4M7DG

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
77
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAAVKLNEIYIRGTFIKFIKLQDNIIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 14
structure length 77
sequence length 88
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dG00
3HFNA 2HNIA 1WQWA 2EJ9A 4NL2A 3RKXA 5LJ3h 4XQ3A 5LJ5j 3JCMe 4EMKC 4HT8A 4Y91A 4M77B 2VC8A 4C8QC 2EJFA 5GAMh 5GMKi 2E10A 5GANh 4X9DA 5GAN4 4M7DF 4M7DB 5GMKj 3QUIA 5LJ5d 1B34A 4PNOA 3JB9J 4M7AA 4M77C 4V2SA 1I4K1 4M77G 4C92A 2RM4A 4M7DC 4C8QE 4M75E 4MMLA 1HXDA 4XTWA 2QTXA 2DTIA 3RIRA 2VXFA 4M78B 4M78F 4F7UF 5LJ3j 5LJ5f 5GMKm 3HSBA 4M77E 4PJOF 5GAMj 4RCCA 2DVEA 5GAOq 2DZCA 4XTVA 5GANj 2YLBA 3BW1A 4EMKA 1N9SA 5GAN7 2RD1A 2YLCA 1LOJA 4M78C 5LJ3d 5GMKh 4M7DE 5GAMd 3AHUA 4RCBA 5GAN2 3EFRA 5GANd 5GAOr 3INZA 4M77A 4XTUA 3JCMg 1Y96B 3V7SA 3JCMV 4DQ2A 4M7AD 4XU2A 4XU1A 2K57A 3HFOA 3QHSA 4XU0A 4M78E 5LJ3f 4A53A 4C92D 2Y90A 1JRIA 2CGHA 2DXTA 5GAMf 3JCMP 1I5LA 4PJOE 4M75C 5GANf 1TH7A 4C8QG 2DZ9A 4M75G 5DY9A 5I21A 2DKGA 4M7AF 4NOYA 4A54A 3JB9H 3EFSA 4J6WA 2ZGWA 4N0AC 4PJOB 2JN0A 4M7DG 1D3BB 1LJOA 3JCMW 5LJ5e 3JCMQ 2YHTA 4F7UB 3V7CA 4C8QA 3JCMc 1Y96A 4M75A 2DEQA 4XU3A 3GIBA 4M78G 4PJOC 3M4GA 4F7UG 1N9RA 1M5Q1 1MGQA 4PJOG 3JB9I 4NL3A 3V7RA 3JB9D 3JCMb 5GAOm 3JCMh 2E1HA 4QVCA 5LJ3e 4N0AA 3JCMJ 4M7DA 3PGGA 5GAMe 4F7UE 3V8JA 5GANe 5GAN8 4HA8A 4MMKA 3RKWA 3SWNB 1WNLA 5GAOl 2EWNA 1KQ1A 3JB9F 3JCMX 4X9CA 4J6XA 1U1TA 5GAOn 4M7AB 2EJGA 4M78A 2RA2A 3SWNC 4C92F 3BY7A 4C8QD 4C92B 3VU3C 4F7UA 4M75D 5LJ5g 4PJOA 1LNXA 5CAIA 2DXUA 4M7AC 4XTYA 3SB2A 4C92C 3BDUA 4HT9A 2DTOA 4M77D 1M8VA 5GAN6 3BFMA 3JCMd 4J6YA 1BIBA 2FYKA 4JRIA 4XTZA 4EMGA 4QVDA 5GMKe 1KQ2A 4M7DD 3L1AA 3RUXA 4M7AE 3L2ZA 5LJ3g 1X01A 2FB7A 3FJPA 4C92E 1H641 5GAMg 2DJZA 3FIFA 2VXEA 4J5YA 2EAYA 4M77F 3JCMf 3SWNA 3RESA 5GANg 5GAN5 4M78D 4JUVA 3QSUA 4JRKA 4XTXA 4PJOD 1BIAA 5GAOp 3V8LA 1I81A 2DTHA 4M75F 4WF2A 1D3BA 1I8FA 1B34B 1U1SA 2I2LA 1HK9A 5LJ5h 3FB9A 5GAN3 3RERA 3V8KA 3JB9G 2RB6A 4M7AG 1JBMA 4JLIA 4C92G 5GMKl 4EMHA 4OP0A 2E41A 1WQ7A 3QO3A 4EMKB 4C8QB 1YCYA 1WPYA 4C8QF 4M75B 2E65A 2E64A 3RKYA
chains in the Genus database with same CATH superfamily
3CMEA 2QA4T 1ABQA 2E10A 3MEAA 2KEAA 4JPBW 2HD0A 3CBOA 2JW4A 3CCVT 2CP2A 1VQKT 1BCMA 2JS0A 2DA9A 3I55T 2DFUA 4LDVA 4RCCA 2WACA 2VV5A 1K0SA 1LPLA 4E47A 4F04B 5KYXA 4BE2A 3G6EQ 1MV3A 2YSQA 4C5HA 4JZ4A 1QP3A 2I0NA 2CH4A 4CC2A 5DY9A 2V1RA 2RF0A 1VQPQ 2KDSA 4OGEA 1D0YA 2RI3A 1VQKA 3OYDA 4HCZA 3I55A 3E19A 1W2BP 1YP5A 3WVDB 2YHTA 3GLXA 1TG0A 1NJIU 2R5MA 2KR3A 1GRIA 1VIEA 1QVGP 2RJEA 3M4GA 3N5BB 1VQ4A 3CPWA 2DK3A 5LJ3e 1PG5B 3JV3A 4RTUA 1ARKA 2NUTA 3OYFA 2DVJA 1OV3A 2DPPB 3CCST 1I0CA 3M4YA 3O8VA 2JZ2A 4X1VA 1S1NA 1B07A 3RUXA 3JRZA 1X43A 3H8ZA 4PLLA 3FJPA 1UGVA 3RESA 4AG2C 3LH0A 1BIAA 3PTAA 3UA7A 2DIGA 4MZTA 3VYGA 1U1SA 4QVZA 2M0YA 2D8JA 1NPRA 1BU1A 1RAEB 3CCSA 1UG1A 1M8MA 5CQYA 1IO6A 4EMKB 2MCNA 1WQWA 4NL2A 2LTOA 4XQ3A 3HPWA 3CCLA 2H3JA 4HT8A 4BDZA 2RK2A 1KFZA 3P8HA 2MAMA 3UA6A 2L3QA 2PTKA 1OQKA 2DE0X 2M51A 1IREB 1TUGB 4KRTA 2QQRA 2QTXA 3CCRT 3RIRA 2O01E 1Y7XA 1YIJQ 4IIOA 1VQNQ 4Q5WA 1EX4A 5GMKh 4JJDA 1AWJA 3AHUA 1VQ8Q 5GAN2 3EFRA 2DD4A 2RQVA 4AMCA 3OY9A 2K57A 3HRSA 1UE9A 4HVVA 3EHRA 2DXTA 4PK4A 4PJOE 1ZQ1A 5GANf 2O9SA 3PE0A 2RJDA 4FIBA 3TU4K 4QQ6A 2CKKA 1AWXA 1NLOC 3CCRA 1W70A 1QVFS 1D1CA 1X6BA 4C0ZA 5EC7A 3VS4A 1TTHB 2BZ8A 4HXJA 1WYXA 2CSIA 3JB9D 2AIRB 1K8AR 2A36A 1QW1A 2DJQA 4N0AA 1I5OB 3Q1JA 4IIMA 5CQXA 1Q82R 3CBPA 1SF9A 1G5VA 3SWNC 3OYGA 4PKCC 1K4US 5FU7B 5AYFA 1K8AU 4E7IA 1RUWA 2RHZA 5FU6B 1VQOQ 3QZ9B 4BI4A 3L2VA 1WHGA 4BD3A 3BE3A 1NYGA 2JT4A 1S72Q 2YUQA 3SFMA 3JB9G 1ZSZB 1H3HA 1C1AA 1WHMA 1KC8R 1TU0B 2HNIA 1M90R 1MMGA 4HT9A 2VC8A 3A8HB 2RH2A 1K9MU 1QCOA 3QUIA 1UGSB 4J7IA 2NUZA 2M02A 1PNJA 2YUOA 4QQGA 4PJOF 4PJOB 2XIDA 4Y28E 1SPKA 1PSEA 2D0QB 1GBQA 3RR6A 5GANd 2QYZA 2L5QA 3QBYA 1OEBA 5IN1A 4XTUA 1ZBJA 2ROTA 1HYOA 2XI9A 2Y90A 1JRIA 2FPFA 1C6VX 1OYXA 1X6GA 2L89A 4J6WA 1YHQT 5A0DA 1D3BB 3PMIA 3OYLA 3CC7T 4KH0B 2P4RA 2G6FX 3OW2P 2DBKA 3OYHA 1M1FA 1N5ZA 2KRMA 4RTWA 3OYIA 2FL7A 1NEGA 1ZUKA 1PC0A 3NMZC 3CCUQ 2MK5A 3JCMX 2ZPFB 2EJGA 2Z0WA 4F7UA 3BY7A 5CKFA 3VU3C 3OYJA 4IURA 1JJ2S 3CC7A 3RMSA 2CZ1B 1UGRB 1T0HA 2FPDA 3QDFA 1BIBA 2G3RA 1KQ2A 2M9UA 1WJRA 4TVRA 4ZTFA 4D8KA 4DEXA 3FIFA 4M77F 1IXDA 4DA4A 1FXXA 1YFNA 3MPUB 1AVZC 1FWZA 2F1LA 2LQNA 3QKJA 3EGUA 4E7HA 2YRVA 2FPEA 4WTOB 3LH5A 3OYBA 3M57A 4RTVA 4DOVA 1Y71A 2W10A 5GMKl 3H9NA 3QIIA 3G71T 1OX9A 2RHXA 1V29B 2GTJA 1UGPB 4EMKC 1NPPA 3OBWA 3OYAA 4PJJA 2JVVA 1M1GA 4KUDK 2HQHA 1TOVA 1I4K1 2HQEA 2NUPA 2HCKA 2J7IA 2PZ1A 2JTFA 1EIFA 3GNGA 4AFUC 1AOJA 1OULA 4J9DA 2K4YA 2DERA 3BW1A 3EFOB 5J26A 2V8JA 5GAOr 3OS2A 1JJ2A 4JJBA 2L3PA 5FLXE 1VQLA 3EG2A 3EG1A 2FZCB 3PT9A 3G4SQ 3L2QA 3CD6T 3L42A 1FYNA 2BE7D 5IH2A 2LQ8A 1PM3A 2QEXA 1Z9ZA 3SHWA 2XHCA 1N9RA 1ABOA 4A4EA 1ZHIA 4FU6A 3JCMh 2HL5C 1K73R 5GANe 1YN8A 3GBQA 2K7AA 2OTLQ 1GCPA 2EWNA 4OMNA 4XK8E 4OMQA 4M78A 3CD6A 2QQBA 1JB0E 5FU7C 1K73U 3RDVA 4ZGDB 4HCKA 2OTJT 1AD5A 1QLYA 5FU6C 2EAYA 1OOTA 1YITT 1ZX6A 4JRKA 1T0JA 3ZBDA 1B34B 4F14A 2I2LA 5KYYA 2RN8A 1VQ7T 3U23A 5LJ5h 2O31A 4HCBA 3UF4A 1X27A 1VQ6T 4L6V5 2A28A 4J8OA 2LT4A 1ZSZC 4J9EA 3QO3A 2VWFA 1KQSA 2OTJA 3A8OB 1GFCA 3CXCS 5KYUA 1YJ9T 1YITA 3CCJA 4ELZC 2LQWA 1M4ZA 2AKLA 2KE9A 2QTVA 3TREA 1QQJA 5GMKm 5GAMj 3CCEQ 3H0HA 1VQ6A 1M30A 1W1FA 2O88A 2EW3A 3C12A 3JCMg 4ATOA 3EG9A 3QHSA 2L3RA 1WHJA 4M75C 1WXBA 1YJ9A 2ZZDA 4IUTA 2O4XB 2RJCA 3VS2A 1YCSB 1YNZA 2AKKA 1PKSA 1AWWA 2ATCB 1X6OA 2CYZB 5I22A 4E7ZA 4CC4B 1NYFA 1N6AA 4OB0B 1QKWA 4PJOG 1KHIA 3JB9I 2NWMA 3H0IA 1WJQA 4OMOA 1WIEA 2E6ZA 4J9BA 4C0DC 1OPLA 4OGCA 1VQ9T 1RAFB 2A0FB 2F69A 2EKOA 5LJ5g 3M56A 3CXCA 1WHKA 4IUQA 2QA4Q 3S3NA 4M77D 2CUBA 4HKEA 3CCVQ 3S3MA 1WZOA 1VQKQ 1FMWA 3CPWP 3NTKA 2D0NA 4M78D 2LVMA 4XTXA 1DJ7B 5KCOA 2COWA 3OYNA 1I81A 1GXIE 1MMAA 2V8IA 2F5KA 2RQRA 3FJ5A 4ORZA 2JMAA 2DL4A 4LD6A 2YDLA 2IIMA 5CKHA 5D7UA 2RB6A 3PFSA 2CS7A 4N4GA 1W6XA 3CMET 1HJDA 5J39A 1UB4A 2DAQA 4M77G 4P5NA 2BKDN 3J7AF 4OB1B 3M0PA 1PHTA 3HP9A 2NUTB 3KBGA 2DVEA 1QCNA 1LOJA 3TSZA 1M3AA 1IZ6A 3CMAT 3MHXA 1SRLA 4OB2B 2LCCA 4J7FA 3M0QA 4A53A 4Y92A 1UJYA 3CPFA 3VS0A 3E2UA 2PVDB 8ATCB 1Q81C 5I21A 5KYWB 4M7AF 3M0TA 2K5IA 2GQVA 2JN0A 4LUDA 2DEUA 3CC2Q 1MNDA 2VGMA 2CZ6B 4F17A 3OA6A 1QWFA 4KH1B 2KRNA 1IGQA 2QDLA 1Y96A 3CMAA 2DMOA 1VQ4T 3NTIA 4N4HA 3L2UA 1VIFA 2E1HA 1NJIR 4JRPA 3X20B 4ANJA 2GQIA 4PJNA 1AZGB 2LJ3A 4JLGA 1U1TA 4LE9A 1YBYA 1LNXA 3UDCA 1RACB 1D1BA 3T9NA 2K3YA 1M8VA 1XJWB 3BFMA 3URGA 2FYKA 4EMGA 4RMOA 2Y4YA 1YJWQ 4FM4B 1B3QA 1X2KA 3SWNA 1NZ9A 2LNHB 3MKDA 2JM8A 4LNPA 2C0TA 4J83A 1RLQC 2ENMA 1U3OA 5ECAA 3FB9A 