4M7DG

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
77
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAAVKLNEIYIRGTFIKFIKLQDNIIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 14
structure length 77
sequence length 88
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dG00
5GANh 2YLBA 2EJ9A 3GIBA 4C92B 4M78E 4M78C 5GAOq 1N9RA 3JCMg 4NL2A 2DZCA 3JB9G 3QO3A 1LOJA 2E10A 4C8QE 4F7UB 3QUIA 4C8QB 4F7UE 2DEQA 2DZ9A 4MMLA 4M77D 4HA8A 4WF2A 4C92C 5LJ3d 4M7AG 3INZA 4JUVA 4M78G 5LJ3f 3JB9J 1WNLA 3VU3C 4A53A 4M7DA 2VXEA 4J6YA 4XU1A 5LJ3h 4X9DA 5LJ5f 5LJ5d 5GAN8 2ZGWA 5GANj 5GAOm 4M7DE 1I5LA 2QTXA 3RKYA 2Y90A 4M7AA 2VC8A 3SWNC 2YHTA 4XU3A 4M77C 3JCMc 4F7UG 3PGGA 3JB9I 2RA2A 2EAYA 3JCMd 4C92F 1I81A 4XTVA 2E41A 4M75D 4XTWA 1M8VA 5GMKh 5GANd 1Y96B 5GANf 4M78A 2VXFA 4EMGA 5GAMj 1HK9A 3RKWA 5LJ5e 5LJ3g 5LJ3j 4J6WA 4XTZA 5I21A 5GAMd 2RB6A 3EFRA 4X9CA 5GAN6 4J6XA 4N0AC 3V7RA 3QHSA 4PJOB 4MMKA 4C8QG 4OP0A 4C8QC 4PJOD 2CGHA 4QVCA 3RKXA 4M7DF 1JRIA 3JCMe 2EJGA 3RUXA 2DKGA 3HFNA 4V2SA 3JCMV 4XTUA 4C92D 4RCCA 5GAOp 3M4GA 4M78B 4N0AA 3AHUA 3JB9F 3RERA 5GAOn 4HT8A 4XU0A 3V8JA 2DXUA 4M77E 1JBMA 4JRKA 3SB2A 1M5Q1 3BFMA 5GAMe 1WQ7A 4HT9A 4M7AF 1H641 5GMKi 3JB9H 2DJZA 3FIFA 1BIAA 4M75E 4M75A 3JCMh 4PNOA 4M75F 3JCMb 2DTHA 3L1AA 4A54A 3BW1A 4M75C 4Y91A 4C92E 4EMKB 1KQ1A 3SWNA 1B34B 4EMHA 5GMKl 1D3BB 1X01A 4M77F 4PJOE 2FYKA 3JCMQ 5GAMh 4M7AC 2I2LA 1Y96A 3BDUA 4XTXA 1I4K1 4M75B 4EMKC 4QVDA 4NL3A 4C92A 1N9SA 2E64A 2DTIA 4XTYA 4RCBA 4NOYA 4PJOG 4C8QD 3SWNB 3L2ZA 2JN0A 3RIRA 1D3BA 5GMKj 4C8QF 2FB7A 5GMKm 5GAOr 5DY9A 4M7DG 4PJOA 3V7SA 3JCMX 1KQ2A 5LJ5g 1YCYA 1LJOA 5LJ3e 4JLIA 3BY7A 2RM4A 2K57A 5GMKe 3JB9D 4M78F 4M7AD 4M7DB 5GAN2 3HSBA 4M7DD 2DTOA 4M75G 5GAN5 1LNXA 1WPYA 5GAN7 3V8KA 1U1SA 3V7CA 3JCMP 4M7AE 2YLCA 3V8LA 4XU2A 1U1TA 4M7AB 3RESA 4PJOC 4M77A 3JCMf 4JRIA 2DXTA 2DVEA 5GAN3 2E1HA 5GAOl 1I8FA 2RD1A 4C92G 4DQ2A 4M7DC 4J5YA 1BIBA 5GANe 5LJ5h 4XQ3A 2HNIA 3FB9A 4EMKA 1TH7A 5GANg 3JCMJ 1MGQA 1B34A 4M78D 3EFSA 4F7UA 4M77G 5GAMf 5GAN4 5GAMg 2EWNA 4PJOF 4C8QA 4F7UF 2EJFA 5LJ5j 3QSUA 3FJPA 2E65A 3JCMW 1WQWA 5CAIA 3HFOA 4M77B 1HXDA
chains in the Genus database with same CATH superfamily
3L2WA 3LYIA 4KUIA 4BD3A 3GIBA 5D7UA 1K73R 1N9RA 1ZUKA 3FRNA 5J39A 1UUEA 2P0QA 4MMLA 5EC7A 1MNDA 1WNLA 4XU1A 3QXEB 3CXCP 1TUCA 3SEMA 3CCQA 3SWNC 3MEAA 2YHTA 2HQHA 5KYWB 1PKTA 3PMIA 1UJYA 2CSQA 2V1RA 4K11A 4BUGA 5LJ3j 1KHIA 3EFRA 4X9CA 4MMKA 3CCRA 3FJ5A 2JNGA 2VGMA 2GTJA 3L2VA 2X3WD 1M90U 5HCKA 4E7ZA 4XU0A 2ECZA 4X34A 2EQIA 2JJ9A 2ROTA 5D6WA 1BI1A 5KYXA 3EH2A 4M75C 2E6ZA 4FYYB 5GMKl 4GBQA 5IHNA 1GCQC 2DXBA 2SEMA 2MWPA 3F70A 1I4K1 1VQ5A 1UTIA 2FZCB 3DLMA 4C92A 3CCUQ 4C8QD 3QIIA 1ZBXA 2H3EB 1N8RU 5KYYA 3MKDA 1V29B 2O31A 1AOJA 1UECA 2RK2A 2X4JA 2DL5A 3CPWP 1AHJB 1G2BA 1UG1A 4VUBA 3VS1A 3HL8A 2RD1A 4DQ2A 4OMFB 3R6NA 3FB9A 4OB0B 5L23A 2A08A 1MGQA 1HYOA 4C5IA 4M7AD 4OB2B 2A37A 4M77B 5GANh 4QQ6A 3CCMT 3JCMg 1R77A 2E5QA 1RAHB 3REAB 3JB9G 5C0MA 2P0PA 4ZTFA 3OS0A 5I11A 2VVKA 4C0GA 5LJ3d 4HCKA 2QG9B 1VQNQ 2KDSA 2YUPA 1M8MA 1OPLA 3CMAQ 4ANJA 3CCVA 3OYLA 1YJNA 1UGVA 1OU9A 4O6JA 1TUDA 2X4XA 2DAQA 4IUPA 4XTZA 2F5KA 4JJNK 3VYGA 4QVCA 4A4KA 2EJGA 4HKEA 3HFNA 3M53A 4HVWA 5DLQE 2KRMA 2HBPA 3PMTA 1I5OB 1YIJA 1QQJA 2PVOB 4LDXA 1M5Q1 4PJJA 2A36A 5GMKi 2DJZA 1GFDA 1BIAA 1OV3A 1YITA 4A4GA 2J06A 3JCMb 2CH4A 4A4HA 2QQ9A 1KK7A 2X35A 1YJWA 1JEGA 2LQ8A 2FG0A 2I2LA 9ATCB 1VA7A 1VQLT 1IHWA 2D9TA 2E64A 2W0ZA 1LVKA 2RHYA 1K8AR 2OTJT 4PJOG 4J8OA 4P5NA 2DYBA 2O2OA 2ZPHB 4ORZA 3RDVA 3RMQA 5GAOr 4FCYA 3CPFA 3OYIA 2P84A 5LJ3e 3EGUA 2MF2A 2K57A 2QGGA 1Y07A 4RTZA 1T3SA 2DTOA 2V8IA 3CC7A 2CP5A 1W2BS 3V8LA 2FEIA 1WHJA 3EFOA 2DXCA 3GOXA 3S3MA 3M59A 4XQ3A 2KT1A 2JOYA 2QQRA 5IHKA 5GAMf 3QJYA 3NGPA 4ZNXA 2EW3A 1Q86R 1N27A 3A5ZB 4J83A 3VS6A 1UDLA 2MMPA 1JXMA 4IUVA 5CQXA 4KRTA 2OTLQ 2LCSA 3J81E 2HCKA 3CEYA 4HA8A 2QA4A 2DL3A 3CC2A 3INZA 2LZ6B 2K79A 1YP5A 4J6YA 4X9DA 4C5EA 2QDLA 4B9XA 1KC8C 1W4SA 2CZ7B 1GCQA 4RUGA 2AT1B 1KIKA 3ME9A 2EAYA 1FYNA 1QVGP 2GCXA 2E41A 1U06A 1M8VA 4C0DC 4BACA 3CD6T 4EMGA 1TTHB 1KQSS 5I2MA 1IGUA 2MI6A 2G6FX 2VGNA 3OYHA 4L6V5 2CSIA 1UFFA 3CCSQ 3UF4A 1A0NB 3CCUT 2KSSA 3H0HA 2DRMA 1QLYA 2C0TA 2RNAA 2KAFA 2YUNA 4ZN1A 4JS5A 5GJWB 3L1AA 3BW1A 2BIVA 4LN2A 4EMHA 3VS7A 3H6ZA 2PQWA 1SSFA 4BDZA 2KRSA 4IIMA 4QVDA 1N9SA 1D0ZA 3OYYA 5D6YA 2M51A 4M7DG 2LVMA 2WSEE 1IRXA 3EG1A 1SHGA 1G3YA 4LDYA 3PTAA 1LNXA 2RJEA 4NS5A 4J9FA 1X75C 1YBYA 4M77A 1RACB 1X27A 1D0XA 3ZEHA 2HMAA 2H3JA 2KRNA 2OAUA 2EGAA 1JO8A 5GANg 2RK1A 4BI8B 1YIJT 3EFSA 1VQ6T 3OA6A 3Q1JA 2CH4W 1QMCA 1S1NA 3EGDB 3PE0A 4C0ZA 2KT8A 2L5QA 2E3IA 2RH2A 3LH0A 3LW5E 4R56A 1V76A 2YUOA 2HKQB 5HK3A 4OMLA 1N5ZA 1K8AU 4WCIA 3KUFA 3CCQQ 4WF2A 4M77D 3M0TA 2K3XA 1MUZA 1HJDA 2A28A 5LJ5d 2R5MA 4MZPA 3RKYA 1YHQQ 1VIFA 2BTTA 3CCJT 2LX7A 3M0SA 3EHQA 4IURA 2YT6A 3CCRQ 2A7YA 3MP6A 1NE8A 1S72T 5GAMd 1M3BA 2KEAA 1EFNA 2RB6A 2L3PA 2PTKA 1Q7YR 2IPOB 3RKXA 4GLKA 4C92D 5HK0A 2PUOB 4C5HA 4N0AA 5C6SA 3I56A 3CQTA 4M77E 3OYCA 1VQMQ 2RQRA 3A8HB 8ATCB 2OTJQ 4M75E 3QKJA 3OMCA 4L59A 2CZ0B 1KG1A 4JLGA 1K8AC 4BE2A 2K6DA 2NUPB 4F17A 2RN8A 1Q81U 4J9BA 4M7AC 1QVGS 5FU7C 2KI7A 3CCET 1C1AA 1GBQA 1OQKA 4D8KA 1OZ2A 3RIRA 2EYQA 3VYHB 2LX9A 3DKMA 3E2UA 2RQUA 3I55T 3JB9D 1ZUYA 1NJIR 1RAEB 2YRVA 3O8VA 1I0CA 1BU1A 1N8RC 1RAIB 1SF9A 3X28B 1K4US 4C92G 1D0YA 1KJWA 1TH7A 1SRMA 3CCUA 4DOWA 3TCJA 3TSWA 4PJOF 4D8DA 2ZPFB 2B8AA 2CS7A 1WGSA 2LNVA 1QVFS 5CAIA 2ZPIB 4EPCA 3HHTB 1GRIA 2W10A 4BI4A 4KBMB 3UPUA 4C92B 4MZTA 1NJIU 2IIMA 2AKLA 4JJBA 1PSEA 4NL2A 4RTTA 3QO3A 3CCLT 1FWZA 2BUDA 3E9GA 2HL5C 1Q81C 4XK8E 1SSHA 5LJ3h 2JXBA 2DEUA 3I56Q 2QXFA 3TREA 1VQMA 1BI2A 2JZ2A 2OTJA 3MEVA 1WX6A 4TVRA 2F2WA 2K3BA 3JCMd 2RF0A 5CVIA 1VOMA 5GANd 2DL8A 1NM7A 3H0FA 2EYYA 1PD1A 2DIQA 1HK9A 2K3YA 1D1BA 1OEBA 1BCMA 2PU9B 5DLOA 1K73C 5FWCA 1UGRB 5A0DA 1K9MR 4EIKA 3H41A 1YITQ 3AHUA 5LL6S 3C95A 2K5LA 1OULA 3SB2A 3OMGA 2ZPGB 5AYFA 1P92A 2COZA 4ZTJA 1QVPA 2COYA 2PUKB 3UA6A 4O5VA 4C92E 2D1XA 2KXDA 3VV0A 4JPBW 4PFZA 2FYKA 2ZPEB 3FDRA 2CUBA 3M0PA 2CP7A 4Y92A 2J7IA 2L2PA 4XTYA 4N4IA 1VQ8Q 1ZX6A 4J9GA 3JCMX 1YIJQ 1YCYA 3BY7A 8AT1B 4KGXB 5GAN2 1UEBA 3OYMA 4JJDA 2EBPA 1K0XA 4OMNA 3CD6Q 2LTOA 4B6MA 5GANe 1E7OA 3CC4A 2KVQG 2DO3A 3M54A 4C0FA 2XD0A 2HSEB 1ABQA 5D6XA 1RLPC 3A8OB 1YITT 3CC2Q 2QTVA 4HVUA 1KQSP 2YSQA 4ATOA 1UJ0A 4F7UE 2DEQA 1Q7YU 4C92C 4ZGJB 1PM3A 2YUQA 3EG2A 1VIEA 1TG0A 4M7AA 3JB9I 4C92F 5DM7R 3C0CA 3M0QA 1Y96B 1CKAA 3G7ZA 1YFNA 5M9OA 1VQ8T 1X6BA 1IHVA 1PHTA 2KE9A 3CCSA 3URGA 4LD6A 4OVAA 2CGHA 4OGEA 4M7DF 2ROLA 3CBOA 2QA4Q 3QYHB 3ER0A 4M78B 2JM9A 3QZ9B 4PJNA 4CRIA 3WVDB 3G6EA 4MDXA 2LC4A 1UGSB 3S3OA 3UATA 4N4HA 4PLLA 1V1CA 