4M7DG

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
77
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAAVKLNEIYIRGTFIKFIKLQDNIIDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 14
structure length 77
sequence length 88
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dG00
4J6YA 3JCMQ 5GAN2 4XTYA 1WQ7A 5GAMh 4XU3A 5LJ5e 2DTIA 3V7CA 3JCMb 1JBMA 4QVCA 4J5YA 3HFNA 4XTVA 4EMKA 3SB2A 3JB9F 4XQ3A 4EMHA 3INZA 5GAMd 4M7AG 2E64A 1U1TA 4NOYA 3QSUA 3JCMJ 4M75G 4V2SA 5CAIA 3L2ZA 5GANh 3RERA 1N9SA 2EWNA 4C92G 4N0AC 4C8QG 4M7DC 4M7AE 4F7UG 4M75E 3FJPA 2EJ9A 4M78G 3JB9H 2YLBA 2DTOA 4A54A 4C92E 2VXFA 4M77F 4C8QE 4F7UE 4HT9A 4PJOC 2DXTA 1WNLA 4M78E 5LJ5g 2VXEA 5GANd 3HSBA 3V7RA 1JRIA 4M7AD 2FYKA 3JCMd 2DXUA 1TH7A 2EJGA 4M75D 5GAN6 5GAOn 4HA8A 5GMKe 4M7AA 2VC8A 3RIRA 4M75A 5GAOp 1B34A 4C8QD 3V8LA 5LJ5j 4EMGA 4M78D 4C92A 4C8QA 5LJ3d 4F7UA 3VU3C 1U1SA 4M7AB 3SWNB 4M78A 4Y91A 3BY7A 4A53A 4MMLA 4M75B 2DKGA 1HK9A 3FIFA 1B34B 1I5LA 4M7DG 3FB9A 1M8VA 4C92B 1D3BA 4C8QB 1X01A 4F7UB 5GAN7 3BFMA 4QVDA 2E41A 4M78B 5LJ3e 4M7DE 4PNOA 2I2LA 5GAMf 2YHTA 4OP0A 4RCCA 4X9CA 3JB9I 1D3BB 2DZCA 2QTXA 1M5Q1 5GAMe 4M7DD 3EFSA 3JCMP 5GMKi 4RCBA 1BIAA 2DVEA 5GMKm 4EMKC 5GAN3 4N0AA 4XU0A 3RKYA 1LJOA 4M7DA 3V7SA 4M77C 5GMKj 4PJOD 3SWNA 2RA2A 3RUXA 3JCMW 2E1HA 3PGGA 2JN0A 4JRKA 3JCMc 4J6WA 2RB6A 5DY9A 5GANf 3JCMf 3AHUA 1WQWA 1HXDA 4XTUA 5GMKh 4M7DB 5GAN4 2RM4A 5GANe 4HT8A 1I81A 2RD1A 3JCMe 3JCMX 5GAOr 5LJ5h 2E65A 4DQ2A 5GAOl 4PJOB 1BIBA 5LJ3f 4J6XA 4M7AF 1I8FA 3QHSA 3V8KA 2EJFA 2E10A 4M75F 5GAMg 1WPYA 5LJ3j 4JUVA 4PJOG 4MMKA 4C92F 3QUIA 4XTWA 4C8QF 2CGHA 4F7UF 4XTXA 3RKXA 5LJ5d 5GAN8 4M78F 4JRIA 4M77G 1H641 3JB9D 4PJOE 5GAMj 5GAN5 2EAYA 2DJZA 5GAOq 2DEQA 5I21A 3RESA 2DTHA 3BDUA 4M77E 4NL2A 3QO3A 2Y90A 5GANg 4XU2A 4X9DA 1KQ1A 3JCMg 4XU1A 3JCMV 1YCYA 4PJOA 3L1AA 3V8JA 4M77D 1LNXA 5GANj 4M77A 4NL3A 5LJ3g 3JB9G 5GMKl 4M7DF 4JLIA 3M4GA 1MGQA 3JB9J 1LOJA 3BW1A 4EMKB 3JCMh 3HFOA 4M77B 4PJOF 1I4K1 1Y96A 4M7AC 3SWNC 4WF2A 2HNIA 4M75C 3EFRA 2YLCA 1KQ2A 2K57A 2DZ9A 5LJ3h 1N9RA 4C92C 4C8QC 5GAOm 2FB7A 1Y96B 3RKWA 3GIBA 4M78C 4XTZA 5LJ5f 2ZGWA 4C92D
chains in the Genus database with same CATH superfamily
1FXXA 5CQYA 2DTIA 4ZGEB 1JBMA 1VA7A 4J5YA 2JUFA 1M2VB 2H8HA 3SB2A 2DRKA 3DB4A 4QKUA 2KRMA 1QQJA 3CC2T 2LT1A 1IREB 2EKHA 2OJ2A 4HCKA 3PTAA 2EBPA 5GAN6 5GAOn 2ABLA 2VC8A 2K79A 4AFZC 2X4WA 3LW5E 4L5GA 5KH6A 1RAGB 1YJNQ 1AWJA 1PC0A 2E41A 1GCPA 2CP5A 3S6WA 5FWCA 2W0ZA 3JB9I 4F04B 2R5AA 2DVEA 2E6ZA 4QT7A 1KFZA 3CD6T 3JCMc 3GNFB 1ZA1B 2L3SA 1MUZA 2XG8D 2RM4A 3L2WA 3AT1B 2V8KA 4HCZA 1RAEB 3HTRA 2D6FA 4OMPA 1U5SA 2O9VA 2E70A 3V8KA 2OI3A 1WX6A 4M75F 5KYUA 3G1JA 2LTOA 2EAYA 1TWBA 3MP6A 1EZZB 1YWOA 2Y90A 3RR6A 5AT1B 4ATOA 2Y4YA 3HL8A 1V1CA 1M9SA 2HL3A 3JSCA 4NL3A 2ZPIB 3ZEHA 3A8GB 2QEXT 5C0MA 3I55A 3JRZA 1Y96A 3A8OB 1ARKA 3Q1JA 5LJ5f 4JRQA 3X20B 4JJBA 2LJ0A 1YWPA 2DF6A 3CPWP 2J05A 2XK0A 5CKBA 2A0FB 2RHZA 1P92A 4M7AG 2J7IA 3MP1A 3TSWA 2E4HA 1TTHB 3NTIA 5CAIA 2H3EB 1BK2A 4M75E 2A28A 3JB9H 4BE2A 2OX7A 2COYA 1K1ZA 1E6HA 1JXMA 1VYUA 3JCMd 4M75D 5HKCA 1JJ2P 3R6NA 2K5IA 4RTZA 4EMGA 4C92A 2RQWA 1NEGA 1Q82R 3UF4A 2RQUA 3FB9A 2JVVA 5IHNA 2DYBA 3G4SA 2KROA 1K9MC 1OX9A 2DE0X 3A8LB 4C5HA 1QVPA 3CXCA 1M3CA 1NEBA 1YJ9A 1RL2A 3TCJA 3TU4K 2RH2A 3HRTA 4FL6A 3JCMW 4AMCA 1XNIA 3H6ZA 4A63B 3F70A 3JCMX 2KXCA 1QP2A 1VQ4A 3VS2A 1M27C 2DIGA 1BYMA 1O75A 1Q95G 2MI6A 2O2OA 4M78F 1H641 1RADB 5GAOq 3H41A 2ZAEA 1EX4A 5CIUA 5A2QE 2HAXA 1ZSZC 4PJOA 1RUWA 5HK0A 5FRNA 4JRPA 2M16A 2EIFA 1N27A 2DBKA 2ECZA 3QYHB 1LOJA 3RMSA 3JCMh 1VQOQ 3WVEB 1X6BA 1I4K1 3I55Q 4KUDK 4M75C 2PU9B 4PJLA 1YBYA 2FB7A 3RKYA 1M2VA 2ZZDA 1XJWB 3LYIA 2F5TX 3WVDB 1K8AU 4A4KA 4EMKA 2JT4A 3MP8A 1YP5A 2GQIA 1B07A 2A37A 2C0TA 1Q7YR 3OMCA 1T3LA 4FW1A 5I22A 4BI8B 3S3MA 2YWWA 2VXFA 2L3PA 1VQNA 4M78E 2VXEA 3CCLT 1PWTA 2KAFA 1BKBA 3U23A 2FO0A 3V8LA 4M78D 2RJFA 4DEXA 3SWNB 3OYMA 1SPKA 1HYOA 2KBTA 2DKGA 4DBHA 1WLPB 5D6YA 1VIFA 2HCKA 3QWYA 4C8QB 4RG8A 4MZMA 5AYFA 4Z88A 1HSQA 2I2LA 1H3HA 1G3YA 4UC4A 3G4SQ 4JPBW 4A4GA 3OYFA 5GAN3 2IG0A 4FW2A 4OF1A 3FC3A 1JXOA 1YJ9Q 4CC7A 1WFWA 2E1HA 2KE9A 3PGGA 2CP2A 2EGCA 1M3BA 3X26B 4HT8A 5KYYB 2GQVA 1QLYA 4B9XA 3DLLA 3HKSA 3H9NA 4PFOA 3M55A 3UA7A 5J39A 1Q82U 1C6VX 4NL2A 2D8HA 2L89A 1VQ5T 3JCMg 1KIKA 3EAEA 3M59A 2E6NA 1XTDA 3NTHA 2HSEB 2RQVA 2E12A 3BW1A 5A0LA 2DD4A 2VKNA 3CCEA 4LXCA 3DKMA 3H8ZA 3OYIA 2YXYA 2DK3A 1U06A 1S72T 2D0NA 3CCJQ 3GIBA 4M78C 4IUQA 3G71A 1D1BA 5CR2A 2C0OA 1M90U 2FVUA 2CSQA 3JCMb 3P8HA 1W2BS 4JLGA 3M0QA 3JB9F 1NBEB 3QSUA 1RI0A 4M75G 4PKCC 1PD0A 1D0ZA 3H0FA 3FJPA 3CCSA 2RQRA 3OS1A 3HSBA 1M4ZA 1JRIA 4E6RA 3CC4A 4FM4B 1NPPA 1Q86R 1K73U 1KQSS 5FU6B 2RO0A 5FU7B 5D6XA 6AT1B 2EW3A 2HQXA 2E3IA 1V76A 4L59A 4OGCA 1VQ6A 1YJNT 1VQ8A 1YITA 2RPNA 1NJIR 2RHIA 5IXBA 3CCVA 4BI3A 3I56A 2QASA 3EG0A 4KULA 2DETA 1KK7A 2O9SA 5DLQE 2RB6A 4JS5A 2L3QA 2HZYA 3JCMe 3NFCA 1VQKQ 3HRUA 4J9GA 1NE8A 5CVIA 5J26A 2CREA 2NUTB 2DBMA 5LJ5d 2MK5A 3JB9D 2OTJA 1DJ7B 3OQ5A 2JXBA 3QO3A 3CXCS 1Q7YC 1PNJA 3C12A 5KCOA 4RKUE 3VS1A 1QCNA 4VUBA 1PKSA 4M7DF 2CH4W 2ZPBB 4LDYA 3E19A 5IT9E 4PJJA 4AFSC 2DIQA 2YUOA 3VKIA 1ZBXA 2MCNA 5CKFA 1MV0B 2A36A 1QVFA 2D1XA 4BY6C 4XTZA 3JCMQ 3OW2P 4XU3A 3G71Q 4C0ZA 1MMAA 3HFNA 2O31A 4XAXB 1VYVA 2YUQA 3GOXA 1RI9A 3EG1A 4XQ3A 1U1TA 3JCMJ 2BKDN 4P5NA 4R56A 1S1NA 4M4ZA 1KD1U 2O4XB 2MOXA 1T0JA 4M78G 3VJPA 1TUGB 3UA6A 4C5EA 4RTYA 4FCYA 2K4YA 2Z0WA 1H3ZA 5D7UA 3CCSQ 1WHJA 1TH7A 1OPKA 5KYNA 5LJ5j 4N4IA 4J7FA 1ZQ1A 4C8QA 3QKJA 3M57A 4M7AB 1HJDA 3OBWA 4FYWB 4MMLA 1IGUA 2DRMA 5IHKA 1B3QA 2K5FA 3QPHA 4M7DE 1R8OB 5GAMf 1VQ8Q 1YITQ 1YHQQ 2QTXA 5CK9A 4OMFB 4M7DD 4MDWA 4JJCA 4RCBA 1KJWA 2HBPA 4OB0B 2P0KA 3LH5A 1EFNA 1R0BG 3PE0A 4BD3A 3CCVQ 3CCMQ 1HXDA 3RNJA 4F17A 2KYMA 1JEGA 2YRDA 4J9IA 2XIDA 5L8RE 3OYBA 5LJ3j 2VGNA 1VQ7A 3FDRA 3NTKA 3FEOA 4LDWA 1OZ3A 1EIFA 2KQWA 1QVFP 1MMDA 2OTJQ 3EG2A 3HP9A 1YI2A 3A5ZB 1SRMA 2HQEA 5KE3A 3M4GA 1YCSB 2FEIA 3LGFA 4L6V5 5A0DA 4CRIA 1GFCA 2DL8A 4PJOF 4E7SA 1VQOT 1B7TA 3MEAA 1VQ9Q 1X69A 3OYAA 2M9UA 3I55T 1H8KA 2YLCA 1Q86C 3REAB 2VYTA 2V1RA 4RUGA 4C92D 4IUUA 1IO6A 4DEYA 1WHGA 1NG2A 1ZSGA 2AT1B 3RBBB 2LJ1A 1NJIC 1PG5B 2QDYB 2C06A 2DL5A 1G8XA 1N9SA 3A8HB 4M7DC 2KR3A 2L3RA 1AWXA 2QYZA 3RMQA 2NYSA 1IZ6A 5CKEA 7AT1B 5LJ5g 1WXUA 3TEEA 1YJWA 2XICA 3GNGA 3E9FA 4RTUA 2CH4A 2CUBA 4JZ4A 3CMAA 3OYCA 2CP3A 2RHXA 4PNOA 2ED1A 2K3BA 2KXDA 1ZHIA 3OYGA 3G4ST 2EYQA 4LD6A 3EH1A 1H92A 1BI1A 3SFMA 1YJ9T 2X3XD 4PJOD 1OULA 2EKOA 5C6SA 3RUXA 5GANf 2CP6A 1GFDA 3CPWA 1AD5A 1WHHA 2NUZA 2V1QA 2NUTA 2LRQA 2EGEA 1NZ9A 1SRLA 2EFIA 2DA9A 4DA4A 4R0KA 1ACMB 3VUZA 4F7UF 2V8IA 1VQ7Q 3MPUB 4LDVA 2DEQA 4N4GA 4O6JA 4J9DA 1JJ2A 4AFQC 