4M7DD

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 16
structure length 74
sequence length 74
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dD00
1HK9A 4M77C 3SWNC 3RERA 3V7CA 4J5YA 3RUXA 5GAN3 4M75B 2E10A 2VC8A 2QTXA 4PJOE 5LJ5g 4PJOC 3SWNA 2DXTA 3JCMP 1N9RA 3JCMW 1WQWA 4X9CA 3JCMb 1LOJA 4F7UE 4XTUA 4N0AA 5LJ3g 5CAIA 4M78F 4M7DC 5GAMg 2E65A 3JCMQ 4M7AF 2DVEA 4EMKC 3FJPA 1X01A 2YLCA 5LJ5f 4NL3A 4EMGA 2DTIA 5DY9A 3QHSA 5GAN6 5GAN7 1N9SA 4WF2A 5LJ3h 4OP0A 4C92F 4C92D 4C92G 5GANe 3JCMX 3QSUA 4J6XA 4EMKA 2VXFA 3JB9F 4M75G 4M75D 2YHTA 4PJOA 1H641 1MGQA 3JCMh 3JCMJ 4M7DD 4M7DG 5GAN5 2I2LA 4M7AC 4HT8A 4M77A 4F7UG 4F7UF 4M78D 4M78G 4XU0A 3GIBA 4F7UB 5GAMf 5GMKh 3JCMg 3INZA 4J6YA 4JLIA 1B34A 3L1AA 2DTOA 4JRKA 4JUVA 4C92C 5LJ5e 2E41A 5GAN4 3RKWA 4C8QA 1HXDA 3FB9A 4XTZA 3V8JA 4M7DE 3JCMV 4RCCA 4A54A 3V8KA 1D3BB 2E64A 2FYKA 4M77E 4XTVA 5LJ3f 1LJOA 3SB2A 3PGGA 5LJ3d 4C92B 5GMKe 3JCMd 5GAN8 1M8VA 4EMHA 3JCMf 2DEQA 4A53A 1I81A 4C92E 1JRIA 2VXEA 3VU3C 2JN0A 4QVCA 2E1HA 3BW1A 4HA8A 5GAOq 1YCYA 3JCMc 3JB9J 4M75C 4QVDA 4M78B 4DQ2A 2FB7A 3AHUA 1TH7A 4PNOA 3V7RA 5GAMd 2EAYA 4EMKB 2EWNA 1BIBA 1Y96B 2DZCA 2DZ9A 5GMKm 4M7AG 4M7AD 1KQ2A 5GAOl 1WQ7A 4MMLA 3RESA 4M7AB 3FIFA 5GAMj 5GAMe 1U1TA 4JRIA 5GANd 4V2SA 2DJZA 2CGHA 4M7DA 2DXUA 4M78C 4M7DF 3JCMe 5LJ5d 2DTHA 4M77D 4M77G 4XU2A 4M77F 4XTYA 4F7UA 3QO3A 4C8QE 4M78A 4J6WA 3L2ZA 4M75F 3QUIA 2RA2A 3M4GA 4XU1A 4C8QB 2K57A 4HT9A 4PJOF 4NOYA 1WNLA 5GAOr 4MMKA 3BDUA 4C8QD 1LNXA 4C8QG 4X9DA 1I5LA 5GMKj 3V8LA 2EJGA 3BY7A 5LJ3e 1M5Q1 1D3BA 2EJ9A 3HFOA 5LJ5j 4M7AE 4C92A 3EFRA 5GAOm 3HSBA 1U1SA 4Y91A 5GMKl 1WPYA 5GAOp 5GAN2 3JB9H 2DKGA 5GAMh 2Y90A 4XU3A 5GMKi 1JBMA 5GANf 3JB9D 3JB9G 4M75A 4M78E 5I21A 2RM4A 5LJ5h 4PJOG 4PJOD 2HNIA 3HFNA 2RD1A 3RIRA 3SWNB 1I4K1 4XTWA 4XQ3A 2YLBA 1Y96A 3EFSA 4C8QF 4PJOB 4M75E 4N0AC 1I8FA 5GANg 4XTXA 3RKXA 5GANj 4RCBA 5GANh 4M77B 4M7AA 2RB6A 2EJFA 4C8QC 3BFMA 1KQ1A 2ZGWA 4NL2A 3V7SA 5LJ3j 3JB9I 4M7DB 3RKYA 1BIAA 5GAOn 1B34B
chains in the Genus database with same CATH superfamily
2K2MA 1X6OA 3X25B 2VC8A 2AKLA 4E7JA 1N9RA 4A63B 3JCMb 3A8LB 5GJWB 1KK7A 1UJYA 3EGXB 4DOWA 3NHNA 1M90R 4EDUA 3TSWA 1M3BA 1ABQA 4ORZA 3HRTA 1LPLA 3DLMA 1YJWT 2HZYA 1XOVA 2RHZA 3D7SB 3LH0A 1Q82U 1YI2Q 2WSFE 1B7TA 2HKQB 3INZA 9ATCB 5IH2A 1C6VX 1TUCA 1HXDA 2CZ0B 4J9IA 1ZSGA 4RCCA 4M77E 1ZBXA 2P0PA 4L5GA 2GFUA 1M1KR 2K3XA 1K4US 2JS2A 2BTTA 5FRNA 4PJJA 2QQAA 2M9UA 5CIUA 3LYIA 1O75A 1SF9A 2X35A 2ZCFB 1U1TA 3GP8A 1VQ5T 4IIOA 2AZSA 5CCAA 1KSWA 1NPRA 4WTOB 1H3HA 4M75F 3OYJA 4MMKA 4J9BA 2HBPA 1V76A 5KCOA 4OMFB 1NLPC 1CSKA 2P0QA 3CC7Q 1QWEA 3VS5A 3FRNA 3OW2P 2MI6A 4LE9A 3CCRQ 1C1AA 1SKUB 5GAMh 4XU3A 3GLXA 4JLGA 1VQ7T 1KQSP 1FMKA 2DRKA 2DF6A 2RD1A 3PFSA 1E7OA 1MV0B 2CS7A 1R8OB 4UC4A 1CKBA 3X28B 1P92A 1UECA 2DYBA 4OMNA 4EPCA 2OTLT 3P8BB 1KD1U 2LP5A 1VQLT 1HK9A 3GNFB 4M75B 2YUNA 3VS4A 3RNJA 4JZ4A 4PJOE 4PJOC 2GBQA 1QCFA 3G7ZA 2L5QA 5GAMg 3VS3A 4K11A 2DVEA 1X01A 4IUTA 3G71T 4LDUA 1HSQA 1QMCA 1QVGA 2YXYA 3OYKA 2LNVA 1RADB 2X4JA 1Z9QA 2PUOB 1YCSB 5KYUB 4XAXB 2D6FA 3VRYA 4AFSC 3MKDA 4ANJA 2BE9B 3OYMA 1R0BG 4OMOA 3GF5A 3OYLA 3OMGA 4AG2C 5KE3A 2F5KA 1IHVA 4ZN1A 3OBYA 3VU3C 3UA6A 1T0JA 3JCMc 2EWNA 4KH1B 3VS0A 5KYYA 1G3SA 2FO0A 5A2QE 5I2SA 3LWHA 5FU6C 2K5LA 2HDAA 2PZ1A 4C8QB 2K57A 2DNUA 3EFOB 3G4ST 3MEWA 5CKEA 3VRZA 2X4WA 1TUGB 2QDLA 3BY7A 4JZ3A 2JOYA 4HXJA 3GOXA 4FL6A 2VKNA 2Y90A 4IUPA 2H3EB 1JBMA 1VQLQ 3CD6T 4M75A 3OYIA 2HNIA 3ZBDA 3ZFJA 2E70A 4N0AC 1I8FA 2XI9A 4CC7A 3JSCA 3C95A 2LT1A 3A8MB 3X26B 2OAUA 1SRLA 1OU8A 1Q86C 1SSFA 4R55A 2Y4YA 5FW9A 2KNBB 4PL6A 2MCNA 1DJ7B 2O4XA 1X6GA 2LRQA 3O5ZA 1SPKA 2QI2A 4M75G 4Y92A 1SRMA 1MGQA 3EGDB 2PVOB 2FRYA 4PLIA 2EFIA 3UPUA 3CCVA 5GAN5 2O9VA 3I9QA 1QKXA 3EAEA 3CCMQ 2XDPA 4AFQC 2RJFA 3LW5E 1WJQA 2W10A 5D6YA 1VOMA 2COWA 1K1ZA 3A8GB 1ZUYA 4M7DE 3IQLA 3CCRT 5LJ3f 1M8VA 5HK0A 5GAN8 2KE9A 2DX1A 2DEQA 3DB3A 4JJBA 3OYAA 1OEBA 2YRVA 2FVUA 2D9TA 4EMKB 4A4KA 2WSEE 4M7AD 4E7KA 5GAMe 1OPLA 3CD6Q 3NTKA 3CCLA 2QTVA 1ZUUA 1QWFA 3OB9A 4FYVB 4RTXA 3L2ZA 4QQ6A 5CKFA 3HRUA 3CPWS 1VQ8A 1VQ8Q 1M2OA 1X2QA 4X9DA 2HL3A 4DBFA 2K3YA 2FPFA 3URGA 2EQMA 2VYTA 2FPEA 1VQ6Q 2E5KA 1UGPB 1VQ7Q 1TSFA 4BY6C 2DL4A 2QAZA 2FG0A 5GANg 1S1NA 1YHQQ 1ZBJA 2CT3A 2DPPB 4ESRA 2YWWA 4XK8E 1IGQA 3C0CA 3N5BB 4XTUA 1V29B 2NWMA 3JCMQ 1VQKA 4NL3A 1QP3A 3G4SA 1JJ2P 3QWXX 2E3HA 3QSUA 2YT6A 4FM4B 2PNIA 4QW2A 4KGXB 1Q81C 2AIRB 4LNPA 3FLGA 2M1HA 1Q86R 3TVTA 1G3WA 4M78D 3CCVT 2P84A 4MDWA 3M0SA 3X20B 1O9SA 2O01E 4JUVA 3CMET 1PG5B 2OJ2A 3G6ET 2QXFA 1QVGP 4N4HA 5CQYA 1KHIA 2HCKA 2RPNA 4A54A 5GMKh 5EC7A 1RAIB 4Z88A 3CC2T 3THKA 1JRIA 3DKMA 3M0PA 1YJWQ 1QVFS 1X2KA 4KUDK 1WXUA 1NE8A 1S72Q 3U23A 2RH2A 4PJLA 3NGPA 1BIBA 1BCMA 2DZ9A 1WGSA 3Q1JA 4PKCC 2EGEA 3M53A 2MMPA 2X4YA 3S6WA 2LCLA 2C0TA 4M78A 2DD5A 1ZSZC 2K5FA 1JXMA 2DLPA 3A98A 1YJ9Q 1K9MC 4EIKA 5KYWB 2V1RA 3V8LA 1UEBA 1M5Q1 2EJ9A 1M90U 4HCBA 1D0ZA 3OMCA 2LDMA 3L2VA 3OS1A 1VQOA 4HCZA 4PJOD 3EHQA 1RABB 1YJ9T 2J6OA 2L3RA 1T0HA 2DA9A 2D0QB 2ED1A 5KYYB 2RB6A 3BFMA 1YJNQ 1IB8A 1OPKA 2D8JA 1KFZA 3REAB 2JUFA 3P8DA 4X1VA 2AKKA 4DA4A 3QXEB 2PUKB 4BD3A 1C0MA 4R56A 1RLPC 2KXCA 2KXDA 3MP8A 1QVFP 2XHCA 5DM7R 3G6EQ 2KQWA 2YUPA 3F70A 4ATOA 2WSCE 2E4HA 1UB4A 1ZA1B 1YHQA 2RK1A 1E6HA 3QPHA 1FMWA 1RL2A 4BDZA 1VQNT 1VQKQ 2HEQA 2QEXQ 5GAN4 2NYSA 3JRZA 3SD4A 3CMAA 1UHCA 3QYGB 4OMLA 3CCQA 3SB2A 1YWOA 3JCMd 4OB2B 4MZMA 1Y57A 3NTIA 1VA7A 2F69A 2E1HA 4ELZC 2RHYA 4M78B 1ZHIA 2B86A 1I0CA 2RJCA 5KYWA 2VGMA 4RG2A 5CKHA 4M78C 1K9MU 2EYXA 1NG2A 2Z0WA 2DTHA 1TXQA 3PNWC 1QP2A 2OI3A 5IHKA 5CKDA 1HYOA 1WNLA 4KT0E 2JMCA 4C8QD 2NUTA 1YWPA 4FYWB 4MDXA 1NYFA 3CMEA 2CUDA 4L6V5 1G83A 2DE0X 4M7AE 3TQ7P 5GMKl 1WPYA 3JB9H 2DKGA 3MP6A 2R58A 5GMKi 4F16A 5AT1B 4GY5A 4BI3A 2DERA 1GCPA 1X43A 4C8QF 1NPPA 4ZTFA 2XKOC 1KC8R 4FYXB 1NM7A 2JM9A 3I56Q 1B34B 3V7CA 4GBQA 2E6ZA 2ZPEB 4LXCA 3UWNA 2SRCA 1LOJA 1W2BA 2KROA 3MO8A 2JTFA 1D0YA 5KYNA 2F1LA 3OYCA 5KE2A 2JTEA 4KUIA 3MP1A 3A1PA 1VQ9T 5I2MA 2LNHB 4M7DD 3E9GA 2RN8A 3PVLA 1RAAB 1WJSA 4AFZC 2KR3A 3H8ZA 4FT2A 4JLIA 1PRMC 1UGSB 4C92C 3UF4A 5KH6A 3OYFA 3I55T 2E6NA 3HL8A 3CCLQ 1M3CA 4C0ZA 4A4GA 2BZ8A 2FYKA 1Q7YU 2PTKA 2RF0A 2CZ7B 2L3PA 2EAYA 1IXDA 1W1FA 1WQ7A 3RESA 2AT1B 3LX7A 4KULA 1JO8A 1U06A 4M7DA 4IUVA 3I35A 1WXTA 1WIEA 4O5VA 6AT1B 2FL7A 2DYIA 3L2UA 3I5RA 2KRSA 3H0FA 5GAOm 1YIJT 1U1SA 2L8DA 3JV3A 1G3TA 3CCEQ 1UTIA 3CCJQ 5HY6A 4M78E 5I21A 3NTHA 2LJ0A 2C06A 3WVDB 2FZKB 1FX7A 3EFSA 2P4TA 2HQXA 1T3LA 2JMAA 4J9DA 5GANj 1K8AU 3M59A 3QDRB 5LJ3j 1QCNA 3ME9A 1BIAA 5GAN3 1ARKA 2RI5A 3G6EA 2LMJA 3CC7A 1KHCA 4X9CA 4F7UE 3VS7A 2COYA 1GCQC 2KI7A 5LJ5f 2EVRA 1F1BB 1AHJB 4J7IA 1KIKA 5GAN7 4C92D 