4M7DD

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 16
structure length 74
sequence length 74
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dD00
4RCBA 3JB9J 2FYKA 1B34A 1MGQA 2DEQA 5GAN4 2RD1A 1TH7A 2YLCA 3L1AA 1HK9A 3JB9F 1N9SA 3L2ZA 5GAOn 3RIRA 2DZCA 5GMKl 5GAOl 4A53A 4F7UE 5GAMd 5LJ3e 4M77G 4JUVA 3V7SA 4C8QF 4M78C 5LJ5j 4M7DA 2DVEA 5GAN6 5LJ5f 4JRIA 1BIBA 1N9RA 3JCMf 4PJOA 4M78G 4N0AA 2QTXA 4M75C 4M75B 2RM4A 3RKYA 2HNIA 4EMGA 2E1HA 4JLIA 5DY9A 3V7CA 4HT9A 1I4K1 4J5YA 4C92F 4M7AA 1H641 4M77F 4M75E 4XTXA 3V8KA 5LJ5e 4PJOC 4PJOB 2VXFA 3RERA 3BFMA 3JCMe 3JCMQ 5GAOp 5I21A 4NOYA 2YHTA 3FIFA 5GAN7 3V8LA 4M75D 1JBMA 4F7UB 5GANg 2E64A 1I81A 3V8JA 1U1TA 5GAMg 2EJFA 4PJOE 4J6YA 4X9CA 3RUXA 4F7UG 4DQ2A 4NL3A 2DJZA 3HSBA 5GANd 4PJOD 4M7AE 4M7DB 2E10A 1B34B 3BDUA 3HFOA 3M4GA 2VXEA 3RESA 3RKWA 3GIBA 4XU2A 4A54A 1WQ7A 3JCMb 4V2SA 4EMHA 4C92A 1D3BA 2DTHA 4M77A 4XTVA 2EJ9A 1M5Q1 3QHSA 4J6WA 4M75G 5GMKj 5GANj 4M7DC 4HA8A 5GANf 2RA2A 3BW1A 4JRKA 3JCMc 1HXDA 5GAMf 5LJ3h 5GAMj 3HFNA 3SWNA 4N0AC 4MMLA 2DZ9A 2I2LA 3INZA 4XTZA 1D3BB 4M78F 5GAOq 4PJOG 2E65A 4WF2A 1I5LA 4M7DE 1M8VA 1Y96A 5GAN3 3FB9A 4M7AC 4M7AB 5GMKe 3AHUA 4M75F 4C92E 5GANe 4QVDA 1I8FA 2YLBA 3SWNC 3SWNB 4C8QA 5GAMe 5GAOm 3FJPA 1LNXA 4M7DD 2FB7A 1LJOA 5LJ5h 3JCMJ 2EWNA 4C92D 3JCMW 3JCMh 4PJOF 2CGHA 1KQ1A 4C8QC 4C8QB 3PGGA 2EJGA 4M7AD 3QO3A 3JCMP 4F7UF 2DXUA 2E41A 3QUIA 5LJ5d 4XTYA 2K57A 2ZGWA 4C8QE 4M78A 3JCMd 1YCYA 3JB9D 4XTUA 4XTWA 4M7DG 1WQWA 2Y90A 4C92C 4C92B 1JRIA 3EFRA 3RKXA 4M77C 4M77B 3BY7A 4M75A 4XU0A 3VU3C 4C8QD 5LJ3g 5GMKi 4C92G 2DTOA 1BIAA 4J6XA 5GAN8 4QVCA 5CAIA 1LOJA 1X01A 4M78B 4RCCA 5GMKm 2VC8A 4EMKA 5LJ3d 5GAOr 2DKGA 4M77E 4XU3A 4M7AG 5GAN2 1WNLA 4PNOA 4M7DF 5GAN5 2JN0A 3JB9H 4NL2A 3QSUA 1Y96B 4M78E 4Y91A 2DXTA 4MMKA 4X9DA 4M77D 3JCMX 4F7UA 5LJ5g 3JB9G 4HT8A 4EMKC 3V7RA 4EMKB 3EFSA 4XU1A 2DTIA 2EAYA 3JCMg 1U1SA 3JB9I 4M78D 3SB2A 3JCMV 5GMKh 4OP0A 2RB6A 5LJ3j 5GANh 5LJ3f 4C8QG 1KQ2A 5GAMh 4M7AF 4XQ3A 1WPYA
chains in the Genus database with same CATH superfamily
3G4SA 4RCBA 3EGDB 3TCJA 2KSSA 3CMEA 1M3AA 2DZCA 1TU0B 2DERA 3UWNA 1IB8A 1KD1C 2CDTA 2KNBB 1WHJA 3UPUA 3SFMA 1GFCA 4E2FB 3RKYA 1RAHB 4M4ZA 1AWWA 4MZMA 2DD4A 1YNZA 1XNIA 2VXFA 2K2MA 3OBWA 1E6GA 4R0KA 4DQ2A 1UDLA 1KD1U 1H8KA 2EVRA 3QJYA 3C0CA 2DD5A 2PUKB 5J39A 2BE9B 1ZSZC 3ER0A 2KXDA 4V2SA 5D6WA 3ZFJA 1QVGA 4XQ3A 3VYHB 4X34A 1NG2A 5GAMf 2KR3A 4JPBW 5L23A 1SSHA 2GQIA 3PMTA 1KD1R 3LGFA 3P8HA 3G71Q 1U5SA 3L42A 3CPWP 4HCCA 1ZBXA 3QO3A 3M54A 4ZGEB 4QW2A 4M7DG 2Y90A 5D6YA 1OEBA 2C0IA 4BB7A 3S3OA 3EH1A 3CCRA 2DTOA 3M4YA 3OMCA 1X01A 4JRPA 5CK9A 4AFSC 1Z9ZA 4WTOB 2OTJT 3CBOA 1UUEA 1WXTA 1G5VA 3EFOA 2VV5A 5FWBA 3V7RA 3EFSA 5J3BA 4CC4B 1PM3A 1WGSA 3SB2A 4OP0A 2RB6A 4D6WA 4C5GA 3DKMA 4FYVB 4OMQA 3ULRB 4HVWA 5FRMA 4PJNA 1HK9A 2AKKA 1N5ZA 2ZCFB 3RBBB 1JJ2S 4RTZA 2PUOB 2JNGA 5FLXE 1PHTA 1S72Q 2KRNA 2M02A 1UHCA 2CP2A 3QYGB 2KK4A 3H0FA 4M77F 4M75E 3CXCP 4Y92A 3FIFA 4ZTFA 4M75D 1SF9A 3CCEA 1H92A 2B8AA 2LQWA 5KCOA 2WSEE 2B86A 2DMOA 3CMET 2CP7A 4EMHA 2ZPBB 1W2BA 2DIQA 2R5MA 3GF5A 4M7DB 1OZ3A 3CC2Q 4N0AC 3G6EQ 4N4HA 2I2LA 2WSCE 4JJNK 3EGXA 3ZBDA 1VQ4Q 3OYKA 3NTIA 4HT8A 4FIBA 3SWNB 4PL6A 1K8AC 2KAFA 1G83A 2CUBA 2NUZA 3H41A 2GF7A 4J9CA 2EQUA 3OS1A 2EJGA 4M7AD 1M8MA 2CP5A 1K0XA 2EQJA 1YWPA 3H0HA 1K76A 4YTLA 1OYXA 4M77C 4J6XA 2C0OA 4B9XA 5GAN5 1RADB 1Y96B 1MV3A 4X9DA 1U8RA 4Z8AA 2MYSA 4KBMB 2I0NA 3CXCA 3CCSQ 2EAYA 2O31A 3VS0A 3UA7A 1WHKA 3I5SA 1PCXA 3A8HB 5GAN4 2PU9B 5C6SA 1R0BG 3S3NA 2EKOA 2CYZB 3TREA 3L2ZA 1RLPC 2MCNA 4LDYA 2V1QA 1K8AR 2DVEA 4ME7A 3P8BB 2KI7A 3CCRT 4QQ6A 4LDVA 1AOJA 4GBQA 5CCAA 1WHLA 4IUVA 2KBTA 1KQSP 3S3MA 2H3EB 3TVTA 3CCLA 3EHQA 1NM7A 2HDAA 3CCUA 2RJDA 3EGUA 2HQXA 3OYAA 1TUGB 1GL5A 2CZ1B 3CCVA 3RKWA 4L59A 3JCMb 5HY6A 5A0DA 3OYMA 4M75G 1NE8A 2ECZA 1F1BB 2RHYA 2XHCA 1C6VX 2YUQA 4B9WA 1D3BB 1CKAA 1LCKA 2CZ6B 3D7SB 2YWWA 1YFNA 1M8VA 4JLGA 3OYCA 4X1VA 4C92E 1TOVA 2D1XA 1NZ9A 2GQVA 1JB0E 3CCET 4C92D 3JCMh 1OPLA 1SHFA 2NYSA 3LX7A 2JW4A 1VIFA 4QT7A 4RTYA 1KFZA 1PG5B 3VUBA 1WJSA 5LJ5d 2K57A 1PSEA 2EYYA 2EBPA 3UA6A 4PLLA 4XTUA 1B07A 1VQPT 3M0SA 1G3YA 3H6ZA 3JRZA 3RKXA 2QQRA 2F5TX 2LDMA 1P92A 2KXCA 1YBYA 2IG0A 2EGCA 3LWHA 5GJWB 4M7AG 5FRNA 1TWBA 3I55A 4M78E 3JCMX 2L3QA 1UGSB 4C5IA 3I9QA 4M78D 1JQQA 2QI2A 3REAB 3CBPA 3NGPA 4AT1B 2YLCA 2XK0A 4CI0C 2MI6A 5GMKl 2ROLA 2WSFE 1KC8C 2KE9A 2PVOB 2CP3A 2LCSA 4LDWA 2MPXC 1X75C 4M75B 1M2OA 4EMGA 1W6XA 5DY9A 1YITA 1I4K1 4LD6A 1UGVA 1UEBA 3S6WA 3RERA 2NUPB 1QVPA 2GFAA 1PNJA 1YI2Q 1N27A 2JTEA 2J6OA 4F7UB 2F2XA 1JEGA 4LD9K 5GAMg 1U1TA 2RJEA 4PJLA 2DYIA 1YJ9A 1M90U 2JS2A 4JZ3A 5KE3A 2VXEA 3OSSC 2CZ7B 3DLMA 3PE0A 1NYFA 3RESA 1QCOA 1CSKA 2V8IA 3NFCA 3HPWA 1PKSA 3CCJQ 2EJ9A 4BI3A 5GANf 1D09B 3GBQA 2EYWA 5LJ3h 4BD3A 2KT1A 4AFQC 5ECAA 2KYBA 4M7AB 3MEAA 2VVKA 5KH6A 5J26A 3HRUA 4BE2A 3JB9J 3FJPA 1KC8R 1WA7A 2X4WA 3CCLT 1VQMA 2LNHB 3GNFB 1KHCA 3QKJA 2LT1A 1BU1A 3CCVT 4B6MA 4BI8B 2JVVA 3CCQA 5L8RE 4OMNA 4KUIA 3VU3C 3VRYA 4C92G 1ZLMA 1LOJA 2FEIA 5EC7A 2DXTA 5LJ3j 3GNGA 3HL8A 3M0RA 1G3SA 1MGQA 2DL8A 2YXYA 1VQNQ 2RD1A 1WJRA 3L1AA 1BB9A 5HCKA 1U3OA 2J6KA 5GAOl 5EG2A 1PC0A 1N6AA 2EYZA 1QCNA 1VQKQ 2O9VA 4HCZA 3M57A 4CRIA 4JRIA 1IXDA 1GBQA 1N9RA 4PJOA 4M78G 4JDSA 2ZAEA 5CKDA 1TG0A 3CMAQ 3LWIA 4C92F 2D0QB 1VQ5A 1BK2A 3I55T 3EG9B 3R6OA 2BE7D 2A7YA 3OW2A 3OS0A 4E7HA 3H8ZA 2EQIA 2DYBA 2BKDN 1RAIB 4XU2A 2HQHA 1VQLQ 1J3TA 4KUDK 3NTHA 1VOMA 2EKHA 3IQLA 1JJ2P 4ORZA 2YUOA 2DZ9A 1YITT 2E70A 2AT1B 4M78F 4J7IA 2AKLA 1VQ7Q 1MMGA 1QP2A 4Z89A 2COZA 2DL3A 1D0ZA 3M55A 5KYXB 3EGDA 4PJOF 5A2QE 3MEUA 1YJ9T 1PD0A 3PGGA 2JMCA 4ZN3A 2PZ1A 2L3RA 2A0FB 3EHRA 1EIFA 3EH2A 2ZGWA 4E7SA 1GFDA 4C92C 2O01E 4RTXA 2QA4Q 4CC7A 1YJWA 5GMKi 3AT1B 1TUCA 5FU6B 4M78B 1YHQQ 5LJ3d 4DOVA 4M77E 1X27A 3JB9H 2P0PA 3NTKA 4M77D 2LT4A 3A98A 2QYZA 2LNVA 3NHNA 3JB9I 3VS5A 1VQMT 5GMKh 4KGVB 1Q82C 4HVUA 1ABOA 2FYKA 1PKTA 3UDCA 2JT4A 2RQRA 1Y57A 3X25B 4M78C 3EG1A 3CCQT 1OU8A 2E4HA 3HRTA 1GCQC 2A36A 2QTXA 2DXBA 1BI0A 3QYHB 2QDLA 3OYLA 2LRQA 1IHVA 1X2QA 2PTKA 4ZTJA 2RHIA 1Q82U 2KVQG 4PJOC 2KYMA 3JCMe 3CC4Q 4FCYA 1XOVA 2JS0A 2MIOA 3RUXA 2DXCA 1M2VB 2FPDA 1ZSZB 4AMCA 2G3RA 3GIBA 4PKCC 2YUPA 1OOTA 1UGPB 2QEXA 5GMKj 2QXFA 3JCMc 2JMAA 3OYNA 1IHWA 2HBWA 1Q82R 2P4RA 1VQ5T 4L6V5 1NPRA 4PFOA 5GAOm 1I8FA 2QASA 1Z9QA 2RHZA 2VGNA 3WVDB 2GGRA 2KRSA 1NEGA 2D9TA 2OTLQ 1BCMA 4XTYA 2MK5A 2R58A 4XTWA 1I5OB 4IURA 2RHUA 3FRNA 1BCOA 3OS2A 1Q7YC 2CP6A 5IXBA 4XAXB 2BIVA 3THKA 1WNLA 2ABLA 3SEMA 1AHJB 4OF1A 1M3CA 2P0QA 3CCMQ 1YIJQ 4XU1A 1PRLC 3TQ7P 1KQ2A 1ZA1B 1KK7A 2J6FA 1M1KC 1OV3A 4C5EA 5HK0A 2J05A 3EAEA 4KGZB 2SRCA 1PWTA 4Z88A 5GAMd 5LJ3e 4M77G 4M7DA 