3EH1A 3CD6A 1NPPA 1QVGA 3E9FA 4PLIA 3VS5A 3RBBB 3CC4Q 2EGCA 3BDUA 2DX1A 4M75B 4FIBA 3CCQT 1PSFA 2E4HA 2DYIA 4XAXB 3DB4A 1N8RR 3PNWC 3EG0A 4JZ3A 2XMFA 5DY9A 3V7SA 4DBQA 2CP6A 1KD1C 3HSBA 2HQXA 2J6OA 3A1PA 3ZBDA 2BZYA 4JZ4A 3U23A 2AZSA 1PCXA 3SFMA 3CCLQ 3JV3A 3H8ZA 1HSQA 2CP3A 2A3LA 1QVFA 4PK4A 1TWBA 2EWNA 1W2BP 2GQVA 1WQWA 2BZXA 2F5TX 2FZKB 1KFZA 2K2MA 1MMAA 4JS4A 2RJFA 4OMMA 1JQQA 4QW2A 3GNFB 1BK2A 1UGQB 2LT1A 5LJ3f 4F16A 4LE9A 3VU3C 4M7DA 1X6OA 2IVWA 3EGXB 2ZZDA 1WZOA 2ED1A 2LJ3A 1Y7XA 2L0AA 4Z88A 1I81A 4XTVA 3VS0A 4LD9K 2EYZA 4QKUA 2Y4XA 2FHDA 4OP0A 1N6AA 3LH5A 2DKGA 1K73U 4V2SA 2M9UA 1YWPA 3PVLA 2B86A 2JTFA 2DXUA 2ABLA 3EG3A 1JBMA 3JSCA 1YHQA 1C0MA 3MP1A 1ZQ1A 2J6FA 4E7HA 5KCOA 4LXCA 3QPHA 2E12A 1FX7A 5IAYA 2HL3A 3CCLA 4DBFA 3REBB 2BZ8A 5CKDA 3QDRB 2VYTA 2RJCA 3QZ5B 1TOVA 4RCBA 1GBRA 1D3BA 2FB7A 1Q86U 1LJOA 2COWA 3HPWA 4GY5A 1ACMB 1VYVA 1HD3A 2KMTA 5IHIA 3OYGA 4HVVA 3EG9A 1H8KA 5GAN7 1U1TA 5J26A 2QDYB 2E1HA 3P8BB 3KXTA 2PVDB 3VUZA 2X9HA 1FXXA 2FPEA 1BCOA 2QAZA 2I0NA 3OB9A 1PG5B 3G6ET 1QWEA 2EQJA 1YHQT 3R6OA 1JJ2A 6AT1B 2GGRA 3NFCA 4J9HA 5GAOq 3G71Q 4AG1C 4R0KA 3WVEB 1KHCA 2X3XD 1KC8R 3CC7T 3SDZA 4KGZB 1W70A 4GLMA 1VQ6Q 1O9SA 2AZVA 4FW1A 2LJ0A 1NYGA 2KNBB 2ZGWA 3E1SA 1OYXA 4BY6C 1RUWA 3CBPA 2CZ6B 2GFUA 1IO6A 3PGGA 3QWXX 5GMKh 4R55A 1KQSA 4M78A 1Q95G 1VUBA 3V7RA 1I07A 3RUXA 4ELYC 3CMAT 4LUDA 2JS2A 1NLPC 1M3AA 2KXCA 3CCEQ 3O5ZA 2XDDA 4JJCA 1MHNA 2O9SA 1VQOT 1ZSGA 1B07A 1SRLA 2JUFA 1VQKQ 2VB6A 3CCMA 1M90R 4PJOE 2L8DA 1G8XA 2EIFA 1BYMA 1ZBJA 1MMNA 5CCAA 3TQ7P 4NOYA 1T0HA 1XJWB 3HRSA 4QQGA 2KQWA 2DMOA 4JLIA 3RMSA 1M1KU 4OMOA 2GBQA 1M2VB 1JB0E 2CP0A 1SG5A 3V8KA 3M4YA 3JCMP 2EQUA 2E6NA 2NUTA 5FWBA 4J9IA 4CI0C 2DBKA 4J7IA 3CPWA 4J5YA 1BIBA 1QCOA 1UGPB 3JCMJ 1I1JA 1B34A 4J9DA 3NMZC 4F7UF 2EJFA 2E65A 2HZYA 1VQOA 3G4SA 3ZFJA 2YLBA 2NYSA 4M78C 1VQ9T 2JW4A 4F7UB 2E10A 2E5KA 2YWWA 4C8QB 5KYYB 2D0QB 3CMAA 3QG1A 1YI2A 1M3CA 1YJWT 3C4SA 1C6VX 1TSFA 1YJNQ 1Y57A 3OS1A 4AG2C 4XU3A 3MCAB 1BB9A 4XTWA 2DVJA 4FSSA 7AT1B 4RMOA 2JVVA 3QWYA 2VKNA 1H3ZA 4KUDK 3OS5A 3FEOA 4OMPA 1TXQA 2A0FB 1AT1B 1T3LA 1JU5C 4RCCA 5GAOp 1FMKA 1WA7A 2VWFA 4J9EA 1MV0B 5GAOn 4M4ZA 2F69A 4KT0E 3FIFA 2DIGA 1OU8A 1RI0A 2XG8D 3LLRA 3TEEA 4Y91A 2X4WA 3I9QA 3L42A 1VQ9A 2XDBA 5FU6C 4ELZC 3PVQA 3OYKA 1CKBA 1RAGB 2ENMA 4JDSA 1Y96A 3CCST 1SEMA 4FT4A 5IN1A 3FLGA 2RHZA 4PJOA 1B3QA 2GF7A 1GL5A 1KQ2A 2FL7A 5I22A 5GMKe 2EVRA 3UWNA 4FSXA 3G6EQ 1Y71A 2EGEA 1ZLMA 2D6FA 1YI2Q 1TS9A 2K5FA 4PJOC 3C12A 3DB3A 2HKNA 2KYBA 1O75A 2VV5A 3OY9A 2GNCA 4PJMA 3CMET 2HNIA 4JRQA 3OSVA 1RI9A 2F2XA 1Z9ZA 2DL7A 3JAME 2R5AA 5GAN4 4PJLA 5A2QE 1E6GA 2IG0A 2DPPB 2OTLA 1VQPA 2JTEA 2EJ9A 4FYWB 4RTYA 4M78E 1WHHA 1MNEA 2LDMA 5FU7B 3I5SA 5IH2A 3QUIA 5HKCA 4B9WA 3H0IA 3EHRA 2RQTA 4Y28E 4RG2A 4AFQC 3MPUB 3OYDA 2J05A 3I55A 5GANf 1K9MC 1NG2A 2M16A 1LPLA 5LJ5e 5J3BA 1RL2A 4AFZC 3MO8A 3VUBA 1YI2T 1WJQA 3CC4T 2KGTA 3M4GA 2MCNA 1QKXA 3V8JA 3ASKA 3IQLA 5GAMe 1H641 3G4ST 2MIOA 5HY6A 1S72Q 4RTUA 4J9CA 5GJVB 3C94A 4A54A 1G5VA 2OJ2A 3SWNA 4Z8AA 3GPLA 1NLOC 1BBZA 4M77F 1WXTA 2DM1A 2R57A 3TVTA 2DA9A 1ZUUA 1NBEB 2DTIA 3CBMA 3CXCA 5CO7A 1G83A 4OMQA 1EIFA 3GNGA 1ZHIA 3BE3A 1WHKA 2WSCE 1VYUA 3MEWA 3NPFA 4M7AE 3OYNA 4M7AB 4BE0A 5CQYA 5GAOl 1NYFA 2DNUA 4OB3B 4M7DC 3UA7A 3CCJA 2LCCA 1IREB 2LMJA 4PL6A 4F7UA 5GAMg 4C8QA 3I55Q 5LJ5j 1GXIE 2EQKA 2QQBA 2RA2A 2RHIA 3GLXA 3GP8A 4CC7A 2L89A 1PC0A 1T0JA 5KE2A 3UDCA 3OYBA 2XIDA 2VXEA 5GAN8 3M58A 5FROA 4M7DE 4KGVB 2O4XA 1YNZA 3VRZA 2NWMA 3OQ5A 3VRYA 4RKUE 1AEYA 2K5IA 4J6WA 2KYMA 1KSWA 3CCEA 4J6XA 2O88A 3JCMe 2ZPBB 2F2VA 5KYXB 1MMDA 3VS2A 4ZN3A 3JCMV 1VQ6A 1VQKA 4HT8A 5KE3A 4OF1A 1D1AA 4D6WA 2QGFB 4M7AF 4HT9A 3BFMA 1WLPB 1QCFA 2DTHA 3PIPA 2DD5A 2MK5A 3MHXA 2EKOA 2CREA 1M2OA 2DD4A 3X24B 1IXDA 5GAMh 1M9SA 3CCJQ 2P4TA 4XTXA 2ZAEA 1ZSZB 4E47A 3TU4K 2KR3A 4IUUA 4QQDA 1YJWQ 2JN0A 3LX7A 4C8QF 1QW1A 1YJNT 1UB4A 2DETA 1JJ2P 4E7KA 1ZSZC 1PRLC 2FPDA 3HP9A 4X1VA 4DBHA 1OX9A 1M1KC 3D7SB 1X2QA 1PWTA 1U1SA 2YLCA 4XU2A 4CC2A 2O4XB 3RESA 3JCMf 2DXTA 1PKSA 2XHCA 3ZL7C 2WACA 3L2QA 1VQNT 1B7TA 3CXCS 4M77G 1K0SA 3OBYA 3FJPA 3JCMW 5FRNA 2M0YA 2LQNA 2SRCA 1PNJA 3J7AF 3HTRA 1RAAB 4BE1A 3LGFA 2RI5A 3VS3A 4C8QE 2L3QA 1VQ4T 4JUVA 4A53A 4FT2A 1BKBA 2LQKA 1IB8A 4II1A 3I5RA 2O9VA 3JCMc 4M77C 2GQIA 1JJ2S 4E7SA 3G71T 2BE9B 4RTXA 1LCKA 2JTMA 1H92A 3M5AA 1VQOQ 2CT3A 5GAMj 4ZGEB 4A63B 1ABOA 2AHJB 5AT1B 2Z0WA 4C8QC 2XKOC 1JRIA 2MYSA 2C0OA 1G3SA 3X26B 2QEXT 5KCHA 3HRTA 4KH1B 3EG9B 3KBGA 4JRKA 1Q81R 1AWJA 5ECAA 4M75A 3JCMh 3WXMB 2RMOA 1KQ1A 2D0NA 1VQ7A 2EPDA 5IXFA 3VJPA 2K4YA 3ULRB 3JCMQ 2DL4A 4DOVA 1YJ9A 2XI9A 3OW2A 2MOXA 4NL3A 1X2KA 4A4EA 3BDLA 1W6XA 2AIRB 1VQPT 1FMWA 1AWOA 2ESWA 3EFOB 4CC4B 2KK4A 3A8MB 1WHMA 2E70A 2M0OA 1W2BA 1QVFP 4C5GA 1VQ9Q 4JRIA 4OB1B 2LJ1A 2RI3A 2MPXC 5FLXE 3TSZA 1OPKA 1QP2A 1R0BG 2X4YA 1VQ5T 3QSUA 3HRUA 1X43A 5I21A 4L5GA 1GCPA 1E6HA 1M27C 2YDLA 1U8RA 1EZZB 4F14A 1K1ZA 3EGXA 4HXJA 4QT7A 4AT1B 4ME7A 5CIUA 2QASA 4N4GA 2BKDN 2DZ9A 3P8DA 2XDPA 3VKIA 3JB9J 1OZ3A 3UT1A 4LDVA 4FYXB 2LT4A 1I5LA 2QQSA 1RLQC 3OW2P 4IKFA 3RR6A 1SKUB 5KH6A 2NUPA 1Q82C 2H8HA 5KYUB 2CP2A 2HDAA 2QK0A 4BY6B 2RPNA 2FVUA 5CKEA 3OBWA 2R58A 2E3HA 2NLUA 1AVZC 1YJ9Q 4HCBA 3A98A 4PJOD 3X20B 3JRZA 3M56A 2K2VA 1NJIC 1M90C 2JT4A 1H3HA 3JB9H 4OGCA 1D1CA 3M57A 4RTWA 1OX8A 1MMGA 2LRQA 2YXYA 2EKHA 1B34B 1D3BB 1R0CB 4HCZA 1J3TA 2L3RA 4CC3A 3OW2S 3PFSA 1WHGA 1U3OA 1YCSB 4M78F 2MWOA 1WI7A 2KBTA 2PZ1A 1S72A 1X69A 1ZA2B 1ZSZA 4E7JA 3NTHA 3EGDA 2QA4T 4LNPA 5FU6B 2LNHB 1AWWA 4C0DB 2DERA 4E2FB 5LJ5h 2DILA 4EMKA 2DE0X 2YRCA 1YJ9T 2V1QA 1VQLA 4F04B 2CUDA 1UHCA 3NTKA 3NTIA 5CKFA 2FRYA 2M1HA 2FRWA 2L3SA 2LQWA 5CKBA 1NEGA 2DZCA 2FPFA 2GTOA 3DLLA 2JM8A 4PFOA 3M0RA 2DBMA 1AZGB 2FO0A 4E6RA 1KD1R 4M7AG 1YN8A 1OOTA 1WJRA 2JMCA 3M0UA 5IT9E 2Y4YA 5GANj 5GAOm 1NZ9A 4IIOA 2Y90A 1GFCA 1WIEA 3QYGB 1K9MU 4DA4A 3X25B 3GF5A 2QQAA 2O01E 2P0KA 3PT9A 5LJ3g 3L2UA 2V26A 1AWXA 2K9GA 4PJOB 4C8QG 1IGQA 4Z02A 5CKHA 4HCCA 4AMCA 2D8HA 1PD0A 2DJQA 1U5SA 1TU0B 1BI3A 2XICA 1BI0A 2XU8A 4RTVA 4BB7A 1WJSA 4M75F 4EMKB 2BE7D 2ZCFB 3SD4A 3MJXA 3CMEA 1M1FA 3OSSC 3G1JA 2C0IA 1Q86C 1W1FA 3H9NA 1M2VA 3THKA 2NUTB 4RG8A 3PIOA 5I2SA 5GMKm 5LJ5g 1VQ5Q 4PKCC 4YTLA 4M7DD 2YRDA 2LP5A 1VQ8A 4WTOB 1RAFB 2V8KA 1I8FA 3KFVA 1D09B 2RO0A 4IUQA 2HBWA 3RNJA 4IUTA 2AK5A 3EAEA 3CCVQ 3G71A 1RABB 2NUZA 3T9NA 5FW9A 5L8RE 1WHLA 3HFOA 4AFUC 2QEXQ 2J6KA 2JMAA 4ESRA 2F1LA 1MV3A 1G3WA 5CR2A 1RADB 4FU6A 4LDUA 5KYUA 3QJ6A 2EYWA 2HD0A 4QVZA 1Q82R 4M78G 2FZGB 3LWIA 2EFIA 1NEBA 2D8JA 3GBQA 3LGLA 1VYTA 5LJ5f 1AZEA 4Q5WA 2QTXA 1R8OB 1QWFA 1CSKA 4F7UG 2GFAA 1VQNA 1XNIA 1X6GA 4BDYA 1WXBA 4DBRA 4M75D 1XTDA 2CYZB 2JS0A 4A4FA 3RKWA 1K76A 2KY9A 