4XU2A 4XU1A 4KBMB 1LNXA 1TG0A 2BIVA 1OQKA 4WCIA 3MEVA 4FT2A 1Y71A 3KUFA 5GJVB 1PSEA 3J80E 2L0AA 1K8AR 2DL3A 1NLOC 1OU8A 2DZ9A 4QQDA 2LX7A 1X6OA 3RKWA 3CCJT 3J81E 3GBQA 5GAN2 4BACA 5ECAA 4Z89A 1SF9A 4KRTA 5LJ5e 2V8JA 3A98A 4OMQA 1U3OA 2O4XA 3EFOB 1UJYA 2JTFA 1IRXA 2NLUA 1IHWA 3C94A 1BU1A 3PIPA 2WSEE 4MZPA 1ZSZB 3SHWA 1M30A 4M77F 2FRWA 4F7UE 4PJOC 3V7RA 4M7AA 1RLQC 1OYXA 2P84A 1M3AA 3MHXA 4M75B 4GY5A 4M7DG 1M8VA 1D0YA 4JZ3A 3OYLA 3CMAQ 2R57A 5LJ3e 5IHIA 3N5BB 3EH2A 1OZ2A 4ANJA 1ZA2B 3OYHA 4ZGJB 4EMKC 4ESRA 3HHTB 2L5QA 2ROTA 2RA2A 1UHFA 3E1SA 4DQ2A 5LJ3f 1VQKT 1G3SA 1OX8A 4FYYB 2EYWA 4JRIA 1KHCA 4OMMA 3RDVA 1KC8U 4M77E 1AZGB 3JCMV 2LT4A 4E7JA 4M77D 1UG1A 1I0CA 4C0DC 3UWNA 4PJMA 1M90R 3QDFA 3CBMA 2BE9B 4WF2A 1GCQC 4ORZA 2ZCFB 2D9TA 2D8JA 1I07A 2EYYA 3G71T 3ME9A 2KRSA 2XDPA 4XTVA 3MO8A 1K0SA 3UPUA 2L8DA 5GAMd 3INZA 1UJ0A 1CKAA 2DYIA 4RMOA 2HL5C 3PMTA 1AWOA 1K73R 2G6FX 2RJDA 4DBRA 4HT9A 1BCMA 2WACA 3CD6A 1D09B 3CCST 1KQSP 2GBQA 1FX7A 4LNPA 1KG1A 3VU3C 2QGFB 4A53A 2GCXA 3NGPA 3SEMA 3OY9A 1N5ZA 3OYKA 5CKDA 4M78B 1MMGA 3FJ5A 1SHGA 1WJSA 1SEMA 1QCFA 2DAQA 3EGDB 1VQ8T 4CC3A 1YITT 1M5Q1 1YHQT 2J06A 5GMKi 2P0PA 1OOTA 4XU0A 1V29B 4M77C 2RI2A 1WDXA 1FMVA 3CCVT 4J9EA 3MEWA 5DY9A 3CCMT 5GAN4 3P8BB 4FSXA 1QMCA 1X75C 4O5VA 1K8AC 2GTJA 4II1A 2X4JA 1BIBA 1MHNA 2EJFA 2LCCA 3TREA 5KCHA 2CT3A 2ATCB 3RKXA 1A0NB 2XKOC 2WSFE 4RTWA 5GAMj 2IVWA 3M0UA 2AZSA 4RG2A 3VYHB 1YNZA 2OTJT 1BI2A 4WTOB 2MIOA 2LX9A 3CPWS 3OYYA 1WXBA 2YRVA 2RF0A 1Z9ZA 2JS0A 1VQ4Q 4B9WA 1VQ9T 1C1AA 2HNIA 2HMAA 1QVGA 8AT1B 3EGUA 1YIJA 1KD1R 3BDLA 2X3WD 4OGEA 1K0XA 1JJ2S 2RHYA 2AIRB 2QXFA 2O01E 3CMEA 2MPXC 2BTTA 2ED0A 4F7UG 2FPEA 2M51A 2QGGA 2KEAA 4ZGDB 5GANd 2C0IA 2FYKA 1Q82C 4HVWA 4M75A 2XI9A 1QKXA 2NUPB 4CC2A 3QZ5B 2X4XA 2OTLA 4BY6B 2LNHB 3THKA 2QQAA 2K7AA 4D8KA 2JTMA 1BIAA 3HPWA 5HCKA 2K9GA 1VQNQ 3OW2A 5KE2A 1M90C 1M8MA 4JJNK 1RACB 4D8DA 1OI1A 5IH2A 4IUTA 4PJNA 3QZ9B 5FROA 1T3SA 2AZVA 1G5VA 2M0OA 3M58A 2B8AA 1OEBA 2PTKA 2ZPHB 5GAMg 5EG2A 3QUIA 3M5AA 5GAN8 4M77G 1VQ7T 2IPOB 2PQWA 1QVGP 1VQMA 5I21A 2VWFA 2OAWA 4E7HA 2FRYA 1TS9A 1PHTA 2VGMA 4C5IA 1VQPA 4E7LA 3EG3A 4X34A 4IUPA 4BB7A 5GANj 2QQBA 1K73C 3T9NA 4ZNXA 4OMOA 1G2BA 1PKTA 3M53A 2FPFA 2CYZB 2DERA 5CO7A 4MZTA 3META 4AG2C 2F69A 1UEBA 1ABQA 3M0RA 3MCAB 1YIJQ 1WYXA 2RJCA 4ZTJA 2BZXA 4Y92A 1K9AA 2HEQA 4OB3B 2GGRA 3QBYA 4N0AC 3CMEQ 3FLGA 2EJ9A 2OAUA 3VS4A 2YLBA 2CS7A 4E47A 1RABB 1WJRA 3CCEQ 4QVZA 2EJGA 2EQUA 3MEUA 4N4HA 1X2QA 2QI2A 4BI4A 5LJ3d 3VYGA 4M78A 2YT6A 2DFUA 1G3WA 4Z02A 1B34B 2M1HA 5GAN7 3CMAT 2KSSA 1GBRA 2YHTA 2OTLQ 1D3BB 2YRCA 2DZCA 4FU6A 5GAMe 1VQ5A 1AZEA 4DBQA 2DJQA 4FYXB 3V7SA 3SWNA 3AHUA 4JRKA 5M9OA 1G83A 3CC4Q 4M7DB 2J6KA 2VASA 3GPLA 2LZ6B 5GAOr 4IUVA 5LJ5h 4F14A 2A08A 1FYNA 2AKLA 2DILA 1I8FA 3CCUA 2DNUA 1D1AA 4Q5WA 4ELYC 4C92F 4XTWA 1AHJB 1KD1C 1VQ6Q 2KVQG 3DLMA 1IXDA 1ZUKA 1LVKA 1RLPC 2AHJB 2E5QA 2EQIA 3ULRB 4ELZC 1AWWA 3C4SA 5GANg 1VQMQ 3OMGA 3I56Q 2WSCE 5KYYA 4HCBA 3V8JA 3PNWC 3G6EA 3OA6A 1TXQA 3GF5A 5KYWB 1N8RU 4JJDA 1VQPQ 3HRSA 3JV3A 4DOVA 3VS0A 4KGZB 2LCSA 2LJ3A 1R77A 5J3BA 5LJ3h 2QQ9A 1MMNA 4C0GA 5KYXB 1AEYA 4BUGA 3CC7A 3UDCA 2FPDA 2KYBA 2LDMA 2GF7A 1GRIA 4LDXA 2PUOB 1W4SA 3S3NA 2CKKA 2E64A 4QQ6A 4GLKA 4IIMA 4V2SA 1LPLA 3CCRA 4JDSA 3RERA 1E7OA 4R55A 1JB0E 4BE0A 1RAIB 4C92E 3OS5A 2RI5A 2CUDA 4ZTFA 2YUPA 2VVKA 1PSFA 4KGVB 5FLXE 3R6OA 3EHQA 4LUEA 3LWHA 1N6AA 1TSFA 4J9BA 1HK9A 1I5LA 3H0IA 1MNEA 2V26A 1ZUYA 4QVDA 2QDLA 4AT1B 3QG1A 2VV5A 4RCCA 3UATA 4IURA 2DO3A 4PL6A 3UT1A 3VS6A 5GMKj 3QJ6A 4LE9A 2JN0A 3OYNA 2LMJA 1NPRA 1WQWA 4E7KA 5GMKh 5GANe 3EG9B 1KC8R 2QG9B 3TSZA 3ZBDA 2P4RA 4PJOB 1QCOA 2Y4XA 1X27A 2E10A 2P4TA 3KXTA 4J7IA 3CCUQ 4HCCA 4PJOE 4HVVA 5GAN5 2ZPFB 2DJZA 1C0MA 2DTHA 3A1PA 2XDDA 1T0HA 1Q81R 5I2SA 5D6WA 3PVLA 3QJYA 3VV0A 3OW2S 2VUBA 2ROLA 1PRMC 3M4YA 2RHUA 2XU8A 2DXCA 5LJ3g 3JB9G 5GMKl 3G6EQ 3SDZA 1X6GA 2MYSA 3ER0A 4EMKB 3M0SA 2PUKB 1VQ4T 2QTVA 4Z8AA 5FW9A 2AKKA 1WHLA 4C92C 1UHCA 1UUEA 2K6DA 5I2MA 2GFAA 2ZPEB 1VQLA 1M2OA 3CC7Q 3V7CA 2QA4A 1ZBJA 1TUDA 4IKFA 4RTTA 3J7AF 1YI2Q 3L42A 2CZ1B 2MMPA 3L2ZA 2EWNA 2R58A 2PVOB 1BBZA 2RK1A 3CCRQ 5CCAA 1IGQA 2KNBB 2DL7A 1HD3A 3CCQA 1WNLA 4J83A 4BDYA 2CDTA 2JTEA 4KH1B 1OV3A 1X2KA 4HA8A 4C0DB 2YSQA 1B34A 2XHCA 3QIIA 2CT4A 3BY7A 3O5ZA 1XOVA 1W1FA 1D3BA 1KHIA 4F7UB 2K3XA 3BFMA 3VS7A 1AT1B 1QWFA 4LN2A 2J6OA 3MJXA 2SEMA 2DXBA 2HSPA 3CBOA 3I5RA 4M7DA 2DD5A 5A0GA 1W2BA 2HKQB 1VQNT 1YJWQ 1QVFS 2DEUA 2M0YA 1ABOA 2IIMA 4PLLA 2K2VA 1VQOA 2FZGB 5IXFA 1UTIA 2XD0A 2KGTA 4FT4A 3OSVA 3PT9A 2KDSA 1SG5A 4KH0B 3I5SA 2YUNA 4FYVB 1Y57A 1KQSA 3PFSA 4MDXA 5KYWA 5CKHA 2B86A 4PLIA 4JLIA 4X1VA 3GLXA 3JB9J 3G7ZA 1K9MU 3L2VA 5KYXA 4M77B 2I0NA 2RN8A 3M9QA 1AVZC 1PD1A 1E6GA 1RAAB 1WZOA 4XK8E 3KFVA 1FMKA 1PRLC 3P8DA 2XMFA 2ZGWA 3VRYA 1WQ7A 4YTLA 3CEYA 2W10A 1NM7A 2CZ0B 1VQLQ 4QVCA 2JS2A 1YIJT 1XQHA 1BI3A 2QA4Q 3CC2A 1YN8A 2ENMA 2LQWA 3PIOA 2LQKA 2RQTA 4C92G 4PFPA 3CMET 1Q81U 2K2MA 3L2UA 4KT0E 4LD9K 2GNCA 2DXTA 2JNGA 2K5LA 2QQSA 2H3JA 3CCET 4RTXA 3CCQQ 5GMKe 1K4US 3OYEA 1W2BP 2LVMA 1Y07A 5GAOp 1KC8C 1CSKA 2DL4A 3PVQA 2RJEA 1QP3A 2FL7A 3FIFA 1OPLA 3M0PA 1W6XA 1X01A 2EQMA 2DM1A 4E7ZA 2OTLT 1Q81C 2RK2A 3O8VA 3QWXX 4OVAA 1LJOA 2BE7D 4K11A 3EG9A 4IIOA 2FG0A 3QXEB 2NWMA 3CC4T 4LUDA 1SKUB 2GFUA 1UGRB 4J6XA 3JAME 2LQ8A 3QHSA 2JW4A 3E9GA 2BZ8A 4PJOG 4MMKA 2F2WA 4C8QF 3CCJA 3URGA 4C0FA 1VQ6T 2G3RA 2D0QB 4EPCA 2FZCB 1UECA 2F1LA 4ZN3A 2E5KA 2HQHA 1VQMT 2FHDA 2LP5A 1YCYA 3I56T 4KGXB 1SHFA 3FRNA 2QEXA 2HBWA 3VS5A 1UGQB 3PMIA 1VQPT 2LC4A 1J3TA 1MGQA 2PZ1A 2VB6A 2J6FA 4AFUC 3HFOA 1TUCA 1I5OB 5IN1A 1ZUUA 4DOWA 3CXCP 5GAOm 3NMZC 1FMWA 4LDUA 4C5GA 1K76A 5GAMh 2PNIA 4BE1A 3GP8A 1PM3A 2JM9A 3WXMB 2CP7A 1UGSB 4PFZA 4OMLA 1UE9A 3CPFA 3CC2Q 5I11A 2HDAA 3QYGB 1ZLMA 3OSSC 1UB4A 4B6MA 4OB2B 2DTOA 4C8QE 4JS4A 2RNAA 2JM8A 3DB3A 2DX1A 4DBFA 3CQTA 2DXUA 4GLMA 1GCQA 4C8QD 3X25B 1BCOA 4F7UA 1VQKA 1U1SA 3EFOA 4J9HA 2X35A 1ZSZA 1IB8A 4OP0A 1X43A 3EGXB 1WHMA 3EFSA 5CQXA 5FWBA 1VUBA 2LCLA 2P0QA 3CD6Q 1WIEA 2JOYA 4J6WA 1TOVA 5LL6S 4A4HA 1UGVA 2LNVA 1RAHB 2RD1A 1QWEA 3X24B 5GAOl 1WI7A 2X9HA 2EQKA 4JUVA 1UFFA 2CGHA 1NYGA 3CCUT 3SD4A 3C0CA 1N8RR 3NPFA 3A8MB 3LGLA 5FRMA 1PCXA 1BI0A 1KQ1A 3VUBA 1KSWA 3OB9A 3VS3A 1GXIE 4M77A 1JU5C 4A4EA 3G6ET 3VRZA 2QEXQ 5GJWB 2EYZA 1R0CB 2KMTA 3LWIA 1UGPB 4E7IA 3SWNC 4ZN1A 1VYTA 3EFRA 3ZL7C 2HD0A 2A7YA 4C8QC 3ASKA 1YFNA 2X51A 4J6YA 1M1FA 1GBQA 2MWPA 3CC7T 3X28B 4J9FA 3ZFJA 5L23A 4A4FA 2O88A 1BB9A 3BE3A 2A3LA 4NOYA 2JZ2A 1YI2T 4J9CA 1SSFA 1OU9A 1VOMA 5GANh 1YHQA 3MKDA 2JMCA 3L2RA 3CCLA 3CCRT 4A54A 1SSHA 2MWOA 2R5MA 2PVGB 1Q7YU 3CCMA 1M1KR 2GTOA 2K3YA 3RIRA 5DLOA 3C95A 2RMOA 4Y91A 3I35A 1O9SA 1MV3A 2JMAA 2M02A 