4M7OA

The crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
KKYHRIISLIPSNTEILYRLGIGEDIVGVSTVDDYPKDVKKGKKQFDAMNLNKEELIKAKPDLILAHESQKNSAGKVLKSLKDKGVKVVYVKDAQSIDETYDTFKSIGQLTDREKQAKELVDETKHNVDKIINSVPKHHKKQEVFMEVSSKPDIYTAGKDTFFNDMLEKLDAKNSFDDVKGWKSVSKESIIKRNPDILISTEGKSKSDYIEMIKKRGGFDKINAVKNTRIETVDGDEVSRPGPRIDEGLKDLRDDIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis
molecule tags Iron binding protein
molecule keywords Iron-binding protein
total genus 91
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4m7oA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4m7oA01
2RG7A 5HX7A 4TKVA 3U7QA 3MFQA 5JOQA 2XDQA 2XUZA 5CX1B 4WNAA 5HDQA 3TNYA 4G09A 1FP4A 2ETVA 3AESB 1K2VN 3K1AA 2OGWA 4FKMA 4PAGA 4XPIA 4HMOA 1FP4B 4WZBA 1M1NA 1XVLA 4TKUA 4LJSA 3AETB 3CX3A 3G9QA 4MLZA 1PSZA 1L5HA 3AEQA 5JG7A 5I4KA 1K75A 5FLYA 2O1EA 4M7OA 4PM4A 5M29A 3HJTA 4MO9A 4FNAA 4XPIB 1M1YA 4CL2A 4NNOA 4WZBB 1G21A 3AEUA 3ZK7A 1H1LA 1H1LB 5KOHA 5KOHB 3AERB 4OXQA 1QGUA 5AFSA 5GGXA 1KAEA 4HMQA 3R5SA 4UTOA 3U7QB 3HXPA 3ZKAA 4B8YA 4MX8A 2YNMD 5BVGB 1K7SN 1N4DA 4UDNA 1G20A 1G20B 4WN9B 1MIOB 2M6KA 5KHLB 1L5HB 1N2CA 4WESB 2MINA 3AETA 3R5TA 1QH1B 4HMPA 4NNPA 2PRSA 2AFHB 5KOJB 1TOAA 2XV1A 1M34A 1QGUB 2WI8A 3ZTTA 2PS9A 4ND8B 4BBPA 1KAHA 5BVHA 3BE5A 3ZK9A 4WNAB 3PSAA 4INOA 1N4AA 2XY4A 3UJPA 2WHYA 5GGYA 5KOJA 2R7AA 2YNMC 5M34A 2OV1A 3MD9A 4H0FA 3MINB 3MINA 2QI9F 4OXRA 4UTPA 2Q8PA 3AEQB 3EIXA 3PDIB 2M6LA 2X4LA 1ESZA 5BVHB 2XQVA 4OVKA 2Q8QA 5M2QA 1QH8B 3NU1A 1PQ4A 2AFIB 3AEUB 3PSHA 2AFHA 3AEKA 1QH8A 4WZAB 4HN9A 2MINB 4FI3F 3LHSA 5M3BA 2XDQB 3PDIA 1MIOA 1N2ZA 4TKVB 2PHZA 3TLKA 3MWGA 3ZK8A 4LS3A 4IRMA 4G07A 4WN9A 5B58T 3MWFA 4GICA 2OSVA 4TKUB 3AERA 5JJ5A 4WZAA 2OV3A 5CR9A 5JPDA 3AEKB 1M34B 1M1NB 4UDOA 4INPA 2AFIA 4N01A 2R79A 1QH1A 4ND8A 1EFDN 3GI1A 1M1YB 4K3VA 3TEFA 5CX1A 1K0FA 3AESA 1G21B 3K1AB 3LI2A 4H59A 4MDYA 4WESA 4DBLE 1N2CB 1KARA 2PS3A 5BVGA 3BE6A 3HH8A 4FILA 3EIWA 2XH8A 2PS0A
chains in the Genus database with same CATH superfamily
1UKCA 1C1HA 4M89A 2K6GA 1O5OA 4EA8A 1FTQA 2HTFA 3AVPA 3OMXA 3P20A 5JSKA 5HIJA 2V74B 2ATXA 2P67A 5IFLA 2X2OA 3L8YA 1COWA 1G9TA 4I4LA 3VRHA 3WE7A 2B8NA 4U63A 1U81A 1E6LA 4RS3A 1BX3A 3JALA 3ABRB 3NW9A 5CP8A 1R0RE 3U9LA 3OHMA 2ID4A 3HY4A 3BUSA 3RYIB 2JH8A 4KXVA 4L8WB 4C2TA 4UTRA 1ODIA 1BC5A 1UJ4A 2CUKA 4ZEOA 2VUIB 3UJ3X 4XQ9A 2GDJA 3ODGA 1DAEA 5H02A 4DJTA 4U1RA 1X77A 4HH0A 1NBOA 3KQVA 3WL7A 2ZZMA 4O4LF 1XZBA 1JNYA 2BW0A 4EDFA 2I8CA 2PFGA 2CXSA 3QTBA 1ZGGA 4L22A 4DBLC 1IHPA 1QE3A 4EA6A 5HS6A 3WP0A 1J8QA 1K8YB 3F7OA 3N3BC 3OG9A 2DZDA 4Y1GA 4YAWA 3HXPA 4EF6A 4RTNA 1QVAA 3EVFA 1W4AA 2PRYA 4FFVA 3RIXA 4TMTA 4BLRA 5BYKA 1JQ3A 5CVVA 1X1RA 2JHPA 1U04A 4IDOA 1UEIA 3UJ6A 4WXEA 4K87A 3RFXA 4A7PA 1ADYA 4Q4DA 1QH1B 1Z25A 2I87A 2JIMA 4WECA 4PAQA 4ARIA 1NYRA 2PEYA 5JVDF 1RRKA 2XSZD 3QITA 4N41A 3K0HA 2XWJI 1MG5A 4X8LA 3IBCA 4M6WB 3JQCA 3DFMA 1P29A 2GX6A 3CUVA 4YRRA 1Z4IA 1Z62A 2CXNA 3BRWD 3BQMB 1LB1B 3VZSA 1D2MA 6REQA 5JQGB 2WTBA 3D2AA 1Z6XA 3VTAA 1NZFA 1AHNA 5IAOA 3NV7A 1NJSA 1EVJA 1E8NA 1B76A 3RVSA 3NXSA 5CG2A 3PTZA 3OJ0A 5H68A 3WQRA 1AHHA 3D3WA 3C3MA 1XEFA 2Q0QA 4PPYA 4KMMA 4YS6A 3H9CA 1N9KA 1ESZA 1P2UA 1AN0A 1VJRA 1EFKA 2VNAA 2VNKA 4V3CA 2ASEA 4H35A 4B3SB 3PC3A 3UJ8A 1QANA 3M6XA 3WRYC 1L7VC 2HA0A 2QMEA 3K09A 4BQEA 4E07A 4Z3OA 2XZLA 2BHLA 2QMQA 1TCUA 3VNRA 4I5IA 3E9QA 3SM9A 1SUWA 4X7RA 5FQOA 1Z17A 2BMDA 1I4OA 3T34A 5I7VA 1E1RD 4OHVA 5FA8A 2GD6A 4MDEA 2EF1A 1BJTA 3AZQA 2AUNA 2JJMA 2F3PA 4IX1A 4RPKA 3QMPA 1Q7RA 4X8HA 4AW9A 4Q4AB 5JC1A 5HTOA 1JLKA 2P79A 1D0SA 1TW2A 4FD3A 2NU7A 3QEJA 4G9GA 4HCJA 4MW6A 2ZBEA 1GSAA 1LVUA 4HY3A 4AECA 3E5NA 4PIPA 4I14A 5B6PA 4QU5A 5D7NA 3S1SA 2R11A 2Y0PA 2F55A 2OV8A 3CUKA 5T57A 2VT3A 5G53C 1FJXA 4TTPA 4LC1A 3SKYA 1TC2A 1DO2A 3NT2A 3EXEA 3CZRA 1KEEB 1K08A 1Y3HA 1O0SA 1J49A 1WOMA 2I1QA 3CWCA 3DAFA 4ZT3A 4BVFA 3SJUA 3OHSX 2L19A 1S2NA 1VMDA 3LUAA 1E3WA 2RGNA 1I3CA 3B6ZA 1R3UA 3RW9A 5CFPA 2Q6KA 4CM8B 4NBVA 2ZCVA 4PSUA 4AS1A 1WZCA 4WY5A 1Z5PA 3W3AH 2DHRA 1EE9A 4XGKA 1A9OA 4D4MA 3JRXA 1QK4A 3KM0A 1DLJA 1SUSA 1UK8A 1ATZA 4MB2A 4OK3A 1GQFA 2JBHA 3RYCB 5REQA 1DNPA 5E4FA 1IWBB 4A0SA 2FRDC 5K0CA 3GUZA 3DZIA 4LX8A 5ECYA 4OFZA 3HO1A 1EU1A 3RVDA 1YO6A 3UHJA 4AJOA 4MYCA 3H1TA 1EM8A 4IPTA 1FBTA 1I36A 1RI5A 1BD4A 2CLDX 3FFBA 3H3XA 3O4JA 3OOEA 4DC1A 1XLTA 3LRXA 2JLQA 2HHAA 1SRQA 4HAOA 3PD0A 1UCFA 1HORA 2GBPA 1BVHA 1QKJA 4AWBA 1X7GA 1XKTA 2NU9A 2GJKA 2GLUA 2H4YA 3G5UA 4ZT2A 4RHXA 5KWIA 2XZOA 1VMAA 3PGKA 1H5QA 4I50F 4TZKA 2QRVA 1T3LA 1D5CA 1HDOA 4LF9B 3DMDA 3KKEA 5TY0A 4ROSA 1EBUA 4D98A 1EEXB 1CFZA 1E2IA 1LV8A 4PZYA 5C4GB 3RQIA 3I3OA 1L5KA 3O4IA 3U7IA 3AHJA 4O2AA 3L8DA 1X6VA 1CB0A 1ZQ9A 4RFVA 1ZUD1 5DXAA 5BNWA 3KEFA 5K09A 4JXZA 2HJGA 3E48A 1OIWA 3JYPA 3NASA 1WBJB 4OAOA 4ESVA 2W90A 1OTXA 4LSWA 5K8IA 3PSAA 3RUEA 3GN1A 4JR0A 4MIKA 1LCIA 1F0NA 4LYDA 5IC5A 4N40A 2BZSA 1Y89A 1ZMXA 2R1TB 3K8QA 3VYUB 2LTAA 4O4HA 4PTZA 3CGGA 3TX6A 5IS2A 2Q4RA 3AONB 4WRRA 1DEAA 3TNFA 2O4UX 5AWFC 1XHLA 2HK8A 1DAKA 1OR8A 1UT5A 1O54A 2PQ2A 3DWIA 4QL3A 4P0PB 1XMPA 1CY1A 5HXAA 1CNMA 