1ZQ1A 2VB6A 1YJWT 1VQ8Q 2D0NA 2AZSA 2HEQA 1VQ9A 2DETA 4HCBA 3OBYA 1MMAA 5CKFA 2RN8A 2O4XA 2F5KA 3LGLA 1M1KU 3HTRA 2YHTA 3NPFA 3A8LB 2KT8A 5GANg 1D0YA 1Q7YR 1JXOA 1WXUA 1YP5A 1Y0MA 3PIOA 5DLQE 2K5IA 4R55A 1B34B 1ABQA 2RMOA 4AG1C 2LJ3A 4FSXA 2A37A 3OYFA 3VS4A 2O88A 1XQHA 2DA9A 3N5BB 3EG0A 4JRKA 1HXDA 4LUEA 4ZN1A 2RPNA 3LH0A 1M1KR 2RNAA 4RG2A 1Y96A 4IUPA 3AHUA 2GNCA 4ANJA 1NBEB 1Q95G 5FU7C 1WI7A 2FB7A 5LJ5h 3CD6Q 2L89A 3CPWA 1AD5A 2QTVA 2LC4A 1EX4A 2EGAA 2QQ9A 1VQPA 2MOXA 2CH4W 1G3WA 4AFZC 2LQKA 4HXJA 1UFFA 4DBHA 1NLOC 2FRYA 2QGGA 2QEXT 1K73C 1JRIA 4BDYA 1UECA 4M77B 3GLXA 1KJWA 1WFWA 2L8DA 4OB0B 2HL3A 3Q1JA 2XDPA 4PNOA 1V1CA 2RK2A 1M9SA 2KRMA 2FO0A 1IREB 2E6ZA 3WXMB 1D0XA 1NLPC 4XK8E 4JS5A 2MF2A 5IN1A 1TTHB 1YN8A 4RUGA 1FMWA 3EFOB 4RKUE 1UG1A 1T3SA 2LP5A 3C95A 2HKQB 5GAOn 3MJXA 1TS9A 4A53A 1QVGS 2XMFA 3OSVA 1K8AU 3MKDA 2FL7A 1ZBJA 2DLPA 5LJ5j 3RMSA 3DB3A 2X4JA 1X69A 3OQ5A 3QPHA 3JV3A 2V8JA 1VYVA 2IIMA 2K4YA 3CC7A 2ZPHB 5I21A 5DM7R 1T0HA 5GAN7 1YJNA 1K73R 2XD0A 2GTOA 4J9FA 3OMGA 2OJ2A 3I56A 2OAUA 3HSBA 3GPLA 4PLIA 5DLOA 1Y7XA 1UB4A 2E10A 2P84A 3BDUA 4A4KA 1GBRA 2XDBA 3CPFA 1MHNA 2CT4A 4IKFA 2M0OA 2H3JA 1RABB 3X26B 1VQ9T 3HFNA 5GAOq 2E65A 2ZPEB 2M51A 5GMKe 4C8QA 2JZ2A 3PFSA 4BDZA 3M0QA 3EG3A 1VQOQ 4J83A 1K1ZA 1G8XA 4F16A 2HMAA 1W1FA 1WHMA 3QWXX 3CBMA 3L2RA 2AHJB 3JSCA 1X2KA 1QVFP 5KYWB 3OYIA 1D1CA 2BZXA 4JJDA 1AWJA 4RTWA 4M75A 2V26A 4F04B 5I22A 2IVWA 3PNWC 4P5NA 1R0CB 3E1SA 5GAOr 2C06A 3QXEB 3R6NA 1IRXA 2JN0A 2NUPA 1HJDA 2X3WD 4GLMA 4F7UA 3G71A 1CKBA 2MWPA 2E3IA 2DRMA 1Q86C 1RLQC 2QDYB 3LYIA 3A8OB 2RJCA 1K0SA 4PJMA 1RI9A 3QWYA 3C94A 3JB9F 5LL6S 4ESRA 1G3TA 1VUBA 1W2BS 4C8QF 2RI5A 2X4XA 2DJQA 5KYUA 2HNIA 1NYGA 1ZUKA 1YWOA 4M7AA 2ZPGB 1KQSA 4KT0E 2OTJQ 2CSQA 1UJ0A 1KHIA 3JCMQ 8ATCB 2E64A 5IT9E 3V8JA 4PJOE 2DK3A 1MNEA 2NUTA 1MMDA 4NL3A 2CP0A 5CKEA 4PJOD 1V76A 3VV0A 1R8OB 2BZ8A 1WQ7A 4J9IA 3WVEB 4Z02A 3PT9A 2EW3A 1SEMA 1Q86R 4KH1B 2FRWA 1S72A 1HD3A 4F17A 4FM4B 5IH2A 1JO8A 3M0TA 2F2VA 3CC7T 1QW1A 1DJ7B 1KC8U 1YJNT 2KY9A 1YCSB 2L3PA 2JTMA 2LJ1A 3I56T 2L0AA 3NMZC 4C8QC 5A0GA 3G4SQ 1M1FA 1OPKA 2F1LA 3REBB 4NS5A 2JJ9A 2JTFA 3CMEQ 1OU9A 1YCYA 3DB4A 3BE3A 1M4ZA 1WQWA 3J7AF 1I07A 2K5LA 3JAME 3CC2A 4KGXB 3G6EA 2K6DA 4QVCA 3HRSA 4Q5WA 4EMKA 1WIEA 3A5ZB 2FZCB 3OS5A 1VQ4A 4ATOA 2LTOA 1SKUB 2QK0A 3M0UA 1QWEA 3PTAA 5FROA 3ME9A 1HSQA 2DTIA 4MZTA 3FLGA 3M5AA 2OAWA 4TVRA 5AT1B 1W4SA 2XKOC 1VYTA 2KROA 4C0FA 4OMOA 1N9SA 3MHXA 1BBZA 2DRKA 3E19A 2D6FA 2FZKB 1BIBA 2LCLA 3JCMf 1B3QA 3MO8A 2RM4A 2X51A 1OQKA 1U06A 1G2BA 4FW2A 5LJ5e 1M1GA 4OB3B 1UGRB 2RQWA 3CCSA 3G71T 2EFIA 2K9GA 2ZZDA 4GY5A 1ZUUA 3GP8A 3VS3A 3KUFA 3M9QA 1UGQB 1N8RC 4FT2A 2ATCB 3CCRQ 2K3BA 3J81E 2BTTA 5C0MA 1VA7A 4PJOG 1MUZA 5AYFA 2LCCA 2E5QA 3FB9A 3MEWA 3JCMP 4IIOA 1WHHA 2V1RA 4E7IA 4KH0B 1R77A 2D8JA 1QVFS 6AT1B 1N8RU 2CZ0B 1QWFA 2W10A 1TUDA 2DFUA 3CQTA 3EG2A 1RAAB 2ROTA 1SPKA 2NWMA 4C92B 1C1AA 3EFRA 3QG1A 1S72T 1BIAA 5GAN8 4LUDA 5GMKm 2OX7A 2VC8A 4PK4A 1K9MC 3C4SA 1WHGA 1SSFA 1NPPA 4EMKC 4R56A 1N8RR 2P4TA 2HL5C 2CT3A 5LJ3f 2DBMA 1M2VA 5GAMh 3CCEQ 1WPYA 2E6NA 2AIRB 1ZSZA 2HD0A 5FWCA 3TSZA 2C0TA 2XDDA 3VKIA 4KULA 1SHGA 3M53A 4JUVA 3V7SA 2LQNA 5KYYB 5GJVB 3MP6A 1WDXA 1QQJA 4RTUA 1K9MU 4CC3A 4OMMA 3CC2T 1ZX6A 3G6ET 1RACB 4JLIA 2X4YA 1XJWB 2L3SA 1AEYA 3E9GA 4DOWA 1VQ4T 1AWXA 3QZ5B 3V8KA 4PJOB 3HHTB 4PFZA 2EJFA 4DA4A 3E9FA 2FG0A 3SD4A 4HKEA 2E12A 1BI2A 1QLYA 1AWOA 4A54A 1K9MR 1V29B 1WLPB 3RMQA 1QVGP 1OI1A 3QHSA 1VQ6Q 1JJ2A 1AVZC 5GAMj 4OB1B 1IO6A 3A8GB 2O2OA 5A0LA 1TXQA 3MP1A 1OZ2A 1UTIA 1YI2A 2Y4XA 3CCST 2DILA 2FHDA 4AFUC 2L5QA 8AT1B 3QDFA 2CH4A 2YUNA 2KDSA 2XICA 2CGHA 1RI0A 4BI4A 1M30A 1UE9A 4HVVA 1GRIA 3CCJA 2Z0WA 2KEAA 1M27C 4XU3A 2K7AA 1X6OA 1E7OA 3G1JA 3F70A 3JCMV 3CCLQ 3OW2S 2A3LA 3CCUQ 2WACA 3ZEHA 1AZEA 1IGQA 1B34A 2LVMA 1VQOT 4FU6A 3SDZA 4ELZC 3MP8A 5IHNA 3CCVQ 4BE1A 5GAN6 4N0AA 3UF4A 3QBYA 2GFUA 1MV0B 1NEBA 1SRLA 3OA6A 2D8HA 4J5YA 2RQUA 4E7KA 2LX7A 5CVIA 2V8KA 3VS7A 2E5KA 2QQBA 3O5ZA 4FL6A 1Q7YU 2DL4A 2VGMA 1VQNA 5CKHA 4D8DA 2O9SA 2DL7A 3HFOA 4A4HA 2RI2A 5I11A 4IUUA 4ZGJB 5CKBA 1VQKA 4Y28E 4M77A 4XTVA 1W2BP 5M9OA 4WCIA 3BW1A 3OYEA 4A4FA 2DL5A 1O9SA 1QKWA 3SWNA 3CMAA 2DM1A 2K3YA 1I5LA 5I2SA 4WF2A 1D1BA 2GCXA 4QQDA 1ZUYA 2YRVA 2ZPIB 4RTTA 3I55Q 2RQTA 2LQ8A 5HKCA 5FU7B 2DVJA 2JM8A 4O6JA 3JCMJ 3JCMW 1FYNA 2QAZA 1MMNA 2A08A 4OVAA 2M9UA 4OGEA 2FVUA 5IHIA 1VQLA 1RL2A 4C8QE 3JB9D 4C8QD 2XG8D 1QMCA 2PVGB 4RCCA 1Q81C 1YITQ 1VQ7A 1B7TA 2HCKA 5GAN2 4OGCA 4M7DF 4NL2A 1ZSGA 3HP9A 1YI2T 1BI1A 1RAEB 4LDUA 3JCMg 1I1JA 2LJ0A 5CAIA 1UJYA 2VYTA 3MPUB 2DEQA 1YJ9Q 3FC3A 5IHKA 5IAYA 4OMFB 1FXXA 4BY6B 3G4ST 1Q81U 3MEVA 4F7UE 3CCJT 1S1NA 2EGEA 2QA4A 2M16A 3QIIA 4A63B 2KQWA 1T3LA 3FJ5A 4BE0A 1RUWA 3UT1A 4ELYC 1D1AA 2X9HA 2E1HA 1YHQA 4HT9A 2DF6A 5D6XA 2AK5A 4J9EA 1LVKA 2HSEB 2DX1A 1K73U 4NOYA 2EPDA 2LZ6B 1I81A 2HQEA 4BY6C 1VQMQ 2JXBA 3GOXA 2DJZA 2O4XB 2CS7A 1Q81R 4PFPA 4M7AE 3M4GA 5KYWA 3X20B 2HAXA 1D3BA 2DTHA 4IUQA 2HZYA 2YRDA 3CCQQ 4M7DC 4UC4A 1I0CA 1WXBA 1JU5C 1JXMA 1VQ6A 1ZHIA 3INZA 2RH2A 3VJPA 2DAQA 4MDXA 5GAN3 3OYGA 1GCPA 3CC4A 2EYXA 2YLBA 2KGTA 3P8DA 3SWNC 5GAMe 7AT1B 2F69A 2FPEA 2YRCA 4QVZA 4J7FA 3CEYA 1VYUA 2CUDA 1VQNT 2PQWA 4ZGDB 2E41A 2JOYA 4JS4A 3ZL7C 1VQKT 2RI3A 4FW1A 5LJ3g 4XU0A 4C0ZA 4J9DA 3CMAT 4J9GA 4OMLA 2COWA 3URGA 1FMVA 2ENMA 4FYXB 2IPOB 2EQKA 3M0PA 1VQ5Q 3EGXB 3KBGA 4MMKA 5HK3A 2ED0A 3JB9G 1ACMB 2VASA 3J80E 5GANh 4IUTA 3RNJA 4C8QG 3VS2A 4DBRA 2OTLA 2COYA 2YSQA 1VQLT 2QG9B 4JJCA 2RO0A 1OX9A 3VRZA 2H8HA 4DEYA 4BACA 2OI3A 1GXIE 5LJ5f 1H3ZA 2JM9A 1VQ7T 1PSFA 2DBKA 4XTXA 2DO3A 3VS1A 3CCMA 1YIJA 3PMIA 3SHWA 3CPWS 2ESWA 3OYYA 2PVDB 2XU8A 4F7UG 1XTDA 2HKNA 3M59A 3RR6A 2GTJA 3BDLA 1RAGB 2QA4T 3OB9A 2CKKA 4J6WA 1T0JA 1Q86U 1VQ8A 5GANj 2R57A 1YJWQ 1EFNA 1OX8A 2QQAA 2R5AA 5KYNA 1YHQT 4FSSA 2F2WA 4EIKA 4M75F 4QVDA 1WJQA 1LJOA 4LXCA 4KRTA 1UHFA 4E7JA 3LH5A 4L5GA 4C8QB 5CIUA 4F7UF 2DXUA 2LX9A 3G7ZA 1QVFA 2VKNA 2GBQA 2RHXA 2Y4YA 4JRQA 1ARKA 1M90C 2AZVA 1VQ6T 1TSFA 2SEMA 4IIMA 3U23A 3CXCS 4RTVA 2DKGA 3L2WA 3TU4K 3DLLA 3CC4T 2DE0X 4Y91A 3QSUA 3M58A 4LN2A 4J8OA 5CQYA 3M56A 3CD6A 4C0GA 3L2QA 1Y07A 4QQGA 4M7AF 1E6HA 1PD1A 1BYMA 9ATCB 3E2UA 4MZPA 1QCFA 2G6FX 3QDRB 5KE2A 2QEXQ 3A8MB 1KSWA 1WZOA 3EG9A 2VWFA 4M75C 2XIDA 2QGFB 4O5VA 2KMTA 1KG1A 1NJIC 1H641 4PJJA 3RDVA 2DEUA 5KYUB 3I35A 1RAFB 1EZZB 1X6GA 4J6YA 3H9NA 5CO7A 2MAMA 5GANd 3OW2P 1M90R 2OTLT 2XI9A 1FWZA 3CCUT 1X43A 3C12A 2NUTB 4C92A 5CR2A 4K11A 4FYYB 1NJIU 1SG5A 1Y71A 1M5Q1 1O75A 3QJ6A 4HA8A 1LPLA 2RA2A 4EPCA 4JJBA 2PNIA 2CREA 2EYQA 4DBFA 1IZ6A 4CC2A 5KYXA 2QQSA 4M7AC 2M0YA 1M3BA 3CCMT 1YIJT 1LNXA 2X35A 2EWNA 4OB2B 3KFVA 1FX7A 1QKXA 1KQ1A 