1GBQA 2P4RA 1N8RR 5IHNA 1RI9A 2EQUA 4J83A 1VQ5Q 3FEOA 1K8AC 2EKHA 4BE1A 1OULA 2YRCA 3FDRA 4Z8AA 2FPDA 4LUDA 4J8OA 3KBGA 3FB9A 2BZYA 2ZAEA 2DJQA 5IN1A 3CPFA 1G5VA 3CCJA 4CC2A 5LJ3d 3S3MA 2VV5A 4GLMA 3OYGA 1WYXA 3JB9J 3CCMT 2LJ3A 2J6KA 5CKBA 4OGCA 2XDDA 1NJIU 1GXIE 2MF2A 2K6DA 2DO3A 2RQTA 2DMOA 1NBEB 2MWPA 2O2OA 4CI0C 1UFFA 1G2BA 3CCJT 2BE7D 5EG2A 3CPWP 3J81E 3PE0A 2L3SA 4FW1A 2GNCA 4O6JA 2DAQA 1JXOA 3I56T 3CCSA 1UGRB 4E7SA 1WZOA 4HKEA 2FZGB 2QDYB 1UHFA 5I22A 5J3BA 1YP5A 2DM1A 3QBYA 1UE9A 3ZL7C 1JEGA 3QZ5B 2JM8A 4LUEA 3SEMA 1VQMA 1I4K1 4PJOB 2OTJT 1GL5A 2LX7A 2YSQA 2ZGWA 1AWXA 2KBTA 1N8RC 2CZ1B 4JJCA 2J6FA 4JS5A 3CC2Q 3CC2A 3SWNA 1VQMT 2K4YA 2RHXA 2HQEA 4DBRA 2NUTB 2E65A 5CVIA 1K0XA 2QGGA 3CMAQ 2Y4XA 1EIFA 4E6RA 3CCUQ 2DTIA 5DY9A 3OY9A 2VVKA 2J7IA 1NJIR 2X9HA 2K7AA 1X6BA 2VXFA 1MMDA 2OX7A 2IIMA 2A0FB 2JS0A 1I1JA 1M3AA 3H0IA 4LN2A 5DLQE 4M7AC 4C0DB 3S3OA 3GIBA 4F7UB 2QG9B 2DL7A 4D8DA 2DVJA 2ATCB 2RHIA 4IUQA 4FSSA 1X27A 4L59A 3OYNA 3M54A 1FXXA 2JN0A 4QQDA 3BW1A 3NPFA 2NUPA 1M1KC 3CCMA 1QW1A 3AT1B 2KGTA 1ACMB 3C94A 4LDYA 2JJ9A 2PQWA 4LDXA 4M77G 3M0QA 1M8MA 4OB1B 2CT4A 4XU1A 3L2QA 3G71Q 2ROLA 1MV3A 1BU1A 2DBKA 5FWCA 2ECZA 3HFOA 4OMQA 3EG3A 4A4HA 3HSBA 1WHKA 3DB4A 1YHQT 3JB9D 2RM4A 3SWNB 1GFDA 4M4ZA 2CP6A 1H8KA 3L42A 1AVZC 2KK4A 2VASA 3OW2A 3SWNC 4N4GA 4J5YA 7AT1B 4QVZA 2QTXA 1GFCA 2SEMA 1BI1A 4KH0B 4OGEA 4AT1B 4D8KA 5LJ5g 2GTOA 3KFVA 1D1CA 4EMKC 2XU8A 3LGLA 5IT9E 1M2VB 3JAME 1SG5A 1R0CB 3EGUA 1K0SA 4OMPA 4J6XA 1B3QA 3M57A 4RTWA 4AG1C 1MNDA 1VQOT 2P0KA 4ZGEB 2KSSA 4XU0A 2QEXA 1PKTA 4OVAA 2FHDA 3H0HA 2GQIA 3G4SQ 1RAHB 2NUPB 4XTZA 3NMZC 1K73R 1M1FA 4RG8A 2LQNA 2DIQA 4BI8B 3RBBB 1QLYA 1K76A 1BK2A 3KUFA 4DOVA 3PIOA 2KY9A 2FB7A 1TH7A 1NLOC 2LCCA 4E7ZA 2LC4A 3HTRA 5GAOl 2V8JA 4MMLA 4M7AB 3CCEA 3E2UA 3BE3A 3OYDA 3JCMe 2MK5A 1SHFA 2LZ6B 1M30A 2RA2A 3HHTB 2RO0A 4ZTJA 1YBYA 3CXCP 2DL3A 3BDUA 3J80E 3E9FA 2JVVA 5GMKj 2C0IA 5M9OA 5GAOp 1PWTA 5GAN2 2A08A 1VIEA 2OTJA 4XTWA 2PVGB 1QCOA 1PD1A 2HD0A 1WHJA 3E19A 1B07A 3TCJA 4A4EA 3VS2A 2X4XA 1QVFA 4C8QC 1D09B 2ZPIB 2F5TX 2E10A 1BCOA 3JCMW 1I5OB 1RAEB 4BDYA 2ENMA 1IREB 2L0AA 4BUGA 1SSHA 4M7AF 2YLCA 2EW3A 4P5NA 2R5MA 5LJ3h 3R6NA 3VYHB 2OTJQ 2V8KA 4LDVA 1YJNA 4KRTA 2QQ9A 2LTOA 5D6WA 3JCMh 3WVEB 3M0TA 1BI3A 1MHNA 4F7UG 1TWBA 1W2BP 4PFPA 3VUZA 4AMCA 3WXMB 4JRKA 4ME7A 1VQOQ 4J9CA 3PMTA 2QEXT 2EQKA 2QA4A 5A0GA 4E47A 2LT4A 3NFCA 2MAMA 1D3BB 3M0UA 1UGVA 4E2FB 1AWWA 1QQJA 1I81A 4QVCA 1BBZA 4PNOA 1YJ9A 3S3NA 3OYEA 5GMKm 1YI2A 5IAYA 2ZPFB 2CGHA 3OW2S 1Q82R 2DXUA 1D1AA 5LL6S 3RMQA 2DEUA 3GPLA 1VQ5A 3UDCA 4F7UA 1OX9A 4M77F 4XTYA 2A37A 4J6WA 4Y28E 2ESWA 3R6OA 1M9SA 3P8HA 3EH2A 4KGVB 2VB6A 1OV3A 2EYZA 1A0NB 1YI2T 1MUZA 1YN8A 3FJ5A 2L89A 3CC4T 4F04B 3LLRA 3M56A 2RQWA 4JJDA 2GCXA 1GBRA 5ECAA 1ZLMA 3HFNA 3EH1A 3RIRA 1PC0A 2O9SA 1RACB 2YLBA 1NEBA 2J06A 1AT1B 4M75E 3CCST 1ZA2B 4XTXA 5KYXA 3PMIA 3OYBA 1XNIA 1BB9A 1XJWB 3SHWA 3VJPA 5FU7B 2A28A 1WLPB 3RUXA 2RQVA 1EX4A 5D6XA 3CD6A 2FZCB 1G3YA 2JZ2A 1KC8U 2XK0A 3CBOA 5C0MA 5I11A 4DEYA 4LD9K 4PFOA 1SEMA 4B9WA 4KBMB 2RMOA 1HD3A 3I55A 4IKFA 4M75D 2ED0A 1VQPQ 2W0ZA 3SDZA 3JCMJ 1VQPA 2XD0A 1AWOA 1WHMA 2COZA 3CPWA 2MIOA 2GFAA 5GAMf 1B34A 1UGQB 5CR2A 2E41A 1VQNA 2EYWA 4FT4A 2R5AA 2F2WA 2CP5A 3V8KA 1M1GA 2VWFA 2KAFA 1M2VA 2OAWA 4GLKA 1VQ8T 3V7RA 5L23A 2KT1A 1X69A 1Y96B 3TU4K 4M7AG 1JQQA 2DETA 1VYVA 1IRXA 3PVQA 3EG9A 3VS1A 4V2SA 1Q95G 4J9EA 3CCRA 3OYYA 2G3RA 1NJIC 3CC4Q 2ABLA 2RI2A 2CSIA 3QJ6A 1KJWA 5HCKA 2CP7A 3PTAA 1NZ9A 1AZGB 1MNEA 2RNAA 5HKCA 1AEYA 2LX9A 3A5ZB 4DEXA 5J26A 1T3SA 4RTTA 1OOTA 5LJ5h 2IVWA 1M90C 4BI4A 4DBHA 1TS9A 1GCQA 3M0RA 3QKJA 4JJNK 3A8OB 3RKXA 2EPDA 2FRWA 4J9HA 1Q86U 3HKSA 4M7AA 3CCUT 1WXBA 2X51A 3JB9I 3CMAT 1KG1A 4M7DB 2BKDN 4C0DC 1AD5A 1UDLA 1WJRA 1AOJA 1JU5C 5IHIA 4HCCA 2DXTA 5AYFA 3MEUA 4RTVA 2WACA 3CXCA 2KYBA 3ZEHA 2LCSA 4CRIA 5IXBA 2VUBA 4EMGA 4F14A 3UA7A 4C92F 2QQRA 4MZTA 1H92A 1R77A 1LCKA 2BIVA 1SHGA 2L2PA 1BI0A 1YITA 1HJDA 2I2LA 1AZEA 2X3XD 2QGFB 4M78G 4FCYA 4TVRA 3JCMg 1VQLA 2CH4A 3V8JA 3QYHB 2GQVA 2A3LA 3HP9A 1I07A 3CBMA 3I55Q 2RK2A 2R57A 4XTVA 2XICA 1WA7A 1YIJA 4C92B 3EG9B 2YDLA 5FU7C 4A53A 4BE0A 1QVGS 4DQ2A 3AHUA 2EYQA 3M58A 1WFWA 1UG1A 1K9AA 3VYGA 2M51A 3VUBA 1Q7YR 2YRDA 4M7DF 8ATCB 2DXBA 2JNGA 4C8QE 1KQSA 3CC7T 4C0GA 1YFNA 1ZUKA 1XQHA 2JW4A 2CKKA 1PSEA 2K5IA 4NS5A 5LJ3e 5FLXE 1D3BA 3EFRA 3EG2A 2B8AA 5FRMA 2D8HA 1K73U 1ZQ1A 5FROA 1VQ9A 4BACA 2O88A 2XIDA 1QVPA 3QIIA 4PJOG 2XG8D 2QK0A 1WX6A 5KYUA 4JPBW 2DXCA 3QWYA 1PM3A 5GANh 3RMSA 1G8XA 4RTYA 3HRSA 3MPUB 3ASKA 4FW2A 3TSZA 2RJEA 2MYSA 3DLLA 2HAXA 3I56A 2HSEB 3A8HB 2LJ1A 2V8IA 1J3TA 3M55A 4AFUC 4QKUA 3QHSA 5GAN6 2HL5C 3CC4A 1N9SA 4ZN3A 3JCMX 1YITQ 3OS0A 5D7UA 1BKBA 3EGXA 1RUWA 4PJOA 1H641 1ZSZB 5A0DA 5KYXB 4HT8A 4WCIA 4PJNA 1FWZA 2DL8A 2CH4W 4QQGA 5CO7A 4C8QA 3L2WA 3EFOA 2A7YA 2X3WD 2EQJA 2K79A 3CCQQ 1LJOA 1WHHA 4IUUA 2QQBA 1LVKA 2VXEA 3OQ5A 4HA8A 1YCYA 2LQKA 3OSVA 2YUQA 1PHTA 1M4ZA 2I0NA 2BZXA 1VQNQ 3CCSQ 1D1BA 2H8HA 4JRQA 2QA4T 1KQ2A 1KD1R 1RLQC 2DL5A 3QZ9B 1VQPT 1VYUA 1W4SA 2DJZA 4KGZB 1U3OA 1PRLC 1VQMQ 4B9XA 3QUIA 1ZX6A 4ZNXA 4PJOF 5GAOr 3J7AF 4C5IA 4C8QG 4PFZA 1OYXA 5HK3A 2HMAA 2EGCA 3CCVQ 1VQ4Q 1Q81R 2O4XB 1XTDA 5GANf 1UUEA 3H6ZA 3M4YA 1Y96A 4C0FA 1KD1C 4Z89A 2NLUA 2DIGA 3OSSC 5KCHA 4M77B 2CP3A 1PKSA 2EJFA 1Y0MA 4NL2A 2EQIA 3FC3A 1VYTA 1OZ2A 3META 4CC4B 2LVMA 3UATA 1TTHB 1JJ2A 5DLOA 4BY6B 2IG0A 2EIFA 4QT7A 1MMAA 4RTZA 5CAIA 4N4IA 4BB7A 3HPWA 2L3QA 4OB0B 2PU9B 4E7LA 2CDTA 2DK3A 4HVVA 2DRMA 4EMKA 2QASA 3E1SA 4M7DG 1WI7A 2ZPHB 1NYGA 3CCUA 2QQSA 2D0NA 4J6YA 3EG1A 2DTOA 4FU6A 2AZVA 3CBPA 4C5GA 5FU6B 3MJXA 4F17A 1EFNA 4RTUA 2CSQA 3JCMV 2AK5A 4PLLA 3CXCS 2A36A 2E64A 2KVQG 1RAGB 2RI3A 5GAOq 2CP0A 1TUDA 1W2BS 4HCKA 1X75C 5L8RE 4RMOA 4E7IA 2DZCA 3EG0A 2GTJA 1Q82C 4JRPA 3OA6A 1TG0A 2GF7A 1YJNT 2M0YA 1VQ7A 5J39A 1VIFA 1IGUA 4DBQA 3QO3A 2HBWA 2JXBA 1VQ4A 4NOYA 3VKIA 1VQKT 2K3BA 4IIMA 2EGAA 3QJYA 4FSXA 5FWBA 3LH5A 5LJ5j 4C92A 4Y91A 2CUBA 5CK9A 2RJDA 2KRMA 4JS4A 3OS2A 1QKWA 1WHLA 4II1A 3TEEA 2HKNA 3C4SA 4XQ3A 3GBQA 1Q81U 1YITT 4RCBA 4JDSA 1VQ9Q 2ZPGB 2F2VA 4J7FA 1KQSS 3JCMP 1WQWA 2HSPA 8AT1B 1S72T 4N0AA 4M7DC 1UJ0A 3FJPA 1MMGA 4WF2A 3MEVA 1KC8C 4OP0A 4C92G 1OI1A 3LGFA 1OZ3A 1WHGA 2KDSA 2DILA 2H3JA 3L2RA 2DBMA 3PIPA 2YHTA 1RAFB 1VQ6A 5CQXA 3CQTA 1S72A 2MPXC 4A4FA 2JTMA 1U8RA 2ZZDA 1N5ZA 3MEAA 2MWOA 2BUDA 4LDWA 1YNZA 2GGRA 3TREA 2HQHA 3L1AA 4OMMA 1BI2A 3RKWA 3RR6A 2C0OA 2K9GA 1Q7YC 2LQ8A 3OBWA 3BDLA 2V26A 5GMKe 3CEYA 3JCMf 3LWIA 3G71A 1WDXA 1Z9ZA 4E7HA 2KEAA 3OS5A 3C12A 1W70A 2FEIA 2JT4A 4B6MA 2QYZA 5C6SA 4IURA 3ER0A 1ZSZA 5GAMj 2AHJB 3VS6A 4JRIA 4PJMA 2OTLA 2KT8A 3M5AA 3CCET 2D1XA 2XDBA 1Y71A 