2MAMA 3CMEQ 1FMVA 4N0AC 1K9AA 5KYWA 4EDUA 1JXOA 2DLPA 2PVGB 3JB9F 1G3TA 4PFPA 3CCMQ 1Q7YC 1WQ7A 2DF6A 3QBYA 1VQ7Q 3CC7Q 4LDWA 3N5BB 1UHFA 5CK9A 1XOVA 2V8JA 4FM4B 4DEYA 2DFUA 1VQ4A 4AFSC 2RJDA 2CZ1B 4E7IA 1IZ6A 3VS4A 2QYZA 3SHWA 4EMKC 1ZA1B 1Y0MA 1UE9A 3S6WA 2RQVA 1Z9QA 2DRKA 3OS2A 2C06A 3L2ZA 2QEXA 3A8LB 2WSFE 2OI3A 4FL6A 1QP3A 1WXUA 2RM4A 4M7DB 3M55A 2RHUA 1WPYA 2PNIA 1OI1A 1M30A 3CC2T 2EQMA 2HEQA 1QCNA 1YWOA 2DVEA 3M9QA 1KD1U 2HAXA 2DK3A 2CT4A 2KROA 1XQHA 1AD5A 3G4SQ 4DEXA 4LUEA 2M02A 1VQKT 2QI2A 1WDXA 3OYJA 5A0LA 2EYXA 1F1BB 4JRPA 3QDFA 4MZMA 4KULA 1VQ7T 1LOJA 2CDTA 3CCRT 2XK0A 4BI3A 2ATCB 1M1KR 1EX4A 2RQWA 1ARKA 1KC8U 2OAWA 2VC8A 1Q82U 1TUGB 1M4ZA 2VASA 2VXFA 1VQ4Q 3J80E 2RHXA 5GAN6 3OYEA 3QHSA 3A8GB 2K7AA 3NHNA 4XTUA 4FW2A 5KYNA 3RERA 2P4RA 2LCLA 4UC4A 2OTLT 4PNOA 2HSPA 4E7LA 2ED0A 2G3RA 5IXBA 1QKWA 2CKKA 1DJ7B 1X01A 4MDWA 2RI2A 3L2RA 2OX7A 5FRMA 4J7FA 1WFWA 3LWHA 4Z89A 1VQMT 2AKKA 3MEUA 1SHFA 3SWNB 5GMKj 2VUBA 1WYXA 3CCVT 5A0GA 3FC3A 3I35A 1NPRA 4KH0B 3P8HA 4M75G 4FYVB 5GAN5 3OYFA 3V7CA 1M1GA 3HKSA 1VQLQ 3E19A 5GAN3 3META 3AT1B 2HQEA 1VQPQ 3CPWS 4ZGDB 1SPKA 4M78D 3OYAA 1PRMC 2X51A 3MP8A 3S3NA 3I56T 5EG2A 1HXDA
chains in the Genus database with same CATH topology
4EPCA 1VQOA 3HHTB 3ZFJA 3L2WA 2YLBA 3LYIA 4KBMB 4KUIA 4BD3A 4BI4A 4C92B 3UPUA 4MZTA 1U8RA 3GIBA 4M78C 1NJIU 1N9RA 4NL2A 1PSEA 3FRNA 5J39A 1VQ9T 4ME7A 5CIUA 3QO3A 2E10A 4F7UB 3CCLT 4N4GA 2BKDN 4C8QB 1FWZA 2D0QB 3CMAA 3QG1A 1YI2A 2DZ9A 2BUDA 2P0QA 3P8DA 2XDPA 4MMLA 3E9GA 3VKIA 3JB9J 1YJWT 1Q81C 4XK8E 1WNLA 3C4SA 1OZ3A 3UT1A 4XU1A 4LDVA 5LJ3h 3QXEB 2QXFA 2LT4A 3TREA 1VQMA 1BI2A 2QQSA 3OS1A 3CCQA 1I5LA 4IKFA 2JZ2A 2OTJA 3SWNC 3MEAA 2YHTA 3MEVA 4XU3A 5KH6A 4TVRA 1Q82C 3JCMd 3MCAB 3PMIA 5CVIA 4XTWA 5GANd 4BY6B 2FVUA 4RMOA 2DIQA 5CKEA 2JVVA 1HK9A 3G4SA 2K3YA 4BUGA 1H3ZA 3OBWA 5LJ3j 2R58A 4KUDK 3OS5A 3FEOA 1KHIA 2NLUA 2PU9B 3EFRA 4X9CA 5DLOA 4HCBA 4MMKA 4PJOD 1K73C 3CCRA 3X20B 1UGRB 5A0DA 3JRZA 2JNGA 2VGMA 3L2VA 4RCCA 5GAOp 3M56A 1M90U 3AHUA 5GAOn 2K2VA 1NJIC 5LL6S 1M90C 4XU0A 3C95A 2K5LA 4X34A 3SB2A 3OMGA 5D6WA 2ZPGB 2F69A 5AYFA 3JB9H 4KT0E 1P92A 3FIFA 1BI1A 4OGCA 1QVPA 2DIGA 1RI0A 2PUKB 2XG8D 4ZTJA 3M57A 4O5VA 3LLRA 4M75C 2E6ZA 3TEEA 4Y91A 4C92E 2LRQA 1B34B 2X4WA 3L42A 5GMKl 1VQ9A 1D3BB 5FU6C 4ELZC 3VV0A 2XDBA 3OYKA 2FYKA 4HCZA 2ZPEB 2DXBA 3FDRA 2L3RA 2MWPA 4JDSA 1Y96A 3F70A 3CCST 1I4K1 1VQ5A 3DLMA 4C92A 4FT4A 3OW2S 4XTYA 5IN1A 3FLGA 4C8QD 3QIIA 1ZBXA 2RHZA 3PFSA 4N4IA 4PJOA 1N8RU 2GF7A 3JCMX 1KQ2A 1YCYA 2FL7A 1V29B 3BY7A 5GMKe 4M78F 5GAN2 1UEBA 2MWOA 3OYMA 3UWNA 4FSXA 1Y71A 2RK2A 1S72A 2X4JA 4E7JA 2D6FA 3NTHA 2QA4T 1AHJB 2K5FA 4PJOC 5FU6B 4VUBA 3C12A 3DB3A 4C0DB 3HL8A 1O75A 2RD1A 2VV5A 4DQ2A 2LTOA 3OY9A 5GANe 3CC4A 4OMFB 2KVQG 5LJ5h 3CMET 2HNIA 3FB9A 3OSVA 4EMKA 2DO3A 4OB0B 3M54A 4JRQA 1YJ9T 1MGQA 3JAME 4C0FA 2R5AA 2XD0A 4C5IA 5GAN4 1VQLA 4M7AD 4OB2B 5A2QE 2IG0A 3NTKA 3NTIA 5CKFA 5D6XA 2M1HA 4M77B 3A8OB 1YITT 2DPPB 2OTLA 5GANh 1VQPA 2EJ9A 4QQ6A 3CCMT 5CKBA 4M78E 3JCMg 2LDMA 5FU7B 2DZCA 2E5QA 3JB9G 3DLLA 5C0MA 4ATOA 2P0PA 4ZTFA 3OS0A 3QUIA 5HKCA 4F7UE 2DEQA 4C0GA 4C92C 1Q7YU 4M7AG 5LJ3d 4B9WA 4ZGJB 4Y28E 1WJRA 1VIEA 2KDSA 4RG2A 2Y4YA 5IT9E 5GANj 5GAOm 3OYDA 1NZ9A 2Y90A 4M7AA 3CCVA 3JB9I 3OYLA 3I55A 3QYGB 4C92F 5DM7R 4DA4A 3X25B 1YJNA 1K9MU 3GF5A 2QQAA 2O01E 4O6JA 1Y96B 2X4XA 2P0KA 3G7ZA 5GANf 1K9MC 2DAQA 4IUPA 5M9OA 1VQ8T 2M16A 3PT9A 5LJ5e 5J3BA 5LJ3g 1RL2A 4XTZA 3L2UA 2F5KA 3CCSA 3URGA 4JJNK 3VYGA 3MO8A 3VUBA 4PJOB 4LD6A 4C8QG 4OVAA 2CGHA 4OGEA 4QVCA 4M7DF 3CBOA 4A4KA 4Z02A 2EJGA 5CKHA 4HCCA 4HKEA 1YI2T 1WJQA 3HFNA 3M53A 5DLQE 3QYHB 3CC4T 3ER0A 3M4GA 4M78B 2HBPA 3PMTA 3V8JA 3ASKA 1YIJA 2PVOB 1HXDA 1BI3A 2XICA 1BI0A 1M5Q1 5GAMe 4LDXA 1H641 3G4ST 3QZ9B 5GMKi 2DJZA 2XU8A 4CRIA 3WVDB 3G6EA 4MDXA 4BB7A 1BIAA 5HY6A 1WJSA 1YITA 4A4GA 4M75F 3C94A 3JCMb 4A54A 4EMKB 4A4HA 1G5VA 2LC4A 1UGSB 2QQ9A 3SWNA 4N4HA 4PLLA 3GPLA 2ZCFB 3S3OA 3CD6A 4M77F 1NPPA 1QVGA 3E9FA 3SD4A 4PLIA 2X35A 1YJWA 3CMEA 1M1FA 2LQ8A 2I2LA 3OSSC 2R57A 3BDUA 1Q86C 4M75B 1VQLT 2D9TA 2E64A 2DTIA 1PSFA 4FIBA 3CCQT 3CBMA 2RHYA 2OTJT 4J8OA 4P5NA 4PJOG 2ZPHB 4RG8A 4XAXB 3DB4A 3RMQA 3PNWC 3PIOA 3CXCA 5I2SA 5CO7A 5GMKm 5GAOr 5DY9A 3CPFA 1EIFA 3V7SA 3GNGA 5LJ5g 3OYIA 5LJ3e 2MF2A 4PKCC 2K57A 1KD1C 1ZHIA 3HSBA 2HQXA 1Y07A 4YTLA 2DTOA 2V8IA 3ZBDA 3CC7A 4M7DD 2WSCE 3MEWA 1VQ8A 4M7AE 1W2BS 3OYNA 3V8LA 4M7AB 4BE0A 3SFMA 5CQYA 5GAOl 2V8KA 1I8FA 2DXCA 3GOXA 2RO0A 4OB3B 4M7DC 3S3MA 4IUQA 3H8ZA 3M59A 4IUTA 4XQ3A 3CCJA 2LCCA 1IREB 4PL6A 2JOYA 2QQRA 3EAEA 4F7UA 2A3LA 1QVFA 5GAMf 3G71A 3QJYA 2EWNA 4C8QA 5GAMg 5LJ5j 2GQVA 3T9NA 2EQKA 1GXIE 5L8RE 1WQWA 2RA2A 2F5TX 2QQBA 3HFOA 1N27A 3A5ZB 2RHIA 3GLXA 3GP8A 4J83A 2L89A 1G3WA 4JS4A 2MMPA 2RJFA 4IUVA 5KE2A 5CR2A 5CQXA 4QW2A 3UDCA 3OYBA 4FU6A 3GNFB 4LDUA 1UGQB 2LT1A 3CEYA 4HA8A 3QJ6A 2XIDA 2HD0A 4QVZA 3INZA 5LJ3f 4M78G 2QA4A 3CC2A 3VU3C 3LWIA 1X6OA 4M7DA 2VXEA 4J6YA 2EFIA 3LGLA 4X9DA 5LJ5f 2IVWA 4C5EA 3M58A 5FROA 5GAN8 4M7DE 4B9XA 4Q5WA 1KC8C 2QTXA 1W4SA 2CZ7B 1R8OB 2ZZDA 2O4XA 4F7UG 2GFAA 1VQNA 1Y7XA 1XNIA 3ME9A 2EAYA 4BDYA 2GCXA 1I81A 3OQ5A 2E41A 4XTVA 4M75D 1M8VA 1XTDA 2CYZB 4RKUE 4C0DC 4BACA 3CD6T 4EMGA 4A4FA 2K5IA 3RKWA 1KQSS 4LD9K 5I2MA 2KY9A 2MAMA 2MI6A 4J6WA 2Y4XA 2VGNA 2FHDA 4J6XA 4N0AC 3CCEA 3OYHA 4OP0A 1N6AA 3JCMe 2ZPBB 2DKGA 4L6V5 4ZN3A 1K73U 4V2SA 3JCMV 4EDUA 2M9UA 2PVGB 1VQ6A 1VQKA 3JB9F 1G3TA 4HT8A 5KE3A 2JTFA 4OF1A 2DXUA 4D6WA 3CCUT 1JBMA 3JSCA 1Q7YC 4M7AF 4HT9A 3BFMA 2KSSA 1WQ7A 1YHQA 3MP1A 3QBYA 1ZQ1A 4LDWA 3N5BB 5CK9A 1XOVA 2KAFA 4ZN1A 2DTHA 2V8JA 3L1AA 5KCOA 2DD5A 3BW1A 3PIPA 2BIVA 4E7HA 3QPHA 3MHXA 2E12A 4EMHA 1FX7A 2EKOA 4FM4B 3H6ZA 2PQWA 1SSFA 5IAYA 1VQ4A 3X24B 2DD4A 4BDZA 2RJDA 3CCLA 2CZ1B 5GAMh 1M9SA 2P4TA 4E7IA 5CKDA 1IZ6A 4XTXA 3QDRB 4EMKC 2VYTA 4QVDA 1N9SA 4E47A 3S6WA 2RJCA 3QZ5B 3TU4K 4RCBA 3OYYA 3OS2A 4IUUA 4QQDA 5D6YA 3L2ZA 2C06A 2JN0A 1D3BA 3LX7A 3A8LB 4C8QF 2FB7A 1QW1A 2WSFE 2QEXA 1YJNT 1UB4A 2LVMA 4M7DG 2WSEE 4FL6A 1LJOA 1QP3A 3HPWA 4GY5A 1Q86U 4E7KA 2RM4A 4JS5A 4M7DB 2KMTA 3M55A 3HP9A 3OYGA 1G3YA 1M1KC 4LDYA 2RHUA 3PTAA 1LNXA 1WPYA 1OI1A 2RJEA 1U1SA 4NS5A 5GAN7 3CC2T 2YLCA 1X75C 4XU2A 1U1TA 2O4XB 1YBYA 2EQMA 3RESA 4M77A 5J26A 3JCMf 2QDYB 2DXTA 2DVEA 2XHCA 2E1HA 3M9QA 1KD1U 3P8BB 3KXTA 2HAXA 2DK3A 2PVDB 3VUZA 3ZEHA 1XQHA 1FXXA 2H3JA 2OAUA 2WACA 3L2QA 5GANg 2RK1A 4BI8B 1VQNT 3CXCS 3EFSA 1YIJT 3OA6A 1VQ6T 4M77G 3OB9A 1VQKT 3Q1JA 2QI2A 3OBYA 3FJPA 4C0ZA 3JCMW 5FRNA 2L5QA 2EQJA 3G6ET 2RH2A 3LH0A 3LW5E 4R56A 1YHQT 3OYJA 3R6OA 5A0LA 1JJ2A 5HK3A 3NFCA 4JRPA 3J7AF 5GAOq 4MZMA 1K8AU 4KULA 3WVEB 4BE1A 1KHCA 3LGFA 1VQ7T 2RI5A 4C8QE 1LOJA 3CCRT 3KUFA 2XK0A 4BI3A 