2DNUA 1BKBA 1SRMA 2J06A 4E7ZA 3OYBA 1IGUA 1NJIR 4AG2C 5D7UA 3TSWA 4QKUA 4M78A 3JCMd 5KYYA 1GCQA 1VQ8T 5KCHA 4LDXA 3BY7A 2RQVA 3TEEA 1VQ9Q 3MCAB 1KQSS 2FPFA 2K2VA 2EQMA 2BZYA 4LNPA 1WYXA 4GLKA 1A0NB 4J9BA 4EMKB 1ZA2B 1U1SA 2JUFA 1VQOA 3VUZA 4D8KA 1MNDA 5FW9A 2K5FA 2HSPA 1TH7A 3A1PA 3RIRA 4E7LA 1K9AA 2M1HA 2W0ZA 4VUBA 3QZ9B 3META 1KIKA 1HYOA 3ASKA 5CQXA 3V7CA 4RG8A 3L2UA 1H3HA 4MDWA 2RF0A 3T9NA 4J9HA 2FZGB 3BFMA 5GAOp 3OYDA 3UATA 4HCKA 3CD6T 2YDLA 1AZGB 3V8LA 2YT6A 1JBMA 4X9CA 1VIEA 1W70A 2K3XA 3O8VA 2X3XD 2LMJA 1WX6A 1VQPQ 2NLUA 3PVLA 4FT4A 2DPPB 3PVQA 2BUDA 3X28B 3I5RA 3X24B 3FEOA 1BI3A 1QP3A 2MWOA 4MMLA 2RK1A 1C0MA 4XTZA 3VS6A 4M7DE 2MMPA 4OMPA 2OTJA 2L2PA 4F14A 4JZ4A 5GANe 1PRMC 4M7DD 1K4US 2VUBA 2ZPFB 4A4EA 4E47A 4N4IA 4DBQA 2P0KA 2HBPA 2ED1A 3OYJA 4C0DB 1FMKA 3QUIA 2K79A 5IXFA 3OYHA 5I2MA 4BUGA 2DIGA 4ZNXA 2A28A 4II1A 4A4GA 4EDUA 5FU6C 4FYWB 2CSIA 4N4GA 3HKSA 3VYGA 3FDRA 3CC7Q 1OULA 5LJ5g 3OY9A 4DEXA 2J7IA 3H0IA 3LW5E 3L2VA 1YJNQ 2EIFA 4RMOA 4C0DC 1X6BA 4E6RA 3KXTA 3LLRA 1AT1B 2E3HA 4C5HA 2RJFA 4LE9A 3PIPA 3I56Q
chains in the Genus database with same CATH topology
2VYTA 4RCBA 3G4SA 2DEQA 1G3SA 1MGQA 3TCJA 3FC3A 2RD1A 1WJRA 3C94A 3L1AA 2KSSA 4OMFB 5IAYA 1FXXA 5LL6S 4BY6B 3CMEA 3JB9F 2DZCA 1G3TA 4IKFA 5GAOl 3G4ST 5EG2A 1Q81U 1N6AA 3MEVA 1VUBA 3UWNA 4F7UE 1KD1C 1W2BS 3CCJT 4C8QF 2RI5A 2QA4A 4HCZA 2M16A 3M57A 3QIIA 3SFMA 2KQWA 2X4XA 4JRIA 4CRIA 3UPUA 1N9RA 4BE0A 4PJOA 4M78G 4JDSA 3UT1A 4ELYC 5CKDA 3RKYA 2HNIA 1YHQA 2E1HA 4HT9A 4MZMA 3LWIA 2DD4A 4C92F 2D0QB 4M7AA 2ZPGB 1KQSA 5D6XA 4KT0E 1VQ5A 1XNIA 3I55T 2VXFA 3R6OA 1KHIA 3JCMQ 1K73U 4NOYA 3OBWA 2E64A 1I81A 2HQEA 5IT9E 3V8JA 4PJOE 2DK3A 4BY6C 2A7YA 4DQ2A 4NL3A 2DJZA 2O4XB 5CKEA 3OS0A 3GOXA 2CS7A 3H8ZA 3QJYA 3OW2A 4E7HA 2DD5A 4PJOD 2PUKB 3VV0A 5J39A 4M7AE 3M4GA 1R8OB 2BKDN 3ER0A 4XU2A 1WQ7A 4V2SA 3WVEB 3X20B 2HAXA 4Z02A 1D3BA 2DTHA 3PT9A 5D6WA 3ZFJA 1QVGA 4KUDK 3NTHA 4IUQA 3VYHB 4X34A 4M7DC 4UC4A 5GAMf 1S72A 2DZ9A 4FM4B 2E70A 1ZHIA 1YITT 3INZA 1VQ6A 2RH2A 4M78F 3VJPA 2DAQA 4MDXA 4J7IA 5GAN3 1QP2A 3OYGA 3CC4A 3CC7T 1QW1A 1DJ7B 2YLBA 3P8DA 3PMTA 3SWNC 2KY9A 5GAMe 1YJNT 1KC8U 1KD1U 3LGFA 3P8HA 2F69A 3M55A 3L42A 2JTMA 3I56T 4QVZA 4PJOF 4J7FA 5A2QE 4HCCA 3MEUA 1ZBXA 3CEYA 1YJ9T 1VQNT 4C8QC 5A0GA 2PQWA 3PGGA 4ZGDB 1M1FA 3QO3A 4ZN3A 4NS5A 3M54A 2E41A 2JOYA 2L3RA 2JTFA 4ZGEB 4JS4A 1EIFA 2ZGWA 4QW2A 1VQKT 1YCYA 2RI3A 3DB4A 3J7AF 1M4ZA 1WQWA 2Y90A 4C92C 4M7DG 5D6YA 2O01E 4BB7A 5LJ3g 4XU0A 3S3OA 3CCRA 2K5LA 4C0ZA 5GMKi 3JAME 1YJWA 3CC2A 2DTOA 3G6EA 3M4YA 3OMCA 3HRSA 4QVCA 1X01A 4Q5WA 5FU6B 4M78B 4JRPA 3CMAT 4EMKA 5LJ3d 3URGA 5CK9A 4DOVA 4M77E 3A5ZB 3OS5A 2OTJT 1VQ4A 3CBOA 4ATOA 2EQKA 3JB9H 2LTOA 2P0PA 3NTKA 3KBGA 4MMKA 5HK3A 4M77D 1G5VA 2LT4A 3PTAA 3JB9G 2VV5A 5FROA 3ME9A 2LNVA 3V7RA 3EFSA 5J3BA 2DTIA 4MZTA 3JB9I 3J80E 1VQMT 1WGSA 3SB2A 3FLGA 3M5AA 4OP0A 2RB6A 4D6WA 5GMKh 4IUTA 4C5GA 4C8QG 5GANh 4TVRA 1Q82C 3DKMA 1W4SA 2XKOC 2FYKA 2OTLA 5FRMA 1HK9A 4C0FA 1N9SA 3UDCA 1VQLT 3MHXA 2RO0A 3E19A 2ZCFB 1JJ2S 3X25B 4M78C 4BACA 2D6FA 3CCQT 1GXIE 5LJ5f 3HRTA 1H3ZA 1BIBA 2LCLA 3JCMf 2PUOB 2JNGA 2QTXA 2DXBA 3MO8A 1BI0A 3QYHB 2RM4A 5FLXE 3OYLA 1VQ7T 2LRQA 3QYGB 2KK4A 4ZTJA 1PSFA 4M77F 4M75E 2RHIA 4XTXA 2KVQG 5LJ5e 1M1GA 4OB3B 1UGRB 1Q82U 4PJOC 2DO3A 3JCMe 3CCMA 3CCSA 3FIFA 3G71T 3PMIA 4ZTFA 1YIJA 2EFIA 3CPWS 4M75D 2ZZDA 1XOVA 4GY5A 3OYYA 3CCEA 2PVDB 2XU8A 3RUXA 4F7UG 1XTDA 2B8AA 3GP8A 3M59A 2DXCA 3KUFA 5KCOA 3M9QA 2WSEE 3CMET 2G3RA 3GIBA 4PKCC 4EMHA 3BDLA 1UGQB 1UGPB 2QEXA 1N8RC 2QA4T 4FT2A 3OB9A 2CKKA 2ZPBB 4J6WA 2DIQA 2R5MA 5GMKj 5GANj 1W2BA 2QXFA 3GF5A 1Q86U 1VQ8A 4M7DB 3JCMc 2R57A 3OYNA 2QQAA 1OZ3A 2R5AA 3J81E 1YHQT 4N0AC 4N4HA 2I2LA 5C0MA 2WSCE 4JJNK 4PJOG 5AYFA 2LCCA 2E5QA 1VQ5T 3FB9A 1NPRA 4L6V5 3ZBDA 3MEWA 3OYKA 4M75F 3NTIA 4QVDA 5GAOm 3JCMP 1I8FA 4FIBA 3SWNB 4PL6A 4HT8A 1K8AC 2RHZA 2KAFA 2VGNA 3WVDB 1WJQA 1LJOA 4E7IA 2GF7A 1QVFS 1N8RU 2CZ0B 2EQUA 4L5GA 4C8QB 3OS1A 4E7JA 2EJGA 5CIUA 4M7AD 2D9TA 4F7UF 2DXUA 2LX9A 3G7ZA 2EQJA 4XTYA 2R58A 1QVFA 4XTWA 2RHXA 4IURA 2RHUA 3FRNA 4C92B 2Y4YA 3EFRA 4YTLA 1OYXA 4M77C 3OS2A 1Q7YC 4JRQA 3QG1A 1S72T 1BIAA 4J6XA 5GAN8 5CAIA 1M90C 5GMKm 1VQ6T 2VC8A 4XAXB 4B9XA 3CXCS 2BIVA 2DKGA 1WNLA 5GAN5 3L2WA 3TU4K 1K9MC 3DLLA 3CC4T 3QSUA 1Y96B 4Y91A 3M58A 4X9DA 3C4SA 1AHJB 4OF1A 1U8RA 5CQYA 1SSFA 1NPPA 4J8OA 3M56A 3CD6A 2P0QA 4EMKC 4R56A 4KBMB 4C0GA 3L2QA 1Y07A 2EAYA 4QQGA 4XU1A 3CXCA 2P4TA 5LJ3f 1KQ2A 4M7AF 5GAMh 1WPYA 3A8HB 5GAN4 2E6NA 1BYMA 2PU9B 4MZPA 4C5EA 5C6SA 5HK0A 3S3NA 1M1KC 2EKOA 2HD0A 3EAEA 2CYZB 3TREA 3L2ZA 2XDDA 3VKIA 5KE2A 3QDRB 4KULA 5GAMd 5LJ3e 4LDYA 3M53A 4JUVA 4M77G 3V7SA 4M7DA 2DVEA 3A8MB 1ZQ1A 4ME7A 3MP6A 3P8BB 3CCRT 1K9MU 1YJWT 3CC2T 4QQ6A 3G6ET 4M75C 1VQ9A 4JLIA 2X4YA 4HCBA 4LDVA 2XIDA 4O5VA 3E9GA 2KMTA 5CCAA 1KG1A 1NJIC 4DOWA 1VQ4T 1H641 3OBYA 4IUVA 5CKFA 3QZ5B 3V8KA 2O4XA 2F5KA 3S3MA 3LGLA 3HHTB 4PJOB 1M1KU 2YHTA 3A8LB 5GANg 3CCLA 2EJFA 4J6YA 3CCUA 2RJDA 5CO7A 2MAMA 2HQXA 3PIOA 4DA4A 5DLQE 5GANd 2K5IA 2OTLT 3OYAA 3E9FA 2XI9A 3SD4A 1B34B 1FWZA 2CZ1B 2E12A 4HKEA 4R55A 3C12A 3CCUT 3CCVA 1BI2A 3RKWA 4L59A 4A54A 3JCMb 4FSXA 3OYFA 5HY6A 1V29B 4C92A 5CR2A 5A0DA 3OYMA 1NJIU 1XQHA 3N5BB 1Y71A 3RMQA 1M5Q1 1OI1A 3QHSA 1O75A 4M75G 3QJ6A 1JJ2A 4HA8A 4EPCA 2RA2A 4JRKA 5GAMj 4OB1B 1HXDA 1NE8A 2RHYA 4ZN1A 2XHCA 2EYQA 3A8GB 4B9WA 1D3BB 3LH0A 2CZ6B 1IZ6A 4RG2A 5A0LA 1M8VA 1Y96A 2QQSA 4JLGA 3OYCA 4M7AC 3MP1A 4IUPA 3AHUA 1OZ2A 4C92E 1YI2A 2Y4XA 3CCMT 3CCST 1YIJT 1LNXA 1NZ9A 2FHDA 2GQVA 1JB0E 5FU7C 2FB7A 2X35A 5LJ5h 2L5QA 2L89A 3CCET 2EWNA 4OB2B 4C92D 3JCMh 3CPWA 2KDSA 2CGHA 2XICA 1FX7A 3LX7A 1RI0A 1KQ1A 2LC4A 1BKBA 1VIFA 2QQ9A 4BI4A 1VQPA 3OYBA 1G3WA 1WJSA 3VUBA 5LJ5d 2LQKA 2K57A 1PSEA 3JCMd 4M78A 4PLLA 4XTUA 2QEXT 3CCJA 1VQPT 1K73C 1G3YA 1JRIA 3H6ZA 3JRZA 3RKXA 5KCHA 4BDYA 1VQ8T 4M77B 2QQRA 2F5TX 3BY7A 3GLXA 4LDXA 2LDMA 1P92A 3TEEA 1YBYA 2IG0A 2L8DA 3MCAB 3LWHA 4OB0B 1KQSS 3Q1JA 2XDPA 4XU3A 4M7AG 5FRNA 2K2VA 2EQMA 4PNOA 2RK2A 1M9SA 1X6OA 4M78E 3I55A 1IREB 2E6ZA 3WXMB 3JCMX 4GLKA 3F70A 1UGSB 4EMKB 4C5IA 1U1SA 2JUFA 4XK8E 4M78D 3JCMV 4JS5A 2MF2A 2A3LA 3VUZA 3OW2S 1VQOA 2QI2A 5IN1A 2K5FA 2WACA 3ZEHA 3CBPA 1B34A 4RKUE 2LVMA 1VQOT 1TH7A 2YLCA 2XK0A 3C95A 4FU6A 3SDZA 4ELZC 4CI0C 5GAOn 3RIRA 2MI6A 5GMKl 3MP8A 4A53A 1QVGS 2WSFE 4E7LA 3OSVA 1KC8C 1K8AU 2M1HA 2PVOB 2FL7A 4BE1A 4VUBA 5LJ5j 5GAN6 3RMSA 4LDWA 3QZ9B 3DB3A 4N0AA 2X4JA 1X75C 3META 3OQ5A 4M75B 3QPHA 4EMGA 3ASKA 5CQXA 3QBYA 3V7CA 2GFUA 5DY9A 3OA6A 1YITA 4RG8A 2V8JA 1I4K1 4J5YA 3L2UA 4MDWA 4LD6A 4E7KA 1UEBA 3S6WA 3T9NA 2K4YA 3CC7A 3RERA 2ZPHB 3BFMA 1QVPA 5CVIA 5I21A 5DM7R 2V8KA 2GFAA 5GAN7 5GAOp 