4M7MA

Crystal structure of the r111k:r132q:y134f:t54v:r59w:a32w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.57 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKPAVEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Rational Design of a Colorimetric pH Sensor from a Soluble Retinoic Acid Chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 32
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4m7mA00
1HMRA 2WUTA 2K62A 1VYGA 5D45A 4IB7A 3FELA 1JYJA 1JZUA 3HWFA 2FWVA 1JYDA 4YDAA 3AKMA 2NP1A 4I3DA 5HZ8A 3FA7A 4GNYA 1FDQA 1CBSA 1ICNA 3FEPA 3I0AA 3D97A 1IKEA 5L8OA 4XMEA 3BSZE 3STNA 2HZRA 4HPCA 4GETA 4GE1A 1MVGA 3BLGA 4GRJA 4ORWA 4ZR2A 4HPAA 1GXAA 1EUOA 2NNEA 2WEXA 4I9SA 4TLJA 4YBPA 4ZHDA 1OBQA 2ACOA 1IFBA 5F6BA 4DQ4A 1EALA 1PM1X 1SXWA 1KQXA 5DG4A 1FEMA 1T68X 2EU7X 3PPTA 1EIOA 3B2IA 3WJBA 4ZFXA 1S44A 3BX7A 3MVFA 1EPBA 5LKEA 2A2GA 4AZRA 1VPRA 2NNQA 3IFBA 1X89A 3GAQA 4YFQA 1GGLA 5KICA 1Z24A 3P6GA 2HNXA 4QZTA 3WBGA 4AZPA 4I3CA 3ZUOA 1RBPA 3KQ0A 3VG4A 2XSTA 1JV4A 4GKCA 3WJGA 1LFOA 1SY1A 3WJFA 3NX1A 5IO5A 5K06A 1EPAA 2A13A 3STKA 5L8NA 4AYHA 4ARHA 1AVGI 2FR2A 3MBTA 4YGHA 3KFGA 1I4UA 4IB6A 3O2YA 4XMFA 3CR6A 5EZ2A 1I04A 1LICA 3S26A 3O19A 4TKHA 5F58A 5H9AA 2KT4B 1FENA 5F7GA 1E06A 5H9KA 3EYCA 1DFVA 4ORRA 2FR3A 1MUPA 1LIEA 2K23A 2Q2PA 1X8NA 2BLGA 1KGLA 2CM4A 1PEEA 3HWDA 4AZNA 2YG2A 1XCAA 4LKTA 4XMGA 1LKEA 2R56A 2Q2MA 1PBOA 2G7BA 3QKGA 3EMMA 1GT3A 5H9NA 1KQWA 1IIUA 1GT1A 1BEBA 2JU8A 4AZOA 4XMCA 4ZCBA 4ZH6A 3UEXA 4AZQA 2N93A 3BDRA 1B4MA 4ORYA 1OPBA 4O9SA 4OMXA 1TOWA 1RLBE 4LKPA 4QAEA 4K19A 2GC9A 4NLIA 2QOSC 2W2FA 2LBAA 1ZNDA 2L9CA 5HCDC 1KOIA 1QQSA 1JBHA 1E00A 3JSQA 4TJZA 3C78X 5F6ZA 1MDCA 3NP1A 1B8EA 3CQNA 3VG3A 2FRSA 2XKLA 2Q39A 3TGBA 4YGZA 5F1EA 3UEUA 1BSOA 1DZJA 2FS7A 3G7XA 4YCHA 3T1DA 3FEKA 4N7CA 2RD7C 1OEJA 3P6HA 4HPBA 4CK4A 1EQDA 2MO5A 3BX8A 1A3YA 2JN3A 4XMHA 1YWBA 4QZUA 3WVMA 4YFRA 3WJDA 3TZSA 1YIVA 1KXOA 1X8UA 5HZ9A 4ZHFA 4KIIA 5D4AA 2A0AA 3BU9A 4R0BA 4D6AA 1ZNEA 1LF7A 4I9RA 5B29A 5LJBA 1SA8A 1G7NA 3EBWA 3KFHA 1S7DA 3PEDA 5LJCA 1ZNLA 1KT4A 1AELA 3FR5A 4DQ3A 4ALBA 1OPAA 1TOUA 3L4RA 1QY0A 2ACPX 1PMPA 1DZKA 3VG2A 2OZQA 3CWKA 5HA1A 1ML7A 3TGCA 2AKQA 4YH0A 1LNMA 5HZQA 1G85A 1KZWA 3FA8A 1GT5A 1ALBA 2L5PA 4A60A 3CBCA 1H91A 4QGVA 4Y0PA 3KFIA 3FW5A 1QY2A 3OJYC 5H8TA 2LKKA 5IO7A 1R0UA 4NNTA 4EDEA 2E4JA 4NYRA 1SXUA 2NNDA 3NX2A 5BVSA 2ANSA 1CBQA 4IBAA 4XMDA 3STMX 3CQRA 3PH5A 1YWCA 2Q4NA 1JJJA 4ZHCA 1BRQA 2W2BA 2R74A 3BRNA 2QO6A 4IMOA 5C0NA 2WWPA 1E5PA 4TKJA 1QFVA 2L67A 1L6MA 1CJ5A 1I06A 1O8VA 4HFOA 4EEJA 4D6BA 2RA6A 3CBSA 2AMMX 2ALLX 1IFCA 3FR4A 3NQ9A 2FS6A 3APVA 3DSZA 1AQBA 2OFRX 2WSJA 1HMTA 4EXZA 1EIIA 1GKAB 2G78A 3F9DA 5H9LA 5HAEA 1S2PA 1X8OA 3JS1A 2CM9A 1O1VA 2OFMX 5D8JA 1MX7A 3FW4A 4TKBA 3B2LA 2AL0X 1UREA 1NP1A 1SXXA 1GKAA 3HWEA 3KZAA 1KT3A 1D3SA 3P6FA 1ZNKA 1KZXA 2WQAE 4YBUA 2FTBA 3P6CA 1NGLA 2OVAA 1ERBA 1LIBA 1X8PA 4OS0A 2AT6X 3NPOA 2A2UA 3EBKA 5LJHA 1MX8A 2W2AA 5FFHA 2CBSA 1A57A 1D2UA 1FELA 1BLRA 1A2DA 2CBRA 1E02A 1N0SA 2MJIA 2DM5A 1DF3A 4TQ2A 2ASNX 1BJ7A 4ZH9A 2GTFX 2RQ0A 1TW4A 2WEWA 4LZUA 5D48A 2CZUA 2L68A 2AT5X 3DTQA 3BS2A 4YKMA 2AT0X 4YCEA 3APWA 3CMPA 4UU2A 4ES7A 2X45A 5JR8A 1BSYA 2QO4A 4N7DA 1YP6A 2IFBA 3PECA 1OEEA 3HWGA 3RSWA 3PP6A 3PH6A 1HQPA 3C77X 3SAOA 1CBIA 1X71A 3WJCA 1CBRA 4HPDA 4BOEA 2OVEA 4A8ZA 1XKIA 2OVDA 4MVKA 1OBUA 2F73A 2GJ5A 1CRBA 5IO6A 4NYQA 5HCEC 1YWDA 4MVIA 5EDBA 1A18A 1NP4A 4ODDA 5HWZA 1B0OA 1HBPA 5LJKA 4QYNA 2MM3A 3ELXA 1QABE 4PSQA 1ZNHA 1HBQA 3FLLA 4ALOA 3VG6A 4ZHHA 1ADLA 1QWDA 5HCCC 2QM9A 2LFOA 1EXSA 1LIDA 1X8QA 5D47A 3APXA 5B27A 1ZRYA 4ORUA 5HZ6A 1GX8A 1ICMA 1DC9A 1DZMA 3ELZA 4Y0SA 2AT3X 3K3LA 1BBPA 1SXYA 3P6EA 2RCTA 3TGAA 1GT4A 3BU1A 2O62A 3APUA 4IMNA 1SY2A 3EM0A 5LJDA 3VG7A 1G74A 2HLVA 4GNWA 2P8GA 1LPJA 2POAA 1TVQA 4QGXA 5FAZA 3NADA 4LZVA 1BM5A 3KFFA 1O1UA 3B2JA 4OS8A 1OBPA 2WQ9A 4IAXA 4M6SA 2G79A 4AW8A 4BQUA 5AQ6A 4YDBA 3ZUIA 1HN2A 5EEDA 3F8AA 3U0DA 4NLJA 3TF6A 2A3FX 4QGWA 4ZHGA 5LJGA 1QFTA 4Y0QA 4UU3A 3VG5A 1U17A 1U0XA 1IKJA 1GM6A 1FE3A 3FMZA 5BVQA 1BWYA 5EEEA 5HTDA 1DZPA 3B2KA 1TXLA 5LKFA 2HZQA 1P6PA 1SY0A 1YWAA 1UZ2X 4ZJ0A 1DV9A 1AB0A 1EW3A 4ZGUA 3NQ3A 2JU7A 3P6DA 4AZMA 4YGGA 4M7MA 2LBVA 4TNNA 5CE4A 2HMBA 4YFPA 1ZNGA 3UEWA 3FENA 3B2HA 4IB8A 5HBSA 2HYSA 2JU3A 4Y0RA 2QO5A 5LJEA 3WJEA 4WFVA 5EPQA 5DPQA 1QY1A 1SY3A 1KT6A 5HTEA 5HA0A 3U03A 4YKOA 1IW2A 4NNSA 4WFUA 5HZ5A 3D95A 3U9PC 1YUPA 4RUNA 2AH7X 2JOZA 3O22A 1YP7A 5EDCA 5L8IA 3UEVA 3ZQ3A 2RCQA 4GH7A 4YMYA 2LB6A 1JJXA 3AKNA 1BSQA 3FA9A 2FT9A 4NP1A 4A1YA 1T8VA 5BVTA 1KT5A 1ACDA 1I05A 5KHPA 3NR3A 2Q9SA 3WXQA 4BVMA 1GX9A 1OEKA 1QG5A 4QYPA 4A1HA 4IB9A 4OMWA 4EFGA 3Q6LA 2FLJA 4I3BA 5KIDA 2KTDA 4MVLA 4IAWA 2WR6A 3D96A 1T0VA 1HMSA 3I17A 1G5WA 3FA6A 1FTPA 1KT7A 1LIFA 2AT8X 1B56A 3FR2A 1BRPA 2CZTA 1ERXA 3C76X 4ORSA 3RZYA 3IA8A 2R73A 4OS3A 3HK1A 4WBKA 2PY1A 1U18A 3BY0A 1VYFA 3FIQA 5FENA 2X46A 4ORXA 4RUUA
chains in the Genus database with same CATH superfamily