1R5OA 4GKAA 3AWDA 3ZCUA 2G1KA 1BDMA 3FBWA 1KU6A 1S2GA 3HTXA 3DM5A 4CKCA 1QF6A 3VFDA 4H60A 3UYLA 4TLMB 2EP5A 4ZT6A 1LZKA 2Q7OE 2Y05A 1SM4A 4D9MA 2FVXA 1KJ9A 1Z39A 4F4JA 5IK2D 3OAAD 5H1YA 3LPMA 5AESA 3LVRE 5CFQA 1Z4OA 3W5CA 4LKOA 3GQVA 1O5TA 1YL5A 1SN7A 4JI8B 3PFGA 3L5KA 2VYQA 3AR4A 3H4VA 3HJBA 3HSSA 4BPBA 3RYFB 1QVZA 1SCBA 1YD7A 2NTJA 1O95A 3W2GA 4N76A 3FDZA 4M86A 4KFUA 4YFVA 4A0FA 1ZAYA 3PGA1 4DOMA 1WTCA 3T3HA 4OLBA 4L5YA 2JFZA 2DKFA 2IOFK 3COYA 5LM3A 1S1MA 3DF9A 3SYLA 1DPFA 2QP3A 4Y6OA 1VP9A 3ICWA 3ZCTA 3AT1A 4EL5A 1GLVA 1P0QA 3WI7A 5IT5A 2RG7A 3VR2D 3JR7A 1SBNE 1AB5A 2X7HA 2AI2A 1JG4A 1YONA 4N5DA 2CSXA 3LT2A 5IT9A 4RK1A 5CYPA 1C8LA 2GZDA 2JGMA 1CK4A 3CCFA 3I01M 1MEOA 2RHWA 5HIIA 3JWHA 5A4FS 5CNMA 1V7PC 5ITWA 3SMQA 2RGBA 4O0MA 1PJ3A 1Q50A 2I7VA 3PP8A 4RQTA 4ZOAA 2C2ZA 3FHTA 1CBUA 3SQNA 1QMGA 1SB9A 3ON5A 4RZIA 1A3CA 1R9JA 1YQWA 2XXBA 4JC5A 2B7LA 1DQRA 5THXA 5JWRA 3A4TA 5JJBA 3NTVA 4KE6A 5KWEA 2XW6A 4OM7A 1V3VA 1K9VF 3VVBA 4R83A 2J0SA 1ZRMA 4NNOA 2X1LA 4ML3A 5I7AA 3GNSA 1W2HA 3T06B 1O87A 3TG2A 3VDMA 3DB1A 3PXUA 5FJIA 4CEJA 2WIBA 2P6NA 4FYPA 4WKBA 1DCKA 4MS1B 1CUFA 3P9QA 4JLNA 4X95A 1J2EA 2HK6A 3KQNA 5ALIA 1VPDA 3V4OA 1XRQA 2Z2YA 2SHKA 3PWZA 5I47A 3ONNA 1Y5NA 4J90A 3EZNA 3D2BA 4IV5A 1QLJA 3X44A 4BVAA 4ZYVA 5BN3B 2XKKA 2FSIA 1TM5E 1EHIA 3E84A 5E4TA 3CUYA 2PRSA 5JE8A 4A73A 1JF8A 2Z4SA 4F38A 2ZIXA 1QX4A 4KK4A 3PVZA 1DAGA 4MV8A 5TX7A 2EJUA 3PF8A 2A9JA 3OOWA 3D6UA 2C4KA 1PKEA 2BDUA 2ZRPA 3HCWA 4L07A 5P21A 1RYEA 4RJJA 2FSUA 3QPWA 1Z0JA 4I19A 1JLRA 4H7KA 5EIOA 1XCPA 1X1TA 1T9GS 2AD5A 2BBSA 4ZAYA 3NHUA 4NYMR 3KVVA 1ICIA 4QYIB 1M10A 2ZBPA 4V0KA 3KEGA 4EJSB 1KKUA 2R8BA 4IUYA 1G7RA 3N2GB 1L4KA 3DUFB 1FYFA 5A1JA 2X9GA 2E21A 3RWBA 2OXCA 2IOQA 4E11A 3DEAA 1R27A 4NIMA 3VMMA 4JA0A 2B8JA 2HQOA 3KUUA 3C4QA 2BBWA 3IB3A 3LL7A 4H7FA 4QUDA 2QOEA 4BVGA 4DIDA 3O2SB 1CJBA 1NLUA 1X39A 2AUTA 5K05A 1XSEA 4WOJA 2FOXA 4TVOA 5FBLB 1DQYA 1PJLA 1I4LD 2VA9A 3D4LA 4G0MA 4OJYA 3I9NA 2PWZA 3KNZA 5KYWA 4B71A 3QSGA 3WYBA 3V1NA 3UICA 5T3YA 2NIPA 2FI1A 1NVTA 3SFVA 1CJVC 2I5PO 1G41A 4LDZA 3SQDA 1JVSA 2ZTSA 2ZT6A 4N01A 1SU4A 4KQ6A 2JHFA 4MIEA 4ND8A 4G81A 4YN3A 3TQIA 3KQHA 4OYHA 5DHFA 5C9ZA 1OD6A 2H5IA 2P0AA 4GZ3A 4JLBA 3N8IA 1OXBB 3GEDA 1IM8A 1WULS 2CLKB 3FOWA 4FYHA 1H4SA 3OZSA 2J9RA 4B32A 2ZE6A 4XSVA 3ZY4A 4YC7A 3CUEF 4BFSA 3B1YA 3V00A 2PGJA 4NECA 1UBSB 3ZJUA 3ZOZA 4NZZA 2WWFA 2O2XA 1GT91 5IAEA 3SN6A 4EM6A 4LPSA 3UXHA 3VC7A 5J4VA 4QGAA 4F5WA 3SJAA 2BUBA 1OPRA 1Y3IA 2YHIB 3NTXA 5CGZA 5I7WA 4HMOA 3TDKA 4DR1B 2OB2A 2VJNA 3BQ9A 1B2RA 3S81A 3AETB 1WY7A 1OVMA 1HDGO 1JFFA 1T1EA 3CIFA 4DY6A 5AHOA 2QXYA 3O92A 2H8GA 1AK9A 1PUXA 1FL9A 1KBQA 2XVXA 3NH9A 4HZGA 4RVHA 3EWSA 2Q2NA 4U3JB 3T9EA 5BN5A 1ZI9A 4K6GA 1U28C 2H1CA 2WLSA 1SO8A 2A0YA 3SIRA 2OUKA 2VP2A 1ENYA 1YR9A 2ZB4A 4M1YA 3RFUA 4IX9A 4CWAA 4WZBB 4FOPA 5INTA 2AMLA 3AEUA 3DE7X 3H1GA 3H3JA 5JQGF 3TLXA 4AT1A 3LXXA 2A14A 3CZ5A 1R7RA 4R7ZA 4UKDA 5TRTA 4CN9A 3EXEB 1ECJA 5H59A 2ZWVA 1W36D 2DC1A 3AK4A 3F6RA 4CLXA 4NZYA 1I2CA 4C21A 4BNXA 4BLVA 3TW6A 1YI1A 2P40A 4KVZA 3ZU4A 1J6UA 4UPEA 1G20B 4RLSA 3ZHBA 5KNBA 4D3FA 3CR8A 1FP6A 2CD7A 1EWRA 3H5LA 1B14A 4JYAB 5TS2A 1PCXA 2VWPA 1RSZA 2JF0A 2Y1WA 3BVPA 3O9ZA 4GPZA 4F5YA 2ZSEA 2FYTA 4HP8A 3JD0A 4NNPA 1Z5NA 4A91A 1GAXA 1HQKA 1WKCA 3GVIA 3ZTTA 3QI7A 4LQ4A 4ZQIA 2ZIFA 5B55A 4JCCA 3UAZA 4IGFA 3T7KA 2X4IA 1KAMA 2V7QD 3BL5A 3PCTA 4ZYYA 5EZ6B 4TL8A 3UJPA 1E1QA 5FPQA 1I5RA 3PV0A 1H2XA 4YROA 4WX2B 3UNXA 1OGJA 4KHZA 4M98A 4CT4B 4MPRA 1RKQA 2QIPA 1YCGA 3UATA 1S01A 2X40A 3W5SA 1CUAA 5AJZA 2PSEA 3OX3A 4G4GA 4BQNA 3UBMA 5DIFA 2BI4A 1IDN1 4JQZA 3VH1A 3GLGA 1Q1GA 1SCJA 2P2CA 2W6OA 2CXUA 2B8WA 1EUCB 4BLOA 1KY4A 4JQCA 3C5CA 1S8NA 4L4UA 3UV7A 4M1WA 4CU5A 3LHSA 1M2KA 4ASUA 1HEYA 2ZRFA 1QBKC 3N70A 4GRDA 3K6KA 3BGIA 5CNIA 1P7WA 1XQ6A 1VLQA 1Q83A 2I4NA 1ND5A 1XRPA 3L9XA 3E5RA 4BZWA 1OA0A 3EZ9A 3ZH2A 4CGZA 2ZSBA 1YC5A 4Q37A 4F85A 1TZMA 3LBNA 3EPRA 1N6NA 4AZSA 2R4QA 5L9AA 3G89A 3UK6A 1DQPA 1KERA 4P4LA 1QH1A 2V55B 1POWA 6NULA 4E1AA 4L6CA 2WUGA 4L8YA 1VA4A 1JBEA 2MIIA 2WOOA 3DBLA 1BQEA 2YZGA 3KLBA 3L9WA 3ONWA 4LY6A 1GPKA 3JQDA 2HCTA 1WDTA 3ZZNA 1GZ7A 1A9YA 4AFNA 1NZJA 1U1IA 4UAJA 1PRYA 2V7WA 1E0DA 3D3EA 4AXBA 1N5LA 5H9VA 2ONYA 4ZCMA 3GLHB 3ZU6A 5EMHA 1LGYA 1F9EA 2ZSJA 1E9FA 1JKXA 2VFAA 5AOBA 4GZ6A 4MCHA 4CIWA 3U44A 1C0KA 1BVRA 1LS6A 4FBMA 4YPFA 3DV2A 4L6IA 1KEZA 2W2NA 2NAFA 3FCAA 3PHBE 4F60A 2D59A 4IS2A 4Y6GB 4CLRA 3L1VA 4TKUA 3ZUPA 1YFZA 3SHQA 5JY1A 2B78A 2DBQA 3SF8A 3V2IA 3EVTA 1CJSA 2C9OA 4QGFA 4BAGA 3NDIA 2WUWE 2REQA 5B5SA 1E7RA 2F1KA 4B87A 3QW2A 3VGJA 4CDMA 4CTJA 1IUOA 2UVPA 4ZARA 1VG0B 1EVYA 4B84A 4RULA 3QEBZ 3S55A 2PKQP 1AN9A 2HX1A 1W19A 2YVAA 3G2MA 1CNEA 3P4UA 2JCBA 3AY3A 1LFDB 3HFSA 4RC9A 2Y99A 1NW6A 3LGXA 2AG5A 3D5EA 2CHVA 1NUUA 5DM2A 2YFQA 3EC2A 5B1EA 4LN1A 4PLHA 3SDSA 2CFCA 4GNRA 4F4FA 4B3JA 4MKXA 4JJFA 1RM5A 2A30A 2B2NA 4KN6A 1XJCA 1OIVA 1YB2A 3P0RA 4AZVA 4XUDA 4K05A 3BXEA 2O8FA 1B42A 2N42A 2PLRA 1KGSA 2QE7A 2D74A 3U1BA 3CCCA 4BZZA 3TCNA 4DABA 1PJ4A 3U4QA 2RGCA 3ESZA 4KLAA 4RYLA 1BXRB 2Q5FA 1TEVA 3F96A 5GP1A 1DQNA 