3OYDA 1N27A 3V8LA 1YJNA 2XD0A 3CD6T 1JBMA 4F7UB 2QQBA 3OMGA 4FL6A 5GAMg 1U1TA 2RJEA 1Q7YU 4LD9K 4X9CA 1VIEA 3I56A 2OAUA 2VGMA 3HSBA 1YJ9A 1M90U 3GPLA 1VQNA 4PLIA 5CKHA 5DLOA 2K3XA 1Y7XA 3O8VA 1UB4A 2E10A 3BDUA 3HFOA 4A4KA 5KE3A 2VXEA 3OSSC 2NLUA 2CZ7B 3DLMA 3RESA 4A4HA 2RI2A 4FT4A 2V8IA 2DPPB 3NFCA 4IUUA 5CKBA 4ZGJB 3HPWA 1VQKA 4Y28E 2XDBA 4M77A 2BUDA 3CPFA 4XTVA 2EJ9A 3X28B 1MHNA 4BI3A 3X24B 5M9OA 5GANf 3BW1A 3OYEA 3FEOA 4A4FA 1BI3A 2M0OA 2H3JA 1O9SA 1QP3A 2MWOA 3HFNA 5LJ3h 3SWNA 3X26B 4MMLA 3CMAA 2RK1A 4BD3A 4XTZA 2K3YA 5GAOq 5I2SA 2E65A 4WF2A 2MMPA 2ZPEB 1I5LA 4M7DE 2OTJA 2GCXA 4QQDA 4M7AB 3MEAA 2YRVA 2ZPIB 5GMKe 5KH6A 4BE2A 5J26A 3HRUA 4C8QA 5GANe 3JB9J 4M7DD 2JZ2A 3FJPA 2LQ8A 2X4WA 5HKCA 5FU7B 2VUBA 2ZPFB 3PFSA 4O6JA 4A4EA 3CCLT 4BDZA 3JCMJ 1VQMA 1VQ9T 4E47A 4N4IA 3JCMW 4J83A 3GNFB 1KHCA 3QKJA 2LT1A 2P0KA 2HBPA 3OYJA 4C0DB 4OVAA 2M9UA 4OGEA 3CBMA 2FVUA 3L2RA 2AHJB 3QUIA 3CCVT 1VQLA 4BI8B 1RL2A 2JVVA 4C8QE 3OYHA 3JB9D 3JSCA 3OYIA 3CCQA 5L8RE 4KUIA 5I2MA 3VU3C 4M75A 4BUGA 4C8QD 2XG8D 2DIGA 4C92G 2IVWA 3PNWC 4II1A 4A4GA 4EDUA 1LOJA 5FU6C 2PVGB 4RCCA 1Q81C 4P5NA 3E1SA 2C06A 5GAOr 4N4GA 1VQ7A 3HKSA 3QXEB 5GAN2 3VYGA 4OGCA 4M7DF 2JN0A 4NL2A 3HP9A 2DXTA 3FDRA 1YI2T 4F7UA 5LJ5g 3OY9A 3G71A 1BI1A 3LW5E 4LDUA 3L2VA 2MWPA 3JCMg 3PIPA 1Q86C 2EIFA 4RMOA 4C0DC 3KXTA 5LJ3j 2QDYB 3GNGA 3HL8A 3LLRA 3A8OB 2RJFA 3LYIA 4C5HA 4XQ3A 2RJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCB A;  3JB9 J;  2FYK A;  1B34 A;  1MGQ A;  2DEQ A;  5GAN 4;  2RD1 A;  1TH7 A;  2YLC A;  3L1A A;  1HK9 A;  3JB9 F;  1N9S A;  3L2Z A;  5GAO n;  3RIR A;  2DZC A;  5GMK l;  5GAO l;  4A53 A;  4F7U E;  5GAM d;  5LJ3 e;  4M77 G;  4JUV A;  3V7S A;  4C8Q F;  4M78 C;  5LJ5 j;  4M7D A;  2DVE A;  5GAN 6;  5LJ5 f;  4JRI A;  1BIB A;  1N9R A;  3JCM f;  4PJO A;  4M78 G;  4N0A A;  2QTX A;  4M75 C;  4M75 B;  2RM4 A;  3RKY A;  2HNI A;  4EMG A;  2E1H A;  4JLI A;  5DY9 A;  3V7C A;  4HT9 A;  1I4K 1;  4J5Y A;  4C92 F;  4M7A A;  1H64 1;  4M77 F;  4M75 E;  4XTX A;  3V8K A;  5LJ5 e;  4PJO C;  4PJO B;  2VXF A;  3RER A;  3BFM A;  3JCM e;  3JCM Q;  5GAO p;  5I21 A;  4NOY A;  2YHT A;  3FIF A;  5GAN 7;  3V8L A;  4M75 D;  1JBM A;  4F7U B;  5GAN g;  2E64 A;  1I81 A;  3V8J A;  1U1T A;  5GAM g;  2EJF A;  4PJO E;  4J6Y A;  4X9C A;  3RUX A;  4F7U G;  4DQ2 A;  4NL3 A;  2DJZ A;  3HSB A;  5GAN d;  4PJO D;  4M7A E;  4M7D B;  2E10 A;  1B34 B;  3BDU A;  3HFO A;  3M4G A;  2VXE A;  3RES A;  3RKW A;  3GIB A;  4XU2 A;  4A54 A;  1WQ7 A;  3JCM b;  4V2S A;  4EMH A;  4C92 A;  1D3B A;  2DTH A;  4M77 A;  4XTV A;  2EJ9 A;  1M5Q 1;  3QHS A;  4J6W A;  4M75 G;  5GMK j;  5GAN j;  4M7D C;  4HA8 A;  5GAN f;  2RA2 A;  3BW1 A;  4JRK A;  3JCM c;  1HXD A;  5GAM f;  5LJ3 h;  5GAM j;  3HFN A;  3SWN A;  4N0A C;  4MML A;  2DZ9 A;  2I2L A;  3INZ A;  4XTZ A;  1D3B B;  4M78 F;  5GAO q;  4PJO G;  2E65 A;  4WF2 A;  1I5L A;  4M7D E;  1M8V A;  1Y96 A;  5GAN 3;  3FB9 A;  4M7A C;  4M7A B;  5GMK e;  3AHU A;  4M75 F;  4C92 E;  5GAN e;  4QVD A;  1I8F A;  2YLB A;  3SWN C;  3SWN B;  4C8Q A;  5GAM e;  5GAO m;  3FJP A;  1LNX A;  4M7D D;  2FB7 A;  1LJO A;  5LJ5 h;  3JCM J;  2EWN A;  4C92 D;  3JCM W;  3JCM h;  4PJO F;  2CGH A;  1KQ1 A;  4C8Q C;  4C8Q B;  3PGG A;  2EJG A;  4M7A D;  3QO3 A;  3JCM P;  4F7U F;  2DXU A;  2E41 A;  3QUI A;  5LJ5 d;  4XTY A;  2K57 A;  2ZGW A;  4C8Q E;  4M78 A;  3JCM d;  1YCY A;  3JB9 D;  4XTU A;  4XTW A;  4M7D G;  1WQW A;  2Y90 A;  4C92 C;  4C92 B;  1JRI A;  3EFR A;  3RKX A;  4M77 C;  4M77 B;  3BY7 A;  4M75 A;  4XU0 A;  3VU3 C;  4C8Q D;  5LJ3 g;  5GMK i;  4C92 G;  2DTO A;  1BIA A;  4J6X A;  5GAN 8;  4QVC A;  5CAI A;  1LOJ A;  1X01 A;  4M78 B;  4RCC A;  5GMK m;  2VC8 A;  4EMK A;  5LJ3 d;  5GAO r;  2DKG A;  4M77 E;  4XU3 A;  4M7A G;  5GAN 2;  1WNL A;  4PNO A;  4M7D F;  5GAN 5;  2JN0 A;  3JB9 H;  4NL2 A;  3QSU A;  1Y96 B;  4M78 E;  4Y91 A;  2DXT A;  4MMK A;  4X9D A;  4M77 D;  3JCM X;  4F7U A;  5LJ5 g;  3JB9 G;  4HT8 A;  4EMK C;  3V7R A;  4EMK B;  3EFS A;  4XU1 A;  2DTI A;  2EAY A;  3JCM g;  1U1S A;  3JB9 I;  4M78 D;  3SB2 A;  3JCM V;  5GMK h;  4OP0 A;  2RB6 A;  5LJ3 j;  5GAN h;  5LJ3 f;  4C8Q G;  1KQ2 A;  5GAM h;  4M7A F;  4XQ3 A;  1WPY A; 
#chains in the Genus database with same CATH topology
 3G4S A;  4RCB A;  3EGD B;  3TCJ A;  2KSS A;  3CME A;  1M3A A;  2DZC A;  1TU0 B;  2DER A;  3UWN A;  1IB8 A;  1KD1 C;  2CDT A;  2KNB B;  1WHJ A;  3UPU A;  3SFM A;  1GFC A;  4E2F B;  3RKY A;  1RAH B;  4M4Z A;  1AWW A;  4MZM A;  2DD4 A;  1YNZ A;  1XNI A;  2VXF A;  2K2M A;  3OBW A;  1E6G A;  4R0K A;  4DQ2 A;  1UDL A;  1KD1 U;  1H8K A;  2EVR A;  3QJY A;  3C0C A;  2DD5 A;  2PUK B;  5J39 A;  2BE9 B;  1ZSZ C;  3ER0 A;  2KXD A;  4V2S A;  5D6W A;  3ZFJ A;  1QVG A;  4XQ3 A;  3VYH B;  4X34 A;  1NG2 A;  5GAM f;  2KR3 A;  4JPB W;  5L23 A;  1SSH A;  2GQI A;  3PMT A;  1KD1 R;  3LGF A;  3P8H A;  3G71 Q;  1U5S A;  3L42 A;  3CPW P;  4HCC A;  1ZBX A;  3QO3 A;  3M54 A;  4ZGE B;  4QW2 A;  4M7D G;  2Y90 A;  5D6Y A;  1OEB A;  2C0I A;  4BB7 A;  3S3O A;  3EH1 A;  3CCR A;  2DTO A;  3M4Y A;  3OMC A;  1X01 A;  4JRP A;  5CK9 A;  4AFS C;  1Z9Z A;  4WTO B;  2OTJ T;  3CBO A;  1UUE A;  1WXT A;  1G5V A;  3EFO A;  2VV5 A;  5FWB A;  3V7R A;  3EFS A;  5J3B A;  4CC4 B;  1PM3 A;  1WGS A;  3SB2 A;  4OP0 A;  2RB6 A;  4D6W A;  4C5G A;  3DKM A;  4FYV B;  4OMQ A;  3ULR B;  4HVW A;  5FRM A;  4PJN A;  1HK9 A;  2AKK A;  1N5Z A;  2ZCF B;  3RBB B;  1JJ2 S;  4RTZ A;  2PUO B;  2JNG A;  5FLX E;  1PHT A;  1S72 Q;  2KRN A;  2M02 A;  1UHC A;  2CP2 A;  3QYG B;  2KK4 A;  3H0F A;  4M77 F;  4M75 E;  3CXC P;  4Y92 A;  3FIF A;  4ZTF A;  4M75 D;  1SF9 A;  3CCE A;  1H92 A;  2B8A A;  2LQW A;  5KCO A;  2WSE E;  2B86 A;  2DMO A;  3CME T;  2CP7 A;  4EMH A;  2ZPB B;  1W2B A;  2DIQ A;  2R5M A;  3GF5 A;  4M7D B;  1OZ3 A;  3CC2 Q;  4N0A C;  3G6E Q;  4N4H A;  2I2L A;  2WSC E;  4JJN K;  3EGX A;  3ZBD A;  1VQ4 Q;  3OYK A;  3NTI A;  4HT8 A;  4FIB A;  3SWN B;  4PL6 A;  1K8A C;  2KAF A;  1G83 A;  2CUB A;  2NUZ A;  3H41 A;  2GF7 A;  4J9C A;  2EQU A;  3OS1 A;  2EJG A;  4M7A D;  1M8M A;  2CP5 A;  1K0X A;  2EQJ A;  1YWP A;  3H0H A;  1K76 A;  4YTL A;  1OYX A;  4M77 C;  4J6X A;  2C0O A;  4B9X A;  5GAN 5;  1RAD B;  1Y96 B;  1MV3 A;  4X9D A;  1U8R A;  4Z8A A;  2MYS A;  4KBM B;  2I0N A;  3CXC A;  3CCS Q;  2EAY A;  2O31 A;  3VS0 A;  3UA7 A;  1WHK A;  3I5S A;  1PCX A;  3A8H B;  5GAN 4;  2PU9 B;  5C6S A;  1R0B G;  3S3N A;  2EKO A;  2CYZ B;  3TRE A;  3L2Z A;  1RLP C;  2MCN A;  4LDY A;  2V1Q A;  1K8A R;  2DVE A;  4ME7 A;  3P8B B;  2KI7 A;  3CCR T;  4QQ6 A;  4LDV A;  1AOJ A;  4GBQ A;  5CCA A;  1WHL A;  