4GBQA 4CC4B 1LCKA 3NHNA 1Z9QA 4BDZA 4X9CA 4FSSA 1U8RA 3LH0A 3JCMP 1G3TA 2EPDA 2CSIA 4OB1B 2BZYA 3TQ7P 4KUIA 1YJWT 4EDUA 3JCMf 2EYXA 4FIBA 4XTUA 1M1GA 1I81A 4QW2A 2QAZA 3EGDA 1VQ9A 4M7AF 2KT8A 1WPYA 2QQRA 2EQJA 2XDBA 5DM7R 4OMNA 2COZA 2L2PA 5HK3A 3OS2A 1W70A 5KYUB 1NLPC 3I9QA 2SRCA 3BDUA 5IAYA 2E3HA 3LX7A 4X9DA 4CI0C 2F2VA 1TU0B 1NYFA 3E2UA 2MF2A 2KK4A 2DVJA 4HXJA 1CKBA 3L2QA 5FU6C 5FU7C 1S72A 3CBPA 1N9RA 1F1BB 1Y96B 2KI7A 3M0TA 2KT1A 2QK0A 4XTYA 2F5KA 3OYJA 1VQLT 1WA7A 3OS0A 5EC7A 2ESWA 2QA4T 2AK5A 4EMHA 2DLPA 4HVUA 4M7AE 4C8QG 3M54A 3LLRA 2KY9A 2X4YA 4PK4A 1D0XA 3CCLQ 4M7AD 2HKNA 3CCQT 2CZ6B 4EIKA 3D7SB 1WHKA 1WGSA 3QDRB 5HY6A 1FWZA 1YJNA 1QKWA 4HKEA 4C92B 1JO8A 1N8RC 1JQQA 3EGXA 1ZX6A 2COWA 1Y7XA 3IQLA 1Q86U 1QW1A 5GMKm 1MNDA 4N0AA 1WXTA 3OBYA 4E2FB 1GL5A 2NUPA 1QVGS 2DMOA 4Y28E 1NJIU 1RAFB 2E65A 2LQNA 2EGAA 2F2XA 1AOJA 3S3OA 1UDLA 4AG1C 1M1KU 2FZKB 2BUDA 2RI3A 2JJ9A 9ATCB 4XTXA 2CP0A 4TVRA 3OYDA 1D1CA 3RESA 4NS5A 1VQ5Q 1K9MR 1Y0MA 2KRNA 1IHVA 8ATCB 2EVRA 3L1AA 4F16A 3EHRA 4D6WA 2CZ7B 4J8OA 2DPPB 3TVTA 4RTVA 2MAMA 1M1KC 4M7AC 2ZPGB 1I1JA 2PVDB 4ME7A 1WJQA 1VIEA 3REBB 3H0HA 4QQGA 2K57A 1KQ2A 1S72Q 2YDLA 3KBGA 3M56A
chains in the Genus database with same CATH topology
3JCMQ 1YIJA 1WQ7A 4YTLA 3CEYA 1FXXA 4XU3A 5CQYA 2DTIA 3BDLA 4OGEA 4C0ZA 4ZGEB 1JBMA 2CZ0B 1JJ2S 4QVCA 4J5YA 3HFNA 1YIJT 1XQHA 2JUFA 4XAXB 2RHYA 1BI3A 3SB2A 3GOXA 2QXFA 3CC2A 3DB4A 2O01E 4XQ3A 1U1TA 3PIOA 3CMEA 3JCMJ 2LQKA 2BKDN 3CC2T 2LT1A 4P5NA 4R56A 1IREB 4C92G 1KD1U 3CMET 4F7UG 1Q81U 2O4XB 4M78G 3VJPA 3L2UA 4KT0E 4C5EA 4LD9K 2K4YA 2DXTA 1H3ZA 2JNGA 2K5LA 2QQSA 4ZGDB 3PTAA 5GANd 2H3JA 2FYKA 3CCET 1TH7A 5GAN6 5GAOn 1Q82C 5GMKe 3OYEA 2VC8A 2LVMA 1Y07A 4M75A 5GAOp 1KC8C 5LJ5j 4N4IA 4J7FA 1ZQ1A 2XI9A 4C8QA 3QKJA 3M57A 4M7AB 2RJEA 3OBWA 1QP3A 4MMLA 2FL7A 3FIFA 2K5FA 2X4WA 3QZ5B 2X4XA 3LW5E 4L5GA 1X01A 3QPHA 5KH6A 2OTLA 2EQMA 2E41A 4BY6B 4M7DE 3S6WA 1R8OB 5GAMf 2QQAA 2OTLT 2JTMA 3JB9I 1Q81C 2RK2A 2QTXA 5CK9A 4OMFB 4M7DD 4MDWA 2R5AA 3O8VA 4RCBA 1BIAA 2DVEA 2E6ZA 4OVAA 1LJOA 3HPWA 2HBPA 4OB0B 2P0KA 3OW2A 3CD6T 3QXEB 4BD3A 3JCMc 5KE2A 3GNFB 1M90C 4JJNK 1HXDA 3CC4T 2XG8D 1OI1A 2RM4A 3L2WA 2V8KA 4HCZA 4IUTA 5FROA 3QZ9B 2D6FA 2GFUA 1G5VA 1UGRB 4J6XA 3JAME 2M0OA 2LQ8A 2E70A 2B8AA 3M58A 3QHSA 3V8KA 3OYBA 4M75F 2XIDA 3E9GA 2ZPHB 5L8RE 5LJ3j 5GAMg 2VGNA 1VQ7A 4PJOG 4MMKA 5EG2A 3FDRA 3QUIA 3M5AA 3NTKA 4C8QF 3CCJA 2LTOA 3URGA 3FEOA 4C0FA 4M77G 5GAN8 2G3RA 1VQ7T 1VQ6T 2D0QB 4EPCA 4LDWA 2EAYA 1OZ3A 2PQWA 3MP6A 1EIFA 1VQMA 2KQWA 5I21A 4ZN3A 2Y90A 4E7HA 1VQMT 4ATOA 2FHDA 2VGMA 2Y4YA 3HL8A 4C5IA 1YCYA 3I56T 3HP9A 1YI2A 1VQPA 3A5ZB 1M9SA 4X34A 4E7LA 2HQEA 3FRNA 4IUPA 2QEXA 4BB7A 5GANj 1UGQB 2QQBA 3JSCA 4NL3A 3PMIA 1K73C 2ZPIB 3T9NA 2LC4A 3A8GB 3M4GA 3ZEHA 5KE3A 1VQPT 1MGQA 2QEXT 5C0MA 4L6V5 3LGFA 5A0DA 3I55A 4CRIA 3M53A 3HFOA 3JRZA 4PJOF 1VQOT 1Y96A 2CYZB 3MEAA 3A8OB 5IN1A 3OYAA 2M9UA 5CO7A 3I55T 4MZTA 2YLCA 3META 2F69A 4DOWA 1UEBA 1Q86C 3Q1JA 5GAOm 5LJ5f 2VYTA 4JRQA 3X20B 4LDUA 4C92D 4C5GA 4IUUA 5GAMh 4BE1A 3GP8A 3MCAB 2XK0A 2RJCA 5CKBA 3WXMB 4ZTJA 1UGSB 2RHZA 1P92A 1NJIC 4M7AG 2QDYB 3MP1A 2C06A 3NTIA 3CPFA 5CAIA 4OB3B 3JCMW 3QBYA 1N9SA 3A8HB 3QYGB 4N0AC 4M7DC 2L3RA 3FLGA 3OSSC 1UB4A 4M75E 2EJ9A 2OAUA 3JB9H 4BE2A 3RMQA 2YLBA 4OB2B 2DTOA 2CS7A 1IZ6A 4C8QE 5CKEA 4E47A 4JS4A 3DB3A 5LJ5g 1WJRA 3TEEA 1YJWA 2XICA 4QVZA 2DXUA 2EJGA 3GNGA 4M75D 5HKCA 3E9FA 3JCMd 2EQUA 3MEUA 4N4HA 4C8QD 2K5IA 2QI2A 3X25B 4BI4A 4EMGA 4C92A 5LJ3d 4F7UA 1VQKA 1U1SA 3VYGA 4M78A 1G3WA 4Z02A 3CMAA 1B34B 2X35A 3OYCA 3FB9A 2M1HA 2JVVA 2RHXA 5GAN7 3CMAT 2KSSA 4PNOA 3G4SA 2YHTA 4OP0A 1K9MC 1ZHIA 3OYGA 1D3BB 3G4ST 2EYQA 2DZCA 4FU6A 5GAMe 1VQ5A 3A8LB 4C5HA 1QVPA 3EFSA 4LD6A 3CXCA 5CQXA 1YJ9A 1VUBA 1RL2A 3V7SA 1BI1A 3SFMA 3TCJA 1YJ9T 4PJOD 3SWNA 2LCLA 2EKOA 2P0QA 2RH2A 3HRTA 4FL6A 2JOYA 3RUXA 4JRKA 5C6SA 5M9OA 4J6WA 5GANf 1XNIA 5LL6S 3AHUA 3H6ZA 3CPWA 4M7DB 4A4HA 2LNVA 3F70A 3GPLA 2RD1A 3JCMX 5GAOr 1QP2A 4IUVA 5LJ5h 3X24B 5GAOl 1VQ4A 2LRQA 1NZ9A 2EFIA 1I8FA 2DIGA 1BYMA 2EQKA 3CCUA 1O75A 4Q5WA 4JUVA 4DA4A 4ELYC 4C92F 4XTWA 1AHJB 2CGHA 2MI6A 3VUZA 4F7UF 3CCUT 1KD1C 4M78F 2V8IA 1H641 2KVQG 3SD4A 3DLMA 5GAOq 3A8MB 2DEQA 4LDVA 4N4GA 3LGLA 4O6JA 2E5QA 2AHJB 4ELZC 1JJ2A 5FRMA 3C4SA 5CIUA 5GANg 4XU2A 1BI0A 5A2QE 1KQ1A 3VUBA 2HAXA 4XU1A 3OMGA 2WSCE 4PJOA 4KBMB 4HCBA 3V8JA 5HK0A 3OB9A 1LNXA 3PNWC 3G6EA 2BIVA 3OA6A 5FRNA 1GXIE 4JRPA 3GF5A 4M77A 1N8RU 2M16A 2EIFA 4A4EA 3G6ET 3MEVA 1N27A 3HRSA 3QYHB 4FT2A 1Y71A 3KUFA 1LOJA 3RMSA 4DOVA 3JCMh 2KMTA 3LWIA 1UGPB 4E7IA 3WVEB 1I4K1 1PSEA 3SWNC 3J80E 4ZN1A 4KUDK 4M75C 3EFRA 2PU9B 1YBYA 2DZ9A 2A7YA 2HD0A 2QQ9A 5J3BA 5LJ3h 4C0GA 4C8QC 4QQDA 4BUGA 1X6OA 2FB7A 3RKWA 3CC7A 3CCJT 3ASKA 3RKYA 3J81E 2ZZDA 3UDCA 4J6YA 5GAN2 1M1FA 4BACA 2LDMA 2MWPA 3CC7T 5LJ5e 3X28B 2V8JA 2GF7A 3ZFJA 3LYIA 2F5TX 3WVDB 4A4FA 1K8AU 4LDXA 2PUOB 1W4SA 4A4KA 4EMKA 3MP8A 2CKKA 2A3LA 3S3NA 2O4XA 2E64A 2JZ2A 4NOYA 4QQ6A 4GLKA 1SSFA 1YI2T 4V2SA 2JTFA 3OMCA 2NLUA 3CCRA 4JDSA 5GANh 1YHQA 3RERA 3C94A 3PIPA 2WSEE 4R55A 3L2RA 4MZPA 1JB0E 3CCLA 3CCRT 4BI8B 4BE0A 4A54A 4C92E 3S3MA 2VXFA 4M77F 4F7UE 1VQNA 4PJOC 2MWOA 2R5MA 2PVGB 2VXEA 4M78E 3CCLT 3V7RA 3OS5A 1Q7YU 2RI5A 3CCMA 2KAFA 4M7AA 4ZTFA 1PSFA 2K3YA 1BKBA 3RIRA 3R6OA 5FLXE 5DLOA 3C95A 3V8LA 1OYXA 4M78D 2RJFA 3LWHA 1N6AA 3SWNB 4Y91A 3OYMA 3MHXA 4M75B 2DKGA 1HK9A 4GY5A 1I5LA 1O9SA 4M7DG 1M8VA 5D6YA 1VIFA 4C8QB 4RG8A 3OYLA 4QVDA 4MZMA 2R57A 5LJ3e 5AYFA 2I2LA 3N5BB 4BDZA 3QG1A 2VV5A 1OZ2A 4RCCA 4X9CA 1G3YA 4UC4A 4IURA 2DO3A 1U8RA 3LH0A 3OYHA 4A4GA 4PL6A 3OYFA 3JCMP 4ZGJB 5GAN3 1G3TA 2IG0A 4EMKC 3UT1A 4OF1A 3FC3A 3HHTB 2L5QA 5GMKj 2RA2A 3QJ6A 4OB1B 2E1HA 3PGGA 2JN0A 4KUIA 3OYNA 1YJWT 4EDUA 3JCMf 1NPRA 1WQWA 4FIBA 4XTUA 5GMKh 4E7KA 3X26B 1M1GA 5GANe 4HT8A 1I81A 3E1SA 4QW2A 4DQ2A 3ZBDA 4PJOB 2GQVA 5LJ3f 1VQ9A 4M7AF 1VQKT 1G3SA 2Y4XA 2E10A 2P4TA 4B9XA 1WPYA 2QQRA 3DLLA 2EQJA 3HKSA 2XDBA 5DM7R 3M55A 5HK3A 3KXTA 4J7IA 3OS2A 4JRIA 5J39A 4HCCA 1KHCA 4PJOE 5GAN5 2ZPFB 1Q82U 2DJZA 1KC8U 2DTHA 3BDUA 4M77E 5IAYA 2XDDA 4NL2A 2L89A 3LX7A 1VQ5T 4X9DA 4CI0C 3JCMg 5I2SA 5D6WA 3QJYA 3EAEA 3JCMV 2LT4A 4E7JA 3VV0A 4M77D 3OW2S 2VUBA 3M59A 3M4YA 2E6NA 1XTDA 2RHUA 2XU8A 2DXCA 2MF2A 3NTHA 5GMKl 5LJ3g 3JB9G 4C0DC 2KK4A 3SDZA 3UWNA 3ER0A 2E12A 3BW1A 4EMKB 5A0LA 3L2QA 3CBMA 2PUKB 2DD4A 5FU6C 1VQ4T 5FU7C 1S72A 4WF2A 3CCEA 3DKMA 3H8ZA 3OYIA 2DK3A 3CBPA 1N9RA 2ZCFB 4C92C 1S72T 2D9TA 3GIBA 1Y96B 4M78C 4IUQA 2GFAA 5I2MA 3G71A 5CR2A 2ZPEB 1M90U 1VQLA 2FVUA 4XTYA 3G71T 3V7CA 3JCMb 2F5KA 3P8HA 3OYJA 3ME9A 2QA4A 1W2BS 1VQLT 2XDPA 4XTVA 3OS0A 4JLGA 4IKFA 3MO8A 3UPUA 2L8DA 3JB9F 2QA4T 4EMHA 3INZA 5GAMd 3TU4K 