1JMZA 1HMRA 2WUTA 5FQ6E 1VWPB 2K62A 1VYGA 1KL3A 5D45A 4IB7A 3FELA 5L3YA 2MF6A 1JYJA 2RTJA 3HWFA 1JZUA 2ZAIA 2FWVA 1JYDA 1SWFA 4YDAA 2BS5A 3AKMA 2NP1A 4B55A 2BT9A 4I3DA 3UEVA 5HZ8A 3FA7A 4QQ1A 4GNYA 4CPEA 1FDQA 2I5ZO 1CBSA 3MM0A 1ICNA 3EW1A 3FEPA 1SWJA 3I0AA 5B11O 3T2WA 1E2TA 3D97A 1Y9TA 1IKEA 5L8OA 4XMEA 4CDFA 3BSZE 3STNA 4KC8A 2HZRA 2F01A 4HPCA 4WHIA 1I78A 2DJGA 4GE1A 3PDFA 4GETA 5CSEA 3RE6A 1MVGA 2X34A 2HKDA 3BLGA 1SRJA 2UYWA 4GRJA 4HPAA 4ORWA 1GXAA 4ZR2A 4GDZA 1EUOA 2NNEA 2WEXA 4I9SA 2RTEB 4TLJA 1VYOA 4GDAA 4YBPA 4ZHDA 1PTSA 4BCSA 1OBQA 1MM9A 1SWSA 2ACOA 5IRAA 1IFBA 5F6BA 1SWGA 4DQ4A 3ZWEA 1SWQA 1NBXA 3RWXA 1PM1X 1SXWA 4CPHB 1EALA 1IJ8A 1KQXA 5DG4A 1FEMA 1T68X 4JNJA 3WOVA 4O3ZA 2EU7X 3PPTA 1EIOA 2OF9A 2GTLN 3B2IA 3WJBA 4ZFXA 1SWUA 1S44A 2AVIA 2YMSA 3BX7A 3MVFA 1EPBA 5LKEA 2A2GA 3X00A 4AZRA 5B5FA 2FGSA 4CPIA 1VPRA 2NNQA 3IFBA 1X89A 3GAQA 4YFQA 1GGLA 3PK2A 4CDDA 4CSBA 5KICA 3SLJA 1Z24A 3P6GA 2HNXA 1I9HA 4LQZA 4QZTA 3WBGA 2MWHA 3WYPA 4AZPA 1SWNA 1VWAB 4I3CA 3ZUOA 1AVDA 1RBPA 2DJFA 3KQ0A 4GGTA 3VG4A 2XSTA 3WZQA 3SOTA 1JV4A 2IZFB 4GKCA 3WJGA 1LFOA 1SY1A 3WJFA 3NX1A 1VWEB 3OE3A 5IO5A 4Y59A 5K06A 1EPAA 2RTPB 2A13A 3STKA 5L8NA 1UYNX 4AYHA 4ARHA 1AVGI 2FR2A 3MBTA 4YGHA 3KFGA 1I4UA 3GE2A 4IB6A 3WZPA 1JMXA 3O2YA 4XMFA 3CR6A 5EZ2A 1I04A 1LICA 1NQMA 3S26A 4YVBA 3O19A 4TKHA 2OL8O 5F58A 4BX5B 5H9AA 4U9CA 2KT4B 1FENA 5F7GA 1E06A 4FBRA 5H9KA 2OVSA 1RXJA 3EYCA 4L3RA 1DFVA 4ORRA 2FR3A 1VWIB 1MUPA 1STRB 1LIEA 2K23A 3FYFA 5CHKA 3NQKA 4A1YA 2Q2PA 1X8NA 3RDOA 2PI3O 2BLGA 1N43A 1VWCB 4BX5A 1KGLA 2CM4A 1PEEA 3CKGA 3HWDA 4AZNA 2YG2A 1UYOX 1XCAA 4HWMA 4LKTA 1VWMB 4XMGA 3RKGA 1LKEA 4DNEA 4Z2VA 3VE2A 2R56A 1W5RA 2Q2MA 1PBOA 2G7BA 1DF8A 3QKGA 3EMMA 1GT3A 2RTIB 1KFFA 1KQWA 1IIUA 4O3XB 5H9NA 1GT1A 1BEBA 2JU8A 4PJ2A 2RTRB 3UAQA 4AZOA 4XMCA 4ZCBA 4ZH6A 3UEXA 4AZQA 3D4RA 2N93A 3BDRA 4JHQA 1B4MA 4CDEA 2Z4IA 4ORYA 2C4IA 1OPBA 4O9SA 4OMXA 1TOWA 1HQQA 1MK5A 1RLBE 2BC3A 4LKPA 4QAEA 2CAMA 4K19A 2GC9A 4NLIA 2QOSC 4CV7A 3Q34A 2W2FA 2LBAA 1ZNDA 2L9CA 3MX7A 2IZAA 1SREA 4FQBB 5HCDC 2RTCB 4NV7A 1KOIA 3WZOA 1QQSA 1SRGA 4GGZA 1N4JA 1JBHA 3N91A 1E00A 3JSQA 4TJZA 3C78X 1N9MA 5F6ZA 1MDCA 2C1QA 3NP1A 4GGRA 1B8EA 3EW2A 2Y32A 3CQNA 3VG3A 2FRSA 2XKLA 3E3CA 1JJUA 2Q39A 3RDXA 4JO6A 3TGBA 5FQ8E 4YGZA 5F1EA 3UEUA 1BSOA 2RTMA 5IRUA 1MOYA 2BSZA 1DZJA 2FS7A 3G7XA 4YCHA 3T1DA 3FEKA 4N7CA 2RD7C 1OEJA 3P6HA 4HPBA 1HY2A 4CK4A 1EQDA 4EKVA 1JIWI 4KC7A 1LDQA 4C5PA 2MO5A 3BX8A 1A3YA 2JN3A 2RTOB 3H3IA 4XMHA 4ZGFA 1YWBA 2GTLM 2MHDA 4QZUA 3WVMA 3WJDA 4YFRA 4OELA 3TZSA 1YIVA 2A5BA 2VFCA 3D9WA 1KXOA 1X8UA 2GTLO 4QRLA 5HZ9A 4ZHFA 4KIIA 5D4AA 2A0AA 3BU9A 4R0BA 1Y9LA 4D6AA 3AUMO 1ZNEA 1LF7A 4I9RA 5B29A 5K68A 5LJBA 1HXZA 1SA8A 3P02A 4GJSA 2Y3FA 1G7NA 3EBWA 3KFHA 2OYBO 1S7DA 3PEDA 2RTBB 1ZNLA 5LJCA 1VWRB 3SZIA 1KT4A 1NDJA 1AELA 2X4MA 3FR5A 4DQ3A 2QMIA 4ALBA 1OPAA 1TOUA 2JMBA 3L4RA 1QY0A 2ACPX 1Y55X 2Z4HA 1PMPA 1DZKA 2G8CO 2IZKA 3KVNA 1RXKA 3VG2A 3VE1A 1LCWA 1VWOB 2OZQA 3CWKA 1ML7A 5HA1A 4QNIA 2AKQA 3TGCA 1SWAA 4CPFA 3F6ZB 4OEMA 1LNMA 4YH0A 4MISA 1STPA 1G85A 5HZQA 3S60A 1KZWA 3FA8A 2IZGB 1GT5A 1ALBA 1Y52X 2L5PA 4A60A 3CBCA 1H91A 3CKFA 4CPHA 2OFBA 4Y0PA 4QGVA 3KFIA 3FW5A 2FKJA 1QY2A 3OJYC 2AF5A 5H8TA 3S5XA 2LKKA 5IO7A 1R0UA 1Y53X 4NNTA 2G5LA 4EDEA 1LDOA 3RY2A 3PQUA 2E4JA 4NYRA 4U8UN 1SXUA 4IRWA 2NNDA 3NX2A 5BVSA 4Z2OA 2ANSA 1SWLA 3T6LA 2F09A 1CBQA 4IBAA 4XMDA 3STMX 3SZJA 3CQRA 4ON1A 3PH5A 4KCAA 1YWCA 2RTNB 2Q4NA 3VPJE 1JJJA 4ZHCA 2GH7A 1SRFA 1BRQA 4BGFA 2W2BA 2R74A 3BRNA 2QO6A 2RTGB 4GJVA 4IMOA 5C0NA 2WWPA 3HOLA 1E5PA 1EI5A 4TKJA 3WYQA 2IZIA 4GU8A 1QFVA 1W4TA 2L67A 1L6MA 1CJ5A 1SWOA 1I06A 5K67A 2X56A 2RTHB 1VWBB 1O8VA 4HFOA 4EEJA 1RXHA 4D6BA 2RA6A 3CBSA 2AMMX 2ALLX 1IFCA 1SLEB 3FR4A 1SRHA 3NQ9A 2FS6A 3APVA 4MIRA 3ZI8A 1SWCA 3EC5A 3DSZA 1AQBA 2OFRX 4INNA 2WSJA 4O49A 3VGWA 3VU1A 4Z2PA 2JGSA 3MG5A 1HMTA 4EXZA 1EIIA 1GKAB 2G78A 2IZDB 3F9DA 5H9LA 4O3YA 1S2PA 3RY1A 1X8OA 5HAEA 4BJ8A 3JS1A 1AVEA 1K24A 3S5VA 4BX7B 2CM9A 1O1VA 2OFMX 5D8JA 1MX7A 3FW4A 4TKBA 3B2LA 2AL0X 4O4XA 4I60A 4O4OA 1UREA 4BX6B 1NP1A 1SXXA 1GKAA 1OSPO 3HWEA 3KZAA 5CYBA 1KT3A 1D3SA 3P6FA 1SRIA 2ZAGA 1K3BA 4BX7A 1ZNKA 1KZXA 2OFAA 2WQAE 4YBUA 1VWKB 2FTBA 3P6CA 1NGLA 1SWEA 1ERBA 1LIBA 1X8PA 2OVAA 2RTKA 2OF8A 4FGIB 4BX6A 4OS0A 2AT6X 4NV8A 3NPOA 4OKAA 2A2UA 3EBKA 4Z28A 4ID2A 5AJCA 5LJHA 1MX8A 2VDFA 2W2AA 5FFHA 2CBSA 3QQ2A 1WBIA 1A57A 1D2UA 2OY1O 3OBLA 4GK9A 1FELA 1BLRA 1A2DA 2CBRA 2VFBA 2RN4A 5AJBA 2OY7A 1E02A 1N0SA 2MJIA 1SLFB 2DM5A 1DF3A 4TQ2A 2ASNX 1BJ7A 4ZH9A 5B10O 1N7YA 2GTFX 2RQ0A 2KTSA 4O3WA 1TW4A 2A5CA 2WEWA 4LZUA 5D48A 1VWLB 3V8UA 2CZUA 2L68A 2OL6O 1WUBA 2AT5X 3DTQA 3BS2A 4YKMA 2AT0X 5IRWA 4YCEA 1NQNA 3APWA 3CMPA 3HTYA 4UU2A 4ES7A 1LUQA 2X45A 5JD2A 3LTWA 3RDUA 1BSYA 2QO4A 4N7DA 1YP6A 2IFBA 3PECA 1OEEA 3HWGA 4GUZA 4U3QA 3PP6A 4U46A 3RSWA 3PH6A 4FBVA 3FDCA 5B2AO 1HQPA 3C77X 3ZZVA 4COTA 4Y5DA 3SAOA 5BYPA 1CBIA 1X71A 2IZCB 3WJCA 1CBRA 4HPDA 4BBOA 4BOEA 2OVEA 3ZW0B 2OL7A 1XKIA 4A8ZA 2OVDA 4MVKA 3VHIA 1OBUA 1W6FA 3T2XA 1VWHB 1MEPA 2F73A 2GJ5A 3HPEA 1CRBA 5IO6A 4NYQA 5HCEC 1VWGB 1YWDA 4MVIA 5EDBA 1A18A 3SLTA 3VHMA 1NP4A 4ODDA 5HWZA 1B0OA 1HBPA 5LJKA 4MVEA 4QYNA 2MM3A 3ELXA 4O4SA 1QABE 4PSQA 4U8UM 3ZW0A 1ZNHA 1HBQA 3FLLA 2KW1A 2FHLA 1N9YA 3VG6A 1ADLA 4ALOA 4ZHHA 1QWDA 5HCCC 2QM9A 2LFOA 4U8UO 2OY5O 1EXSA 2LA7A 1LIDA 1SWHA 1X8QA 5IXGA 5D47A 3APXA 5B27A 1ZRYA 4ORUA 5HZ6A 1GX8A 1RSTB 2RTDB 4KT5A 1ICMA 3RBYA 1VWFB 1Y0GA 3ZW1B 1DC9A 2Y3EA 1DZMA 3ELZA 4NW4A 2AT3X 3K3LA 1BBPA 1SMPI 1SXYA 3P6EA 2RCTA 4Y0SA 3TGAA 3JQOA 1GT4A 4IABA 4CDCA 3BU1A 2O62A 3APUA 4IMNA 1SY2A 3EM0A 1JQPA 5LJDA 1LELA 3VG7A 3ZW1A 1G74A 3WZNA 1SWBA 2HLVA 5FQ7E 4GNWA 2P8GA 1LPJA 2POAA 1TVQA 4QGXA 5FAZA 2IZEB 1KL4A 3NADA 1RSUB 4LZVA 2A8GA 1BM5A 3KFFA 1O1UA 3B2JA 4OS8A 1OBPA 1NC9A 4EQAC 2WQ9A 4IAXA 4M6SA 1VWDB 2G79A 4AW8A 4BQUA 5AQ6A 4YDBA 3ZUIA 3AEHA 1HN2A 3RDSA 5EEDA 3F8AA 3U0DA 4NLJA 3TF6A 3RDMA 4JGLA 1LCZA 2A3FX 2RTLA 4QGWA 4ZHGA 