4IUV A;  2KBT A;  1KQS P;  3S3M A;  2H3E B;  3TVT A;  3CCL A;  3EHQ A;  1NM7 A;  2HDA A;  3CCU A;  2RJD A;  3EGU A;  2HQX A;  3OYA A;  1TUG B;  1GL5 A;  2CZ1 B;  3CCV A;  3RKW A;  4L59 A;  3JCM b;  5HY6 A;  5A0D A;  3OYM A;  4M75 G;  1NE8 A;  2ECZ A;  1F1B B;  2RHY A;  2XHC A;  1C6V X;  2YUQ A;  4B9W A;  1D3B B;  1CKA A;  1LCK A;  2CZ6 B;  3D7S B;  2YWW A;  1YFN A;  1M8V A;  4JLG A;  3OYC A;  4X1V A;  4C92 E;  1TOV A;  2D1X A;  1NZ9 A;  2GQV A;  1JB0 E;  3CCE T;  4C92 D;  3JCM h;  1OPL A;  1SHF A;  2NYS A;  3LX7 A;  2JW4 A;  1VIF A;  4QT7 A;  4RTY A;  1KFZ A;  1PG5 B;  3VUB A;  1WJS A;  5LJ5 d;  2K57 A;  1PSE A;  2EYY A;  2EBP A;  3UA6 A;  4PLL A;  4XTU A;  1B07 A;  1VQP T;  3M0S A;  1G3Y A;  3H6Z A;  3JRZ A;  3RKX A;  2QQR A;  2F5T X;  2LDM A;  1P92 A;  2KXC A;  1YBY A;  2IG0 A;  2EGC A;  3LWH A;  5GJW B;  4M7A G;  5FRN A;  1TWB A;  3I55 A;  4M78 E;  3JCM X;  2L3Q A;  1UGS B;  4C5I A;  3I9Q A;  4M78 D;  1JQQ A;  2QI2 A;  3REA B;  3CBP A;  3NGP A;  4AT1 B;  2YLC A;  2XK0 A;  4CI0 C;  2MI6 A;  5GMK l;  2ROL A;  2WSF E;  1KC8 C;  2KE9 A;  2PVO B;  2CP3 A;  2LCS A;  4LDW A;  2MPX C;  1X75 C;  4M75 B;  1M2O A;  4EMG A;  1W6X A;  5DY9 A;  1YIT A;  1I4K 1;  4LD6 A;  1UGV A;  1UEB A;  3S6W A;  3RER A;  2NUP B;  1QVP A;  2GFA A;  1PNJ A;  1YI2 Q;  1N27 A;  2JTE A;  2J6O A;  4F7U B;  2F2X A;  1JEG A;  4LD9 K;  5GAM g;  1U1T A;  2RJE A;  4PJL A;  2DYI A;  1YJ9 A;  1M90 U;  2JS2 A;  4JZ3 A;  5KE3 A;  2VXE A;  3OSS C;  2CZ7 B;  3DLM A;  3PE0 A;  1NYF A;  3RES A;  1QCO A;  1CSK A;  2V8I A;  3NFC A;  3HPW A;  1PKS A;  3CCJ Q;  2EJ9 A;  4BI3 A;  5GAN f;  1D09 B;  3GBQ A;  2EYW A;  5LJ3 h;  4BD3 A;  2KT1 A;  4AFQ C;  5ECA A;  2KYB A;  4M7A B;  3MEA A;  2VVK A;  5KH6 A;  5J26 A;  3HRU A;  4BE2 A;  3JB9 J;  3FJP A;  1KC8 R;  1WA7 A;  2X4W A;  3CCL T;  1VQM A;  2LNH B;  3GNF B;  1KHC A;  3QKJ A;  2LT1 A;  1BU1 A;  3CCV T;  4B6M A;  4BI8 B;  2JVV A;  3CCQ A;  5L8R E;  4OMN A;  4KUI A;  3VU3 C;  3VRY A;  4C92 G;  1ZLM A;  1LOJ A;  2FEI A;  5EC7 A;  2DXT A;  5LJ3 j;  3GNG A;  3HL8 A;  3M0R A;  1G3S A;  1MGQ A;  2DL8 A;  2YXY A;  1VQN Q;  2RD1 A;  1WJR A;  3L1A A;  1BB9 A;  5HCK A;  1U3O A;  2J6K A;  5GAO l;  5EG2 A;  1PC0 A;  1N6A A;  2EYZ A;  1QCN A;  1VQK Q;  2O9V A;  4HCZ A;  3M57 A;  4CRI A;  4JRI A;  1IXD A;  1GBQ A;  1N9R A;  4PJO A;  4M78 G;  4JDS A;  2ZAE A;  5CKD A;  1TG0 A;  3CMA Q;  3LWI A;  4C92 F;  2D0Q B;  1VQ5 A;  1BK2 A;  3I55 T;  3EG9 B;  3R6O A;  2BE7 D;  2A7Y A;  3OW2 A;  3OS0 A;  4E7H A;  3H8Z A;  2EQI A;  2DYB A;  2BKD N;  1RAI B;  4XU2 A;  2HQH A;  1VQL Q;  1J3T A;  4KUD K;  3NTH A;  1VOM A;  2EKH A;  3IQL A;  1JJ2 P;  4ORZ A;  2YUO A;  2DZ9 A;  1YIT T;  2E70 A;  2AT1 B;  4M78 F;  4J7I A;  2AKL A;  1VQ7 Q;  1MMG A;  1QP2 A;  4Z89 A;  2COZ A;  2DL3 A;  1D0Z A;  3M55 A;  5KYX B;  3EGD A;  4PJO F;  5A2Q E;  3MEU A;  1YJ9 T;  1PD0 A;  3PGG A;  2JMC A;  4ZN3 A;  2PZ1 A;  2L3R A;  2A0F B;  3EHR A;  1EIF A;  3EH2 A;  2ZGW A;  4E7S A;  1GFD A;  4C92 C;  2O01 E;  4RTX A;  2QA4 Q;  4CC7 A;  1YJW A;  5GMK i;  3AT1 B;  1TUC A;  5FU6 B;  4M78 B;  1YHQ Q;  5LJ3 d;  4DOV A;  4M77 E;  1X27 A;  3JB9 H;  2P0P A;  3NTK A;  4M77 D;  2LT4 A;  3A98 A;  2QYZ A;  2LNV A;  3NHN A;  3JB9 I;  3VS5 A;  1VQM T;  5GMK h;  4KGV B;  1Q82 C;  4HVU A;  1ABO A;  2FYK A;  1PKT A;  3UDC A;  2JT4 A;  2RQR A;  1Y57 A;  3X25 B;  4M78 C;  3EG1 A;  3CCQ T;  1OU8 A;  2E4H A;  3HRT A;  1GCQ C;  2A36 A;  2QTX A;  2DXB A;  1BI0 A;  3QYH B;  2QDL A;  3OYL A;  2LRQ A;  1IHV A;  1X2Q A;  2PTK A;  4ZTJ A;  2RHI A;  1Q82 U;  2KVQ G;  4PJO C;  2KYM A;  3JCM e;  3CC4 Q;  4FCY A;  1XOV A;  2JS0 A;  2MIO A;  3RUX A;  2DXC A;  1M2V B;  2FPD A;  1ZSZ B;  4AMC A;  2G3R A;  3GIB A;  4PKC C;  2YUP A;  1OOT A;  1UGP B;  2QEX A;  5GMK j;  2QXF A;  3JCM c;  2JMA A;  3OYN A;  1IHW A;  2HBW A;  1Q82 R;  2P4R A;  1VQ5 T;  4L6V 5;  1NPR A;  4PFO A;  5GAO m;  1I8F A;  2QAS A;  1Z9Q A;  2RHZ A;  2VGN A;  3WVD B;  2GGR A;  2KRS A;  1NEG A;  2D9T A;  2OTL Q;  1BCM A;  4XTY A;  2MK5 A;  2R58 A;  4XTW A;  1I5O B;  4IUR A;  2RHU A;  3FRN A;  1BCO A;  3OS2 A;  1Q7Y C;  2CP6 A;  5IXB A;  4XAX B;  2BIV A;  3THK A;  1WNL A;  2ABL A;  3SEM A;  1AHJ B;  4OF1 A;  1M3C A;  2P0Q A;  3CCM Q;  1YIJ Q;  4XU1 A;  1PRL C;  3TQ7 P;  1KQ2 A;  1ZA1 B;  1KK7 A;  2J6F A;  1M1K C;  1OV3 A;  4C5E A;  5HK0 A;  2J05 A;  3EAE A;  4KGZ B;  2SRC A;  1PWT A;  4Z88 A;  5GAM d;  5LJ3 e;  4M77 G;  4M7D A;  1ZQ1 A;  2VB6 A;  1YJW T;  1VQ8 Q;  2D0N A;  2AZS A;  2HEQ A;  1VQ9 A;  2DET A;  4HCB A;  3OBY A;  1MMA A;  5CKF A;  2RN8 A;  2O4X A;  2F5K A;  3LGL A;  1M1K U;  3HTR A;  2YHT A;  3NPF A;  3A8L B;  2KT8 A;  5GAN g;  1D0Y A;  1Q7Y R;  1JXO A;  1WXU A;  1YP5 A;  1Y0M A;  3PIO A;  5DLQ E;  2K5I A;  4R55 A;  1B34 B;  1ABQ A;  2RMO A;  4AG1 C;  2LJ3 A;  4FSX A;  2A37 A;  3OYF A;  3VS4 A;  2O88 A;  1XQH A;  2DA9 A;  3N5B B;  3EG0 A;  4JRK A;  1HXD A;  4LUE A;  4ZN1 A;  2RPN A;  3LH0 A;  1M1K R;  2RNA A;  4RG2 A;  1Y96 A;  4IUP A;  3AHU A;  2GNC A;  4ANJ A;  1NBE B;  1Q95 G;  5FU7 C;  1WI7 A;  2FB7 A;  5LJ5 h;  3CD6 Q;  2L89 A;  3CPW A;  1AD5 A;  2QTV A;  2LC4 A;  1EX4 A;  2EGA A;  2QQ9 A;  1VQP A;  2MOX A;  2CH4 W;  1G3W A;  4AFZ C;  2LQK A;  4HXJ A;  1UFF A;  4DBH A;  1NLO C;  2FRY A;  2QGG A;  2QEX T;  1K73 C;  1JRI A;  4BDY A;  1UEC A;  4M77 B;  3GLX A;  1KJW A;  1WFW A;  2L8D A;  4OB0 B;  2HL3 A;  3Q1J A;  2XDP A;  4PNO A;  1V1C A;  2RK2 A;  1M9S A;  2KRM A;  2FO0 A;  1IRE B;  2E6Z A;  3WXM B;  1D0X A;  1NLP C;  4XK8 E;  4JS5 A;  2MF2 A;  5IN1 A;  1TTH B;  1YN8 A;  4RUG A;  1FMW A;  3EFO B;  4RKU E;  1UG1 A;  1T3S A;  2LP5 A;  3C95 A;  2HKQ B;  5GAO n;  3MJX A;  1TS9 A;  4A53 A;  1QVG S;  2XMF A;  3OSV A;  1K8A U;  3MKD A;  2FL7 A;  1ZBJ A;  2DLP A;  5LJ5 j;  3RMS A;  3DB3 A;  2X4J A;  1X69 A;  3OQ5 A;  3QPH A;  3JV3 A;  2V8J A;  1VYV A;  2IIM A;  2K4Y A;  3CC7 A;  2ZPH B;  5I21 A;  5DM7 R;  1T0H A;  5GAN 7;  1YJN A;  1K73 R;  2XD0 A;  2GTO A;  4J9F A;  3OMG A;  2OJ2 A;  3I56 A;  2OAU A;  3HSB A;  3GPL A;  4PLI A;  5DLO A;  1Y7X A;  1UB4 A;  2E10 A;  2P84 A;  3BDU A;  4A4K A;  1GBR A;  2XDB A;  3CPF A;  1MHN A;  2CT4 A;  4IKF A;  2M0O A;  2H3J A;  1RAB B;  3X26 B;  1VQ9 T;  3HFN A;  5GAO q;  2E65 A;  2ZPE B;  2M51 A;  5GMK e;  4C8Q A;  2JZ2 A;  3PFS A;  4BDZ A;  3M0Q A;  3EG3 A;  1VQO Q;  4J83 A;  1K1Z A;  1G8X A;  4F16 A;  2HMA A;  1W1F A;  1WHM A;  3QWX X;  3CBM A;  3L2R A;  2AHJ B;  3JSC A;  1X2K A;  1QVF P;  5KYW B;  3OYI A;  1D1C A;  2BZX A;  4JJD A;  1AWJ A;  4RTW A;  4M75 A;  2V26 A;  4F04 B;  5I22 