3CC7T 3SDZA 4WF2A 4M77D 1VQ4T 4JUVA 2K3XA 4A53A 1O9SA 4FT2A 1BKBA 2LQKA 5LJ5d 3E1SA 2ZGWA 2R5MA 1OYXA 4II1A 4MZPA 4BY6C 3CBPA 3RKYA 1VIFA 3CCJT 2CZ6B 1KC8U 2VC8A 2GFUA 3JCMc 4M77C 3PGGA 1JJ2S 4IURA 3G71T 1Q82U 2JTMA 5GMKh 4R55A 1KQSA 1M4ZA 3M5AA 2A7YA 4M78A 2VXFA 3MP6A 5GAMj 1NE8A 4ZGEB 3J80E 1S72T 1VUBA 5GAMd 2RHXA 2AHJB 2RB6A 5GAN6 3V7RA 3OYEA 3QHSA 4C8QC 3A8GB 3RKXA 2XKOC 1JRIA 3RUXA 4ELYC 4GLKA 3CMAT 4C92D 4XTUA 5HK0A 2PUOB 1G3SA 4C5HA 3X26B 4N0AA 2QEXT 5C6SA 3RERA 5KCHA 3HRTA 2XDDA 3I56A 1MHNA 4M77E 3OYCA 3KBGA 4JRKA 3A8HB 1VQOT 2LCLA 4UC4A 4M75E 2JUFA 4M75A 3JCMh 2OTLT 4PNOA 3WXMB 4E7LA 5CAIA 3QKJA 3CCMA 2G3RA 3OMCA 4L59A 2CZ0B 1KG1A 2CKKA 1KQ1A 4JLGA 1K8AC 1DJ7B 4BE2A 1X01A 4MDWA 1VQ7A 2RI2A 4PJOE 2L8DA 3VJPA 1Q81U 3J81E 2K4YA 3JCMQ 3L2RA 5FRMA 4M7AC 4J7FA 1QVGS 3LWHA 5FU7C 4DOVA 1YJ9A 2XI9A 3OW2A 3CCET 2EIFA 1BYMA 4NL3A 1VQMT 5CCAA 3MEUA 4NOYA 3HRSA 4A4EA 4QQGA 3SWNB 2KQWA 3BDLA 1OZ2A 3RIRA 5GMKj 1VQPT 2VUBA 2EYQA 3VYHB 2LX9A 3CCVT 3DKMA 4JLIA 5A0GA 2KK4A 3FC3A 3I55T 3A8MB 3JB9D 1NPRA 2E70A 3RMSA 3P8HA 1M1KU 2M0OA 2YRVA 3O8VA 1W2BA 1JB0E 4M75G 5GAN5 3OYFA 3V8KA 1N8RC 3M4YA 3V7CA 2EQUA 2E6NA 3JCMP 1M1GA 3X28B 3HKSA 4C5GA 4JRIA 4OB1B 4CI0C 3E19A 5GAN3 3META 4J7IA 4C92G 3CPWA 2RI3A 4J5YA 1BIBA 1UGPB 2HQEA 5FLXE 3CPWS 1TH7A 4ZGDB 3JCMJ 4M78D 1B34A 1QP2A 3OYAA 2X4YA 3CCUA 3MP8A 4DOWA 3S3NA 1VQ5T 3TCJA 4F7UF 4PJOF 3QSUA 2EJFA 2ZPFB 3I56T 2B8AA 2CS7A 1WGSA 2E65A 2LNVA 3HRUA 5EG2A 1QVFS 5I21A 2ZPIB 4L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN h;  2YLB A;  2EJ9 A;  3GIB A;  4C92 B;  4M78 E;  4M78 C;  5GAO q;  1N9R A;  3JCM g;  4NL2 A;  2DZC A;  3JB9 G;  3QO3 A;  1LOJ A;  2E10 A;  4C8Q E;  4F7U B;  3QUI A;  4C8Q B;  4F7U E;  2DEQ A;  2DZ9 A;  4MML A;  4M77 D;  4HA8 A;  4WF2 A;  4C92 C;  5LJ3 d;  4M7A G;  3INZ A;  4JUV A;  4M78 G;  5LJ3 f;  3JB9 J;  1WNL A;  3VU3 C;  4A53 A;  4M7D A;  2VXE A;  4J6Y A;  4XU1 A;  5LJ3 h;  4X9D A;  5LJ5 f;  5LJ5 d;  5GAN 8;  2ZGW A;  5GAN j;  5GAO m;  4M7D E;  1I5L A;  2QTX A;  3RKY A;  2Y90 A;  4M7A A;  2VC8 A;  3SWN C;  2YHT A;  4XU3 A;  4M77 C;  3JCM c;  4F7U G;  3PGG A;  3JB9 I;  2RA2 A;  2EAY A;  3JCM d;  4C92 F;  1I81 A;  4XTV A;  2E41 A;  4M75 D;  4XTW A;  1M8V A;  5GMK h;  5GAN d;  1Y96 B;  5GAN f;  4M78 A;  2VXF A;  4EMG A;  5GAM j;  1HK9 A;  3RKW A;  5LJ5 e;  5LJ3 g;  5LJ3 j;  4J6W A;  4XTZ A;  5I21 A;  5GAM d;  2RB6 A;  3EFR A;  4X9C A;  5GAN 6;  4J6X A;  4N0A C;  3V7R A;  3QHS A;  4PJO B;  4MMK A;  4C8Q G;  4OP0 A;  4C8Q C;  4PJO D;  2CGH A;  4QVC A;  3RKX A;  4M7D F;  1JRI A;  3JCM e;  2EJG A;  3RUX A;  2DKG A;  3HFN A;  4V2S A;  3JCM V;  4XTU A;  4C92 D;  4RCC A;  5GAO p;  3M4G A;  4M78 B;  4N0A A;  3AHU A;  3JB9 F;  3RER A;  5GAO n;  4HT8 A;  4XU0 A;  3V8J A;  2DXU A;  4M77 E;  1JBM A;  4JRK A;  3SB2 A;  1M5Q 1;  3BFM A;  5GAM e;  1WQ7 A;  4HT9 A;  4M7A F;  1H64 1;  5GMK i;  3JB9 H;  2DJZ A;  3FIF A;  1BIA A;  4M75 E;  4M75 A;  3JCM h;  4PNO A;  4M75 F;  3JCM b;  2DTH A;  3L1A A;  4A54 A;  3BW1 A;  4M75 C;  4Y91 A;  4C92 E;  4EMK B;  1KQ1 A;  3SWN A;  1B34 B;  4EMH A;  5GMK l;  1D3B B;  1X01 A;  4M77 F;  4PJO E;  2FYK A;  3JCM Q;  5GAM h;  4M7A C;  2I2L A;  1Y96 A;  3BDU A;  4XTX A;  1I4K 1;  4M75 B;  4EMK C;  4QVD A;  4NL3 A;  4C92 A;  1N9S A;  2E64 A;  2DTI A;  4XTY A;  4RCB A;  4NOY A;  4PJO G;  4C8Q D;  3SWN B;  3L2Z A;  2JN0 A;  3RIR A;  1D3B A;  5GMK j;  4C8Q F;  2FB7 A;  5GMK m;  5GAO r;  5DY9 A;  4M7D G;  4PJO A;  3V7S A;  3JCM X;  1KQ2 A;  5LJ5 g;  1YCY A;  1LJO A;  5LJ3 e;  4JLI A;  3BY7 A;  2RM4 A;  2K57 A;  5GMK e;  3JB9 D;  4M78 F;  4M7A D;  4M7D B;  5GAN 2;  3HSB A;  4M7D D;  2DTO A;  4M75 G;  5GAN 5;  1LNX A;  1WPY A;  5GAN 7;  3V8K A;  1U1S A;  3V7C A;  3JCM P;  4M7A E;  2YLC A;  3V8L A;  4XU2 A;  1U1T A;  4M7A B;  3RES A;  4PJO C;  4M77 A;  3JCM f;  4JRI A;  2DXT A;  2DVE A;  5GAN 3;  2E1H A;  5GAO l;  1I8F A;  2RD1 A;  4C92 G;  4DQ2 A;  4M7D C;  4J5Y A;  1BIB A;  5GAN e;  5LJ5 h;  4XQ3 A;  2HNI A;  3FB9 A;  4EMK A;  1TH7 A;  5GAN g;  3JCM J;  1MGQ A;  1B34 A;  4M78 D;  3EFS A;  4F7U A;  4M77 G;  5GAM f;  5GAN 4;  5GAM g;  2EWN A;  4PJO F;  4C8Q A;  4F7U F;  2EJF A;  5LJ5 j;  3QSU A;  3FJP A;  2E65 A;  3JCM W;  1WQW A;  5CAI A;  3HFO A;  4M77 B;  1HXD A; 
#chains in the Genus database with same CATH topology
 3L2W A;  3LYI A;  4KUI A;  4BD3 A;  3GIB A;  5D7U A;  1K73 R;  1N9R A;  1ZUK A;  3FRN A;  5J39 A;  1UUE A;  2P0Q A;  4MML A;  5EC7 A;  1MND A;  1WNL A;  4XU1 A;  3QXE B;  3CXC P;  1TUC A;  3SEM A;  3CCQ A;  3SWN C;  3MEA A;  2YHT A;  2HQH A;  5KYW B;  1PKT A;  3PMI A;  1UJY A;  2CSQ A;  2V1R A;  4K11 A;  4BUG A;  5LJ3 j;  1KHI A;  3EFR A;  4X9C A;  4MMK A;  3CCR A;  3FJ5 A;  2JNG A;  2VGM A;  2GTJ A;  3L2V A;  2X3W D;  1M90 U;  5HCK A;  4E7Z A;  4XU0 A;  2ECZ A;  4X34 A;  2EQI A;  2JJ9 A;  2ROT A;  5D6W A;  1BI1 A;  5KYX A;  3EH2 A;  4M75 C;  2E6Z A;  4FYY B;  5GMK l;  4GBQ A;  5IHN A;  1GCQ C;  2DXB A;  2SEM A;  2MWP A;  3F70 A;  1I4K 1;  1VQ5 A;  1UTI A;  2FZC B;  3DLM A;  4C92 A;  3CCU Q;  4C8Q D;  3QII A;  1ZBX A;  2H3E B;  1N8R U;  5KYY A;  3MKD A;  1V29 B;  2O31 A;  1AOJ A;  1UEC A;  2RK2 A;  2X4J A;  2DL5 A;  3CPW P;  1AHJ B;  1G2B A;  1UG1 A;  4VUB A;  3VS1 A;  3HL8 A;  2RD1 A;  4DQ2 A;  4OMF B;  3R6N A;  3FB9 A;  4OB0 B;  5L23 A;  2A08 A;  1MGQ A;  1HYO A;  4C5I A;  4M7A D;  4OB2 B;  2A37 A;  4M77 B;  5GAN h;  4QQ6 A;  3CCM T;  3JCM g;  1R77 A;  2E5Q A;  1RAH B;  3REA B;  3JB9 G;  5C0M A;  2P0P A;  4ZTF A;  3OS0 A;  5I11 A;  2VVK A;  4C0G A;  5LJ3 d;  4HCK A;  2QG9 B;  1VQN Q;  2KDS A;  2YUP A;  1M8M A;  1OPL A;  3CMA Q;  4ANJ A;  3CCV A;  3OYL A;  1YJN A;  1UGV A;  1OU9 A;  4O6J A;  1TUD A;  2X4X A;  2DAQ A;  4IUP A;  4XTZ A;  2F5K A;  4JJN K;  3VYG A;  4QVC A;  4A4K A;  2EJG A;  4HKE A;  3HFN A;  3M53 A;  4HVW A;  5DLQ E;  2KRM A;  2HBP A;  3PMT A;  1I5O B;  1YIJ A;  1QQJ A;  2PVO B;  4LDX A;  1M5Q 1;  4PJJ A;  2A36 A;  5GMK i;  2DJZ A;  1GFD A;  1BIA A;  1OV3 A;  1YIT A;  4A4G A;  2J06 A;  3JCM b;  2CH4 A;  4A4H A;  2QQ9 A;  1KK7 A;  2X35 A;  1YJW A;  1JEG A;  2LQ8 A;  2FG0 A;  2I2L A;  9ATC B;  1VA7 A;  1VQL T;  1IHW A;  2D9T A;  2E64 A;  2W0Z A;  1LVK A;  2RHY A;  1K8A R;  2OTJ T;  4PJO G;  4J8O A;  4P5N A;  2DYB A;  2O2O A;  2ZPH B;  4ORZ A;  3RDV A;  3RMQ A;  5GAO r;  4FCY A;  3CPF A;  3OYI A;  2P84 A;  5LJ3 e;  3EGU A;  2MF2 A;  2K57 A;  2QGG A;  1Y07 A;  4RTZ A;  1T3S A;  2DTO A;  2V8I A;  3CC7 A;  2CP5 A;  1W2B S;  3V8L A;  2FEI A;  1WHJ A;  3EFO A;  2DXC A;  3GOX A;  3S3M A;  3M59 A;  4XQ3 A;  2KT1 A;  2JOY A;  2QQR A;  5IHK