4MZPA 4XU2A 2M02A 4YTLA 4FYYB 1PD0A 4HT9A 4D6WA 1PCXA 4LD6A 1LNXA 3I5SA 3H41A 4ZGDB 3M9QA 4Q5WA 2LQWA 3CCQT 4OF1A 2EYYA 2F2XA 3PT9A 1AWJA 3X24B 2K2VA 2RQRA 3H9NA 2G6FX 1BYMA 3MHXA 4BE2A 2RQUA 1JB0E 4ELYC 1N6AA 2M16A 1D0XA 1H3ZA 5GAOn 3T9NA 1TU0B 3QDFA 4M77C 3RERA 1IO6A 1ABOA 1E6GA 2J05A 4HVUA 2XMFA 2NUZA 4VUBA 3CCLT 1OQKA 2ZPBB 1V1CA 5LJ3g 4M78F 2E3IA 4Z02A 2V1QA 1VUBA 1PSFA 3REBB 4CC3A 3G1JA 2ROTA 3O8VA 5GANe 1YJWA 2VGNA 2CYZB 2KYMA 3JB9F 1M27C 3RDVA 3QG1A 2CP2A 2EBPA 4M77A 4F7UF 1K9MR 1RI0A 1N8RU 1IHWA 1TOVA 1Y7XA 4RUGA 5LJ5e 1CKAA 1W6XA 2KMTA 2EKOA 1JJ2S 1GRIA 4ZGJB 4R0KA 3VV0A 3KXTA 1PNJA 3UT1A 1YIJQ 2KRNA 3ULRB 3PGGA 1N27A 2M0OA 4EMHA 2DFUA 4C92E 4C5EA 3CMEQ 4M75C 4QVDA 5GAMd 4PK4A 4C5HA 4OB3B 5A0LA 3OYHA 2YUOA 2E12A 4FIBA 3FIFA 5GANd 5IXFA 1U5SA 2PVDB 1MMNA 4HVWA 5LJ5d 1VQ6T 4M77D 2DD4A 1VQ4T 4J9GA 3MCAB 1Y07A 1OX8A 3M4GA 2RHUA 1OU9A 1I5LA 2CREA 2EJGA 1FMVA 1FYNA 2O31A 4X34A 2MOXA 3JB9G 1K8AR 1M1KU 3SFMA 4J9FA 2QA4Q 1K73C 2OTLQ 3EGDA 1NEGA 1IZ6A 2CZ6B 5GJVB 2IPOB 2E5QA 1KQ1A 3V7SA 1EZZB 3RKYA 4RKUE 3GNGA 3EHRA
chains in the Genus database with same CATH topology
3SWNC 4N4GA 4J5YA 1X6OA 4QVZA 3X25B 3ASKA 2VC8A 2QTXA 4OGEA 1BI1A 5LJ5g 4E7JA 2JUFA 1N9RA 3P8DA 2RJEA 3JCMb 3DLLA 3A8LB 2HAXA 3I56A 4DA4A 3QXEB 3A8HB 4DOWA 2V8IA 4EMKC 2XU8A 3M55A 3LGLA 2PUKB 5IT9E 4BD3A 4R56A 4EDUA 3QHSA 5GAN6 3JAME 3CC4A 1N9SA 4ZN3A 3JCMX 3MP8A 3HRTA 4J6XA 3OS0A 3M57A 2XHCA 3DLMA 1YJWT 5DM7R 2KQWA 1BKBA 3F70A 4ATOA 4PJOA 1H641 2WSCE 5A0DA 1UB4A 1VQOT 1XOVA 2RK1A 1YHQA 2RHZA 2P0KA 3LH0A 1Q82U 3QPHA 4HT8A 4ZGEB 2WSFE 2KSSA 1RL2A 4XU0A 4BDZA 1VQNT 1FWZA 3INZA 2QEXA 5GAN4 4OVAA 2FHDA 3JRZA 4QQGA 3SD4A 5CO7A 4C8QA 1HXDA 2CZ0B 3L2WA 2A7YA 3CMAA 4XTZA 2EQJA 3QYGB 3RKYA 1M1FA 4RG8A 4RCCA 2DIQA 4BI8B 4M77E 3CCQA 1ZBXA 1LJOA 2P0PA 4L5GA 3SB2A 2GFUA 3JCMd 2K3XA 4IUUA 4MZMA 4OB2B 3NTIA 2QQBA 5FRNA 2VXEA 2F69A 3OQ5A 2E1HA 2QQAA 2M9UA 3KUFA 1YCYA 4HA8A 5CIUA 4DOVA 2LQKA 4ELZC 3PIOA 3OSVA 2RHYA 2KY9A 4M78B 1M4ZA 2FB7A 3LYIA 1TH7A 2LCCA 1O75A 1ZHIA 2LC4A 4JRQA 2X35A 2QA4T 2RJCA 5GAOl 2ZCFB 1KQ2A 2V8JA 4MMLA 4M7AB 3QZ9B 3CCEA 1U1TA 2VGMA 1VQPT 1W4SA 3GP8A 1VQ5T 2DJZA 4RG2A 5CKHA 3OYDA 4M78C 3JCMe 1K9MU 5CCAA 2DTHA 1NPRA 3PNWC 1QP2A 4B9XA 4M75F 3QUIA 2RA2A 5CKDA 3HHTB 3OYJA 2RO0A 4ZTJA 1YBYA 4PJOF 5GAOr 1WNLA 4KT0E 3J7AF 4MMKA 3BDUA 4C5IA 4C8QD 4C8QG 1OYXA 2HBPA 5HK3A 3J80E 3E9FA 5KCOA 2JVVA 4OMFB 2P0QA 5GMKj 3CMEA 4MDXA 4L6V5 4M7AE 3FRNA 2MI6A 5M9OA 5GMKl 1WPYA 5GAOp 5GAN2 2O4XB 3JB9H 2DKGA 3MP6A 2R58A 5GAMh 4XU3A 3GLXA 4JLGA 5GMKi 1XTDA 1VIEA 5GANf 1VQ7T 3H6ZA 2OTJA 4GY5A 3M4YA 2RD1A 4BI3A 4XTWA 3PFSA 2PVGB 1Y96A 4C8QF 2CS7A 1R8OB 4C0FA 2NLUA 1KD1C 2DIGA 2HD0A 3E19A 3TCJA 4A4EA 3OSSC 4ZTFA 4UC4A 5KCHA 2XKOC 4M77B 2X4XA 3X28B 1P92A 1QVFA 2EJFA 4C8QC 4NL2A 4EPCA 2OTLT 3P8BB 3FC3A 1KD1U 1OZ2A 1VQLT 1B34B 1HK9A 2ZPIB 2F5TX 3META 3V7CA 2LVMA 3GNFB 4M75B 2E10A 2E6ZA 1JJ2A 5DLOA 4PJOE 4BY6B 2IG0A 2EIFA 2ZPEB 3UWNA 4PJOC 3JCMW 4BDYA 1LOJA 3G7ZA 2L5QA 1W2BA 1IREB 5CAIA 4BUGA 5GAMg 4N4IA 3MO8A 4BB7A 4M7AF 2DVEA 2JTFA 3HPWA 1X01A 2YLCA 3OYCA 4IUTA 3G71T 4P5NA 4LDUA 5KE2A 4KUIA 4OB0B 2PU9B 2R5MA 3MP1A 5LJ3h 1QVGA 4E7LA 3VYHB 3OYKA 2DK3A 2V8KA 4LDVA 2LNVA 4EMKA 1YJNA 2X4JA 2QQ9A 2PUOB 2LTOA 1VQ9T 5D6WA 5I2MA 3JCMh 3WVEB 3E1SA 4M7DD 4XAXB 1BI3A 2D6FA 4M7DG 1MHNA 3E9GA 4F7UG 2ZPHB 3VUZA 1WJSA 3CCUA 2QQSA 3WXMB 3H8ZA 4FT2A 4J6YA 1UGSB 2DTOA 4JLIA 4JRKA 4ME7A 4C92C 3PMTA 4FU6A 5KH6A 3OYMA 3CBPA 2QEXT 2EQKA 4C5GA 3OYFA 2QA4A 3GF5A 5A0GA 4E47A 5FU6B 3OYLA 3OMGA 2LT4A 3I55T 2E6NA 3HL8A 3NFCA 3JCMV 4C0ZA 5KE3A 2MAMA 4PLLA 4A4GA 3CXCS 1D3BB 2E64A 2FYKA 2KVQG 2RI3A 2F5KA 1Q7YU 4ZN1A 3OBYA 1I81A 3VU3C 4QVCA 5GAOq 1K8AC 3JCMc 1W2BS 1X75C 5L8RE 2CZ7B 4PNOA 1YJ9A 4RMOA 4E7IA 2EAYA 3S3NA 2EWNA 3OYEA 2DZCA 5GMKm 1Q82C 1YI2A 5IAYA 4JRPA 1WQ7A 3RESA 3OA6A 1G3SA 3LX7A 4KULA 5A2QE 2ZPFB 2GF7A 5I2SA 2XD0A 1YJNT 2CGHA 3OW2S 4M7DA 2DXUA 4IUVA 5FU6C 5LL6S 2K5LA 3RMQA 3LWHA 1VQ7A 3GPLA 5J39A 1VQ5A 1VIFA 3UDCA 4F7UA 4M77F 4XTYA 3QO3A 4J6WA 4C8QB 2K57A 4Y28E 4NOYA 1VQ4A 3R6OA 3VKIA 3G4ST 3MEWA 5CKEA 1M9SA 3P8HA 4O5VA 2X4WA 1VQKT 2FL7A 3BY7A 3L2UA 2JOYA 3QJYA 4FSXA 5LJ5j 1YI2T 4C92A 5GAOm 3GOXA 2L89A 1U1SA 4Y91A 3CC4T 1YIJT 2L8DA 3LLRA 3M56A 5CK9A 1G3TA 4FL6A 2RJDA 2Y90A 4IUPA 2GCXA 4JS4A 1JBMA 3CD6T 5HY6A 4M75A 4M78E 5I21A 3OS2A 3OYIA 3NTHA 2HNIA 3ZBDA 3HFNA 2C06A 4II1A 3RIRA 3TEEA 3C4SA 3WVDB 4XQ3A 3ZFJA 2YLBA 1FX7A 2P4TA 2HQXA 3EFSA 1Q81U 1YITT 2E70A 4M75E 1I8FA 4N0AC 3CCST 4XTXA 5GANj 3PMIA 4RCBA 2XI9A 3OYBA 1XNIA 3VJPA 3JSCA 1K8AU 3C95A 3M59A 3QDRB 5LJ3j 5FU7B 2LT1A 3ME9A 3A8MB 4JDSA 1BIAA 3X26B 2OAUA 2ZPGB 3RUXA 5GAN3 2RI5A 1Q86C 4J7FA 1KQSS 3G6EA 1SSFA 3JCMP 5D6XA 3CC7A 3CD6A 1KHCA 1WQWA 4R55A 2Y4YA 4X9CA 1G3YA 4F7UE 1S72T 4N0AA 2JZ2A 4M7DC 1KC8U 2XK0A 3CBOA 5C0MA 4PL6A 3FJPA 1DJ7B 5LJ5f 1AHJB 4J7IA 4LD9K 5GAN7 4WF2A 2O4XA 3MEVA 4OP0A 4KBMB 1OI1A 4B9WA 4C92D 4C92G 1KC8C 3LGFA 1OZ3A 2LRQA 2KDSA 2H3JA 3I55A 3L2RA 2QI2A 4IKFA 2EQUA 3PIPA 4J83A 4M75G 2YHTA 4M75D 1VQ6A 1MGQA 3FEOA 5CQXA 2PVOB 4PLIA 3SDZA 3JCMJ 1VQPA 4A4FA 2JTMA 2EFIA 4BE1A 3CCVA 5GAN5 3CPWA 3UPUA 2ZZDA 1U8RA 3MEAA 3FDRA 2MWOA 2BUDA 4LDWA 2GFAA 3TREA 5GAMf 1B34A 3EAEA 3L1AA 2XDPA 1UGQB 5CR2A 2E41A 2RJFA 3LW5E 1BI2A 3KBGA 4J8OA 3RKWA 1VQNA 1WJQA 5D6YA 3FB9A 4FT4A 3A8GB 1Q7YC 2LQ8A 5IN1A 4M7DE 3CPFA 1G5VA 3OBWA 2R5AA 3CCJA 3CCRT 3BDLA 3V8KA 5LJ3f 1M1GA 5LJ3d 5GMKe 3S3MA 2KAFA 5HK0A 5GAN8 1M8VA 2VV5A 3CEYA 3JCMf 2DEQA 3LWIA 3DB3A 3G71A 3OYGA 3OYAA 4E7HA 3JB9J 4GLKA 2YRVA 1VQ8T 3CCMT 3V7RA 3OS5A 3C12A 2FVUA 2D9TA 4EMKB 4A4KA 1Y96B 3TU4K 2WSEE 4M7AG 5CKBA 4OGCA 2XDDA 1NJIU 4M7AD 1GXIE 2MF2A 2DO3A 5C6SA 4IURA 3ER0A 5GAMj 2AHJB 4E7KA 2MWPA 4JRIA 5GAMe 4CI0C 2OTLA 3M5AA 4V2SA 3CCJT 3CCRA 3OYYA 3CCET 3NTKA 2G3RA 3CCLA 5EG2A 2XDBA 1NJIC 1Y71A 3OB9A 4MZPA 4XU2A 3J81E 3L2ZA 4YTLA 2RI2A 3QJ6A 4QQ6A 3HRUA 5CKFA 4O6JA 4D6WA 2DAQA 3CPWS 1VQ8A 3I56T 3CCSA 4LD6A 1UGRB 1LNXA 4X9DA 3PTAA 1NZ9A 4ZGDB 4HKEA 2K3YA 3M9QA 4Q5WA 2QDYB 1S72A 3URGA 5J3BA 2EQMA 3CCQT 3QBYA 4OF1A 2VYTA 5HKCA 3PT9A 2LX9A 3QZ5B 3A5ZB 5J26A 1VQMA 3X24B 1UGPB 2IVWA 2K2VA 5LJ5h 1M90C 4BI4A 1I4K1 4BY6C 4PJOB 2OTJT 3QKJA 1BYMA 3MHXA 4JJNK 3A8OB 4BE2A 5GANg 3RKXA 1JB0E 4ELYC 1Q86U 4M7AA 3HKSA 1N6AA 3CCUT 2M16A 2ZGWA 3JB9I 3CMAT 1KG1A 4M7DB 2BKDN 1H3ZA 5GAOn 3T9NA 4M77C 4C0DC 3RERA 1WJRA 1N8RC 2DPPB 2CZ1B 4JS5A 3CC2A 4XK8E 4HCCA 3SWNA 2DXTA 5AYFA 2K4YA 1VQMT 2RHXA 4HT9A 2HQEA 4VUBA 3MEUA 3CCLT 2ZPBB 3N5BB 4XTUA 5LJ3g 1V29B 4M78F 2WACA 3CXCA 2E65A 5CVIA 4Z02A 3JCMQ 3ZEHA 1VUBA 4CRIA 1VQKA 2Y4XA 1EIFA 2VUBA 1QP3A 4NL3A 4EMGA 2DTIA 1PSFA 3G4SA 5DY9A 3OY9A 4C92F 3QSUA 