A;  2IVW A;  3PNW C;  4P5N A;  1R0C B;  3E1S A;  5GAO r;  2C06 A;  3QXE B;  3R6N A;  1IRX A;  2JN0 A;  2NUP A;  1HJD A;  2X3W D;  4GLM A;  4F7U A;  3G71 A;  1CKB A;  2MWP A;  2E3I A;  2DRM A;  1Q86 C;  1RLQ C;  2QDY B;  3LYI A;  3A8O B;  2RJC A;  1K0S A;  4PJM A;  1RI9 A;  3QWY A;  3C94 A;  3JB9 F;  5LL6 S;  4ESR A;  1G3T A;  1VUB A;  1W2B S;  4C8Q F;  2RI5 A;  2X4X A;  2DJQ A;  5KYU A;  2HNI A;  1NYG A;  1ZUK A;  1YWO A;  4M7A A;  2ZPG B;  1KQS A;  4KT0 E;  2OTJ Q;  2CSQ A;  1UJ0 A;  1KHI A;  3JCM Q;  8ATC B;  2E64 A;  5IT9 E;  3V8J A;  4PJO E;  2DK3 A;  1MNE A;  2NUT A;  1MMD A;  4NL3 A;  2CP0 A;  5CKE A;  4PJO D;  1V76 A;  3VV0 A;  1R8O B;  2BZ8 A;  1WQ7 A;  4J9I A;  3WVE B;  4Z02 A;  3PT9 A;  2EW3 A;  1SEM A;  1Q86 R;  4KH1 B;  2FRW A;  1S72 A;  1HD3 A;  4F17 A;  4FM4 B;  5IH2 A;  1JO8 A;  3M0T A;  2F2V A;  3CC7 T;  1QW1 A;  1DJ7 B;  1KC8 U;  1YJN T;  2KY9 A;  1YCS B;  2L3P A;  2JTM A;  2LJ1 A;  3I56 T;  2L0A A;  3NMZ C;  4C8Q C;  5A0G A;  3G4S Q;  1M1F A;  1OPK A;  2F1L A;  3REB B;  4NS5 A;  2JJ9 A;  2JTF A;  3CME Q;  1OU9 A;  1YCY A;  3DB4 A;  3BE3 A;  1M4Z A;  1WQW A;  3J7A F;  1I07 A;  2K5L A;  3JAM E;  3CC2 A;  4KGX B;  3G6E A;  2K6D A;  4QVC A;  3HRS A;  4Q5W A;  4EMK A;  1WIE A;  3A5Z B;  2FZC B;  3OS5 A;  1VQ4 A;  4ATO A;  2LTO A;  1SKU B;  2QK0 A;  3M0U A;  1QWE A;  3PTA A;  5FRO A;  3ME9 A;  1HSQ A;  2DTI A;  4MZT A;  3FLG A;  3M5A A;  2OAW A;  4TVR A;  5AT1 B;  1W4S A;  2XKO C;  1VYT A;  2KRO A;  4C0F A;  4OMO A;  1N9S A;  3MHX A;  1BBZ A;  2DRK A;  3E19 A;  2D6F A;  2FZK B;  1BIB A;  2LCL A;  3JCM f;  1B3Q A;  3MO8 A;  2RM4 A;  2X51 A;  1OQK A;  1U06 A;  1G2B A;  4FW2 A;  5LJ5 e;  1M1G A;  4OB3 B;  1UGR B;  2RQW A;  3CCS A;  3G71 T;  2EFI A;  2K9G A;  2ZZD A;  4GY5 A;  1ZUU A;  3GP8 A;  3VS3 A;  3KUF A;  3M9Q A;  1UGQ B;  1N8R C;  4FT2 A;  2ATC B;  3CCR Q;  2K3B A;  3J81 E;  2BTT A;  5C0M A;  1VA7 A;  4PJO G;  1MUZ A;  5AYF A;  2LCC A;  2E5Q A;  3FB9 A;  3MEW A;  3JCM P;  4IIO A;  1WHH A;  2V1R A;  4E7I A;  4KH0 B;  1R77 A;  2D8J A;  1QVF S;  6AT1 B;  1N8R U;  2CZ0 B;  1QWF A;  2W10 A;  1TUD A;  2DFU A;  3CQT A;  3EG2 A;  1RAA B;  2ROT A;  1SPK A;  2NWM A;  4C92 B;  1C1A A;  3EFR A;  3QG1 A;  1S72 T;  1BIA A;  5GAN 8;  4LUD A;  5GMK m;  2OX7 A;  2VC8 A;  4PK4 A;  1K9M C;  3C4S A;  1WHG A;  1SSF A;  1NPP A;  4EMK C;  4R56 A;  1N8R R;  2P4T A;  2HL5 C;  2CT3 A;  5LJ3 f;  2DBM A;  1M2V A;  5GAM h;  3CCE Q;  1WPY A;  2E6N A;  2AIR B;  1ZSZ A;  2HD0 A;  5FWC A;  3TSZ A;  2C0T A;  2XDD A;  3VKI A;  4KUL A;  1SHG A;  3M53 A;  4JUV A;  3V7S A;  2LQN A;  5KYY B;  5GJV B;  3MP6 A;  1WDX A;  1QQJ A;  4RTU A;  1K9M U;  4CC3 A;  4OMM A;  3CC2 T;  1ZX6 A;  3G6E T;  1RAC B;  4JLI A;  2X4Y A;  1XJW B;  2L3S A;  1AEY A;  3E9G A;  4DOW A;  1VQ4 T;  1AWX A;  3QZ5 B;  3V8K A;  4PJO B;  3HHT B;  4PFZ A;  2EJF A;  4DA4 A;  3E9F A;  2FG0 A;  3SD4 A;  4HKE A;  2E12 A;  1BI2 A;  1QLY A;  1AWO A;  4A54 A;  1K9M R;  1V29 B;  1WLP B;  3RMQ A;  1QVG P;  1OI1 A;  3QHS A;  1VQ6 Q;  1JJ2 A;  1AVZ C;  5GAM j;  4OB1 B;  1IO6 A;  3A8G B;  2O2O A;  5A0L A;  1TXQ A;  3MP1 A;  1OZ2 A;  1UTI A;  1YI2 A;  2Y4X A;  3CCS T;  2DIL A;  2FHD A;  4AFU C;  2L5Q A;  8AT1 B;  3QDF A;  2CH4 A;  2YUN A;  2KDS A;  2XIC A;  2CGH A;  1RI0 A;  4BI4 A;  1M30 A;  1UE9 A;  4HVV A;  1GRI A;  3CCJ A;  2Z0W A;  2KEA A;  1M27 C;  4XU3 A;  2K7A A;  1X6O A;  1E7O A;  3G1J A;  3F70 A;  3JCM V;  3CCL Q;  3OW2 S;  2A3L A;  3CCU Q;  2WAC A;  3ZEH A;  1AZE A;  1IGQ A;  1B34 A;  2LVM A;  1VQO T;  4FU6 A;  3SDZ A;  4ELZ C;  3MP8 A;  5IHN A;  3CCV Q;  4BE1 A;  5GAN 6;  4N0A A;  3UF4 A;  3QBY A;  2GFU A;  1MV0 B;  1NEB A;  1SRL A;  3OA6 A;  2D8H A;  4J5Y A;  2RQU A;  4E7K A;  2LX7 A;  5CVI A;  2V8K A;  3VS7 A;  2E5K A;  2QQB A;  3O5Z A;  4FL6 A;  1Q7Y U;  2DL4 A;  2VGM A;  1VQN A;  5CKH A;  4D8D A;  2O9S A;  2DL7 A;  3HFO A;  4A4H A;  2RI2 A;  5I11 A;  4IUU A;  4ZGJ B;  5CKB A;  1VQK A;  4Y28 E;  4M77 A;  4XTV A;  1W2B P;  5M9O A;  4WCI A;  3BW1 A;  3OYE A;  4A4F A;  2DL5 A;  1O9S A;  1QKW A;  3SWN A;  3CMA A;  2DM1 A;  2K3Y A;  1I5L A;  5I2S A;  4WF2 A;  1D1B A;  2GCX A;  4QQD A;  1ZUY A;  2YRV A;  2ZPI B;  4RTT A;  3I55 Q;  2RQT A;  2LQ8 A;  5HKC A;  5FU7 B;  2DVJ A;  2JM8 A;  4O6J A;  3JCM J;  3JCM W;  1FYN A;  2QAZ A;  1MMN A;  2A08 A;  4OVA A;  2M9U A;  4OGE A;  2FVU A;  5IHI A;  1VQL A;  1RL2 A;  4C8Q E;  3JB9 D;  4C8Q D;  2XG8 D;  1QMC A;  2PVG B;  4RCC A;  1Q81 C;  1YIT Q;  1VQ7 A;  1B7T A;  2HCK A;  5GAN 2;  4OGC A;  4M7D F;  4NL2 A;  1ZSG A;  3HP9 A;  1YI2 T;  1BI1 A;  1RAE B;  4LDU A;  3JCM g;  1I1J A;  2LJ0 A;  5CAI A;  1UJY A;  2VYT A;  3MPU B;  2DEQ A;  1YJ9 Q;  3FC3 A;  5IHK A;  5IAY A;  4OMF B;  1FXX A;  4BY6 B;  3G4S T;  1Q81 U;  3MEV A;  4F7U E;  3CCJ T;  1S1N A;  2EGE A;  2QA4 A;  2M16 A;  3QII A;  4A63 B;  2KQW A;  1T3L A;  3FJ5 A;  4BE0 A;  1RUW A;  3UT1 A;  4ELY C;  1D1A A;  2X9H A;  2E1H A;  1YHQ A;  4HT9 A;  2DF6 A;  5D6X A;  2AK5 A;  4J9E A;  1LVK A;  2HSE B;  2DX1 A;  1K73 U;  4NOY A;  2EPD A;  2LZ6 B;  1I81 A;  2HQE A;  4BY6 C;  1VQM Q;  2JXB A;  3GOX A;  2DJZ A;  2O4X B;  2CS7 A;  1Q81 R;  4PFP A;  4M7A E;  3M4G A;  5KYW A;  3X20 B;  2HAX A;  1D3B A;  2DTH A;  4IUQ A;  2HZY A;  2YRD A;  3CCQ Q;  4M7D C;  4UC4 A;  1I0C A;  1WXB A;  1JU5 C;  1JXM A;  1VQ6 A;  1ZHI A;  3INZ A;  2RH2 A;  3VJP A;  2DAQ A;  4MDX A;  5GAN 3;  3OYG A;  1GCP A;  3CC4 A;  2EYX A;  2YLB A;  2KGT A;  3P8D A;  3SWN C;  5GAM e;  7AT1 B;  2F69 A;  2FPE A;  2YRC A;  4QVZ A;  4J7F A;  3CEY A;  1VYU A;  2CUD A;  1VQN T;  2PQW A;  4ZGD B;  2E41 A;  2JOY A;  4JS4 A;  3ZL7 C;  1VQK T;  2RI3 A;  4FW1 A;  5LJ3 g;  4XU0 A;  4C0Z A;  4J9D A;  3CMA T;  4J9G A;  4OML A;  2COW A;  3URG A;  1FMV A;  2ENM A;  4FYX B;  2IPO B;  2EQK A;  3M0P A;  1VQ5 Q;  3EGX B;  3KBG A;  4MMK A;  5HK3 A;  2ED0 A;  3JB9 G;  1ACM B;  2VAS A;  3J80 E;  5GAN h;  4IUT A;  3RNJ A;  4C8Q G;  3VS2 A;  4DBR A;  2OTL A;  2COY A;  2YSQ A;  1VQL T;  2QG9 B;  4JJC A;  2RO0 A;  1OX9 A;  3VRZ A;  2H8H A;  4DEY A;  4BAC A;  2OI3 A;  1GXI E;  5LJ5 f;  1H3Z A;  2JM9 A;  1VQ7 T;  1PSF A;  2DBK A;  4XTX A;  2DO3 A;  3VS1 A;  3CCM A;  1YIJ A;  3PMI A;  3SHW A;  3CPW S;  2ESW A;  3OYY A;  2PVD B;  2XU8 A;  4F7U G;  1XTD A;  2HKN A;  3M59 A;  3RR6 A;  2GTJ A;  3BDL A;  1RAG B;  2QA4 T;  3OB9 A;  2CKK A;  4J6W A;  1T0J A;  1Q86 U;  1VQ8 A;  5GAN j;  2R57 A;  1YJW Q;  1EFN A;  1OX8 A;  2QQA A;  2R5A A;  5KYN A;  1YHQ T;  4FSS A;  2F2W A;  4EIK A;  4M75 F;  4QVD A;  1WJQ A;  1LJO A;  4LXC A;  4KRT A;  1UHF A;  4E7J A;  3LH5 