4M7SA

Crystal structure of semet btrn in an open conformation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
249
structure length
214
Chain Sequence
MDKLFSMIEVEVNSQCNRTCWYCPNSVTGEMDPALYKTLMEQLSSLDFAGRISFHFYGEPLLCKNLDLFVGMTTEYIPRARPIIYTNGDFLTEKRLQTLTELGIQKFIVTQHAGADKEKVVYLDHSASKANMSCMVPSNLAVVTVLGNVLPCFEDFNQKMVMGNIGEQHISDIWHNDKFTSFRKMLKEGHRGKSDLCKNCNNVSVQTEEQYDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray analysis of butirosin biosynthetic enzyme BtrN redefines structural motifs for AdoMet radical chemistry.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Metal binding protein
molecule keywords BtrN
total genus 71
structure length 214
sequence length 249
ec nomenclature ec 1.1.99.38: 2-deoxy-scyllo-inosamine dehydrogenase (AdoMet-dependent).
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13186 SPASM Iron-sulfur cluster-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4m7sA00
2ZZ2A 4WY0A 2TRSA 3DKLA 4W9TA 1C9DA 5U7SA 4M5PA 3W7IA 1M7OA 1SZGA 2D73A 1O95A 3LCIA 1F74A 2ZZ7A 1YDNA 3IIPA 5E93A 4EVZA 3MW7A 3G1YA 5FEZA 1SQ7A 1OHLA 5E0KA 4O19A 2TYSA 4JTJA 3A21A 4N6EA 1JCXA 2F7FA 1XBYA 4JIQA 5LNUA 3MHFA 3S5ZA 1ZENA 1VC4A 1MXSA 1EPXA 1W0MA 1Q45A 4IJBA 3NM3A 3SY5A 2B4GA 4O1CA 3NQ6A 1PCKA 3RU6A 3W1RA 1YXDA 3Q58A 3W76A 3OEXA 1EP3A 1G69A 3W1UA 1QCWA 1LROA 4JTUA 1OX4B 4NVTA 3NOEA 4ALDA 3O6YX 3P62A 3ZWTA 3TDFA 1KBIA 1Z48A 1H7OA 1WBJA 4ORIA 3TV8A 4K8EA 3DI1A 1JVNA 2YW3A 3INPA 1TTQA 4IMCA 1G4PA 2CLHA 3PM6A 2C16A 3LHZA 2Y6ZA 2QJGA 4K6AA 4O11A 1LRTA 1GPWA 4JXCA 1TO3A 1W56A 3QW4B 5L9FA 4LY8A 2GJLA 5LGZA 4NJKA 1G4TA 4UFIA 3WK2A 3W86A 4A29A 2FJKA 1OF8A 1N7KA 1P1XA 3B05A 1EIXA 3W2UA 1W37A 1FDJA 3IIOA 3M44A 5D33A 3P80A 2GUUA 2WSYA 3RFAA 4QISA 5KTLA 4R7JA 1W1ZA 2VEMA 3O06A 4AMAA 2G96A 3GR8A 2C6QA 2O7QA 1V7YA 2PCQA 4DPPA 2HSAA 3L5MA 1AL8A 3W72A 1NEYA 1OYAA 3IV3A 1UCWA 5KZMA 2X1RA 3GK0A 1G67A 2YR1A 2Z0IA 2EHHA 1A5BA 4GC4A 4XKYB 3N3MA 4UTUA 4JTHA 1FWNA 2FPVA 5G5IA 3W7RA 4O1BA 2J6XA 2PRMA 2YCEA 5FF7A 3W7KA 2ZYFA 3D0CA 2G5WA 2PRLA 3NG3A 4MJMA 5HR7A 3TC6A 4IX2A 4AXKA 3LCLA 5D04C 3I65A 2Y62A 1KLZA 3LHWA 3MI3A 4H3DA 4JS3A 5AYYA 5FEXA 1FWRA 4MJZA 4TX9A 1SO4A 2ZTKA 4LT9A 1W5OA 3U8GA 2B7QA 1CI1A 2DZSA 3W85A 4DELA 3G3DA 3W2NA 3WFAA 3OVQA 3TX9A 3UPBA 3MI2A 3ATYA 1DBTA 3TXVA 1EWDA 4U4MA 4CNOA 2J27A 1HFBA 1OFQA 1K8XA 3GKFA 5DCEA 1TCDA 3FYOA 4JTKA 4KWWA 4UTJA 3W84A 1B3OA 3Q37A 2VC6A 3H53A 4LRSA 4WQ6A 3W7CA 5DELA 2QCFA 1HL2A 4CCDA 3CM4A 2V2CA 1EX5A 4O1DA 2X1TA 3YPIA 2NUWA 3M5VA 2E77A 3ATZA 4KKXA 2C13A 2C1HA 5K4ZA 1H1ZA 2VEPA 4QQ3A 3NQDA 3S5YA 4FHAA 3W88A 1GQNA 3UQNA 3P5ZA 1KFBA 5CZTA 4MLJA 3DFTA 5IM51 3OIXA 1TIMA 5LSMA 5DN1A 3M16A 3MP4A 1NAL1 1S5TA 1MEWA 3QRHA 4N9DA 1WX0A 5KINA 5F2MA 3LCHA 3ELFA 3W2LA 3ZR4A 1H7PA 1MO0A 2CLEA 3SR7A 4BK9A 3NL6A 2JBMA 4MOZA 1KFCA 3NQ2A 2AAMA 3W7JA 3EWZA 2QCDA 1A5AA 1ZAHA 4AWUA 1P4CA 4MKNA 4M7TA 1TQXA 6TIMA 1IIGA 2OX1A 2ZZ6A 1GYLA 2A5HA 3C8FA 3V1PA 4UTMA 3E9AA 4UTLA 1IXNA 5HNRA 5TBOA 4Y90A 2YFNA 2A0NA 4UMAA 3LV5A 4K39A 4JTSA 4NX5A 1X6UA 1OK4A 4YMZA 1KM2A 1RZMA 2WQPA 2Y88A 3UXDA 2Q3OA 4GXMA 5A8GA 3N73A 4UUIA 1SO5A 3G1DA 3GDLA 5C5YA 1ME9A 3M0ZA 1VCFA 1YTEA 3LRMA 1LOLA 4K38A 1ADOA 4U28A 1SO6A 3G8RA 1MEIA 3W1QA 4PH6A 2VFDA 5HWJA 4FEZA 3A22A 1GVQA 2Y7EA 1DVJA 4X3ZA 3G1XA 4AB4A 2C0AA 4NZJA 3NYZA 1O94A 3GX9A 3B04A 1RPXA 3BGGA 1N55A 1SW3A 1QPNA 3EKLA 4MZ8A 4OWGA 3W70A 1XL9A 1T8XA 3QSRA 4FIQA 2I1OA 3O15A 4JTGA 3QFEA 4DF0A 1NF0A 3H55A 2X1UA 3ZS4A 2ZRXA 2V2HA 3DU0A 2GVLA 1YXCA 5DCBA 3FA5A 4PCFA 5AHLA 3MYPA 1RQHA 3NQGA 5DXYA 1TTPA 3PAJA 4O14A 1R2RA 3O1NA 1LOQA 3C2VA 5J5DA 4AH7A 4MY8A 3PF3A 3W7PA 3NEVA 1O5XA 5I3FA 2Z6IA 2QF7A 3RLVA 3HG5A 3IVSA 4CQ8A 1M5WA 1EWEA 2RKXA 5CKSA 4XBSA 3B0VC 3R5EA 4NXSA 3PVFA 1OK6A 3NQFA 1VYSX 5I3JA 1BEUA 2VFFA 2CWNA 3S8HA 1G4EA 3HIJA 4MLRA 3SGUA 5EY5A 1OVDA 2JK2A 4MY9A 4PA8A 1N8FA 1DQWA 4CNNA 2CZDA 1VH7A 4UFHA 3FOKA 