2ABLA 3RERA 2HAXA 2X4JA 2HBPA 4EPCA 2FZKB 3F70A 1XOVA 2KBTA 3RKYA 3CCLT 5KE2A 2F5TX 4Y91A 2R5AA 4RTTA 5GMKi 1ZSGA 4X9DA 4CI0C 2LX9A 1C0MA 2LX7A 1VUBA 1X2QA 4M7AA 2PNIA 1VQMQ 3VKIA 1G2BA 2O9VA 2GGRA 1K76A 5FRNA 2VASA 4CRIA 5LJ3j 1PD0A 1XQHA 3E1SA 2RJFA 5D6YA 2RQTA 2J6KA 5IHIA 3OS0A 2HEQA 4DBHA 4LDUA 4ZN1A 2YT6A 2KXDA 2J6FA 2ZPHB 5D6XA 1W2BS 2KT8A 2BZYA 5IAYA 2QGGA 4IKFA 1TH7A 2ED1A 9ATCB 1QVGS 2DKGA 2K5LA 3G6ET 1GCQC 3SDZA 2VVKA 1YJNQ 3GP8A 3JCMc 3S6WA 2DO3A 3GF5A 1R8OB 3A8GB 5DM7R 1Q86C 2L0AA 1UHFA 1SG5A 4FYXB 3FEOA 5FWBA 4A4KA 3G6EA 3PIOA 1M2VA 3OSSC 2HBWA 3SB2A 2GFUA 1G8XA 2X51A 1Q7YU 5GMKe 1VQPA 3OYYA 3ASKA 4DBFA 1N8RC 3L2ZA 4HVUA 1X01A 1W4SA 4JDSA 3JCMf 2JOYA 4JUVA 2MI6A 2V26A 1G3WA 2DL5A 3J80E 1R77A 1WJSA 1W2BA 4ESRA 3WVEB 3TCJA 3M0UA 2CP7A 2DL8A 4BY6B 2LDMA 3KXTA 1TWBA 1YHQQ 2CP0A 5A0GA 1BB9A 3H0FA 1F1BB 1PWTA 1TS9A 5GMKj 2E70A 2WSEE 4GY5A 4C92A 2RM4A 3EG0A 5A2QE 2EYQA 2D1XA 4A4FA 4F7UF 5LJ5f 1K9MR 4M77E 2O2OA 2JNGA 5I11A 4EMKA 3NFCA 2FRYA 3JSCA 2A7YA 2BIVA 4OF1A 4M7AD 3HFOA 4M78E 3QWXX 1QVFA 1G3SA 1YIJT 3QZ5B 4JS4A 1AEYA 1VQ8T 1Y07A 2AT1B 2SRCA 3JAME 4NOYA 3I5SA 2LQKA 1M27C 4DBQA 2DNUA 4KGZB 4E7SA 2ROLA 2DXCA 1OU9A 2DX1A 4ME7A 2DIQA 5CR2A 3V7RA 2EQKA 3JCMb 3I56Q 2BZXA 2QI2A 1K9AA 2KRSA 4M7DA 2EGAA 3PGGA 4FYWB 1RL2A 2MIOA 1YIJA 1M3CA 2EGCA 5DLQE 3ZL7C 1VQ8A 3G71Q 3HL8A 1UUEA 2R58A 4XTYA 3IQLA 3QG1A 3JCMd 2ZAEA 2RQUA 2K79A 3I35A 3VUBA 2K6DA 1V1CA 1PCXA 1JQQA 1WI7A 4FL6A 5CKDA 3O5ZA 3QDRB 1TUDA 2OI3A 2ZPGB 4QW2A 1HK9A 2JXBA 2DLPA 4QQDA 3WXMB 1WX6A 5D6WA 3PIPA 1WXTA 2A37A 2ED0A 5A0LA 1E6HA 3CD6Q 3AT1B 4L59A 2X4XA 2E65A 1SSHA 2LC4A 4M77B 2RQWA 3BDLA 2VB6A 2P4TA 5LJ5d 4PJLA 2EFIA 4GBQA 1VQOA 3MP6A 1Q7YC 1BYMA 4M78B 4M78F 1WLPB 2L2PA 2LJ0A 3EGDB 1UFFA 1T3LA 2EKHA 5IXFA 2MF2A 2D9TA 4O5VA 3RNJA 1MMNA 2DD5A 4C92D 1VQLT 1IB8A 2HSPA 4D6WA 1YI2Q 1TSFA 3OW2S 1Q95G 2EYWA 1T3SA 3EFSA 2ZGWA 4KULA 5KYYB 1GL5A 2LNVA 3A1PA 2QEXT 4C8QA 1OX8A 4M75A 2DEQA 2X3WD 4ZNXA 1VQ7Q 4QVCA 1D0XA 2LP5A 1PRMC 4Z88A 4BACA 5CKBA 3CCMQ 3LLRA 3NPFA 4OMPA 2SEMA 5KYUB 5HK3A 5CVIA 2MWOA 4J9CA 1Q82C 1D0ZA 2CH4W 3META 2V8KA 3CCUT 4R0KA 1Y0MA 2L3SA 4B9XA 4M7DD 3KUFA 3DLLA 2FRWA 1NEBA 3I9QA 2KYMA 4KUIA 1IRXA 4Z89A 3EG9B 2KAFA 1FMKA 1I07A 3VJPA 4WF2A 4RTZA 5EG2A 3P8DA 2C0IA 3QJYA 4FW2A 2HKNA 1OU8A 2YXYA 4E7JA 3CCUA 1M3BA 2MOXA 4CC7A 2XKOC 1WQ7A 2VGNA 2YLCA 4RTXA 2EJ9A 4DEYA 3JCMe 5GAMh 3S3OA 2EJFA 1KC8C 4B9WA 2EGEA 3CCQQ 5GAN4 3CCJT 1JXMA 4PNOA 2M0OA 3JB9J 1M90C 1BBZA 1UJ0A 1HXDA 3PVQA 2FO0A 1Q81U 5GJVB 5GANj 2DM1A 2JJ9A 4DBRA 1VQ9Q 2KXCA 2H3EB 4XU2A 4MDXA 1E7OA 5HY6A 1VQ5Q 3DB4A 2E6NA 2OX7A 3CC4T 5CKEA 1O9SA 1V76A 2EQMA 3EFOA 5LJ5e 3EGXA 3M53A 3V7CA 2P0KA 1H8KA 2EYYA 1XNIA 4PJOC 4F7UG 2E3HA 1M5Q1 1ZA1B 2DYIA 2EVRA 4QKUA 4PFZA 4IUPA 4O6JA 3M59A 3LWIA 3DLMA 4JRQA 3DB3A 3ULRB 3CC4A 3C95A 3QPHA 1H3ZA 1QCFA 4C8QD 3CMEQ 2K3XA 4M75D 2W0ZA 4Z02A 1U5SA 2DTOA 2GBQA 2OTLT 3LX7A 4JRIA 3G4SA 4M7AE 2BUDA 2ECZA 3J81E 5GAMg 1G83A 1P92A 2IG0A 2EQJA 3G1JA 3HRTA 3M55A 3H41A 5GAOp 3V8LA 5KE3A 1ACMB 4Z8AA 3EH1A 5FROA 5LL6S 3GOXA 1NBEB 2MMPA 4BUGA 2XDBA 2C06A 2OTLA 2EIFA 4J9IA 4A4HA 2MYSA 2XD0A 4PLIA 2COYA 3A8LB 3HFNA 3I55Q 5KYXB 3LYIA 2CUDA 2WSCE 1J3TA 1B34A 4M77C 3SEMA 3MO8A 1VQ4Q 2KSSA 2E5KA 4FYVB 4J9GA 4PJMA 2CP6A 5CIUA 1M1KC 4XTVA 2DL7A 2YLBA 2EPDA 3EAEA 4M78C 1Q86R 1ZUUA 1GBRA 4IUUA 4DQ2A 3ME9A 3MEWA 4GLKA 1WHHA 3OSVA 2DF6A 1U8RA 2RO0A 1BI2A 2DL3A 1Q86U 1N8RR 2LRQA 5FW9A 1WFWA 1QWEA 1R0CB 2ZPEB 3L2WA 3GIBA 4M78G 2LMJA 5CCAA 3C4SA 2IVWA 3NGPA 1VA7A 5GAOm 4AG1C 3JCMJ 1BCOA 5IHKA 4FT4A 3CCEA 1N8RU 3MP1A 2E4HA 3RKWA 3CCSQ 1IGUA 2GNCA 4UC4A 4C0FA 4M7AB 2GF7A 5HCKA 4MZMA 1ZLMA 3CPWS 1UHCA 3CCLQ 1QVPA 2LCLA 2RK1A 3ER0A 3UT1A 1VYUA 4E6RA 1IHVA 3OYMA 4C92E 1TUCA 2ZPIB 4J9HA 2XICA 1MHNA 5I2SA 2QDYB 4VUBA 2R57A 4N4IA 2CP3A 4FCYA 5GAN3 4IUVA 3V8KA 3L2RA 6AT1B 1VOMA 4R56A 2E41A 2J6OA 1SRMA 2ESWA 2HZYA 5LJ3h 3CCRQ 3HRUA 2QA4A 2B8AA 1WA7A 3X25B 3FDRA 4JZ3A 5L8RE 3CCVA 2QQSA 2RHUA 3A98A 3VS7A 3OQ5A 1K0XA 2CZ7B 2EYXA 3ZEHA 5GAOq 1BI1A 1M2VB 3PNWC 1N9SA 4M7DE 2FEIA 2B86A 3INZA 2P0QA 4ELYC 1FMVA 4XAXB 3VS6A 4AFQC 5L23A 3JCMP 2KQWA 4B6MA 1KG1A 4PFOA 4EDUA 3JB9H 1UEBA 3JCMQ 4OMFB 2WSFE 3MEUA 3OB9A 1HSQA 3VS5A 4XU3A 1AHJB 1X69A 1RAGB 3NHNA 3G7ZA 3CC2T 4JJNK 1GFDA 1QVFP 4RG2A 3REAB 4F7UE 5KYWA 5GAN8 1WGSA 3MEVA 4C5GA 1RLPC 1FX7A 2KVQG 2X3XD 2ZCFB 3RMQA 5CK9A 2RA2A 4C92F 4C92B 1KJWA 2RMOA 3BDUA 1VQPT 2E5QA 2RI2A 1KD1C 5DLOA 1WDXA 5LJ3g 2FB7A 4R55A 2VUBA 1SSFA 3CC2A 1YWOA 3FLGA 1LCKA 3QSUA 1Q7YR 1OPKA 3PMTA 3C0CA 1YJWT 3LGFA 2XK0A 1RI9A 1MNEA 1WXUA 2LCSA 2K5FA 2F2VA 3P8BB 2E12A 3TEEA 2NYSA 2X4WA 3LW5E 1AWOA 3I5RA 3X26B 2GCXA 2CT4A 4EMHA 3OBYA 3D7SB 1R0BG 4M7DF 4M7DB 1CKBA 1RI0A 3EH2A 4LUEA 2FHDA 3OS1A 5KCHA 4C8QE 1YJWA 4M75E 2OJ2A 5KH6A 2KYBA 2EQIA 4C5IA 1OZ3A 3OMGA 1QVGA 3VRZA 1VQMT 4RCBA 3R6OA 2JTMA 2XMFA 2A3LA 3VS3A 3V7SA 3QWYA 4XU1A 3CC7Q 4ZTJA 5GAMf 2KT1A 3ZFJA 5CO7A 2QQAA 1LJOA 1H92A 2YWWA 2DXBA 4F7UB 4MZPA 3LWHA 4BI8B 1Q82U 1Z9QA 1MUZA 1VQMA 3MCAB 1IHWA 4NL3A 3M0SA 1M2OA 3RBBB 1YJNT 4BDYA 3DKMA 4II1A 5KYNA 1VQNT 4HA8A 1VYTA 1WNLA 4OVAA 5C0MA 1NJIC 4ZGEB 2PVOB 4BI3A 4M7AC 2BTTA 5IXBA 4FW1A 5GAN6 3UWNA 4LDXA 4QVDA 2RI5A 3L1AA 1G3TA 1JJ2P 5GAN5 2QQ9A 3R6NA 1QMCA 1YJNA 2FG0A 1XTDA 1VQNA 4X34A 4WCIA 1I8FA 1KC8U 3M58A 2J05A 5I2MA 4E7KA 2NUPB 1VQLQ 3OYCA 1M90U 3A8MB 1QKXA 1U06A 1A0NB 4M7AG 3CEYA 3VYHB 2AZSA 3KFVA 3LGLA 4OP0A 2D8HA 2J06A 4C8QB 1WPYA 4C8QF 4M75B 4M75F 2KY9A 3HHTB 4BE0A 2K3BA 2AZVA 2DETA 4RKUE 2ZPBB 4JJCA 2QEXQ 2GFAA 2F2WA 2RHIA 2HMAA 2VKNA 4XTWA 1VQOT 2COZA 2VXFA 3HSBA 3OYKA 2DRMA 3OMCA 3VS1A 4D8DA 2Y4XA 5GAN7 2QXFA 4PFPA 2M1HA 5GAMd 2XU8A 1BI3A 3TQ7P 1S72T 4C0DB 2FVUA 1I5LA 3UATA 2DZ9A 4L5GA 1BI0A 4AFZC 4N0AC 2CP5A 2PQWA 1YHQA 1ZSZA 2GTOA 3EG3A 2EYZA 1MGQA 2CDTA 1KQSP 2OAWA 1PRLC 1S72A 4OMMA 1SEMA 2V1QA 3M0RA 2QK0A 2K2VA 1JEGA 1AZEA 3OS5A 3V8JA 4ZN3A 1EZZB 4CC3A 2PUKB 1KSWA 5FRMA 1N27A 4J6XA 5GAOn 5FWCA 1PKTA 2CZ0B 2YRCA 5C6SA 1YWPA 3I56T 2YUPA 4PJOA 3VV0A 2OTJQ 2DXUA 2L8DA 1YITQ 2LT1A 4C92C 7AT1B 3CCJQ 1VYVA 2K2MA 1KIKA 2A08A 2H8HA 5J3BA 1M9SA 2DJZA 2XDPA 4RTYA 2PU9B 2JTEA 2KNBB 1NE8A 1VQ6Q 4FSXA 2MPXC 1M1KR 1K8AC 1D3BA 1NLPC 5AT1B 4DOWA 3I56A 3EHQA 2CSQA 3FC3A 3EGXB 3M54A 1YJ9Q 3CC4Q 2HQXA 1PSFA 4JLIA 4C92G 3G71A 3QYHB 4JS5A 3QYGB 2MWPA 4K11A 1M1KU 1QP2A 3RKXA 1JU5C 1JXOA 4QT7A 5GANh 1RAHB 2DILA 4V2SA 1ZBXA 4M7DC 1KHCA 1KQSS 2RNAA 2DTIA 3CXCP 4BB7A 2JUFA 4AFSC 1ZA2B 2RD1A 3OW2A 3E9GA 3UPUA 2E3IA 2IPOB 1K9MC 1NM7A 4M77A 1CSKA 4LDYA 3M9QA 3JCMV 1Q81R 4BE1A 4XU0A 5LJ3f 1UECA 2CGHA 4BY6C 4KGVB 2DRKA 2HDAA 4LN2A 2FZGB 4AT1B 3FRNA 1LVKA 3EGDA 4M7DG 1D09B 1WHLA 2JS2A 1CKAA 1YI2T 1MV0B 2CT3A 