3J7AF 3L42A 3QSUA 1RI0A 4M75G 2CZ1B 2MMPA 4PKCC 3L2ZA 4RMOA 4M7AE 2EWNA 2R58A 3PMTA 4C8QG 3M54A 2PVOB 3LLRA 2KY9A 2RK1A 3FJPA 2RJDA 3CCSA 2X4YA 5CCAA 4HT9A 3CCQA 2WACA 3OS1A 3CD6A 1WNLA 4J83A 4M7AD 3HSBA 1M4ZA 1JRIA 3CCST 4BDYA 3CC4A 4HA8A 4C0DB 2CZ6B 3CCQT 1FX7A 1B34A 2XHCA 4FM4B 3QIIA 1KG1A 1NPPA 1K73U 1KQSS 5FU6B 1WGSA 3VU3C 2RO0A 5FU7B 3BY7A 3QDRB 1XOVA 2GCXA 5D6XA 5HY6A 1FWZA 2HQXA 4A53A 1YJNA 4HKEA 4C92B 4L59A 4OGCA 1D3BA 1KHIA 3OY9A 4F7UB 2K3XA 3OYKA 3BFMA 1N8RC 5CKDA 1YJNT 4M78B 1VQ8A 1VQ6A 1WJSA 1YITA 1Y7XA 2DAQA 1Q86U 1VQ8T 1YITT 1M5Q1 1YHQT 1QW1A 2RHIA 5GMKi 2P0PA 2DXBA 5GMKm 3CBOA 4N0AA 4XU0A 2DD5A 1V29B 3OBYA 4BI3A 4KULA 5A0GA 3I56A 3CCVA 4M77C 1W2BA 2RI2A 1QVGS 1VQNT 3CCVT 1QVFS 4Y28E 5DLQE 2RB6A 3MEWA 5DY9A 3CCMT 4JS5A 1NJIU 5GAN4 3P8BB 4FSXA 4PLLA 2K2VA 1X75C 4O5VA 3JCMe 1VQOA 1K8AC 2E65A 3NFCA 4II1A 2X4JA 1BIBA 1MHNA 2XD0A 3S3OA 4FT4A 3HRUA 2EJFA 2LCCA 3TREA 1M1KU 2BUDA 5KCHA 1NE8A 2RI3A 3OSVA 3PT9A 5CVIA 5J26A 2KDSA 4XTXA 3RKXA 5LJ5d 2XKOC 3JB9D 2WSFE 5GAMj 2IVWA 2OTJA 4TVRA 3OYDA 1DJ7B 3OQ5A 3RESA 1KQSA 4RG2A 3VYHB 4NS5A 3PFSA 3QO3A 4M7DA 3CXCS 4MDXA 1Q7YC 2OTJT 5CKHA 3C12A 5KCOA 1BI2A 4PLIA 3L1AA 4RKUE 2LX9A 4VUBA 3OYYA 3CPWS 4M7DF 4JLIA 2ZPBB 4D6WA 4LDYA 2CZ7B 3E19A 2YRVA 3GLXA 5IT9E 3G7ZA 4J8OA 2DPPB 3L2VA 3JB9J 1K9MU 2DIQA 4M77B 4B9WA 2MAMA 3VKIA 1M1KC 4M7AC 2ZPGB 1VQ9T 2PVDB 3M9QA 2HNIA 1ZBXA 4ME7A 1WJQA 1VIEA 4XK8E 1KQ2A 4QQGA 2K57A 5CKFA 1QVGA 1QVFA 3KBGA 4XTZA 4BY6C 3M56A 3P8DA 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6Y A;  3JCM Q;  5GAN 2;  4XTY A;  1WQ7 A;  5GAM h;  4XU3 A;  5LJ5 e;  2DTI A;  3V7C A;  3JCM b;  1JBM A;  4QVC A;  4J5Y A;  3HFN A;  4XTV A;  4EMK A;  3SB2 A;  3JB9 F;  4XQ3 A;  4EMH A;  3INZ A;  5GAM d;  4M7A G;  2E64 A;  1U1T A;  4NOY A;  3QSU A;  3JCM J;  4M75 G;  4V2S A;  5CAI A;  3L2Z A;  5GAN h;  3RER A;  1N9S A;  2EWN A;  4C92 G;  4N0A C;  4C8Q G;  4M7D C;  4M7A E;  4F7U G;  4M75 E;  3FJP A;  2EJ9 A;  4M78 G;  3JB9 H;  2YLB A;  2DTO A;  4A54 A;  4C92 E;  2VXF A;  4M77 F;  4C8Q E;  4F7U E;  4HT9 A;  4PJO C;  2DXT A;  1WNL A;  4M78 E;  5LJ5 g;  2VXE A;  5GAN d;  3HSB A;  3V7R A;  1JRI A;  4M7A D;  2FYK A;  3JCM d;  2DXU A;  1TH7 A;  2EJG A;  4M75 D;  5GAN 6;  5GAO n;  4HA8 A;  5GMK e;  4M7A A;  2VC8 A;  3RIR A;  4M75 A;  5GAO p;  1B34 A;  4C8Q D;  3V8L A;  5LJ5 j;  4EMG A;  4M78 D;  4C92 A;  4C8Q A;  5LJ3 d;  4F7U A;  3VU3 C;  1U1S A;  4M7A B;  3SWN B;  4M78 A;  4Y91 A;  3BY7 A;  4A53 A;  4MML A;  4M75 B;  2DKG A;  1HK9 A;  3FIF A;  1B34 B;  1I5L A;  4M7D G;  3FB9 A;  1M8V A;  4C92 B;  1D3B A;  4C8Q B;  1X01 A;  4F7U B;  5GAN 7;  3BFM A;  4QVD A;  2E41 A;  4M78 B;  5LJ3 e;  4M7D E;  4PNO A;  2I2L A;  5GAM f;  2YHT A;  4OP0 A;  4RCC A;  4X9C A;  3JB9 I;  1D3B B;  2DZC A;  2QTX A;  1M5Q 1;  5GAM e;  4M7D D;  3EFS A;  3JCM P;  5GMK i;  4RCB A;  1BIA A;  2DVE A;  5GMK m;  4EMK C;  5GAN 3;  4N0A A;  4XU0 A;  3RKY A;  1LJO A;  4M7D A;  3V7S A;  4M77 C;  5GMK j;  4PJO D;  3SWN A;  2RA2 A;  3RUX A;  3JCM W;  2E1H A;  3PGG A;  2JN0 A;  4JRK A;  3JCM c;  4J6W A;  2RB6 A;  5DY9 A;  5GAN f;  3JCM f;  3AHU A;  1WQW A;  1HXD A;  4XTU A;  5GMK h;  4M7D B;  5GAN 4;  2RM4 A;  5GAN e;  4HT8 A;  1I81 A;  2RD1 A;  3JCM e;  3JCM X;  5GAO r;  5LJ5 h;  2E65 A;  4DQ2 A;  5GAO l;  4PJO B;  1BIB A;  5LJ3 f;  4J6X A;  4M7A F;  1I8F A;  3QHS A;  3V8K A;  2EJF A;  2E10 A;  4M75 F;  5GAM g;  1WPY A;  5LJ3 j;  4JUV A;  4PJO G;  4MMK A;  4C92 F;  3QUI A;  4XTW A;  4C8Q F;  2CGH A;  4F7U F;  4XTX A;  3RKX A;  5LJ5 d;  5GAN 8;  4M78 F;  4JRI A;  4M77 G;  1H64 1;  3JB9 D;  4PJO E;  5GAM j;  5GAN 5;  2EAY A;  2DJZ A;  5GAO q;  2DEQ A;  5I21 A;  3RES A;  2DTH A;  3BDU A;  4M77 E;  4NL2 A;  3QO3 A;  2Y90 A;  5GAN g;  4XU2 A;  4X9D A;  1KQ1 A;  3JCM g;  4XU1 A;  3JCM V;  1YCY A;  4PJO A;  3L1A A;  3V8J A;  4M77 D;  1LNX A;  5GAN j;  4M77 A;  4NL3 A;  5LJ3 g;  3JB9 G;  5GMK l;  4M7D F;  4JLI A;  3M4G A;  1MGQ A;  3JB9 J;  1LOJ A;  3BW1 A;  4EMK B;  3JCM h;  3HFO A;  4M77 B;  4PJO F;  1I4K 1;  1Y96 A;  4M7A C;  3SWN C;  4WF2 A;  2HNI A;  4M75 C;  3EFR A;  2YLC A;  1KQ2 A;  2K57 A;  2DZ9 A;  5LJ3 h;  1N9R A;  4C92 C;  4C8Q C;  5GAO m;  2FB7 A;  1Y96 B;  3RKW A;  3GIB A;  4M78 C;  4XTZ A;  5LJ5 f;  2ZGW A;  4C92 D; 
#chains in the Genus database with same CATH topology
 1FXX A;  5CQY A;  2DTI A;  4ZGE B;  1JBM A;  1VA7 A;  4J5Y A;  2JUF A;  1M2V B;  2H8H A;  3SB2 A;  2DRK A;  3DB4 A;  4QKU A;  2KRM A;  1QQJ A;  3CC2 T;  2LT1 A;  1IRE B;  2EKH A;  2OJ2 A;  4HCK A;  3PTA A;  2EBP A;  5GAN 6;  5GAO n;  2ABL A;  2VC8 A;  2K79 A;  4AFZ C;  2X4W A;  3LW5 E;  4L5G A;  5KH6 A;  1RAG B;  1YJN Q;  1AWJ A;  1PC0 A;  2E41 A;  1GCP A;  2CP5 A;  3S6W A;  5FWC A;  2W0Z A;  3JB9 I;  4F04 B;  2R5A A;  2DVE A;  2E6Z A;  4QT7 A;  1KFZ A;  3CD6 T;  3JCM c;  3GNF B;  1ZA1 B;  2L3S A;  1MUZ A;  2XG8 D;  2RM4 A;  3L2W A;  3AT1 B;  2V8K A;  4HCZ A;  1RAE B;  3HTR A;  2D6F A;  4OMP A;  1U5S A;  2O9V A;  2E70 A;  3V8K A;  2OI3 A;  1WX6 A;  4M75 F;  5KYU A;  3G1J A;  2LTO A;  2EAY A;  1TWB A;  3MP6 A;  1EZZ B;  1YWO A;  2Y90 A;  3RR6 A;  5AT1 B;  4ATO A;  2Y4Y A;  3HL8 A;  1V1C A;  1M9S A;  2HL3 A;  3JSC A;  4NL3 A;  2ZPI B;  3ZEH A;  3A8G B;  2QEX T;  5C0M A;  3I55 A;  3JRZ A;  1Y96 A;  3A8O B;  1ARK A;  3Q1J A;  5LJ5 f;  4JRQ A;  3X20 B;  4JJB A;  2LJ0 A;  1YWP A;  2DF6 A;  3CPW P;  2J05 A;  2XK0 A;  5CKB A;  2A0F B;  2RHZ A;  1P92 A;  4M7A G;  2J7I A;  3MP1 A;  3TSW A;  2E4H A;  1TTH B;  3NTI A;  5CAI A;  2H3E B;  1BK2 A;  4M75 E;  2A28 A;  3JB9 H;  4BE2 A;  2OX7 A;  2COY A;  1K1Z A;  1E6H A;  1JXM A;  1VYU A;  3JCM d;  4M75 D;  5HKC A;  1JJ2 P;  3R6N A;  2K5I A;  4RTZ A;  4EMG A;  4C92 A;  2RQW A;  1NEG A;  1Q82 R;  3UF4 A;  2RQU A;  3FB9 A;  2JVV A;  5IHN A;  2DYB A;  3G4S A;  2KRO A;  1K9M C;  1OX9 A;  2DE0 X;  3A8L B;  4C5H A;  1QVP A;  3CXC A;  1M3C A;  1NEB A;  1YJ9 A;  1RL2 A;  3TCJ A;  3TU4 K;  2RH2 A;  3HRT A;  4FL6 A;  3JCM W;  4AMC A;  1XNI A;  3H6Z A;  4A63 B;  3F70 A;  3JCM X;  2KXC A;  1QP2 A;  1VQ4 A;  3VS2 A;  1M27 C;  2DIG A;  1BYM A;  1O75 A;  1Q95 G;  2MI6 A;  2O2O A;  4M78 F;  1H64 1;  1RAD B;  5GAO q;  3H41 A;  2ZAE A;  1EX4 A;  5CIU A;  5A2Q E;  2HAX A;  1ZSZ C;  4PJO A;  1RUW A;  5HK0 A;  5FRN A;  4JRP A;  2M16 A;  2EIF A;  1N27 A;  2DBK A;  2ECZ A;  3QYH B;  1LOJ A;  3RMS A;  3JCM h;  1VQO Q;  3WVE B;  1X6B A;  1I4K 1;  3I55 Q;  4KUD K;  4M75 C;  2PU9 B;  4PJL A;  1YBY A;  2FB7 A;  3RKY A;  1M2V A;  2ZZD A;  1XJW B;  3LYI A;  2F5T X;  3WVD B;  1K8A U;  4A4K A;  4EMK A;  2JT4 A;  3MP8 A;  1YP5 A;  2GQI A;  