5LJGA 1QFTA 4Y0QA 2OY8A 2FHNX 4UU3A 3VG5A 3LV4A 1U17A 1U0XA 1IKJA 1GM6A 4GD9A 1FE3A 3FMZA 4GZVA 1LCVA 1KL5A 5BVQA 1BWYA 5EEEA 5HTDA 2X8TA 5JR8A 1DZPA 1VWNB 1TXLA 2QOMA 2HZQA 3B2KA 5LKFA 1P6PA 1SY0A 1YWAA 1UZ2X 4ZJ0A 4DCBA 1DV9A 2X32A 1AB0A 1EW3A 3FIDA 4ZGUA 3NQ3A 2X8FA 2JU7A 3P6DA 4I95A 4AZMA 5F2BA 4YGGA 4M7MA 4O4UA 4TNNA 2KD2A 2LBVA 5CE4A 2HMBA 4YFPA 2IZBA 1ZNGA 3UEWA 3FENA 3B2HA 1VWJB 4IB8A 4L1NA 3SZHA 5HBSA 1SWRA 2HYSA 2JU3A 4Y0RA 2QO5A 5LJEA 3VHHA 3T6FA 3HOEA 3WJEA 3P24A 2FKGA 2ZSCA 4WFVA 5EPQA 2QCBA 5DPQA 1QY1A 2WPUA 1SY3A 1KT6A 2M4LA 5HTEA 5HA0A 3RE5A 3U03A 4KH8A 1IW2A 4MEEA 4YKOA 4NNSA 5B3MO 3NBXX 4WFUA 2BS6A 5HZ5A 3D95A 3OD9A 3U9PC 1SLDB 1YUPA 2RTQB 4RUNA 2I5VO 2AH7X 1SWTA 2JOZA 1RAVA 1YP7A 3LHNA 3O22A 5EDCA 5L8IA 2RCQA 4GH7A 3ZQ3A 2LB6A 4YMYA 1JJXA 3AKNA 1BSQA 3FA9A 2FT9A 4ML7B 4NP1A 1T8VA 1SLGB 1KT5A 1ACDA 1I05A 3ZW2A 5BVTA 5KHPA 3NR3A 2Q9SA 1SWKA 2X8SA 3WXQA 2RTAA 1GX9A 1OEKA 1QG5A 4QYPA 4A1HA 4BVMA 2UZ2A 4IB9A 4OMWA 3Q6LA 4EFGA 2FLJA 2BHVA 4I3BA 5KIDA 1STSB 1PBYA 1VWQB 2IZHB 2KTDA 4Z27A 4MVLA 4IAWA 2WR6A 1FJ1E 2IZJA 1T0VA 3D96A 1HMSA 3I17A 1G5WA 3FA6A 1FTPA 3RDQA 1KT7A 5B5GA 1LIFA 2AT8X 1B56A 3FR2A 1BRPA 1SWPA 2CZTA 1ERXA 3C76X 5AEOA 4ORSA 3RZYA 1GX3A 3IA8A 1HXLA 2R73A 3PQSA 2C1SA 3HK1A 4FBOA 4I6SA 4OS3A 2X55A 4WBKA 2PY1A 1U18A 4Z6JA 2JW1A 3BY0A 3SLOA 2IZLB 1VYFA 3FIQA 5FENA 1SWDA 2X46A 4ORXA 4RUUA 2RTFB
chains in the Genus database with same CATH topology
1HMRA 2WUTA 5FQ6E 2K62A 1VYGA 5D45A 4IB7A 3FELA 1JYJA 1JZUA 3HWFA 2ZAIA 2FWVA 1JYDA 4YDAA 2BS5A 3AKMA 2NP1A 2BT9A 4I3DA 5HZ8A 3FA7A 4QQ1A 4GNYA 1FDQA 1CBSA 1ICNA 3FEPA 3I0AA 3D97A 1Y9TA 1IKEA 5L8OA 4XMEA 3BSZE 3STNA 4KC8A 2HZRA 4HPCA 4WHIA 4GETA 4GE1A 1MVGA 3BLGA 4GRJA 4ORWA 4ZR2A 4HPAA 1GXAA 4GDZA 1EUOA 2NNEA 2WEXA 4I9SA 4TLJA 4YBPA 4ZHDA 1OBQA 2ACOA 1IFBA 5F6BA 4DQ4A 3ZWEA 3RWXA 1EALA 1PM1X 1SXWA 1KQXA 5DG4A 1FEMA 1T68X 3WOVA 4O3ZA 2EU7X 3PPTA 1EIOA 2GTLN 3B2IA 3WJBA 4ZFXA 1S44A 2YMSA 3BX7A 3MVFA 1EPBA 5LKEA 2A2GA 4AZRA 1VPRA 2NNQA 3IFBA 1X89A 3GAQA 4YFQA 1GGLA 4CSBA 5KICA 1Z24A 3P6GA 2HNXA 4LQZA 4QZTA 3WBGA 2MWHA 4AZPA 4I3CA 3ZUOA 1RBPA 3KQ0A 3VG4A 2XSTA 3SOTA 1JV4A 4GKCA 3WJGA 1LFOA 1SY1A 3WJFA 3NX1A 3OE3A 5IO5A 5K06A 1EPAA 2A13A 3STKA 5L8NA 4AYHA 4ARHA 1AVGI 2FR2A 3MBTA 4YGHA 3KFGA 1I4UA 3GE2A 4IB6A 3O2YA 4XMFA 3CR6A 5EZ2A 1I04A 1LICA 3S26A 3O19A 4TKHA 5F58A 5H9AA 4U9CA 2KT4B 1FENA 5F7GA 1E06A 4FBRA 5H9KA 2OVSA 3EYCA 4L3RA 1DFVA 4ORRA 2FR3A 1MUPA 3FYFA 1LIEA 2K23A 3NQKA 4A1YA 2Q2PA 1X8NA 2BLGA 1KGLA 2CM4A 1PEEA 3HWDA 4AZNA 2YG2A 1XCAA 4HWMA 4LKTA 4XMGA 3RKGA 1LKEA 3VE2A 2R56A 2Q2MA 1PBOA 2G7BA 3QKGA 3EMMA 1GT3A 4O3XB 5H9NA 1KQWA 1IIUA 1GT1A 1BEBA 2JU8A 4PJ2A 3UAQA 4AZOA 4XMCA 4ZCBA 4ZH6A 3UEXA 4AZQA 3D4RA 2N93A 3BDRA 1B4MA 2Z4IA 4ORYA 1OPBA 4O9SA 4OMXA 1TOWA 1RLBE 4LKPA 4QAEA 4K19A 2GC9A 4NLIA 2QOSC 4CV7A 2W2FA 2LBAA 1ZNDA 2L9CA 3MX7A 4FQBB 5HCDC 1KOIA 1QQSA 1JBHA 3N91A 1E00A 3JSQA 4TJZA 3C78X 5F6ZA 1MDCA 3NP1A 1B8EA 3CQNA 3VG3A 2FRSA 2XKLA 3E3CA 2Q39A 3TGBA 5FQ8E 4YGZA 5F1EA 3UEUA 1BSOA 1DZJA 2FS7A 3G7XA 4YCHA 3T1DA 3FEKA 4N7CA 2RD7C 1OEJA 3P6HA 4HPBA 4CK4A 1EQDA 1JIWI 4KC7A 2MO5A 3BX8A 1A3YA 2JN3A 3H3IA 4XMHA 4ZGFA 1YWBA 2GTLM 2MHDA 4QZUA 3WVMA 3WJDA 4YFRA 3TZSA 1YIVA 1KXOA 1X8UA 2GTLO 4QRLA 5HZ9A 4ZHFA 4KIIA 5D4AA 2A0AA 3BU9A 4R0BA 1Y9LA 4D6AA 1ZNEA 1LF7A 4I9RA 5B29A 5LJBA 1SA8A 3P02A 1G7NA 3EBWA 3KFHA 1S7DA 3PEDA 5LJCA 1ZNLA 1KT4A 1AELA 3FR5A 4DQ3A 2QMIA 4ALBA 1OPAA 1TOUA 2JMBA 3L4RA 1QY0A 2ACPX 2Z4HA 1PMPA 1DZKA 3VG2A 3VE1A 2OZQA 3CWKA 5HA1A 1ML7A 3TGCA 4QNIA 2AKQA 3F6ZB 4YH0A 1LNMA 4MISA 5HZQA 1G85A 3S60A 1KZWA 3FA8A 1GT5A 1ALBA 2L5PA 4A60A 3CBCA 1H91A 4QGVA 4Y0PA 3KFIA 3FW5A 1QY2A 3OJYC 5H8TA 3S5XA 2LKKA 5IO7A 1R0UA 4NNTA 4EDEA 3PQUA 2E4JA 4NYRA 4U8UN 1SXUA 2NNDA 3NX2A 5BVSA 2ANSA 2F09A 1CBQA 4IBAA 4XMDA 3STMX 3CQRA 4ON1A 3PH5A 4KCAA 1YWCA 3VPJE 2Q4NA 1JJJA 4ZHCA 1BRQA 2W2BA 2R74A 3BRNA 2QO6A 4IMOA 5C0NA 2WWPA 3HOLA 1E5PA 1EI5A 4TKJA 4GU8A 1QFVA 2L67A 1L6MA 1CJ5A 1I06A 1O8VA 4HFOA 4EEJA 4D6BA 2RA6A 3CBSA 2AMMX 2ALLX 1IFCA 3FR4A 3NQ9A 2FS6A 3APVA 4MIRA 3ZI8A 3DSZA 1AQBA 2OFRX 4INNA 2WSJA 4O49A 3VU1A 1HMTA 4EXZA 1EIIA 1GKAB 2G78A 3F9DA 5H9LA 5HAEA 4O3YA 1S2PA 1X8OA 3JS1A 3S5VA 2CM9A 1O1VA 2OFMX 5D8JA 1MX7A 3FW4A 4TKBA 3B2LA 2AL0X 4O4XA 4O4OA 1UREA 1NP1A 1SXXA 1GKAA 3HWEA 3KZAA 5CYBA 1KT3A 1D3SA 3P6FA 2ZAGA 1ZNKA 1KZXA 2WQAE 4YBUA 2FTBA 3P6CA 1NGLA 2OVAA 1ERBA 1LIBA 1X8PA 4FGIB 4OS0A 2AT6X 3NPOA 2A2UA 3EBKA 4ID2A 5AJCA 5LJHA 1MX8A 2W2AA 5FFHA 2CBSA 1A57A 1D2UA 3OBLA 4GK9A 1FELA 1BLRA 1A2DA 2CBRA 2RN4A 5AJBA 1E02A 1N0SA 2MJIA 2DM5A 1DF3A 4TQ2A 2ASNX 1BJ7A 4ZH9A 2GTFX 2RQ0A 2KTSA 4O3WA 1TW4A 2WEWA 4LZUA 5D48A 3V8UA 2CZUA 2L68A 2AT5X 3DTQA 3BS2A 4YKMA 2AT0X 4YCEA 3APWA 3CMPA 3HTYA 4UU2A 4ES7A 2X45A 5JR8A 1BSYA 2QO4A 4N7DA 1YP6A 2IFBA 3PECA 1OEEA 3HWGA 4U3QA 3RSWA 3PP6A 3PH6A 4FBVA 1HQPA 3C77X 3ZZVA 4COTA 3SAOA 5BYPA 1CBIA 1X71A 3WJCA 1CBRA 4HPDA 4BOEA 2OVEA 3ZW0B 4A8ZA 1XKIA 2OVDA 4MVKA 1OBUA 2F73A 2GJ5A 1CRBA 5IO6A 4NYQA 5HCEC 1YWDA 4MVIA 5EDBA 1A18A 1NP4A 4ODDA 5HWZA 1B0OA 1HBPA 5LJKA 4MVEA 4QYNA 2MM3A 3ELXA 4O4SA 1QABE 4PSQA 4U8UM 3ZW0A 1ZNHA 1HBQA 3FLLA 2KW1A 4ALOA 3VG6A 4ZHHA 1ADLA 1QWDA 5HCCC 2QM9A 2LFOA 4U8UO 1EXSA 2LA7A 1LIDA 1X8QA 5D47A 3APXA 5B27A 1ZRYA 4ORUA 5HZ6A 1GX8A 4KT5A 3ZW1B 1ICMA 3RBYA 1DC9A 1DZMA 3ELZA 4NW4A 2AT3X 3K3LA 1BBPA 1SMPI 1SXYA 3P6EA 2RCTA 4Y0SA 3TGAA 3JQOA 1GT4A 4IABA 3BU1A 2O62A 3APUA 4IMNA 1SY2A 