3PSWA 3M5ZA 3DFSA 4S2CA 3NPVA 3DAQA 1PS9A 3U2OA 1KFEA 2X30A 1GVFA 3DHFA 2A21A 3W7QA 1ML1A 1YLVA 5F4WA 5AB3A 3KOFA 4UTIA 2ABBA 3TXZA 4NJHA 3HBLA 3P84A 1KV8A 2A85A 5K9XA 4UTTA 2VEKA 3GAYA 3FEMA 4QAIA 3T7VA 4KFPA 2QCDB 3NQ7A 4RLIA 1TTIA 3HF3A 1QNVA 3S5NA 4Y96A 2E1DA 1H7XA 4MFEA 1OABA 3FIGA 4MVAA 3QW3A 2YX0A 1FCVA 1FDYA 1KA9F 2V0TA 4LU0A 3N2MA 2VFGA 3BVJA 1KM5A 1ZJIA 2I14A 3LXCA 3BK0A 2W79A 1H7WA 4RZ6A 1TQJA 1A53A 3CLMA 4WZHA 1W54A 3HGOA 3MI6A 4HKPA 3DENA 1M6JA 5LNWA 2NX3A 5LZLA 4O8RA 2E6YA 3LM7A 2FLIA 3S1UA 1HTIA 2LLEA 4NU7A 5G1TA 4DO5A 4AWTA 4JR5A 2V5LA 3W07A 1LDCA 4MYXA 4R34A 5ABTA 2H8XA 1I2NA 3U6WA 2FTPA 4Q32A 3OA3A 3GYEA 3IIVA 1S3HA 1WOAA 3UWYA 1L6SA 2ZA3A 3VE7A 5EA9A 2H3DA 2NV1A 4NJGA 1VQTA 3PB0A 1DV7A 3BARA 3L66A 4Q4KA 3DFOA 1L6YA 1OFPA 2BWGA 1OX5A 5D03A 3NZ1A 2V30A 4FB7A 4K37A 3W1NA 3QJAA 3KRZA 2ZDRA 3MYOA 1LCOA 1Q6OA 5I3GA 2WNNA 3W23A 1TV8A 2A2IA 2V8ZA 3IRDA 3WK0A 1P0NA 4NJJA 1OF6A 5G4EA 3FKRA 4RXGA 1D3GA 2F84A 4IMDA 4UTWC 3TW7A 1OX4A 1TPUA 4FX7A 3G24A 1X1ZA 1VGAA 2ZA2A 3NGJA 2A1YA 1EB3A 3HGSA 1H7NA 4Z1BA 4A2RA 3LGEA 4IGHA 4CCEA 3NPXA 5EL1A 1H62A 4GUFA 3SSJA 3B06A 4GJ1A 4PL1A 4UXDA 1Q3NA 2OT1A 4RZ4A 1UBSA 3OHIA 3L9CA 1TRDA 3RK8A 4JN6A 2E6FA 4ADUA 3EEGA 3TNOA 4GUJA 3F4WA 1H5YA 4I7UA 1QWGA 2FFCA 2ZRWA 1XKYA 3HQ1A 2GVJA 5CPOA 3T40A 1VRDA 4JD4A 3VI2A 3UWZA 2QEZA 4BWLC 1K7FA 3SJ3A 2EKCA 4IPIA 1T96A 2BSLA 4N9BA 3W87A 3I7SA 1ONRA 2P0OA 3BG9A 3R13A 1SZEA 4RK8A 5AHFA 3LHTA 4UR8A 1QO2A 1DJQA 4Z0SA 1IF2A 1XDMA 1XI3A 3N14A 3W7EA 2B7NA 2QUUA 1TV7A 2R91A 3DXIA 3G22A 5DBTA 3QQ0A 2Y70A 4QM1A 3S9YA 1JUBA 5K9DA 2GQ8A 4IXXA 4D2JA 4P2VA 1WAUA 5CPNA 3GNNA 4C1KA 3PC0A 1W5QA 1XXXA 2RH9A 5K7JA 1XBXA 4O50A 2DU2A 2TSYA 1QO5A 4Z1CA 3SECA 3LI1A 1Z44A 3QMRA 3E02A 3W75A 1ZALA 3BPWA 5CG7A 2CZFA 2O7SA 1OYCA 2ABAA 4MUZA 3TSMA 3NR0A 3ZWSA 2E5CA 4HNNA 1O60A 3W74A 1L9WA 1QDSA 1J4EA 5C6MA 3K30A 2G95A 4LV9A 5HJLA 3L0GA 5EBUA 2GQ9A 3LTYA 1XC4A 3N19B 4JTFA 1E51A 1Z42A 2Y89A 4DQWA 1JULA 5F1UA 2E6DA 2PE4A 3KRUA 3LXBA 1QAPA 3HPXA 3UYCA 2YFOA 1ICQA 1LTDA 3THAA 1ICPA 1G7VA 5HUPA 2B7OA 1SO3A 3LCWA 1DJNA 4TIMA 3EB2A 3A24A 4I7VA 1WBHA 3GZ3A 2CZ5A 1T99A 1F5ZA 1K3UA 3TQKA 3L0NA 1JCMP 4OGZA 3A23A 4JYEA 1KM6A 5K3VA 3W1AA 5D37A 3W7LA 2HMCA 3GDKA 4BI6A 2JGYA 4PFMA 1ZNNA 3NPWA 1QPRA 1RV8A 2A7NA 3W7OA 2HS6A 2RHGA 4GFSA 2NXHA 1AW5A 5D2TA 2YYTA 1OFOA 1PIIA 3PUDA 4A21A 4O17A 5AYZA 4LS2A 1VCVA 1GWJA 3EX6A 4N4QA 3TU9A 1BWKA 3N9RA 1PVNA 1IXOA 4XWUA 4DPQA 2NZLA 2E09A 3LB0A 3LI0A 3KVKA 3TSBA 2WNZA 3IGXA 3GDTA 1VLWA 4JTEA 3S0CA 4I9AA 5C2XA 3V75A 3I6RA 2DJLA 4JTIA 1H63A 3VCRA 4RV8A 1B9BA 5K4XA 3CT7A 3KXQA 3MHUA 3GDRA 1DOSA 5A5WA 4M6QA 3R2GA 3NQEA 2XN0A 2ZZ1A 4AHPA 2QCLA 3LERA 5LGXA 4IMFA 4XZ9A 4BR1A 3NQ8A 2EPHA 3M43A 1O5KA 5I3KA 4FIRA 2J9ZA 3STFA 1VPXA 2CLIA 2TMDA 3G1VA 1GVRA 4B5NA 4P61A 4NQ1A 1U5JA 3B4UA 1T0OA 2QDHA 3LHYA 4ZQNA 1XUZA 3UXAA 3FJLA 1H60A 1NSJA 2R94A 2VFIA 2TPSA 3EKZA 1IIHA 3WJXA 1JQXA 3VNDA 1I2OA 3MBFA 1O4UA 3MBDA 1GG1A 2VXNA 5EMUA 4LVBA 2VELA 3QZEA 1B4EA 4AWSA 1LBFA 1S5VA 1RR2A 3QYQA 4LTSA 4CCCA 3W7DA 2GVGA 1TV5A 3HPZA 2OJPA 3LHVA 3Q94A 4LC8A 1K7XA 3CWNA 4PTNA 3NAVA 4CQ9A 2H6RA 5IBXA 5L6UA 1HUVA 1DL3A 5CPMA 5H91A 5FI8A 4QNWA 2VFHA 4MFDA 1RQBA 3C52A 1C29A 1W5NA 4E2BA 3PB2A 3CB8A 2GJNA 1JRBA 3W3OA 2OCZA 3M7WA 3UZJA 4ZQPA 3GNDA 3LV6A 1JR1A 2GOUA 3MWAA 4EIVA 3T4CA 3PG8A 1F7BA 1H61A 1VJIA 5AHEA 4O28A 3F4NA 2Z1BA 3T78A 2RDUA 1TPVA 3A5VA 1D9EA 5EYWA 3CC1A 2OMAA 1TRIA 4MZ1A 3TKFA 4UTKA 5HWMA 4O0ZA 2G97A 2I9EA 1XCFA 4QITA 4BWLA 2DZTA 1LOSA 2YZRA 4LRTA 3TMQA 4AAJA 3MJYA 2C15A 3S1VA 3UWVA 1OYBA 1MEHA 1YDOA 3KRSA 1F76A 2J24A 4ZQOA 4UTWA 3OVPA 4CNPA 3IVUA 5HR6A 3BG3A 1DORA 4LS0A 4HN4A 1GTEA 3LDVA 2YDAA 3VKJA 4GBUA 3O16A 3CIWA 3EXSA 1SPQA 1YPFA 3PY2A 4E2DA 2X2GA 3B03A 1CX9A 5AC7A 1RVGA 1TJRA 3DHDA 4HPJA 1ZAJA 4HPXA 3EX2A 4JX6A 3QF0A 1I2PA 2C3ZA 3UD6A 1YDVA 2C19A 1WYIA 3DFNA 3IGSA 3RMJA 2WKJA 3EWUA 4LUIA 2YXGA 