1B07 A;  2A37 A;  2C0T A;  1Q7Y R;  3OMC A;  1T3L A;  4FW1 A;  5I22 A;  4BI8 B;  3S3M A;  2YWW A;  2VXF A;  2L3P A;  1VQN A;  4M78 E;  2VXE A;  3CCL T;  1PWT A;  2KAF A;  1BKB A;  3U23 A;  2FO0 A;  3V8L A;  4M78 D;  2RJF A;  4DEX A;  3SWN B;  3OYM A;  1SPK A;  1HYO A;  2KBT A;  2DKG A;  4DBH A;  1WLP B;  5D6Y A;  1VIF A;  2HCK A;  3QWY A;  4C8Q B;  4RG8 A;  4MZM A;  5AYF A;  4Z88 A;  1HSQ A;  2I2L A;  1H3H A;  1G3Y A;  4UC4 A;  3G4S Q;  4JPB W;  4A4G A;  3OYF A;  5GAN 3;  2IG0 A;  4FW2 A;  4OF1 A;  3FC3 A;  1JXO A;  1YJ9 Q;  4CC7 A;  1WFW A;  2E1H A;  2KE9 A;  3PGG A;  2CP2 A;  2EGC A;  1M3B A;  3X26 B;  4HT8 A;  5KYY B;  2GQV A;  1QLY A;  4B9X A;  3DLL A;  3HKS A;  3H9N A;  4PFO A;  3M55 A;  3UA7 A;  5J39 A;  1Q82 U;  1C6V X;  4NL2 A;  2D8H A;  2L89 A;  1VQ5 T;  3JCM g;  1KIK A;  3EAE A;  3M59 A;  2E6N A;  1XTD A;  3NTH A;  2HSE B;  2RQV A;  2E12 A;  3BW1 A;  5A0L A;  2DD4 A;  2VKN A;  3CCE A;  4LXC A;  3DKM A;  3H8Z A;  3OYI A;  2YXY A;  2DK3 A;  1U06 A;  1S72 T;  2D0N A;  3CCJ Q;  3GIB A;  4M78 C;  4IUQ A;  3G71 A;  1D1B A;  5CR2 A;  2C0O A;  1M90 U;  2FVU A;  2CSQ A;  3JCM b;  3P8H A;  1W2B S;  4JLG A;  3M0Q A;  3JB9 F;  1NBE B;  3QSU A;  1RI0 A;  4M75 G;  4PKC C;  1PD0 A;  1D0Z A;  3H0F A;  3FJP A;  3CCS A;  2RQR A;  3OS1 A;  3HSB A;  1M4Z A;  1JRI A;  4E6R A;  3CC4 A;  4FM4 B;  1NPP A;  1Q86 R;  1K73 U;  1KQS S;  5FU6 B;  2RO0 A;  5FU7 B;  5D6X A;  6AT1 B;  2EW3 A;  2HQX A;  2E3I A;  1V76 A;  4L59 A;  4OGC A;  1VQ6 A;  1YJN T;  1VQ8 A;  1YIT A;  2RPN A;  1NJI R;  2RHI A;  5IXB A;  3CCV A;  4BI3 A;  3I56 A;  2QAS A;  3EG0 A;  4KUL A;  2DET A;  1KK7 A;  2O9S A;  5DLQ E;  2RB6 A;  4JS5 A;  2L3Q A;  2HZY A;  3JCM e;  3NFC A;  1VQK Q;  3HRU A;  4J9G A;  1NE8 A;  5CVI A;  5J26 A;  2CRE A;  2NUT B;  2DBM A;  5LJ5 d;  2MK5 A;  3JB9 D;  2OTJ A;  1DJ7 B;  3OQ5 A;  2JXB A;  3QO3 A;  3CXC S;  1Q7Y C;  1PNJ A;  3C12 A;  5KCO A;  4RKU E;  3VS1 A;  1QCN A;  4VUB A;  1PKS A;  4M7D F;  2CH4 W;  2ZPB B;  4LDY A;  3E19 A;  5IT9 E;  4PJJ A;  4AFS C;  2DIQ A;  2YUO A;  3VKI A;  1ZBX A;  2MCN A;  5CKF A;  1MV0 B;  2A36 A;  1QVF A;  2D1X A;  4BY6 C;  4XTZ A;  3JCM Q;  3OW2 P;  4XU3 A;  3G71 Q;  4C0Z A;  1MMA A;  3HFN A;  2O31 A;  4XAX B;  1VYV A;  2YUQ A;  3GOX A;  1RI9 A;  3EG1 A;  4XQ3 A;  1U1T A;  3JCM J;  2BKD N;  4P5N A;  4R56 A;  1S1N A;  4M4Z A;  1KD1 U;  2O4X B;  2MOX A;  1T0J A;  4M78 G;  3VJP A;  1TUG B;  3UA6 A;  4C5E A;  4RTY A;  4FCY A;  2K4Y A;  2Z0W A;  1H3Z A;  5D7U A;  3CCS Q;  1WHJ A;  1TH7 A;  1OPK A;  5KYN A;  5LJ5 j;  4N4I A;  4J7F A;  1ZQ1 A;  4C8Q A;  3QKJ A;  3M57 A;  4M7A B;  1HJD A;  3OBW A;  4FYW B;  4MML A;  1IGU A;  2DRM A;  5IHK A;  1B3Q A;  2K5F A;  3QPH A;  4M7D E;  1R8O B;  5GAM f;  1VQ8 Q;  1YIT Q;  1YHQ Q;  2QTX A;  5CK9 A;  4OMF B;  4M7D D;  4MDW A;  4JJC A;  4RCB A;  1KJW A;  2HBP A;  4OB0 B;  2P0K A;  3LH5 A;  1EFN A;  1R0B G;  3PE0 A;  4BD3 A;  3CCV Q;  3CCM Q;  1HXD A;  3RNJ A;  4F17 A;  2KYM A;  1JEG A;  2YRD A;  4J9I A;  2XID A;  5L8R E;  3OYB A;  5LJ3 j;  2VGN A;  1VQ7 A;  3FDR A;  3NTK A;  3FEO A;  4LDW A;  1OZ3 A;  1EIF A;  2KQW A;  1QVF P;  1MMD A;  2OTJ Q;  3EG2 A;  3HP9 A;  1YI2 A;  3A5Z B;  1SRM A;  2HQE A;  5KE3 A;  3M4G A;  1YCS B;  2FEI A;  3LGF A;  4L6V 5;  5A0D A;  4CRI A;  1GFC A;  2DL8 A;  4PJO F;  4E7S A;  1VQO T;  1B7T A;  3MEA A;  1VQ9 Q;  1X69 A;  3OYA A;  2M9U A;  3I55 T;  1H8K A;  2YLC A;  1Q86 C;  3REA B;  2VYT A;  2V1R A;  4RUG A;  4C92 D;  4IUU A;  1IO6 A;  4DEY A;  1WHG A;  1NG2 A;  1ZSG A;  2AT1 B;  3RBB B;  2LJ1 A;  1NJI C;  1PG5 B;  2QDY B;  2C06 A;  2DL5 A;  1G8X A;  1N9S A;  3A8H B;  4M7D C;  2KR3 A;  2L3R A;  1AWX A;  2QYZ A;  3RMQ A;  2NYS A;  1IZ6 A;  5CKE A;  7AT1 B;  5LJ5 g;  1WXU A;  3TEE A;  1YJW A;  2XIC A;  3GNG A;  3E9F A;  4RTU A;  2CH4 A;  2CUB A;  4JZ4 A;  3CMA A;  3OYC A;  2CP3 A;  2RHX A;  4PNO A;  2ED1 A;  2K3B A;  2KXD A;  1ZHI A;  3OYG A;  3G4S T;  2EYQ A;  4LD6 A;  3EH1 A;  1H92 A;  1BI1 A;  3SFM A;  1YJ9 T;  2X3X D;  4PJO D;  1OUL A;  2EKO A;  5C6S A;  3RUX A;  5GAN f;  2CP6 A;  1GFD A;  3CPW A;  1AD5 A;  1WHH A;  2NUZ A;  2V1Q A;  2NUT A;  2LRQ A;  2EGE A;  1NZ9 A;  1SRL A;  2EFI A;  2DA9 A;  4DA4 A;  4R0K A;  1ACM B;  3VUZ A;  4F7U F;  2V8I A;  1VQ7 Q;  3MPU B;  4LDV A;  2DEQ A;  4N4G A;  4O6J A;  4J9D A;  1JJ2 A;  4AFQ C;  4XU2 A;  4XU1 A;  4KBM B;  1LNX A;  1TG0 A;  2BIV A;  1OQK A;  4WCI A;  3MEV A;  4FT2 A;  1Y71 A;  3KUF A;  5GJV B;  1PSE A;  3J80 E;  2L0A A;  1K8A R;  2DL3 A;  1NLO C;  1OU8 A;  2DZ9 A;  4QQD A;  2LX7 A;  1X6O A;  3RKW A;  3CCJ T;  3J81 E;  3GBQ A;  5GAN 2;  4BAC A;  5ECA A;  4Z89 A;  1SF9 A;  4KRT A;  5LJ5 e;  2V8J A;  3A98 A;  4OMQ A;  1U3O A;  2O4X A;  3EFO B;  1UJY A;  2JTF A;  1IRX A;  2NLU A;  1IHW A;  3C94 A;  1BU1 A;  3PIP A;  2WSE E;  4MZP A;  1ZSZ B;  3SHW A;  1M30 A;  4M77 F;  2FRW A;  4F7U E;  4PJO C;  3V7R A;  4M7A A;  1RLQ C;  1OYX A;  2P84 A;  1M3A A;  3MHX A;  4M75 B;  4GY5 A;  4M7D G;  1M8V A;  1D0Y A;  4JZ3 A;  3OYL A;  3CMA Q;  2R57 A;  5LJ3 e;  5IHI A;  3N5B B;  3EH2 A;  1OZ2 A;  4ANJ A;  1ZA2 B;  3OYH A;  4ZGJ B;  4EMK C;  4ESR A;  3HHT B;  2L5Q A;  2ROT A;  2RA2 A;  1UHF A;  3E1S A;  4DQ2 A;  5LJ3 f;  1VQK T;  1G3S A;  1OX8 A;  4FYY B;  2EYW A;  4JRI A;  1KHC A;  4OMM A;  3RDV A;  1KC8 U;  4M77 E;  1AZG B;  3JCM V;  2LT4 A;  4E7J A;  4M77 D;  1UG1 A;  1I0C A;  4C0D C;  3UWN A;  4PJM A;  1M90 R;  3QDF A;  3CBM A;  2BE9 B;  4WF2 A;  1GCQ C;  4ORZ A;  2ZCF B;  2D9T A;  2D8J A;  1I07 A;  2EYY A;  3G71 T;  3ME9 A;  2KRS A;  2XDP A;  4XTV A;  3MO8 A;  1K0S A;  3UPU A;  2L8D A;  5GAM d;  3INZ A;  1UJ0 A;  1CKA A;  2DYI A;  4RMO A;  2HL5 C;  3PMT A;  1AWO A;  1K73 R;  2G6F X;  2RJD A;  4DBR A;  4HT9 A;  1BCM A;  2WAC A;  3CD6 A;  1D09 B;  3CCS T;  1KQS P;  2GBQ A;  1FX7 A;  4LNP A;  1KG1 A;  3VU3 C;  2QGF B;  4A53 A;  2GCX A;  3NGP A;  3SEM A;  3OY9 A;  1N5Z A;  3OYK A;  5CKD A;  4M78 B;  1MMG A;  3FJ5 A;  1SHG A;  1WJS A;  1SEM A;  1QCF A;  2DAQ A;  3EGD B;  1VQ8 T;  4CC3 A;  1YIT T;  1M5Q 1;  1YHQ T;  2J06 A;  5GMK i;  2P0P A;  1OOT A;  4XU0 A;  1V29 B;  4M77 C;  2RI2 A;  1WDX A;  1FMV A;  3CCV T;  4J9E A;  3MEW A;  5DY9 A;  3CCM T;  5GAN 4;  3P8B B;  4FSX A;  1QMC A;  1X75 C;  4O5V A;  1K8A C;  2GTJ A;  4II1 A;  2X4J A;  1BIB A;  1MHN A;  2EJF A;  2LCC A;  3TRE A;  5KCH A;  2CT3 A;  2ATC B;  3RKX A;  1A0N B;  2XKO C;  2WSF E;  4RTW A;  5GAM j;  2IVW A;  3M0U A;  2AZS A;  4RG2 A;  3VYH B;  1YNZ A;  2OTJ T;  1BI2 A;  4WTO B;  2MIO A;  2LX9 A;  3CPW S;  3OYY A;  1WXB A;  2YRV A;  2RF0 A;  1Z9Z A;  2JS0 A;  1VQ4 