3EM0A 5LJDA 3VG7A 3ZW1A 1G74A 2HLVA 5FQ7E 4GNWA 2P8GA 1LPJA 2POAA 1TVQA 4QGXA 5FAZA 3NADA 4LZVA 1BM5A 3KFFA 1O1UA 3B2JA 4OS8A 1OBPA 4EQAC 2WQ9A 4IAXA 4M6SA 2G79A 4AW8A 4BQUA 5AQ6A 4YDBA 3ZUIA 1HN2A 5EEDA 3F8AA 3U0DA 4NLJA 3TF6A 4JGLA 2A3FX 4QGWA 4ZHGA 5LJGA 1QFTA 4Y0QA 4UU3A 3VG5A 3LV4A 1U17A 1U0XA 1IKJA 1GM6A 1FE3A 3FMZA 4GZVA 5BVQA 1BWYA 5EEEA 5HTDA 2X8TA 1DZPA 3B2KA 1TXLA 5LKFA 2HZQA 1P6PA 1SY0A 1YWAA 1UZ2X 4ZJ0A 1DV9A 1AB0A 1EW3A 4ZGUA 3NQ3A 2X8FA 2JU7A 3P6DA 4I95A 4AZMA 4YGGA 4M7MA 4O4UA 4TNNA 2KD2A 2LBVA 5CE4A 2HMBA 4YFPA 1ZNGA 3UEWA 3FENA 3B2HA 4IB8A 4L1NA 5HBSA 2HYSA 2JU3A 4Y0RA 2QO5A 5LJEA 3HOEA 3WJEA 3P24A 4WFVA 5EPQA 5DPQA 1QY1A 1SY3A 1KT6A 2M4LA 5HTEA 5HA0A 3U03A 4KH8A 1IW2A 4YKOA 4NNSA 3NBXX 4WFUA 2BS6A 5HZ5A 3D95A 3OD9A 3U9PC 1YUPA 4RUNA 2AH7X 2JOZA 3O22A 1YP7A 5EDCA 3LHNA 5L8IA 3UEVA 3ZQ3A 2RCQA 4GH7A 4YMYA 2LB6A 1JJXA 3AKNA 1BSQA 3FA9A 2FT9A 4ML7B 4NP1A 1T8VA 3ZW2A 1KT5A 1ACDA 1I05A 5BVTA 5KHPA 3NR3A 2Q9SA 2X8SA 3WXQA 4BVMA 1GX9A 1OEKA 1QG5A 4QYPA 4A1HA 4IB9A 4OMWA 4EFGA 3Q6LA 2FLJA 2BHVA 4I3BA 5KIDA 2KTDA 4MVLA 4IAWA 2WR6A 3D96A 1T0VA 1HMSA 3I17A 1G5WA 3FA6A 1FTPA 1KT7A 1LIFA 2AT8X 1B56A 3FR2A 1BRPA 2CZTA 1ERXA 3C76X 5AEOA 4ORSA 3RZYA 3IA8A 3PQSA 2R73A 4I6SA 4OS3A 3HK1A 4FBOA 4WBKA 2PY1A 1U18A 2JW1A 3BY0A 1VYFA 3FIQA 5FENA 2X46A 4ORXA 4RUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMR A;  2WUT A;  2K62 A;  1VYG A;  5D45 A;  4IB7 A;  3FEL A;  1JYJ A;  1JZU A;  3HWF A;  2FWV A;  1JYD A;  4YDA A;  3AKM A;  2NP1 A;  4I3D A;  5HZ8 A;  3FA7 A;  4GNY A;  1FDQ A;  1CBS A;  1ICN A;  3FEP A;  3I0A A;  3D97 A;  1IKE A;  5L8O A;  4XME A;  3BSZ E;  3STN A;  2HZR A;  4HPC A;  4GET A;  4GE1 A;  1MVG A;  3BLG A;  4GRJ A;  4ORW A;  4ZR2 A;  4HPA A;  1GXA A;  1EUO A;  2NNE A;  2WEX A;  4I9S A;  4TLJ A;  4YBP A;  4ZHD A;  1OBQ A;  2ACO A;  1IFB A;  5F6B A;  4DQ4 A;  1EAL A;  1PM1 X;  1SXW A;  1KQX A;  5DG4 A;  1FEM A;  1T68 X;  2EU7 X;  3PPT A;  1EIO A;  3B2I A;  3WJB A;  4ZFX A;  1S44 A;  3BX7 A;  3MVF A;  1EPB A;  5LKE A;  2A2G A;  4AZR A;  1VPR A;  2NNQ A;  3IFB A;  1X89 A;  3GAQ A;  4YFQ A;  1GGL A;  5KIC A;  1Z24 A;  3P6G A;  2HNX A;  4QZT A;  3WBG A;  4AZP A;  4I3C A;  3ZUO A;  1RBP A;  3KQ0 A;  3VG4 A;  2XST A;  1JV4 A;  4GKC A;  3WJG A;  1LFO A;  1SY1 A;  3WJF A;  3NX1 A;  5IO5 A;  5K06 A;  1EPA A;  2A13 A;  3STK A;  5L8N A;  4AYH A;  4ARH A;  1AVG I;  2FR2 A;  3MBT A;  4YGH A;  3KFG A;  1I4U A;  4IB6 A;  3O2Y A;  4XMF A;  3CR6 A;  5EZ2 A;  1I04 A;  1LIC A;  3S26 A;  3O19 A;  4TKH A;  5F58 A;  5H9A A;  2KT4 B;  1FEN A;  5F7G A;  1E06 A;  5H9K A;  3EYC A;  1DFV A;  4ORR A;  2FR3 A;  1MUP A;  1LIE A;  2K23 A;  2Q2P A;  1X8N A;  2BLG A;  1KGL A;  2CM4 A;  1PEE A;  3HWD A;  4AZN A;  2YG2 A;  1XCA A;  4LKT A;  4XMG A;  1LKE A;  2R56 A;  2Q2M A;  1PBO A;  2G7B A;  3QKG A;  3EMM A;  1GT3 A;  5H9N A;  1KQW A;  1IIU A;  1GT1 A;  1BEB A;  2JU8 A;  4AZO A;  4XMC A;  4ZCB A;  4ZH6 A;  3UEX A;  4AZQ A;  2N93 A;  3BDR A;  1B4M A;  4ORY A;  1OPB A;  4O9S A;  4OMX A;  1TOW A;  1RLB E;  4LKP A;  4QAE A;  4K19 A;  2GC9 A;  4NLI A;  2QOS C;  2W2F A;  2LBA A;  1ZND A;  2L9C A;  5HCD C;  1KOI A;  1QQS A;  1JBH A;  1E00 A;  3JSQ A;  4TJZ A;  3C78 X;  5F6Z A;  1MDC A;  3NP1 A;  1B8E A;  3CQN A;  3VG3 A;  2FRS A;  2XKL A;  2Q39 A;  3TGB A;  4YGZ A;  5F1E A;  3UEU A;  1BSO A;  1DZJ A;  2FS7 A;  3G7X A;  4YCH A;  3T1D A;  3FEK A;  4N7C A;  2RD7 C;  1OEJ A;  3P6H A;  4HPB A;  4CK4 A;  1EQD A;  2MO5 A;  3BX8 A;  1A3Y A;  2JN3 A;  4XMH A;  1YWB A;  4QZU A;  3WVM A;  4YFR A;  3WJD A;  3TZS A;  1YIV A;  1KXO A;  1X8U A;  5HZ9 A;  4ZHF A;  4KII A;  5D4A A;  2A0A A;  3BU9 A;  4R0B A;  4D6A A;  1ZNE A;  1LF7 A;  4I9R A;  5B29 A;  5LJB A;  1SA8 A;  1G7N A;  3EBW A;  3KFH A;  1S7D A;  3PED A;  5LJC A;  1ZNL A;  1KT4 A;  1AEL A;  3FR5 A;  4DQ3 A;  4ALB A;  1OPA A;  1TOU A;  3L4R A;  1QY0 A;  2ACP X;  1PMP A;  1DZK A;  3VG2 A;  2OZQ A;  3CWK A;  5HA1 A;  1ML7 A;  3TGC A;  2AKQ A;  4YH0 A;  1LNM A;  5HZQ A;  1G85 A;  1KZW A;  3FA8 A;  1GT5 A;  1ALB A;  2L5P A;  4A60 A;  3CBC A;  1H91 A;  4QGV A;  4Y0P A;  3KFI A;  3FW5 A;  1QY2 A;  3OJY C;  5H8T A;  2LKK A;  5IO7 A;  1R0U A;  4NNT A;  4EDE A;  2E4J A;  4NYR A;  1SXU A;  2NND A;  3NX2 A;  5BVS A;  2ANS A;  1CBQ A;  4IBA A;  4XMD A;  3STM X;  3CQR A;  3PH5 A;  1YWC A;  2Q4N A;  1JJJ A;  4ZHC A;  1BRQ A;  2W2B A;  2R74 A;  3BRN A;  2QO6 A;  4IMO A;  5C0N A;  2WWP A;  1E5P A;  4TKJ A;  1QFV A;  2L67 A;  1L6M A;  1CJ5 A;  1I06 A;  1O8V A;  4HFO A;  4EEJ A;  4D6B A;  2RA6 A;  3CBS A;  2AMM X;  2ALL X;  1IFC A;  3FR4 A;  3NQ9 A;  2FS6 A;  3APV A;  3DSZ A;  1AQB A;  2OFR X;  2WSJ A;  1HMT A;  4EXZ A;  1EII A;  1GKA B;  2G78 A;  3F9D A;  5H9L A;  5HAE A;  1S2P A;  1X8O A;  3JS1 A;  2CM9 A;  1O1V A;  2OFM X;  5D8J A;  1MX7 A;  3FW4 A;  4TKB A;  3B2L A;  2AL0 X;  1URE A;  1NP1 A;  1SXX A;  1GKA A;  3HWE A;  3KZA A;  1KT3 A;  1D3S A;  3P6F A;  1ZNK A;  1KZX A;  2WQA E;  4YBU A;  2FTB A;  3P6C A;  1NGL A;  2OVA A;  1ERB A;  1LIB A;  1X8P A;  4OS0 A;  2AT6 X;  3NPO A;  2A2U A;  3EBK A;  5LJH A;  1MX8 A;  2W2A A;  5FFH A;  2CBS A;  1A57 A;  1D2U A;  1FEL A;  1BLR A;  1A2D A;  2CBR A;  1E02 A;  1N0S A;  2MJI A;  2DM5 A;  1DF3 A;  4TQ2 A;  2ASN X;  1BJ7 A;  4ZH9 A;  2GTF X;  2RQ0 A;  1TW4 A;  2WEW A;  4LZU A;  5D48 A;  2CZU A;  2L68 A;  2AT5 X;  3DTQ A;  3BS2 A;  4YKM A;  2AT0 X;  4YCE A;  3APW