2QQRA 5GANe 3O8VA 4MZTA 4FM4B 2VGNA 1YJWA 2CYZB 4QW2A 2VXFA 1Q81C 3JB9F 2BIVA 1BI0A 1YITA 3FLGA 5DLQE 3QG1A 2I2LA 4M7AC 2M1HA 4M77A 4C0DB 4F7UF 1G3WA 1RI0A 4M78D 4M78G 3CCVT 3S3OA 1N8RU 1Y7XA 4MDWA 4TVRA 4F7UB 3GIBA 3JCMg 3X20B 1O9SA 2O01E 5LJ5e 4JUVA 1VQLA 3CMET 2KMTA 2EKOA 1JJ2S 3G6ET 2QXFA 2RHIA 4N4HA 3QYHB 2GQVA 1KHIA 2A3LA 5CQYA 3HP9A 3V8JA 3VV0A 4ZGJB 3CBMA 4IUQA 3KXTA 2RK2A 2R57A 3UT1A 4A54A 4XTVA 2XICA 5GMKh 1YIJA 4C92B 4L59A 3PGGA 1N27A 2M0OA 3OYNA 3CC2T 5FU7C 3M54A 4EMHA 4A53A 4C92E 1JRIA 1FXXA 3DKMA 4C5EA 2JN0A 4QQDA 3BW1A 4BE0A 1QVGS 4M75C 4QVDA 4KUDK 1QVFS 1NE8A 4DQ2A 3AHUA 5GAMd 2RH2A 1BIBA 3CCMA 1M1KC 2DZ9A 1QW1A 2EYQA 1WGSA 4OB3B 3M58A 3Q1JA 4C5HA 5A0LA 4PKCC 3OYHA 3C94A 2E12A 4FIBA 3FIFA 4LDYA 3VYGA 5GANd 3M53A 2PQWA 2MMPA 3VUBA 2PVDB 2X4YA 4LDXA 4M7DF 3S6WA 5LJ5d 2DXBA 1VQ6T 4M77D 4M77G 2DD4A 2JNGA 2LCLA 4C8QE 4M78A 2DD5A 2K5FA 1VQ4T 4OB1B 1KQSA 3CC7T 3MCAB 4C0GA 1Y07A 3M4GA 4XU1A 3L2QA 1XQHA 1K9MC 2RHUA 2CKKA 1PSEA 2K5IA 1I5LA 4NS5A 3V8LA 2EJGA 5LJ3e 1UEBA 5FLXE 1M5Q1 1D3BA 2EJ9A 3HFOA 4A4HA 3EFRA 1M90U 3HSBA 4HCBA 2B8AA 5FRMA 1K73U 1VQ9A 1ZQ1A 3OMCA 5FROA 2LDMA 3L2VA 4BACA 2XIDA 1QVPA 3DB4A 4X34A 3OS1A 3JB9D 3QIIA 4HCZA 3JB9G 1VQOA 1YHQT 2RM4A 1M1KU 4PJOG 4PJOD 2XG8D 3SFMA 3SWNB 1YJ9T 1K73C 2L3RA 2DXCA 1IZ6A 2CZ6B 2D0QB 3L42A 5GANh 3RMSA 2E5QA 2RB6A 3BFMA 1KQ1A 2KK4A 3V7SA 3OW2A 3HRSA 1NPPA 4RKUE 3GNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  4M77 C;  3SWN C;  3RER A;  3V7C A;  4J5Y A;  3RUX A;  5GAN 3;  4M75 B;  2E10 A;  2VC8 A;  2QTX A;  4PJO E;  5LJ5 g;  4PJO C;  3SWN A;  2DXT A;  3JCM P;  1N9R A;  3JCM W;  1WQW A;  4X9C A;  3JCM b;  1LOJ A;  4F7U E;  4XTU A;  4N0A A;  5LJ3 g;  5CAI A;  4M78 F;  4M7D C;  5GAM g;  2E65 A;  3JCM Q;  4M7A F;  2DVE A;  4EMK C;  3FJP A;  1X01 A;  2YLC A;  5LJ5 f;  4NL3 A;  4EMG A;  2DTI A;  5DY9 A;  3QHS A;  5GAN 6;  5GAN 7;  1N9S A;  4WF2 A;  5LJ3 h;  4OP0 A;  4C92 F;  4C92 D;  4C92 G;  5GAN e;  3JCM X;  3QSU A;  4J6X A;  4EMK A;  2VXF A;  3JB9 F;  4M75 G;  4M75 D;  2YHT A;  4PJO A;  1H64 1;  1MGQ A;  3JCM h;  3JCM J;  4M7D D;  4M7D G;  5GAN 5;  2I2L A;  4M7A C;  4HT8 A;  4M77 A;  4F7U G;  4F7U F;  4M78 D;  4M78 G;  4XU0 A;  3GIB A;  4F7U B;  5GAM f;  5GMK h;  3JCM g;  3INZ A;  4J6Y A;  4JLI A;  1B34 A;  3L1A A;  2DTO A;  4JRK A;  4JUV A;  4C92 C;  5LJ5 e;  2E41 A;  5GAN 4;  3RKW A;  4C8Q A;  1HXD A;  3FB9 A;  4XTZ A;  3V8J A;  4M7D E;  3JCM V;  4RCC A;  4A54 A;  3V8K A;  1D3B B;  2E64 A;  2FYK A;  4M77 E;  4XTV A;  5LJ3 f;  1LJO A;  3SB2 A;  3PGG A;  5LJ3 d;  4C92 B;  5GMK e;  3JCM d;  5GAN 8;  1M8V A;  4EMH A;  3JCM f;  2DEQ A;  4A53 A;  1I81 A;  4C92 E;  1JRI A;  2VXE A;  3VU3 C;  2JN0 A;  4QVC A;  2E1H A;  3BW1 A;  4HA8 A;  5GAO q;  1YCY A;  3JCM c;  3JB9 J;  4M75 C;  4QVD A;  4M78 B;  4DQ2 A;  2FB7 A;  3AHU A;  1TH7 A;  4PNO A;  3V7R A;  5GAM d;  2EAY A;  4EMK B;  2EWN A;  1BIB A;  1Y96 B;  2DZC A;  2DZ9 A;  5GMK m;  4M7A G;  4M7A D;  1KQ2 A;  5GAO l;  1WQ7 A;  4MML A;  3RES A;  4M7A B;  3FIF A;  5GAM j;  5GAM e;  1U1T A;  4JRI A;  5GAN d;  4V2S A;  2DJZ A;  2CGH A;  4M7D A;  2DXU A;  4M78 C;  4M7D F;  3JCM e;  5LJ5 d;  2DTH A;  4M77 D;  4M77 G;  4XU2 A;  4M77 F;  4XTY A;  4F7U A;  3QO3 A;  4C8Q E;  4M78 A;  4J6W A;  3L2Z A;  4M75 F;  3QUI A;  2RA2 A;  3M4G A;  4XU1 A;  4C8Q B;  2K57 A;  4HT9 A;  4PJO F;  4NOY A;  1WNL A;  5GAO r;  4MMK A;  3BDU A;  4C8Q D;  1LNX A;  4C8Q G;  4X9D A;  1I5L A;  5GMK j;  3V8L A;  2EJG A;  3BY7 A;  5LJ3 e;  1M5Q 1;  1D3B A;  2EJ9 A;  3HFO A;  5LJ5 j;  4M7A E;  4C92 A;  3EFR A;  5GAO m;  3HSB A;  1U1S A;  4Y91 A;  5GMK l;  1WPY A;  5GAO p;  5GAN 2;  3JB9 H;  2DKG A;  5GAM h;  2Y90 A;  4XU3 A;  5GMK i;  1JBM A;  5GAN f;  3JB9 D;  3JB9 G;  4M75 A;  4M78 E;  5I21 A;  2RM4 A;  5LJ5 h;  4PJO G;  4PJO D;  2HNI A;  3HFN A;  2RD1 A;  3RIR A;  3SWN B;  1I4K 1;  4XTW A;  4XQ3 A;  2YLB A;  1Y96 A;  3EFS A;  4C8Q F;  4PJO B;  4M75 E;  4N0A C;  1I8F A;  5GAN g;  4XTX A;  3RKX A;  5GAN j;  4RCB A;  5GAN h;  4M77 B;  4M7A A;  2RB6 A;  2EJF A;  4C8Q C;  3BFM A;  1KQ1 A;  2ZGW A;  4NL2 A;  3V7S A;  5LJ3 j;  3JB9 I;  4M7D B;  3RKY A;  1BIA A;  5GAO n;  1B34 B; 
#chains in the Genus database with same CATH topology
 2K2M A;  1X6O A;  3X25 B;  2VC8 A;  2AKL A;  4E7J A;  1N9R A;  4A63 B;  3JCM b;  3A8L B;  5GJW B;  1KK7 A;  1UJY A;  3EGX B;  4DOW A;  3NHN A;  1M90 R;  4EDU A;  3TSW A;  1M3B A;  1ABQ A;  4ORZ A;  3HRT A;  1LPL A;  3DLM A;  1YJW T;  2HZY A;  1XOV A;  2RHZ A;  3D7S B;  3LH0 A;  1Q82 U;  1YI2 Q;  2WSF E;  1B7T A;  2HKQ B;  3INZ A;  9ATC B;  5IH2 A;  1C6V X;  1TUC A;  1HXD A;  2CZ0 B;  4J9I A;  1ZSG A;  4RCC A;  4M77 E;  1ZBX A;  2P0P A;  4L5G A;  2GFU A;  1M1K R;  2K3X A;  1K4U S;  2JS2 A;  2BTT A;  5FRN A;  4PJJ A;  2QQA A;  2M9U A;  5CIU A;  3LYI A;  1O75 A;  1SF9 A;  2X35 A;  2ZCF B;  1U1T A;  3GP8 A;  1VQ5 T;  4IIO A;  2AZS A;  5CCA A;  1KSW A;  1NPR A;  4WTO B;  1H3H A;  4M75 F;  3OYJ A;  4MMK A;  4J9B A;  2HBP A;  1V76 A;  5KCO A;  4OMF B;  1NLP C;  1CSK A;  2P0Q A;  3CC7 Q;  1QWE A;  3VS5 A;  3FRN A;  3OW2 P;  2MI6 A;  4LE9 A;  3CCR Q;  1C1A A;  1SKU B;  5GAM h;  4XU3 A;  3GLX A;  4JLG A;  1VQ7 T;  1KQS P;  1FMK A;  2DRK A;  2DF6 A;  2RD1 A;  3PFS A;  1E7O A;  1MV0 B;  2CS7 A;  1R8O B;  4UC4 A;  1CKB A;  3X28 B;  1P92 A;  1UEC A;  2DYB A;  4OMN A;  4EPC A;  2OTL T;  3P8B B;  1KD1 U;  2LP5 A;  1VQL T;  1HK9 A;  3GNF B;  4M75 B;  2YUN A;  3VS4 A;  3RNJ A;  4JZ4 A;  4PJO E;  4PJO C;  2GBQ A;  1QCF A;  3G7Z A;  2L5Q A;  5GAM g;  3VS3 A;  4K11 A;  2DVE A;  1X01 A;  4IUT A;  3G71 T;  4LDU A;  1HSQ A;  1QMC A;  1QVG A;  2YXY A;  3OYK A;  2LNV A;  1RAD B;  2X4J A;  1Z9Q A;  2PUO B;  1YCS B;  5KYU B;  4XAX B;  2D6F A;  3VRY A;  4AFS C;  3MKD A;  4ANJ A;  2BE9 B;  3OYM A;  1R0B G;  4OMO A;  3GF5 A;  3OYL A;  3OMG A;  4AG2 C;  5KE3 A;  2F5K A;  1IHV A;  4ZN1 A;  3OBY A;  3VU3 C;  3UA6 A;  1T0J A;  3JCM c;  2EWN A;  4KH1 B;  3VS0 A;  5KYY A;  1G3S A;  2FO0 A;  5A2Q E;  5I2S A;  3LWH A;  5FU6 C;  2K5L A;  2HDA A;  2PZ1 A;  4C8Q B;  2K57 A;  2DNU A;  3EFO B;  3G4S T;  3MEW A;  5CKE A;  3VRZ A;  2X4W A;  1TUG B;  2QDL A;  3BY7 A;  4JZ3 A;  2JOY A;  4HXJ A;  3GOX A;  4FL6 A;  2VKN A;  2Y90 A;  4IUP A;  2H3E B;  1JBM A;  1VQL Q;  3CD6 T;  4M75 A;  3OYI A;  2HNI A;  3ZBD A;  3ZFJ A;  2E70 A;  4N0A C;  1I8F A;  2XI9 A;  4CC7 A;  3JSC A;  3C95 A;  2LT1 A;  3A8M B;  3X26 B;  2OAU A;  1SRL A;  1OU8 A;  1Q86 C;  1SSF A;  4R55 A;  2Y4Y A;  5FW9 A;  2KNB B;  4PL6 A;  2MCN A;  1DJ7 B;  2O4X A;  1X6G A;  2LRQ A;  3O5Z A;  1SPK A;  