Q;  4B9W A;  1VQ9 T;  1C1A A;  2HNI A;  2HMA A;  1QVG A;  8AT1 B;  3EGU A;  1YIJ A;  1KD1 R;  3BDL A;  2X3W D;  4OGE A;  1K0X A;  1JJ2 S;  2RHY A;  2AIR B;  2QXF A;  2O01 E;  3CME A;  2MPX C;  2BTT A;  2ED0 A;  4F7U G;  2FPE A;  2M51 A;  2QGG A;  2KEA A;  4ZGD B;  5GAN d;  2C0I A;  2FYK A;  1Q82 C;  4HVW A;  4M75 A;  2XI9 A;  1QKX A;  2NUP B;  4CC2 A;  3QZ5 B;  2X4X A;  2OTL A;  4BY6 B;  2LNH B;  3THK A;  2QQA A;  2K7A A;  4D8K A;  2JTM A;  1BIA A;  3HPW A;  5HCK A;  2K9G A;  1VQN Q;  3OW2 A;  5KE2 A;  1M90 C;  1M8M A;  4JJN K;  1RAC B;  4D8D A;  1OI1 A;  5IH2 A;  4IUT A;  4PJN A;  3QZ9 B;  5FRO A;  1T3S A;  2AZV A;  1G5V A;  2M0O A;  3M58 A;  2B8A A;  1OEB A;  2PTK A;  2ZPH B;  5GAM g;  5EG2 A;  3QUI A;  3M5A A;  5GAN 8;  4M77 G;  1VQ7 T;  2IPO B;  2PQW A;  1QVG P;  1VQM A;  5I21 A;  2VWF A;  2OAW A;  4E7H A;  2FRY A;  1TS9 A;  1PHT A;  2VGM A;  4C5I A;  1VQP A;  4E7L A;  3EG3 A;  4X34 A;  4IUP A;  4BB7 A;  5GAN j;  2QQB A;  1K73 C;  3T9N A;  4ZNX A;  4OMO A;  1G2B A;  1PKT A;  3M53 A;  2FPF A;  2CYZ B;  2DER A;  5CO7 A;  4MZT A;  3MET A;  4AG2 C;  2F69 A;  1UEB A;  1ABQ A;  3M0R A;  3MCA B;  1YIJ Q;  1WYX A;  2RJC A;  4ZTJ A;  2BZX A;  4Y92 A;  1K9A A;  2HEQ A;  4OB3 B;  2GGR A;  3QBY A;  4N0A C;  3CME Q;  3FLG A;  2EJ9 A;  2OAU A;  3VS4 A;  2YLB A;  2CS7 A;  4E47 A;  1RAB B;  1WJR A;  3CCE Q;  4QVZ A;  2EJG A;  2EQU A;  3MEU A;  4N4H A;  1X2Q A;  2QI2 A;  4BI4 A;  5LJ3 d;  3VYG A;  4M78 A;  2YT6 A;  2DFU A;  1G3W A;  4Z02 A;  1B34 B;  2M1H A;  5GAN 7;  3CMA T;  2KSS A;  1GBR A;  2YHT A;  2OTL Q;  1D3B B;  2YRC A;  2DZC A;  4FU6 A;  5GAM e;  1VQ5 A;  1AZE A;  4DBQ A;  2DJQ A;  4FYX B;  3V7S A;  3SWN A;  3AHU A;  4JRK A;  5M9O A;  1G83 A;  3CC4 Q;  4M7D B;  2J6K A;  2VAS A;  3GPL A;  2LZ6 B;  5GAO r;  4IUV A;  5LJ5 h;  4F14 A;  2A08 A;  1FYN A;  2AKL A;  2DIL A;  1I8F A;  3CCU A;  2DNU A;  1D1A A;  4Q5W A;  4ELY C;  4C92 F;  4XTW A;  1AHJ B;  1KD1 C;  1VQ6 Q;  2KVQ G;  3DLM A;  1IXD A;  1ZUK A;  1LVK A;  1RLP C;  2AHJ B;  2E5Q A;  2EQI A;  3ULR B;  4ELZ C;  1AWW A;  3C4S A;  5GAN g;  1VQM Q;  3OMG A;  3I56 Q;  2WSC E;  5KYY A;  4HCB A;  3V8J A;  3PNW C;  3G6E A;  3OA6 A;  1TXQ A;  3GF5 A;  5KYW B;  1N8R U;  4JJD A;  1VQP Q;  3HRS A;  3JV3 A;  4DOV A;  3VS0 A;  4KGZ B;  2LCS A;  2LJ3 A;  1R77 A;  5J3B A;  5LJ3 h;  2QQ9 A;  1MMN A;  4C0G A;  5KYX B;  1AEY A;  4BUG A;  3CC7 A;  3UDC A;  2FPD A;  2KYB A;  2LDM A;  2GF7 A;  1GRI A;  4LDX A;  2PUO B;  1W4S A;  3S3N A;  2CKK A;  2E64 A;  4QQ6 A;  4GLK A;  4IIM A;  4V2S A;  1LPL A;  3CCR A;  4JDS A;  3RER A;  1E7O A;  4R55 A;  1JB0 E;  4BE0 A;  1RAI B;  4C92 E;  3OS5 A;  2RI5 A;  2CUD A;  4ZTF A;  2YUP A;  2VVK A;  1PSF A;  4KGV B;  5FLX E;  3R6O A;  3EHQ A;  4LUE A;  3LWH A;  1N6A A;  1TSF A;  4J9B A;  1HK9 A;  1I5L A;  3H0I A;  1MNE A;  2V26 A;  1ZUY A;  4QVD A;  2QDL A;  4AT1 B;  3QG1 A;  2VV5 A;  4RCC A;  3UAT A;  4IUR A;  2DO3 A;  4PL6 A;  3UT1 A;  3VS6 A;  5GMK j;  3QJ6 A;  4LE9 A;  2JN0 A;  3OYN A;  2LMJ A;  1NPR A;  1WQW A;  4E7K A;  5GMK h;  5GAN e;  3EG9 B;  1KC8 R;  2QG9 B;  3TSZ A;  3ZBD A;  2P4R A;  4PJO B;  1QCO A;  2Y4X A;  1X27 A;  2E10 A;  2P4T A;  3KXT A;  4J7I A;  3CCU Q;  4HCC A;  4PJO E;  4HVV A;  5GAN 5;  2ZPF B;  2DJZ A;  1C0M A;  2DTH A;  3A1P A;  2XDD A;  1T0H A;  1Q81 R;  5I2S A;  5D6W A;  3PVL A;  3QJY A;  3VV0 A;  3OW2 S;  2VUB A;  2ROL A;  1PRM C;  3M4Y A;  2RHU A;  2XU8 A;  2DXC A;  5LJ3 g;  3JB9 G;  5GMK l;  3G6E Q;  3SDZ A;  1X6G A;  2MYS A;  3ER0 A;  4EMK B;  3M0S A;  2PUK B;  1VQ4 T;  2QTV A;  4Z8A A;  5FW9 A;  2AKK A;  1WHL A;  4C92 C;  1UHC A;  1UUE A;  2K6D A;  5I2M A;  2GFA A;  2ZPE B;  1VQL A;  1M2O A;  3CC7 Q;  3V7C A;  2QA4 A;  1ZBJ A;  1TUD A;  4IKF A;  4RTT A;  3J7A F;  1YI2 Q;  3L42 A;  2CZ1 B;  2MMP A;  3L2Z A;  2EWN A;  2R58 A;  2PVO B;  1BBZ A;  2RK1 A;  3CCR Q;  5CCA A;  1IGQ A;  2KNB B;  2DL7 A;  1HD3 A;  3CCQ A;  1WNL A;  4J83 A;  4BDY A;  2CDT A;  2JTE A;  4KH1 B;  1OV3 A;  1X2K A;  4HA8 A;  4C0D B;  2YSQ A;  1B34 A;  2XHC A;  3QII A;  2CT4 A;  3BY7 A;  3O5Z A;  1XOV A;  1W1F A;  1D3B A;  1KHI A;  4F7U B;  2K3X A;  3BFM A;  3VS7 A;  1AT1 B;  1QWF A;  4LN2 A;  2J6O A;  3MJX A;  2SEM A;  2DXB A;  2HSP A;  3CBO A;  3I5R A;  4M7D A;  2DD5 A;  5A0G A;  1W2B A;  2HKQ B;  1VQN T;  1YJW Q;  1QVF S;  2DEU A;  2M0Y A;  1ABO A;  2IIM A;  4PLL A;  2K2V A;  1VQO A;  2FZG B;  5IXF A;  1UTI A;  2XD0 A;  2KGT A;  4FT4 A;  3OSV A;  3PT9 A;  2KDS A;  1SG5 A;  4KH0 B;  3I5S A;  2YUN A;  4FYV B;  1Y57 A;  1KQS A;  3PFS A;  4MDX A;  5KYW A;  5CKH A;  2B86 A;  4PLI A;  4JLI A;  4X1V A;  3GLX A;  3JB9 J;  3G7Z A;  1K9M U;  3L2V A;  5KYX A;  4M77 B;  2I0N A;  2RN8 A;  3M9Q A;  1AVZ C;  1PD1 A;  1E6G A;  1RAA B;  1WZO A;  4XK8 E;  3KFV A;  1FMK A;  1PRL C;  3P8D A;  2XMF A;  2ZGW A;  3VRY A;  1WQ7 A;  4YTL A;  3CEY A;  2W10 A;  1NM7 A;  2CZ0 B;  1VQL Q;  4QVC A;  2JS2 A;  1YIJ T;  1XQH A;  1BI3 A;  2QA4 Q;  3CC2 A;  1YN8 A;  2ENM A;  2LQW A;  3PIO A;  2LQK A;  2RQT A;  4C92 G;  4PFP A;  3CME T;  1Q81 U;  2K2M A;  3L2U A;  4KT0 E;  4LD9 K;  2GNC A;  2DXT A;  2JNG A;  2K5L A;  2QQS A;  2H3J A;  3CCE T;  4RTX A;  3CCQ Q;  5GMK e;  1K4U S;  3OYE A;  1W2B P;  2LVM A;  1Y07 A;  5GAO p;  1KC8 C;  1CSK A;  2DL4 A;  3PVQ A;  2RJE A;  1QP3 A;  2FL7 A;  3FIF A;  1OPL A;  3M0P A;  1W6X A;  1X01 A;  2EQM A;  2DM1 A;  4E7Z A;  2OTL T;  1Q81 C;  2RK2 A;  3O8V A;  3QWX X;  4OVA A;  1LJO A;  2BE7 D;  4K11 A;  3EG9 A;  4IIO A;  2FG0 A;  3QXE B;  2NWM A;  3CC4 T;  4LUD A;  1SKU B;  2GFU A;  1UGR B;  4J6X A;  3JAM E;  2LQ8 A;  3QHS A;  2JW4 A;  3E9G A;  2BZ8 A;  4PJO G;  4MMK A;  2F2W A;  4C8Q F;  3CCJ A;  3URG A;  4C0F A;  1VQ6 T;  2G3R A;  2D0Q B;  4EPC A;  2FZC B;  1UEC A;  2F1L A;  4ZN3 A;  2E5K A;  2HQH A;  1VQM T;  2FHD A;  2LP5 A;  1YCY A;  3I56 T;  4KGX B;  1SHF A;  3FRN A;  2QEX A;  2HBW A;  3VS5 A;  1UGQ B;  3PMI A;  1VQP T;  2LC4 A;  1J3T A;  1MGQ A;  2PZ1 A;  2VB6 A;  2J6F A;  4AFU C;  3HFO A;  1TUC A;  1I5O B;  5IN1 A;  1ZUU A;  4DOW A;  3CXC P;  5GAO m;  3NMZ C;  1FMW A;  4LDU A;  4C5G A;  1K76 A;  5GAM h;  2PNI A;  4BE1 A;  3GP8 A;  1PM3 A;  2JM9 A;  3WXM B;  2CP7 A;  1UGS B;  4PFZ A;  4OML A;  1UE9 A;  3CPF A;  3CC2 Q;  5I11 A;  2HDA A;  3QYG B;  1ZLM A;  3OSS C;  1UB4 A;  4B6M A;  4OB2 B;  2DTO A;  4C8Q E;  4JS4 A;  2RNA A;  2JM8 A;  3DB3 A;  2DX1 A;  4DBF A;  3CQT A;  2DXU A;  4GLM A;  1GCQ A;  4C8Q D;  3X25 B;  1BCO A;  4F7U A;  1VQK A;  1U1S A;  3EFO A;  4J9H A;  2X35 A;  1ZSZ A;  1IB8 A;  4OP0 A;  1X43 A;  3EGX B;  1WHM A;  3EFS A;  5CQX A;  5FWB A;  