A;  3CMP A;  4UU2 A;  4ES7 A;  2X45 A;  5JR8 A;  1BSY A;  2QO4 A;  4N7D A;  1YP6 A;  2IFB A;  3PEC A;  1OEE A;  3HWG A;  3RSW A;  3PP6 A;  3PH6 A;  1HQP A;  3C77 X;  3SAO A;  1CBI A;  1X71 A;  3WJC A;  1CBR A;  4HPD A;  4BOE A;  2OVE A;  4A8Z A;  1XKI A;  2OVD A;  4MVK A;  1OBU A;  2F73 A;  2GJ5 A;  1CRB A;  5IO6 A;  4NYQ A;  5HCE C;  1YWD A;  4MVI A;  5EDB A;  1A18 A;  1NP4 A;  4ODD A;  5HWZ A;  1B0O A;  1HBP A;  5LJK A;  4QYN A;  2MM3 A;  3ELX A;  1QAB E;  4PSQ A;  1ZNH A;  1HBQ A;  3FLL A;  4ALO A;  3VG6 A;  4ZHH A;  1ADL A;  1QWD A;  5HCC C;  2QM9 A;  2LFO A;  1EXS A;  1LID A;  1X8Q A;  5D47 A;  3APX A;  5B27 A;  1ZRY A;  4ORU A;  5HZ6 A;  1GX8 A;  1ICM A;  1DC9 A;  1DZM A;  3ELZ A;  4Y0S A;  2AT3 X;  3K3L A;  1BBP A;  1SXY A;  3P6E A;  2RCT A;  3TGA A;  1GT4 A;  3BU1 A;  2O62 A;  3APU A;  4IMN A;  1SY2 A;  3EM0 A;  5LJD A;  3VG7 A;  1G74 A;  2HLV A;  4GNW A;  2P8G A;  1LPJ A;  2POA A;  1TVQ A;  4QGX A;  5FAZ A;  3NAD A;  4LZV A;  1BM5 A;  3KFF A;  1O1U A;  3B2J A;  4OS8 A;  1OBP A;  2WQ9 A;  4IAX A;  4M6S A;  2G79 A;  4AW8 A;  4BQU A;  5AQ6 A;  4YDB A;  3ZUI A;  1HN2 A;  5EED A;  3F8A A;  3U0D A;  4NLJ A;  3TF6 A;  2A3F X;  4QGW A;  4ZHG A;  5LJG A;  1QFT A;  4Y0Q A;  4UU3 A;  3VG5 A;  1U17 A;  1U0X A;  1IKJ A;  1GM6 A;  1FE3 A;  3FMZ A;  5BVQ A;  1BWY A;  5EEE A;  5HTD A;  1DZP A;  3B2K A;  1TXL A;  5LKF A;  2HZQ A;  1P6P A;  1SY0 A;  1YWA A;  1UZ2 X;  4ZJ0 A;  1DV9 A;  1AB0 A;  1EW3 A;  4ZGU A;  3NQ3 A;  2JU7 A;  3P6D A;  4AZM A;  4YGG A;  4M7M A;  2LBV A;  4TNN A;  5CE4 A;  2HMB A;  4YFP A;  1ZNG A;  3UEW A;  3FEN A;  3B2H A;  4IB8 A;  5HBS A;  2HYS A;  2JU3 A;  4Y0R A;  2QO5 A;  5LJE A;  3WJE A;  4WFV A;  5EPQ A;  5DPQ A;  1QY1 A;  1SY3 A;  1KT6 A;  5HTE A;  5HA0 A;  3U03 A;  4YKO A;  1IW2 A;  4NNS A;  4WFU A;  5HZ5 A;  3D95 A;  3U9P C;  1YUP A;  4RUN A;  2AH7 X;  2JOZ A;  3O22 A;  1YP7 A;  5EDC A;  5L8I A;  3UEV A;  3ZQ3 A;  2RCQ A;  4GH7 A;  4YMY A;  2LB6 A;  1JJX A;  3AKN A;  1BSQ A;  3FA9 A;  2FT9 A;  4NP1 A;  4A1Y A;  1T8V A;  5BVT A;  1KT5 A;  1ACD A;  1I05 A;  5KHP A;  3NR3 A;  2Q9S A;  3WXQ A;  4BVM A;  1GX9 A;  1OEK A;  1QG5 A;  4QYP A;  4A1H A;  4IB9 A;  4OMW A;  4EFG A;  3Q6L A;  2FLJ A;  4I3B A;  5KID A;  2KTD A;  4MVL A;  4IAW A;  2WR6 A;  3D96 A;  1T0V A;  1HMS A;  3I17 A;  1G5W A;  3FA6 A;  1FTP A;  1KT7 A;  1LIF A;  2AT8 X;  1B56 A;  3FR2 A;  1BRP A;  2CZT A;  1ERX A;  3C76 X;  4ORS A;  3RZY A;  3IA8 A;  2R73 A;  4OS3 A;  3HK1 A;  4WBK A;  2PY1 A;  1U18 A;  3BY0 A;  1VYF A;  3FIQ A;  5FEN A;  2X46 A;  4ORX A;  4RUU A; 
#chains in the Genus database with same CATH topology
 1JMZ A;  1HMR A;  2WUT A;  5FQ6 E;  1VWP B;  2K62 A;  1VYG A;  1KL3 A;  5D45 A;  4IB7 A;  3FEL A;  5L3Y A;  2MF6 A;  1JYJ A;  2RTJ A;  3HWF A;  1JZU A;  2ZAI A;  2FWV A;  1JYD A;  1SWF A;  4YDA A;  2BS5 A;  3AKM A;  2NP1 A;  4B55 A;  2BT9 A;  4I3D A;  3UEV A;  5HZ8 A;  3FA7 A;  4QQ1 A;  4GNY A;  4CPE A;  1FDQ A;  2I5Z O;  1CBS A;  3MM0 A;  1ICN A;  3EW1 A;  3FEP A;  1SWJ A;  3I0A A;  5B11 O;  3T2W A;  1E2T A;  3D97 A;  1Y9T A;  1IKE A;  5L8O A;  4XME A;  4CDF A;  3BSZ E;  3STN A;  4KC8 A;  2HZR A;  2F01 A;  4HPC A;  4WHI A;  1I78 A;  2DJG A;  4GE1 A;  3PDF A;  4GET A;  5CSE A;  3RE6 A;  1MVG A;  2X34 A;  2HKD A;  3BLG A;  1SRJ A;  2UYW A;  4GRJ A;  4HPA A;  4ORW A;  1GXA A;  4ZR2 A;  4GDZ A;  1EUO A;  2NNE A;  2WEX A;  4I9S A;  2RTE B;  4TLJ A;  1VYO A;  4GDA A;  4YBP A;  4ZHD A;  1PTS A;  4BCS A;  1OBQ A;  1MM9 A;  1SWS A;  2ACO A;  5IRA A;  1IFB A;  5F6B A;  1SWG A;  4DQ4 A;  3ZWE A;  1SWQ A;  1NBX A;  3RWX A;  1PM1 X;  1SXW A;  4CPH B;  1EAL A;  1IJ8 A;  1KQX A;  5DG4 A;  1FEM A;  1T68 X;  4JNJ A;  3WOV A;  4O3Z A;  2EU7 X;  3PPT A;  1EIO A;  2OF9 A;  2GTL N;  3B2I A;  3WJB A;  4ZFX A;  1SWU A;  1S44 A;  2AVI A;  2YMS A;  3BX7 A;  3MVF A;  1EPB A;  5LKE A;  2A2G A;  3X00 A;  4AZR A;  5B5F A;  2FGS A;  4CPI A;  1VPR A;  2NNQ A;  3IFB A;  1X89 A;  3GAQ A;  4YFQ A;  1GGL A;  3PK2 A;  4CDD A;  4CSB A;  5KIC A;  3SLJ A;  1Z24 A;  3P6G A;  2HNX A;  1I9H A;  4LQZ A;  4QZT A;  3WBG A;  2MWH A;  3WYP A;  4AZP A;  1SWN A;  1VWA B;  4I3C A;  3ZUO A;  1AVD A;  1RBP A;  2DJF A;  3KQ0 A;  4GGT A;  3VG4 A;  2XST A;  3WZQ A;  3SOT A;  1JV4 A;  2IZF B;  4GKC A;  3WJG A;  1LFO A;  1SY1 A;  3WJF A;  3NX1 A;  1VWE B;  3OE3 A;  5IO5 A;  4Y59 A;  5K06 A;  1EPA A;  2RTP B;  2A13 A;  3STK A;  5L8N A;  1UYN X;  4AYH A;  4ARH A;  1AVG I;  2FR2 A;  3MBT A;  4YGH A;  3KFG A;  1I4U A;  3GE2 A;  4IB6 A;  3WZP A;  1JMX A;  3O2Y A;  4XMF A;  3CR6 A;  5EZ2 A;  1I04 A;  1LIC A;  1NQM A;  3S26 A;  4YVB A;  3O19 A;  4TKH A;  2OL8 O;  5F58 A;  4BX5 B;  5H9A A;  4U9C A;  2KT4 B;  1FEN A;  5F7G A;  1E06 A;  4FBR A;  5H9K A;  2OVS A;  1RXJ A;  3EYC A;  4L3R A;  1DFV A;  4ORR A;  2FR3 A;  1VWI B;  1MUP A;  1STR B;  1LIE A;  2K23 A;  3FYF A;  5CHK A;  3NQK A;  4A1Y A;  2Q2P A;  1X8N A;  3RDO A;  2PI3 O;  2BLG A;  1N43 A;  1VWC B;  4BX5 A;  1KGL A;  2CM4 A;  1PEE A;  3CKG A;  3HWD A;  4AZN A;  2YG2 A;  1UYO X;  1XCA A;  4HWM A;  4LKT A;  1VWM B;  4XMG A;  3RKG A;  1LKE A;  4DNE A;  4Z2V A;  3VE2 A;  2R56 A;  1W5R A;  2Q2M A;  1PBO A;  2G7B A;  1DF8 A;  3QKG A;  3EMM A;  1GT3 A;  2RTI B;  1KFF A;  1KQW A;  1IIU A;  4O3X B;  5H9N A;  1GT1 A;  1BEB A;  2JU8 A;  4PJ2 A;  2RTR B;  3UAQ A;  4AZO A;  4XMC A;  4ZCB A;  4ZH6 A;  3UEX A;  4AZQ A;  3D4R A;  