A;  5GAM f;  3QJY A;  3NGP A;  4ZNX A;  2EW3 A;  1Q86 R;  1N27 A;  3A5Z B;  4J83 A;  3VS6 A;  1UDL A;  2MMP A;  1JXM A;  4IUV A;  5CQX A;  4KRT A;  2OTL Q;  2LCS A;  3J81 E;  2HCK A;  3CEY A;  4HA8 A;  2QA4 A;  2DL3 A;  3CC2 A;  3INZ A;  2LZ6 B;  2K79 A;  1YP5 A;  4J6Y A;  4X9D A;  4C5E A;  2QDL A;  4B9X A;  1KC8 C;  1W4S A;  2CZ7 B;  1GCQ A;  4RUG A;  2AT1 B;  1KIK A;  3ME9 A;  2EAY A;  1FYN A;  1QVG P;  2GCX A;  2E41 A;  1U06 A;  1M8V A;  4C0D C;  4BAC A;  3CD6 T;  4EMG A;  1TTH B;  1KQS S;  5I2M A;  1IGU A;  2MI6 A;  2G6F X;  2VGN A;  3OYH A;  4L6V 5;  2CSI A;  1UFF A;  3CCS Q;  3UF4 A;  1A0N B;  3CCU T;  2KSS A;  3H0H A;  2DRM A;  1QLY A;  2C0T A;  2RNA A;  2KAF A;  2YUN A;  4ZN1 A;  4JS5 A;  5GJW B;  3L1A A;  3BW1 A;  2BIV A;  4LN2 A;  4EMH A;  3VS7 A;  3H6Z A;  2PQW A;  1SSF A;  4BDZ A;  2KRS A;  4IIM A;  4QVD A;  1N9S A;  1D0Z A;  3OYY A;  5D6Y A;  2M51 A;  4M7D G;  2LVM A;  2WSE E;  1IRX A;  3EG1 A;  1SHG A;  1G3Y A;  4LDY A;  3PTA A;  1LNX A;  2RJE A;  4NS5 A;  4J9F A;  1X75 C;  1YBY A;  4M77 A;  1RAC B;  1X27 A;  1D0X A;  3ZEH A;  2HMA A;  2H3J A;  2KRN A;  2OAU A;  2EGA A;  1JO8 A;  5GAN g;  2RK1 A;  4BI8 B;  1YIJ T;  3EFS A;  1VQ6 T;  3OA6 A;  3Q1J A;  2CH4 W;  1QMC A;  1S1N A;  3EGD B;  3PE0 A;  4C0Z A;  2KT8 A;  2L5Q A;  2E3I A;  2RH2 A;  3LH0 A;  3LW5 E;  4R56 A;  1V76 A;  2YUO A;  2HKQ B;  5HK3 A;  4OML A;  1N5Z A;  1K8A U;  4WCI A;  3KUF A;  3CCQ Q;  4WF2 A;  4M77 D;  3M0T A;  2K3X A;  1MUZ A;  1HJD A;  2A28 A;  5LJ5 d;  2R5M A;  4MZP A;  3RKY A;  1YHQ Q;  1VIF A;  2BTT A;  3CCJ T;  2LX7 A;  3M0S A;  3EHQ A;  4IUR A;  2YT6 A;  3CCR Q;  2A7Y A;  3MP6 A;  1NE8 A;  1S72 T;  5GAM d;  1M3B A;  2KEA A;  1EFN A;  2RB6 A;  2L3P A;  2PTK A;  1Q7Y R;  2IPO B;  3RKX A;  4GLK A;  4C92 D;  5HK0 A;  2PUO B;  4C5H A;  4N0A A;  5C6S A;  3I56 A;  3CQT A;  4M77 E;  3OYC A;  1VQM Q;  2RQR A;  3A8H B;  8ATC B;  2OTJ Q;  4M75 E;  3QKJ A;  3OMC A;  4L59 A;  2CZ0 B;  1KG1 A;  4JLG A;  1K8A C;  4BE2 A;  2K6D A;  2NUP B;  4F17 A;  2RN8 A;  1Q81 U;  4J9B A;  4M7A C;  1QVG S;  5FU7 C;  2KI7 A;  3CCE T;  1C1A A;  1GBQ A;  1OQK A;  4D8K A;  1OZ2 A;  3RIR A;  2EYQ A;  3VYH B;  2LX9 A;  3DKM A;  3E2U A;  2RQU A;  3I55 T;  3JB9 D;  1ZUY A;  1NJI R;  1RAE B;  2YRV A;  3O8V A;  1I0C A;  1BU1 A;  1N8R C;  1RAI B;  1SF9 A;  3X28 B;  1K4U S;  4C92 G;  1D0Y A;  1KJW A;  1TH7 A;  1SRM A;  3CCU A;  4DOW A;  3TCJ A;  3TSW A;  4PJO F;  4D8D A;  2ZPF B;  2B8A A;  2CS7 A;  1WGS A;  2LNV A;  1QVF S;  5CAI A;  2ZPI B;  4EPC A;  3HHT B;  1GRI A;  2W10 A;  4BI4 A;  4KBM B;  3UPU A;  4C92 B;  4MZT A;  1NJI U;  2IIM A;  2AKL A;  4JJB A;  1PSE A;  4NL2 A;  4RTT A;  3QO3 A;  3CCL T;  1FWZ A;  2BUD A;  3E9G A;  2HL5 C;  1Q81 C;  4XK8 E;  1SSH A;  5LJ3 h;  2JXB A;  2DEU A;  3I56 Q;  2QXF A;  3TRE A;  1VQM A;  1BI2 A;  2JZ2 A;  2OTJ A;  3MEV A;  1WX6 A;  4TVR A;  2F2W A;  2K3B A;  3JCM d;  2RF0 A;  5CVI A;  1VOM A;  5GAN d;  2DL8 A;  1NM7 A;  3H0F A;  2EYY A;  1PD1 A;  2DIQ A;  1HK9 A;  2K3Y A;  1D1B A;  1OEB A;  1BCM A;  2PU9 B;  5DLO A;  1K73 C;  5FWC A;  1UGR B;  5A0D A;  1K9M R;  4EIK A;  3H41 A;  1YIT Q;  3AHU A;  5LL6 S;  3C95 A;  2K5L A;  1OUL A;  3SB2 A;  3OMG A;  2ZPG B;  5AYF A;  1P92 A;  2COZ A;  4ZTJ A;  1QVP A;  2COY A;  2PUK B;  3UA6 A;  4O5V A;  4C92 E;  2D1X A;  2KXD A;  3VV0 A;  4JPB W;  4PFZ A;  2FYK A;  2ZPE B;  3FDR A;  2CUB A;  3M0P A;  2CP7 A;  4Y92 A;  2J7I A;  2L2P A;  4XTY A;  4N4I A;  1VQ8 Q;  1ZX6 A;  4J9G A;  3JCM X;  1YIJ Q;  1YCY A;  3BY7 A;  8AT1 B;  4KGX B;  5GAN 2;  1UEB A;  3OYM A;  4JJD A;  2EBP A;  1K0X A;  4OMN A;  3CD6 Q;  2LTO A;  4B6M A;  5GAN e;  1E7O A;  3CC4 A;  2KVQ G;  2DO3 A;  3M54 A;  4C0F A;  2XD0 A;  2HSE B;  1ABQ A;  5D6X A;  1RLP C;  3A8O B;  1YIT T;  3CC2 Q;  2QTV A;  4HVU A;  1KQS P;  2YSQ A;  4ATO A;  1UJ0 A;  4F7U E;  2DEQ A;  1Q7Y U;  4C92 C;  4ZGJ B;  1PM3 A;  2YUQ A;  3EG2 A;  1VIE A;  1TG0 A;  4M7A A;  3JB9 I;  4C92 F;  5DM7 R;  3C0C A;  3M0Q A;  1Y96 B;  1CKA A;  3G7Z A;  1YFN A;  5M9O A;  1VQ8 T;  1X6B A;  1IHV A;  1PHT A;  2KE9 A;  3CCS A;  3URG A;  4LD6 A;  4OVA A;  2CGH A;  4OGE A;  4M7D F;  2ROL A;  3CBO A;  2QA4 Q;  3QYH B;  3ER0 A;  4M78 B;  2JM9 A;  3QZ9 B;  4PJN A;  4CRI A;  3WVD B;  3G6E A;  4MDX A;  2LC4 A;  1UGS B;  3S3O A;  3UAT A;  4N4H A;  4PLL A;  1V1C A;  3EH1 A;  3CD6 A;  1NPP A;  1QVG A;  3E9F A;  4PLI A;  3VS5 A;  3RBB B;  3CC4 Q;  2EGC A;  3BDU A;  2DX1 A;  4M75 B;  4FIB A;  3CCQ T;  1PSF A;  2E4H A;  2DYI A;  4XAX B;  3DB4 A;  1N8R R;  3PNW C;  3EG0 A;  4JZ3 A;  2XMF A;  5DY9 A;  3V7S A;  4DBQ A;  2CP6 A;  1KD1 C;  3HSB A;  2HQX A;  2J6O A;  3A1P A;  3ZBD A;  2BZY A;  4JZ4 A;  3U23 A;  2AZS A;  1PCX A;  3SFM A;  3CCL Q;  3JV3 A;  3H8Z A;  1HSQ A;  2CP3 A;  2A3L A;  1QVF A;  4PK4 A;  1TWB A;  2EWN A;  1W2B P;  2GQV A;  1WQW A;  2BZX A;  2F5T X;  2FZK B;  1KFZ A;  2K2M A;  1MMA A;  4JS4 A;  2RJF A;  4OMM A;  1JQQ A;  4QW2 A;  3GNF B;  1BK2 A;  1UGQ B;  2LT1 A;  5LJ3 f;  4F16 A;  4LE9 A;  3VU3 C;  4M7D A;  1X6O A;  2IVW A;  3EGX B;  2ZZD A;  1WZO A;  2ED1 A;  2LJ3 A;  1Y7X A;  2L0A A;  4Z88 A;  1I81 A;  4XTV A;  3VS0 A;  4LD9 K;  2EYZ A;  4QKU A;  2Y4X A;  2FHD A;  4OP0 A;  1N6A A;  3LH5 A;  2DKG A;  1K73 U;  4V2S A;  2M9U A;  1YWP A;  3PVL A;  2B86 A;  2JTF A;  2DXU A;  2ABL A;  3EG3 A;  1JBM A;  3JSC A;  1YHQ A;  1C0M A;  3MP1 A;  1ZQ1 A;  2J6F A;  4E7H A;  5KCO A;  4LXC A;  3QPH A;  2E12 A;  1FX7 A;  5IAY A;  2HL3 A;  3CCL A;  4DBF A;  3REB B;  2BZ8 A;  5CKD A;  3QDR B;  2VYT A;  2RJC A;  3QZ5 B;  1TOV A;  4RCB A;  1GBR A;  1D3B A;  2FB7 A;  1Q86 U;  1LJO A;  2COW A;  3HPW A;  4GY5 A;  1ACM B;  1VYV A;  1HD3 A;  2KMT A;  5IHI A;  3OYG A;  4HVV A;  3EG9 A;  1H8K A;  5GAN 7;  1U1T A;  5J26 A;  2QDY B;  2E1H A;  3P8B B;  3KXT A;  2PVD B;  3VUZ A;  2X9H A;  1FXX A;  2FPE A;  1BCO A;  2QAZ A;  2I0N A;  3OB9 A;  1PG5 B;  3G6E T;  1QWE A;  2EQJ A;  1YHQ T;  3R6O A;  1JJ2 A;  6AT1 B;  2GGR A;  3NFC A;  4J9H A;  5GAO q;  3G71 Q;  4AG1 C;  4R0K A;  3WVE B;  1KHC A;  2X3X D;  1KC8 R;  3CC7 T;  3SDZ A;  4KGZ B;  1W70 A;  4GLM A;  1VQ6 Q;  1O9S A;  2AZV A;  4FW1 A;  2LJ0 A;  1NYG A;  2KNB B;  2ZGW A;  3E1S A;  1OYX A;  4BY6 C;  1RUW A;  3CBP A;  2CZ6 B;  2GFU A;  1IO6 A;  3PGG A;  3QWX X;  5GMK h;  4R55 A;  1KQS A;  4M78 A;  1Q95 G;  1VUB A;  3V7R A;  1I07 A;  3RUX A;  4ELY C;  3CMA T;  4LUD A;  2JS2 A;  1NLP C;  1M3A A;  2KXC A;  3CCE Q;  3O5Z A;  2XDD A;  4JJC A;  1MHN A;  2O9S A;  1VQO T;  1ZSG A;  1B07 A;  1SRL A;  2JUF A;  1VQK Q;  2VB6 A;  3CCM A;  1M90 R;  4PJO E;  2L8D A;  1G8X A;  