2HKQB 2C0OA 2X9HA 4HCCA 2HL3A 1SKUB 1RAIB 1BK2A 4KGXB 5GAMe 1RABB 4MMKA 4MDWA 5GAOl 2EBPA 4KT0E 1PD1A 2QG9B 1KQ1A 2RHYA 4X9CA 4J9FA 1NG2A 1OZ2A 4A63B 5CAIA 3CCMT 4J6YA 3TSWA 1YI2A 3G4ST 1EFNA 2X35A 3SD4A 2CREA 1H641 2M16A 2AHJB 2VXEA 3X24B 2BE9B 3HKSA 5GANg 4ZGJB 4RUGA 4E7LA 1MMDA 4PJOD 3QXEB 2DTHA 4HVWA 1O75A 4PL6A 3X28B 2D6FA 1SHGA 1Y57A 1VQ7A 5IT9E 2LJ1A 1RADB 3CCMA 1JBMA 1YCYA 1G3YA 2XG8D 2NLUA 5LJ5j 4C8QC 3CBMA 2RPNA 3H6ZA 1AT1B 3GNFB 1BKBA 1UDLA 3VRYA 1TXQA 2VYTA 4OB3B 2OAUA 3QJ6A 4NS5A 3OYEA 3CMAQ 1K1ZA 2DBMA 4C5EA 2HSEB 4FT2A 3VUZA 4MMLA 1D1AA 3NTHA 4RG8A 4LDWA 3CCQT 5HKCA 2PVGB 2DZCA 3MP8A 5LJ3d 1RAAB 4YTLA 2DYBA 2AK5A 2P0PA 4KBMB 1Y96B 1I1JA 1B7TA 4C8QG 4M75G 3E9FA 2K9GA 5HK0A 1JO8A 2LZ6B 4A54A 2JMCA 3PVLA 2QASA 5GJWB 3JCMW 4FSSA 8AT1B 1KD1R 1VQ5T 2KROA 3M5AA 3C94A 3CCQA 2P84A 2XDDA 3MJXA 2KMTA 2YRDA 2JM9A 2EQUA 3CCET 1KD1U 3GPLA 3SWNB 5M9OA 1E6GA 3JB9F 1VQ9A 4E2FB 2X4YA 1VQ5A 1SHFA 2YUNA 1UGQB 2PUOB 4XTZA 4LD9K 1KK7A 1ZUYA 4F16A 3A5ZB 2KGTA 1X75C 4LXCA 5IHNA 3TVTA 3CQTA 4J5YA 4EIKA 2O4XA 4M4ZA 1HD3A 1GCQA 3THKA 4OMLA 4C0GA 1K73C 3REBB 1OI1A 4GLMA 2KK4A 2QGFB 2F2XA 4FYYB 1UTIA 2QAZA 4A4GA 3HTRA 2KI7A 2E64A
chains in the Genus database with same CATH topology
2LC4A 3CMEA 2OTJA 3A8OB 2QA4T 4M77B 3CXCS 3BDLA 1YJ9T 2E10A 3MEAA 1YITA 2HD0A 3CBOA 4M7DF 3CCJA 4ELZC 4M7DB 1RI0A 2P4TA 5LJ5d 1M4ZA 2FHDA 3OS1A 3CCVT 5KCHA 1VQKT 4C8QE 1YJWA 4M75E 3I55T 2EFIA 5KH6A 3TREA 3MP6A 1VQOA 1Q7YC 1BYMA 4M78B 4M78F 4LDVA 5GMKm 5GAMj 4RCCA 4C5IA 1OZ3A 3OMGA 2WACA 1VQ6A 2VV5A 1QVGA 2MF2A 1VQMT 4RCBA 2D9TA 4E47A 4BE2A 3C12A 2JTMA 3R6OA 2A3LA 3JCMg 4O5VA 3V7SA 4ATOA 4XU1A 4C5HA 2DD5A 3QHSA 4C92D 1QP3A 2L3RA 1VQLT 4ZTJA 5GAMf 4D6WA 4M75C 1YJ9A 3ZFJA 2ZZDA 5DY9A 4IUTA 2O4XB 5CO7A 2KDSA 2RJCA 3OW2S 4OGEA 2QQAA 3EFSA 2ZGWA 2RI3A 4KULA 1VQKA 3OYDA 1LJOA 4HCZA 3I55A 3E19A 2DXBA 3WVDB 1X6OA 2LNVA 2CYZB 2YHTA 3GLXA 4MZPA 4F7UB 3LWHA 1GXIE 1NJIU 2R5MA 1N6AA 1VIEA 4BI8B 4OB0B 4C8QA 2QEXT 4M75A 2DEQA 2RJEA 1Q82U 3M4GA 3N5BB 1VQMA 3MCAB 4PJOG 1KHIA 3JB9I 4NL3A 3CPWA 1VQ4A 1WJQA 4QVCA 2DK3A 5LJ3e 1YJNT 4BDYA 4BACA 3DKMA 4II1A 5CKBA 1VQNT 2E6ZA 3LLRA 4HA8A 4OVAA 1WNLA 4C0DC 5C0MA 5HK3A 4OGCA 1VQ9T 1NJIC 5CVIA 2MWOA 2F69A 2EKOA 2PVOB 3M56A 4BI3A 4ZGEB 5LJ5g 3CXCA 4IUQA 3META 1Q82C 3OYFA 4M7AC 3S3NA 2V8KA 3CCUT 4M77D 2DPPB 3CCST 3M4YA 5GAN6 3O8VA 4B9XA 2JZ2A 3UWNA 4LDXA 4M7DD 4QVDA 2RI5A 4HKEA 3KUFA 3L1AA 3RUXA 3DLLA 3S3MA 1G3TA 3JRZA 3H8ZA 4PLLA 3FJPA 3NTKA 4KUIA 5GAN5 2QQ9A 3RESA 4M78D 3LH0A 1YJNA 2LVMA 4XTXA 1BIAA 1DJ7B 2KAFA 1XTDA 5KCOA 3VJPA 3OYNA 3PTAA 4X34A 1VQNA 1I81A 2DIGA 4MZTA 4WF2A 1I8FA 1U1SA 2V8IA 4QVZA 3M58A 3VYGA 2F5KA 1KC8U 5EG2A 3P8DA 5I2MA 4E7KA 3QJYA 3OYCA 1M90U 3A8MB 4LD6A 1NPRA 5CKHA 2RB6A 4E7JA 3CEYA 3CCUA 4M7AG 3CCSA 3VYHB 5CQYA 3LGLA 2XKOC 3PFSA 4OP0A 1WQ7A 4EMKB 2VGNA 2YLCA 1WPYA 4C8QB 4M75B 4M75F 4C8QF 2CS7A 4N4GA 2KY9A 3HHTB 4BE0A 1WQWA 2EJ9A 4NL2A 2LTOA 3CMET 4XQ3A 3HPWA 3JCMe 2H3JA 3CCLA 4HT8A 4BDZA 2RK2A 5GAMh 3S3OA 2EJFA 4RKUE 5J39A 4B9WA 1KC8C 3P8HA 2ZPBB 5GAN4 3CCJT 1UB4A 2MAMA 2DAQA 2M0OA 4PNOA 2GFAA 3JB9J 1M90C 4M77G 2RHIA 4P5NA 1IREB 2BKDN 3J7AF 1HXDA 4OB1B 4XTWA 2QQRA 2QTXA 1VQOT 3CCRT 3RIRA 2O01E 3HP9A 1Y7XA 2VXFA 1Q81U 3HSBA 3OYKA 3KBGA 3OMCA 2DVEA 5GANj 2Y4XA 4Q5WA 5GAN7 2QXFA 1LOJA 5GMKh 4L59A 2M1HA 1IZ6A 5GAMd 3CMAT 5GAN2 3EFRA 3AHUA 2DD4A 3MHXA 2XU8A 1BI3A 4OB2B 1S72T 2LCCA 4J7FA 4C0DB 4XU2A 3OY9A 2K57A 4MDXA 3HRSA 4A53A 5HY6A 3CPFA 3DB4A 2DXTA 2FVUA 4PJOE 1ZQ1A 1I5LA 2E6NA 5GANf 2DZ9A 2RJDA 4FIBA 2PVDB 4L5GA 4QQ6A 3CC4T 5I21A 3TU4K 1Q81C 4M7AF 1BI0A 2CKKA 5CKEA 2K5IA 2GQVA 4N0AC 1O9SA 2JN0A 1YHQA 2PQWA 2EQMA 5LJ5e 3CCRA 2VGMA 2CZ6B 3M53A 1QVFS 3OA6A 3V7CA 4C0ZA 2P0KA 1Y96A 1XNIA 4PJOC 4F7UG 3CMAA 1M5Q1 1MGQA 1VQ4T 3JB9D 3NTIA 4N4HA 3L2UA 1QW1A 1VIFA 2E1HA 4IUPA 1S72A 4O6JA 4N0AA 2K2VA 4JRPA 3M59A 3Q1JA 3OS5A 3V8JA 4ZN3A 5CQXA 3X20B 3LWIA 3DLMA 4JRQA 3DB3A 2PUKB 3CBPA 5FRMA 3CC4A 1N27A 4JLGA 3C95A 1G5VA 4J6XA 1U1TA 5GAOn 2CZ0B 3QPHA 3SWNC 3OYGA 5C6SA 3I56T 1YBYA 4C8QD 1H3ZA 4PJOA 2K3XA 4M75D 4PKCC 1LNXA 3UDCA 3VV0A 5FU7B 5AYFA 2DXUA 4Z02A 2L8DA 1K8AU 2LT1A 3T9NA 2K3YA 4C92C 4E7IA 2DTOA 1M8VA 2OTLT 3LX7A 3BFMA 3URGA 2FYKA 4JRIA 4EMGA 4RMOA 3G4SA 2RHZA 5FU6B 2Y4YA 4FM4B 4M7AE 2BUDA 3QZ9B 3J81E 5J3BA 1M9SA 5GAMg 2DJZA 1P92A 2IG0A 2PU9B 2XDPA 2EQJA 3SWNA 4BI4A 3HRTA 1NZ9A 1NE8A 3M55A 4FSXA 3L2VA 4BD3A 5GAOp 3V8LA 3OBYA 1K8AC 5KE3A 1D3BA 4J83A 4DOWA 5FROA 5LL6S 3I56A 3FB9A 3SFMA 3RERA 3JB9G 3GOXA 2HAXA 2MMPA 4BUGA 3M54A 3FC3A 2XDBA 2X4JA 2HBPA 1PSFA 2HQXA 4JLIA 4C92G 4EPCA 2EIFA 2C06A 2OTLA 4A4HA 2XD0A 3G71A 3F70A 3QYHB 1XOVA 3QYGB 2MWPA 4PLIA 4JS5A 3RKYA 3A8LB 1QP2A 2HNIA 3HFNA 1M1KU 3LYIA 3RKXA 3CCLT 5KE2A 4HT9A 2WSCE 2F5TX 4Y91A 2R5AA 2VC8A 3A8HB 2RH2A 5GMKi 5GANh 1K9MU 4X9DA 4CI0C 2LX9A 3QUIA 1B34A 1UGSB 1VUBA 4M7AA 4M77C 4V2SA 1ZBXA 4J7IA 3MO8A 3VKIA 4M7DC 1KHCA 1KQSS 5FRNA 2KSSA 4CRIA 2DTIA 5LJ3j 4BB7A 4QQGA 1XQHA 3E1SA 5CIUA 4PJOF 1M1KC 4PJOB 2JUFA 4XTVA 2RJFA 2XIDA 2YLBA 5D6YA 3EAEA 4Y28E 2RD1A 4M78C 3OW2A 1PSEA 3E9GA 2D0QB 3UPUA 3OS0A 1K9MC 5GANd 4LDUA 2L5QA 3QBYA 5IN1A 4ZN1A 4M77A 4XTUA 4IUUA 3M9QA 4LDYA 3JCMV 4DQ2A 4BE1A 3ME9A 3MEWA 4XU0A 2ZPHB 5LJ3f 2XI9A 5D6XA 2Y90A 1W2BS 1JRIA 2CGHA 4BY6C 5IAYA 4GLKA 4IKFA 1TH7A 3OSVA 1QVGS 2DKGA 1OYXA 2K5LA 1U8RA 2L89A 2RO0A 3FRNA 3G6ET 4J6WA 1BI2A 1YHQT 1Q86U 5A0DA 1D3BB 3PMIA 3OYLA 4M7DG 3CC7T 2LRQA 3SDZA 1YI2T 3GP8A 2ZPEB 3L2WA 3JCMc 3S6WA 3GIBA 4M78G 4HCCA 3OYHA 2DO3A 1M1FA 3C4SA 3GF5A 5CCAA 2IVWA 5GAOm 1R8OB 3OYIA 2FL7A 3JCMJ 4FT4A 5GAMe 3A8GB 5DM7R 3CCEA 1Q86C 1N8RU 3MP1A 4MMKA 4MDWA 3RKWA 5GAOl 4KT0E 4C0FA 4UC4A 1KQ1A 3JCMX 2RHYA 2ZPFB 4X9CA 4M7AB 2GF7A 2EJGA 3FEOA 4MZMA 1OZ2A 4A4KA 3BY7A 5CKFA 4F7UA 3VU3C 3PIOA 3G6EA 3OYJA 3CPWS 4IURA 1QVPA 5CAIA 1JJ2S 2LCLA 3OSSC 3SB2A 2RK1A 3RMSA 3CC7A 2CZ1B 3CCMT 3ER0A 3UT1A 1UGRB 2GFUA 4J6YA 1BIBA 1Q7YU 5GMKe 2G3RA 3G4ST 1YI2A 1KQ2A 1VQPA 3OYYA 2X35A 3ASKA 3SD4A 2M9UA 1N8RC 3OYMA 3L2ZA 1WJRA 4TVRA 1X01A 4ZTFA 4C92E 1H641 2ZPIB 2M16A 2AHJB 3FIFA 2VXEA 4M77F 3X24B 2XICA 1W4SA 3HKSA 4JDSA 3JCMf 5GANg 4ZGJB 4DA4A 2JOYA 4JUVA 1MHNA 1FXXA 4E7LA 4PJOD 5I2SA 2MI6A 3QXEB 2DTHA 2QDYB 1O75A 1G3WA 3J80E 4VUBA 1FWZA 2R57A 1WJSA 3QKJA 4N4IA 4PL6A 3X28B 4E7HA 2D6FA 1W2BA 2YRVA 1VQ7A 3WVEB 5IT9E 3TCJA 5GAN3 4IUVA 3V8KA 3L2RA 3OYBA 3M57A 4DOVA 4R56A 1Y71A 3CCMA 1JBMA 5GMKl 2E41A 3QIIA 4BY6B 2LDMA 1YCYA 1G3YA 3KXTA 3G71T 2RHXA 2XG8D 5A0GA 1V29B 2NLUA 5LJ3h 1UGPB 3HRUA 4EMKC 5LJ5j 1NPPA 4C8QC 2QA4A 3CBMA 3OBWA 2B8AA 3H6ZA 1BKBA 3GNFB 3OYAA 2JVVA 3X25B 1M1GA 5GMKj 2VYTA 4OB3B 4KUDK 2E70A 2OAUA 2WSEE 4GY5A 3QJ6A 3FDRA 4NS5A 3OYEA 1I4K1 5L8RE 