2N93 A;  3BDR A;  4JHQ A;  1B4M A;  4CDE A;  2Z4I A;  4ORY A;  2C4I A;  1OPB A;  4O9S A;  4OMX A;  1TOW A;  1HQQ A;  1MK5 A;  1RLB E;  2BC3 A;  4LKP A;  4QAE A;  2CAM A;  4K19 A;  2GC9 A;  4NLI A;  2QOS C;  4CV7 A;  3Q34 A;  2W2F A;  2LBA A;  1ZND A;  2L9C A;  3MX7 A;  2IZA A;  1SRE A;  4FQB B;  5HCD C;  2RTC B;  4NV7 A;  1KOI A;  3WZO A;  1QQS A;  1SRG A;  4GGZ A;  1N4J A;  1JBH A;  3N91 A;  1E00 A;  3JSQ A;  4TJZ A;  3C78 X;  1N9M A;  5F6Z A;  1MDC A;  2C1Q A;  3NP1 A;  4GGR A;  1B8E A;  3EW2 A;  2Y32 A;  3CQN A;  3VG3 A;  2FRS A;  2XKL A;  3E3C A;  1JJU A;  2Q39 A;  3RDX A;  4JO6 A;  3TGB A;  5FQ8 E;  4YGZ A;  5F1E A;  3UEU A;  1BSO A;  2RTM A;  5IRU A;  1MOY A;  2BSZ A;  1DZJ A;  2FS7 A;  3G7X A;  4YCH A;  3T1D A;  3FEK A;  4N7C A;  2RD7 C;  1OEJ A;  3P6H A;  4HPB A;  1HY2 A;  4CK4 A;  1EQD A;  4EKV A;  1JIW I;  4KC7 A;  1LDQ A;  4C5P A;  2MO5 A;  3BX8 A;  1A3Y A;  2JN3 A;  2RTO B;  3H3I A;  4XMH A;  4ZGF A;  1YWB A;  2GTL M;  2MHD A;  4QZU A;  3WVM A;  3WJD A;  4YFR A;  4OEL A;  3TZS A;  1YIV A;  2A5B A;  2VFC A;  3D9W A;  1KXO A;  1X8U A;  2GTL O;  4QRL A;  5HZ9 A;  4ZHF A;  4KII A;  5D4A A;  2A0A A;  3BU9 A;  4R0B A;  1Y9L A;  4D6A A;  3AUM O;  1ZNE A;  1LF7 A;  4I9R A;  5B29 A;  5K68 A;  5LJB A;  1HXZ A;  1SA8 A;  3P02 A;  4GJS A;  2Y3F A;  1G7N A;  3EBW A;  3KFH A;  2OYB O;  1S7D A;  3PED A;  2RTB B;  1ZNL A;  5LJC A;  1VWR B;  3SZI A;  1KT4 A;  1NDJ A;  1AEL A;  2X4M A;  3FR5 A;  4DQ3 A;  2QMI A;  4ALB A;  1OPA A;  1TOU A;  2JMB A;  3L4R A;  1QY0 A;  2ACP X;  1Y55 X;  2Z4H A;  1PMP A;  1DZK A;  2G8C O;  2IZK A;  3KVN A;  1RXK A;  3VG2 A;  3VE1 A;  1LCW A;  1VWO B;  2OZQ A;  3CWK A;  1ML7 A;  5HA1 A;  4QNI A;  2AKQ A;  3TGC A;  1SWA A;  4CPF A;  3F6Z B;  4OEM A;  1LNM A;  4YH0 A;  4MIS A;  1STP A;  1G85 A;  5HZQ A;  3S60 A;  1KZW A;  3FA8 A;  2IZG B;  1GT5 A;  1ALB A;  1Y52 X;  2L5P A;  4A60 A;  3CBC A;  1H91 A;  3CKF A;  4CPH A;  2OFB A;  4Y0P A;  4QGV A;  3KFI A;  3FW5 A;  2FKJ A;  1QY2 A;  3OJY C;  2AF5 A;  5H8T A;  3S5X A;  2LKK A;  5IO7 A;  1R0U A;  1Y53 X;  4NNT A;  2G5L A;  4EDE A;  1LDO A;  3RY2 A;  3PQU A;  2E4J A;  4NYR A;  4U8U N;  1SXU A;  4IRW A;  2NND A;  3NX2 A;  5BVS A;  4Z2O A;  2ANS A;  1SWL A;  3T6L A;  2F09 A;  1CBQ A;  4IBA A;  4XMD A;  3STM X;  3SZJ A;  3CQR A;  4ON1 A;  3PH5 A;  4KCA A;  1YWC A;  2RTN B;  2Q4N A;  3VPJ E;  1JJJ A;  4ZHC A;  2GH7 A;  1SRF A;  1BRQ A;  4BGF A;  2W2B A;  2R74 A;  3BRN A;  2QO6 A;  2RTG B;  4GJV A;  4IMO A;  5C0N A;  2WWP A;  3HOL A;  1E5P A;  1EI5 A;  4TKJ A;  3WYQ A;  2IZI A;  4GU8 A;  1QFV A;  1W4T A;  2L67 A;  1L6M A;  1CJ5 A;  1SWO A;  1I06 A;  5K67 A;  2X56 A;  2RTH B;  1VWB B;  1O8V A;  4HFO A;  4EEJ A;  1RXH A;  4D6B A;  2RA6 A;  3CBS A;  2AMM X;  2ALL X;  1IFC A;  1SLE B;  3FR4 A;  1SRH A;  3NQ9 A;  2FS6 A;  3APV A;  4MIR A;  3ZI8 A;  1SWC A;  3EC5 A;  3DSZ A;  1AQB A;  2OFR X;  4INN A;  2WSJ A;  4O49 A;  3VGW A;  3VU1 A;  4Z2P A;  2JGS A;  3MG5 A;  1HMT A;  4EXZ A;  1EII A;  1GKA B;  2G78 A;  2IZD B;  3F9D A;  5H9L A;  4O3Y A;  1S2P A;  3RY1 A;  1X8O A;  5HAE A;  4BJ8 A;  3JS1 A;  1AVE A;  1K24 A;  3S5V A;  4BX7 B;  2CM9 A;  1O1V A;  2OFM X;  5D8J A;  1MX7 A;  3FW4 A;  4TKB A;  3B2L A;  2AL0 X;  4O4X A;  4I60 A;  4O4O A;  1URE A;  4BX6 B;  1NP1 A;  1SXX A;  1GKA A;  1OSP O;  3HWE A;  3KZA A;  5CYB A;  1KT3 A;  1D3S A;  3P6F A;  1SRI A;  2ZAG A;  1K3B A;  4BX7 A;  1ZNK A;  1KZX A;  2OFA A;  2WQA E;  4YBU A;  1VWK B;  2FTB A;  3P6C A;  1NGL A;  1SWE A;  1ERB A;  1LIB A;  1X8P A;  2OVA A;  2RTK A;  2OF8 A;  4FGI B;  4BX6 A;  4OS0 A;  2AT6 X;  4NV8 A;  3NPO A;  4OKA A;  2A2U A;  3EBK A;  4Z28 A;  4ID2 A;  5AJC A;  5LJH A;  1MX8 A;  2VDF A;  2W2A A;  5FFH A;  2CBS A;  3QQ2 A;  1WBI A;  1A57 A;  1D2U A;  2OY1 O;  3OBL A;  4GK9 A;  1FEL A;  1BLR A;  1A2D A;  2CBR A;  2VFB A;  2RN4 A;  5AJB A;  2OY7 A;  1E02 A;  1N0S A;  2MJI A;  1SLF B;  2DM5 A;  1DF3 A;  4TQ2 A;  2ASN X;  1BJ7 A;  4ZH9 A;  5B10 O;  1N7Y A;  2GTF X;  2RQ0 A;  2KTS A;  4O3W A;  1TW4 A;  2A5C A;  2WEW A;  4LZU A;  5D48 A;  1VWL B;  3V8U A;  2CZU A;  2L68 A;  2OL6 O;  1WUB A;  2AT5 X;  3DTQ A;  3BS2 A;  4YKM A;  2AT0 X;  5IRW A;  4YCE A;  1NQN A;  3APW A;  3CMP A;  3HTY A;  4UU2 A;  4ES7 A;  1LUQ A;  2X45 A;  5JD2 A;  3LTW A;  3RDU A;  1BSY A;  2QO4 A;  4N7D A;  1YP6 A;  2IFB A;  3PEC A;  1OEE A;  3HWG A;  4GUZ A;  4U3Q A;  3PP6 A;  4U46 A;  3RSW A;  3PH6 A;  4FBV A;  3FDC A;  5B2A O;  1HQP A;  3C77 X;  3ZZV A;  4COT A;  4Y5D A;  3SAO A;  5BYP A;  1CBI A;  1X71 A;  2IZC B;  3WJC A;  1CBR A;  4HPD A;  4BBO A;  4BOE A;  2OVE A;  3ZW0 B;  2OL7 A;  1XKI A;  4A8Z A;  2OVD A;  4MVK A;  3VHI A;  1OBU A;  1W6F A;  3T2X A;  1VWH B;  1MEP A;  2F73 A;  2GJ5 A;  3HPE A;  1CRB A;  5IO6 A;  4NYQ A;  5HCE C;  1VWG B;  1YWD A;  4MVI A;  5EDB A;  1A18 A;  3SLT A;  3VHM A;  1NP4 A;  4ODD A;  5HWZ A;  1B0O A;  1HBP A;  5LJK A;  4MVE A;  4QYN A;  2MM3 A;  3ELX A;  4O4S A;  1QAB E;  4PSQ A;  4U8U M;  3ZW0 A;  1ZNH A;  1HBQ A;  3FLL A;  2KW1 A;  2FHL A;  1N9Y A;  3VG6 A;  1ADL A;  4ALO A;  4ZHH A;  1QWD A;  5HCC C;  2QM9 A;  2LFO A;  4U8U O;  2OY5 O;  1EXS A;  2LA7 A;  1LID A;  1SWH A;  1X8Q A;  5IXG A;  5D47 A;  3APX A;  5B27 A;  1ZRY A;  4ORU A;  5HZ6 A;  1GX8 A;  1RST B;  2RTD B;  4KT5 A;  1ICM A;  3RBY A;  1VWF B;  1Y0G A;  3ZW1 B;  1DC9 A;  2Y3E A;  1DZM A;  3ELZ A;  4NW4 A;  2AT3 X;  3K3L