4RCXA 3OVRA 2A7PA 2FPTA 4ZZ9A 1Z41A 5HINA 3LRKA 3LCGA 4CLMA 5CZ0A 4GWEA 2VFEA 2DZWA 1BWLA 1OFBA 3CQ0A 4G1KA 2J88A 3L5LA 5D02A 4DXVA 5FEWA 4YCPA 3KFTA 1JUKA 3MUXA 1TTJA 1SFLA 3NL3A 3P74A 3QPYA 4Y9AA 4AF0B 1LBMA 3W1MA 1MSSA 3TQVA 3SW6A 1PCWA 2YYUA 1YXYA 2QCCA 3BO9A 1SZNA 3HPSA 5BNKA 3HO8A 3AO0A 4UNLA 4YWIA 3I7RA 4FNUA 3TMLA 1LRQA 2VEIA 3NVTA 4JICA 3O8AA 1TYGA 4AEOA 4FX8A 2V2DA 3P8IA 1K8ZA 4QNEA 3M47A 1UB3A 4FNTA 7TIMA 2QCNA 2W6RA 3RLUA 4IPJA 3WK1A 1H51A 4A22A 1G6CA 2ZZ5A 5LNRA 3R8RA 5LKYA 4OHQA 4GNJA 3M9YA 3MO7A 3NL2A 4ZVJA 1QFEA 3BLIA 1IGSA 5CSRA 4HSOA 4OV9A 4UR7A 5CSSA 1KFJA 3TK7A 5HWNA 4PODA 1FBAA 5J5RA 1LBLA 3KX6A 1AK5A 3UWQA 4ZQRA 4YCOA 4KFNA 1K02A 3L65A 4TR9A 4XKYA 1ZHAA 3BGJA 4IWWA 1MZHA 1UASA 4O0KA 4R33A 3DFPA 3W7NA 4FXSA 3N34A 4UMBA 3WJSA 2QAFA 3LX9A 5DLCA 2P10A 4H6KA 5T26A 1SU5A 5CZJA 5AN7A 3ABSA 3HJZA 3R12A 4NNAA 2PURA 3NO5A 2UV8G 2GPTA 1LZOA 4HIBA 2EF9A 4JDBA 5LHEA 5SWUA 1IXPA 2NLIA 1VCGA 1KW1A 2Y7DA 1AG1O 5DCDA 5BRBA 5K2ZA 3NQAA 2Q8LA 3TUUA 2NUYA 4UCGA 2DZVA 5D32A 4Z08A 3IVTA 3FFSA 1K8YA 3W9ZA 2FPYA 1YPIA 2WPBA 2BXVA 5DXXA 4BFAA 2PRHA 5FF3A 3TROA 5AYXA 5TQLA 3PBUA 2QJIA 3DH7A 5C55A 2Q8ZA 4X2RA 3MP5A 3VFLA 4O16A 1L2UA 1EP1A 4HT3A 3PS7A 1OFDA 2B7PA 1F6KA 1OG0A 1W5PA 2ZA1A 3C4UA 5KMYA 3W2JA 4DO4A 3WJZA 1JCJA 4RJEA 2QDGA 3DGRA 3CIXA 3DKJA 3LRLA 3PR2A 1QPOA 2DZUA 1OJXA 4TMCA 3QC3A 1H7RA 1P0KA 3IIZA 5U4NA 3W2MA 4R53A 5G2HA 3CEUA 2NWSA 2E6AA 3KAOA 1Q6QA 4LS1A 3QSTA 3PSVA 5BMWA 3KVLA 4UFJA 2NX1A 5AC6A 2H3BA 3G8EA 3IEBA 3NQCA 5FEPA 2FB3A 2QCGA 4O52A 4FNQA 5GVJA 1GYNA 4MPQA 3PBWA 3S6DA 2C14A 5K9CA 1WA3A 3FJ6A 5D2WA 1F6PA 1BKSA 3G0SA 1TPFA 4IOTA 2Z2UA 4JY9A 3S5OA 2ZTJA 3NPUA 3MMTA 1QPQA 2E5BA 5KSWA 1SFJA 3WK3A 4M7SA 1TPB1 5D38A 5LNSA 3TJXA 2YPIA 3G1FA 3QQ1A 4WX2A 1FX6A 2JGQA 3C2FA 5G4WA 3W1LA 2XN1A 3PULA 5CPLA 2CLKA 2ISSA 1ME8A 4BI5A 3STCA 3W1PA 4DBEA 2Y61A 1R30A 2X1SA 1VYPX 4E0CA 4GUIA 4JDYA 1NF7A 1FXQA 4ADTA 3PBYA 3HGRA 1I4NA 4JY8A 4YL2A 3C2EA 4IXHA 1VHNA 3GKAA 3M6YA 1JQVA 4WOZA 1UJPA 5FESA 1YTKA 3TAKA 4JNMA 1XBZA 1R46A 3TR2A 3HG4A 4WJEA 1P5BA 3PWAA 3GR7A 3NA8A 4MYAA 3SGZA 4ZL1A 4LC6A 3GXTA 3C3NA 1FWTA 1V5XA 3WJWA 1W31A 1LP6A 1AMKA 3BLFA 3UPWA 1ZFJA 2VOMA 1W3TA 3GIYA 3C2OA 3P8JA 3B0UX 1VR6A 1Q6RA 1W3NA 1GVOA 2R8WA 1ZCOA 2CFFA 1W5MA 4J9JA 4M19A 2W0UA 3M41A 3T44A 3GXPA 2P1FA 1SW7A 1UUMA 4RZ5A 1K7EA 2V5BA 3ABQA 4FNPA 2RDWA 3CEPA 1EUAA 3ANYA 3HGJA 1R2TA 4O53A 1X1OA 2CLMA 5DBUA 5D2YA 3DFQA 2A4AA 2NX9A 1LM1A 3QPZA 2ISWA 3UY7A 5E1QA 3GVGA 3KHJA 4OU1A 3DBPA 3TIMA 3STEA 1OFEA 4QJ1A 4DF2A 4K7YA 2QCHA 1PHWA 4DBDA 3EWBX 2CLOA 4I7WA 8TIMA 1WXJA 5CZSA 5D2VA 2CW6A 1SUXA 2ZRYA 4GRSA 3MHGA 4JIPA 2CZEA 3BW4A 2ATMA 3UWUA 2NXIA 5G2IA 3RNDA 3TA6A 2FDSA 4UNKA 3GDMA 3CHVA 1W3IA 1KFKA 1FWSA 4TMBA 3TFXA 3SZ8A 2WO5A 2ISVA 4E38A 1AW2A 5D05A 2KZHA 2Y63A 3QMSA 4ZQMA 1ME7A 2C18A 3GXNA 4IX0A 4Y6GA 1FUYA 1H50A 4DEFA 1R2SA 4OQVA 4M6PA 4OT7A 3O6DA 2DZPA 3TQ0A 1JRCA 1HO4A 1XM3A 2XFWA 1WDWA 1A5SA 3QH2A 4RX0A 2QUVA 2E68A 3P81A 1FCQA 4NXKA 1IXQA 3L21A 4X22A 2WV8A 4H4IA 3S1XA 4JX4A 4ORMA 1HO1A 1JCYA 5HMSA 2NV2A 1R47A 2ZBTA 4K36A 3M5YA 3TSDA 3OG3A 3LLDA 3SI9A 5CGQA 4BI7A 1U83A 3H54A 5DY2A 5G2WA 1KTBA 1FXPA 1D3HA 1LORA 2FQIA 2ZZ3A 4HNVA 4EOUA 3L0KA 3G1SA 1YADA 1J2WA 1FCUA 3PG9A 2WOQA 4NJIA 5D30A 5AHMA 1TPH1 3B0PA 1VHCA 3WJYA 1FDZA 1S5WA 5D2XA 1RD5A 1KLYA 2WJZA 2V82A 3E0IA 3L5AA 1BTMA 4GUGA 5LNVA 4O57A 1PHQA 1KFLA 2DJXA 4PL2A 4XTIA 4LVDA 2EAWA 4POCA 4WXYA 1ZAIA 2EGZA 3SIZA 1F05A 2BX7A 4UFMA 5H2ZA 2YSWA 1VS1A 3P7YA 1DQXA 1GZGA 2ATSA 3G0XA 1RQEA 2Y7FA 4LVFA 3UWWA 2ZCGA 1KBJA 1L6WA 4WY0B 2JKEA 4Z1DA 3TCEA 3O05A 5HUOA 1LRNA 4ONVA 1HG3A 4O18A 2QCMA 1AL7A 3GB6A 4JX5A 5TIMA 3G1HA 2QR6A 2ZZ4A 2A6LA 2RDTA 4LVGA 4O4WA 4O1AA 2HTMA 2ZRVA 4FF7A 5AFDA 4A3UA 3VE9A 3I68A 1OFRA 3LHUA 4HSNA 3S1WA 2QKFA 3FYPA 4OE7A 3O63A 5LHFA 1GEQA 3W7MA 4ADSA 3O07A 1TPC1 3L67A 1GT8A 3LTPA 1H1YA 2VKZG 3LBMA 1KTNA 5F4XA 