2HY7A 4D3DA 4P4GA 3HMQA 1NX9A 2Z4RA 2F64A 1U3CA 1FSGA 1PUJA 1EZ1A 2PCJA 3R8FA 1NN3A 2C1XA 1MF7A 1QK3A 1KMMA 4IVNA 3GC6A 3CLVA 4M4SA 4MH0R 2QRJA 2QTGA 5EMNA 3VH4A 3GA5A 2YNMC 1IN7A 2WRZA 5EXEA 4MI6A 4OSEA 5J2UF 4RA9B 2Q1YA 5JMWA 1CUGA 3W3AD 4UTPA 5THKA 3CV3A 3DD1A 4QDKA 1VCIA 1C3VA 1DAOA 2WIDA 4V2UA 2HU8A 5CYGA 4XWWA 2R00A 2CNNA 1APBA 1GWNA 3HDHA 1JBKA 2FQ1A 1S8AA 1FUIA 3ME5A 3PU6A 5CAEA 3BIFA 3CBGA 4P7FA 1I80A 4MP3A 4PTLA 3VR5H 3DCYA 1A8IA 1L2TA 5HA5A 3GAZA 4J0IA 2ZS8A 4CQLA 1GHTA 4BQQA 2QENA 3ZKWA 1S1CA 4OM8A 4DWVA 1DCMA 3IEKA 1JDBB 2X0NA 1F14A 2FPRA 3ETJA 2G1UA 2C3PA 2NTYC 3DE6X 1J0XO 1OXMA 2DR0A 1T15A 3DT9A 1QH0A 4JLSA 5B58T 2RBKA 3ZY5A 4YAGA 5EJ8A 1N8TA 3FKSD 4IGKA 2RC6A 2JPDA 2C5HA 2VQSA 4XR9A 2VPQA 3IGFA 3ZX5A 5JCOC 2Q49A 2HIGA 2JBWA 3P9ZA 4Q9AA 2QL9A 1DQZA 2ZU0C 3AB3A 1CQWA 3H5AA 2ZI9A 4Q15A 2CCJA 4P4SB 8ADHA 3PKJA 5JS7A 5DP2A 1T5SA 5K3EA 3EAFA 3C6MA 4X41A 3IQEA 4B7XA 5I7EA 2G25A 5E8JA 2HL6A 3MSCA 5E7IA 5LP6A 1W0JD 4Z4EA 3AVXA 1CE8B 4JLOA 3ZV5A 1DJQA 1IUPA 4EEKA 2OLEA 5JDCA 3IE2A 3KKKA 4BNLA 5I7RA 4LMBA 1USWA 4IYJA 1T0IA 3IQIX 4PO9A 4MKHA 4YRTA 1XWIA 3LT4A 3I6QA 1P44A 2REXB 4AKTA 1AGYA 3HPQA 4I99A 1P91A 4UAGA 3TQHA 1CLUA 1P4SA 2XB8A 5KYXA 1OBOA 3TOSA 1FP4A 2OO5C 2C78A 4JN6B 4LRWA 1GRQA 4LZWA 4NX2A 4ZQCB 4F71A 2A9RA 5B1DA 4UTXA 1HNZB 2ATIA 1WCYA 5FL7D 3ZW9A 3H04A 1BXGA 1WF6A 2FXVA 3HYLA 1B8VA 4MQMA 1K3FA 4KWTA 5EHXA 4N7BA 1JUDA 4CEIA 4B3MB 2I9PA 1U2DA 4OB8A 4XOUA 3ABIA 3HGMA 1JZQA 3FY4A 3JQGB 4Y8VA 5EKTA 3TTUA 1RYNA 3EUAA 1E94E 4CIBA 1H8HD 3CLRC 2VJLA 2BMFA 3AI3A 3VYWA 3VNBA 1MC4A 1MORA 3BGWA 1MQSA 1MOPA 4BWVA 3P9CA 3ROEA 3OKCA 4UCFA 2J6HA 1N0VC 1PJQA 3KTOA 3A6FA 2P9CA 3EZ6A 1KJQA 2AQKA 1Y9DA 3GT4A 3O3MB 3PQ6A 1JHRA 4LX0A 3LUJA 5ALXA 1M2VB 5AM0A 1SVWA 3SOPA 1L4BA 3FPJA 3T5GA 1Q57A 1UUFA 2XCRB 3GP5A 3D6HA 5BQ3A 4LYAA 4ITVA 2VWHA 4W9MC 1GNTA 1IBSA 4PINA 3RC1A 1TAHA 3OZGA 1FUKA 1EJBA 3VJKA 3GRFA 4JKIA 4DV3B 4BFVA 1P61B 4OFXA 2FR0A 4YASA 6Q21A 4IDCA 4IWNA 2PR7A 4OXXA 3X1DA 1Y9AA 5LKRA 5HTKA 1XG5A 3GJ7A 1TOAA 2QN6A 2VDQB 4P4SA 1GADO 1JJ7A 4KQMA 3OZIA 2QTNA 3QLVC 3EGDA 4QHSA 5BMVF 5KKNB 4DB2A 1GARA 5FOUA 1BCSB 2XT9A 4R84A 5B4TA 1LJ8A 4KQKA 4OA8A 4RBNA 6CHYA 5HZKA 5JDIC 3LT0A 3CZQA 3G1WA 1UK7A 1F6WA 4RJIA 3FGOA 5D87A 5H82A 5B37A 2HU7A 4F2WA 1RWVA 3A1EA 4DMMA 3P2MA 2ZR7A 4B3XA 3UPTA 3ZWDA 1FDVA 4EA7A 2D00A 1DT5A 1YULA 1N2HA 3KOMA 3QVSA 1JSXA 3H97A 1PK9A 1UBKS 1Z8DA 2ANBA 1V6SA 1T2DA 3K9FC 5CPBA 2V7PA 3FUXA 3JZMA 2LNDA 5DULA 3K9LA 4LSGA 5KNBD 2Q9BA 4JBLA 5F35A 2FWBA 2EGGA 3BWXA 1QHXA 3PDIA 1Z08A 1ZIDA 3TCXB 4HNAA 3L6BA 4J91A 2BBTA 3A4VA 3LUCA 5C37A 4NBLA 1I3OA 4DMLA 5IJ9B 2HA4A 1EDOA 1OGYA 5EG5A 3E53A 3ZGOA 5CA0B 1RWBA 1OI2A 2HNBA 4FBLA 4R16A 2O20A 4M83A 2QLBA 2X9QA 2X4DA 3PZRA 5FL3A 5AVTA 4O4JA 1VSTA 5KVCA 1E60A 3NJ8A 1P4HA 1BOOA 2PRZA 2Z2ZA 3BWYA 4W9NA 3QEAZ 3NHWA 3IR7A 3WGNA 4RK6A 1XTIA 2VZ0A 5TQ2B 3NBFA 1AXGA 2BMEA 2F9FA 1IMOA 2NM0A 3U4GA 4E03A 1KZGB 4DBLE 3ILVA 1E3DA 4CL3A 3Q4GA 2HMVA 4R1NA 1C8VB 1ZXBA 2IXAA 5H16A 4BNDA 2UXBB 4NYJR 5TMEA 2A33A 2AWOA 3G9UA 3TMKA 4O2RA 4GL4A 3BDVA 1X0XA 3FYDA 4MPPA 4TUYA 5CEJA 3AF6A 4KSYA 1PNVA 3E3AA 2NW6A 3N2IA 1Z0SA 3ABQB 5T7BA 4FHCA 1Z07A 1K66A 2GAIA 2GI4A 4QEKA 4TRJA 3CHYA 2WSIA 4K2HA 5DW0A 4F56A 3GD7A 5IBCA 5IJ0B 1PL7A 4XVRA 1S96A 2FCRA 1HT1E 2P4EA 3MOGA 4OGKA 4PX2A 4ZYLA 1JPJA 3USZA 1ML3A 2EZ8A 5CLLA 2B7CA 1GQ2A 3AUUA 4HLCA 3VU9B 4X90A 2O1EA 3UM9A 4CLRB 4EATA 4EG4A 2JVKA 2R6DA 3H19A 5L6LB 3NKVA 2F1HA 2RDMA 3UWDA 3HLTA 4D9KA 2P3QA 1IQUA 3G17A 4HNSA 3S4YA 4BATA 2BM9A 1ILEA 3IURA 1DBIA 1VKZA 1NVDA 1U0NA 3KUKA 2FB9A 4KMSA 1P75A 4IDAA 4LMAA 4TTVA 5BN4B 1D6NA 3NHLA 5K3AA 1VDMA 4UNIA 3DL4A 4M0LA 2B3DA 3COWA 3HKCA 3M5PA 1PV4A 3AIIA 1KHTA 3TGWA 3ZV4A 1WDMA 2IS4A 4QO7A 4DM7A 4I3HA 1J22A 1XCMA 1PTKA 2LIPA 5JH7A 4BMPB 1WB4A 3FPBA 2P9ZA 3C6QA 4HS9A 2Z9DA 3CPSA 3DHWC 3OTWA 3Q1LA 5D5HA 1I10A 4YGXB 4YAUA 3O8QA 3I4FA 3JCZA 3BFVA 2GVZC 5DK4A 1RZUA 1GRNA 2YL2A 4NONA 3IC5A 2OYCA 4LRUA 1OZAA 2AW5A 3DULA 1K4MA 4NCHA 2WHEA 5CG1A 5JSYA 1H2FA 2X0IA 1U8YA 4JZKA 2ONCA 2JKYA 1QQ5A 1YU9A 3A3PA 3LW8A 4JOBA 3ZWPA 4ES6A 4QSMA 3ZPXA 1UL1X 1C29B 3EVEA 4MI1A 5C3MA 5FIUA 1G16A 1GCIA 2GN8A 4QGSA 3IAXA 4KLCA 1UJ6A 1UFOA 2RGAA 1OI4A 3NC0C 3M1LA 3O26A 1R64A 4NBUA 4P38A 4Q3CA 1VBKA 1Z18A 4Q4JB 4E5DA 3MMNA 3T7AA 1G4HA 3QKSA 4RK5A 3EIXA 1CP2A 5CA1F 1XQWA 1TECE 2XVYA 1E2EA 1NYLA 4XASA 4C5BA 5ABPA 1N9GB 3V1TC 2Z8ZA 5CB4F 5I8WA 2UUAB 1U65A 4IZ6A 3PC2A 4M55A 3U1VA 2UXCB 1XBTA 2YFKA 1ID1A 1W36C 2V6GA 4G5XA 4ZZ3A 4QYWA 4RY0A 5FPSA 6AT1A 2QE6A 2UKDA 4MA5A 5F5NA 9GPBA 3HC7A 1TYCA 4HNHA 5ESXA 3QUSA 1DKOA 3QOFA 521PA 5JHHB 3HB9A 1QP4A 3IOEA 1K5DA 5IHXA 1Z0ZA 3HZRA 1D6JA 2V9PA 1KBZA 3HHPA 1VLZA 2X6TA 4EGSA 3WIVA 1PO7A 2B36A 3JWPA 3TZQA 4GO1A 3K1YA 2WT4A 5KNBH 4OLJA 3D8NA 5EJ5A 4ZVOA 4WADA 4YRZA 5B3LA 2R7NA 4EFNA 3LD9A 3B3JA 1M7BA 3W5IA 2W2PA 2JFWA 3KPWA 4Q4JA 3OE7A 4ZYZA 1FIUA 2CL6X 4E6EA 3I61A 1J4AA 1X38A 4Y2TA 3C48A 2QDKA 5MDHA 1A97A 3RRMA 5JXJA 2QL7A 1LBEA 3ZXYA 5BYAA 2FPPB 4UCXA 1KO8A 2VPYA 5CT8A 3UT5B 4B31A 2M1XA 2ZJAA 2XA1A 3VUFA 4BMDA 3UH1A 