A;  4L5G A;  4C8Q B;  5CIU A;  4F7U F;  2DXU A;  2LX9 A;  3G7Z A;  1QVF A;  2VKN A;  2GBQ A;  2RHX A;  2Y4Y A;  4JRQ A;  1ARK A;  1M90 C;  2AZV A;  1VQ6 T;  1TSF A;  2SEM A;  4IIM A;  3U23 A;  3CXC S;  4RTV A;  2DKG A;  3L2W A;  3TU4 K;  3DLL A;  3CC4 T;  2DE0 X;  4Y91 A;  3QSU A;  3M58 A;  4LN2 A;  4J8O A;  5CQY A;  3M56 A;  3CD6 A;  4C0G A;  3L2Q A;  1Y07 A;  4QQG A;  4M7A F;  1E6H A;  1PD1 A;  1BYM A;  9ATC B;  3E2U A;  4MZP A;  1QCF A;  2G6F X;  3QDR B;  5KE2 A;  2QEX Q;  3A8M B;  1KSW A;  1WZO A;  3EG9 A;  2VWF A;  4M75 C;  2XID A;  2QGF B;  4O5V A;  2KMT A;  1KG1 A;  1NJI C;  1H64 1;  4PJJ A;  3RDV A;  2DEU A;  5KYU B;  3I35 A;  1RAF B;  1EZZ B;  1X6G A;  4J6Y A;  3H9N A;  5CO7 A;  2MAM A;  5GAN d;  3OW2 P;  1M90 R;  2OTL T;  2XI9 A;  1FWZ A;  3CCU T;  1X43 A;  3C12 A;  2NUT B;  4C92 A;  5CR2 A;  4K11 A;  4FYY B;  1NJI U;  1SG5 A;  1Y71 A;  1M5Q 1;  1O75 A;  3QJ6 A;  4HA8 A;  1LPL A;  2RA2 A;  4EPC A;  4JJB A;  2PNI A;  2CRE A;  2EYQ A;  4DBF A;  1IZ6 A;  4CC2 A;  5KYX A;  2QQS A;  4M7A C;  2M0Y A;  1M3B A;  3CCM T;  1YIJ T;  1LNX A;  2X35 A;  2EWN A;  4OB2 B;  3KFV A;  1FX7 A;  1QKX A;  1KQ1 A;  2DNU A;  1BKB A;  1SRM A;  2J06 A;  4E7Z A;  3OYB A;  1IGU A;  1NJI R;  4AG2 C;  5D7U A;  3TSW A;  4QKU A;  4M78 A;  3JCM d;  5KYY A;  1GCQ A;  1VQ8 T;  5KCH A;  4LDX A;  3BY7 A;  2RQV A;  3TEE A;  1VQ9 Q;  3MCA B;  1KQS S;  2FPF A;  2K2V A;  2EQM A;  2BZY A;  4LNP A;  1WYX A;  4GLK A;  1A0N B;  4J9B A;  4EMK B;  1ZA2 B;  1U1S A;  2JUF A;  1VQO A;  3VUZ A;  4D8K A;  1MND A;  5FW9 A;  2K5F A;  2HSP A;  1TH7 A;  3A1P A;  3RIR A;  4E7L A;  1K9A A;  2M1H A;  2W0Z A;  4VUB A;  3QZ9 B;  3MET A;  1KIK A;  1HYO A;  3ASK A;  5CQX A;  3V7C A;  4RG8 A;  3L2U A;  1H3H A;  4MDW A;  2RF0 A;  3T9N A;  4J9H A;  2FZG B;  3BFM A;  5GAO p;  3OYD A;  3UAT A;  4HCK A;  3CD6 T;  2YDL A;  1AZG B;  3V8L A;  2YT6 A;  1JBM A;  4X9C A;  1VIE A;  1W70 A;  2K3X A;  3O8V A;  2X3X D;  2LMJ A;  1WX6 A;  1VQP Q;  2NLU A;  3PVL A;  4FT4 A;  2DPP B;  3PVQ A;  2BUD A;  3X28 B;  3I5R A;  3X24 B;  3FEO A;  1BI3 A;  1QP3 A;  2MWO A;  4MML A;  2RK1 A;  1C0M A;  4XTZ A;  3VS6 A;  4M7D E;  2MMP A;  4OMP A;  2OTJ A;  2L2P A;  4F14 A;  4JZ4 A;  5GAN e;  1PRM C;  4M7D D;  1K4U S;  2VUB A;  2ZPF B;  4A4E A;  4E47 A;  4N4I A;  4DBQ A;  2P0K A;  2HBP A;  2ED1 A;  3OYJ A;  4C0D B;  1FMK A;  3QUI A;  2K79 A;  5IXF A;  3OYH A;  5I2M A;  4BUG A;  2DIG A;  4ZNX A;  2A28 A;  4II1 A;  4A4G A;  4EDU A;  5FU6 C;  4FYW B;  2CSI A;  4N4G A;  3HKS A;  3VYG A;  3FDR A;  3CC7 Q;  1OUL A;  5LJ5 g;  3OY9 A;  4DEX A;  2J7I A;  3H0I A;  3LW5 E;  3L2V A;  1YJN Q;  2EIF A;  4RMO A;  4C0D C;  1X6B A;  4E6R A;  3KXT A;  3LLR A;  1AT1 B;  2E3H A;  4C5H A;  2RJF A;  4LE9 A;  3PIP A;  3I56 Q; 
#chains in the Genus database with same CATH homology
 2VYT A;  4RCB A;  3G4S A;  2DEQ A;  1G3S A;  1MGQ A;  3TCJ A;  3FC3 A;  2RD1 A;  1WJR A;  3C94 A;  3L1A A;  2KSS A;  4OMF B;  5IAY A;  1FXX A;  5LL6 S;  4BY6 B;  3CME A;  3JB9 F;  2DZC A;  1G3T A;  4IKF A;  5GAO l;  3G4S T;  5EG2 A;  1Q81 U;  1N6A A;  3MEV A;  1VUB A;  3UWN A;  4F7U E;  1KD1 C;  1W2B S;  3CCJ T;  4C8Q F;  2RI5 A;  2QA4 A;  4HCZ A;  2M16 A;  3M57 A;  3QII A;  3SFM A;  2KQW A;  2X4X A;  4JRI A;  4CRI A;  3UPU A;  1N9R A;  4BE0 A;  4PJO A;  4M78 G;  4JDS A;  3UT1 A;  4ELY C;  5CKD A;  3RKY A;  2HNI A;  1YHQ A;  2E1H A;  4HT9 A;  4MZM A;  3LWI A;  2DD4 A;  4C92 F;  2D0Q B;  4M7A A;  2ZPG B;  1KQS A;  5D6X A;  4KT0 E;  1VQ5 A;  1XNI A;  3I55 T;  2VXF A;  3R6O A;  1KHI A;  3JCM Q;  1K73 U;  4NOY A;  3OBW A;  2E64 A;  1I81 A;  2HQE A;  5IT9 E;  3V8J A;  4PJO E;  2DK3 A;  4BY6 C;  2A7Y A;  4DQ2 A;  4NL3 A;  2DJZ A;  2O4X B;  5CKE A;  3OS0 A;  3GOX A;  2CS7 A;  3H8Z A;  3QJY A;  3OW2 A;  4E7H A;  2DD5 A;  4PJO D;  2PUK B;  3VV0 A;  5J39 A;  4M7A E;  3M4G A;  1R8O B;  2BKD N;  3ER0 A;  4XU2 A;  1WQ7 A;  4V2S A;  3WVE B;  3X20 B;  2HAX A;  4Z02 A;  1D3B A;  2DTH A;  3PT9 A;  5D6W A;  3ZFJ A;  1QVG A;  4KUD K;  3NTH A;  4IUQ A;  3VYH B;  4X34 A;  4M7D C;  4UC4 A;  5GAM f;  1S72 A;  2DZ9 A;  4FM4 B;  2E70 A;  1ZHI A;  1YIT T;  3INZ A;  1VQ6 A;  2RH2 A;  4M78 F;  3VJP A;  2DAQ A;  4MDX A;  4J7I A;  5GAN 3;  1QP2 A;  3OYG A;  3CC4 A;  3CC7 T;  1QW1 A;  1DJ7 B;  2YLB A;  3P8D A;  3PMT A;  3SWN C;  2KY9 A;  5GAM e;  1YJN T;  1KC8 U;  1KD1 U;  3LGF A;  3P8H A;  2F69 A;  3M55 A;  3L42 A;  2JTM A;  3I56 T;  4QVZ A;  4PJO F;  4J7F A;  5A2Q E;  4HCC A;  3MEU A;  1ZBX A;  3CEY A;  1YJ9 T;  1VQN T;  4C8Q C;  5A0G A;  2PQW A;  3PGG A;  4ZGD B;  1M1F A;  3QO3 A;  4ZN3 A;  4NS5 A;  3M54 A;  2E41 A;  2JOY A;  2L3R A;  2JTF A;  4ZGE B;  4JS4 A;  1EIF A;  2ZGW A;  4QW2 A;  1VQK T;  1YCY A;  2RI3 A;  3DB4 A;  3J7A F;  1M4Z A;  1WQW A;  2Y90 A;  4C92 C;  4M7D G;  5D6Y A;  2O01 E;  4BB7 A;  5LJ3 g;  4XU0 A;  3S3O A;  3CCR A;  2K5L A;  4C0Z A;  5GMK i;  3JAM E;  1YJW A;  3CC2 A;  2DTO A;  3G6E A;  3M4Y A;  3OMC A;  3HRS A;  4QVC A;  1X01 A;  4Q5W A;  5FU6 B;  4M78 B;  4JRP A;  3CMA T;  4EMK A;  5LJ3 d;  3URG A;  5CK9 A;  4DOV A;  4M77 E;  3A5Z B;  3OS5 A;  2OTJ T;  1VQ4 A;  3CBO A;  4ATO A;  2EQK A;  3JB9 H;  2LTO A;  2P0P A;  3NTK A;  3KBG A;  4MMK A;  5HK3 A;  4M77 D;  1G5V A;  2LT4 A;  3PTA A;  3JB9 G;  2VV5 A;  5FRO A;  3ME9 A;  2LNV A;  3V7R A;  3EFS A;  5J3B A;  2DTI A;  4MZT A;  3JB9 I;  3J80 E;  1VQM T;  1WGS A;  3SB2 A;  3FLG A;  3M5A A;  4OP0 A;  2RB6 A;  4D6W A;  5GMK h;  4IUT A;  4C5G A;  4C8Q G;  5GAN h;  4TVR A;  1Q82 C;  3DKM A;  1W4S A;  2XKO C;  2FYK A;  2OTL A;  5FRM A;  1HK9 A;  4C0F A;  1N9S A;  3UDC A;  1VQL T;  3MHX A;  2RO0 A;  3E19 A;  2ZCF B;  1JJ2 S;  3X25 B;  4M78 C;  4BAC A;  2D6F A;  3CCQ T;  1GXI E;  5LJ5 f;  3HRT A;  1H3Z A;  1BIB A;  2LCL A;  3JCM f;  2PUO B;  2JNG A;  2QTX A;  2DXB A;  3MO8 A;  1BI0 A;  3QYH B;  2RM4 A;  5FLX E;  3OYL A;  1VQ7 T;  2LRQ A;  3QYG B;  2KK4 A;  4ZTJ A;  1PSF A;  4M77 F;  4M75 E;  2RHI A;  4XTX A;  2KVQ G;  5LJ5 e;  1M1G A;  4OB3 B;  1UGR B;  1Q82 U;  4PJO C;  2DO3 A;  3JCM e;  3CCM A;  3CCS A;  3FIF A;  3G71 T;  3PMI A;  4ZTF A;  1YIJ A;  2EFI A;  3CPW S;  4M75 D;  2ZZD A;  1XOV A;  4GY5 A;  3OYY A;  3CCE A;  2PVD B;  2XU8 A;  3RUX A;  4F7U G;  1XTD A;  2B8A A;  3GP8 A;  3M59 A;  2DXC A;  3KUF A;  5KCO A;  3M9Q A;  2WSE E;  3CME T;  2G3R A;  3GIB A;  4PKC C;  4EMH A;  3BDL A;  1UGQ B;  1UGP B;  2QEX A;  1N8R C;  2QA4 T;  4FT2 A;  3OB9 A;  2CKK A;  2ZPB B;  4J6W A;  2DIQ A;  2R5M A;  5GMK j;  5GAN j;  1W2B A;  2QXF A;  3GF5 A;  1Q86 U;  1VQ8 A;  4M7D B;  3JCM c;  2R57 A;  3OYN A;  2QQA A;  