1I2QA 3GLCA 1YYAA 4UFKA 4EF8A 2R14A 2OT0A 3W6YA 3DZ1A 3TW6A 4L4LA 1SSDA 4ML9A 3QMTA 3UNDA 1J5TA 3LLFA 3BV4A 5FF0A 3CU2A 4MZYA 5FF4A 3PUEA 4N4PA 4BF9A 3EX1A 5BOOA 4XTDA 3R89A 1SR9A 4Z0JA 2ZRZA 4AVFA 4JYDA 3W83A 1A5CA 2PC4A 3ZFHA 4UMCA 3HOJA 3CPRA 4UIOA 4K8HA 3W7GA 4MIMA 1JCNA 2XN2A 1M7PA 2ALDA 2Y7GA 4RXFA 5I3HA 3C0JA 4WOQA 1ICSA 3CTLA 5FF2A 4FO4A 1VZWA 2CLFA 2NXGA 3G18A 5EKYA 5AC8A 2V81A 4XQ6A 1I45A 2A7RA 3KVJA 4ICNA 1LYXA 2H90A 1XUUA 4LNYA 3NNTA 5IBXC 4TO8A 2Q3RA 3JR2A 3EX3A 4L4MA 4UTHA 4N9EA 5F1VA 2QCEA 3P67A 4IMEA 3QM3A 4FNSA 1CW2A 1C8VA 4UTTC 1VYRA 4JYFA 3EXRA 4O54A 2HS8A 4DO6A 1KTCA 4DF1A 3P61A 4NX0A 1QMLA 3P82A 6ALDA 2OZ0A 3HB9A 4QIUA 4O13A 1WQ5A 2A6NA 1TB3A 5F2IA 4PC8A 1W8SA 4OV4A 2AQWA 4IUOA 4LWWA 1JUEA 1EEPA 2ZQ0A 3W2KA 5AHIA 4EWND 3JS3A 2VENA 3MP3A 1SW0A 1Q6LA 2J9XA 2Z6JA 3UY8A 5MHBA 4FXRA 3I7QA 1GG0A 3JRKA 1GVSA 3EWWA 1KM4A 3HMJG 3T55A 4AHQA 4LOCA 1G4SA 1OX6A 1AW1A 3P5YA 5KZDA 4Y8FA 1F73A 3USBA 1GOXA 1F2JA 1QOQA 1TPEA 3C2RA 1EA0A 3NZRA 4S2BA 1LLZA 4NNCA 2WSQA 3E12A 3NQVA 1OFAA 4LW7A 1KV5A 1NFBA 5C54A 3PBVA 3E96A 3Q2DA 5D09A 1ALDA 2NWRA 3FS2A 2BLEA 1XBVA 3OBKA 1FQ0A 4N2YA 3SFKA 2BTMA 3EXTA 4TU1A 3TC7A 1SZFA 3EWYA 5AOUA 4UFLA 4Q33A 5BW6A 2YW4A 4WUIA 2JKPA 3UZ5A 2DORA 4ZMGA 3P60A 4MY1A 4XUGA 1QR7A 5G1YA 2B0MA 4N6FA 1B4KA 3BLEA 3E49A 3TAOA 1LLWA 3W22A 1GJPA 1ZY9A 3PUOA 4O12A 4WXZA 2GQAA 3W7HA 3STGA 4YLWA 1SSGA 4S1FA 4N9CA 4AF0A 4RKAA 3HG3A 3BW3A 4M6VA 1FCBA 4PEKA 2NUXA 4FNRA 1DHPA 5HULA 1PE1A 4IMGA 3DI0A 4HHPA 2AGKA 4JTTA 3W71A 2CLLA 1X7FA 1DKWA 4YXGA 1PL9A 3TH6A 3EX4A 2X16A 3EWXA 4KWVA 4UC5A 3LCXA 1Y0EA 3W1XA 3THQA 3A5FA 4LV4A 2H8ZA 2QAPA 5F2LA 4NZFA 3AJXA 4AHOA 2QJHA 1THFD 2QUTA 3ABOA 3LCFA 2WNQA 3NM1A 3F1QA 2Y85A 3F03K 3IIXA 3N2XA 1JCLA 3FKKA 3QEZA 4WD0A 3LOTA 1WV2A 4OBTA 3KVMA 1X8FA 1WOBA 1TMHA 4X9SA 1G7UA 4HNTA 3O6CA 1EP2A 3NXFA 2WSRA 4NNBA 5KITA 3C56A 1K03A 2JKAA 1YTDA 2DP3A 1TSIA 3IGUA 4LUJA 3RF9A 1KM0A 1JJKA 3BG5A 3G1AA 4HNUA 4Z1AA 4WY0F 4QSHA 4A2SA 1FWWA 2FIQA 1B57A 2J9YA 4EF9A 1I8JA 3FLUA 3ABRA 3NDOA 1TJPA 1PV8A 3LBCA 1TPWA 2RFGA 2V9DA 4NUWA 3LTSA 4XBKA 4O15A 3W1TA 5AHNA 2ZRUA 3TFCA 5EPDA 1GTHA 3NQMA 1XFBA 2E5DA 3TJLA 3L68A 3G0UA 4C1LA 3W73A 3N9SA 4O4VA 1I2RA 1FY6A 5F2GA 2ZFAA 3LXAA 4GUHA 4JEQA 3C6CA 4ZQCA 1UUOA 2CU0A 2IQTA 2FB2A 4FX6M 4K7VA 2BZNA 3A9IA 4GE8A 3L2IA 1EUNA 5I3IA 2DZXA 2YGYA 4JGDA 3TE9A 1QOPA 1A50A 1TREA 4IQLA 3HG2A 5BMXA 1XDLA 4CQAA 1NVMA 3G3MA 4N02A 3GAKA 4O10A 4JTLA 3C61A 1VLIA 1TPDA 1KM1A 3M1ZA 4KFOA 3S42A 3CWOX 5DY3A 5HQEA 3NL5A 5KZEA 5F4SA 3M5XA 1KM3A 3BW2A 4NT0A 3B8DA 4LVAA 4RR4A
chains in the Genus database with same CATH superfamily
1E4MM 1HVQA 2WWCA 3MMUA 3W7IA 1SZGA 1F74A 2VGIA 1C3FA 1YDNA 5GPRA 3MW7A 1XINA 3G1YA 4D8AA 1SQ7A 4YPJA 2GDVA 4O19A 2EPKX 1E1FA 4GNVA 4PBGA 5FJPA 1ZU8A 4JIQA 4HN8A 3MHFA 5LNUA 1ZENA 1LUCA 2ZC8A 3MUIA 2WHJA 4H9TA 3NM3A 2B4GA 3HA1A 1PCKA 3MSDA 3RU6A 1YXDA 3T4WA 3OEXA 1EP3A 1G69A 3MMDA 3W1UA 1DE6A 1HKIA 3P62A 1WBJA 3K8LA 3DI1A 1JVNA 2YW3A 2YCKX 4DYKA 3SCVA 2CLHA 4O11A 2GWNA 1GPWA 1TO3A 1XHGA 3GC5A 3HV9A 1WKYA 3WK2A 4B4FA 3W86A 4PB3A 3H21A 3M0MA 4Y8EA 1EIXA 1W37A 1QRQA 4FOJA 3M44A 4CU7A 4M81A 3WLNA 4PN2A 4QISA 5KTLA 4W4QA 2PCQA 3VDAA 1NEYA 1XLKA 3L4XA 3LZ5A 1I1XA 3F5LA 3GK0A 2YR1A 3DX5A 5CXPA 1DWJM 2WYSA 1K9EA 4HHHA 2FHFA 4UTUA 2ZE3A 1FWNA 4JIEA 1ZLPA 1CGUA 4YWSA 2GGHA 1WAWA 4O1BA 4D6IA 3MUCA 3W7KA 1NOFA 1DJWA 4R7WA 1BRLA 1E55A 3S6TA 2QUMA 5HR7A 3TC6A 2VGBA 2CYGA 1VFTA 4CD6A 4GI8A 4WJXA 1G5AA 1EDGA 1MXGA 4DJDD 3NEHA 1FWRA 4EPDC 4LT9A 2WHLA 4ZTYA 1T41A 1R3SA 4L6HA 1MDLA 3WQDA 2ASHA 4O1FA 1UA3A 1DBTA 1ZB5A 3TXVA 2C1IA 4ZR8A 4TVCA 3UP8A 1NIUA 4JIHA 3VK5A 3Q37A 2VC6A 1MQRA 4WQ6A 1W1VA 2IXVA 3GNXA 3B8TA 1XQKA 1JDFA 5H8PA 3YPIA 3ZJ8A 4QS5A 3K8MA 1V6TA 3ATZA 4KKXA 2C13A 2C8NA 3W88A 4GISA 1KFBA 2RJGA 3OIXA 1TIMA 5LSMA 4JFVA 1MEWA 2PDLA 4S3DA 4IISA 1TCMA 2WW5A 3Q67A 4W8BA 2CLEA 3SR7A 5M03A 2JBMA 1TV4A 