1I4TD 4ZZ2A 1A96A 5ALZA 1DJMA 1LK7A 3KD2A 2BKEA 4BN5A 1CFJA 2XD9A 1ODFA 1PNTA 3KJXA 3CG0A 1TUBB 3K0AA 3PBKA 3TJRA 4A6EA 2J67A 2IP4A 3DEFA 5AVQA 1XEAA 3E8MA 3ROMA 4AY3A 1KEUA 2RHLA 1ORHA 3EZYA 3NHPA 2JLUA 2A9FA 2OHVA 1BWRA 3L1JA 5DTEA 1DUVG 1ZITA 5EKSA 4GBJA 3WHIA 4JT4A 1XZLA 3NFRA 2UYHA 3I3SR 3PNQA 2OMKA 2DTEA 1H4VB 3CWZA 3MCUA 5FR2A 1H1LA 1VJ0A 3ECCA 4Q16A 3WBJA 3NAGA 5JEEA 1MEEA 1NJ1A 3I28A 4QFBA 4RL6A 5TPWB 1SIBE 5HZHA 1CIPA 3ISVA 2IEYA 1W85A 3OAAA 1J8VA 1OKKA 4DWJA 4X1IB 5AM5A 4RDXA 5HIAA 3PDWA 2H2HA 1UH5A 3KDAA 1X2BA 1G8JA 4IJMA 4Q1EA 1A4IA 1MQAA 2HA2A 5AW8A 4DZZA 3R5FA 1WVMA 1UWVA 4V0LA 4B3IA 1QV7A 2BM1A 2X2FA 4EF5A 5KQMA 1A5ZA 3SJ7A 4KUGA 1PBNA 1ZHHA 2PGAA 2ZIVB 3Q2OA 1CEXA 1EE1A 3KZOA 3A1NA 3FJOA 4U9UA 5EJGA 5HKOA 4IIVA 3ER8A 2RONA 1USGA 2C83A 4EW3A 4EI9A 2FN4A 3NDPA 3RC2A 4CG1A 4M0CA 5FV4A 1C7JA 9LDBA 4CM9A 1RAAA 1NPDA 2IYEA 1P74A 2RKBA 2FEMA 1KK3A 2EAUA 1J8MF 3Q7SA 1W7AA 4LBVA 4MGEA 5B6JA 3OO0A 2PKXA 1DC4A 4RS4A 3W4KA 3Q40A 5F2EA 1T1GA 5GADl 3AEQB 3R5KA 2YUIA 3OPVA 3QBVA 5KTKA 1R37A 3LV8A 4Y6QA 1TLFA 5IVHA 4YRKA 4LF4B 2JFPA 3LRPA 5E4YA 2NXJA 3RVLA 2WYWA 4B6SA 1J42A 1L7PA 2GMWA 4AF7A 5G0TA 4BL5A 1NTOA 3GRCA 1RKVA 3OKPA 3WXBA 4Z2YA 4YV7A 1Q95A 1IEWA 3SJBA 2FHSA 2A0XA 3DAHA 4L5BA 2ZRCA 5EYPA 1F7UA 2F8SA 4I5FA 2GZRA 2HM7A 2ZTMA 3KUCA 2IY9A 4UHDA 1QZUA 4J0KA 4EYSA 1UOQA 4C3OB 2QNIA 3L7MA 5DOVA 3UHPA 3WQBA 3CYFA 5DLDA 1HGXA 2DH6A 2HUPA 3V34A 3AY0A 1MTZA 2RHHA 4FC6A 4C0JA 4DADA 2X76A 3ICVA 3E8SA 1ZW6A 1JKJB 5CJPA 1LSSA 3C1OA 3VSAA 4ZCLA 3OP4A 4K6OA 1JA1A 4WXHA 3NIFB 4OJQA 4RENA 1Q92A 4RZQA 4BNZA 1XDUA 3DZGA 5LDGA 1QRRA 1YUNA 5TT0A 4RCZA 5EWLA 5LUAA 1XXHB 2X6QA 3T52A 2ZXEA 3TDNA 1YF3A 1GFWA 1PZGA 2H51A 1OB2A 3D6MA 1WY5A 1YK0A 2VLIA 2SKDA 3A6GA 3Q3IA 2PJZA 1Z7BA 3SZRA 1VJ1A 1J25A 2PY6A 3MNFA 4LW8A 4L5IA 4PIMA 5EE3A 1EK6A 2ZI4A 3BD9A 1U0BB 3AJRA 2E55A 1X15A 5DE3A 1H3EA 2A1TS 3T1OA 1TEHA 3HN6A 1U7UA 4G2NA 4MQ6A 3ROGA 4MVJA 2V7GA 2Q6OA 3M83A 2YXBA 1RPAA 4F4UA 4GYJA 1RYDA 1TVCA 2ECPA 3EXIA 3HE3A 1XO1A 2V8OA 2QQ0A 2GLXA 3BRCA 3HA3A 4X20B 1F3OA 4F93B 4DR3B 3IBFA 1PDOA 1Y4AE 1T9AA 2PXHA 3VR4A 5B6IA 5JS6A 3IV6A 3H5RA 4RSGA 1A2OA 3A37A 3JQ7A 4LHYA 2P7HA 2WKQA 4PGAA 2Q4TA 4CG2A 1V8ZA 2Y1EA 3CX4A 2FX2A 3EVBA 3X1YA 4ZDIA 4G84A 3NAMA 5G1PA 4EZBA 1ULZA 2GN1A 1Z0AA 3JXEA 2G0TA 2FUG6 2Q6LA 2UDPA 2JZNA 4NPAA 4X9XA 4KUEA 1KP9A 2BTOA 4ZVVA 3R44A 4C1BA 1QCDA 1VHWA 4HVCA 4HRAA 4B6EA 4RJKA 3FPAA 3MYRA 5JAIA 2XXJA 3P0EA 4AO6A 2QAIA 1Q1NA 1B43A 1RZ3A 4W1SA 3ELUA 4BEJA 4B9EA 3CNHA 1X80B 2GLTA 3DDUA 5K8UA 2X4GA 4OHPA 1OXKB 3DXXA 4H08A 5CM2Z 5JARA 1TM4E 1WUTA 2EKBA 5F1YA 1HMYA 1M34A 4OBBA 5F51A 3C74A 1C9NA 1DO8A 2PUDA 2QQEA 2WSBA 2QK4A 3USES 3HKDB 3OF2A 3T38A 5ADVA 3F1KA 4GSYA 2PH5A 4LYEA 2QROA 1Z82A 1V7CA 1UAGA 1YGPA 3SC2B 3IOYA 4Q7JB 2WMYA 3BICA 3F5FA 3ICEA 1TMYA 2WJWA 5CA0F 1KSHA 1C81A 1NKSA 4PLWA 4XM0A 2GBIA 4EHIA 1EAMA 4E0BA 3M4YA 3CJQA 3WGQA 3LP6A 4JBHA 3EQ7A 3LLUA 1XZCA 2NUBA 3PE4A 1VTKA 4MB6A 4N0QA 4ZKDA 2QS9A 3JTEA 2J5RA 5EP2A 3INYA 3A4NA 5KOHA 3DC2A 4GX5A 4ZYXA 3B8HA 3ORYA 4EB3A 6PFKA 4HDKA 2JVIA 2YDYA 3KXKA 4RM2A 1SG0A 3HP1A 3N0WA 2JD2A 3QTLA 4DV2B 2A9QA 1KYTA 1JP7A 121PA 3SG0A 3WB1A 4F1WA 5LOVB 3GLIB 2ZRAA 4A2PA 2Y4OA 5IMSA 2Z2XA 3KQKA 2PE5A 3DHVA 2D6FA 3QZUA 2BGGA 4HEA6 1TLLA 4LY9A 3MERA 1QHHB 1JJBA 4C20A 5JY6A 3PTLA 1QIFA 2Y92A 3A1WA 3B5IA 1GR1A 4GUAA 4TSKA 2ZAMA 1GITA 1DEKA 1N3BA 3KBOA 4ARSA 2WF6A 5EIFA 1KR2A 4DNXA 5ALVA 3BWCA 4X71A 5JNLA 3KCNA 3L7NA 2GRJA 2QRVB 4W1RA 4H1UA 3MWLA 1QTNA 3OJXA 3R3UA 1OAAA 1SBQA 1WW3A 3NGLA 4ALNA 4HWOA 1Z4PX 3P2IA 4KQ9A 3E4CA 4U6QA 5JPCA 1L4EA 2G1AA 4CEIB 2NU9B 3JSAA 1G3IA 1DO0A 3JAKA 3HCNA 4Y0AA 4F9EA 1GYRA 2RIRA 3OMLA 4ND5A 1I1HA 3LZ6A 4JT2A 1PVDA 1IAVA 1N8NA 2CCKA 3L0BA 4PRLA 4DLWA 1A1VA 3F6CA 5TQVA 1B2LA 4QVKA 3W5UA 4DR6B 3AESB 5DNVA 3MCTA 2CMHA 5H70A 4TMWA 1JN0A 1ZN9A 5LLSA 2FFHA 1Y6RA 3UJDA 5MHTA 1V47A 2QVZX 1DT3A 4IMRA 3WGKA 3QU5A 4HTFB 1NNI1 4L75A 5DT9A 1XT6A 2RIPA 1DKUA 4P58A 1GA6A 2BLLA 3M0EA 3S2EA 4E31A 3ZVMA 5DRYA 4LYYA 2BD0A 1RIFA 4B45A 1OXXK 2Y71A 3U4MA 3QEKA 2KPOA 1UP4A 3F1LA 4FGZA 3OEED 4OA5A 4PHHA 2R6FA 3DMNA 3NHAA 3O74A 3DXYA 4G25A 1AQNA 3U1TA 1NJ6A 5LVAA 1JH9A 1RFLA 2WDPA 2BVNA 3ONEA 4OUKX 3CEMA 3LPDA 3UA3A 4BRZA 5A04A 1US8A 2J30A 1E2PA 4Y9UA 4E2ZA 3ZDCA 5CTJA 2BYTA 2B2XA 2JI4A 5JMPA 3RRXA 5IT0A 2Y76A 5DEOA 2IIVA 1AHIA 2HCJB 1NR5A 2JIZA 1DTEA 2A9VA 2FX3A 2PM8A 3FRIA 4PYJA 4S24A 3L92A 2ZIEA 3QE3A 1VI5A 3P9RA 3OP1A 4A5SA 1S2MA 2DJIA 1KPHA 4ZVLA 4MVCA 1IBRA 3NHZA 3CVUA 3ZHOA 2GK3A 4NFSA 4WKPA 2PAAA 1OFHA 4OJKA 3WB9A 2CNWA 2HF7A 3HJGA 5KSYA 4M87A 3WY9A 5LMNB 5ITVA 2AS0A 4WNAB 5C8YB 3SHFA 4EHAA 1U6KA 2BDEA 3EH1A 3ABSB 1E61A 3EASA 1CIVA 4WY8A 1I9CA 2ZRGA 1BH2A 1ID8A 4RZ2A 4C6TA 2QI9F 1HPLA 1BMTA 4JEIA 1L5ZA 4BEWA 4TTAA 5CIYA 5BWMA 4ABTA 4OY3A 1GPH1 2I2AA 2FQXA 3CLKA 3OA2A 3RI3A 5B7PA 3NVMB 5JRZA 2XTNA 4EAAA 2OHIA 2X5NA 2BEVA 2Z5VA 5CRIA 3QWBA 5KIAA 3AZOA 1LBTA 2PRIA 1LW6E 1OJLA 1YAJA 3DVRX 3IUPA 4RA6B 5FPKA 2ORVA 3AC0A 3SLKA 1YR2A 2H65A 3I4CA 3OOYA 5UKDA 3F3YA 2JARA 3UGQA 4YO7A 1PT9A 4AVYA 1TIKA 4BTLA 