2EIF A;  1BYM A;  1ZBJ A;  1MMN A;  5CCA A;  3TQ7 P;  4NOY A;  1T0H A;  1XJW B;  3HRS A;  4QQG A;  2KQW A;  2DMO A;  4JLI A;  3RMS A;  1M1K U;  4OMO A;  2GBQ A;  1M2V B;  1JB0 E;  2CP0 A;  1SG5 A;  3V8K A;  3M4Y A;  3JCM P;  2EQU A;  2E6N A;  2NUT A;  5FWB A;  4J9I A;  4CI0 C;  2DBK A;  4J7I A;  3CPW A;  4J5Y A;  1BIB A;  1QCO A;  1UGP B;  3JCM J;  1I1J A;  1B34 A;  4J9D A;  3NMZ C;  4F7U F;  2EJF A;  2E65 A;  2HZY A;  1VQO A;  3G4S A;  3ZFJ A;  2YLB A;  2NYS A;  4M78 C;  1VQ9 T;  2JW4 A;  4F7U B;  2E10 A;  2E5K A;  2YWW A;  4C8Q B;  5KYY B;  2D0Q B;  3CMA A;  3QG1 A;  1YI2 A;  1M3C A;  1YJW T;  3C4S A;  1C6V X;  1TSF A;  1YJN Q;  1Y57 A;  3OS1 A;  4AG2 C;  4XU3 A;  3MCA B;  1BB9 A;  4XTW A;  2DVJ A;  4FSS A;  7AT1 B;  4RMO A;  2JVV A;  3QWY A;  2VKN A;  1H3Z A;  4KUD K;  3OS5 A;  3FEO A;  4OMP A;  1TXQ A;  2A0F B;  1AT1 B;  1T3L A;  1JU5 C;  4RCC A;  5GAO p;  1FMK A;  1WA7 A;  2VWF A;  4J9E A;  1MV0 B;  5GAO n;  4M4Z A;  2F69 A;  4KT0 E;  3FIF A;  2DIG A;  1OU8 A;  1RI0 A;  2XG8 D;  3LLR A;  3TEE A;  4Y91 A;  2X4W A;  3I9Q A;  3L42 A;  1VQ9 A;  2XDB A;  5FU6 C;  4ELZ C;  3PVQ A;  3OYK A;  1CKB A;  1RAG B;  2ENM A;  4JDS A;  1Y96 A;  3CCS T;  1SEM A;  4FT4 A;  5IN1 A;  3FLG A;  2RHZ A;  4PJO A;  1B3Q A;  2GF7 A;  1GL5 A;  1KQ2 A;  2FL7 A;  5I22 A;  5GMK e;  2EVR A;  3UWN A;  4FSX A;  3G6E Q;  1Y71 A;  2EGE A;  1ZLM A;  2D6F A;  1YI2 Q;  1TS9 A;  2K5F A;  4PJO C;  3C12 A;  3DB3 A;  2HKN A;  2KYB A;  1O75 A;  2VV5 A;  3OY9 A;  2GNC A;  4PJM A;  3CME T;  2HNI A;  4JRQ A;  3OSV A;  1RI9 A;  2F2X A;  1Z9Z A;  2DL7 A;  3JAM E;  2R5A A;  5GAN 4;  4PJL A;  5A2Q E;  1E6G A;  2IG0 A;  2DPP B;  2OTL A;  1VQP A;  2JTE A;  2EJ9 A;  4FYW B;  4RTY A;  4M78 E;  1WHH A;  1MNE A;  2LDM A;  5FU7 B;  3I5S A;  5IH2 A;  3QUI A;  5HKC A;  4B9W A;  3H0I A;  3EHR A;  2RQT A;  4Y28 E;  4RG2 A;  4AFQ C;  3MPU B;  3OYD A;  2J05 A;  3I55 A;  5GAN f;  1K9M C;  1NG2 A;  2M16 A;  1LPL A;  5LJ5 e;  5J3B A;  1RL2 A;  4AFZ C;  3MO8 A;  3VUB A;  1YI2 T;  1WJQ A;  3CC4 T;  2KGT A;  3M4G A;  2MCN A;  1QKX A;  3V8J A;  3ASK A;  3IQL A;  5GAM e;  1H64 1;  3G4S T;  2MIO A;  5HY6 A;  1S72 Q;  4RTU A;  4J9C A;  5GJV B;  3C94 A;  4A54 A;  1G5V A;  2OJ2 A;  3SWN A;  4Z8A A;  3GPL A;  1NLO C;  1BBZ A;  4M77 F;  1WXT A;  2DM1 A;  2R57 A;  3TVT A;  2DA9 A;  1ZUU A;  1NBE B;  2DTI A;  3CBM A;  3CXC A;  5CO7 A;  1G83 A;  4OMQ A;  1EIF A;  3GNG A;  1ZHI A;  3BE3 A;  1WHK A;  2WSC E;  1VYU A;  3MEW A;  3NPF A;  4M7A E;  3OYN A;  4M7A B;  4BE0 A;  5CQY A;  5GAO l;  1NYF A;  2DNU A;  4OB3 B;  4M7D C;  3UA7 A;  3CCJ A;  2LCC A;  1IRE B;  2LMJ A;  4PL6 A;  4F7U A;  5GAM g;  4C8Q A;  3I55 Q;  5LJ5 j;  1GXI E;  2EQK A;  2QQB A;  2RA2 A;  2RHI A;  3GLX A;  3GP8 A;  4CC7 A;  2L89 A;  1PC0 A;  1T0J A;  5KE2 A;  3UDC A;  3OYB A;  2XID A;  2VXE A;  5GAN 8;  3M58 A;  5FRO A;  4M7D E;  4KGV B;  2O4X A;  1YNZ A;  3VRZ A;  2NWM A;  3OQ5 A;  3VRY A;  4RKU E;  1AEY A;  2K5I A;  4J6W A;  2KYM A;  1KSW A;  3CCE A;  4J6X A;  2O88 A;  3JCM e;  2ZPB B;  2F2V A;  5KYX B;  1MMD A;  3VS2 A;  4ZN3 A;  3JCM V;  1VQ6 A;  1VQK A;  4HT8 A;  5KE3 A;  4OF1 A;  1D1A A;  4D6W A;  2QGF B;  4M7A F;  4HT9 A;  3BFM A;  1WLP B;  1QCF A;  2DTH A;  3PIP A;  2DD5 A;  2MK5 A;  3MHX A;  2EKO A;  2CRE A;  1M2O A;  2DD4 A;  3X24 B;  1IXD A;  5GAM h;  1M9S A;  3CCJ Q;  2P4T A;  4XTX A;  2ZAE A;  1ZSZ B;  4E47 A;  3TU4 K;  2KR3 A;  4IUU A;  4QQD A;  1YJW Q;  2JN0 A;  3LX7 A;  4C8Q F;  1QW1 A;  1YJN T;  1UB4 A;  2DET A;  1JJ2 P;  4E7K A;  1ZSZ C;  1PRL C;  2FPD A;  3HP9 A;  4X1V A;  4DBH A;  1OX9 A;  1M1K C;  3D7S B;  1X2Q A;  1PWT A;  1U1S A;  2YLC A;  4XU2 A;  4CC2 A;  2O4X B;  3RES A;  3JCM f;  2DXT A;  1PKS A;  2XHC A;  3ZL7 C;  2WAC A;  3L2Q A;  1VQN T;  1B7T A;  3CXC S;  4M77 G;  1K0S A;  3OBY A;  3FJP A;  3JCM W;  5FRN A;  2M0Y A;  2LQN A;  2SRC A;  1PNJ A;  3J7A F;  3HTR A;  1RAA B;  4BE1 A;  3LGF A;  2RI5 A;  3VS3 A;  4C8Q E;  2L3Q A;  1VQ4 T;  4JUV A;  4A53 A;  4FT2 A;  1BKB A;  2LQK A;  1IB8 A;  4II1 A;  3I5R A;  2O9V A;  3JCM c;  4M77 C;  2GQI A;  1JJ2 S;  4E7S A;  3G71 T;  2BE9 B;  4RTX A;  1LCK A;  2JTM A;  1H92 A;  3M5A A;  1VQO Q;  2CT3 A;  5GAM j;  4ZGE B;  4A63 B;  1ABO A;  2AHJ B;  5AT1 B;  2Z0W A;  4C8Q C;  2XKO C;  1JRI A;  2MYS A;  2C0O A;  1G3S A;  3X26 B;  2QEX T;  5KCH A;  3HRT A;  4KH1 B;  3EG9 B;  3KBG A;  4JRK A;  1Q81 R;  1AWJ A;  5ECA A;  4M75 A;  3JCM h;  3WXM B;  2RMO A;  1KQ1 A;  2D0N A;  1VQ7 A;  2EPD A;  5IXF A;  3VJP A;  2K4Y A;  3ULR B;  3JCM Q;  2DL4 A;  4DOV A;  1YJ9 A;  2XI9 A;  3OW2 A;  2MOX A;  4NL3 A;  1X2K A;  4A4E A;  3BDL A;  1W6X A;  2AIR B;  1VQP T;  1FMW A;  1AWO A;  2ESW A;  3EFO B;  4CC4 B;  2KK4 A;  3A8M B;  1WHM A;  2E70 A;  2M0O A;  1W2B A;  1QVF P;  4C5G A;  1VQ9 Q;  4JRI A;  4OB1 B;  2LJ1 A;  2RI3 A;  2MPX C;  5FLX E;  3TSZ A;  1OPK A;  1QP2 A;  1R0B G;  2X4Y A;  1VQ5 T;  3QSU A;  3HRU A;  1X43 A;  5I21 A;  4L5G A;  1GCP A;  1E6H A;  1M27 C;  2YDL A;  1U8R A;  1EZZ B;  4F14 A;  1K1Z A;  3EGX A;  4HXJ A;  4QT7 A;  4AT1 B;  4ME7 A;  5CIU A;  2QAS A;  4N4G A;  2BKD N;  2DZ9 A;  3P8D A;  2XDP A;  3VKI A;  3JB9 J;  1OZ3 A;  3UT1 A;  4LDV A;  4FYX B;  2LT4 A;  1I5L A;  2QQS A;  1RLQ C;  3OW2 P;  4IKF A;  3RR6 A;  1SKU B;  5KH6 A;  2NUP A;  1Q82 C;  2H8H A;  5KYU B;  2CP2 A;  2HDA A;  2QK0 A;  4BY6 B;  2RPN A;  2FVU A;  5CKE A;  3OBW A;  2R58 A;  2E3H A;  2NLU A;  1AVZ C;  1YJ9 Q;  4HCB A;  3A98 A;  4PJO D;  3X20 B;  3JRZ A;  3M56 A;  2K2V A;  1NJI C;  1M90 C;  2JT4 A;  1H3H A;  3JB9 H;  4OGC A;  1D1C A;  3M57 A;  4RTW A;  1OX8 A;  1MMG A;  2LRQ A;  2YXY A;  2EKH A;  1B34 B;  1D3B B;  1R0C B;  4HCZ A;  1J3T A;  2L3R A;  4CC3 A;  3OW2 S;  3PFS A;  1WHG A;  1U3O A;  1YCS B;  4M78 F;  2MWO A;  1WI7 A;  2KBT A;  2PZ1 A;  1S72 A;  1X69 A;  1ZA2 B;  1ZSZ A;  4E7J A;  3NTH A;  3EGD A;  2QA4 T;  4LNP A;  5FU6 B;  2LNH B;  1AWW A;  4C0D B;  2DER A;  4E2F B;  5LJ5 h;  2DIL A;  4EMK A;  2DE0 X;  2YRC A;  1YJ9 T;  2V1Q A;  1VQL A;  4F04 B;  2CUD A;  1UHC A;  3NTK A;  3NTI A;  5CKF A;  2FRY A;  2M1H A;  2FRW A;  2L3S A;  2LQW A;  5CKB A;  1NEG A;  2DZC A;  2FPF A;  2GTO A;  3DLL A;  2JM8 A;  4PFO A;  3M0R A;  2DBM A;  1AZG B;  2FO0 A;  4E6R A;  1KD1 R;  4M7A G;  1YN8 A;  1OOT A;  1WJR A;  2JMC A;  3M0U A;  5IT9 E;  2Y4Y A;  5GAN j;  5GAO m;  1NZ9 A;  4IIO A;  2Y90 A;  1GFC A;  1WIE A;  3QYG B;  1K9M U;  4DA4 A;  3X25 B;  3GF5 A;  2QQA A;  2O01 E;  2P0K A;  3PT9 A;  5LJ3 g;  3L2U A;  2V26 A;  1AWX A;  2K9G A;  4PJO B;  4C8Q G;  1IGQ A;  4Z02 A;  5CKH A;  4HCC A;  4AMC A;  2D8H A;  1PD0 