1VUB A;  2LCL A;  2P0Q A;  3CD6 Q;  1WIE A;  2JOY A;  4J6W A;  1TOV A;  5LL6 S;  4A4H A;  1UGV A;  2LNV A;  1RAH B;  2RD1 A;  1QWE A;  3X24 B;  5GAO l;  1WI7 A;  2X9H A;  2EQK A;  4JUV A;  1UFF A;  2CGH A;  1NYG A;  3CCU T;  3SD4 A;  3C0C A;  1N8R R;  3NPF A;  3A8M B;  3LGL A;  5FRM A;  1PCX A;  1BI0 A;  1KQ1 A;  3VUB A;  1KSW A;  3OB9 A;  3VS3 A;  1GXI E;  4M77 A;  1JU5 C;  4A4E A;  3G6E T;  3VRZ A;  2QEX Q;  5GJW B;  2EYZ A;  1R0C B;  2KMT A;  3LWI A;  1UGP B;  4E7I A;  3SWN C;  4ZN1 A;  1VYT A;  3EFR A;  3ZL7 C;  2HD0 A;  2A7Y A;  4C8Q C;  3ASK A;  1YFN A;  2X51 A;  4J6Y A;  1M1F A;  1GBQ A;  2MWP A;  3CC7 T;  3X28 B;  4J9F A;  3ZFJ A;  5L23 A;  4A4F A;  2O88 A;  1BB9 A;  3BE3 A;  2A3L A;  4NOY A;  2JZ2 A;  1YI2 T;  4J9C A;  1SSF A;  1OU9 A;  1VOM A;  5GAN h;  1YHQ A;  3MKD A;  2JMC A;  3L2R A;  3CCL A;  3CCR T;  4A54 A;  1SSH A;  2MWO A;  2R5M A;  2PVG B;  1Q7Y U;  3CCM A;  1M1K R;  2GTO A;  2K3Y A;  3RIR A;  5DLO A;  3C95 A;  2RMO A;  4Y91 A;  3I35 A;  1O9S A;  1MV3 A;  2JMA A;  2M02 A;  4GBQ A;  4CC4 B;  1LCK A;  3NHN A;  1Z9Q A;  4BDZ A;  4X9C A;  4FSS A;  1U8R A;  3LH0 A;  3JCM P;  1G3T A;  2EPD A;  2CSI A;  4OB1 B;  2BZY A;  3TQ7 P;  4KUI A;  1YJW T;  4EDU A;  3JCM f;  2EYX A;  4FIB A;  4XTU A;  1M1G A;  1I81 A;  4QW2 A;  2QAZ A;  3EGD A;  1VQ9 A;  4M7A F;  2KT8 A;  1WPY A;  2QQR A;  2EQJ A;  2XDB A;  5DM7 R;  4OMN A;  2COZ A;  2L2P A;  5HK3 A;  3OS2 A;  1W70 A;  5KYU B;  1NLP C;  3I9Q A;  2SRC A;  3BDU A;  5IAY A;  2E3H A;  3LX7 A;  4X9D A;  4CI0 C;  2F2V A;  1TU0 B;  1NYF A;  3E2U A;  2MF2 A;  2KK4 A;  2DVJ A;  4HXJ A;  1CKB A;  3L2Q A;  5FU6 C;  5FU7 C;  1S72 A;  3CBP A;  1N9R A;  1F1B B;  1Y96 B;  2KI7 A;  3M0T A;  2KT1 A;  2QK0 A;  4XTY A;  2F5K A;  3OYJ A;  1VQL T;  1WA7 A;  3OS0 A;  5EC7 A;  2ESW A;  2QA4 T;  2AK5 A;  4EMH A;  2DLP A;  4HVU A;  4M7A E;  4C8Q G;  3M54 A;  3LLR A;  2KY9 A;  2X4Y A;  4PK4 A;  1D0X A;  3CCL Q;  4M7A D;  2HKN A;  3CCQ T;  2CZ6 B;  4EIK A;  3D7S B;  1WHK A;  1WGS A;  3QDR B;  5HY6 A;  1FWZ A;  1YJN A;  1QKW A;  4HKE A;  4C92 B;  1JO8 A;  1N8R C;  1JQQ A;  3EGX A;  1ZX6 A;  2COW A;  1Y7X A;  3IQL A;  1Q86 U;  1QW1 A;  5GMK m;  1MND A;  4N0A A;  1WXT A;  3OBY A;  4E2F B;  1GL5 A;  2NUP A;  1QVG S;  2DMO A;  4Y28 E;  1NJI U;  1RAF B;  2E65 A;  2LQN A;  2EGA A;  2F2X A;  1AOJ A;  3S3O A;  1UDL A;  4AG1 C;  1M1K U;  2FZK B;  2BUD A;  2RI3 A;  2JJ9 A;  9ATC B;  4XTX A;  2CP0 A;  4TVR A;  3OYD A;  1D1C A;  3RES A;  4NS5 A;  1VQ5 Q;  1K9M R;  1Y0M A;  2KRN A;  1IHV A;  8ATC B;  2EVR A;  3L1A A;  4F16 A;  3EHR A;  4D6W A;  2CZ7 B;  4J8O A;  2DPP B;  3TVT A;  4RTV A;  2MAM A;  1M1K C;  4M7A C;  2ZPG B;  1I1J A;  2PVD B;  4ME7 A;  1WJQ A;  1VIE A;  3REB B;  3H0H A;  4QQG A;  2K57 A;  1KQ2 A;  1S72 Q;  2YDL A;  3KBG A;  3M56 A; 
#chains in the Genus database with same CATH homology
 3JCM Q;  1YIJ A;  1WQ7 A;  4YTL A;  3CEY A;  1FXX A;  4XU3 A;  5CQY A;  2DTI A;  3BDL A;  4OGE A;  4C0Z A;  4ZGE B;  1JBM A;  2CZ0 B;  1JJ2 S;  4QVC A;  4J5Y A;  3HFN A;  1YIJ T;  1XQH A;  2JUF A;  4XAX B;  2RHY A;  1BI3 A;  3SB2 A;  3GOX A;  2QXF A;  3CC2 A;  3DB4 A;  2O01 E;  4XQ3 A;  1U1T A;  3PIO A;  3CME A;  3JCM J;  2LQK A;  2BKD N;  3CC2 T;  2LT1 A;  4P5N A;  4R56 A;  1IRE B;  4C92 G;  1KD1 U;  3CME T;  4F7U G;  1Q81 U;  2O4X B;  4M78 G;  3VJP A;  3L2U A;  4KT0 E;  4C5E A;  4LD9 K;  2K4Y A;  2DXT A;  1H3Z A;  2JNG A;  2K5L A;  2QQS A;  4ZGD B;  3PTA A;  5GAN d;  2H3J A;  2FYK A;  3CCE T;  1TH7 A;  5GAN 6;  5GAO n;  1Q82 C;  5GMK e;  3OYE A;  2VC8 A;  2LVM A;  1Y07 A;  4M75 A;  5GAO p;  1KC8 C;  5LJ5 j;  4N4I A;  4J7F A;  1ZQ1 A;  2XI9 A;  4C8Q A;  3QKJ A;  3M57 A;  4M7A B;  2RJE A;  3OBW A;  1QP3 A;  4MML A;  2FL7 A;  3FIF A;  2K5F A;  2X4W A;  3QZ5 B;  2X4X A;  3LW5 E;  4L5G A;  1X01 A;  3QPH A;  5KH6 A;  2OTL A;  2EQM A;  2E41 A;  4BY6 B;  4M7D E;  3S6W A;  1R8O B;  5GAM f;  2QQA A;  2OTL T;  2JTM A;  3JB9 I;  1Q81 C;  2RK2 A;  2QTX A;  5CK9 A;  4OMF B;  4M7D D;  4MDW A;  2R5A A;  3O8V A;  4RCB A;  1BIA A;  2DVE A;  2E6Z A;  4OVA A;  1LJO A;  3HPW A;  2HBP A;  4OB0 B;  2P0K A;  3OW2 A;  3CD6 T;  3QXE B;  4BD3 A;  3JCM c;  5KE2 A;  3GNF B;  1M90 C;  4JJN K;  1HXD A;  3CC4 T;  2XG8 D;  1OI1 A;  2RM4 A;  3L2W A;  2V8K A;  4HCZ A;  4IUT A;  5FRO A;  3QZ9 B;  2D6F A;  2GFU A;  1G5V A;  1UGR B;  4J6X A;  3JAM E;  2M0O A;  2LQ8 A;  2E70 A;  2B8A A;  3M58 A;  3QHS A;  3V8K A;  3OYB A;  4M75 F;  2XID A;  3E9G A;  2ZPH B;  5L8R E;  5LJ3 j;  5GAM g;  2VGN A;  1VQ7 A;  4PJO G;  4MMK A;  5EG2 A;  3FDR A;  3QUI A;  3M5A A;  3NTK A;  4C8Q F;  3CCJ A;  2LTO A;  3URG A;  3FEO A;  4C0F A;  4M77 G;  5GAN 8;  2G3R A;  1VQ7 T;  1VQ6 T;  2D0Q B;  4EPC A;  4LDW A;  2EAY A;  1OZ3 A;  2PQW A;  3MP6 A;  1EIF A;  1VQM A;  2KQW A;  5I21 A;  4ZN3 A;  2Y90 A;  4E7H A;  1VQM T;  4ATO A;  2FHD A;  2VGM A;  2Y4Y A;  3HL8 A;  4C5I A;  1YCY A;  3I56 T;  3HP9 A;  1YI2 A;  1VQP A;  3A5Z B;  1M9S A;  4X34 A;  4E7L A;  2HQE A;  3FRN A;  4IUP A;  2QEX A;  4BB7 A;  5GAN j;  1UGQ B;  2QQB A;  3JSC A;  4NL3 A;  3PMI A;  1K73 C;  2ZPI B;  3T9N A;  2LC4 A;  3A8G B;  3M4G A;  3ZEH A;  5KE3 A;  1VQP T;  1MGQ A;  2QEX T;  5C0M A;  4L6V 5;  3LGF A;  5A0D A;  3I55 A;  4CRI A;  3M53 A;  3HFO A;  3JRZ A;  4PJO F;  1VQO T;  1Y96 A;  2CYZ B;  3MEA A;  3A8O B;  5IN1 A;  3OYA A;  2M9U A;  5CO7 A;  3I55 T;  4MZT A;  2YLC A;  3MET A;  2F69 A;  4DOW A;  1UEB A;  1Q86 C;  3Q1J A;  5GAO m;  5LJ5 f;  2VYT A;  4JRQ A;  3X20 B;  4LDU A;  4C92 D;  4C5G A;  4IUU A;  5GAM h;  4BE1 A;  3GP8 A;  3MCA B;  2XK0 A;  2RJC A;  5CKB A;  3WXM B;  4ZTJ A;  1UGS B;  2RHZ A;  1P92 A;  1NJI C;  4M7A G;  2QDY B;  3MP1 A;  2C06 A;  3NTI A;  3CPF A;  5CAI A;  4OB3 B;  3JCM W;  3QBY A;  1N9S A;  3A8H B;  3QYG B;  4N0A C;  4M7D C;  2L3R A;  3FLG A;  3OSS C;  1UB4 A;  4M75 E;  2EJ9 A;  2OAU A;  3JB9 H;  4BE2 A;  3RMQ A;  2YLB A;  4OB2 B;  2DTO A;  2CS7 A;  1IZ6 A;  4C8Q E;  5CKE A;  4E47 A;  4JS4 A;  3DB3 A;  5LJ5 g;  1WJR A;  3TEE A;  1YJW A;  2XIC A;  4QVZ A;  2DXU A;  2EJG A;  3GNG A;  4M75 D;  5HKC A;  3E9F A;  3JCM d;  2EQU A;  3MEU A;  4N4H A;  4C8Q D;  2K5I A;  2QI2 A;  3X25 B;  4BI4 A;  4EMG A;  4C92 A;  5LJ3 d;  4F7U A;  1VQK A;  1U1S A;  3VYG A;  4M78 A;  1G3W A;  4Z02 A;  3CMA A;  1B34 B;  2X35 A;  3OYC A;  3FB9 A;  2M1H A;  2JVV A;  2RHX A;  5GAN 7;  3CMA T;  2KSS A;  4PNO A;  3G4S A;  2YHT A;  4OP0 A;  1K9M C;  1ZHI A;  3OYG A;  1D3B B;  3G4S T;  2EYQ A;  2DZC A;  4FU6 A;  5GAM e;  1VQ5 A;  3A8L B;  4C5H A;  1QVP A;  3EFS A;  4LD6 A;  3CXC A;  5CQX A;  1YJ9 A;  1VUB A;  1RL2 