1HFKA 8MHTA 5FA5A 5KU1A 3F9CA 4F2HA 1NPYA 3GGCA 3M7IA 2IV2X 4AS2A 2WWYA 1PG5A 4QTXA 4ZVUA 5DBEX 4DUGA 3DL0A 4ZMBA 3NC4A 2OKGA 2O8DB 5E1DA 4D57A 1DG3A 1QO7A 2GPTA 3ZJ5A 4C0WA 3T3IA 1PTJA 1F5NA 3EF1A 1NN5A 2BSAA 2W6QA 4DG9A 3E82A 3LHDA 1AU9A 2EFEB 2J3IA 2QNBA 4BMCA 3Q6IA 4QOFA 5B36A 4N0PA 3N76A 3NT4A 1T1SA 5FBKA 4DLAA 3OQJA 3MUFA 4JDUA 3M4NA 1AKYA 1DEXA 1JQAA 4KIFA 4CXMA 5KYVA 2RE8A 4YLEA 3AHEA 5FI1B 2HLHA 3H18A 1LRLA 5HBGA 5FBQB 5T4FA 1PT7A 5DM70 1B15A 2G5TA 2BCJQ 2FUKA 4RANA 4WCFC 3T0FA 1TD9A 4ASUD 1S3SA 2PUAA 1GZSA 1MCZA 4G1UC 3UWOA 5AO9A 1QC5B 4PXYA 2X58A 4TKVA 3DNFA 1JG6A 4Q1VA 1SOUA 3SSNA 4D41A 2VLBA 3ICCA 1AUQA 4FIDA 4WNAA 4WAUA 4HH4A 2JLSA 3D5TA 3HGTA 3MILA 3WGZA 3D4NA 1TF5A 4PZLA 1X9IA 4W99A 3BSFA 3REOA 2F4VB 5EJEA 2MYTA 1RCTE 3U80A 5LWHA 4DCVA 5HQ3A 2P91A 2XKAA 3E7PA 4YA6A 3OC0A 2QSJA 2ZI6A 2QRNA 1YRLA 3QV2A 2QZZA 5EP1A 5EMLA 1E8MA 3F4LA 5FXMA 4KR9A 3RG2A 5KDDA 2IXTA 4AN4A 1TQ2A 2BI7A 1NMZA 4HAYA 1SVMA 1ML4A 4FQ5A 1GQQA 1GQYA 2VWQA 4EG5A 2FJ0A 4FJ0A 4PZ9A 1E2NA 3HU1A 4H0NA 4XRRA 2B4TO 1YB5A 1D9ZA 3LBHA 1T5LA 4E15A 1NVFA 1EXNA 1JEYB 3D7NA 1DE0A 2HF2A 4DA0A 3GRAA 2ZJ5A 3ED1A 2I6FA 1PJCA 2ZP1A 4OJMX 1J2UA 2IDKA 1E2UA 5FHQA 3ECAA 2HK7A 2Q7XA 1YSCA 4MX8A 2VHWA 4RHCA 1MT3A 4IMIB 4MXDA 4JYPA 4R7GA 2HRDA 3KOXA 3SQOA 4PYLA 5FEMA 1T2AA 1Y4UA 4IG9A 1QWOA 4Q4CA 2ID8A 4DEXA 3R74A 4DLPA 2CD9A 5GIOE 1Y3BE 5JZBA 2OZPA 1YASA 2FPIB 2JAQA 4PQYA 4AURA 1Q20A 2IYRA 4GMHA 2AYXA 5FX2A 3EVZA 3VC1A 1ZWLA 3AFHA 2IT1A 3UAGA 1QRDA 4NEQA 2JEOA 5EIXA 1Q0RA 2HPVA 5I8PA 1MO4A 2I2FA 3M4XA 3VYSB 3I09A 4L76A 4M8LA 3WHLA 1U4OA 2H29A 3OTQA 4TWBA 1Z6AA 1M54A 5I5EA 1XVTA 3FSEA 3MINB 1DS6A 2WJVA 1KI3A 2XTJA 2WAXA 3PE3A 4MS3B 5IBQA 5HW0A 1Q0TA 1ZM9A 2Q2WA 3O91A 4INZA 1QNFA 3BS4A 4FLFA 2P6RA 3SOZA 3A28A 2JGAA 3ABZA 1E2LA 4QDOA 3LU1A 1AKMA 2R97A 4FX2A 3TZEA 4RKEA 2QVCA 5E7JA 2WE7A 3VVCA 3WRVA 2J5KA 2RGWA 3CZ9A 5E7MA 3LDHA 5TGDA 4YV2A 4HBGA 1W75A 1I01A 3NATA 3TECE 1SXQA 1QDLB 1XQ1A 2FWAA 3A70A 2O0JA 1T5TA 1A9QA 3E03A 3L05A 4I1YA 4N3CA 5LA6F 1NBMD 1ODJA 1V3UA 2UU9B 5EHZA 3EZFA 4AZTA 3IUMA 5FAKA 1B1CA 3M9WA 2QL6A 3FDFA 5J59A 2QJWA 4IXWA 1ZCFA 4GOLD 4OL0A 4B74A 2OZLA 1EUDB 1XTVA 4FKZA 4IVPA 3GEGA 4NYJQ 1RC0A 4PR0A 2DKOA 2W83A 5CEEA 5KINB 4A0QA 4YMVA 2V6MA 3OFVA 2ACEA 1D7AA 4ZYWA 1L5OA 4MUXA 4UM9B 2OBFA 2KX7A 3AGPA 1JQ5A 3S1LA 3ZBQA 1JU4A 2VVTA 3AP2A 4TYYA 2PYDA 2KW5A 1YCDA 2G5CA 1FB5A 2HNKA 3SHOA 2HWYA 2V6FA 2RCYA 4DG5A 5C35A 3EJ6A 4WVFA 1FFDA 1MO2A 1E2QA 4OQFA 4O4LB 1F06A 4OKNA 3MWDB 3LPAA 1DX6A 1TZJA 1V71A 2QMZA 1YHNA 2XUZA 3IPLA 4XB2A 4D4LA 1W5SA 2WJ4A 2PSSA 1GPJA 3CXUA 1C4WA 3E9MA 1NLFA 1YQEA 3DG9A 4P9NA 3K1AA 1FXSA 4FK8A 1VL5A 3IV9A 2H2AA 4IZIA 3A27A 4ENVA 1SUIA 3VOBA 1RXSA 4P3PA 2BE7A 4WTOA 3VDRA 2Y68A 3DMYA 2I4OA 3LQQA 4QJBA 5DM1A 2IBTA 4AK9A 2VJAA 4N03A 1GPWB 5J4LA 3DW1X 5HE9A 4NE9A 3OOSA 3TR6A 1Z28A 2KJQA 3DLPX 3GEBA 3TPZA 1UP7A 1N75A 1YQDA 3FG9A 1L5VA 2QR3A 2ZATA 3COSA 3M6AA 4PGHA 1RHUA 2ZBRA 3DL7A 4FLMA 5EP3A 1JXMA 3WHPA 3ML1A 4B5KA 4G85A 4IUDS 4B5LA 2PRJA 4B3CA 3KU4A 2EW8A 5EIEA 1T26A 2GXAA 1ZD9A 3N75A 3AIOA 5AVWA 2IELA 4CNQA 3OTOB 2GM4A 1PSDA 1RHRA 2GGSA 4HLUC 4MUEA 5CIQA 1WEKA 4B0OA 2WM2A 1CU1A 5JFOA 5LOVA 3CNQS 3GH3A 3ND5A 4UUNA 4U4AA 4WA8A 5D3KA 3HJHA 3V1YA 5E9AA 4EOGA 1XHEA 3DZHA 2MSKA 3NUZA 1NPTO 4KIJA 4N7RA 4Q82A 4DLYA 3KTAB 3VZBA 2IXDA 3GEMA 2I66A 2FZCA 4LZLA 4NQRA 1NR7A 5KPDA 2B2CA 2YC4C 5JAZA 1LLFA 3VR6D 4KQEA 2KI5A 5KJCA 1KI2A 3MT9A 2BRUA 2C5EA 4YDHB 4QASA 1X7WA 1A4RA 4CU2A 5CITA 4NXNB 1O03A 1TMOA 5E0OA 3U0BA 1MRZA 2EFHB 2RGGA 5EWLB 3V55A 3OE1A 4MVJH 3PHLA 4OBWA 2C92A 2XQJA 1OTHA 3L1UA 2GCIA 3FPFA 5FUWA 3UXYA 1VJGA 2C4NA 2B99A 2GYUA 2ZYIA 2XE4A 4GECA 1P17A 3CF6R 4MV3A 3VAZA 1TFRA 1V1JA 3T9DA 1U9IA 3VX3A 4ENSA 2VEDA 3D5QA 2OBLA 1E2HA 1L4UA 4V0OA 4MR9A 4C6RA 1E7SA 5HHTA 1X13A 1ZH6A 2NZ2A 2OT3B 1NQAO 1CSEE 1IZ0A 2O0LA 2P11A 2W37A 1UMKA 3M8KA 4JHLA 4LC9A 4KBGA 4ND3A 5KVVA 1VIDA 3NWOA 2HWXA 2OWEA 4O2BF 1IATA 1E66A 3AYXB 1Y3DE 4UTNA 1TF2A 3R3VA 1DINA 4B7UA 4WH0A 2NV0A 1V43A 3JYHA 3P0JA 3OOHA 1GSIA 1X9GA 4F6RA 2XGMA 3U3XA 4AULA 5JS2A 3CF0A 2YWBA 1EFUA 2N9UA 3NZEA 6GPBA 2R79A 3OCVA 4HDQB 3I83A 4QT0A 5CX1A 4MUFA 1KO5A 1QOQB 1MOZA 3NRCA 4XB1A 3TLEA 4RZXA 2YXPX 2C8KA 1MAHA 1WX1A 2HUNA 3ITNA 3L6CA 5HKAA 2G40A 5C80A 2VH1A 5FWXB 2B4YA 3WX0A 3TI9A 5A3QA 5AI4A 2GVDC 1XRJA 1II9A 2F7SA 3CVJA 3GAAA 1C30B 1E9VA 4MVJG 5D3MA 2FW9A 1YR6A 5IDYA 3OQNA 1Z6PA 4AY4A 5JNVA 1OXTA 3IJRA 1NJFA 1U2GC 1W35A 4DBZA 4POOA 2PUEA 4U0KA 5E1MA 3GCZA 4QTZA 1MHTA 2O0MA 5AHRA 2PL5A 4G4SO 5I8ZA 2XCTB 4ITRC 1EDDA 3TM5A 4RFLA 1WRBA 3C97A 3I30X 3QIAA 4LI3X 1NUSA 1DZIA 1F60A 1P0MA 1P0CA 1F8GA 1OLXB 5AKJA 1DELA 4YRFA 2ORWA 3I1YA 4L5AA 2FNAA 4MR9B 2FK7A 4KUHA 1JKJA 4KIGA 4EY7A 4E5SA 3G2PA 4A6XA 1H1LB 2CUZA 3H83A 3Q15C 4M38A 5CXSA 3KE9A 4EHKA 4JI2B 2H08A 3GCXA 4X3PA 4X44A 1N3LA 7AT1A 1QIMA 3NM5A 3UJBA 3FE2A 4CNBA 3L3BA 4P33A 2PUHA 5B7QA 3EXAA 3AU8A 2AR7A 1ES9A 3KYDB 4KPUA 4C0QC 4CTOA 4Z1MD 1WP4A 2QRMA 2ZTUA 4M9ZA 5EUQB 3E81A 2HU5A 5FTKA 4DF3A 3RCBA 3K70C 1R4NA 3RUIA 1G2IA 2BHRA 3P9SA 3VX4A 1G8YA 4UOQA 