A;  2DJQ A;  1U5S A;  1TU0 B;  1BI3 A;  2XIC A;  1BI0 A;  2XU8 A;  4RTV A;  4BB7 A;  1WJS A;  4M75 F;  4EMK B;  2BE7 D;  2ZCF B;  3SD4 A;  3MJX A;  3CME A;  1M1F A;  3OSS C;  3G1J A;  2C0I A;  1Q86 C;  1W1F A;  3H9N A;  1M2V A;  3THK A;  2NUT B;  4RG8 A;  3PIO A;  5I2S A;  5GMK m;  5LJ5 g;  1VQ5 Q;  4PKC C;  4YTL A;  4M7D D;  2YRD A;  2LP5 A;  1VQ8 A;  4WTO B;  1RAF B;  2V8K A;  1I8F A;  3KFV A;  1D09 B;  2RO0 A;  4IUQ A;  2HBW A;  3RNJ A;  4IUT A;  2AK5 A;  3EAE A;  3CCV Q;  3G71 A;  1RAB B;  2NUZ A;  3T9N A;  5FW9 A;  5L8R E;  1WHL A;  3HFO A;  4AFU C;  2QEX Q;  2J6K A;  2JMA A;  4ESR A;  2F1L A;  1MV3 A;  1G3W A;  5CR2 A;  1RAD B;  4FU6 A;  4LDU A;  5KYU A;  3QJ6 A;  2EYW A;  2HD0 A;  4QVZ A;  1Q82 R;  4M78 G;  2FZG B;  3LWI A;  2EFI A;  1NEB A;  2D8J A;  3GBQ A;  3LGL A;  1VYT A;  5LJ5 f;  1AZE A;  4Q5W A;  2QTX A;  1R8O B;  1QWF A;  1CSK A;  4F7U G;  2GFA A;  1VQN A;  1XNI A;  1X6G A;  4BDY A;  1WXB A;  4DBR A;  4M75 D;  1XTD A;  2CYZ B;  2JS0 A;  4A4F A;  3RKW A;  1K76 A;  2KY9 A;  2MAM A;  3CME Q;  1FMV A;  4N0A C;  1K9A A;  5KYW A;  4EDU A;  1JXO A;  2DLP A;  2PVG B;  3JB9 F;  1G3T A;  4PFP A;  3CCM Q;  1Q7Y C;  1WQ7 A;  2DF6 A;  3QBY A;  1VQ7 Q;  3CC7 Q;  4LDW A;  3N5B B;  1UHF A;  5CK9 A;  1XOV A;  2V8J A;  4FM4 B;  4DEY A;  2DFU A;  1VQ4 A;  4AFS C;  2RJD A;  2CZ1 B;  4E7I A;  1IZ6 A;  3VS4 A;  2QYZ A;  3SHW A;  4EMK C;  1ZA1 B;  1Y0M A;  1UE9 A;  3S6W A;  2RQV A;  1Z9Q A;  2DRK A;  3OS2 A;  2C06 A;  3L2Z A;  2QEX A;  3A8L B;  2WSF E;  2OI3 A;  4FL6 A;  1QP3 A;  1WXU A;  2RM4 A;  4M7D B;  3M55 A;  2RHU A;  1WPY A;  2PNI A;  1OI1 A;  1M30 A;  3CC2 T;  2EQM A;  2HEQ A;  1QCN A;  1YWO A;  2DVE A;  3M9Q A;  1KD1 U;  2HAX A;  2DK3 A;  2CT4 A;  2KRO A;  1XQH A;  1AD5 A;  3G4S Q;  4DEX A;  4LUE A;  2M02 A;  1VQK T;  2QI2 A;  1WDX A;  3OYJ A;  5A0L A;  2EYX A;  1F1B B;  4JRP A;  3QDF A;  4MZM A;  4KUL A;  1VQ7 T;  1LOJ A;  2CDT A;  3CCR T;  2XK0 A;  4BI3 A;  2ATC B;  1M1K R;  1EX4 A;  2RQW A;  1ARK A;  1KC8 U;  2OAW A;  2VC8 A;  1Q82 U;  1TUG B;  1M4Z A;  2VAS A;  2VXF A;  1VQ4 Q;  3J80 E;  2RHX A;  5GAN 6;  3OYE A;  3QHS A;  3A8G B;  2K7A A;  3NHN A;  4XTU A;  4FW2 A;  5KYN A;  3RER A;  2P4R A;  2LCL A;  4UC4 A;  2OTL T;  4PNO A;  2HSP A;  4E7L A;  2ED0 A;  2G3R A;  5IXB A;  1QKW A;  2CKK A;  1DJ7 B;  1X01 A;  4MDW A;  2RI2 A;  3L2R A;  2OX7 A;  5FRM A;  4J7F A;  1WFW A;  3LWH A;  4Z89 A;  1VQM T;  2AKK A;  3MEU A;  1SHF A;  3SWN B;  5GMK j;  2VUB A;  1WYX A;  3CCV T;  5A0G A;  3FC3 A;  3I35 A;  1NPR A;  4KH0 B;  3P8H A;  4M75 G;  4FYV B;  5GAN 5;  3OYF A;  3V7C A;  1M1G A;  3HKS A;  1VQL Q;  3E19 A;  5GAN 3;  3MET A;  3AT1 B;  2HQE A;  1VQP Q;  3CPW S;  4ZGD B;  1SPK A;  4M78 D;  3OYA A;  1PRM C;  2X51 A;  3MP8 A;  3S3N A;  3I56 T;  5EG2 A;  1HXD A; 
#chains in the Genus database with same CATH homology
 4EPC A;  1VQO A;  3HHT B;  3ZFJ A;  3L2W A;  2YLB A;  3LYI A;  4KBM B;  4KUI A;  4BD3 A;  4BI4 A;  4C92 B;  3UPU A;  4MZT A;  1U8R A;  3GIB A;  4M78 C;  1NJI U;  1N9R A;  4NL2 A;  1PSE A;  3FRN A;  5J39 A;  1VQ9 T;  4ME7 A;  5CIU A;  3QO3 A;  2E10 A;  4F7U B;  3CCL T;  4N4G A;  2BKD N;  4C8Q B;  1FWZ A;  2D0Q B;  3CMA A;  3QG1 A;  1YI2 A;  2DZ9 A;  2BUD A;  2P0Q A;  3P8D A;  2XDP A;  4MML A;  3E9G A;  3VKI A;  3JB9 J;  1YJW T;  1Q81 C;  4XK8 E;  1WNL A;  3C4S A;  1OZ3 A;  3UT1 A;  4XU1 A;  4LDV A;  5LJ3 h;  3QXE B;  2QXF A;  2LT4 A;  3TRE A;  1VQM A;  1BI2 A;  2QQS A;  3OS1 A;  3CCQ A;  1I5L A;  4IKF A;  2JZ2 A;  2OTJ A;  3SWN C;  3MEA A;  2YHT A;  3MEV A;  4XU3 A;  5KH6 A;  4TVR A;  1Q82 C;  3JCM d;  3MCA B;  3PMI A;  5CVI A;  4XTW A;  5GAN d;  4BY6 B;  2FVU A;  4RMO A;  2DIQ A;  5CKE A;  2JVV A;  1HK9 A;  3G4S A;  2K3Y A;  4BUG A;  1H3Z A;  3OBW A;  5LJ3 j;  2R58 A;  4KUD K;  3OS5 A;  3FEO A;  1KHI A;  2NLU A;  2PU9 B;  3EFR A;  4X9C A;  5DLO A;  4HCB A;  4MMK A;  4PJO D;  1K73 C;  3CCR A;  3X20 B;  1UGR B;  5A0D A;  3JRZ A;  2JNG A;  2VGM A;  3L2V A;  4RCC A;  5GAO p;  3M56 A;  1M90 U;  3AHU A;  5GAO n;  2K2V A;  1NJI C;  5LL6 S;  1M90 C;  4XU0 A;  3C95 A;  2K5L A;  4X34 A;  3SB2 A;  3OMG A;  5D6W A;  2ZPG B;  2F69 A;  5AYF A;  3JB9 H;  4KT0 E;  1P92 A;  3FIF A;  1BI1 A;  4OGC A;  1QVP A;  2DIG A;  1RI0 A;  2PUK B;  2XG8 D;  4ZTJ A;  3M57 A;  4O5V A;  3LLR A;  4M75 C;  2E6Z A;  3TEE A;  4Y91 A;  4C92 E;  2LRQ A;  1B34 B;  2X4W A;  3L42 A;  5GMK l;  1VQ9 A;  1D3B B;  5FU6 C;  4ELZ C;  3VV0 A;  2XDB A;  3OYK A;  2FYK A;  4HCZ A;  2ZPE B;  2DXB A;  3FDR A;  2L3R A;  2MWP A;  4JDS A;  1Y96 A;  3F70 A;  3CCS T;  1I4K 1;  1VQ5 A;  3DLM A;  4C92 A;  4FT4 A;  3OW2 S;  4XTY A;  5IN1 A;  3FLG A;  4C8Q D;  3QII A;  1ZBX A;  2RHZ A;  3PFS A;  4N4I A;  4PJO A;  1N8R U;  2GF7 A;  3JCM X;  1KQ2 A;  1YCY A;  2FL7 A;  1V29 B;  3BY7 A;  5GMK e;  4M78 F;  5GAN 2;  1UEB A;  2MWO A;  3OYM A;  3UWN A;  4FSX A;  1Y71 A;  2RK2 A;  1S72 A;  2X4J A;  4E7J A;  2D6F A;  3NTH A;  2QA4 T;  1AHJ B;  2K5F A;  4PJO C;  5FU6 B;  4VUB A;  3C12 A;  3DB3 A;  4C0D B;  3HL8 A;  1O75 A;  2RD1 A;  2VV5 A;  4DQ2 A;  2LTO A;  3OY9 A;  5GAN e;  3CC4 A;  4OMF B;  2KVQ G;  5LJ5 h;  3CME T;  2HNI A;  3FB9 A;  3OSV A;  4EMK A;  2DO3 A;  4OB0 B;  3M54 A;  4JRQ A;  1YJ9 T;  1MGQ A;  3JAM E;  4C0F A;  2R5A A;  2XD0 A;  4C5I A;  5GAN 4;  1VQL A;  4M7A D;  4OB2 B;  5A2Q E;  2IG0 A;  3NTK A;  3NTI A;  5CKF A;  5D6X A;  2M1H A;  4M77 B;  3A8O B;  1YIT T;  2DPP B;  2OTL A;  5GAN h;  1VQP A;  2EJ9 A;  4QQ6 A;  3CCM T;  5CKB A;  4M78 E;  3JCM g;  2LDM A;  5FU7 B;  2DZC A;  2E5Q A;  3JB9 G;  3DLL A;  5C0M A;  4ATO A;  2P0P A;  4ZTF A;  3OS0 A;  3QUI A;  5HKC A;  4F7U E;  2DEQ A;  4C0G A;  4C92 C;  1Q7Y U;  4M7A G;  5LJ3 d;  4B9W A;  4ZGJ B;  4Y28 E;  1WJR A;  1VIE A;  2KDS A;  4RG2 A;  2Y4Y A;  5IT9 E;  5GAN j;  5GAO m;  3OYD A;  1NZ9 A;  2Y90 A;  4M7A A;  3CCV A;  3JB9 I;  3OYL A;  3I55 A;  3QYG B;  4C92 F;  5DM7 R;  4DA4 A;  3X25 B;  1YJN A;  1K9M U;  3GF5 A;  2QQA A;  2O01 E;  4O6J A;  1Y96 B;  2X4X A;  2P0K A;  3G7Z A;  5GAN f;  1K9M C;  2DAQ A;  4IUP A;  5M9O A;  1VQ8 T;  2M16 A;  3PT9 A;  5LJ5 e;  5J3B A;  5LJ3 g;  1RL2 A;  4XTZ A;  3L2U A;  2F5K A;  3CCS A;  3URG A;  4JJN K;  3VYG A;  3MO8 A;  3VUB A;  4PJO B;  4LD6 A;  4C8Q G;  4OVA A;  2CGH A;  4OGE A;  4QVC A;  4M7D F;  3CBO A;  4A4K A;  4Z02 A;  2EJG A;  5CKH A;  4HCC A;  4HKE A;  1YI2 T;  1WJQ A;  3HFN A;  3M53 A;  5DLQ E;  3QYH B;  3CC4 T;  3ER0 A;  3M4G A;  4M78 B;  2HBP A;  3PMT A;  3V8J A;  3ASK A;  1YIJ A;  2PVO B;  1HXD A;  1BI3 A;  2XIC A;  1BI0 A;  1M5Q 1;  5GAM e;  4LDX A;  1H64 1;  3G4S T;  3QZ9 B;  