5A6BA 2AAMA 2QCDA 3MKKA 2PGWA 2YXXA 3EEZA 2B31A 4Q8OA 1Z9AA 1VJSA 4AZ6A 3H70A 4ZOEA 3SY1A 5ABGA 2WCSA 3NSMA 3UCDA 1TUFA 1EJRC 4UTMA 4Q7IA 4GYJA 4PB5A 1IT8A 4UTLA 4RZBA 4KIRA 4Q8WA 4LANA 1IXNA 2IQ0A 1W9VA 2WM0A 4Y90A 4YVPA 2A0NA 4UMAA 4NX5A 3FNDA 1FFQA 1X6UA 3MPGA 1KM2A 1Y5VA 4GXMA 3TTSA 1GOKA 3M0ZA 5LIWX 1MQPA 2WVSA 1ADOA 5HXMA 2QPSA 1E6SM 4LB4A 5E9AA 4W85A 3A22A 4CNSA 1DVJA 4QGCA 4AB4A 2C0AA 2HBXA 4XD3A 1RPXA 1H41A 4LCSA 1QPNA 1QNRA 3W70A 2X0SA 1PX4A 1XL9A 5A6KA 1NELA 1EBHA 2I1OA 4GINA 1X7IA 4JTGA 2ON3A 3GU9A 4KF1A 2X1UA 1XPYA 2QJMA 2UWFA 2ZRXA 3DU0A 4XX6A 1OT1A 3WUFA 1T40A 1RQHA 3E0VA 1E6PA 5HJYA 3PZUA 4X2PA 4DJEA 2QGYA 2DH2A 4J3XA 2V69A 3AJ7A 2ZE0A 1OD0A 3NEVA 1O5XA 1YPXA 1TMLA 4U5IA 3R8HA 2A3CA 3HG5A 2PZ0A 2WZEA 3B0VC 2NQZA 1GHSA 3PVFA 1OK6A 1BEUA 2VFFA 1NWUA 4LJ3A 2WJFA 1HJVA 1EGVA 1KQZA 3HIJA 1PKYA 2PSNA 3SGUA 4YS1A 1LT7A 3FY1A 3XINA 4WDWA 3RR1A 3P3BA 4C1NA 3ME3A 4IQDA 2P8BA 4KEVA 1ADSA 3FOKA 3M5ZA 3GR4A 4GX9A 2CBJA 4G7EA 3TLQA 3O7UA 4PUUA 1HGWA 3VD5A 1RCQA 2X30A 1GVFA 3DHFA 5GJPA 2E9BA 2D0HA 2J78A 3W7QA 1YLVA 5AB3A 1F9CA 4AWEA 4H04A 3RM4A 2I5IA 2OLHA 3P84A 1KV8A 8XIMA 5E0CA 1Q7MA 1CB2A 4KFPA 3N4FA 3NQ7A 3HF3A 4Y96A 2ZUUA 1V0MA 1H7XA 3B9EA 1Y5WA 2D2HA 4NZ3A 1IR2A 4QG8A 4AD2A 2I14A 3LXCA 1VKFA 1RALA 3BK0A 2W79A 1HNYA 3MCOA 1H7WA 3QHOA 4NAEB 3ECQA 5CPSA 4WZHA 1A0CA 1VIWA 3GG1A 2R1MA 1O6IA 4HKPA 5LNWA 5LZLA 4O8RA 2E6YA 2LLEA 1VBHA 4AWTA 4MPKA 4MYXA 4O1EA 2XVPA 3WQ4A 4Z2HA 3U6WA 4Q32A 8CGTA 3OA3A 2OEKA 1I6NA 1JI2A 3IANA 3OLDA 1W9XA 4P7NA 6TAAA 2I56A 2J13A 3NURA 3L66A 2NVDA 2BNJA 2W27A 3DFOA 3OZMA 1XP3A 4F8XA 2O9PA 4J3VA 1LT8A 4FB7A 5C0QA 2XSXA 4Y9NA 2WSPA 4WF7A 1W3LA 4EXBA 1NJJA 2CXGA 4PCPA 3SRKA 5I3GA 4IIFA 3W23A 2A2IA 3BLKA 5EMMA 2V8ZA 3IRDA 4NJJA 4DJFC 1SFTA 2V38A 4I5XA 1R3QA 4IMDA 3IJ8A 5D8WA 2VZVA 4FX7A 3G24A 1VGAA 3GUWA 2YLLA 3KBWA 3DYPA 3PJUA 4LX4A 3W01A 2HVNA 1EB3A 4A2RA 3LGEA 4XSLA 4HVXA 4DBSA 3CO8A 2D0FA 4IGHA 4CU6A 1PIFA 4GUFA 3SSJA 1E4NA 2PLJA 4IFKA 1WDRA 4BY3A 2C91A 2DIKA 1WP6A 1PKMA 4JN6A 1A49A 3LD5A 3EEGA 3F4CA 3F4WA 5FAJA 1QWGA 2FFCA 2PBGA 4JFWA 3OU8A 3KS6A 1K7FA 2EKCA 1T96A 4LF1A 5JBFA 4N9BA 1F6YA 5AHFA 1UOKA 4UR8A 5BU9A 1HXJA 3RILA 1HKMA 1XDMA 2C71A 1AJ2A 3W7EA 1TR1A 3BH4A 3DXIA 4C6DA 3G22A 5DBTA 3IK4A 4PTMA 2Y70A 4LQ1A 1JUBA 5K9DA 2GQ8A 3RM9A 2PDCA 5CPNA 3GNNA 2OTDA 1RPKA 3AMLA 3PC0A 5CJMA 4FR6A 4AZCA 2Q09A 3SAZA 1ZQ5A 1AD1A 5XINA 2O55A 3WMBA 3LI1A 3M0JA 3MSYA 1ONEA 3UETA 3LPPA 3BPWA 3IRSA 1GOWA 5C9RA 2G41A 3A6OA 3TSMA 1O66A 3NR0A 4NG3A 1KRBC 3ARWA 2VM8A 2E5CA 3W28A 4WDTA 4H00A 5C9UA 2X40A 3AXKA 1RBLA 1J4EA 3EPOA 4UOQA 4D1JA 4TVUA 2G95A 4LV9A 3L0GA 4AMCA 4KCUA 1KBKA 1JULA 5I0DA 3AS1A 4YVXA 1QAPA 2YFOA 3WZ0E 2X8RA 1X39A 5HUPA 4PMYA 3W0KA 4TIMA 3A24A 3DECA 2BBFA 2CZ5A 1T99A 1F5ZA 3BE7A 5KETA 3A23A 4JYEA 1KM6A 5C71A 5EFFA 1G1YA 1NFGA 5D37A 3F4VA 1OWQA 5A8OA 1OGBA 2HMCA 3N2CA 5CAHA 4J5NA 4MNLA 4PFMA 1ZNNA 3DYMA 2BY1A 3C5QA 3UR5A 3HFYA 5A95A 1ELSA 3LY0A 4HZ8A 3NO3A 3BUVA 4H41A 3L4TA 1PVNA 3H4GA 4FOUA 4DZIA 1YBQA 3E5PA 3NZPA 4GABA 4ZB0A 1VLWA 4B5VA 1J0KA 2FHCA 4UWMA 1H63A 4RV8A 4FA3A 3KXQA 3GDRA 5A5WA 4M6QA 3LGGA 4YYCA 3R2GA 3NQEA 5DRCA 3LERA 3QGKC 4IMFA 3QY8A 1NTHA 3NQ8A 3BMVA 3WDRA 1O5KA 2J9ZA 3NQBA 2IPJA 1U5JA 2Q6ZA 5XIMA 3T0AA 4GA8A 2QDHA 3D47A 3UZZA 2YBUA 2J7CA 3KHDA 4ZQNA 4QCEA 3FJLA 4ZOBA 3HM7A 4B5WA 3T81A 2R94A 1X96A 2WHMA 3HMCA 3H12A 3PTDA 3APTA 1E1CB 1A47A 2VX5A 4IICA 2F8QA 4PMQA 3HPZA 4C6PA 4QE5A 5CBJA 1K7XA 3CWNA 2YDSA 4PTNA 3UG4A 1WDPA 2OEMA 2WLZA 5JIWA 3UFYA 2VFHA 2BXYA 3VNZA 1NWTA 1C29A 1WB0A 3GW3A 3OYXA 1JF6A 2OYKA 4AD4A 3CB8A 2GJNA 3RLHA 2DPEA 4G2DA 2NSXA 3U3HA 4YU1A 2VD9A 3NJ3A 3UZJA 4ZQPA 1JR1A 1JD7A 5A6JA 1V3LA 4A05A 4GZEA 3TQPA 3PG8A 1H61A 1FP8A 3PN8A 5CSYA 2RDXA 2RDUA 1VFOA 2REQA 2O4QA 2PODA 4EPKA 3TKFA 4C6EA 3KUMA 1XS2A 3N6HA 4XIAA 1HF6A 1J0IA 1R9YA 4O0ZA 2I9EA 3GXFA 4AAJA 1CECA 3MJYA 1OYBA 2J24A 3OA5A 4RE4A 