2QI2 A;  4M75 G;  4Y92 A;  1SRM A;  1MGQ A;  3EGD B;  2PVO B;  2FRY A;  4PLI A;  2EFI A;  3UPU A;  3CCV A;  5GAN 5;  2O9V A;  3I9Q A;  1QKX A;  3EAE A;  3CCM Q;  2XDP A;  4AFQ C;  2RJF A;  3LW5 E;  1WJQ A;  2W10 A;  5D6Y A;  1VOM A;  2COW A;  1K1Z A;  3A8G B;  1ZUY A;  4M7D E;  3IQL A;  3CCR T;  5LJ3 f;  1M8V A;  5HK0 A;  5GAN 8;  2KE9 A;  2DX1 A;  2DEQ A;  3DB3 A;  4JJB A;  3OYA A;  1OEB A;  2YRV A;  2FVU A;  2D9T A;  4EMK B;  4A4K A;  2WSE E;  4M7A D;  4E7K A;  5GAM e;  1OPL A;  3CD6 Q;  3NTK A;  3CCL A;  2QTV A;  1ZUU A;  1QWF A;  3OB9 A;  4FYV B;  4RTX A;  3L2Z A;  4QQ6 A;  5CKF A;  3HRU A;  3CPW S;  1VQ8 A;  1VQ8 Q;  1M2O A;  1X2Q A;  4X9D A;  2HL3 A;  4DBF A;  2K3Y A;  2FPF A;  3URG A;  2EQM A;  2VYT A;  2FPE A;  1VQ6 Q;  2E5K A;  1UGP B;  1VQ7 Q;  1TSF A;  4BY6 C;  2DL4 A;  2QAZ A;  2FG0 A;  5GAN g;  1S1N A;  1YHQ Q;  1ZBJ A;  2CT3 A;  2DPP B;  4ESR A;  2YWW A;  4XK8 E;  1IGQ A;  3C0C A;  3N5B B;  4XTU A;  1V29 B;  2NWM A;  3JCM Q;  1VQK A;  4NL3 A;  1QP3 A;  3G4S A;  1JJ2 P;  3QWX X;  2E3H A;  3QSU A;  2YT6 A;  4FM4 B;  2PNI A;  4QW2 A;  4KGX B;  1Q81 C;  2AIR B;  4LNP A;  3FLG A;  2M1H A;  1Q86 R;  3TVT A;  1G3W A;  4M78 D;  3CCV T;  2P84 A;  4MDW A;  3M0S A;  3X20 B;  1O9S A;  2O01 E;  4JUV A;  3CME T;  1PG5 B;  2OJ2 A;  3G6E T;  2QXF A;  1QVG P;  4N4H A;  5CQY A;  1KHI A;  2HCK A;  2RPN A;  4A54 A;  5GMK h;  5EC7 A;  1RAI B;  4Z88 A;  3CC2 T;  3THK A;  1JRI A;  3DKM A;  3M0P A;  1YJW Q;  1QVF S;  1X2K A;  4KUD K;  1WXU A;  1NE8 A;  1S72 Q;  3U23 A;  2RH2 A;  4PJL A;  3NGP A;  1BIB A;  1BCM A;  2DZ9 A;  1WGS A;  3Q1J A;  4PKC C;  2EGE A;  3M53 A;  2MMP A;  2X4Y A;  3S6W A;  2LCL A;  2C0T A;  4M78 A;  2DD5 A;  1ZSZ C;  2K5F A;  1JXM A;  2DLP A;  3A98 A;  1YJ9 Q;  1K9M C;  4EIK A;  5KYW B;  2V1R A;  3V8L A;  1UEB A;  1M5Q 1;  2EJ9 A;  1M90 U;  4HCB A;  1D0Z A;  3OMC A;  2LDM A;  3L2V A;  3OS1 A;  1VQO A;  4HCZ A;  4PJO D;  3EHQ A;  1RAB B;  1YJ9 T;  2J6O A;  2L3R A;  1T0H A;  2DA9 A;  2D0Q B;  2ED1 A;  5KYY B;  2RB6 A;  3BFM A;  1YJN Q;  1IB8 A;  1OPK A;  2D8J A;  1KFZ A;  3REA B;  2JUF A;  3P8D A;  4X1V A;  2AKK A;  4DA4 A;  3QXE B;  2PUK B;  4BD3 A;  1C0M A;  4R56 A;  1RLP C;  2KXC A;  2KXD A;  3MP8 A;  1QVF P;  2XHC A;  5DM7 R;  3G6E Q;  2KQW A;  2YUP A;  3F70 A;  4ATO A;  2WSC E;  2E4H A;  1UB4 A;  1ZA1 B;  1YHQ A;  2RK1 A;  1E6H A;  3QPH A;  1FMW A;  1RL2 A;  4BDZ A;  1VQN T;  1VQK Q;  2HEQ A;  2QEX Q;  5GAN 4;  2NYS A;  3JRZ A;  3SD4 A;  3CMA A;  1UHC A;  3QYG B;  4OML A;  3CCQ A;  3SB2 A;  1YWO A;  3JCM d;  4OB2 B;  4MZM A;  1Y57 A;  3NTI A;  1VA7 A;  2F69 A;  2E1H A;  4ELZ C;  2RHY A;  4M78 B;  1ZHI A;  2B86 A;  1I0C A;  2RJC A;  5KYW A;  2VGM A;  4RG2 A;  5CKH A;  4M78 C;  1K9M U;  2EYX A;  1NG2 A;  2Z0W A;  2DTH A;  1TXQ A;  3PNW C;  1QP2 A;  2OI3 A;  5IHK A;  5CKD A;  1HYO A;  1WNL A;  4KT0 E;  2JMC A;  4C8Q D;  2NUT A;  1YWP A;  4FYW B;  4MDX A;  1NYF A;  3CME A;  2CUD A;  4L6V 5;  1G83 A;  2DE0 X;  4M7A E;  3TQ7 P;  5GMK l;  1WPY A;  3JB9 H;  2DKG A;  3MP6 A;  2R58 A;  5GMK i;  4F16 A;  5AT1 B;  4GY5 A;  4BI3 A;  2DER A;  1GCP A;  1X43 A;  4C8Q F;  1NPP A;  4ZTF A;  2XKO C;  1KC8 R;  4FYX B;  1NM7 A;  2JM9 A;  3I56 Q;  1B34 B;  3V7C A;  4GBQ A;  2E6Z A;  2ZPE B;  4LXC A;  3UWN A;  2SRC A;  1LOJ A;  1W2B A;  2KRO A;  3MO8 A;  2JTF A;  1D0Y A;  5KYN A;  2F1L A;  3OYC A;  5KE2 A;  2JTE A;  4KUI A;  3MP1 A;  3A1P A;  1VQ9 T;  5I2M A;  2LNH B;  4M7D D;  3E9G A;  2RN8 A;  3PVL A;  1RAA B;  1WJS A;  4AFZ C;  2KR3 A;  3H8Z A;  4FT2 A;  4JLI A;  1PRM C;  1UGS B;  4C92 C;  3UF4 A;  5KH6 A;  3OYF A;  3I55 T;  2E6N A;  3HL8 A;  3CCL Q;  1M3C A;  4C0Z A;  4A4G A;  2BZ8 A;  2FYK A;  1Q7Y U;  2PTK A;  2RF0 A;  2CZ7 B;  2L3P A;  2EAY A;  1IXD A;  1W1F A;  1WQ7 A;  3RES A;  2AT1 B;  3LX7 A;  4KUL A;  1JO8 A;  1U06 A;  4M7D A;  4IUV A;  3I35 A;  1WXT A;  1WIE A;  4O5V A;  6AT1 B;  2FL7 A;  2DYI A;  3L2U A;  3I5R A;  2KRS A;  3H0F A;  5GAO m;  1YIJ T;  1U1S A;  2L8D A;  3JV3 A;  1G3T A;  3CCE Q;  1UTI A;  3CCJ Q;  5HY6 A;  4M78 E;  5I21 A;  3NTH A;  2LJ0 A;  2C06 A;  3WVD B;  2FZK B;  1FX7 A;  3EFS A;  2P4T A;  2HQX A;  1T3L A;  2JMA A;  4J9D A;  5GAN j;  1K8A U;  3M59 A;  3QDR B;  5LJ3 j;  1QCN A;  3ME9 A;  1BIA A;  5GAN 3;  1ARK A;  2RI5 A;  3G6E A;  2LMJ A;  3CC7 A;  1KHC A;  4X9C A;  4F7U E;  3VS7 A;  2COY A;  1GCQ C;  2KI7 A;  5LJ5 f;  2EVR A;  1F1B B;  1AHJ B;  4J7I A;  1KIK A;  5GAN 7;  4C92 D;  1GBQ A;  2P4R A;  1N8R R;  5IHN A;  1RI9 A;  2EQU A;  4J83 A;  1VQ5 Q;  3FEO A;  1K8A C;  2EKH A;  4BE1 A;  1OUL A;  2YRC A;  3FDR A;  4Z8A A;  2FPD A;  4LUD A;  4J8O A;  3KBG A;  3FB9 A;  2BZY A;  2ZAE A;  2DJQ A;  5IN1 A;  3CPF A;  1G5V A;  3CCJ A;  4CC2 A;  5LJ3 d;  3S3M A;  2VV5 A;  4GLM A;  3OYG A;  1WYX A;  3JB9 J;  3CCM T;  2LJ3 A;  2J6K A;  5CKB A;  4OGC A;  2XDD A;  1NJI U;  1GXI E;  2MF2 A;  2K6D A;  2DO3 A;  2RQT A;  2DMO A;  1NBE B;  2MWP A;  2O2O A;  4CI0 C;  1UFF A;  1G2B A;  3CCJ T;  2BE7 D;  5EG2 A;  3CPW P;  3J81 E;  3PE0 A;  2L3S A;  4FW1 A;  2GNC A;  4O6J A;  2DAQ A;  1JXO A;  3I56 T;  3CCS A;  1UGR B;  4E7S A;  1WZO A;  4HKE A;  2FZG B;  2QDY B;  1UHF A;  5I22 A;  5J3B A;  1YP5 A;  2DM1 A;  3QBY A;  1UE9 A;  3ZL7 C;  1JEG A;  3QZ5 B;  2JM8 A;  4LUE A;  3SEM A;  1VQM A;  1I4K 1;  4PJO B;  2OTJ T;  1GL5 A;  2LX7 A;  2YSQ A;  2ZGW A;  1AWX A;  2KBT A;  1N8R C;  2CZ1 B;  4JJC A;  2J6F A;  4JS5 A;  3CC2 Q;  3CC2 A;  3SWN A;  1VQM T;  2K4Y A;  2RHX A;  2HQE A;  4DBR A;  2NUT B;  2E65 A;  5CVI A;  1K0X A;  2QGG A;  3CMA Q;  2Y4X A;  1EIF A;  4E6R A;  3CCU Q;  2DTI A;  5DY9 A;  3OY9 A;  2VVK A;  2J7I A;  1NJI R;  2X9H A;  2K7A A;  1X6B A;  2VXF A;  1MMD A;  2OX7 A;  2IIM A;  2A0F B;  2JS0 A;  1I1J A;  1M3A A;  3H0I A;  4LN2 A;  5DLQ E;  4M7A C;  4C0D B;  3S3O A;  3GIB A;  4F7U B;  2QG9 B;  2DL7 A;  4D8D A;  2DVJ A;  2ATC B;  2RHI A;  4IUQ A;  4FSS A;  1X27 A;  4L59 A;  3OYN A;  3M54 A;  1FXX A;  2JN0 A;  4QQD A;  3BW1 A;  3NPF A;  2NUP A;  1M1K C;  3CCM A;  1QW1 A;  3AT1 B;  2KGT A;  1ACM B;  3C94 A;  4LDY A;  2JJ9 A;  2PQW A;  4LDX A;  4M77 G;  3M0Q A;  1M8M A;  4OB1 B;  2CT4 A;  4XU1 A;  3L2Q A;  3G71 Q;  2ROL A;  1MV3 A;  1BU1 A;  2DBK A;  5FWC A;  2ECZ A;  3HFO A;  4OMQ A;  3EG3 A;  4A4H A;  3HSB A;  1WHK A;  3DB4 A;  1YHQ T;  3JB9 D;  2RM4 A;  3SWN B;  1GFD A;  4M4Z A;  2CP6 A;  1H8K A;  3L42 A;  1AVZ C;  2KK4 A;  2VAS A;  3OW2 A;  3SWN C;  4N4G A;  4J5Y A;  7AT1 B;  4QVZ A;  2QTX A;  1GFC A;  2SEM A;  1BI1 A;  4KH0 B;  4OGE A;  4AT1 B;  4D8K A;  5LJ5 g;  2GTO A;  3KFV A;  1D1C A;  4EMK C;  