1OZ3 A;  2R5A A;  3J81 E;  1YHQ T;  4N0A C;  4N4H A;  2I2L A;  5C0M A;  2WSC E;  4JJN K;  4PJO G;  5AYF A;  2LCC A;  2E5Q A;  1VQ5 T;  3FB9 A;  1NPR A;  4L6V 5;  3ZBD A;  3MEW A;  3OYK A;  4M75 F;  3NTI A;  4QVD A;  5GAO m;  3JCM P;  1I8F A;  4FIB A;  3SWN B;  4PL6 A;  4HT8 A;  1K8A C;  2RHZ A;  2KAF A;  2VGN A;  3WVD B;  1WJQ A;  1LJO A;  4E7I A;  2GF7 A;  1QVF S;  1N8R U;  2CZ0 B;  2EQU A;  4L5G A;  4C8Q B;  3OS1 A;  4E7J A;  2EJG A;  5CIU A;  4M7A D;  2D9T A;  4F7U F;  2DXU A;  2LX9 A;  3G7Z A;  2EQJ A;  4XTY A;  2R58 A;  1QVF A;  4XTW A;  2RHX A;  4IUR A;  2RHU A;  3FRN A;  4C92 B;  2Y4Y A;  3EFR A;  4YTL A;  1OYX A;  4M77 C;  3OS2 A;  1Q7Y C;  4JRQ A;  3QG1 A;  1S72 T;  1BIA A;  4J6X A;  5GAN 8;  5CAI A;  1M90 C;  5GMK m;  1VQ6 T;  2VC8 A;  4XAX B;  4B9X A;  3CXC S;  2BIV A;  2DKG A;  1WNL A;  5GAN 5;  3L2W A;  3TU4 K;  1K9M C;  3DLL A;  3CC4 T;  3QSU A;  1Y96 B;  4Y91 A;  3M58 A;  4X9D A;  3C4S A;  1AHJ B;  4OF1 A;  1U8R A;  5CQY A;  1SSF A;  1NPP A;  4J8O A;  3M56 A;  3CD6 A;  2P0Q A;  4EMK C;  4R56 A;  4KBM B;  4C0G A;  3L2Q A;  1Y07 A;  2EAY A;  4QQG A;  4XU1 A;  3CXC A;  2P4T A;  5LJ3 f;  1KQ2 A;  4M7A F;  5GAM h;  1WPY A;  3A8H B;  5GAN 4;  2E6N A;  1BYM A;  2PU9 B;  4MZP A;  4C5E A;  5C6S A;  5HK0 A;  3S3N A;  1M1K C;  2EKO A;  2HD0 A;  3EAE A;  2CYZ B;  3TRE A;  3L2Z A;  2XDD A;  3VKI A;  5KE2 A;  3QDR B;  4KUL A;  5GAM d;  5LJ3 e;  4LDY A;  3M53 A;  4JUV A;  4M77 G;  3V7S A;  4M7D A;  2DVE A;  3A8M B;  1ZQ1 A;  4ME7 A;  3MP6 A;  3P8B B;  3CCR T;  1K9M U;  1YJW T;  3CC2 T;  4QQ6 A;  3G6E T;  4M75 C;  1VQ9 A;  4JLI A;  2X4Y A;  4HCB A;  4LDV A;  2XID A;  4O5V A;  3E9G A;  2KMT A;  5CCA A;  1KG1 A;  1NJI C;  4DOW A;  1VQ4 T;  1H64 1;  3OBY A;  4IUV A;  5CKF A;  3QZ5 B;  3V8K A;  2O4X A;  2F5K A;  3S3M A;  3LGL A;  3HHT B;  4PJO B;  1M1K U;  2YHT A;  3A8L B;  5GAN g;  3CCL A;  2EJF A;  4J6Y A;  3CCU A;  2RJD A;  5CO7 A;  2MAM A;  2HQX A;  3PIO A;  4DA4 A;  5DLQ E;  5GAN d;  2K5I A;  2OTL T;  3OYA A;  3E9F A;  2XI9 A;  3SD4 A;  1B34 B;  1FWZ A;  2CZ1 B;  2E12 A;  4HKE A;  4R55 A;  3C12 A;  3CCU T;  3CCV A;  1BI2 A;  3RKW A;  4L59 A;  4A54 A;  3JCM b;  4FSX A;  3OYF A;  5HY6 A;  1V29 B;  4C92 A;  5CR2 A;  5A0D A;  3OYM A;  1NJI U;  1XQH A;  3N5B B;  1Y71 A;  3RMQ A;  1M5Q 1;  1OI1 A;  3QHS A;  1O75 A;  4M75 G;  3QJ6 A;  1JJ2 A;  4HA8 A;  4EPC A;  2RA2 A;  4JRK A;  5GAM j;  4OB1 B;  1HXD A;  1NE8 A;  2RHY A;  4ZN1 A;  2XHC A;  2EYQ A;  3A8G B;  4B9W A;  1D3B B;  3LH0 A;  2CZ6 B;  1IZ6 A;  4RG2 A;  5A0L A;  1M8V A;  1Y96 A;  2QQS A;  4JLG A;  3OYC A;  4M7A C;  3MP1 A;  4IUP A;  3AHU A;  1OZ2 A;  4C92 E;  1YI2 A;  2Y4X A;  3CCM T;  3CCS T;  1YIJ T;  1LNX A;  1NZ9 A;  2FHD A;  2GQV A;  1JB0 E;  5FU7 C;  2FB7 A;  2X35 A;  5LJ5 h;  2L5Q A;  2L89 A;  3CCE T;  2EWN A;  4OB2 B;  4C92 D;  3JCM h;  3CPW A;  2KDS A;  2CGH A;  2XIC A;  1FX7 A;  3LX7 A;  1RI0 A;  1KQ1 A;  2LC4 A;  1BKB A;  1VIF A;  2QQ9 A;  4BI4 A;  1VQP A;  3OYB A;  1G3W A;  1WJS A;  3VUB A;  5LJ5 d;  2LQK A;  2K57 A;  1PSE A;  3JCM d;  4M78 A;  4PLL A;  4XTU A;  2QEX T;  3CCJ A;  1VQP T;  1K73 C;  1G3Y A;  1JRI A;  3H6Z A;  3JRZ A;  3RKX A;  5KCH A;  4BDY A;  1VQ8 T;  4M77 B;  2QQR A;  2F5T X;  3BY7 A;  3GLX A;  4LDX A;  2LDM A;  1P92 A;  3TEE A;  1YBY A;  2IG0 A;  2L8D A;  3MCA B;  3LWH A;  4OB0 B;  1KQS S;  3Q1J A;  2XDP A;  4XU3 A;  4M7A G;  5FRN A;  2K2V A;  2EQM A;  4PNO A;  2RK2 A;  1M9S A;  1X6O A;  4M78 E;  3I55 A;  1IRE B;  2E6Z A;  3WXM B;  3JCM X;  4GLK A;  3F70 A;  1UGS B;  4EMK B;  4C5I A;  1U1S A;  2JUF A;  4XK8 E;  4M78 D;  3JCM V;  4JS5 A;  2MF2 A;  2A3L A;  3VUZ A;  3OW2 S;  1VQO A;  2QI2 A;  5IN1 A;  2K5F A;  2WAC A;  3ZEH A;  3CBP A;  1B34 A;  4RKU E;  2LVM A;  1VQO T;  1TH7 A;  2YLC A;  2XK0 A;  3C95 A;  4FU6 A;  3SDZ A;  4ELZ C;  4CI0 C;  5GAO n;  3RIR A;  2MI6 A;  5GMK l;  3MP8 A;  4A53 A;  1QVG S;  2WSF E;  4E7L A;  3OSV A;  1KC8 C;  1K8A U;  2M1H A;  2PVO B;  2FL7 A;  4BE1 A;  4VUB A;  5LJ5 j;  5GAN 6;  3RMS A;  4LDW A;  3QZ9 B;  3DB3 A;  4N0A A;  2X4J A;  1X75 C;  3MET A;  3OQ5 A;  4M75 B;  3QPH A;  4EMG A;  3ASK A;  5CQX A;  3QBY A;  3V7C A;  2GFU A;  5DY9 A;  3OA6 A;  1YIT A;  4RG8 A;  2V8J A;  1I4K 1;  4J5Y A;  3L2U A;  4MDW A;  4LD6 A;  4E7K A;  1UEB A;  3S6W A;  3T9N A;  2K4Y A;  3CC7 A;  3RER A;  2ZPH B;  3BFM A;  1QVP A;  5CVI A;  5I21 A;  5DM7 R;  2V8K A;  2GFA A;  5GAN 7;  5GAO p;  3OYD A;  1N27 A;  3V8L A;  1YJN A;  2XD0 A;  3CD6 T;  1JBM A;  4F7U B;  2QQB A;  3OMG A;  4FL6 A;  5GAM g;  1U1T A;  2RJE A;  1Q7Y U;  4LD9 K;  4X9C A;  1VIE A;  3I56 A;  2OAU A;  2VGM A;  3HSB A;  1YJ9 A;  1M90 U;  3GPL A;  1VQN A;  4PLI A;  5CKH A;  5DLO A;  2K3X A;  1Y7X A;  3O8V A;  1UB4 A;  2E10 A;  3BDU A;  3HFO A;  4A4K A;  5KE3 A;  2VXE A;  3OSS C;  2NLU A;  2CZ7 B;  3DLM A;  3RES A;  4A4H A;  2RI2 A;  4FT4 A;  2V8I A;  2DPP B;  3NFC A;  4IUU A;  5CKB A;  4ZGJ B;  3HPW A;  1VQK A;  4Y28 E;  2XDB A;  4M77 A;  2BUD A;  3CPF A;  4XTV A;  2EJ9 A;  3X28 B;  1MHN A;  4BI3 A;  3X24 B;  5M9O A;  5GAN f;  3BW1 A;  3OYE A;  3FEO A;  4A4F A;  1BI3 A;  2M0O A;  2H3J A;  1O9S A;  1QP3 A;  2MWO A;  3HFN A;  5LJ3 h;  3SWN A;  3X26 B;  4MML A;  3CMA A;  2RK1 A;  4BD3 A;  4XTZ A;  2K3Y A;  5GAO q;  5I2S A;  2E65 A;  4WF2 A;  2MMP A;  2ZPE B;  1I5L A;  4M7D E;  2OTJ A;  2GCX A;  4QQD A;  4M7A B;  3MEA A;  2YRV A;  2ZPI B;  5GMK e;  5KH6 A;  4BE2 A;  5J26 A;  3HRU A;  4C8Q A;  5GAN e;  3JB9 J;  4M7D D;  2JZ2 A;  3FJP A;  2LQ8 A;  2X4W A;  5HKC A;  5FU7 B;  2VUB A;  2ZPF B;  3PFS A;  4O6J A;  4A4E A;  3CCL T;  4BDZ A;  3JCM J;  1VQM A;  1VQ9 T;  4E47 A;  4N4I A;  3JCM W;  4J83 A;  3GNF B;  1KHC A;  3QKJ A;  2LT1 A;  2P0K A;  2HBP A;  3OYJ A;  4C0D B;  4OVA A;  2M9U A;  4OGE A;  3CBM A;  2FVU A;  3L2R A;  2AHJ B;  3QUI A;  3CCV T;  1VQL A;  4BI8 B;  1RL2 A;  2JVV A;  4C8Q E;  3OYH A;  3JB9 D;  3JSC A;  3OYI A;  3CCQ A;  5L8R E;  4KUI A;  5I2M A;  3VU3 C;  4M75 A;  4BUG A;  4C8Q D;  2XG8 D;  2DIG A;  4C92 G;  2IVW A;  3PNW C;  4II1 A;  4A4G A;  4EDU A;  1LOJ A;  5FU6 C;  2PVG B;  4RCC A;  1Q81 C;  4P5N A;  3E1S A;  2C06 A;  5GAO r;  4N4G A;  1VQ7 A;  3HKS A;  3QXE B;  5GAN 2;  3VYG A;  4OGC A;  4M7D F;  2JN0 A;  4NL2 A;  3HP9 A;  2DXT A;  3FDR A;  1YI2 T;  4F7U A;  5LJ5 g;  3OY9 A;  3G71 A;  1BI1 A;  3LW5 E;  4LDU A;  3L2V A;  2MWP A;  3JCM g;  3PIP A;  1Q86 C;  2EIF A;  4RMO A;  4C0D C;  3KXT A;  5LJ3 j;  2QDY B;  3GNG A;  3HL8 A;  3LLR A;  3A8O B;  2RJF A;  3LYI A;  4C5H A;  4XQ3 A;  2RJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...