3EMZA 3S2LA 8XIAA 3WUEA 1L8NA 1KFWA 3LDVA 3S46A 3N2OA 3VNMA 9XIMA 1BYDA 2EKGA 4E2DA 3RRAA 2ZICA 3QLLA 2EBNA 3B03A 2IPFA 3QV9A 5AC7A 3DHDA 1JYWA 4ROQA 3SY8A 1CZ1A 3VC5A 4IP4A 4JHOA 4JX6A 1IR1A 1I2PA 1CGVA 3RMJA 1FKWA 2J79A 2WKJA 3EWUA 4LUIA 3MKVA 2A7PA 1IT7A 4CEUC 3LRKA 4BF7A 3AMGA 2ZXQA 4IL0A 3N11A 1IWBA 3A3HA 4G56A 1QWKA 3ANVA 2J88A 5D02A 4DXVA 4WDXA 5FEWA 4EKJA 3KFTA 4KW2A 1JUKA 3MUXA 1SFLA 3ARQA 1AH4A 4HZ7A 3O2LA 2XVNA 1X8CA 1LBMA 1FWBC 4ZENA 2YYUA 2QCCA 4TVDA 1XLCA 3ITOA 1F61A 3AO0A 3LQLA 4UNLA 3EBVA 4J3WA 3TMLA 3UF9A 1LRQA 2VEIA 3LGDA 3NVTA 1QU4A 4AEOA 4FX8A 3TN3A 3WNPA 1DYSA 2PGFA 1K8ZA 5GJNA 3M47A 3RLUA 3WK1A 1H51A 2ZZ5A 5LNRA 4GNJA 5BWAA 4GZ7A 3PWIA 2WLYA 3PPFA 5TF0A 4O0QA 4OV9A 2G3FA 2XZ9A 1AQHA 4PEEA 1WUEA 3SCWA 3KX6A 4YNGA 4YCOA 4ZQRA 1K02A 3H2AA 3WQCA 4L1XA 1TJ1A 1IEXA 3AZTA 4FXSA 3BLLA 3WJSA 2BGQA 4CKQA 5DLCA 4KETA 3VKKA 2P10A 4H6KA 2YCLA 1XLHA 3CNYA 2PURA 2CLPA 4AG0A 2GPTA 3B4YA 1IXPA 3KBJA 2NLIA 2ACQA 2Y7DA 1YQ2A 2MUCA 2XM1A 4L6OA 2J66A 1FWHC 2NUYA 2DZVA 2PTDA 3M46A 1YPIA 1WZMA 1G01A 4BFAA 5AYXA 2VL4A 5TQLA 5C55A 2OWWA 3N18A 3MP5A 4DB7A 2HNEA 2ZA1A 3RN6A 3W2JA 3FA3A 2AMGA 4RJEA 1TR9A 3LS9A 2QDGA 4B5UA 3DG7A 3DGRA 3CIXA 5E5CA 2Q8XA 3PBGA 1EBGA 1H7RA 1P0KA 4R85A 5MKGB 5U4NA 4R53A 4C7DA 1GCYA 1R6WA 2NWSA 3KAOA 5BMWA 3QSTA 1QK0A 4GMEA 4UFJA 2NX1A 1R3YA 2H3BA 2DW7A 3G8EA 1NOWA 3IEBA 4O52A 1QW9A 3VM5A 3BAWA 4FNQA 3CZGA 4HU3A 3PBWA 3AFBA 4EAYA 2C14A 3CYVA 3N1AA 5D9OA 3BQ5A 2Q71A 4LALA 2AQVA 1TPFA 4IOTA 4KRUA 4Q8QA 1ODZA 2E5BA 5KSWA 3GVRA 3WK3A 3A13A 4F0MA 5D38A 1VBGA 2VR4A 5LNSA 2YPIA 5DMMA 2P53A 1UZ4A 3LUTA 3UG3A 1UZ1A 4PMOA 4Z2GA 3TYEA 3STCA 1R30A 1YRRA 5E6ZA 1LWJA 1TA3B 3HGRA 1ZUAX 4JY8A 2DEPA 3MUAA 1B3WA 3C2EA 3VC6A 3FW6A 3CL6A 4GGHA 3ARSA 2OR2A 4WOZA 1EHNA 3QY6A 1FWIC 1YTKA 1XBZA 1R46A 4MB3A 1JD9A 4QDMA 3WELA 1P1MA 3SGZA 1XRSA 3QLDA 4LC6A 5AVNA 3C3NA 3KCLA 2W61A 1LP6A 3VU2A 1B90A 3FHAA 3C2OA 3B0UX 1Q6RA 1GVOA 2R8WA 1NFPA 2I17A 2W0UA 4HPHA 3KTCA 2P1FA 5I6SA 1E71M 4RZ5A 2V5BA 4IG2B 3H7UA 1EUAA 3ANYA 4O53A 4RDZA 2VDHA 4XZHA 5A69A 5D2YA 3PPHA 1ISZA 2P76A 1AQ0A 4Q4MA 3EDKA 1LM1A 3QPZA 3UY7A 3KHJA 1W1YA 4GJJA 3RUBL 5HATA 1UR8A 4K7YA 3IJLA 3TYAA 3TWBA 1ISWA 2CBIA 3EWBX 2CLOA 4I7WA 5A6MA 5CZSA 4PBEA 1SUXA 2FTWA 2OWXA 4MADA 3MHGA 1OEPA 2CZEA 1UH3A 3RAOA 2D1ZA 3AS0A 3BW4A 5G2IA 3MVIA 4IFKB 2FDMA 4UNKA 4FLOA 4GLEA 4WR3A 3MKCA 4E2VA 1KFKA 3GBDA 1R85A 3K2GA 3SZ8A 2ISVA 5CEWA 2FJUB 3UG5A 1MNSA 4ZQMA 3GXNA 3L2LA 4I5UA 1K6WA 5EB8A 1R2SA 1UBPC 2QIWA 1M9HA 2DZPA 3TQ0A 2F61A 3T09A 1A5SA 3VIKA 1W91A 1MW1A 6XIAA 3L21A 1QI3A 3ONBA 4EWJA 3WIJA 1HO1A 1WCGA 5HMSA 2NV2A 1R47A 3UJEA 4I9MA 1B1YA 4ZXOA 1JZ2A 3ISIX 4N0RA 1XIMA 1PTGA 3WD1A 5G2WA 1DJGA 1DWFM 2A3EA 4GNKB 2EO7A 4GPNA 5AECA 5IDZA 2FQIA 2POTA 4JNYA 4EOUA 3L0KA 4XAZA 3VIMA 8RUCA 4Q8VA 3I3DA 2OOFA 3O0FA 3R7MA 2R24A 4KWUA 1FCUA 3PG9A 4GIAA 1GEHA 1UG6A 2Y5JA 3ZVHB 1JDDA 3B0PA 1FDZA 3GC2A 3CK5A 2V82A 3E0IA 3WD2A 5LNVA 1PHQA 3V35A 2QIIA 3SFWA 3KOXA 1AJ0A 1JZ6A 1P48A 3VMOA 1F05A 5H2ZA 2PBOA 4HMCA 3H2CA 3VGDA 1GZGA 4GYKA 1RQEA 1BLIA 2Y7FA 1M53A 3XIMA 4DJDA 1RBOB 1KBJA 2CITA 1L6WA 2WSKA 1TIWA 4YTUA 4D8LA 2JKEA 2JIWA 2P5NA 5HUOA 4QJ5B 4F0HA 4ONVA 3BAJA 1CCWB 2HBVA 3TW9A 1EF3A 3ZIZA 1AA1B 3OW1A 4O1AA 2PAJA 4FF7A 5AFDA 3EDDA 2OLSA 1W1TA 4HSNA 3PZVA 4OE7A 3FYPA 3O63A 2PD9A 3PZIA 1GEQA 4Q7BA 3F5KA 2VDIA 3W7MA 2CBUA 3WF1A 4IJRA 3LTPA 3WLIA 1J11A 1I2QA 3GLCA 1YYAA 4UFKA 4EF8A 2NQJA 1KKRA 4QAWA 3DZ1A 4G9PA 3BICA 3H2NA 1QNQA 2HVMA 1QOXA 1YNQA 1J5TA 3BV4A 1V79A 4MZYA 3PUEA 1X6NA 1UW9A 2E67A 1B2YA 4Z0JA 5LIXX 1WO2A 2PFHA 4J3UA 2X05A 4YTQA 2ZRZA 3W83A 1A5CA 2VX4A 3CPRA 1PYFA 1MDRA 3W7GA 3TEVA 3L4VA 3QPEA 3FAXA 1M7PA 4C6BA 2ISFA 3UNTA 3MTWA 4EANA 3WLJA 2WVVA 3P0WA 2JEQA 2V81A 1E6ZA 4AIEA 1ISVA 3OVGA 1PZ1A 1JNDA 2H90A 3IS4A 1OIFA 4TQTA 4KPLA 3CUHA 3QR3A 4L4MA 4UTHA 1E0WA 3I6EA 3QKEA 4IMEA 4WKFA 4P7RA 4FNSA 1C8VA 5BXSA 3L2MA 1V0NA 