4C92A 3CCVA 2RM4A 2HQEA 2QQSA 4C5EA 2RHUA 4FT2A 2JTFA 1EIFA 3VUZA 4MMLA 5A2QE 2EYQA 3OQ5A 3GNGA 4A4FA 2CZ7B 4F7UF 3NTHA 4RG8A 4LDWA 5LJ5f 4M77E 5HKCA 2PVGB 3ZEHA 1BI1A 5GAOq 2DZCA 3CCQT 2K4YA 3MP8A 2JNGA 3BW1A 3PNWC 1N9SA 4EMKA 4M7DE 5LJ3d 3NFCA 4YTLA 3JSCA 5J26A 2V8JA 2A7YA 2P0PA 4KBMB 5GAOr 3INZA 2BIVA 4OF1A 2P0QA 3OS2A 1Y96B 4ELYC 1JJ2A 4M7AD 3HFOA 4XAXB 5FLXE 4M78E 1QVFA 1G3SA 1VQLA 1YIJT 3JCMP 3QZ5B 4JS4A 2KQWA 4C8QG 4M75G 3E9FA 3PT9A 5HK0A 1KG1A 1VQ8T 1Y07A 3L2QA 3CD6T 3JAME 4NOYA 4A54A 4EDUA 3L42A 3JB9H 1UEBA 2LQKA 3JCMW 3JCMQ 1VQ5T 4OMFB 2WSFE 3MEUA 3M5AA 3C94A 3OB9A 2LQ8A 3CCQA 2XDDA 2KMTA 2QEXA 4XU3A 1AHJB 2DXCA 2XHCA 2EQUA 1N9RA 4ME7A 2DIQA 3G7ZA 5CR2A 3V7RA 2EQKA 4A4EA 1ZHIA 3JCMb 4FU6A 4JJNK 3JCMh 3CC2T 2QI2A 4RG2A 4M7DA 3PGGA 4F7UE 3CCET 1RL2A 5GANe 1KD1U 5GAN8 1YIJA 1WGSA 3MEVA 3GPLA 4C5GA 3SWNB 5M9OA 1FX7A 2KVQG 2EWNA 5DLQE 3JB9F 2ZCFB 3RMQA 1VQ8A 1VQ9A 4XK8E 3HL8A 2X4YA 5CK9A 4M78A 2RA2A 3CD6A 4C92F 4C92B 2QQBA 2R58A 4XTYA 1VQ5A 3BDUA 1JB0E 1UGQB 3QG1A 2PUOB 4XTZA 3JCMd 5FU7C 1K73U 4LD9K 1VQPT 2E5QA 2RI2A 3A5ZB 4ZGDB 1KD1C 5DLOA 5LJ3g 2FB7A 1X75C 3VUBA 2OTJT 4R55A 5FU6C 4J5YA 2VUBA 2EAYA 1SSFA 3CC2A 1YITT 3FLGA 3QSUA 2O4XA 4JRKA 4FL6A 3PMTA 5CKDA 3LGFA 1YJWT 2XK0A 3QDRB 3ZBDA 4QW2A 1B34B 2ZPGB 2I2LA 1HK9A 4C0GA 1K73C 2K5FA 1VQ7T 5LJ5h 3P8BB 2E12A 4HCBA 3TEEA 4QQDA 3WXMB 1OI1A 1VQ6T 4L6V5 5D6WA 3PIPA 2KK4A 2X4WA 3LW5E 3X26B 2GCXA 4J8OA 2LT4A 4EMHA 5A0LA 4A4GA 3QO3A 1KQSA 2X4XA 2E65A 2E64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFN A;  2HNI A;  1WQW A;  2EJ9 A;  4NL2 A;  3RKX A;  5LJ3 h;  4XQ3 A;  5LJ5 j;  3JCM e;  4EMK C;  4HT8 A;  4Y91 A;  4M77 B;  2VC8 A;  4C8Q C;  2EJF A;  5GAM h;  5GMK i;  2E10 A;  5GAN h;  4X9D A;  5GAN 4;  4M7D F;  4M7D B;  5GMK j;  3QUI A;  5LJ5 d;  1B34 A;  4PNO A;  3JB9 J;  4M7A A;  4M77 C;  4V2S A;  1I4K 1;  4M77 G;  4C92 A;  2RM4 A;  4M7D C;  4C8Q E;  4M75 E;  4MML A;  1HXD A;  4XTW A;  2QTX A;  2DTI A;  3RIR A;  2VXF A;  4M78 B;  4M78 F;  4F7U F;  5LJ3 j;  5LJ5 f;  5GMK m;  3HSB A;  4M77 E;  4PJO F;  5GAM j;  4RCC A;  2DVE A;  5GAO q;  2DZC A;  4XTV A;  5GAN j;  2YLB A;  3BW1 A;  4EMK A;  1N9S A;  5GAN 7;  2RD1 A;  2YLC A;  1LOJ A;  4M78 C;  5LJ3 d;  5GMK h;  4M7D E;  5GAM d;  3AHU A;  4RCB A;  5GAN 2;  3EFR A;  5GAN d;  5GAO r;  3INZ A;  4M77 A;  4XTU A;  3JCM g;  1Y96 B;  3V7S A;  3JCM V;  4DQ2 A;  4M7A D;  4XU2 A;  4XU1 A;  2K57 A;  3HFO A;  3QHS A;  4XU0 A;  4M78 E;  5LJ3 f;  4A53 A;  4C92 D;  2Y90 A;  1JRI A;  2CGH A;  2DXT A;  5GAM f;  3JCM P;  1I5L A;  4PJO E;  4M75 C;  5GAN f;  1TH7 A;  4C8Q G;  2DZ9 A;  4M75 G;  5DY9 A;  5I21 A;  2DKG A;  4M7A F;  4NOY A;  4A54 A;  3JB9 H;  3EFS A;  4J6W A;  2ZGW A;  4N0A C;  4PJO B;  2JN0 A;  4M7D G;  1D3B B;  1LJO A;  3JCM W;  5LJ5 e;  3JCM Q;  2YHT A;  4F7U B;  3V7C A;  4C8Q A;  3JCM c;  1Y96 A;  4M75 A;  2DEQ A;  4XU3 A;  3GIB A;  4M78 G;  4PJO C;  3M4G A;  4F7U G;  1N9R A;  1M5Q 1;  1MGQ A;  4PJO G;  3JB9 I;  4NL3 A;  3V7R A;  3JB9 D;  3JCM b;  5GAO m;  3JCM h;  2E1H A;  4QVC A;  5LJ3 e;  4N0A A;  3JCM J;  4M7D A;  3PGG A;  5GAM e;  4F7U E;  3V8J A;  5GAN e;  5GAN 8;  4HA8 A;  4MMK A;  3RKW A;  3SWN B;  1WNL A;  5GAO l;  2EWN A;  1KQ1 A;  3JB9 F;  3JCM X;  4X9C A;  4J6X A;  1U1T A;  5GAO n;  4M7A B;  2EJG A;  4M78 A;  2RA2 A;  3SWN C;  4C92 F;  3BY7 A;  4C8Q D;  4C92 B;  3VU3 C;  4F7U A;  4M75 D;  5LJ5 g;  4PJO A;  1LNX A;  5CAI A;  2DXU A;  4M7A C;  4XTY A;  3SB2 A;  4C92 C;  3BDU A;  4HT9 A;  2DTO A;  4M77 D;  1M8V A;  5GAN 6;  3BFM A;  3JCM d;  4J6Y A;  1BIB A;  2FYK A;  4JRI A;  4XTZ A;  4EMG A;  4QVD A;  5GMK e;  1KQ2 A;  4M7D D;  3L1A A;  3RUX A;  4M7A E;  3L2Z A;  5LJ3 g;  1X01 A;  2FB7 A;  3FJP A;  4C92 E;  1H64 1;  5GAM g;  2DJZ A;  3FIF A;  2VXE A;  4J5Y A;  2EAY A;  4M77 F;  3JCM f;  3SWN A;  3RES A;  5GAN g;  5GAN 5;  4M78 D;  4JUV A;  3QSU A;  4JRK A;  4XTX A;  4PJO D;  1BIA A;  5GAO p;  3V8L A;  1I81 A;  2DTH A;  4M75 F;  4WF2 A;  1D3B A;  1I8F A;  1B34 B;  1U1S A;  2I2L A;  1HK9 A;  5LJ5 h;  3FB9 A;  5GAN 3;  3RER A;  3V8K A;  3JB9 G;  2RB6 A;  4M7A G;  1JBM A;  4JLI A;  4C92 G;  5GMK l;  4EMH A;  4OP0 A;  2E41 A;  1WQ7 A;  3QO3 A;  4EMK B;  4C8Q B;  1YCY A;  1WPY A;  4C8Q F;  4M75 B;  2E65 A;  2E64 A;  3RKY A; 
#chains in the Genus database with same CATH topology
 3CME A;  2QA4 T;  1ABQ A;  2E10 A;  3MEA A;  2KEA A;  4JPB W;  2HD0 A;  3CBO A;  2JW4 A;  3CCV T;  2CP2 A;  1VQK T;  1BCM A;  2JS0 A;  2DA9 A;  3I55 T;  2DFU A;  4LDV A;  4RCC A;  2WAC A;  2VV5 A;  1K0S A;  1LPL A;  4E47 A;  4F04 B;  5KYX A;  4BE2 A;  3G6E Q;  1MV3 A;  2YSQ A;  4C5H A;  4JZ4 A;  1QP3 A;  2I0N A;  2CH4 A;  4CC2 A;  5DY9 A;  2V1R A;  2RF0 A;  1VQP Q;  2KDS A;  4OGE A;  1D0Y A;  2RI3 A;  1VQK A;  3OYD A;  4HCZ A;  3I55 A;  3E19 A;  1W2B P;  1YP5 A;  3WVD B;  2YHT A;  3GLX A;  1TG0 A;  1NJI U;  2R5M A;  2KR3 A;  1GRI A;  1VIE A;  1QVG P;  2RJE A;  3M4G A;  3N5B B;  1VQ4 A;  3CPW A;  2DK3 A;  5LJ3 e;  1PG5 B;  3JV3 A;  4RTU A;  1ARK A;  2NUT A;  3OYF A;  2DVJ A;  1OV3 A;  2DPP B;  3CCS T;  1I0C A;  3M4Y A;  3O8V A;  2JZ2 A;  4X1V A;  1S1N A;  1B07 A;  3RUX A;  3JRZ A;  1X43 A;  3H8Z A;  4PLL A;  3FJP A;  1UGV A;  3RES A;  4AG2 C;  3LH0 A;  1BIA A;  3PTA A;  3UA7 A;  2DIG A;  4MZT A;  3VYG A;  1U1S A;  4QVZ A;  2M0Y A;  2D8J A;  1NPR A;  1BU1 A;  1RAE B;  3CCS A;  1UG1 A;  1M8M A;  5CQY A;  1IO6 A;  4EMK B;  2MCN A;  1WQW A;  4NL2 A;  2LTO A;  4XQ3 A;  3HPW A;  3CCL A;  2H3J A;  4HT8 A;  4BDZ A;  2RK2 A;  1KFZ A;  3P8H A;  2MAM A;  3UA6 A;  2L3Q A;  2PTK A;  1OQK A;  2DE0 X;  2M51 A;  1IRE B;  1TUG B;  4KRT A;  2QQR A;  2QTX A;  3CCR T;  3RIR A;  2O01 E;  1Y7X A;  1YIJ Q;  4IIO A;  1VQN Q;  4Q5W A;  1EX4 A;  5GMK h;  4JJD A;  1AWJ A;  3AHU A;  1VQ8 Q;  5GAN 2;  3EFR A;  2DD4 A;  2RQV A;  4AMC A;  3OY9 A;  2K57 A;  3HRS A;  1UE9 A;  4HVV A;  3EHR A;  2DXT A;  4PK4 A;  4PJO E;  1ZQ1 A;  5GAN f;  2O9S A;  3PE0 A;  2RJD A;  4FIB A;  3TU4 K;  4QQ6 A;  2CKK A;  1AWX A;  1NLO C;  3CCR A;  1W70 A;  1QVF S;  1D1C A;  1X6B A;  4C0Z A;  5EC7 A;  3VS4 A;  1TTH B;  2BZ8 A;  4HXJ A;  1WYX A;  2CSI A;  3JB9 D;  2AIR B;  1K8A R;  2A36 A;  1QW1 A;  2DJQ A;  4N0A A;  1I5O B;  3Q1J A;  4IIM A;  5CQX A;  1Q82 R;  3CBP A;  1SF9 A;  1G5V A;  3SWN C;  3OYG A;  4PKC C;  1K4U S;  5FU7 B;  5AYF A;  1K8A U;  4E7I A;  1RUW A;  2RHZ A;  5FU6 B;  1VQO Q;  3QZ9 B;  4BI4 A;  3L2V A;  1WHG A;  4BD3 A;  3BE3 A;  1NYG A;  2JT4 A;  1S72 Q;  2YUQ A;  3SFM A;  3JB9 G;  1ZSZ B;  1H3H A;  1C1A A;  1WHM A;  1KC8 R;  1TU0 B;  2HNI A;  1M90 R;  1MMG A;  4HT9 A;  2VC8 A;  3A8H