2XU8 A;  3LGL A;  5IT9 E;  1M2V B;  3JAM E;  1SG5 A;  1R0C B;  3EGU A;  1K0S A;  4OMP A;  4J6X A;  1B3Q A;  3M57 A;  4RTW A;  4AG1 C;  1MND A;  1VQO T;  2P0K A;  4ZGE B;  2KSS A;  4XU0 A;  2QEX A;  1PKT A;  4OVA A;  2FHD A;  3H0H A;  2GQI A;  3G4S Q;  1RAH B;  2NUP B;  4XTZ A;  3NMZ C;  1K73 R;  1M1F A;  4RG8 A;  2LQN A;  2DIQ A;  4BI8 B;  3RBB B;  1QLY A;  1K76 A;  1BK2 A;  3KUF A;  4DOV A;  3PIO A;  2KY9 A;  2FB7 A;  1TH7 A;  1NLO C;  2LCC A;  4E7Z A;  2LC4 A;  3HTR A;  5GAO l;  2V8J A;  4MML A;  4M7A B;  3CCE A;  3E2U A;  3BE3 A;  3OYD A;  3JCM e;  2MK5 A;  1SHF A;  2LZ6 B;  1M30 A;  2RA2 A;  3HHT B;  2RO0 A;  4ZTJ A;  1YBY A;  3CXC P;  2DL3 A;  3BDU A;  3J80 E;  3E9F A;  2JVV A;  5GMK j;  2C0I A;  5M9O A;  5GAO p;  1PWT A;  5GAN 2;  2A08 A;  1VIE A;  2OTJ A;  4XTW A;  2PVG B;  1QCO A;  1PD1 A;  2HD0 A;  1WHJ A;  3E19 A;  1B07 A;  3TCJ A;  4A4E A;  3VS2 A;  2X4X A;  1QVF A;  4C8Q C;  1D09 B;  2ZPI B;  2F5T X;  2E10 A;  1BCO A;  3JCM W;  1I5O B;  1RAE B;  4BDY A;  2ENM A;  1IRE B;  2L0A A;  4BUG A;  1SSH A;  4M7A F;  2YLC A;  2EW3 A;  4P5N A;  2R5M A;  5LJ3 h;  3R6N A;  3VYH B;  2OTJ Q;  2V8K A;  4LDV A;  1YJN A;  4KRT A;  2QQ9 A;  2LTO A;  5D6W A;  3JCM h;  3WVE B;  3M0T A;  1BI3 A;  1MHN A;  4F7U G;  1TWB A;  1W2B P;  4PFP A;  3VUZ A;  4AMC A;  3WXM B;  4JRK A;  4ME7 A;  1VQO Q;  4J9C A;  3PMT A;  2QEX T;  2EQK A;  2QA4 A;  5A0G A;  4E47 A;  2LT4 A;  3NFC A;  2MAM A;  1D3B B;  3M0U A;  1UGV A;  4E2F B;  1AWW A;  1QQJ A;  1I81 A;  4QVC A;  1BBZ A;  4PNO A;  1YJ9 A;  3S3N A;  3OYE A;  5GMK m;  1YI2 A;  5IAY A;  2ZPF B;  2CGH A;  3OW2 S;  1Q82 R;  2DXU A;  1D1A A;  5LL6 S;  3RMQ A;  2DEU A;  3GPL A;  1VQ5 A;  3UDC A;  4F7U A;  1OX9 A;  4M77 F;  4XTY A;  2A37 A;  4J6W A;  4Y28 E;  2ESW A;  3R6O A;  1M9S A;  3P8H A;  3EH2 A;  4KGV B;  2VB6 A;  1OV3 A;  2EYZ A;  1A0N B;  1YI2 T;  1MUZ A;  1YN8 A;  3FJ5 A;  2L89 A;  3CC4 T;  4F04 B;  3LLR A;  3M56 A;  2RQW A;  4JJD A;  2GCX A;  1GBR A;  5ECA A;  1ZLM A;  3HFN A;  3EH1 A;  3RIR A;  1PC0 A;  2O9S A;  1RAC B;  2YLB A;  1NEB A;  2J06 A;  1AT1 B;  4M75 E;  3CCS T;  1ZA2 B;  4XTX A;  5KYX A;  3PMI A;  3OYB A;  1XNI A;  1BB9 A;  1XJW B;  3SHW A;  3VJP A;  5FU7 B;  2A28 A;  1WLP B;  3RUX A;  2RQV A;  1EX4 A;  5D6X A;  3CD6 A;  2FZC B;  1G3Y A;  2JZ2 A;  1KC8 U;  2XK0 A;  3CBO A;  5C0M A;  5I11 A;  4DEY A;  4LD9 K;  4PFO A;  1SEM A;  4B9W A;  4KBM B;  2RMO A;  1HD3 A;  3I55 A;  4IKF A;  4M75 D;  2ED0 A;  1VQP Q;  2W0Z A;  3SDZ A;  3JCM J;  1VQP A;  2XD0 A;  1AWO A;  1WHM A;  2COZ A;  3CPW A;  2MIO A;  2GFA A;  5GAM f;  1B34 A;  1UGQ B;  5CR2 A;  2E41 A;  1VQN A;  2EYW A;  4FT4 A;  2R5A A;  2F2W A;  2CP5 A;  3V8K A;  1M1G A;  2VWF A;  2KAF A;  1M2V A;  2OAW A;  4GLK A;  1VQ8 T;  3V7R A;  5L23 A;  2KT1 A;  1X69 A;  1Y96 B;  3TU4 K;  4M7A G;  1JQQ A;  2DET A;  1VYV A;  1IRX A;  3PVQ A;  3EG9 A;  3VS1 A;  4V2S A;  1Q95 G;  4J9E A;  3CCR A;  3OYY A;  2G3R A;  1NJI C;  3CC4 Q;  2ABL A;  2RI2 A;  2CSI A;  3QJ6 A;  1KJW A;  5HCK A;  2CP7 A;  3PTA A;  1NZ9 A;  1AZG B;  1MNE A;  2RNA A;  5HKC A;  1AEY A;  2LX9 A;  3A5Z B;  4DEX A;  5J26 A;  1T3S A;  4RTT A;  1OOT A;  5LJ5 h;  2IVW A;  1M90 C;  4BI4 A;  4DBH A;  1TS9 A;  1GCQ A;  3M0R A;  3QKJ A;  4JJN K;  3A8O B;  3RKX A;  2EPD A;  2FRW A;  4J9H A;  1Q86 U;  3HKS A;  4M7A A;  3CCU T;  1WXB A;  2X51 A;  3JB9 I;  3CMA T;  1KG1 A;  4M7D B;  2BKD N;  4C0D C;  1AD5 A;  1UDL A;  1WJR A;  1AOJ A;  1JU5 C;  5IHI A;  4HCC A;  2DXT A;  5AYF A;  3MEU A;  4RTV A;  2WAC A;  3CXC A;  2KYB A;  3ZEH A;  2LCS A;  4CRI A;  5IXB A;  2VUB A;  4EMG A;  4F14 A;  3UA7 A;  4C92 F;  2QQR A;  4MZT A;  1H92 A;  1R77 A;  1LCK A;  2BIV A;  1SHG A;  2L2P A;  1BI0 A;  1YIT A;  1HJD A;  2I2L A;  1AZE A;  2X3X D;  2QGF B;  4M78 G;  4FCY A;  4TVR A;  3JCM g;  1VQL A;  2CH4 A;  3V8J A;  3QYH B;  2GQV A;  2A3L A;  3HP9 A;  1I07 A;  3CBM A;  3I55 Q;  2RK2 A;  2R57 A;  4XTV A;  2XIC A;  1WA7 A;  1YIJ A;  4C92 B;  3EG9 B;  2YDL A;  5FU7 C;  4A53 A;  4BE0 A;  1QVG S;  4DQ2 A;  3AHU A;  2EYQ A;  3M58 A;  1WFW A;  1UG1 A;  1K9A A;  3VYG A;  2M51 A;  3VUB A;  1Q7Y R;  2YRD A;  4M7D F;  8ATC B;  2DXB A;  2JNG A;  4C8Q E;  1KQS A;  3CC7 T;  4C0G A;  1YFN A;  1ZUK A;  1XQH A;  2JW4 A;  2CKK A;  1PSE A;  2K5I A;  4NS5 A;  5LJ3 e;  5FLX E;  1D3B A;  3EFR A;  3EG2 A;  2B8A A;  5FRM A;  2D8H A;  1K73 U;  1ZQ1 A;  5FRO A;  1VQ9 A;  4BAC A;  2O88 A;  2XID A;  1QVP A;  3QII A;  4PJO G;  2XG8 D;  2QK0 A;  1WX6 A;  5KYU A;  4JPB W;  2DXC A;  3QWY A;  1PM3 A;  5GAN h;  3RMS A;  1G8X A;  4RTY A;  3HRS A;  3MPU B;  3ASK A;  4FW2 A;  3TSZ A;  2RJE A;  2MYS A;  3DLL A;  2HAX A;  3I56 A;  2HSE B;  3A8H B;  2LJ1 A;  2V8I A;  1J3T A;  3M55 A;  4AFU C;  4QKU A;  3QHS A;  5GAN 6;  2HL5 C;  3CC4 A;  1N9S A;  4ZN3 A;  3JCM X;  1YIT Q;  3OS0 A;  5D7U A;  1BKB A;  3EGX A;  1RUW A;  4PJO A;  1H64 1;  1ZSZ B;  5A0D A;  5KYX B;  4HT8 A;  4WCI A;  4PJN A;  1FWZ A;  2DL8 A;  2CH4 W;  4QQG A;  5CO7 A;  4C8Q A;  3L2W A;  3EFO A;  2A7Y A;  2X3W D;  2EQJ A;  2K79 A;  3CCQ Q;  1LJO A;  1WHH A;  4IUU A;  2QQB A;  1LVK A;  2VXE A;  3OQ5 A;  4HA8 A;  1YCY A;  2LQK A;  3OSV A;  2YUQ A;  1PHT A;  1M4Z A;  2I0N A;  2BZX A;  1VQN Q;  3CCS Q;  1D1B A;  2H8H A;  4JRQ A;  2QA4 T;  1KQ2 A;  1KD1 R;  1RLQ C;  2DL5 A;  3QZ9 B;  1VQP T;  1VYU A;  1W4S A;  2DJZ A;  4KGZ B;  1U3O A;  1PRL C;  1VQM Q;  4B9X A;  3QUI A;  1ZX6 A;  4ZNX A;  4PJO F;  5GAO r;  3J7A F;  4C5I A;  4C8Q G;  4PFZ A;  1OYX A;  5HK3 A;  2HMA A;  2EGC A;  3CCV Q;  1VQ4 Q;  1Q81 R;  2O4X B;  1XTD A;  5GAN f;  1UUE A;  3H6Z A;  3M4Y A;  1Y96 A;  4C0F A;  1KD1 C;  4Z89 A;  2NLU A;  2DIG A;  3OSS C;  5KCH A;  4M77 B;  2CP3 A;  1PKS A;  2EJF A;  1Y0M A;  4NL2 A;  2EQI A;  3FC3 A;  1VYT A;  1OZ2 A;  3MET A;  4CC4 B;  2LVM A;  3UAT A;  1TTH B;  1JJ2 A;  5DLO A;  4BY6 B;  2IG0 A;  2EIF A;  4QT7 A;  1MMA A;  4RTZ A;  5CAI A;  4N4I A;  4BB7 A;  3HPW A;  2L3Q A;  4OB0 B;  2PU9 B;  4E7L A;  2CDT A;  2DK3 A;  4HVV A;  2DRM A;  4EMK A;  2QAS A;  3E1S A;  4M7D G;  1WI7 A;  2ZPH B;  1NYG A;  3CCU A;  2QQS A;  2D0N A;  4J6Y A;  3EG1 A;  2DTO A;  4FU6 A;  2AZV A;  3CBP A;  4C5G A;  5FU6 B;  3MJX A;  4F17 A;  1EFN A;  4RTU A;  2CSQ A;  3JCM V;  2AK5 A;  4PLL A;  3CXC S;  2A36 A;  2E64 A;  2KVQ G;  1RAG B;  2RI3 A;  5GAO q;  2CP0 A;  1TUD A;  1W2B S;  4HCK A;  1X75 C;  5L8R E;  4RMO A;  4E7I A;  2DZC A;  3EG0 A;  2GTJ A;  1Q82 C;  4JRP A;  3OA6 A;  1TG0 A;  2GF7 A;  1YJN T;  2M0Y A;  1VQ7 A;  5J39 A;  1VIF A;  1IGU A;  4DBQ A;  3QO3 A;  2HBW A;  2JXB A;  1VQ4 A;  4NOY