A;  1BBP A;  1SMP I;  1SXY A;  3P6E A;  2RCT A;  4Y0S A;  3TGA A;  3JQO A;  1GT4 A;  4IAB A;  4CDC A;  3BU1 A;  2O62 A;  3APU A;  4IMN A;  1SY2 A;  3EM0 A;  1JQP A;  5LJD A;  1LEL A;  3VG7 A;  3ZW1 A;  1G74 A;  3WZN A;  1SWB A;  2HLV A;  5FQ7 E;  4GNW A;  2P8G A;  1LPJ A;  2POA A;  1TVQ A;  4QGX A;  5FAZ A;  2IZE B;  1KL4 A;  3NAD A;  1RSU B;  4LZV A;  2A8G A;  1BM5 A;  3KFF A;  1O1U A;  3B2J A;  4OS8 A;  1OBP A;  1NC9 A;  4EQA C;  2WQ9 A;  4IAX A;  4M6S A;  1VWD B;  2G79 A;  4AW8 A;  4BQU A;  5AQ6 A;  4YDB A;  3ZUI A;  3AEH A;  1HN2 A;  3RDS A;  5EED A;  3F8A A;  3U0D A;  4NLJ A;  3TF6 A;  3RDM A;  4JGL A;  1LCZ A;  2A3F X;  2RTL A;  4QGW A;  4ZHG A;  5LJG A;  1QFT A;  4Y0Q A;  2OY8 A;  2FHN X;  4UU3 A;  3VG5 A;  3LV4 A;  1U17 A;  1U0X A;  1IKJ A;  1GM6 A;  4GD9 A;  1FE3 A;  3FMZ A;  4GZV A;  1LCV A;  1KL5 A;  5BVQ A;  1BWY A;  5EEE A;  5HTD A;  2X8T A;  5JR8 A;  1DZP A;  1VWN B;  1TXL A;  2QOM A;  2HZQ A;  3B2K A;  5LKF A;  1P6P A;  1SY0 A;  1YWA A;  1UZ2 X;  4ZJ0 A;  4DCB A;  1DV9 A;  2X32 A;  1AB0 A;  1EW3 A;  3FID A;  4ZGU A;  3NQ3 A;  2X8F A;  2JU7 A;  3P6D A;  4I95 A;  4AZM A;  5F2B A;  4YGG A;  4M7M A;  4O4U A;  4TNN A;  2KD2 A;  2LBV A;  5CE4 A;  2HMB A;  4YFP A;  2IZB A;  1ZNG A;  3UEW A;  3FEN A;  3B2H A;  1VWJ B;  4IB8 A;  4L1N A;  3SZH A;  5HBS A;  1SWR A;  2HYS A;  2JU3 A;  4Y0R A;  2QO5 A;  5LJE A;  3VHH A;  3T6F A;  3HOE A;  3WJE A;  3P24 A;  2FKG A;  2ZSC A;  4WFV A;  5EPQ A;  2QCB A;  5DPQ A;  1QY1 A;  2WPU A;  1SY3 A;  1KT6 A;  2M4L A;  5HTE A;  5HA0 A;  3RE5 A;  3U03 A;  4KH8 A;  1IW2 A;  4MEE A;  4YKO A;  4NNS A;  5B3M O;  3NBX X;  4WFU A;  2BS6 A;  5HZ5 A;  3D95 A;  3OD9 A;  3U9P C;  1SLD B;  1YUP A;  2RTQ B;  4RUN A;  2I5V O;  2AH7 X;  1SWT A;  2JOZ A;  1RAV A;  1YP7 A;  3LHN A;  3O22 A;  5EDC A;  5L8I A;  2RCQ A;  4GH7 A;  3ZQ3 A;  2LB6 A;  4YMY A;  1JJX A;  3AKN A;  1BSQ A;  3FA9 A;  2FT9 A;  4ML7 B;  4NP1 A;  1T8V A;  1SLG B;  1KT5 A;  1ACD A;  1I05 A;  3ZW2 A;  5BVT A;  5KHP A;  3NR3 A;  2Q9S A;  1SWK A;  2X8S A;  3WXQ A;  2RTA A;  1GX9 A;  1OEK A;  1QG5 A;  4QYP A;  4A1H A;  4BVM A;  2UZ2 A;  4IB9 A;  4OMW A;  3Q6L A;  4EFG A;  2FLJ A;  2BHV A;  4I3B A;  5KID A;  1STS B;  1PBY A;  1VWQ B;  2IZH B;  2KTD A;  4Z27 A;  4MVL A;  4IAW A;  2WR6 A;  1FJ1 E;  2IZJ A;  1T0V A;  3D96 A;  1HMS A;  3I17 A;  1G5W A;  3FA6 A;  1FTP A;  3RDQ A;  1KT7 A;  5B5G A;  1LIF A;  2AT8 X;  1B56 A;  3FR2 A;  1BRP A;  1SWP A;  2CZT A;  1ERX A;  3C76 X;  5AEO A;  4ORS A;  3RZY A;  1GX3 A;  3IA8 A;  1HXL A;  2R73 A;  3PQS A;  2C1S A;  3HK1 A;  4FBO A;  4I6S A;  4OS3 A;  2X55 A;  4WBK A;  2PY1 A;  1U18 A;  4Z6J A;  2JW1 A;  3BY0 A;  3SLO A;  2IZL B;  1VYF A;  3FIQ A;  5FEN A;  1SWD A;  2X46 A;  4ORX A;  4RUU A;  2RTF B; 
#chains in the Genus database with same CATH homology
 1HMR A;  2WUT A;  5FQ6 E;  2K62 A;  1VYG A;  5D45 A;  4IB7 A;  3FEL A;  1JYJ A;  1JZU A;  3HWF A;  2ZAI A;  2FWV A;  1JYD A;  4YDA A;  2BS5 A;  3AKM A;  2NP1 A;  2BT9 A;  4I3D A;  5HZ8 A;  3FA7 A;  4QQ1 A;  4GNY A;  1FDQ A;  1CBS A;  1ICN A;  3FEP A;  3I0A A;  3D97 A;  1Y9T A;  1IKE A;  5L8O A;  4XME A;  3BSZ E;  3STN A;  4KC8 A;  2HZR A;  4HPC A;  4WHI A;  4GET A;  4GE1 A;  1MVG A;  3BLG A;  4GRJ A;  4ORW A;  4ZR2 A;  4HPA A;  1GXA A;  4GDZ A;  1EUO A;  2NNE A;  2WEX A;  4I9S A;  4TLJ A;  4YBP A;  4ZHD A;  1OBQ A;  2ACO A;  1IFB A;  5F6B A;  4DQ4 A;  3ZWE A;  3RWX A;  1EAL A;  1PM1 X;  1SXW A;  1KQX A;  5DG4 A;  1FEM A;  1T68 X;  3WOV A;  4O3Z A;  2EU7 X;  3PPT A;  1EIO A;  2GTL N;  3B2I A;  3WJB A;  4ZFX A;  1S44 A;  2YMS A;  3BX7 A;  3MVF A;  1EPB A;  5LKE A;  2A2G A;  4AZR A;  1VPR A;  2NNQ A;  3IFB A;  1X89 A;  3GAQ A;  4YFQ A;  1GGL A;  4CSB A;  5KIC A;  1Z24 A;  3P6G A;  2HNX A;  4LQZ A;  4QZT A;  3WBG A;  2MWH A;  4AZP A;  4I3C A;  3ZUO A;  1RBP A;  3KQ0 A;  3VG4 A;  2XST A;  3SOT A;  1JV4 A;  4GKC A;  3WJG A;  1LFO A;  1SY1 A;  3WJF A;  3NX1 A;  3OE3 A;  5IO5 A;  5K06 A;  1EPA A;  2A13 A;  3STK A;  5L8N A;  4AYH A;  4ARH A;  1AVG I;  2FR2 A;  3MBT A;  4YGH A;  3KFG A;  1I4U A;  3GE2 A;  4IB6 A;  3O2Y A;  4XMF A;  3CR6 A;  5EZ2 A;  1I04 A;  1LIC A;  3S26 A;  3O19 A;  4TKH A;  5F58 A;  5H9A A;  4U9C A;  2KT4 B;  1FEN A;  5F7G A;  1E06 A;  4FBR A;  5H9K A;  2OVS A;  3EYC A;  4L3R A;  1DFV A;  4ORR A;  2FR3 A;  1MUP A;  3FYF A;  1LIE A;  2K23 A;  3NQK A;  4A1Y A;  2Q2P A;  1X8N A;  2BLG A;  1KGL A;  2CM4 A;  1PEE A;  3HWD A;  4AZN A;  2YG2 A;  1XCA A;  4HWM A;  4LKT A;  4XMG A;  3RKG A;  1LKE A;  3VE2 A;  2R56 A;  2Q2M A;  1PBO A;  2G7B A;  3QKG A;  3EMM A;  1GT3 A;  4O3X B;  5H9N A;  1KQW A;  1IIU A;  1GT1 A;  1BEB A;  2JU8 A;  4PJ2 A;  3UAQ A;  4AZO A;  4XMC A;  4ZCB A;  4ZH6 A;  3UEX A;  4AZQ A;  3D4R A;  2N93 A;  3BDR A;  1B4M A;  2Z4I A;  4ORY A;  1OPB A;  4O9S A;  4OMX A;  1TOW A;  1RLB E;  4LKP A;  4QAE A;  4K19 A;  2GC9 A;  4NLI A;  2QOS C;  4CV7 A;  2W2F A;  2LBA A;  1ZND A;  2L9C A;  3MX7 A;  4FQB B;  5HCD C;  1KOI A;  1QQS A;  1JBH A;  3N91 A;  1E00 A;  3JSQ A;  4TJZ A;  3C78 X;  5F6Z A;  1MDC A;  3NP1 A;  1B8E A;  3CQN A;  3VG3 A;  2FRS A;  2XKL A;  3E3C A;  2Q39 A;  3TGB A;  5FQ8 E;  4YGZ A;  5F1E A;  3UEU A;  1BSO A;  1DZJ A;  2FS7 A;  3G7X A;  4YCH A;  3T1D A;  3FEK A;  4N7C A;  2RD7 C;  1OEJ A;  3P6H A;  4HPB A;  4CK4 A;  1EQD A;  1JIW I;  4KC7 A;  2MO5 A;  3BX8 A;  1A3Y A;  2JN3 A;  3H3I A;  4XMH A;  4ZGF A;  