B;  2RH2 A;  1K9M U;  1QCO A;  3QUI A;  1UGS B;  4J7I A;  2NUZ A;  2M02 A;  1PNJ A;  2YUO A;  4QQG A;  4PJO F;  4PJO B;  2XID A;  4Y28 E;  1SPK A;  1PSE A;  2D0Q B;  1GBQ A;  3RR6 A;  5GAN d;  2QYZ A;  2L5Q A;  3QBY A;  1OEB A;  5IN1 A;  4XTU A;  1ZBJ A;  2ROT A;  1HYO A;  2XI9 A;  2Y90 A;  1JRI A;  2FPF A;  1C6V X;  1OYX A;  1X6G A;  2L89 A;  4J6W A;  1YHQ T;  5A0D A;  1D3B B;  3PMI A;  3OYL A;  3CC7 T;  4KH0 B;  2P4R A;  2G6F X;  3OW2 P;  2DBK A;  3OYH A;  1M1F A;  1N5Z A;  2KRM A;  4RTW A;  3OYI A;  2FL7 A;  1NEG A;  1ZUK A;  1PC0 A;  3NMZ C;  3CCU Q;  2MK5 A;  3JCM X;  2ZPF B;  2EJG A;  2Z0W A;  4F7U A;  3BY7 A;  5CKF A;  3VU3 C;  3OYJ A;  4IUR A;  1JJ2 S;  3CC7 A;  3RMS A;  2CZ1 B;  1UGR B;  1T0H A;  2FPD A;  3QDF A;  1BIB A;  2G3R A;  1KQ2 A;  2M9U A;  1WJR A;  4TVR A;  4ZTF A;  4D8K A;  4DEX A;  3FIF A;  4M77 F;  1IXD A;  4DA4 A;  1FXX A;  1YFN A;  3MPU B;  1AVZ C;  1FWZ A;  2F1L A;  2LQN A;  3QKJ A;  3EGU A;  4E7H A;  2YRV A;  2FPE A;  4WTO B;  3LH5 A;  3OYB A;  3M57 A;  4RTV A;  4DOV A;  1Y71 A;  2W10 A;  5GMK l;  3H9N A;  3QII A;  3G71 T;  1OX9 A;  2RHX A;  1V29 B;  2GTJ A;  1UGP B;  4EMK C;  1NPP A;  3OBW A;  3OYA A;  4PJJ A;  2JVV A;  1M1G A;  4KUD K;  2HQH A;  1TOV A;  1I4K 1;  2HQE A;  2NUP A;  2HCK A;  2J7I A;  2PZ1 A;  2JTF A;  1EIF A;  3GNG A;  4AFU C;  1AOJ A;  1OUL A;  4J9D A;  2K4Y A;  2DER A;  3BW1 A;  3EFO B;  5J26 A;  2V8J A;  5GAO r;  3OS2 A;  1JJ2 A;  4JJB A;  2L3P A;  5FLX E;  1VQL A;  3EG2 A;  3EG1 A;  2FZC B;  3PT9 A;  3G4S Q;  3L2Q A;  3CD6 T;  3L42 A;  1FYN A;  2BE7 D;  5IH2 A;  2LQ8 A;  1PM3 A;  2QEX A;  1Z9Z A;  3SHW A;  2XHC A;  1N9R A;  1ABO A;  4A4E A;  1ZHI A;  4FU6 A;  3JCM h;  2HL5 C;  1K73 R;  5GAN e;  1YN8 A;  3GBQ A;  2K7A A;  2OTL Q;  1GCP A;  2EWN A;  4OMN A;  4XK8 E;  4OMQ A;  4M78 A;  3CD6 A;  2QQB A;  1JB0 E;  5FU7 C;  1K73 U;  3RDV A;  4ZGD B;  4HCK A;  2OTJ T;  1AD5 A;  1QLY A;  5FU6 C;  2EAY A;  1OOT A;  1YIT T;  1ZX6 A;  4JRK A;  1T0J A;  3ZBD A;  1B34 B;  4F14 A;  2I2L A;  5KYY A;  2RN8 A;  1VQ7 T;  3U23 A;  5LJ5 h;  2O31 A;  4HCB A;  3UF4 A;  1X27 A;  1VQ6 T;  4L6V 5;  2A28 A;  4J8O A;  2LT4 A;  1ZSZ C;  4J9E A;  3QO3 A;  2VWF A;  1KQS A;  2OTJ A;  3A8O B;  1GFC A;  3CXC S;  5KYU A;  1YJ9 T;  1YIT A;  3CCJ A;  4ELZ C;  2LQW A;  1M4Z A;  2AKL A;  2KE9 A;  2QTV A;  3TRE A;  1QQJ A;  5GMK m;  5GAM j;  3CCE Q;  3H0H A;  1VQ6 A;  1M30 A;  1W1F A;  2O88 A;  2EW3 A;  3C12 A;  3JCM g;  4ATO A;  3EG9 A;  3QHS A;  2L3R A;  1WHJ A;  4M75 C;  1WXB A;  1YJ9 A;  2ZZD A;  4IUT A;  2O4X B;  2RJC A;  3VS2 A;  1YCS B;  1YNZ A;  2AKK A;  1PKS A;  1AWW A;  2ATC B;  1X6O A;  2CYZ B;  5I22 A;  4E7Z A;  4CC4 B;  1NYF A;  1N6A A;  4OB0 B;  1QKW A;  4PJO G;  1KHI A;  3JB9 I;  2NWM A;  3H0I A;  1WJQ A;  4OMO A;  1WIE A;  2E6Z A;  4J9B A;  4C0D C;  1OPL A;  4OGC A;  1VQ9 T;  1RAF B;  2A0F B;  2F69 A;  2EKO A;  5LJ5 g;  3M56 A;  3CXC A;  1WHK A;  4IUQ A;  2QA4 Q;  3S3N A;  4M77 D;  2CUB A;  4HKE A;  3CCV Q;  3S3M A;  1WZO A;  1VQK Q;  1FMW A;  3CPW P;  3NTK A;  2D0N A;  4M78 D;  2LVM A;  4XTX A;  1DJ7 B;  5KCO A;  2COW A;  3OYN A;  1I81 A;  1GXI E;  1MMA A;  2V8I A;  2F5K A;  2RQR A;  3FJ5 A;  4ORZ A;  2JMA A;  2DL4 A;  4LD6 A;  2YDL A;  2IIM A;  5CKH A;  5D7U A;  2RB6 A;  3PFS A;  2CS7 A;  4N4G A;  1W6X A;  3CME T;  1HJD A;  5J39 A;  1UB4 A;  2DAQ A;  4M77 G;  4P5N A;  2BKD N;  3J7A F;  4OB1 B;  3M0P A;  1PHT A;  3HP9 A;  2NUT B;  3KBG A;  2DVE A;  1QCN A;  1LOJ A;  3TSZ A;  1M3A A;  1IZ6 A;  3CMA T;  3MHX A;  1SRL A;  4OB2 B;  2LCC A;  4J7F A;  3M0Q A;  4A53 A;  4Y92 A;  1UJY A;  3CPF A;  3VS0 A;  3E2U A;  2PVD B;  8ATC B;  1Q81 C;  5I21 A;  5KYW B;  4M7A F;  3M0T A;  2K5I A;  2GQV A;  2JN0 A;  4LUD A;  2DEU A;  3CC2 Q;  1MND A;  2VGM A;  2CZ6 B;  4F17 A;  3OA6 A;  1QWF A;  4KH1 B;  2KRN A;  1IGQ A;  2QDL A;  1Y96 A;  3CMA A;  2DMO A;  1VQ4 T;  3NTI A;  4N4H A;  3L2U A;  1VIF A;  2E1H A;  1NJI R;  4JRP A;  3X20 B;  4ANJ A;  2GQI A;  4PJN A;  1AZG B;  2LJ3 A;  4JLG A;  1U1T A;  4LE9 A;  1YBY A;  1LNX A;  3UDC A;  1RAC B;  1D1B A;  3T9N A;  2K3Y A;  1M8V A;  1XJW B;  3BFM A;  3URG A;  2FYK A;  4EMG A;  4RMO A;  2Y4Y A;  1YJW Q;  4FM4 B;  1B3Q A;  1X2K A;  3SWN A;  1NZ9 A;  2LNH B;  3MKD A;  2JM8 A;  4LNP A;  2C0T A;  4J83 A;  1RLQ C;  2ENM A;  1U3O A;  5ECA A;  3FB9 A;  2ABL A;  3RER A;  2HAX A;  2X4J A;  2HBP A;  4EPC A;  2FZK B;  3F70 A;  1XOV A;  2KBT A;  3RKY A;  3CCL T;  5KE2 A;  2F5T X;  4Y91 A;  2R5A A;  4RTT A;  5GMK i;  1ZSG A;  4X9D A;  4CI0 C;  2LX9 A;  1C0M A;  2LX7 A;  1VUB A;  1X2Q A;  4M7A A;  2PNI A;  1VQM Q;  3VKI A;  1G2B A;  2O9V A;  2GGR A;  1K76 A;  5FRN A;  2VAS A;  4CRI A;  5LJ3 j;  1PD0 A;  1XQH A;  3E1S A;  2RJF A;  5D6Y A;  2RQT A;  2J6K A;  5IHI A;  3OS0 A;  2HEQ A;  4DBH A;  4LDU A;  4ZN1 A;  2YT6 A;  2KXD A;  2J6F A;  2ZPH B;  5D6X A;  1W2B S;  2KT8 A;  2BZY A;  5IAY A;  2QGG A;  4IKF A;  1TH7 A;  2ED1 A;  9ATC B;  1QVG S;  2DKG A;  2K5L A;  3G6E T;  1GCQ C;  3SDZ A;  2VVK A;  1YJN Q;  3GP8 A;  3JCM c;  3S6W A;  2DO3 A;  3GF5 A;  1R8O B;  3A8G B;  5DM7 R;  1Q86 C;  2L0A A;  1UHF A;  1SG5 A;  4FYX B;  3FEO A;  5FWB A;  4A4K A;  3G6E A;  3PIO A;  1M2V A;  3OSS C;  2HBW A;  3SB2 A;  2GFU A;  1G8X A;  2X51 A;  1Q7Y U;  5GMK e;  1VQP A;  3OYY A;  3ASK A;  4DBF A;  1N8R C;  3L2Z A;  4HVU A;  1X01 A;  1W4S A;  4JDS A;  3JCM f;  2JOY A;  4JUV A;  2MI6 A;  2V26 A;  1G3W A;  2DL5 A;  3J80 E;  1R77 A;  1WJS A;  1W2B A;  4ESR A;  3WVE B;  3TCJ A;  3M0U A;  2CP7 A;  2DL8 A;  4BY6 B;  2LDM A;  3KXT A;  1TWB A;  1YHQ Q;  2CP0 A;  5A0G A;  1BB9 A;  3H0F A;  1F1B B;  1PWT A;  1TS9 A;  5GMK j;  2E70 A;  2WSE E;  4GY5 A;  4C92 A;  2RM4 A;  3EG0 A;  5A2Q E;  2EYQ A;  2D1X A;  4A4F A;  4F7U F;  5LJ5 f;  1K9M R;  4M77 E;  2O2O A;  2JNG A;  5I11 A;  4EMK A;  3NFC A;  2FRY A;  3JSC A;  2A7Y A;  2BIV A;  4OF1 A;  4M7A D;  3HFO A;  4M78 E;  3QWX X;  1QVF A;  1G3S A;  1YIJ T;  3QZ5 B;  4JS4 A;  1AEY A;  1VQ8 T;  1Y07 A;  2AT1 B;  2SRC A;  3JAM E;  4NOY A;  3I5S A;  2LQK A;  1M27 C;  4DBQ A;  2DNU A;  4KGZ B;  4E7S A;  2ROL A;  2DXC A;  1OU9 A;  2DX1 A;  4ME7 A;  2DIQ A;  5CR2 A;  3V7R A;  2EQK A;  3JCM b;  3I56 Q;  2BZX A;  2QI2 A;  1K9A A;  2KRS A;  4M7D A;  2EGA A;  3PGG A;  4FYW B;  1RL2 A;  2MIO A;  1YIJ A;  1M3C A;  2EGC A;  5DLQ E;  3ZL7 C;  1VQ8 A;  3G71 Q;  3HL8 A;  1UUE A;  2R58 A;  4XTY A;  3IQL A;  3QG1 A;  3JCM d;  2ZAE A;  2RQU A;  2K79 A;  3I35 A;  3VUB A;  2K6D A;  1V1C A;  1PCX A;  1JQQ A;  1WI7 A;  4FL6 A;  5CKD A;  3O5Z A;  3QDR B;  1TUD A;  2OI3 A;  2ZPG B;  4QW2 A;  1HK9 A;  