2JD0A 1RZVA 1WV1A 2ONZA 1E9RA 1E5VA 1VHDA 2C8LA 2XV1A 3KAQA 4F0JA 3QLJA 1T0BA 5DGDA 4XIIA 1AK1A 2IY8A 4EX7A 4OLHA 3DGEC 3KKMA 5A7GA 1JYEA 1TK2A 2P65A 5AUQA 4RLFA 1GPDG 5CVUA 3PIIA 3A3NA 2CL7X 4O4HB 4RE5A 3JQ8A 2NUAA 4J0GA 4PGMA 3EZ7A 4URZR 2VK1A 4PSVA 4C0KA 2H1FA 1HLPA 3IUQA 4M1TA 4MI3A 4Q7EA 3B7PA 3KVYA 2VAMA 4LZNA 3AR5A 1VLLA 4I4CA 2ISCA 2CFSA 4ZAXA 3YASA 1TQ6A 1NRXA 1JHAA 5B7GA 4ZJZA 1Z0IA 1Y33E 4A1OA 4GZLA 4R4JA 3E3MA 1K27A 2XOKA 1VRWA 1S3FA 3T3PB 2XDQB 5DZSA 1WQ1R 4Z1MA 3OD5A 4KB5A 1IY9A 1VCHA 2PMDA 2YRFA 4O0LA 4OYRA 1P81A 1U02A 1M1ZA 1TKAA 4DC0A 3TMYA 1HE5A 2JIDA 2Q1XA 1UPCA 1MLDA 4NATA 4W5HA 2OO3A 3NBXX 3RROA 1ICEA 2IUSA 3IIJA 4QFMA 3RUFA 1VL6A 1PX0A 4HQNA 1YQUA 3VHXB 4DRXB 1YFJA 2O23A 5DXJA 1SPBS 1LTKA 3VH2A 1WAMA 3ILHA 3FBTA 3DM9B 2H9AA 1ITZA 1DJOA 3KYJB 4G8CA 3KFXA 2NSJA 4IIHA 4MQLA 5LPNA 4HOYA 3MJCA 4NQZA 1NMSA 3OT4A 4BJ6A 3STTA 2P27A 3WZMA 5IZCC 1JGTA 5FPYA 4J7CA 1QP7A 4LTMA 4GLBA 4O4LA 2VDLB 4NH4A 5K3DA 4DKJA 3GHHA 3RYCA 1P45A 1UC4B 3F6SA 1V0JA 4XJXA 2W2QA 3QJGA 4KITB 3G0HA 1R4AA 1WLSA 3SX4A 2DERA 3R7FA 1P7CA 2VPIA 5A3RA 2ZR0A 1ODCA 1VLJA 2EFYA 3VOTA 1KQGA 2R6AA 5A05A 4FFBB 1N2IA 3WK8A 1T4MA 3O7WA 1Z0UA 3A9RA 3W6UA 5TC4A 1ZWKA 1U5CA 2XRFA 5JAHA 2CB0A 3W1EA 1XDWA 2VF2A 5GONB 3B8EA 4M60A 4K8OA 4BKQA 4E5YA 2G08A 1Y4SA 2OZLB 3TRIA 3GJQA 1Q2XA 4PR3A 5I7OA 4G36A 2FMTA 3ZV7A 2CZQA 2OXIA 2OD2A 5DNAA 4Z2AA 2CN1A 2EX4A 2IEBA 3KEMA 4XIYA 2G6TA 4OYLA 5HFJA 1Q19A 3O21A 4K9PA 3PICA 1OF1A 2XA2A 2YWHA 1X74A 3V9AA 3GJ5A 2ZI3A 1VXOA 1OH5A 5A7FA 1YZLA 2GHRA 1RPZA 3RTBA 1YJBA 4KK3A 5HYVA 1W5AA 1G21A 1ZFNA 4RF5A 2E9SA 3RARA 9ATCA 2GEKA 4AZ0B 2PD3A 3ENVA 3GNLA 3AVWA 3PR2B 1P7PA 3V4SA 2IHUA 3I9JA 1D5WA 4Q6BA 4XWOA 1VL1A 1JJIA 2CFRA 2OCLA 2XLCA 4QUIA 5ALTA 4EPYA 4ETMA 4ESEA 2YV5A 1VE6A 2VNSA 1RMYA 1DFHA 2WHPB 5BSTA 1QYVA 5U9CA 2BR3A 4QWMA 1HUQA 1NXQA 2RK4A 3D7SA 5FB3A 5BSRA 3W6NA 1TRHA 1UZAA 1JG1A 1KTVA 1L5FA 3GN2A 2D5BA 3W2HA 1BKSB 1PJZA 1DC3A 2I67A 1U8EA 2ZE7A 3D81A 4WNCA 4EG7A 5B1SA 1F1BA 1K4YA 2YMMA 2C4HA 1KNQA 1Y1SA 1JR3D 1SRRA 4PCVA 3ZIUA 3DCNA 1N9GA 2D4HA 2C3UA 1UQRA 5IH7A 1U11A 5EIAA 3JYNA 4P3OA 1RQNA 4Y1FA 2FFRA 1UOPA 4LJ6A 2FG6C 3AR7A 1D9XA 3DE1X 4OHRA 5AIAA 2R7AA 2HTEA 3HVUA 4QYMA 3FLMA 1OCEA 4DA7A 4HGQA 4QQRA 4IIXA 3MJHA 3UFBA 1QGDA 2CUNA 1JW9B 1LDGA 1PK7A 4MITA 5JAPA 1DBPA 2FDRA 4M9SA 5KBYA 1QRTA 3GPIA 4G3XA 4AX4A 3OJWA 2EDAA 4D3YA 2BKLA 3K0FA 1UJNA 2ZT7A 4E46A 5A06A 4FE7A 3C6KA 2ZITA 4IIBA 2YCBA 4UVGA 1SVOA 2VQ6A 3RAEC 3FCEA 1X1EA 4QU9A 4BYMA 2OGSA 5BV1A 5ERGB 2R25B 4IV8A 2IPOA 4MMYB 4XSHA 3VM6A 3RVPA 1MG0A 1SKYB 1DC5A 1J70A 3WK9A 5JZSA 3QF4B 1Z37A 2J07A 3GBPA 3NANA 1CV2A 5FWYA 1OTYA 1RLOA 1NF2A 3O1JC 5AJVB 3WTCA 2BEJA 1XMSA 3H17A 3IMCA 3TE7A 1W29A 3LY9A 3PEWA 5C8YA 1KO4A 1KZHA 3TOVA 1XVVA 2NZUG 1M8PA 3EODA 1PQWA 3NIDB 3FRHA 3OIGA 1DP4A 4R05A 4K3VA 2JLCA 1WABA 1EBFA 4TPKA 4F86A 1CDOA 4BTVA 3DMTC 2XNHA 3IERA 3R3XA 1WD7A 4M1MA 5H0IA 3DTVD 1KDTA 1KVRA 5T41A 4LWPA 2VR1A 3WV5A 5J4YA 2G9ZA 3VR3A 3I05A 3N6XA 2GNPA 3I58A 2OY0A 2QNRA 2WJ3A 1WZUA 2MMGA 2P69A 1BKYA 3H0EA 4EITA 1WUHS 1M6VA 3P9IA 5JJLA 4LNAA 3PWTA 2C3MA 1YL7A 3MT0A 1A9XA 2QZ9A 4XPZA 3TNDA 3DOHA 1SKQA 3IAS1 3RADC 2O19A 2CNWD 2XRMA 2YWFA 1U3TA 1AG9A 3PNSA 4GOMD 4RPGA 5SYMA 3S5UA 1ZC3A 3SGLA 4BQOA 2DB3A 4R9SA 4L16A 2V7EA 3K9GA 2VP5A 5D7BA 5EPEA 4Y0VA 1DBSA 3TR0A 1GYPA 4GXNA 5SYNA 4QBIA 5FDFA 3F78A 3C3KA 5GOTA 4PAWA 2CVOA 4LHEA 5KUTA 1ZRHA 4AKIA 2ICAA 2JIZD 4GI5A 2FPSA 3CF4G 3UC9A 5CDUA 4B79A 2IW1A 3DPIA 2YJ3A 5I48A 3NG1A 3TBKA 1MO5A 2A94A 1NJ2A 1F0YA 1P33A 3ANSA 4GLJA 5HKKD 1IMJA 2EW1A 1JDSA 3K94A 4YJDA 3WRXC 3HVRA 3QE4A 2R8YA 5CA0A 4HEHA 3UXMA 2A9KA 3AG6A 3L79A 2G83A 4UUOA 4RD6A 5B64A 4J0DA 2C5BA 3BJZA 4J9UE 4V2IA 1F20A 3ES9A 3OEEA 5AVJA 5HG0A 5LA6B 3TQFA 4EW6A 4Z7OB 2YUTA 4OHYA 3Q3VA 1FP1D 1R6VA 4FMCF 2GN0A 1RRVA 3K2BA 4V1CA 3GT3A 4JY7A 1O9HA 1UR5A 3ACBA 1XZEA 2I7CA 3O8OA 1G5RA 3I2GA 4YMLA 5KYTA 1EFAA 1Z0FA 1E99A 5HRCA 2WYOA 5LB2A 1VPTA 5F52A 5GGYA 4Z9FA 4EY5A 1QHHA 2W6ID 3SX2A 1XJQA 3H4MA 4Q3EA 1IXSB 2ECFA 3LUHA 4QM6A 2OV2A 4B1FA 2PGXA 3FYHA 2QW1A 4IKPA 4B34A 1TJ4A 3K9QO 1NFFA 1Z7GA 1YE3A 2FAXA 3AUFA 1G59A 4C30A 1PR5A 1VYHA 3KLOA 3EAQA 3NXKA 4HB2A 3AHCA 4UU7A 1NAHA 4I1PA 4S1TA 3VNVA 1GTMA 4HR7A 2GZAA 4S1OA 2FP3A 2NVWA 1FUYB 4J76A 4KO8A 4YYEA 4FUQA 1WVGA 1TAGA 5ICSA 1TZCA 2QX8A 4BKOA 4J6FA 1VPVA 1XROA 2XUJA 3OOJA 4YQYA 4AY2A 4AG5A 1WU7A 1LBHA 1ZPDA 1H6BA 1PLKA 4H7DA 5FOQA 1T25A 1CXZA 1U0HC 5JIBA 3OZFA 4QIHA 3C3AA 4KQGA 4A92A 4DR2B 4FQ8A 3O8RA 1FMFA 4QJIA 4RGVA 2PANA 2Q5EA 4NPHA 4E2XA 2ZRBA 3GNQA 3C5VA 2PKWA 4Q1DA 2WJ6A 2WSMA 3FNIA 2C95A 3TXAA 2W8ZA 4V0RA 2FZVA 4ZXPA 3W2EA 1C3OB 4DT1B 4NCNA 4I55B 4IMPA 3PDCA 3A2NA 2VHCA 3SKVA 2EYQA 5AK3A 4PWYA 3HU3A 2DHDA 2VDKB 2C20A 3JAKB 4GGPA 2D0DA 4E5MA 1AHPA 3H1EA 2IQ5A 1UXKA 3BA1A 3WKDA 4NK4A 1TQ8A 4CCWA 1ULSA 1ZY2A 4PN7A 5I9LA 4UFOA 2HN9A 5AOCA 3V8NA 8AT1A 5BYJA 3Q2KA 4BLWA 3IPRA 1DTSA 3G2NA 4BECA 1BYUA 4G0WA 4FFOA 2EJWA 3V9PA 4DCSA 4AP6A 1U2SA 3OPQA 4UULA 2YHUA 1QYIA 4PX5A 3JQ7B 1WXXA 1KMIY 1E2FA 1K2WA 1SQGA 3FNRA 3GGDA 1TJYA 1U1FA 3IUNA 