5GMK i;  2DJZ A;  2XU8 A;  4CRI A;  3WVD B;  3G6E A;  4MDX A;  4BB7 A;  1BIA A;  5HY6 A;  1WJS A;  1YIT A;  4A4G A;  4M75 F;  3C94 A;  3JCM b;  4A54 A;  4EMK B;  4A4H A;  1G5V A;  2LC4 A;  1UGS B;  2QQ9 A;  3SWN A;  4N4H A;  4PLL A;  3GPL A;  2ZCF B;  3S3O A;  3CD6 A;  4M77 F;  1NPP A;  1QVG A;  3E9F A;  3SD4 A;  4PLI A;  2X35 A;  1YJW A;  3CME A;  1M1F A;  2LQ8 A;  2I2L A;  3OSS C;  2R57 A;  3BDU A;  1Q86 C;  4M75 B;  1VQL T;  2D9T A;  2E64 A;  2DTI A;  1PSF A;  4FIB A;  3CCQ T;  3CBM A;  2RHY A;  2OTJ T;  4J8O A;  4P5N A;  4PJO G;  2ZPH B;  4RG8 A;  4XAX B;  3DB4 A;  3RMQ A;  3PNW C;  3PIO A;  3CXC A;  5I2S A;  5CO7 A;  5GMK m;  5GAO r;  5DY9 A;  3CPF A;  1EIF A;  3V7S A;  3GNG A;  5LJ5 g;  3OYI A;  5LJ3 e;  2MF2 A;  4PKC C;  2K57 A;  1KD1 C;  1ZHI A;  3HSB A;  2HQX A;  1Y07 A;  4YTL A;  2DTO A;  2V8I A;  3ZBD A;  3CC7 A;  4M7D D;  2WSC E;  3MEW A;  1VQ8 A;  4M7A E;  1W2B S;  3OYN A;  3V8L A;  4M7A B;  4BE0 A;  3SFM A;  5CQY A;  5GAO l;  2V8K A;  1I8F A;  2DXC A;  3GOX A;  2RO0 A;  4OB3 B;  4M7D C;  3S3M A;  4IUQ A;  3H8Z A;  3M59 A;  4IUT A;  4XQ3 A;  3CCJ A;  2LCC A;  1IRE B;  4PL6 A;  2JOY A;  2QQR A;  3EAE A;  4F7U A;  2A3L A;  1QVF A;  5GAM f;  3G71 A;  3QJY A;  2EWN A;  4C8Q A;  5GAM g;  5LJ5 j;  2GQV A;  3T9N A;  2EQK A;  1GXI E;  5L8R E;  1WQW A;  2RA2 A;  2F5T X;  2QQB A;  3HFO A;  1N27 A;  3A5Z B;  2RHI A;  3GLX A;  3GP8 A;  4J83 A;  2L89 A;  1G3W A;  4JS4 A;  2MMP A;  2RJF A;  4IUV A;  5KE2 A;  5CR2 A;  5CQX A;  4QW2 A;  3UDC A;  3OYB A;  4FU6 A;  3GNF B;  4LDU A;  1UGQ B;  2LT1 A;  3CEY A;  4HA8 A;  3QJ6 A;  2XID A;  2HD0 A;  4QVZ A;  3INZ A;  5LJ3 f;  4M78 G;  2QA4 A;  3CC2 A;  3VU3 C;  3LWI A;  1X6O A;  4M7D A;  2VXE A;  4J6Y A;  2EFI A;  3LGL A;  4X9D A;  5LJ5 f;  2IVW A;  4C5E A;  3M58 A;  5FRO A;  5GAN 8;  4M7D E;  4B9X A;  4Q5W A;  1KC8 C;  2QTX A;  1W4S A;  2CZ7 B;  1R8O B;  2ZZD A;  2O4X A;  4F7U G;  2GFA A;  1VQN A;  1Y7X A;  1XNI A;  3ME9 A;  2EAY A;  4BDY A;  2GCX A;  1I81 A;  3OQ5 A;  2E41 A;  4XTV A;  4M75 D;  1M8V A;  1XTD A;  2CYZ B;  4RKU E;  4C0D C;  4BAC A;  3CD6 T;  4EMG A;  4A4F A;  2K5I A;  3RKW A;  1KQS S;  4LD9 K;  5I2M A;  2KY9 A;  2MAM A;  2MI6 A;  4J6W A;  2Y4X A;  2VGN A;  2FHD A;  4J6X A;  4N0A C;  3CCE A;  3OYH A;  4OP0 A;  1N6A A;  3JCM e;  2ZPB B;  2DKG A;  4L6V 5;  4ZN3 A;  1K73 U;  4V2S A;  3JCM V;  4EDU A;  2M9U A;  2PVG B;  1VQ6 A;  1VQK A;  3JB9 F;  1G3T A;  4HT8 A;  5KE3 A;  2JTF A;  4OF1 A;  2DXU A;  4D6W A;  3CCU T;  1JBM A;  3JSC A;  1Q7Y C;  4M7A F;  4HT9 A;  3BFM A;  2KSS A;  1WQ7 A;  1YHQ A;  3MP1 A;  3QBY A;  1ZQ1 A;  4LDW A;  3N5B B;  5CK9 A;  1XOV A;  2KAF A;  4ZN1 A;  2DTH A;  2V8J A;  3L1A A;  5KCO A;  2DD5 A;  3BW1 A;  3PIP A;  2BIV A;  4E7H A;  3QPH A;  3MHX A;  2E12 A;  4EMH A;  1FX7 A;  2EKO A;  4FM4 B;  3H6Z A;  2PQW A;  1SSF A;  5IAY A;  1VQ4 A;  3X24 B;  2DD4 A;  4BDZ A;  2RJD A;  3CCL A;  2CZ1 B;  5GAM h;  1M9S A;  2P4T A;  4E7I A;  5CKD A;  1IZ6 A;  4XTX A;  3QDR B;  4EMK C;  2VYT A;  4QVD A;  1N9S A;  4E47 A;  3S6W A;  2RJC A;  3QZ5 B;  3TU4 K;  4RCB A;  3OYY A;  3OS2 A;  4IUU A;  4QQD A;  5D6Y A;  3L2Z A;  2C06 A;  2JN0 A;  1D3B A;  3LX7 A;  3A8L B;  4C8Q F;  2FB7 A;  1QW1 A;  2WSF E;  2QEX A;  1YJN T;  1UB4 A;  2LVM A;  4M7D G;  2WSE E;  4FL6 A;  1LJO A;  1QP3 A;  3HPW A;  4GY5 A;  1Q86 U;  4E7K A;  2RM4 A;  4JS5 A;  4M7D B;  2KMT A;  3M55 A;  3HP9 A;  3OYG A;  1G3Y A;  1M1K C;  4LDY A;  2RHU A;  3PTA A;  1LNX A;  1WPY A;  1OI1 A;  2RJE A;  1U1S A;  4NS5 A;  5GAN 7;  3CC2 T;  2YLC A;  1X75 C;  4XU2 A;  1U1T A;  2O4X B;  1YBY A;  2EQM A;  3RES A;  4M77 A;  5J26 A;  3JCM f;  2QDY B;  2DXT A;  2DVE A;  2XHC A;  2E1H A;  3M9Q A;  1KD1 U;  3P8B B;  3KXT A;  2HAX A;  2DK3 A;  2PVD B;  3VUZ A;  3ZEH A;  1XQH A;  1FXX A;  2H3J A;  2OAU A;  2WAC A;  3L2Q A;  5GAN g;  2RK1 A;  4BI8 B;  1VQN T;  3CXC S;  3EFS A;  1YIJ T;  3OA6 A;  1VQ6 T;  4M77 G;  3OB9 A;  1VQK T;  3Q1J A;  2QI2 A;  3OBY A;  3FJP A;  4C0Z A;  3JCM W;  5FRN A;  2L5Q A;  2EQJ A;  3G6E T;  2RH2 A;  3LH0 A;  3LW5 E;  4R56 A;  1YHQ T;  3OYJ A;  3R6O A;  5A0L A;  1JJ2 A;  5HK3 A;  3NFC A;  4JRP A;  3J7A F;  5GAO q;  4MZM A;  1K8A U;  4KUL A;  3WVE B;  4BE1 A;  1KHC A;  3LGF A;  1VQ7 T;  2RI5 A;  4C8Q E;  1LOJ A;  3CCR T;  3KUF A;  2XK0 A;  4BI3 A;  3CC7 T;  3SDZ A;  4WF2 A;  4M77 D;  1VQ4 T;  4JUV A;  2K3X A;  4A53 A;  1O9S A;  4FT2 A;  1BKB A;  2LQK A;  5LJ5 d;  3E1S A;  2ZGW A;  2R5M A;  1OYX A;  4II1 A;  4MZP A;  4BY6 C;  3CBP A;  3RKY A;  1VIF A;  3CCJ T;  2CZ6 B;  1KC8 U;  2VC8 A;  2GFU A;  3JCM c;  4M77 C;  3PGG A;  1JJ2 S;  4IUR A;  3G71 T;  1Q82 U;  2JTM A;  5GMK h;  4R55 A;  1KQS A;  1M4Z A;  3M5A A;  2A7Y A;  4M78 A;  2VXF A;  3MP6 A;  5GAM j;  1NE8 A;  4ZGE B;  3J80 E;  1S72 T;  1VUB A;  5GAM d;  2RHX A;  2AHJ B;  2RB6 A;  5GAN 6;  3V7R A;  3OYE A;  3QHS A;  4C8Q C;  3A8G B;  3RKX A;  2XKO C;  1JRI A;  3RUX A;  4ELY C;  4GLK A;  3CMA T;  4C92 D;  4XTU A;  5HK0 A;  2PUO B;  1G3S A;  4C5H A;  3X26 B;  4N0A A;  2QEX T;  5C6S A;  3RER A;  5KCH A;  3HRT A;  2XDD A;  3I56 A;  1MHN A;  4M77 E;  3OYC A;  3KBG A;  4JRK A;  3A8H B;  1VQO T;  2LCL A;  4UC4 A;  4M75 E;  2JUF A;  4M75 A;  3JCM h;  2OTL T;  4PNO A;  3WXM B;  4E7L A;  5CAI A;  3QKJ A;  3CCM A;  2G3R A;  3OMC A;  4L59 A;  2CZ0 B;  1KG1 A;  2CKK A;  1KQ1 A;  4JLG A;  1K8A C;  1DJ7 B;  4BE2 A;  1X01 A;  4MDW A;  1VQ7 A;  2RI2 A;  4PJO E;  2L8D A;  3VJP A;  1Q81 U;  3J81 E;  2K4Y A;  3JCM Q;  3L2R A;  5FRM A;  4M7A C;  4J7F A;  1QVG S;  3LWH A;  5FU7 C;  4DOV A;  1YJ9 A;  2XI9 A;  3OW2 A;  3CCE T;  2EIF A;  1BYM A;  4NL3 A;  1VQM T;  5CCA A;  3MEU A;  4NOY A;  3HRS A;  4A4E A;  4QQG A;  3SWN B;  2KQW A;  3BDL A;  1OZ2 A;  3RIR A;  5GMK j;  1VQP T;  2VUB A;  2EYQ A;  3VYH B;  2LX9 A;  3CCV T;  3DKM A;  4JLI A;  5A0G A;  2KK4 A;  3FC3 A;  3I55 T;  3A8M B;  3JB9 D;  1NPR A;  2E70 A;  3RMS A;  3P8H A;  1M1K U;  2M0O A;  2YRV A;  3O8V A;  1W2B A;  1JB0 E;  4M75 G;  5GAN 5;  3OYF A;  3V8K A;  1N8R C;  3M4Y A;  3V7C A;  2EQU A;  2E6N A;  3JCM P;  1M1G A;  3X28 B;  3HKS A;  4C5G A;  4JRI A;  4OB1 B;  4CI0 C;  3E19 A;  5GAN 3;  3MET A;  4J7I A;  4C92 G;  3CPW A;  2RI3 A;  4J5Y A;  1BIB A;  1UGP B;  2HQE A;  5FLX E;  3CPW S;  1TH7 A;  4ZGD B;  3JCM J;  4M78 D;  1B34 A;  1QP2 A;  3OYA A;  2X4Y A;  3CCU A;  3MP8 A;  4DOW A;  3S3N A;  1VQ5 T;  3TCJ A;  4F7U F;  4PJO F;  3QSU A;  2EJF A;  2ZPF B;  3I56 T;  2B8A A;  2CS7 A;  1WGS A;  2E65 A;  2LNV A;  3HRU A;  5EG2 A;  1QVF S;  5I21 A;  2ZPI B;  4L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...