2JXB A;  2DLP A;  4QQD A;  3WXM B;  1WX6 A;  5D6W A;  3PIP A;  1WXT A;  2A37 A;  2ED0 A;  5A0L A;  1E6H A;  3CD6 Q;  3AT1 B;  4L59 A;  2X4X A;  2E65 A;  1SSH A;  2LC4 A;  4M77 B;  2RQW A;  3BDL A;  2VB6 A;  2P4T A;  5LJ5 d;  4PJL A;  2EFI A;  4GBQ A;  1VQO A;  3MP6 A;  1Q7Y C;  1BYM A;  4M78 B;  4M78 F;  1WLP B;  2L2P A;  2LJ0 A;  3EGD B;  1UFF A;  1T3L A;  2EKH A;  5IXF A;  2MF2 A;  2D9T A;  4O5V A;  3RNJ A;  1MMN A;  2DD5 A;  4C92 D;  1VQL T;  1IB8 A;  2HSP A;  4D6W A;  1YI2 Q;  1TSF A;  3OW2 S;  1Q95 G;  2EYW A;  1T3S A;  3EFS A;  2ZGW A;  4KUL A;  5KYY B;  1GL5 A;  2LNV A;  3A1P A;  2QEX T;  4C8Q A;  1OX8 A;  4M75 A;  2DEQ A;  2X3W D;  4ZNX A;  1VQ7 Q;  4QVC A;  1D0X A;  2LP5 A;  1PRM C;  4Z88 A;  4BAC A;  5CKB A;  3CCM Q;  3LLR A;  3NPF A;  4OMP A;  2SEM A;  5KYU B;  5HK3 A;  5CVI A;  2MWO A;  4J9C A;  1Q82 C;  1D0Z A;  2CH4 W;  3MET A;  2V8K A;  3CCU T;  4R0K A;  1Y0M A;  2L3S A;  4B9X A;  4M7D D;  3KUF A;  3DLL A;  2FRW A;  1NEB A;  3I9Q A;  2KYM A;  4KUI A;  1IRX A;  4Z89 A;  3EG9 B;  2KAF A;  1FMK A;  1I07 A;  3VJP A;  4WF2 A;  4RTZ A;  5EG2 A;  3P8D A;  2C0I A;  3QJY A;  4FW2 A;  2HKN A;  1OU8 A;  2YXY A;  4E7J A;  3CCU A;  1M3B A;  2MOX A;  4CC7 A;  2XKO C;  1WQ7 A;  2VGN A;  2YLC A;  4RTX A;  2EJ9 A;  4DEY A;  3JCM e;  5GAM h;  3S3O A;  2EJF A;  1KC8 C;  4B9W A;  2EGE A;  3CCQ Q;  5GAN 4;  3CCJ T;  1JXM A;  4PNO A;  2M0O A;  3JB9 J;  1M90 C;  1BBZ A;  1UJ0 A;  1HXD A;  3PVQ A;  2FO0 A;  1Q81 U;  5GJV B;  5GAN j;  2DM1 A;  2JJ9 A;  4DBR A;  1VQ9 Q;  2KXC A;  2H3E B;  4XU2 A;  4MDX A;  1E7O A;  5HY6 A;  1VQ5 Q;  3DB4 A;  2E6N A;  2OX7 A;  3CC4 T;  5CKE A;  1O9S A;  1V76 A;  2EQM A;  3EFO A;  5LJ5 e;  3EGX A;  3M53 A;  3V7C A;  2P0K A;  1H8K A;  2EYY A;  1XNI A;  4PJO C;  4F7U G;  2E3H A;  1M5Q 1;  1ZA1 B;  2DYI A;  2EVR A;  4QKU A;  4PFZ A;  4IUP A;  4O6J A;  3M59 A;  3LWI A;  3DLM A;  4JRQ A;  3DB3 A;  3ULR B;  3CC4 A;  3C95 A;  3QPH A;  1H3Z A;  1QCF A;  4C8Q D;  3CME Q;  2K3X A;  4M75 D;  2W0Z A;  4Z02 A;  1U5S A;  2DTO A;  2GBQ A;  2OTL T;  3LX7 A;  4JRI A;  3G4S A;  4M7A E;  2BUD A;  2ECZ A;  3J81 E;  5GAM g;  1G83 A;  1P92 A;  2IG0 A;  2EQJ A;  3G1J A;  3HRT A;  3M55 A;  3H41 A;  5GAO p;  3V8L A;  5KE3 A;  1ACM B;  4Z8A A;  3EH1 A;  5FRO A;  5LL6 S;  3GOX A;  1NBE B;  2MMP A;  4BUG A;  2XDB A;  2C06 A;  2OTL A;  2EIF A;  4J9I A;  4A4H A;  2MYS A;  2XD0 A;  4PLI A;  2COY A;  3A8L B;  3HFN A;  3I55 Q;  5KYX B;  3LYI A;  2CUD A;  2WSC E;  1J3T A;  1B34 A;  4M77 C;  3SEM A;  3MO8 A;  1VQ4 Q;  2KSS A;  2E5K A;  4FYV B;  4J9G A;  4PJM A;  2CP6 A;  5CIU A;  1M1K C;  4XTV A;  2DL7 A;  2YLB A;  2EPD A;  3EAE A;  4M78 C;  1Q86 R;  1ZUU A;  1GBR A;  4IUU A;  4DQ2 A;  3ME9 A;  3MEW A;  4GLK A;  1WHH A;  3OSV A;  2DF6 A;  1U8R A;  2RO0 A;  1BI2 A;  2DL3 A;  1Q86 U;  1N8R R;  2LRQ A;  5FW9 A;  1WFW A;  1QWE A;  1R0C B;  2ZPE B;  3L2W A;  3GIB A;  4M78 G;  2LMJ A;  5CCA A;  3C4S A;  2IVW A;  3NGP A;  1VA7 A;  5GAO m;  4AG1 C;  3JCM J;  1BCO A;  5IHK A;  4FT4 A;  3CCE A;  1N8R U;  3MP1 A;  2E4H A;  3RKW A;  3CCS Q;  1IGU A;  2GNC A;  4UC4 A;  4C0F A;  4M7A B;  2GF7 A;  5HCK A;  4MZM A;  1ZLM A;  3CPW S;  1UHC A;  3CCL Q;  1QVP A;  2LCL A;  2RK1 A;  3ER0 A;  3UT1 A;  1VYU A;  4E6R A;  1IHV A;  3OYM A;  4C92 E;  1TUC A;  2ZPI B;  4J9H A;  2XIC A;  1MHN A;  5I2S A;  2QDY B;  4VUB A;  2R57 A;  4N4I A;  2CP3 A;  4FCY A;  5GAN 3;  4IUV A;  3V8K A;  3L2R A;  6AT1 B;  1VOM A;  4R56 A;  2E41 A;  2J6O A;  1SRM A;  2ESW A;  2HZY A;  5LJ3 h;  3CCR Q;  3HRU A;  2QA4 A;  2B8A A;  1WA7 A;  3X25 B;  3FDR A;  4JZ3 A;  5L8R E;  3CCV A;  2QQS A;  2RHU A;  3A98 A;  3VS7 A;  3OQ5 A;  1K0X A;  2CZ7 B;  2EYX A;  3ZEH A;  5GAO q;  1BI1 A;  1M2V B;  3PNW C;  1N9S A;  4M7D E;  2FEI A;  2B86 A;  3INZ A;  2P0Q A;  4ELY C;  1FMV A;  4XAX B;  3VS6 A;  4AFQ C;  5L23 A;  3JCM P;  2KQW A;  4B6M A;  1KG1 A;  4PFO A;  4EDU A;  3JB9 H;  1UEB A;  3JCM Q;  4OMF B;  2WSF E;  3MEU A;  3OB9 A;  1HSQ A;  3VS5 A;  4XU3 A;  1AHJ B;  1X69 A;  1RAG B;  3NHN A;  3G7Z A;  3CC2 T;  4JJN K;  1GFD A;  1QVF P;  4RG2 A;  3REA B;  4F7U E;  5KYW A;  5GAN 8;  1WGS A;  3MEV A;  4C5G A;  1RLP C;  1FX7 A;  2KVQ G;  2X3X D;  2ZCF B;  3RMQ A;  5CK9 A;  2RA2 A;  4C92 F;  4C92 B;  1KJW A;  2RMO A;  3BDU A;  1VQP T;  2E5Q A;  2RI2 A;  1KD1 C;  5DLO A;  1WDX A;  5LJ3 g;  2FB7 A;  4R55 A;  2VUB A;  1SSF A;  3CC2 A;  1YWO A;  3FLG A;  1LCK A;  3QSU A;  1Q7Y R;  1OPK A;  3PMT A;  3C0C A;  1YJW T;  3LGF A;  2XK0 A;  1RI9 A;  1MNE A;  1WXU A;  2LCS A;  2K5F A;  2F2V A;  3P8B B;  2E12 A;  3TEE A;  2NYS A;  2X4W A;  3LW5 E;  1AWO A;  3I5R A;  3X26 B;  2GCX A;  2CT4 A;  4EMH A;  3OBY A;  3D7S B;  1R0B G;  4M7D F;  4M7D B;  1CKB A;  1RI0 A;  3EH2 A;  4LUE A;  2FHD A;  3OS1 A;  5KCH A;  4C8Q E;  1YJW A;  4M75 E;  2OJ2 A;  5KH6 A;  2KYB A;  2EQI A;  4C5I A;  1OZ3 A;  3OMG A;  1QVG A;  3VRZ A;  1VQM T;  4RCB A;  3R6O A;  2JTM A;  2XMF A;  2A3L A;  3VS3 A;  3V7S A;  3QWY A;  4XU1 A;  3CC7 Q;  4ZTJ A;  5GAM f;  2KT1 A;  3ZFJ A;  5CO7 A;  2QQA A;  1LJO A;  1H92 A;  2YWW A;  2DXB A;  4F7U B;  4MZP A;  3LWH A;  4BI8 B;  1Q82 U;  1Z9Q A;  1MUZ A;  1VQM A;  3MCA B;  1IHW A;  4NL3 A;  3M0S A;  1M2O A;  3RBB B;  1YJN T;  4BDY A;  3DKM A;  4II1 A;  5KYN A;  1VQN T;  4HA8 A;  1VYT A;  1WNL A;  4OVA A;  5C0M A;  1NJI C;  4ZGE B;  2PVO B;  4BI3 A;  4M7A C;  2BTT A;  5IXB A;  4FW1 A;  5GAN 6;  3UWN A;  4LDX A;  4QVD A;  2RI5 A;  3L1A A;  1G3T A;  1JJ2 P;  5GAN 5;  2QQ9 A;  3R6N A;  1QMC A;  1YJN A;  2FG0 A;  1XTD A;  1VQN A;  4X34 A;  4WCI A;  1I8F A;  1KC8 U;  3M58 A;  2J05 A;  5I2M A;  4E7K A;  2NUP B;  1VQL Q;  3OYC A;  1M90 U;  3A8M B;  1QKX A;  1U06 A;  1A0N B;  4M7A G;  3CEY A;  3VYH B;  2AZS A;  3KFV A;  3LGL A;  4OP0 A;  2D8H A;  2J06 A;  4C8Q B;  1WPY A;  4C8Q F;  4M75 B;  4M75 F;  2KY9 A;  3HHT B;  4BE0 A;  2K3B A;  2AZV A;  2DET A;  4RKU E;  2ZPB B;  4JJC A;  2QEX Q;  2GFA A;  2F2W A;  2RHI A;  2HMA A;  2VKN A;  4XTW A;  1VQO T;  2COZ A;  2VXF A;  3HSB A;  3OYK A;  2DRM A;  3OMC A;  3VS1 A;  4D8D A;  2Y4X A;  5GAN 7;  2QXF A;  4PFP A;  2M1H A;  5GAM d;  2XU8 A;  1BI3 A;  3TQ7 P;  1S72 T;  4C0D B;  2FVU A;  1I5L A;  3UAT A;  2DZ9 A;  4L5G A;  1BI0 A;  4AFZ C;  4N0A C;  2CP5 A;  2PQW A;  1YHQ A;  1ZSZ A;  2GTO A;  3EG3 A;  2EYZ A;  1MGQ A;  2CDT A;  1KQS P;  2OAW A;  1PRL C;  1S72 A;  4OMM A;  1SEM A;  2V1Q A;  3M0R A;  2QK0 A;  2K2V A;  1JEG A;  1AZE A;  3OS5 A;  3V8J A;  4ZN3 A;  1EZZ B;  4CC3 A;  2PUK B;  1KSW A;  5FRM A;  1N27 A;  4J6X A;  5GAO n;  5FWC A;  1PKT A;  2CZ0 B;  2YRC A;  5C6S A;  1YWP