A;  3VKI A;  1VQK T;  2K3B A;  4IIM A;  2EGA A;  3QJY A;  4FSX A;  5FWB A;  3LH5 A;  5LJ5 j;  4C92 A;  4Y91 A;  2CUB A;  5CK9 A;  2RJD A;  2KRM A;  4JS4 A;  3OS2 A;  1QKW A;  1WHL A;  4II1 A;  3TEE A;  2HKN A;  3C4S A;  4XQ3 A;  3GBQ A;  1Q81 U;  1YIT T;  4RCB A;  4JDS A;  1VQ9 Q;  2ZPG B;  2F2V A;  4J7F A;  1KQS S;  3JCM P;  1WQW A;  2HSP A;  8AT1 B;  1S72 T;  4N0A A;  4M7D C;  1UJ0 A;  3FJP A;  1MMG A;  4WF2 A;  3MEV A;  1KC8 C;  4OP0 A;  4C92 G;  1OI1 A;  3LGF A;  1OZ3 A;  1WHG A;  2KDS A;  2DIL A;  2H3J A;  3L2R A;  2DBM A;  3PIP A;  2YHT A;  1RAF B;  1VQ6 A;  5CQX A;  3CQT A;  1S72 A;  2MPX C;  4A4F A;  2JTM A;  1U8R A;  2ZZD A;  1N5Z A;  3MEA A;  2MWO A;  2BUD A;  4LDW A;  1YNZ A;  2GGR A;  3TRE A;  2HQH A;  3L1A A;  4OMM A;  1BI2 A;  3RKW A;  3RR6 A;  2C0O A;  2K9G A;  1Q7Y C;  2LQ8 A;  3OBW A;  3BDL A;  2V26 A;  5GMK e;  3CEY A;  3JCM f;  3LWI A;  3G71 A;  1WDX A;  1Z9Z A;  4E7H A;  2KEA A;  3OS5 A;  3C12 A;  1W70 A;  2FEI A;  2JT4 A;  4B6M A;  2QYZ A;  5C6S A;  4IUR A;  3ER0 A;  1ZSZ A;  5GAM j;  2AHJ B;  3VS6 A;  4JRI A;  4PJM A;  2OTL A;  2KT8 A;  3M5A A;  3CCE T;  2D1X A;  2XDB A;  1Y71 A;  4MZP A;  4XU2 A;  2M02 A;  4YTL A;  4FYY B;  1PD0 A;  4HT9 A;  4D6W A;  1PCX A;  4LD6 A;  1LNX A;  3I5S A;  3H41 A;  4ZGD B;  3M9Q A;  4Q5W A;  2LQW A;  3CCQ T;  4OF1 A;  2EYY A;  2F2X A;  3PT9 A;  1AWJ A;  3X24 B;  2K2V A;  2RQR A;  3H9N A;  2G6F X;  1BYM A;  3MHX A;  4BE2 A;  2RQU A;  1JB0 E;  4ELY C;  1N6A A;  2M16 A;  1D0X A;  1H3Z A;  5GAO n;  3T9N A;  1TU0 B;  3QDF A;  4M77 C;  3RER A;  1IO6 A;  1ABO A;  1E6G A;  2J05 A;  4HVU A;  2XMF A;  2NUZ A;  4VUB A;  3CCL T;  1OQK A;  2ZPB B;  1V1C A;  5LJ3 g;  4M78 F;  2E3I A;  4Z02 A;  2V1Q A;  1VUB A;  1PSF A;  3REB B;  4CC3 A;  3G1J A;  2ROT A;  3O8V A;  5GAN e;  1YJW A;  2VGN A;  2CYZ B;  2KYM A;  3JB9 F;  1M27 C;  3RDV A;  3QG1 A;  2CP2 A;  2EBP A;  4M77 A;  4F7U F;  1K9M R;  1RI0 A;  1N8R U;  1IHW A;  1TOV A;  1Y7X A;  4RUG A;  5LJ5 e;  1CKA A;  1W6X A;  2KMT A;  2EKO A;  1JJ2 S;  1GRI A;  4ZGJ B;  4R0K A;  3VV0 A;  3KXT A;  1PNJ A;  3UT1 A;  1YIJ Q;  2KRN A;  3ULR B;  3PGG A;  1N27 A;  2M0O A;  4EMH A;  2DFU A;  4C92 E;  4C5E A;  3CME Q;  4M75 C;  4QVD A;  5GAM d;  4PK4 A;  4C5H A;  4OB3 B;  5A0L A;  3OYH A;  2YUO A;  2E12 A;  4FIB A;  3FIF A;  5GAN d;  5IXF A;  1U5S A;  2PVD B;  1MMN A;  4HVW A;  5LJ5 d;  1VQ6 T;  4M77 D;  2DD4 A;  1VQ4 T;  4J9G A;  3MCA B;  1Y07 A;  1OX8 A;  3M4G A;  2RHU A;  1OU9 A;  1I5L A;  2CRE A;  2EJG A;  1FMV A;  1FYN A;  2O31 A;  4X34 A;  2MOX A;  3JB9 G;  1K8A R;  1M1K U;  3SFM A;  4J9F A;  2QA4 Q;  1K73 C;  2OTL Q;  3EGD A;  1NEG A;  1IZ6 A;  2CZ6 B;  5GJV B;  2IPO B;  2E5Q A;  1KQ1 A;  3V7S A;  1EZZ B;  3RKY A;  4RKU E;  3GNG A;  3EHR A; 
#chains in the Genus database with same CATH homology
 3SWN C;  4N4G A;  4J5Y A;  1X6O A;  4QVZ A;  3X25 B;  3ASK A;  2VC8 A;  2QTX A;  4OGE A;  1BI1 A;  5LJ5 g;  4E7J A;  2JUF A;  1N9R A;  3P8D A;  2RJE A;  3JCM b;  3DLL A;  3A8L B;  2HAX A;  3I56 A;  4DA4 A;  3QXE B;  3A8H B;  4DOW A;  2V8I A;  4EMK C;  2XU8 A;  3M55 A;  3LGL A;  2PUK B;  5IT9 E;  4BD3 A;  4R56 A;  4EDU A;  3QHS A;  5GAN 6;  3JAM E;  3CC4 A;  1N9S A;  4ZN3 A;  3JCM X;  3MP8 A;  3HRT A;  4J6X A;  3OS0 A;  3M57 A;  2XHC A;  3DLM A;  1YJW T;  5DM7 R;  2KQW A;  1BKB A;  3F70 A;  4ATO A;  4PJO A;  1H64 1;  2WSC E;  5A0D A;  1UB4 A;  1VQO T;  1XOV A;  2RK1 A;  1YHQ A;  2RHZ A;  2P0K A;  3LH0 A;  1Q82 U;  3QPH A;  4HT8 A;  4ZGE B;  2WSF E;  2KSS A;  1RL2 A;  4XU0 A;  4BDZ A;  1VQN T;  1FWZ A;  3INZ A;  2QEX A;  5GAN 4;  4OVA A;  2FHD A;  3JRZ A;  4QQG A;  3SD4 A;  5CO7 A;  4C8Q A;  1HXD A;  2CZ0 B;  3L2W A;  2A7Y A;  3CMA A;  4XTZ A;  2EQJ A;  3QYG B;  3RKY A;  1M1F A;  4RG8 A;  4RCC A;  2DIQ A;  4BI8 B;  4M77 E;  3CCQ A;  1ZBX A;  1LJO A;  2P0P A;  4L5G A;  3SB2 A;  2GFU A;  3JCM d;  2K3X A;  4IUU A;  4MZM A;  4OB2 B;  3NTI A;  2QQB A;  5FRN A;  2VXE A;  2F69 A;  3OQ5 A;  2E1H A;  2QQA A;  2M9U A;  3KUF A;  1YCY A;  4HA8 A;  5CIU A;  4DOV A;  2LQK A;  4ELZ C;  3PIO A;  3OSV A;  2RHY A;  2KY9 A;  4M78 B;  1M4Z A;  2FB7 A;  3LYI A;  1TH7 A;  2LCC A;  1O75 A;  1ZHI A;  2LC4 A;  4JRQ A;  2X35 A;  2QA4 T;  2RJC A;  5GAO l;  2ZCF B;  1KQ2 A;  2V8J A;  4MML A;  4M7A B;  3QZ9 B;  3CCE A;  1U1T A;  2VGM A;  1VQP T;  1W4S A;  3GP8 A;  1VQ5 T;  2DJZ A;  4RG2 A;  5CKH A;  3OYD A;  4M78 C;  3JCM e;  1K9M U;  5CCA A;  2DTH A;  1NPR A;  3PNW C;  1QP2 A;  4B9X A;  4M75 F;  3QUI A;  2RA2 A;  5CKD A;  3HHT B;  3OYJ A;  2RO0 A;  4ZTJ A;  1YBY A;  4PJO F;  5GAO r;  1WNL A;  4KT0 E;  3J7A F;  4MMK A;  3BDU A;  4C5I A;  4C8Q D;  4C8Q G;  1OYX A;  2HBP A;  5HK3 A;  3J80 E;  3E9F A;  5KCO A;  2JVV A;  4OMF B;  2P0Q A;  5GMK j;  3CME A;  4MDX A;  4L6V 5;  4M7A E;  3FRN A;  2MI6 A;  5M9O A;  5GMK l;  1WPY A;  5GAO p;  5GAN 2;  2O4X B;  3JB9 H;  2DKG A;  3MP6 A;  2R58 A;  5GAM h;  4XU3 A;  3GLX A;  4JLG A;  5GMK i;  1XTD A;  1VIE A;  5GAN f;  1VQ7 T;  3H6Z A;  2OTJ A;  4GY5 A;  3M4Y A;  2RD1 A;  4BI3 A;  4XTW A;  3PFS A;  2PVG B;  1Y96 A;  4C8Q F;  2CS7 A;  1R8O B;  4C0F A;  2NLU A;  1KD1 C;  2DIG A;  2HD0 A;  3E19 A;  3TCJ A;  4A4E A;  3OSS C;  4ZTF A;  4UC4 A;  5KCH A;  2XKO C;  4M77 B;  2X4X A;  3X28 B;  1P92 A;  1QVF A;  2EJF A;  4C8Q C;  4NL2 A;  4EPC A;  2OTL T;  3P8B B;  3FC3 A;  1KD1 U;  1OZ2 A;  1VQL T;  1B34 B;  1HK9 A;  2ZPI B;  2F5T X;  3MET A;  3V7C A;  2LVM A;  3GNF B;  4M75 B;  2E10 A;  2E6Z A;  1JJ2 A;  5DLO A;  4PJO E;  4BY6 B;  2IG0 A;  2EIF A;  2ZPE B;  3UWN A;  4PJO C;  3JCM W;  4BDY A;  1LOJ A;  3G7Z A;  2L5Q A;  1W2B A;  1IRE B;  5CAI A;  4BUG A;  5GAM g;  4N4I A;  3MO8 A;  4BB7 A;  4M7A F;  2DVE A;  2JTF A;  3HPW A;  1X01 A;  2YLC A;  3OYC A;  4IUT A;  3G71 T;  4P5N A;  4LDU A;  5KE2 A;  4KUI A;  4OB0 B;  2PU9 B;  2R5M A;  3MP1 A;  5LJ3 h;  1QVG A;  4E7L A;  3VYH B;  3OYK A;  2DK3 A;  2V8K A;  4LDV A;  2LNV A;  4EMK A;  1YJN A;  2X4J A;  2QQ9 A;  2PUO B;  2LTO A;  1VQ9 T;  5D6W A;  5I2M A;  3JCM h;  3WVE B;  3E1S A;  4M7D D;  4XAX B;  1BI3 A;  2D6F A;  4M7D G;  1MHN A;  3E9G A;  4F7U G;  2ZPH B;  3VUZ A;  1WJS A;  3CCU A;  2QQS A;  3WXM B;  3H8Z A;  4FT2 A;  4J6Y A;  1UGS B;  2DTO A;  4JLI A;  4JRK A;  4ME7 A;  4C92 C;  3PMT A;  4FU6 A;  5KH6 A;  3OYM A;  3CBP A;  2QEX T;  2EQK A;  4C5G A;  3OYF A;  2QA4 A;  3GF5 A;  5A0G A;  4E47 A;  5FU6 B;  3OYL A;  3OMG A;  2LT4 A;  3I55 T;  2E6N A;  3HL8 A;  3NFC A;  3JCM V;  4C0Z A;  5KE3 A;  2MAM A;  4PLL A;  4A4G A;  3CXC S;  1D3B B;  2E64 A;  2FYK A;  2KVQ G;  2RI3 A;  2F5K A;  1Q7Y U;  