3WO0A 3GFRA 4NWIA 5DSXA 4NESA 1EUYA 4G5QA 3ICOA 4BGEA 1IHDA 1TPYA 4S04A 3EXIB 4LDRA 3IDOA 4DQKA 4EMBA 5LFAA 1GTSA 2ZWPA 2Y1DA 4IFIA 5AJWA 3W5BA 2QAGC 2VJDA 4LRXA 1G5TA 4CF7A 4X65B 2PYIA 2C9CA 4LDAA 2QX6A 3FHOA 4OGGA 2WWTA 5H3HA 3VPDA 4ETIA 1G38A 3T1QA 5KYUA 3TX2A 5HM6A 4G4IA 4R5MA 1SXGA 3PFBA 1P3DA 4OI4A 3NHJA 3LPNA 3Q8MA 4N5IX 1XELA 2H6EA 4OQLA 4RPCA 3U16A 4BO8A 2CB9A 5KKAA 2QRLA 4KIWA 4A6DA 3NHRA 4RTMA 4YAEA 2B98A 1XXHA 1FDSA 4DMKA 1Y5RA 1OT3A 4UCWA 2PMCA 3U5ZB 1KFKB 1IM5A 5IPFA 2RGDA 2Y8EA 5IVDA 1E2DA 3ZQ6A 1XWWA 2DG2A 2JZOA 4CLDA 4QLBA 4P3XA 1RAFA 3VU8A 5LP6C 2FMXA 3EGXB 1DIBA 3BFJA 3MBKA 1KMCA 3ZWBA 3DFFA 3BERA 4DFDA 2ZUDA 4N0DA 1CDDA 1WDKA 1E3IA 3AP1A 3NWBA 3QOYA 1Q6YA 1TVKB 1GNSA 4KAJA 4JGGA 2HRRA 1KMHA 3AUTA 4KODA 3K72B 3O8BA 4Q66C 4QSHA 4E3ZA 1E9SA 5LLDA 1T8TA 1MXHA 2ECQA 3PI7A 2IPXA 4NZOA 2VP6A 5EZQA 3DYBA 2Z8YA 5KNDH 4EVRA 5BWNA 2P9BA 1QOPB 4HNTA 4FM9A 3RGGA 5AI6A 2PVPA 2OXFA 4Z0TA 4ZQHA 4EF4A 4KXNA 4LFAB 2WAAA 1AGNA 3A31A 5AI5A 3IYLW 4Q1AA 2NVOA 3IQGX 3VR3D 3FLBA 3P94A 1IOVA 5F2KA 2HJ9A 4FP9A 3EFHA 4MVJP 5AJXA 1Y6ZA 3H4IA 5BV0A 1EWVA 2D3WA 5ULLA 2DTXA 2FFAA 5F7OA 1EFLA 2PQ6A 2AXEA 5G41A 2WU0A 1TL7C 4CF4A 2FEAA 2HKIA 5SY6A 2O5VA 4MR7A 1ECPA 2GZHA 5B2ZA 5JPDA 1NU6A 3HZHA 4HB4A 2X19A 1GEGA 4R51A 1RKBA 4LOHA 2GPYA 3A7DA 1EFDN 2FE1A 3C16C 4NAHA 1NLMA 5IDXA 3VKHA 1I6MA 3FDIA 1AURA 3OFSA 1RRGA 1EBBA 3LLSA 1RYMA 4IXDA 1C7QA 3OKFA 1YVPA 2OBBA 4UU0A 2JI9A 2PS3A 4HRYA 3WICA 1I7DA 2ON6A 2YJ5A 2XBUA 2ZJFA 4GXTA 2J6IA 4MAMA 4ADSG 2PLFA 1XU9A 2QBYB 2J9FB 3NI2A 1GY8A 4MKIA 4Z8YA 5BR8B 4AQYB 4IFTA 3OIVA 4YWHA 5IULC 4LVCA 4RVCA 3QENA 4EKDA 3I5YA 4BIIA 2F9MA 1AS3A 5DBIA 4IICA 3ELWA 3UAXA 3LSTA 1E79A 4OKIA 1ACMA 1EDZA 4MPJA 5HQTA 4DR4B 2ALJA 3AKEA 1UP6A 1ZISA 3H1AA 3WB2A 4UZSA 3B3GA 2CBZA 3U7JA 4ALLA 3ZGNA 2J7PA 4OI1A 3AGQA 1TPZA 1TU4A 3CM0A 3RIMA 1PDWA 4E32A 4KNYA 2WZBA 4LI0A 2HSEA 4UCQA 3ZHXA 3NH6A 3DBLB 4PEVA 3RUCA 3IE1A 4EJSC 3OT5A 4M22A 3NP7A 1IHXA 2CJPA 2QTMA 3RFFA 4PG7A 4D6XA 1TCBA 3KZCA 3Q3HA 4KLRA 5HFNA 4X0EA 3TF5A 2X3UA 3CJRA 3D0RA 4NMWA 3EVCA 5A5EA 5A62A 4DUGD 3NEJA 3GLKA 5IRCD 2CVPA 4R1SA 4YRDA 4UDYX 3DLCA 3FZEA 4KR6A 1JEOA 2I03A 3PFNA 2VAVA 3GPBA 3PYLA 5IDWA 2BGLA 4PZZA 1SXJC 2GASA 4NU6A 4CHGA 1PFYA 1MJHA 3IH5A 4D26A 3EEBA 3G2KA 3QFTA 4REQB 2ZAOA 3ZXIA 4B82A 2XXAA 3GG2A 4N5MA 1LBQA 1Q0HA 1YZTA 1Q6ZA 3F3MA 3THXA 1B8UA 2O4CA 4IO1A 3TPCA 4HVTA 3AETA 3P45A 5ARCA 1C3EA 2HV9A 5TSDA 4CHTA 4HMPA 4JDPA 3IBYA 1O6FA 2ANCA 2KHZA 3L6RA 1C14A 4H4CA 4UHEA 4QRIA 5EXPA 2CT8A 2VO1A 1G18A 3TSYA 2B4QA 3WSWA 4AUMA 1Z5VA 4DDTA 3VYTB 2ACKA 1EX7A 4DRXA 4O2AF 5AKEA 1FSZA 4UNNA 1WB5A 2EXXA 4F97A 1OLUA 1TZ2A 1W581 3OWHA 3DLBA 4D9IA 1LDNA 1SKYE 1O89A 1WUKS 2HSJA 2VCYA 2WTEA 1PT5A 2OHGA 5KQGA 3KAPA 2M2IA 3MFYA 4HX9A 2QHXA 2WWHA 2ZYAA 3SYNA 1U7OA 5JNSA 5BNZA 3IA7A 4QOJA 3CC8A 2ZVQX 3A0UA 2DQKA 2I62A 2BMJA 3OE7D 4FOOA 5FUBA 2HJSA 4OL9A 4URUR 4K9MA 5TPWA 3HEAA 4REMA 4AZ0A 3LF2A 3VBEA 3R23A 4X6YA 3PUKA 3A6KA 2EL7A 1GKIA 1I32A 1QS0A 4IIEA 4OHOA 5AW6A 5KKCA 5TIIA 3FVVA 2RC5A 4U2GA 4DNQA 1Z6TA 2BGJA 4D9HA 2CLIB 3LS2A 3ICQB 4PZDA 3E9CA 3TIIA 4A6PA 4JASB 4NOJA 4OB7A 1LS1A 4EG1A 5DNUA 3QE0A 1Q1AA 5HR5A 4FC7A 1QCCA 2N46A 2M32A 4DJ5X 5JH7F 2XMRA 3MSXA 4J16A 3FPHA 1KZ1A 2R6JA 4R5HA 2GETA 4P31A 4JLVA 2FRVA 3P26A 3ZS9A 2IK8A 1GAQA 2FZ5A 4JC0A 3VR4D 3KJHA 4ZK6A 1N2OA 5IYZB 1ZNWA 1YZNA 3LI2A 1D8AA 3IOBA 5AXAA 1OQAA 1NQUA 3IHLA 1BE8A 3KSRA 1VE7A 3AVQA 4HFRA 4BWGA 3LOPA 2PYZA 1JMYA 2I2WA 4FHEA 1PR4A 2VBFA 5E95A 3RSZA 3U7FB 2V54A 4GOKA 2JI8A 4NXMB 4MVJD 2FN8A 3BREA 1JFFB 2XOKD 4RK0A 3R9XB 1K8XB 2IVFA 4QVIA 3QPCA 2JAUA 1FTNA 5TGTA 1HE8B 1X8KA 4UBLA 2EATA 2GPAA 3W2FA 1EP9A 1WCV1 5BT8A 2MT9A 3T7JA 2VC2B 1ZG3A 1T6YA 4WJKB 3WGMA 4EJFA 4G5OA 2DPHA 3I6ZA 3DNMA 5J5CA 4KWIA 1T8WA 1EHYA 1XZGA 2WWVD 5KJ1A 1TEZA 3NDRA 3N5KA 3B78A 4HXEB 1K6IA 1KVQA 2GKOA 2C61A 4UBOA 3NIWA 4IBOA 2QBYA 3BMNB 3N2YA 1ZJ5A 3DAPA 3LXUX 4KL8S 1CR2A 4YT5A 1F1JA 2AJLI 2CVZA 5D1HA 1EZ4A 1KMQA 3ZE6A 5BWLA 1XKXA 3ZZ1A 3PC7A 1GZVA 2HHJA 3UJCA 4A8TA 3T4UA 2Z95A 4M46A 3UMMA 2QYTA 1VG8A 1JIXA 3R0JA 2Z43A 3R3HA 1DAMA 2VYVD 1RVV1 2QUBA 1F4PA 2FR8A 4OXQA 3SR4A 1LRJA 4DJEC 4HVAA 3I62A 2EJBA 2PKEA 3I1JA 1DVRA 2A6PA 3AJAA 3GW8A 4LXIA 2OHXA 3GZNB 3VO1A 1CUBA 2O8EB 5DF1A 3SE7A 2OCAA 1QR6A 5BVGB 3GAFA 2HW8A 1DGQA 2XXAB 2HPZA 5H7XA 1NQTA 3IP9A 4WASA 1QRSA 3RODA 3G7SA 3IEVA 2GXQA 1WMEA 2HFKA 2G80A 3R5TA 5E8RA 2XBLA 4HO1X 5AW0A 4KPEC 1O9GA 1B0AA 3L77A 1BN7A 2DXIA 4RVOA 5FA6A 4AD8A 3B36A 3HP7A 3TLJA 3UYKA 3N2KB 1E4YA 2R48A 3KOOA 1UBMS 2IA5A 3ROZA 3QFRA 1RQ7A 4O4JB 5MF6A 1FTWA 2H4HA 5KJEA 4LF8B 1IN6A 5TGZA 3E9YA 1YJXA 3OF5A 4KDFA 1H1TA 3SSMA 3UFXB 3WIEA 4TT3D 4J7UA 3KVNA 1X9HA 1JT2A 2QKYA 3TOCA 4CM9D 1KR5A 1W4LA 2WJYA 1ZA2A 3DA8A 3KYDA 3LC7O 4EJ2A 5IXJA 3KV3O 4LBWA 1HYBA 2YXNA 3LWZA 4GMDA 2P5TB 1AB6A 4QPZA 1DXOA 1KO7A 1F8UA 2DVMA 1XZIA 3UMSA 3V4PB 2R62A 2Y1FA 5A2GA 1MRSA 1CC1S 2Y66A 1LEHA 5DO9A 3QMWA 5FBZA 4TLAA 3DV0A 4Y18A 5A7HA 4X00A 3ZD7A 3H9UA 4H6WA 1NI5A 1IB6A 4EZIA 1LC0A 4JJZA 1OKKD 4YAJA 1T4BA 4HADA 3K0SA 2ZBGA 5LC1A 2JK1A 1I94B 