A;  3V7S A;  1BI1 A;  3SFM A;  3TCJ A;  1YJ9 T;  4PJO D;  3SWN A;  2LCL A;  2EKO A;  2P0Q A;  2RH2 A;  3HRT A;  4FL6 A;  2JOY A;  3RUX A;  4JRK A;  5C6S A;  5M9O A;  4J6W A;  5GAN f;  1XNI A;  5LL6 S;  3AHU A;  3H6Z A;  3CPW A;  4M7D B;  4A4H A;  2LNV A;  3F70 A;  3GPL A;  2RD1 A;  3JCM X;  5GAO r;  1QP2 A;  4IUV A;  5LJ5 h;  3X24 B;  5GAO l;  1VQ4 A;  2LRQ A;  1NZ9 A;  2EFI A;  1I8F A;  2DIG A;  1BYM A;  2EQK A;  3CCU A;  1O75 A;  4Q5W A;  4JUV A;  4DA4 A;  4ELY C;  4C92 F;  4XTW A;  1AHJ B;  2CGH A;  2MI6 A;  3VUZ A;  4F7U F;  3CCU T;  1KD1 C;  4M78 F;  2V8I A;  1H64 1;  2KVQ G;  3SD4 A;  3DLM A;  5GAO q;  3A8M B;  2DEQ A;  4LDV A;  4N4G A;  3LGL A;  4O6J A;  2E5Q A;  2AHJ B;  4ELZ C;  1JJ2 A;  5FRM A;  3C4S A;  5CIU A;  5GAN g;  4XU2 A;  1BI0 A;  5A2Q E;  1KQ1 A;  3VUB A;  2HAX A;  4XU1 A;  3OMG A;  2WSC E;  4PJO A;  4KBM B;  4HCB A;  3V8J A;  5HK0 A;  3OB9 A;  1LNX A;  3PNW C;  3G6E A;  2BIV A;  3OA6 A;  5FRN A;  1GXI E;  4JRP A;  3GF5 A;  4M77 A;  1N8R U;  2M16 A;  2EIF A;  4A4E A;  3G6E T;  3MEV A;  1N27 A;  3HRS A;  3QYH B;  4FT2 A;  1Y71 A;  3KUF A;  1LOJ A;  3RMS A;  4DOV A;  3JCM h;  2KMT A;  3LWI A;  1UGP B;  4E7I A;  3WVE B;  1I4K 1;  1PSE A;  3SWN C;  3J80 E;  4ZN1 A;  4KUD K;  4M75 C;  3EFR A;  2PU9 B;  1YBY A;  2DZ9 A;  2A7Y A;  2HD0 A;  2QQ9 A;  5J3B A;  5LJ3 h;  4C0G A;  4C8Q C;  4QQD A;  4BUG A;  1X6O A;  2FB7 A;  3RKW A;  3CC7 A;  3CCJ T;  3ASK A;  3RKY A;  3J81 E;  2ZZD A;  3UDC A;  4J6Y A;  5GAN 2;  1M1F A;  4BAC A;  2LDM A;  2MWP A;  3CC7 T;  5LJ5 e;  3X28 B;  2V8J A;  2GF7 A;  3ZFJ A;  3LYI A;  2F5T X;  3WVD B;  4A4F A;  1K8A U;  4LDX A;  2PUO B;  1W4S A;  4A4K A;  4EMK A;  3MP8 A;  2CKK A;  2A3L A;  3S3N A;  2O4X A;  2E64 A;  2JZ2 A;  4NOY A;  4QQ6 A;  4GLK A;  1SSF A;  1YI2 T;  4V2S A;  2JTF A;  3OMC A;  2NLU A;  3CCR A;  4JDS A;  5GAN h;  1YHQ A;  3RER A;  3C94 A;  3PIP A;  2WSE E;  4R55 A;  3L2R A;  4MZP A;  1JB0 E;  3CCL A;  3CCR T;  4BI8 B;  4BE0 A;  4A54 A;  4C92 E;  3S3M A;  2VXF A;  4M77 F;  4F7U E;  1VQN A;  4PJO C;  2MWO A;  2R5M A;  2PVG B;  2VXE A;  4M78 E;  3CCL T;  3V7R A;  3OS5 A;  1Q7Y U;  2RI5 A;  3CCM A;  2KAF A;  4M7A A;  4ZTF A;  1PSF A;  2K3Y A;  1BKB A;  3RIR A;  3R6O A;  5FLX E;  5DLO A;  3C95 A;  3V8L A;  1OYX A;  4M78 D;  2RJF A;  3LWH A;  1N6A A;  3SWN B;  4Y91 A;  3OYM A;  3MHX A;  4M75 B;  2DKG A;  1HK9 A;  4GY5 A;  1I5L A;  1O9S A;  4M7D G;  1M8V A;  5D6Y A;  1VIF A;  4C8Q B;  4RG8 A;  3OYL A;  4QVD A;  4MZM A;  2R57 A;  5LJ3 e;  5AYF A;  2I2L A;  3N5B B;  4BDZ A;  3QG1 A;  2VV5 A;  1OZ2 A;  4RCC A;  4X9C A;  1G3Y A;  4UC4 A;  4IUR A;  2DO3 A;  1U8R A;  3LH0 A;  3OYH A;  4A4G A;  4PL6 A;  3OYF A;  3JCM P;  4ZGJ B;  5GAN 3;  1G3T A;  2IG0 A;  4EMK C;  3UT1 A;  4OF1 A;  3FC3 A;  3HHT B;  2L5Q A;  5GMK j;  2RA2 A;  3QJ6 A;  4OB1 B;  2E1H A;  3PGG A;  2JN0 A;  4KUI A;  3OYN A;  1YJW T;  4EDU A;  3JCM f;  1NPR A;  1WQW A;  4FIB A;  4XTU A;  5GMK h;  4E7K A;  3X26 B;  1M1G A;  5GAN e;  4HT8 A;  1I81 A;  3E1S A;  4QW2 A;  4DQ2 A;  3ZBD A;  4PJO B;  2GQV A;  5LJ3 f;  1VQ9 A;  4M7A F;  1VQK T;  1G3S A;  2Y4X A;  2E10 A;  2P4T A;  4B9X A;  1WPY A;  2QQR A;  3DLL A;  2EQJ A;  3HKS A;  2XDB A;  5DM7 R;  3M55 A;  5HK3 A;  3KXT A;  4J7I A;  3OS2 A;  4JRI A;  5J39 A;  4HCC A;  1KHC A;  4PJO E;  5GAN 5;  2ZPF B;  1Q82 U;  2DJZ A;  1KC8 U;  2DTH A;  3BDU A;  4M77 E;  5IAY A;  2XDD A;  4NL2 A;  2L89 A;  3LX7 A;  1VQ5 T;  4X9D A;  4CI0 C;  3JCM g;  5I2S A;  5D6W A;  3QJY A;  3EAE A;  3JCM V;  2LT4 A;  4E7J A;  3VV0 A;  4M77 D;  3OW2 S;  2VUB A;  3M59 A;  3M4Y A;  2E6N A;  1XTD A;  2RHU A;  2XU8 A;  2DXC A;  2MF2 A;  3NTH A;  5GMK l;  5LJ3 g;  3JB9 G;  4C0D C;  2KK4 A;  3SDZ A;  3UWN A;  3ER0 A;  2E12 A;  3BW1 A;  4EMK B;  5A0L A;  3L2Q A;  3CBM A;  2PUK B;  2DD4 A;  5FU6 C;  1VQ4 T;  5FU7 C;  1S72 A;  4WF2 A;  3CCE A;  3DKM A;  3H8Z A;  3OYI A;  2DK3 A;  3CBP A;  1N9R A;  2ZCF B;  4C92 C;  1S72 T;  2D9T A;  3GIB A;  1Y96 B;  4M78 C;  4IUQ A;  2GFA A;  5I2M A;  3G71 A;  5CR2 A;  2ZPE B;  1M90 U;  1VQL A;  2FVU A;  4XTY A;  3G71 T;  3V7C A;  3JCM b;  2F5K A;  3P8H A;  3OYJ A;  3ME9 A;  2QA4 A;  1W2B S;  1VQL T;  2XDP A;  4XTV A;  3OS0 A;  4JLG A;  4IKF A;  3MO8 A;  3UPU A;  2L8D A;  3JB9 F;  2QA4 T;  4EMH A;  3INZ A;  5GAM d;  3TU4 K;  3J7A F;  3L42 A;  3QSU A;  1RI0 A;  4M75 G;  2CZ1 B;  2MMP A;  4PKC C;  3L2Z A;  4RMO A;  4M7A E;  2EWN A;  2R58 A;  3PMT A;  4C8Q G;  3M54 A;  2PVO B;  3LLR A;  2KY9 A;  2RK1 A;  3FJP A;  2RJD A;  3CCS A;  2X4Y A;  5CCA A;  4HT9 A;  3CCQ A;  2WAC A;  3OS1 A;  3CD6 A;  1WNL A;  4J83 A;  4M7A D;  3HSB A;  1M4Z A;  1JRI A;  3CCS T;  4BDY A;  3CC4 A;  4HA8 A;  4C0D B;  2CZ6 B;  3CCQ T;  1FX7 A;  1B34 A;  2XHC A;  4FM4 B;  3QII A;  1KG1 A;  1NPP A;  1K73 U;  1KQS S;  5FU6 B;  1WGS A;  3VU3 C;  2RO0 A;  5FU7 B;  3BY7 A;  3QDR B;  1XOV A;  2GCX A;  5D6X A;  5HY6 A;  1FWZ A;  2HQX A;  4A53 A;  1YJN A;  4HKE A;  4C92 B;  4L59 A;  4OGC A;  1D3B A;  1KHI A;  3OY9 A;  4F7U B;  2K3X A;  3OYK A;  3BFM A;  1N8R C;  5CKD A;  1YJN T;  4M78 B;  1VQ8 A;  1VQ6 A;  1WJS A;  1YIT A;  1Y7X A;  2DAQ A;  1Q86 U;  1VQ8 T;  1YIT T;  1M5Q 1;  1YHQ T;  1QW1 A;  2RHI A;  5GMK i;  2P0P A;  2DXB A;  5GMK m;  3CBO A;  4N0A A;  4XU0 A;  2DD5 A;  1V29 B;  3OBY A;  4BI3 A;  4KUL A;  5A0G A;  3I56 A;  3CCV A;  4M77 C;  1W2B A;  2RI2 A;  1QVG S;  1VQN T;  3CCV T;  1QVF S;  4Y28 E;  5DLQ E;  2RB6 A;  3MEW A;  5DY9 A;  3CCM T;  4JS5 A;  1NJI U;  5GAN 4;  3P8B B;  4FSX A;  4PLL A;  2K2V A;  1X75 C;  4O5V A;  3JCM e;  1VQO A;  1K8A C;  2E65 A;  3NFC A;  4II1 A;  2X4J A;  1BIB A;  1MHN A;  2XD0 A;  3S3O A;  4FT4 A;  3HRU A;  2EJF A;  2LCC A;  3TRE A;  1M1K U;  2BUD A;  5KCH A;  1NE8 A;  2RI3 A;  3OSV A;  3PT9 A;  5CVI A;  5J26 A;  2KDS A;  4XTX A;  3RKX A;  5LJ5 d;  2XKO C;  3JB9 D;  2WSF E;  5GAM j;  2IVW A;  2OTJ A;  4TVR A;  3OYD A;  1DJ7 B;  3OQ5 A;  3RES A;  1KQS A;  4RG2 A;  3VYH B;  4NS5 A;  3PFS A;  3QO3 A;  4M7D A;  3CXC S;  4MDX A;  1Q7Y C;  2OTJ T;  5CKH A;  3C12 A;  5KCO A;  1BI2 A;  4PLI A;  3L1A A;  4RKU E;  2LX9 A;  4VUB A;  3OYY A;  3CPW S;  4M7D F;  4JLI A;  2ZPB B;  4D6W A;  4LDY A;  2CZ7 B;  3E19 A;  2YRV A;  3GLX A;  5IT9 E;  3G7Z A;  4J8O A;  2DPP B;  3L2V A;  3JB9 J;  1K9M U;  2DIQ A;  4M77 B;  4B9W A;  2MAM A;  3VKI A;  1M1K C;  4M7A C;  2ZPG B;  1VQ9 T;  2PVD B;  3M9Q A;  2HNI A;  1ZBX A;  4ME7 A;  1WJQ A;  1VIE A;  4XK8 E;  1KQ2 A;  4QQG A;  2K57 A;  5CKF A;  1QVG A;  1QVF A;  3KBG A;  4XTZ A;  4BY6 C;  3M56 A;  3P8D A;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...