;  2PUK B;  1I5L A;  5GAN 3;  4PJO A;  1I8F A;  2R58 A;  3GF5 A;  1KQS S;  2DXB A;  5HY6 A;  3RUX A;  4F7U F;  2BKD N;  5GAN f;  4KUD K;  4IUV A;  4MZP A;  3V8J A;  4PKC C;  1N9R A;  2LCC A;  3DLM A;  3FDR A;  3GLX A;  3VJP A;  3GNF B;  1S72 A;  2ZPE B;  4KBM B;  3C12 A;  5A2Q E;  2VXF A;  4JS4 A;  4HKE A;  3QDR B;  5LJ5 h;  2KSS A;  3OW2 A;  3HP9 A;  3OYM A;  5LJ3 g;  4M7D C;  2QA4 T;  5LJ5 j;  2KDS A;  3CCU T;  1VQO T;  4HT8 A;  2PUO B;  2GFU A;  2Y90 A;  2QDY B;  2K3X A;  3CCR T;  2IVW A;  3DB3 A;  4BE2 A;  1Y07 A;  1I81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...