2HS8A 4H2HA 2E25A 4B4HA 3VILA 3W53A 2WMIA 5AZ1A 1JXKA 1WQ5A 4GHRA 2A6NA 1W8SA 2DIJA 4IUOA 4LWWA 2J6VA 2ZUTA 3JS3A 2VENA 4AVNA 1EH9A 4S3JA 4FS9A 4UBPC 1QK2A 1Q6LA 2Z6JA 1D7KA 4Q4SA 3CQHA 1CXEA 2XIIA 3EWWA 3NCOA 4NL1A 2ESCA 4OIFA 1OX6A 1AW1A 1XD0A 2BS9A 1N82A 1BYCA 4TV5A 1PO9A 4NNCA 3RYSA 1J5SA 2WSQA 1WKDA 3NQVA 3RPMA 2OO0A 4PSRA 1ZP3A 1U2YA 5D09A 1ALDA 2EPLX 1PTDA 1FQ0A 3TC7A 4TU1A 3QXBA 4LUTA 3NFUA 2YW4A 4Z2LA 4E8DA 3WLQA 4MMWA 5BXPA 2DORA 3FN9A 4ZMGA 3G5EA 4INFA 1J96A 4D71A 3A4XA 4AW7A 1GJUA 2DZAA 4D6HA 4UQAA 4U5KA 4C6CA 1V3HA 1GJPA 4GZIA 2G3IA 2GQAA 3STGA 4YLWA 1SSGA 4AF0A 5A6TC 4RKAA 1PPIA 4M6VA 2QVHA 1BWVA 4IMGA 4PFHA 3POHA 4HHPA 3W71A 3AYTA 2J62A 1X7FA 1DKWA 2CHRA 4AU0A 4DXKA 4UC5A 1CLKA 3EWXA 4KWVA 1XGDA 1Z89A 1JIBA 5J04A 4LV4A 4KT2A 1G9HA 2F6XA 2V5KA 4W93A 4AHOA 1THFD 3NM1A 2Y85A 4YTSA 2YBVA 1XH2A 3N2XA 4WD0A 4K68A 4OBTA 4CU8A 3KVMA 1X8FA 1ZS2A 1UH2A 3VCCA 1EP2A 1A80A 3NXFA 2YCJA 4NNBA 2XGZA 1K03A 2JKAA 1Q8JA 4M82A 3B97A 2A3AA 1JJKA 4A35A 3K46A 1BXBA 1TX0A 2XG9A 4LPCA 1POJA 4IP5A 1A4MA 2FIQA 5FJTA 4Z42C 1TJPA 3UERA 4F48A 2RFGA 1DWIM 1US0A 3GG0A 3AUJA 1GTHA 1KXQA 3EWDA 2E5DA 4R88A 3L68A 1JGIA 2DDXA 2H9AB 3DGBA 4LUYA 2VJXA 2FGLA 3R25A 2EG7A 3CV6A 3VD3A 1VBUA 4PTXA 3OOQA 1PAMA 4JEQA 1E3XA 3ARZA 4ERAA 4QSFA 1UUOA 3GHUA 2BGNE 4K7VA 3LMZA 2BZNA 3N2BA 1EUNA 2BOFX 5DEZA 5I3IA 1V8EA 1BYBA 2J7GA 4S3CA 5BMXA 1XDLA 3EB3A 4CUCA 1K9DA 1E1EA 2QJJA 1KM1A 4NILA 4RW5A 4KFOA 5HQEA 3TR9A 5KZEA 5F4SA 1KM3A 3GTXA 3LPFA 4QXIA 4F9DA 3WQ6A 1XWYA 4W9TA 1C9DA 4C5YA 1M7OA 3LCIA 2D73A 1MW3A 4M80A 2ZZ7A 4PE8A 1UP0A 2PDMA 4EVZA 2VRKA 1JYNA 5FEZA 2XH0A 1OHLA 5E0KA 1EQPA 4JTJA 1V6UA 4M1BA 1UKOA 5FACA 3MV11 2F7FA 1VC4A 1MXSA 1N2VA 1RLCL 1EOKA 1UWAA 3NQ6A 2HJPA 3W1RA 5CG0A 2ACRA 1XYFA 1LROA 2ZUMA 1FHLA 4NAEA 3AMKA 2PTWA 1Z48A 6ENLA 3BGAA 2WANA 1TTQA 4YYFA 3PM6A 4HOZA 3LHZA 3LNMA 4IJCA 1TVLA 4YHEA 4JXCA 3II1A 1W56A 2WKLA 4DUVA 4HCLA 2GJLA 1AODA 1UR2A 3VNKA 1JI1A 1G4TA 4A29A 1OF8A 3LNPA 1P1XA 1TUXA 4H19A 2NSOA 1MZRA 2YL5A 1UMLA 4LFYA 2CZVA 3NSXA 3WBXA 3UZYA 4B5TA 3KTSA 2HK1A 2WSYA 3N4AA 2DVTA 2Z29A 1JZ5A 2VEMA 1HJSA 2G96A 3GR8A 2C0HA 2OKTA 2V5JA 1V7YA 2PWFA 3ES7A 1V51A 5CQ1A 5KZMA 2X1RA 1O5RA 2Z0IA 5HMEA 1A5BA 1ITQA 5IDIA 4GC4A 4XKYB 4IG2A 3AQUA 1JDEA 1BSLA 4WKHA 4DLMA 5XIAA 4LBRA 1VRXA 3I10A 5G5IA 2YCEA 1QTWA 5FF7A 1T5AA 2ZYFA 4HK7A 3D0CA 3EB4A 4IQJA 1PSCA 2FZ8A 2G5WA 4FSAA 1FOBA 1RK6A 8A3HA 4RNFA 2VZTA 1I0BA 5D04C 4J27A 4AZBA 2Y62A 4DJEC 2B81A 3MI3A 4PR4A 4H3DA 5FEXA 4MJZA 4FI4A 1EJ7L 4E3TA 2ZTKA 3ZT7A 1W5OA 4QG6A 1E6XM 2B7QA 4P8VA 1JL8A 4LUSA 2DZSA 3CO4A 4DELA 2BGSA 4E8GA 3TX9A 3BOXA 3MI2A 1NWSA 1S2UA 4DM1A 2IKGA 3GTHA 4U4MA 1E0UA 4HOXA 1HFBA 3GKFA 5DCEA 1TCDA 3BJSA 2AL2B 5DELA 3DN5A 1VPQA 1ZBKA 3OZYA 4IPNB 3CM4A 1W2PA 3O9NA 2XIQA 2X1TA 2OQLA 5LXEA 3UJ2A 2E77A 2Z25A 5B7ZA 2C1HA 4J1OA 1WPCA 4GD0A 1SFSA 4FHAA 5CZTA 4MLJA 1S3TC 4QDWA 3MVTA 3M16A 1REQA 3MP4A 1S5TA 1TKKA 4IUGA 2P3ZA 2QPXA 3QRHA 1BFNA 5F2MA 1ZGDA 2HCVA 1OADA 1MO0A 4I8YA 3NL6A 1S39A 4HYWA 1KFCA 5PTDA 3CH0A 3W7JA 1ZAHA 4DYJA 4MKNA 2V6AA 4M7TA 1KB3A 1S46A 4QBXA 2OX1A 4OECA 1GYLA 2A5HA 3UBPC 1ESWA 4JCLA 2ZXAA 3F4DA 2VEFA 3MB9A 1WZAA 3BCJA 3N25A 4C7FA 4US5A 4WSJA 1N8WA 2YFNA 4BEUA 1PKNA 4GBDA 4L9ZA 4YMZA 2ZVRA 2WQPA 5C5YA 3GDLA 3IAPA 3JZEA 5DO8A 1YTEA 4CQBA 4U28A 2GLKA 3G8RA 3B8VA 4GI9A 4WSKA 1HKVA 1QVBA 3LN3A 4PH6A 3W4RA 2WMGA 1A5NC 5HWJA 2Y7EA 3QVQA 1O94A 2ZXDA 4XV0A 4GQQA 3IARA 1DPMA 1EC9A 4MF4A 2PWGA 4A3RA 4OWGA 3R8GA 1BRLB 2HVOA 2QZRA 5ECVA 1YKWA 1W1A1 2WZHA 1CLVA 3GNOA 2V2HA 2GVLA 4Q8UA 5DCBA 3FA5A 4CEXC 5AHLA 1UR0A 2BB0A 5TD4A 4FF5A 4O14A 3E2SA 3CZ8A 4GKTA 5J5DA 4Y9PA 3T8LA 3W81A 5I3FA 2Z6IA 3URNA 3RLVA 4C6MA 5HANA 1M5WA 4IH3A 5CKSA 4XBSA 3FK4A 1YW1A 2CWXA 5I3JA 5IOBA 2CWNA 3S8HA 1G4EA 4RDYA 3WDHA 4OFCA 3HJEA 1N8FA 4CNNA 2GYIA 3VIPA 4TOQA 2QJNA 4IFOA 4ML4A 4V1YA 2CERA 4UFHA 3AIUA 3M64A 3N04A 4ZGYA 1CXIA 3NPVA 