A;  3I56 T;  2YUP A;  4PJO A;  3VV0 A;  2OTJ Q;  2DXU A;  2L8D A;  1YIT Q;  2LT1 A;  4C92 C;  7AT1 B;  3CCJ Q;  1VYV A;  2K2M A;  1KIK A;  2A08 A;  2H8H A;  5J3B A;  1M9S A;  2DJZ A;  2XDP A;  4RTY A;  2PU9 B;  2JTE A;  2KNB B;  1NE8 A;  1VQ6 Q;  4FSX A;  2MPX C;  1M1K R;  1K8A C;  1D3B A;  1NLP C;  5AT1 B;  4DOW A;  3I56 A;  3EHQ A;  2CSQ A;  3FC3 A;  3EGX B;  3M54 A;  1YJ9 Q;  3CC4 Q;  2HQX A;  1PSF A;  4JLI A;  4C92 G;  3G71 A;  3QYH B;  4JS5 A;  3QYG B;  2MWP A;  4K11 A;  1M1K U;  1QP2 A;  3RKX A;  1JU5 C;  1JXO A;  4QT7 A;  5GAN h;  1RAH B;  2DIL A;  4V2S A;  1ZBX A;  4M7D C;  1KHC A;  1KQS S;  2RNA A;  2DTI A;  3CXC P;  4BB7 A;  2JUF A;  4AFS C;  1ZA2 B;  2RD1 A;  3OW2 A;  3E9G A;  3UPU A;  2E3I A;  2IPO B;  1K9M C;  1NM7 A;  4M77 A;  1CSK A;  4LDY A;  3M9Q A;  3JCM V;  1Q81 R;  4BE1 A;  4XU0 A;  5LJ3 f;  1UEC A;  2CGH A;  4BY6 C;  4KGV B;  2DRK A;  2HDA A;  4LN2 A;  2FZG B;  4AT1 B;  3FRN A;  1LVK A;  3EGD A;  4M7D G;  1D09 B;  1WHL A;  2JS2 A;  1CKA A;  1YI2 T;  1MV0 B;  2CT3 A;  2HKQ B;  2C0O A;  2X9H A;  4HCC A;  2HL3 A;  1SKU B;  1RAI B;  1BK2 A;  4KGX B;  5GAM e;  1RAB B;  4MMK A;  4MDW A;  5GAO l;  2EBP A;  4KT0 E;  1PD1 A;  2QG9 B;  1KQ1 A;  2RHY A;  4X9C A;  4J9F A;  1NG2 A;  1OZ2 A;  4A63 B;  5CAI A;  3CCM T;  4J6Y A;  3TSW A;  1YI2 A;  3G4S T;  1EFN A;  2X35 A;  3SD4 A;  2CRE A;  1H64 1;  2M16 A;  2AHJ B;  2VXE A;  3X24 B;  2BE9 B;  3HKS A;  5GAN g;  4ZGJ B;  4RUG A;  4E7L A;  1MMD A;  4PJO D;  3QXE B;  2DTH A;  4HVW A;  1O75 A;  4PL6 A;  3X28 B;  2D6F A;  1SHG A;  1Y57 A;  1VQ7 A;  5IT9 E;  2LJ1 A;  1RAD B;  3CCM A;  1JBM A;  1YCY A;  1G3Y A;  2XG8 D;  2NLU A;  5LJ5 j;  4C8Q C;  3CBM A;  2RPN A;  3H6Z A;  1AT1 B;  3GNF B;  1BKB A;  1UDL A;  3VRY A;  1TXQ A;  2VYT A;  4OB3 B;  2OAU A;  3QJ6 A;  4NS5 A;  3OYE A;  3CMA Q;  1K1Z A;  2DBM A;  4C5E A;  2HSE B;  4FT2 A;  3VUZ A;  4MML A;  1D1A A;  3NTH A;  4RG8 A;  4LDW A;  3CCQ T;  5HKC A;  2PVG B;  2DZC A;  3MP8 A;  5LJ3 d;  1RAA B;  4YTL A;  2DYB A;  2AK5 A;  2P0P A;  4KBM B;  1Y96 B;  1I1J A;  1B7T A;  4C8Q G;  4M75 G;  3E9F A;  2K9G A;  5HK0 A;  1JO8 A;  2LZ6 B;  4A54 A;  2JMC A;  3PVL A;  2QAS A;  5GJW B;  3JCM W;  4FSS A;  8AT1 B;  1KD1 R;  1VQ5 T;  2KRO A;  3M5A A;  3C94 A;  3CCQ A;  2P84 A;  2XDD A;  3MJX A;  2KMT A;  2YRD A;  2JM9 A;  2EQU A;  3CCE T;  1KD1 U;  3GPL A;  3SWN B;  5M9O A;  1E6G A;  3JB9 F;  1VQ9 A;  4E2F B;  2X4Y A;  1VQ5 A;  1SHF A;  2YUN A;  1UGQ B;  2PUO B;  4XTZ A;  4LD9 K;  1KK7 A;  1ZUY A;  4F16 A;  3A5Z B;  2KGT A;  1X75 C;  4LXC A;  5IHN A;  3TVT A;  3CQT A;  4J5Y A;  4EIK A;  2O4X A;  4M4Z A;  1HD3 A;  1GCQ A;  3THK A;  4OML A;  4C0G A;  1K73 C;  3REB B;  1OI1 A;  4GLM A;  2KK4 A;  2QGF B;  2F2X A;  4FYY B;  1UTI A;  2QAZ A;  4A4G A;  3HTR A;  2KI7 A;  2E64 A; 
#chains in the Genus database with same CATH homology
 2LC4 A;  3CME A;  2OTJ A;  3A8O B;  2QA4 T;  4M77 B;  3CXC S;  3BDL A;  1YJ9 T;  2E10 A;  3MEA A;  1YIT A;  2HD0 A;  3CBO A;  4M7D F;  3CCJ A;  4ELZ C;  4M7D B;  1RI0 A;  2P4T A;  5LJ5 d;  1M4Z A;  2FHD A;  3OS1 A;  3CCV T;  5KCH A;  1VQK T;  4C8Q E;  1YJW A;  4M75 E;  3I55 T;  2EFI A;  5KH6 A;  3TRE A;  3MP6 A;  1VQO A;  1Q7Y C;  1BYM A;  4M78 B;  4M78 F;  4LDV A;  5GMK m;  5GAM j;  4RCC A;  4C5I A;  1OZ3 A;  3OMG A;  2WAC A;  1VQ6 A;  2VV5 A;  1QVG A;  2MF2 A;  1VQM T;  4RCB A;  2D9T A;  4E47 A;  4BE2 A;  3C12 A;  2JTM A;  3R6O A;  2A3L A;  3JCM g;  4O5V A;  3V7S A;  4ATO A;  4XU1 A;  4C5H A;  2DD5 A;  3QHS A;  4C92 D;  1QP3 A;  2L3R A;  1VQL T;  4ZTJ A;  5GAM f;  4D6W A;  4M75 C;  1YJ9 A;  3ZFJ A;  2ZZD A;  5DY9 A;  4IUT A;  2O4X B;  5CO7 A;  2KDS A;  2RJC A;  3OW2 S;  4OGE A;  2QQA A;  3EFS A;  2ZGW A;  2RI3 A;  4KUL A;  1VQK A;  3OYD A;  1LJO A;  4HCZ A;  3I55 A;  3E19 A;  2DXB A;  3WVD B;  1X6O A;  2LNV A;  2CYZ B;  2YHT A;  3GLX A;  4MZP A;  4F7U B;  3LWH A;  1GXI E;  1NJI U;  2R5M A;  1N6A A;  1VIE A;  4BI8 B;  4OB0 B;  4C8Q A;  2QEX T;  4M75 A;  2DEQ A;  2RJE A;  1Q82 U;  3M4G A;  3N5B B;  1VQM A;  3MCA B;  4PJO G;  1KHI A;  3JB9 I;  4NL3 A;  3CPW A;  1VQ4 A;  1WJQ A;  4QVC A;  2DK3 A;  5LJ3 e;  1YJN T;  4BDY A;  4BAC A;  3DKM A;  4II1 A;  5CKB A;  1VQN T;  2E6Z A;  3LLR A;  4HA8 A;  4OVA A;  1WNL A;  4C0D C;  5C0M A;  5HK3 A;  4OGC A;  1VQ9 T;  1NJI C;  5CVI A;  2MWO A;  2F69 A;  2EKO A;  2PVO B;  3M56 A;  4BI3 A;  4ZGE B;  5LJ5 g;  3CXC A;  4IUQ A;  3MET A;  1Q82 C;  3OYF A;  4M7A C;  3S3N A;  2V8K A;  3CCU T;  4M77 D;  2DPP B;  3CCS T;  3M4Y A;  5GAN 6;  3O8V A;  4B9X A;  2JZ2 A;  3UWN A;  4LDX A;  4M7D D;  4QVD A;  2RI5 A;  4HKE A;  3KUF A;  3L1A A;  3RUX A;  3DLL A;  3S3M A;  1G3T A;  3JRZ A;  3H8Z A;  4PLL A;  3FJP A;  3NTK A;  4KUI A;  5GAN 5;  2QQ9 A;  3RES A;  4M78 D;  3LH0 A;  1YJN A;  2LVM A;  4XTX A;  1BIA A;  1DJ7 B;  2KAF A;  1XTD A;  5KCO A;  3VJP A;  3OYN A;  3PTA A;  4X34 A;  1VQN A;  1I81 A;  2DIG A;  4MZT A;  4WF2 A;  1I8F A;  1U1S A;  2V8I A;  4QVZ A;  3M58 A;  3VYG A;  2F5K A;  1KC8 U;  5EG2 A;  3P8D A;  5I2M A;  4E7K A;  3QJY A;  3OYC A;  1M90 U;  3A8M B;  4LD6 A;  1NPR A;  5CKH A;  2RB6 A;  4E7J A;  3CEY A;  3CCU A;  4M7A G;  3CCS A;  3VYH B;  5CQY A;  3LGL A;  2XKO C;  3PFS A;  4OP0 A;  1WQ7 A;  4EMK B;  2VGN A;  2YLC A;  1WPY A;  4C8Q B;  4M75 B;  4M75 F;  4C8Q F;  2CS7 A;  4N4G A;  2KY9 A;  3HHT B;  4BE0 A;  1WQW A;  2EJ9 A;  4NL2 A;  2LTO A;  3CME T;  4XQ3 A;  3HPW A;  3JCM e;  2H3J A;  3CCL A;  4HT8 A;  4BDZ A;  2RK2 A;  5GAM h;  3S3O A;  2EJF A;  4RKU E;  5J39 A;  4B9W A;  1KC8 C;  3P8H A;  2ZPB B;  5GAN 4;  3CCJ T;  1UB4 A;  2MAM A;  2DAQ A;  2M0O A;  4PNO A;  2GFA A;  3JB9 J;  1M90 C;  4M77 G;  2RHI A;  4P5N A;  1IRE B;  2BKD N;  3J7A F;  1HXD A;  4OB1 B;  4XTW A;  2QQR A;  2QTX A;  1VQO T;  3CCR T;  3RIR A;  2O01 E;  3HP9 A;  1Y7X A;  2VXF A;  1Q81 U;  3HSB A;  3OYK A;  3KBG A;  3OMC A;  2DVE A;  5GAN j;  2Y4X A;  4Q5W A;  5GAN 7;  2QXF A;  1LOJ A;  5GMK h;  4L59 A;  2M1H A;  1IZ6 A;  5GAM d;  3CMA T;  5GAN 2;  3EFR A;  3AHU A;  2DD4 A;  3MHX A;  2XU8 A;  1BI3 A;  4OB2 B;  1S72 T;  2LCC A;  4J7F A;  4C0D B;  4XU2 A;  3OY9 A;  2K57 A;  4MDX A;  3HRS A;  4A53 A;  5HY6 A;  3CPF A;  3DB4 A;  2DXT A;  2FVU A;  4PJO E;  1ZQ1 A;  1I5L A;  2E6N A;  5GAN f;  2DZ9 A;  2RJD A;  4FIB A;  2PVD B;  4L5G A;  4QQ6 A;  3CC4 T;  5I21 A;  3TU4 K;  1Q81 C;  4M7A F;  1BI0 A;  2CKK A;  5CKE A;  2K5I A;  2GQV A;  4N0A C;  1O9S A;  2JN0 A;  1YHQ A;  2PQW A;  2EQM A;  5LJ5 e;  3CCR A;  2VGM A;  2CZ6 B;  3M53 A;  1QVF S;  3OA6 A;  3V7C A;  4C0Z A;  2P0K A;  1Y96 A;  1XNI A;  4PJO C;  4F7U G;  3CMA A;  