4ZN1 A;  3OBY A;  1I81 A;  3VU3 C;  4QVC A;  5GAO q;  1K8A C;  3JCM c;  1W2B S;  1X75 C;  5L8R E;  2CZ7 B;  4PNO A;  1YJ9 A;  4RMO A;  4E7I A;  2EAY A;  3S3N A;  2EWN A;  3OYE A;  2DZC A;  5GMK m;  1Q82 C;  1YI2 A;  5IAY A;  4JRP A;  1WQ7 A;  3RES A;  3OA6 A;  1G3S A;  3LX7 A;  4KUL A;  5A2Q E;  2ZPF B;  2GF7 A;  5I2S A;  2XD0 A;  1YJN T;  2CGH A;  3OW2 S;  4M7D A;  2DXU A;  4IUV A;  5FU6 C;  5LL6 S;  2K5L A;  3RMQ A;  3LWH A;  1VQ7 A;  3GPL A;  5J39 A;  1VQ5 A;  1VIF A;  3UDC A;  4F7U A;  4M77 F;  4XTY A;  3QO3 A;  4J6W A;  4C8Q B;  2K57 A;  4Y28 E;  4NOY A;  1VQ4 A;  3R6O A;  3VKI A;  3G4S T;  3MEW A;  5CKE A;  1M9S A;  3P8H A;  4O5V A;  2X4W A;  1VQK T;  2FL7 A;  3BY7 A;  3L2U A;  2JOY A;  3QJY A;  4FSX A;  5LJ5 j;  1YI2 T;  4C92 A;  5GAO m;  3GOX A;  2L89 A;  1U1S A;  4Y91 A;  3CC4 T;  1YIJ T;  2L8D A;  3LLR A;  3M56 A;  5CK9 A;  1G3T A;  4FL6 A;  2RJD A;  2Y90 A;  4IUP A;  2GCX A;  4JS4 A;  1JBM A;  3CD6 T;  5HY6 A;  4M75 A;  4M78 E;  5I21 A;  3OS2 A;  3OYI A;  3NTH A;  2HNI A;  3ZBD A;  3HFN A;  2C06 A;  4II1 A;  3RIR A;  3TEE A;  3C4S A;  3WVD B;  4XQ3 A;  3ZFJ A;  2YLB A;  1FX7 A;  2P4T A;  2HQX A;  3EFS A;  1Q81 U;  1YIT T;  2E70 A;  4M75 E;  1I8F A;  4N0A C;  3CCS T;  4XTX A;  5GAN j;  3PMI A;  4RCB A;  2XI9 A;  3OYB A;  1XNI A;  3VJP A;  3JSC A;  1K8A U;  3C95 A;  3M59 A;  3QDR B;  5LJ3 j;  5FU7 B;  2LT1 A;  3ME9 A;  3A8M B;  4JDS A;  1BIA A;  3X26 B;  2OAU A;  2ZPG B;  3RUX A;  5GAN 3;  2RI5 A;  1Q86 C;  4J7F A;  1KQS S;  3G6E A;  1SSF A;  3JCM P;  5D6X A;  3CC7 A;  3CD6 A;  1KHC A;  1WQW A;  4R55 A;  2Y4Y A;  4X9C A;  1G3Y A;  4F7U E;  1S72 T;  4N0A A;  2JZ2 A;  4M7D C;  1KC8 U;  2XK0 A;  3CBO A;  5C0M A;  4PL6 A;  3FJP A;  1DJ7 B;  5LJ5 f;  1AHJ B;  4J7I A;  4LD9 K;  5GAN 7;  4WF2 A;  2O4X A;  3MEV A;  4OP0 A;  4KBM B;  1OI1 A;  4B9W A;  4C92 D;  4C92 G;  1KC8 C;  3LGF A;  1OZ3 A;  2LRQ A;  2KDS A;  2H3J A;  3I55 A;  3L2R A;  2QI2 A;  4IKF A;  2EQU A;  3PIP A;  4J83 A;  4M75 G;  2YHT A;  4M75 D;  1VQ6 A;  1MGQ A;  3FEO A;  5CQX A;  2PVO B;  4PLI A;  3SDZ A;  3JCM J;  1VQP A;  4A4F A;  2JTM A;  2EFI A;  4BE1 A;  3CCV A;  5GAN 5;  3CPW A;  3UPU A;  2ZZD A;  1U8R A;  3MEA A;  3FDR A;  2MWO A;  2BUD A;  4LDW A;  2GFA A;  3TRE A;  5GAM f;  1B34 A;  3EAE A;  3L1A A;  2XDP A;  1UGQ B;  5CR2 A;  2E41 A;  2RJF A;  3LW5 E;  1BI2 A;  3KBG A;  4J8O A;  3RKW A;  1VQN A;  1WJQ A;  5D6Y A;  3FB9 A;  4FT4 A;  3A8G B;  1Q7Y C;  2LQ8 A;  5IN1 A;  4M7D E;  3CPF A;  1G5V A;  3OBW A;  2R5A A;  3CCJ A;  3CCR T;  3BDL A;  3V8K A;  5LJ3 f;  1M1G A;  5LJ3 d;  5GMK e;  3S3M A;  2KAF A;  5HK0 A;  5GAN 8;  1M8V A;  2VV5 A;  3CEY A;  3JCM f;  2DEQ A;  3LWI A;  3DB3 A;  3G71 A;  3OYG A;  3OYA A;  4E7H A;  3JB9 J;  4GLK A;  2YRV A;  1VQ8 T;  3CCM T;  3V7R A;  3OS5 A;  3C12 A;  2FVU A;  2D9T A;  4EMK B;  4A4K A;  1Y96 B;  3TU4 K;  2WSE E;  4M7A G;  5CKB A;  4OGC A;  2XDD A;  1NJI U;  4M7A D;  1GXI E;  2MF2 A;  2DO3 A;  5C6S A;  4IUR A;  3ER0 A;  5GAM j;  2AHJ B;  4E7K A;  2MWP A;  4JRI A;  5GAM e;  4CI0 C;  2OTL A;  3M5A A;  4V2S A;  3CCJ T;  3CCR A;  3OYY A;  3CCE T;  3NTK A;  2G3R A;  3CCL A;  5EG2 A;  2XDB A;  1NJI C;  1Y71 A;  3OB9 A;  4MZP A;  4XU2 A;  3J81 E;  3L2Z A;  4YTL A;  2RI2 A;  3QJ6 A;  4QQ6 A;  3HRU A;  5CKF A;  4O6J A;  4D6W A;  2DAQ A;  3CPW S;  1VQ8 A;  3I56 T;  3CCS A;  4LD6 A;  1UGR B;  1LNX A;  4X9D A;  3PTA A;  1NZ9 A;  4ZGD B;  4HKE A;  2K3Y A;  3M9Q A;  4Q5W A;  2QDY B;  1S72 A;  3URG A;  5J3B A;  2EQM A;  3CCQ T;  3QBY A;  4OF1 A;  2VYT A;  5HKC A;  3PT9 A;  2LX9 A;  3QZ5 B;  3A5Z B;  5J26 A;  1VQM A;  3X24 B;  1UGP B;  2IVW A;  2K2V A;  5LJ5 h;  1M90 C;  4BI4 A;  1I4K 1;  4BY6 C;  4PJO B;  2OTJ T;  3QKJ A;  1BYM A;  3MHX A;  4JJN K;  3A8O B;  4BE2 A;  5GAN g;  3RKX A;  1JB0 E;  4ELY C;  1Q86 U;  4M7A A;  3HKS A;  1N6A A;  3CCU T;  2M16 A;  2ZGW A;  3JB9 I;  3CMA T;  1KG1 A;  4M7D B;  2BKD N;  1H3Z A;  5GAO n;  3T9N A;  4M77 C;  4C0D C;  3RER A;  1WJR A;  1N8R C;  2DPP B;  2CZ1 B;  4JS5 A;  3CC2 A;  4XK8 E;  4HCC A;  3SWN A;  2DXT A;  5AYF A;  2K4Y A;  1VQM T;  2RHX A;  4HT9 A;  2HQE A;  4VUB A;  3MEU A;  3CCL T;  2ZPB B;  3N5B B;  4XTU A;  5LJ3 g;  1V29 B;  4M78 F;  2WAC A;  3CXC A;  2E65 A;  5CVI A;  4Z02 A;  3JCM Q;  3ZEH A;  1VUB A;  4CRI A;  1VQK A;  2Y4X A;  1EIF A;  2VUB A;  1QP3 A;  4NL3 A;  4EMG A;  2DTI A;  1PSF A;  3G4S A;  5DY9 A;  3OY9 A;  4C92 F;  3QSU A;  2QQR A;  5GAN e;  3O8V A;  4MZT A;  4FM4 B;  2VGN A;  1YJW A;  2CYZ B;  4QW2 A;  2VXF A;  1Q81 C;  3JB9 F;  2BIV A;  1BI0 A;  1YIT A;  3FLG A;  5DLQ E;  3QG1 A;  2I2L A;  4M7A C;  2M1H A;  4M77 A;  4C0D B;  4F7U F;  1G3W A;  1RI0 A;  4M78 D;  4M78 G;  3CCV T;  3S3O A;  1N8R U;  1Y7X A;  4MDW A;  4TVR A;  4F7U B;  3GIB A;  3JCM g;  3X20 B;  1O9S A;  2O01 E;  5LJ5 e;  4JUV A;  1VQL A;  3CME T;  2KMT A;  2EKO A;  1JJ2 S;  3G6E T;  2QXF A;  2RHI A;  4N4H A;  3QYH B;  2GQV A;  1KHI A;  2A3L A;  5CQY A;  3HP9 A;  3V8J A;  3VV0 A;  4ZGJ B;  3CBM A;  4IUQ A;  3KXT A;  2RK2 A;  2R57 A;  3UT1 A;  4A54 A;  4XTV A;  2XIC A;  5GMK h;  1YIJ A;  4C92 B;  4L59 A;  3PGG A;  1N27 A;  2M0O A;  3OYN A;  3CC2 T;  5FU7 C;  3M54 A;  4EMH A;  4A53 A;  4C92 E;  1JRI A;  1FXX A;  3DKM A;  4C5E A;  2JN0 A;  4QQD A;  3BW1 A;  4BE0 A;  1QVG S;  4M75 C;  4QVD A;  4KUD K;  1QVF S;  1NE8 A;  4DQ2 A;  3AHU A;  5GAM d;  2RH2 A;  1BIB A;  3CCM A;  1M1K C;  2DZ9 A;  1QW1 A;  2EYQ A;  1WGS A;  4OB3 B;  3M58 A;  3Q1J A;  4C5H A;  5A0L A;  4PKC C;  3OYH A;  3C94 A;  2E12 A;  4FIB A;  3FIF A;  4LDY A;  3VYG A;  5GAN d;  3M53 A;  2PQW A;  2MMP A;  3VUB A;  2PVD B;  2X4Y A;  4LDX A;  4M7D F;  3S6W A;  5LJ5 d;  2DXB A;  1VQ6 T;  4M77 D;  4M77 G;  2DD4 A;  2JNG A;  2LCL A;  4C8Q E;  4M78 A;  2DD5 A;  2K5F A;  1VQ4 T;  4OB1 B;  1KQS A;  3CC7 T;  3MCA B;  4C0G A;  1Y07 A;  3M4G A;  4XU1 A;  3L2Q A;  1XQH A;  1K9M C;  2RHU A;  2CKK A;  1PSE A;  2K5I A;  1I5L A;  4NS5 A;  3V8L A;  2EJG A;  5LJ3 e;  1UEB A;  5FLX E;  1M5Q 1;  1D3B A;  2EJ9 A;  3HFO A;  4A4H A;  3EFR A;  1M90 U;  3HSB A;  4HCB A;  2B8A A;  5FRM A;  1K73 U;  1VQ9 A;  1ZQ1 A;  3OMC A;  5FRO A;  2LDM A;  3L2V A;  4BAC A;  2XID A;  1QVP A;  3DB4 A;  4X34 A;  3OS1 A;  3JB9 D;  3QII A;  4HCZ A;  3JB9 G;  1VQO A;  1YHQ T;  2RM4 A;  1M1K U;  4PJO G;  4PJO D;  2XG8 D;  3SFM A;  3SWN B;  1YJ9 T;  1K73 C;  2L3R A;  2DXC A;  1IZ6 A;  2CZ6 B;  2D0Q B;  3L42 A;  5GAN h;  3RMS A;  2E5Q A;  2RB6 A;  3BFM A;  1KQ1 A;  2KK4 A;  3V7S A;  3OW2 A;  3HRS A;  1NPP A;  4RKU E;  3GNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...