1YWB A;  2GTL M;  2MHD A;  4QZU A;  3WVM A;  3WJD A;  4YFR A;  3TZS A;  1YIV A;  1KXO A;  1X8U A;  2GTL O;  4QRL A;  5HZ9 A;  4ZHF A;  4KII A;  5D4A A;  2A0A A;  3BU9 A;  4R0B A;  1Y9L A;  4D6A A;  1ZNE A;  1LF7 A;  4I9R A;  5B29 A;  5LJB A;  1SA8 A;  3P02 A;  1G7N A;  3EBW A;  3KFH A;  1S7D A;  3PED A;  5LJC A;  1ZNL A;  1KT4 A;  1AEL A;  3FR5 A;  4DQ3 A;  2QMI A;  4ALB A;  1OPA A;  1TOU A;  2JMB A;  3L4R A;  1QY0 A;  2ACP X;  2Z4H A;  1PMP A;  1DZK A;  3VG2 A;  3VE1 A;  2OZQ A;  3CWK A;  5HA1 A;  1ML7 A;  3TGC A;  4QNI A;  2AKQ A;  3F6Z B;  4YH0 A;  1LNM A;  4MIS A;  5HZQ A;  1G85 A;  3S60 A;  1KZW A;  3FA8 A;  1GT5 A;  1ALB A;  2L5P A;  4A60 A;  3CBC A;  1H91 A;  4QGV A;  4Y0P A;  3KFI A;  3FW5 A;  1QY2 A;  3OJY C;  5H8T A;  3S5X A;  2LKK A;  5IO7 A;  1R0U A;  4NNT A;  4EDE A;  3PQU A;  2E4J A;  4NYR A;  4U8U N;  1SXU A;  2NND A;  3NX2 A;  5BVS A;  2ANS A;  2F09 A;  1CBQ A;  4IBA A;  4XMD A;  3STM X;  3CQR A;  4ON1 A;  3PH5 A;  4KCA A;  1YWC A;  3VPJ E;  2Q4N A;  1JJJ A;  4ZHC A;  1BRQ A;  2W2B A;  2R74 A;  3BRN A;  2QO6 A;  4IMO A;  5C0N A;  2WWP A;  3HOL A;  1E5P A;  1EI5 A;  4TKJ A;  4GU8 A;  1QFV A;  2L67 A;  1L6M A;  1CJ5 A;  1I06 A;  1O8V A;  4HFO A;  4EEJ A;  4D6B A;  2RA6 A;  3CBS A;  2AMM X;  2ALL X;  1IFC A;  3FR4 A;  3NQ9 A;  2FS6 A;  3APV A;  4MIR A;  3ZI8 A;  3DSZ A;  1AQB A;  2OFR X;  4INN A;  2WSJ A;  4O49 A;  3VU1 A;  1HMT A;  4EXZ A;  1EII A;  1GKA B;  2G78 A;  3F9D A;  5H9L A;  5HAE A;  4O3Y A;  1S2P A;  1X8O A;  3JS1 A;  3S5V A;  2CM9 A;  1O1V A;  2OFM X;  5D8J A;  1MX7 A;  3FW4 A;  4TKB A;  3B2L A;  2AL0 X;  4O4X A;  4O4O A;  1URE A;  1NP1 A;  1SXX A;  1GKA A;  3HWE A;  3KZA A;  5CYB A;  1KT3 A;  1D3S A;  3P6F A;  2ZAG A;  1ZNK A;  1KZX A;  2WQA E;  4YBU A;  2FTB A;  3P6C A;  1NGL A;  2OVA A;  1ERB A;  1LIB A;  1X8P A;  4FGI B;  4OS0 A;  2AT6 X;  3NPO A;  2A2U A;  3EBK A;  4ID2 A;  5AJC A;  5LJH A;  1MX8 A;  2W2A A;  5FFH A;  2CBS A;  1A57 A;  1D2U A;  3OBL A;  4GK9 A;  1FEL A;  1BLR A;  1A2D A;  2CBR A;  2RN4 A;  5AJB A;  1E02 A;  1N0S A;  2MJI A;  2DM5 A;  1DF3 A;  4TQ2 A;  2ASN X;  1BJ7 A;  4ZH9 A;  2GTF X;  2RQ0 A;  2KTS A;  4O3W A;  1TW4 A;  2WEW A;  4LZU A;  5D48 A;  3V8U A;  2CZU A;  2L68 A;  2AT5 X;  3DTQ A;  3BS2 A;  4YKM A;  2AT0 X;  4YCE A;  3APW A;  3CMP A;  3HTY A;  4UU2 A;  4ES7 A;  2X45 A;  5JR8 A;  1BSY A;  2QO4 A;  4N7D A;  1YP6 A;  2IFB A;  3PEC A;  1OEE A;  3HWG A;  4U3Q A;  3RSW A;  3PP6 A;  3PH6 A;  4FBV A;  1HQP A;  3C77 X;  3ZZV A;  4COT A;  3SAO A;  5BYP A;  1CBI A;  1X71 A;  3WJC A;  1CBR A;  4HPD A;  4BOE A;  2OVE A;  3ZW0 B;  4A8Z A;  1XKI A;  2OVD A;  4MVK A;  1OBU A;  2F73 A;  2GJ5 A;  1CRB A;  5IO6 A;  4NYQ A;  5HCE C;  1YWD A;  4MVI A;  5EDB A;  1A18 A;  1NP4 A;  4ODD A;  5HWZ A;  1B0O A;  1HBP A;  5LJK A;  4MVE A;  4QYN A;  2MM3 A;  3ELX A;  4O4S A;  1QAB E;  4PSQ A;  4U8U M;  3ZW0 A;  1ZNH A;  1HBQ A;  3FLL A;  2KW1 A;  4ALO A;  3VG6 A;  4ZHH A;  1ADL A;  1QWD A;  5HCC C;  2QM9 A;  2LFO A;  4U8U O;  1EXS A;  2LA7 A;  1LID A;  1X8Q A;  5D47 A;  3APX A;  5B27 A;  1ZRY A;  4ORU A;  5HZ6 A;  1GX8 A;  4KT5 A;  3ZW1 B;  1ICM A;  3RBY A;  1DC9 A;  1DZM A;  3ELZ A;  4NW4 A;  2AT3 X;  3K3L A;  1BBP A;  1SMP I;  1SXY A;  3P6E A;  2RCT A;  4Y0S A;  3TGA A;  3JQO A;  1GT4 A;  4IAB A;  3BU1 A;  2O62 A;  3APU A;  4IMN A;  1SY2 A;  3EM0 A;  5LJD A;  3VG7 A;  3ZW1 A;  1G74 A;  2HLV A;  5FQ7 E;  4GNW A;  2P8G A;  1LPJ A;  2POA A;  1TVQ A;  4QGX A;  5FAZ A;  3NAD A;  4LZV A;  1BM5 A;  3KFF A;  1O1U A;  3B2J A;  4OS8 A;  1OBP A;  4EQA C;  2WQ9 A;  4IAX A;  4M6S A;  2G79 A;  4AW8 A;  4BQU A;  5AQ6 A;  4YDB A;  3ZUI A;  1HN2 A;  5EED A;  3F8A A;  3U0D A;  4NLJ A;  3TF6 A;  4JGL A;  2A3F X;  4QGW A;  4ZHG A;  5LJG A;  1QFT A;  4Y0Q A;  4UU3 A;  3VG5 A;  3LV4 A;  1U17 A;  1U0X A;  1IKJ A;  1GM6 A;  1FE3 A;  3FMZ A;  4GZV A;  5BVQ A;  1BWY A;  5EEE A;  5HTD A;  2X8T A;  1DZP A;  3B2K A;  1TXL A;  5LKF A;  2HZQ A;  1P6P A;  1SY0 A;  1YWA A;  1UZ2 X;  4ZJ0 A;  1DV9 A;  1AB0 A;  1EW3 A;  4ZGU A;  3NQ3 A;  2X8F A;  2JU7 A;  3P6D A;  4I95 A;  4AZM A;  4YGG A;  4M7M A;  4O4U A;  4TNN A;  2KD2 A;  2LBV A;  5CE4 A;  2HMB A;  4YFP A;  1ZNG A;  3UEW A;  3FEN A;  3B2H A;  4IB8 A;  4L1N A;  5HBS A;  2HYS A;  2JU3 A;  4Y0R A;  2QO5 A;  5LJE A;  3HOE A;  3WJE A;  3P24 A;  4WFV A;  5EPQ A;  5DPQ A;  1QY1 A;  1SY3 A;  1KT6 A;  2M4L A;  5HTE A;  5HA0 A;  3U03 A;  4KH8 A;  1IW2 A;  4YKO A;  4NNS A;  3NBX X;  4WFU A;  2BS6 A;  5HZ5 A;  3D95 A;  3OD9 A;  3U9P C;  1YUP A;  4RUN A;  2AH7 X;  2JOZ A;  3O22 A;  1YP7 A;  5EDC A;  3LHN A;  5L8I A;  3UEV A;  3ZQ3 A;  2RCQ A;  4GH7 A;  4YMY A;  2LB6 A;  1JJX A;  3AKN A;  1BSQ A;  3FA9 A;  2FT9 A;  4ML7 B;  4NP1 A;  1T8V A;  3ZW2 A;  1KT5 A;  1ACD A;  1I05 A;  5BVT A;  5KHP A;  3NR3 A;  2Q9S A;  2X8S A;  3WXQ A;  4BVM A;  1GX9 A;  1OEK A;  1QG5 A;  4QYP A;  4A1H A;  4IB9 A;  4OMW A;  4EFG A;  3Q6L A;  2FLJ A;  2BHV A;  4I3B A;  5KID A;  2KTD A;  4MVL A;  4IAW A;  2WR6 A;  3D96 A;  1T0V A;  1HMS A;  3I17 A;  1G5W A;  3FA6 A;  1FTP A;  1KT7 A;  1LIF A;  2AT8 X;  1B56 A;  3FR2 A;  1BRP A;  2CZT A;  1ERX A;  3C76 X;  5AEO A;  4ORS A;  3RZY A;  3IA8 A;  3PQS A;  2R73 A;  4I6S A;  4OS3 A;  3HK1 A;  4FBO A;  4WBK A;  2PY1 A;  1U18 A;  2JW1 A;  3BY0 A;  1VYF A;  3FIQ A;  5FEN A;  2X46 A;  4ORX A;  4RUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...