3ELDA 1UZUA 2HRCA 5SZKB 1QPGA 3OQHA 2E2WA 1SK9A 4ZTBA 4JROA 4MW2A 2D5CA 4D8VA 3SZ3A 5A9TA 3BMXA 5IX8A 1PGQA 3C3CA 1OIXA 4S12A 5LBIA 3ADCA 4G01B 3SDZA 1U0SY 4KAFA 3PFIA 4JVMA 2UYCA 1D2CA 1C30A 1K88A 4MW1A 3DKVA 3I9OA 3EGEA 3A3YA 1U2EA 5IW8A 2PZGA 3P32A 4XLZA 1N6PA 3FJ1A 3OCYA 1YZ3A 2QJTA 3WLMA 3UH0A 4E6PA 4I2VA 3GUYA 4RXUA 5CUQA 5KTTA 4DLNA 2B9EA 3ITEA 3RQSA 3KYCA 3CPJB 3HFGA 2WV9A 3V46A 4YCSA 2HDHA 2ZREA 5CX1B 3W7BA 4GDFA 1B3BA 1M2VA 1JR3E 1M74A 4X8OA 2H2GA 4DQVA 1V8DA 3EOZA 4FDTA 3U4AA 3WIUA 3MTDA 1F2DA 5CD1A 4IIUA 2WKWA 1T5BA 1YNSA 3CH4B 3ONDA 4FCTA 1P62B 1H22A 2X42A 4OP3A 4L51A 4XYEA 3U17A 2MHCA 2J59A 2I8LA 3WDLA 3HEMA 3RSCA 2FUNB 1G6KA 1MDFA 5KTYA 3HCBA 2BSQA 2XUGA 3H5TA 4TWIA 1S02A 2TSYB 3C3EA 1TVKA 4HNAB 4EY4A 3VR6A 2CV0A 4MARA 3D2LA 4RO0A 3HP4A 2CGEA 3O0DA 3H99A 2BM8A 2G9QA 3CU5A 1SUFA 4A27A 1L7DA 2ZYDA 1RWKA 1C7FA 2QN9A 2RGXA 5H80A 2UYOA 1JDJA 3MIIA 4LE1A 2Y0BA 1K7YA 1MX9A 1RYYA 1Y8QB 2JIBA 2PUTA 4FSDA 5AVSA 3U4DA 1QG6A 1HYQA 2NQ8A 3PNYA 4K81B 1NYQA 4O08A 3A2KA 1VA5A 1OWMA 4JS0A 5GJWC 2BFCA 1ULTA 1TF7A 4UD2A 3IDFA 3KUDA 1BN6A 2SNIE 4MVXA 4FMCB 4G89A 1ZKDA 5DGIA 2IPAB 4P4UA 1H2HA 1EX6A 3Q0TA 3KSDO 2X7JA 2RAFA 2WFMA 4G8BA 1LLQA 1OVGA 2RG1A 5DBOA 3S7ZA 4HWGA 3J81k 1I7LA 4ZV9A 1BMDA 1VBNA 2F17A 1YCHA 5C1DA 2PVCA 3T15A 3K0KA 1LLUA 1LDYA 4N3GA 5JNTA 1TQHA 1YBHA 2IKSA 1HDRA 3ESAA 2WE8A 1GUAA 2C07A 4O25A 4WK2B 2EKZA 4TMFA 5IVPA 2CXRA 3WWCA 5M34A 3IEMA 1XAGA 2I33A 2FG5A 2R5NA 3GIDA 3MGGA 2AG6A 2WYIA 4URWR 5D3ZA 4JGIA 3RRYA 2YV4A 3WLHA 5IFKA 2F6RA 4DV4B 1Y5MA 2AQ8A 3VV3A 1G8FA 1P8JA 4N0EA 3SR0A 3E1KA 1U3DA 4OQQA 4TRMA 4WXPA 5AKHA 5FO0A 1W0JA 3DKPA 5JI2E 1UIRA 5JJCA 1ECCA 3FGZA 5CAEB 4N48A 4D9FA 2GXUA 4RESA 3LT1A 2I71A 3PPXA 1T0UA 2WPNA 2G8LA 1UJCA 1ZJYA 4L7VA 4O5AA 1EESA 2YWRA 1FUUA 4XWAA 4RTJA 2C2XA 1R0CA 4MYDA 1RYHA 3OZVA 2QG6A 1JQBA 3MRXA 4K1LA 4L3OA 4UZEA 4D5EA 1UOOA 2H1WA 3H6KA 4TMZA 1HL3A 1K8QA 1Z4QA 1N5RA 5JZ9A 2J85A 3RC8A 2BF7A 1FYWA 1ABEA 5BOVA 2H7CA 3IXQA 1K7FB 2Y77A 5AQ1A 3U7HB 1JKFA 2DT5A 4P08A 3GMDA 1MEJA 2R65A 1W93A 4BIMA 2WTMA 4A15A 4R2JA 3S7TA 1ADGA 3AF0A 4KXYA 4I9HA 4L1KA 3O8NA 2Y1LA 2ODEA 4UZFA 1W94A 3OEYA 1H05A 5AJUA 1ND6A 1YIAA 4KEAA 4RFSA 3PNLA 4DHWA 4E12A 4CCYB 1R12A 2BFDB 1V16A 4HAWA 1M0SA 5H3LA 1NBMA 1UFQA 2QY6A 4BNYA 2OQIA 1DL5A 3VPCA 2AEEA 3NUQA 4E4TA 3KDSE 4FMDB 1GT6A 4Y2HA 1UK9A 1WMBA 2E87A 2Q2OA 1XYGA 3IT0A 3ZHYA 5LQJA 2W8BB 3LGAA 5LYYA 5LP6B 1DKNA 3QWAA 3RD5A 3ESQA 3F9RA 2KLHA 2AN3A 3PB3A 1JYFA 1QE5A 1ZO8A 4MWCA 1K2VN 3DZJA 3KETA 3LCMA 2VHYA 3R77A 1GXSA 8ATCA 4JSTA 3CIOA 3VJMA 1KEEA 1VKRA 1X92A 2HPHA 1QYWA 2A7QA 3IAHA 3PKIA 4GT1A 4QJ5A 2IYTA 3GJ4A 4FFNA 2FF5A 2QLJA 1EQ2A 3QHAA 5AW9A 2IYFA 5JG7A 2J32A 5L40A 4JJEA 4F1KA 3A26A 5SICE 4PM4A 3FMVA 1CY6A 4WBNB 1P2TA 2WUVA 3JD4A 2E49A 1ZINA 1ANKA 1OC4A 3PENA 1WF3A 4FNGA 4BVBA 5HZGA 4BJ3A 3AF4A 1TVMA 2VTKA 3AI7A 2WHXA 1Z2CA 3L7OA 3LWDA 4WDQA 5D00A 4BNNA 1H5NA 1CZOA 3QKRB 3REQA 4EPXA 5BRAA 3B20A 2YWGA 4Y2VA 4AG6A 3FPGA 2ORYA 5CDFA 2YYSA 1U9ZA 1T1RA 3LQKA 4GYKA 4R68A 2PX6A 1U0GA 5GMOA 4DHEA 4MS3A 3WHKA 1VHQA 5KZMB 3PFWO 2OXTA 5BW6B 4N5NA 2OQVA 4EYGA 2PTGA 3ZDEA 1MJFA 5EFZA 3W9UA 2NWQA 4RZUA 4MKGA 3SVTA 4WKOA 3MCZA 1FFXB 4BKPA 4MVJI 5AVUA 5C8ZA 5C53B 4KFCA 2XE7A 2BJVA 4AP9A 5JBQA 2PXAA 5IHPA 2QA5A 1QVVA 5LOVF 2DFNA 3EUFA 4IQFA 4LNUA 5LIPA 1UIMA 4EEXA 1GU7A 2NZYA 1Q1ZA 2IE8A 3RKSA 4QOSA 3N2EA 1H0HA 4LYJA 1G63A 1T0JB 1AUVA 3DFZA 1FVOA 5K3OA 2Z3VA 3K35A 3GVPA 4PZAA 3A6EA 3IP3A 5JQGA 1YKGA 2JFOA 2YWDA 2R00C 2O14A 2XDAA 3ZWVA 3UKJA 3IXMA 3PQ3A 4JELA 2P2NA 3LKBA 1E58A 4JWTA 3LCJA 1SBHA 3AHIA 4RA6A 1GDHA 2TMYA 5J2UB 4LNUB 4NMMA 8ABPA 5JAMA 4YRJA 1MJGA 4JP5A 4KXUA 4EY8A 3IAM6 1KJZA 2ZIAA 4CODB 3KWMA 2KMLA 1C3XA 3KEOA 1CCWA 3D0OA 2XEDA 3DF7A 3EFOA 4H16A 4M21A 2C5LA 4G07A 1L6IA 4X1YB 5U4XA 1LK5A 1XCLA 4KVAA 3SF8B 5C0OE 4TYQA 4ZMRA 2A0WA 4LIPD 2DWQA 5HCIA 3QU2A 5EJFA 4YJ2A 2ZOSA 5DTQA 3PCXA 3EHEA 3HA7A 4MJXA 5JSFA 5LWQA 4JP2A 2Q4OA 2OZKA 3REQB 3GVCA 1MPXA 2AIRA 2VXYA 4UU1A 3AQ4A 3BFKA 1G21B 2P35A 1FFGA 3OTGA 1VYUA 4H0CA 4WCDA 4BV9A 4BX0A 3D54D 1OWLA 3DAOA 3KX2A 3I5AA 3Q85A 4CQMD 2ZUUA 2FUG1 2C31A 3FF4A 3D8UA 4CT0A 1LLDA 1P39A 1KPIA 3EFOB 4URVR 1E32A 3NDBB 2VP0A 4C3UA 2IU6A 2WWIA 3DTYA 3AV3A 2QD4A 1XU4A 3GRVA 2JASA 4N3AA 5DM0A 1JFVA 3I1FA 3A9UA 3LY8A 3MIZA 3GRPA 4HX5A 3P2EA 2FDXA 2FSSA 4PV7A 2P6PA 2ZYUX 5T6MA 3ZWXA 4YRSA 2ZUEA 1SKUA 2Y9PB 3RHSA 1TT5B 3GX1A 3CLSD 3F5SA 1K4KA 1SKAA 1TIPA 3FLAA 3PNPA 1MX5A 4GVPA 1E2KA 4ISCA 1K98A 4XGRA 3VU0A 2B35A 4QGBA 5BQOA 2L0XA 3LDGA 5BN5B 5CDGA 4F91B 1UAAA 1RPTA 4NG4A 1X70A 2OPBA 2XNSA 1C1XA 1N5MA 4D0RA 3V4RA 3C87A 2AN9A 2X8JB 3B12A 1A50B 1LSUA 1ZUHA 1RYFA 4R2XA 3W90A 3ZLUA 4DAOA 4DWWA 2VJQA 1OAOC 3WMGA 2E5FA 2CCGA 5H8WA 2X5KO 2VDWA 1CD5A 3U4IA 3BHMA 3ERCA 4M0PA 2AR0A 1JSLA 1P9LA 1EFPB 4RMJA 4GZ5A 3H6HA 1AK2A 1R4MA 3IEXA 1RVDA 4YRNA 1O6ZA 2WDZA 5ENDA 1P9OA 4C7XA 2WZDA 1XK6A 3I9KA 3C1AA 2VN8A 2XR1A 4C3ZA 2D1TA 3S40A 4DJFC 4LJ7A 3DLIA 1BS9A 3OLWA 4TMYA 4LOIA 1ODSA 2M6KA 1Q0QA 3V4ZA 1EWYA 3ILYA 2MINA 4FMBB 3UMCA 2BAGA 2X8BA 1QH9A 1GGJA 1IQRA 1T9DA