1M5Q 1;  1MGQ A;  1VQ4 T;  3JB9 D;  3NTI A;  4N4H A;  3L2U A;  1QW1 A;  1VIF A;  2E1H A;  4IUP A;  1S72 A;  4O6J A;  4N0A A;  2K2V A;  4JRP A;  3M59 A;  3Q1J A;  3OS5 A;  3V8J A;  4ZN3 A;  5CQX A;  3X20 B;  3LWI A;  3DLM A;  4JRQ A;  3DB3 A;  2PUK B;  3CBP A;  5FRM A;  3CC4 A;  1N27 A;  4JLG A;  3C95 A;  1G5V A;  4J6X A;  1U1T A;  5GAO n;  2CZ0 B;  3QPH A;  3SWN C;  3OYG A;  5C6S A;  3I56 T;  1YBY A;  4C8Q D;  1H3Z A;  4PJO A;  2K3X A;  4M75 D;  4PKC C;  1LNX A;  3UDC A;  3VV0 A;  5FU7 B;  5AYF A;  2DXU A;  4Z02 A;  2L8D A;  1K8A U;  2LT1 A;  3T9N A;  2K3Y A;  4C92 C;  4E7I A;  2DTO A;  1M8V A;  2OTL T;  3LX7 A;  3BFM A;  3URG A;  2FYK A;  4JRI A;  4EMG A;  4RMO A;  3G4S A;  2RHZ A;  5FU6 B;  2Y4Y A;  4FM4 B;  4M7A E;  2BUD A;  3QZ9 B;  3J81 E;  5J3B A;  1M9S A;  5GAM g;  2DJZ A;  1P92 A;  2IG0 A;  2PU9 B;  2XDP A;  2EQJ A;  3SWN A;  4BI4 A;  3HRT A;  1NZ9 A;  1NE8 A;  3M55 A;  4FSX A;  3L2V A;  4BD3 A;  5GAO p;  3V8L A;  3OBY A;  1K8A C;  5KE3 A;  1D3B A;  4J83 A;  4DOW A;  5FRO A;  5LL6 S;  3I56 A;  3FB9 A;  3SFM A;  3RER A;  3JB9 G;  3GOX A;  2HAX A;  2MMP A;  4BUG A;  3M54 A;  3FC3 A;  2XDB A;  2X4J A;  2HBP A;  1PSF A;  2HQX A;  4JLI A;  4C92 G;  4EPC A;  2EIF A;  2C06 A;  2OTL A;  4A4H A;  2XD0 A;  3G71 A;  3F70 A;  3QYH B;  1XOV A;  3QYG B;  2MWP A;  4PLI A;  4JS5 A;  3RKY A;  3A8L B;  1QP2 A;  2HNI A;  3HFN A;  1M1K U;  3LYI A;  3RKX A;  3CCL T;  5KE2 A;  4HT9 A;  2WSC E;  2F5T X;  4Y91 A;  2R5A A;  2VC8 A;  3A8H B;  2RH2 A;  5GMK i;  5GAN h;  1K9M U;  4X9D A;  4CI0 C;  2LX9 A;  3QUI A;  1B34 A;  1UGS B;  1VUB A;  4M7A A;  4M77 C;  4V2S A;  1ZBX A;  4J7I A;  3MO8 A;  3VKI A;  4M7D C;  1KHC A;  1KQS S;  5FRN A;  2KSS A;  4CRI A;  2DTI A;  5LJ3 j;  4BB7 A;  4QQG A;  1XQH A;  3E1S A;  5CIU A;  4PJO F;  1M1K C;  4PJO B;  2JUF A;  4XTV A;  2RJF A;  2XID A;  2YLB A;  5D6Y A;  3EAE A;  4Y28 E;  2RD1 A;  4M78 C;  3OW2 A;  1PSE A;  3E9G A;  2D0Q B;  3UPU A;  3OS0 A;  1K9M C;  5GAN d;  4LDU A;  2L5Q A;  3QBY A;  5IN1 A;  4ZN1 A;  4M77 A;  4XTU A;  4IUU A;  3M9Q A;  4LDY A;  3JCM V;  4DQ2 A;  4BE1 A;  3ME9 A;  3MEW A;  4XU0 A;  2ZPH B;  5LJ3 f;  2XI9 A;  5D6X A;  2Y90 A;  1W2B S;  1JRI A;  2CGH A;  4BY6 C;  5IAY A;  4GLK A;  4IKF A;  1TH7 A;  3OSV A;  1QVG S;  2DKG A;  1OYX A;  2K5L A;  1U8R A;  2L89 A;  2RO0 A;  3FRN A;  3G6E T;  4J6W A;  1BI2 A;  1YHQ T;  1Q86 U;  5A0D A;  1D3B B;  3PMI A;  3OYL A;  4M7D G;  3CC7 T;  2LRQ A;  3SDZ A;  1YI2 T;  3GP8 A;  2ZPE B;  3L2W A;  3JCM c;  3S6W A;  3GIB A;  4M78 G;  4HCC A;  3OYH A;  2DO3 A;  1M1F A;  3C4S A;  3GF5 A;  5CCA A;  2IVW A;  5GAO m;  1R8O B;  3OYI A;  2FL7 A;  3JCM J;  4FT4 A;  5GAM e;  3A8G B;  5DM7 R;  3CCE A;  1Q86 C;  1N8R U;  3MP1 A;  4MMK A;  4MDW A;  3RKW A;  5GAO l;  4KT0 E;  4C0F A;  4UC4 A;  1KQ1 A;  3JCM X;  2RHY A;  2ZPF B;  4X9C A;  4M7A B;  2GF7 A;  2EJG A;  3FEO A;  4MZM A;  1OZ2 A;  4A4K A;  3BY7 A;  5CKF A;  4F7U A;  3VU3 C;  3PIO A;  3G6E A;  3OYJ A;  3CPW S;  4IUR A;  1QVP A;  5CAI A;  1JJ2 S;  2LCL A;  3OSS C;  3SB2 A;  2RK1 A;  3RMS A;  3CC7 A;  2CZ1 B;  3CCM T;  3ER0 A;  3UT1 A;  1UGR B;  2GFU A;  4J6Y A;  1BIB A;  1Q7Y U;  5GMK e;  2G3R A;  3G4S T;  1YI2 A;  1KQ2 A;  1VQP A;  3OYY A;  2X35 A;  3ASK A;  3SD4 A;  2M9U A;  1N8R C;  3OYM A;  3L2Z A;  1WJR A;  4TVR A;  1X01 A;  4ZTF A;  4C92 E;  1H64 1;  2ZPI B;  2M16 A;  2AHJ B;  3FIF A;  2VXE A;  4M77 F;  3X24 B;  2XIC A;  1W4S A;  3HKS A;  4JDS A;  3JCM f;  5GAN g;  4ZGJ B;  4DA4 A;  2JOY A;  4JUV A;  1MHN A;  1FXX A;  4E7L A;  4PJO D;  5I2S A;  2MI6 A;  3QXE B;  2DTH A;  2QDY B;  1O75 A;  1G3W A;  3J80 E;  4VUB A;  1FWZ A;  2R57 A;  1WJS A;  3QKJ A;  4N4I A;  4PL6 A;  3X28 B;  4E7H A;  2D6F A;  1W2B A;  2YRV A;  1VQ7 A;  3WVE B;  5IT9 E;  3TCJ A;  5GAN 3;  4IUV A;  3V8K A;  3L2R A;  3OYB A;  3M57 A;  4DOV A;  4R56 A;  1Y71 A;  3CCM A;  1JBM A;  5GMK l;  2E41 A;  3QII A;  4BY6 B;  2LDM A;  1YCY A;  1G3Y A;  3KXT A;  3G71 T;  2RHX A;  2XG8 D;  5A0G A;  1V29 B;  2NLU A;  5LJ3 h;  1UGP B;  3HRU A;  4EMK C;  5LJ5 j;  1NPP A;  4C8Q C;  2QA4 A;  3CBM A;  3OBW A;  2B8A A;  3H6Z A;  1BKB A;  3GNF B;  3OYA A;  2JVV A;  3X25 B;  1M1G A;  5GMK j;  2VYT A;  4OB3 B;  4KUD K;  2E70 A;  2OAU A;  2WSE E;  4GY5 A;  3QJ6 A;  3FDR A;  4NS5 A;  3OYE A;  1I4K 1;  5L8R E;  4C92 A;  3CCV A;  2RM4 A;  2HQE A;  2QQS A;  4C5E A;  2RHU A;  4FT2 A;  2JTF A;  1EIF A;  3VUZ A;  4MML A;  5A2Q E;  2EYQ A;  3OQ5 A;  3GNG A;  4A4F A;  2CZ7 B;  4F7U F;  3NTH A;  4RG8 A;  4LDW A;  5LJ5 f;  4M77 E;  5HKC A;  2PVG B;  3ZEH A;  1BI1 A;  5GAO q;  2DZC A;  3CCQ T;  2K4Y A;  3MP8 A;  2JNG A;  3BW1 A;  3PNW C;  1N9S A;  4EMK A;  4M7D E;  5LJ3 d;  3NFC A;  4YTL A;  3JSC A;  5J26 A;  2V8J A;  2A7Y A;  2P0P A;  4KBM B;  5GAO r;  3INZ A;  2BIV A;  4OF1 A;  2P0Q A;  3OS2 A;  1Y96 B;  4ELY C;  1JJ2 A;  4M7A D;  3HFO A;  4XAX B;  5FLX E;  4M78 E;  1QVF A;  1G3S A;  1VQL A;  1YIJ T;  3JCM P;  3QZ5 B;  4JS4 A;  2KQW A;  4C8Q G;  4M75 G;  3E9F A;  3PT9 A;  5HK0 A;  1KG1 A;  1VQ8 T;  1Y07 A;  3L2Q A;  3CD6 T;  3JAM E;  4NOY A;  4A54 A;  4EDU A;  3L42 A;  3JB9 H;  1UEB A;  2LQK A;  3JCM W;  3JCM Q;  1VQ5 T;  4OMF B;  2WSF E;  3MEU A;  3M5A A;  3C94 A;  3OB9 A;  2LQ8 A;  3CCQ A;  2XDD A;  2KMT A;  2QEX A;  4XU3 A;  1AHJ B;  2DXC A;  2XHC A;  2EQU A;  1N9R A;  4ME7 A;  2DIQ A;  3G7Z A;  5CR2 A;  3V7R A;  2EQK A;  4A4E A;  1ZHI A;  3JCM b;  4FU6 A;  4JJN K;  3JCM h;  3CC2 T;  2QI2 A;  4RG2 A;  4M7D A;  3PGG A;  4F7U E;  3CCE T;  1RL2 A;  5GAN e;  1KD1 U;  5GAN 8;  1YIJ A;  1WGS A;  3MEV A;  3GPL A;  4C5G A;  3SWN B;  5M9O A;  1FX7 A;  2KVQ G;  2EWN A;  5DLQ E;  3JB9 F;  2ZCF B;  3RMQ A;  1VQ8 A;  1VQ9 A;  4XK8 E;  3HL8 A;  2X4Y A;  5CK9 A;  4M78 A;  2RA2 A;  3CD6 A;  4C92 F;  4C92 B;  2QQB A;  2R58 A;  4XTY A;  1VQ5 A;  3BDU A;  1JB0 E;  1UGQ B;  3QG1 A;  2PUO B;  4XTZ A;  3JCM d;  5FU7 C;  1K73 U;  4LD9 K;  1VQP T;  2E5Q A;  2RI2 A;  3A5Z B;  4ZGD B;  1KD1 C;  5DLO A;  5LJ3 g;  2FB7 A;  1X75 C;  3VUB A;  2OTJ T;  4R55 A;  5FU6 C;  4J5Y A;  2VUB A;  2EAY A;  1SSF A;  3CC2 A;  1YIT T;  3FLG A;  3QSU A;  2O4X A;  4JRK A;  4FL6 A;  3PMT A;  5CKD A;  3LGF A;  1YJW T;  2XK0 A;  3QDR B;  3ZBD A;  4QW2 A;  1B34 B;  2ZPG B;  2I2L A;  1HK9 A;  4C0G A;  1K73 C;  2K5F A;  1VQ7 T;  5LJ5 h;  3P8B B;  2E12 A;  4HCB A;  3TEE A;  4QQD A;  3WXM B;  1OI1 A;  1VQ6 T;  4L6V 5;  5D6W A;  3PIP A;  2KK4 A;  2X4W A;  3LW5 E;  3X26 B;  2GCX A;  4J8O A;  2LT4 A;  4EMH A;  5A0L A;  4A4G A;  3QO3 A;  1KQS A;  2X4X A;  2E65 A;  2E64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...