3DAQA 3ORWA 2A21A 3NDZA 4Q6XA 5F4WA 1YMYA 3KOFA 2HNHA 2ABBA 3PFMA 3CV1A 4R5EA 3AISA 3DOPA 2VC7A 2VEKA 3EAUA 3GAYA 1P6BA 3KDNA 2QCDB 3ABXA 1KGWA 4LAZA 1TTIA 4RLIA 2WKGA 2E1DA 1MNZA 2WVTA 1OABA 3FIGA 3BSHA 4MVAA 2PA6A 4W7WA 1FDYA 5H6HA 2V0TA 3Q45A 4LU0A 2IUZA 2VFGA 3B8SA 2HDJA 4NYYA 1XIIA 1ZJIA 2P0IA 2QXWA 4H6QA 4GC3A 4EPBC 2PP3A 1UC4A 1W54A 4XISA 2EXOA 3DENA 3ITGA 3AIVA 3R11A 3PTQA 4L56A 3S1UA 1HKWA 4NU7A 4DO5A 5ABFA 1LDCA 3H2EA 4R34A 2X1IA 2PP1A 1XRTA 5FKYA 2PDYA 3U0HA 2H8XA 1I60A 2PWUA 1I2NA 4GXWA 2QULA 3GYEA 5ABHA 3WD3A 4AEFA 1L6SA 6A3HA 1JCTA 1EA9C 7A3HA 2H3DA 3FA4A 1MWOA 3BWWA 3H2MA 1DV7A 4Q4KA 3BARA 1OFPA 1CYGA 4KBXA 1HX0A 3W25A 3AIBA 2OQHA 1CGYA 4CQCA 3W1NA 4UOZA 4ACZA 1MVYA 3ZZ1A 4GCAA 2ZDRA 3KBNA 5DQPA 1TV8A 5GNYA 3WK0A 4HTBA 1P0NA 4HZMA 1OF6A 3S2CA 3FKRA 4RXGA 2RJHA 1D3GA 3NYDA 4JTQA 4E5TA 5CBBA 3D3AA 1X1ZA 4HQVA 3CBWA 2REQB 4XUYA 1AVAA 5M2FX 2A1YA 4FMVA 2ZUNA 3A64A 3ERPA 4UXDA 3VIGA 5CC3A 2FVMA 4RZ4A 4B9ZA 1TRDA 2OG9A 3OZOA 4JFSA 3E0FA 4LSBA 3TNOA 3JUGA 3OLEA 1LF1A 1XKYA 3CHEA 2GVJA 3HQ1A 3VI2A 2QEZA 3ID7A 3SJ3A 2PDUA 3VABA 4JTDA 4XIMA 4H7VA 2HISA 1SZEA 4I3GA 3OZPA 4CD7A 2PDFA 3V0TA 3EA3A 1IF2A 3ARPA 1AJZA 2VZUA 1XI3A 2G3MA 2QUUA 2CIPA 2R91A 4F0LA 4XB3A 4HPGA 3ALFA 3S9YA 4W89A 3VKDA 4IXXA 4NAFA 1V4YA 1VAHA 1ZSXA 1XQLA 1XXXA 6CGTA 5HDRA 1GOIA 1LWHA 2YDRA 3KTXA 1SMDA 1XBXA 1GVYA 4C6LA 2P3EA 2Y4SA 3ITYA 2E7FA 3IUHA 1WZLA 3E02A 5T9BG 3VO0A 1FA2A 1QHOA 5FL1A 3TYZA 1RH9A 4A6GA 1U1JA 5T9CE 2WBKA 4Y9MA 3OGVA 1Q6FA 1FFRA 1XV8A 3GSMA 1QI5A 4CD4A 5CH9A 3ZJ7A 4PMUA 4Y9OA 1CDGA 1L9WA 1QDSA 1SJBA 4CNUA 3K30A 1J93A 2AL1A 3H26A 4AZ7A 1KNWA 4PMRA 2G37A 1E51A 1Z42A 5F1UA 3LXBA 1QT1A 3LK6A 1ICQA 3THAA 1G7VA 1NDVA 1SO3A 5AYIA 3VX1A 1WBHA 3F7JA 3GZ3A 1DQUA 2XGBA 1NDWA 2GL5A 3L0NA 1S2AA 1JCMP 2ANUA 4DZ5A 4PUEA 3T6CA 3TYDA 4HA4A 5K3VA 3W1AA 3W7LA 4S3EA 4BI6A 2JGYA 1RV8A 3FXYA 3KE0A 4GFSA 4ZO6A 1KO0A 5D2TA 2YYTA 1OFOA 3PUDA 4XZBA 1VCVA 3EX6A 1GHRA 4XWUA 2ADAA 2E09A 4ZBCA 3BCDA 1VB9A 3LI0A 3TSBA 4GFIA 2WNZA 4I6VA 3GDTA 3S0CA 1K9TA 4JTEA 5C2XA 4L6DA 2DJLA 3T05A 4XO7A 1K70A 2YDQA 2ODOA 1DOSA 2PD5A 3M7SA 4AHPA 2QCLA 2OFJA 1E4IA 4XZ9A 3BJTA 3M43A 3MC5A 5BOEA 2WWDA 3CZJA 3WQ5A 1VPXA 3OPSA 2TMDA 1GQIA 3G1VA 4WLCA 1GVRA 4B5NA 3PWGA 2JQXA 2ZX5A 3GVQA 1GONA 1XLDA 3B4UA 1T0OA 4C6JA 3FDGA 1GORA 5G1MA 3AHVA 2GJXB 4LYKA 1LG2A 3VUSA 1WE5A 3MUZ1 1OZQA 1R3RA 3W38A 2NQ5A 1TFVA 4DXXA 2TPSA 1BG4A 3WJXA 3VNDA 1FWCC 3MBFA 4Q4RA 1O4UA 3MBDA 5EMUA 3FJNA 3CH9A 3ENLA 4AWSA 4JKKA 1LBFA 3QYQA 2DGAA 1K4HA 2DUAA 4LTSA 1GVIA 1J6PA 3W7DA 4C7GA 4MHBA 2XUCA 5DX7A 1BQCA 4DBUA 2H6RA 1IZJA 5EMKA 3OIHA 1DL3A 5CPMA 5FI8A 4QNWA 4J7RA 1EPVA 4F0KA 3DFHA 1W5NA 2PU1A 4E2BA 1D8CA 2J7DA 4OKDA 1V77A 4DI8A 4UCFA 3C86A 3CAKA 1M3UA 3T4CA 4V15A 4Q4QA 1VJIA 4ICCX 1TPVA 2IQDA 1TMQA 2PWVA 1D9EA 5EYWA 6REQA 3GG7A 2OMAA 3S2JA 2R1NA 2AMXA 1TRIA 1YNYA 3APGA 5I78A 2FZDA 2GZXA 2G4JA 2ZUVA 1X97A 2YL6A 3MUY1 5HWMA 4BQ3A 4AUBA 1LOSA 2YZRA 3B8WA 5DMNA 4DJFA 3E0WA 4HNCA 3KRSA 3A3XA 4UTWA 3OVPA 1R0MA 1UR3M 4KEZA 3OO2A 1A5KC 3H4WA 1PWLA 3BG3A 4LS0A 3FVMA 2JFEX 1JAKA 2YDAA 3VKJA 3A4JA 4GBUA 3CIWA 3EXSA 1TVNA 1BHGA 1I75A 3IJ9A 3D46A 2X0HA 3MCNA 4QE1A 3M4HA 1CX9A 1RVGA 1TJRA 4HPJA 1H1NA 4P7OA 3QF0A 3BAKA 2C3ZA 1CNVA 1GJWA 4NZ5A 3DFNA 1WYIA 3IGSA 3U48A 4ZZ9A 1Z41A 1LQAA 3WLRA 4W88A 5I79A 1BWLA 1OFBA 2FGZA 3ZSSA 1IYXA 3VOIA 3CASA 1W6TA 4MG4A 1DJIA 2IXUA 4G1KA 1K6AA 5A8PA 3HFTA 4J3SA 1TTJA 1F3XA 3NL3A 4B2DA 1GZJA 4WGHA 3AU6A 3ZLFA 3TQVA 3SW6A 1PCWA 1PJ9A 3HO8A 1N8IA 3WBAA 5EMJA 3VIOA 4BS0A 4FNUA 1LQ2A 1OCJA 4DN1A 4JICA 4BKNA 3CL7A 4GVIA 7TIMA 2QCNA 2W6RA 3CHFA 3W02A 4BHYA 2WC4A 4IPLA 3P14A 4FLRA 4A22A 1G6CA 3M9YA 1DJXA 2J25A 2QYGA 1M01A 5CSRA 3QV7A 2DV0A 4UNIA 4UR7A 2G3NA 3U7VA 3LPOA 5HWNA 3S2NA 5IXEA 5J5RA 5DRIA 3UWQA 3L65A 4TR9A 4XKYA 1ZHAA 1GVEA 4JBRA 1GGOA 1UASA 4R33A 3T0BA 4LYRA 3W7NA 3P93A 2QQ6A 3SN4A 1RY0A 3ABSA 1XJBA 4NNAA 1F3TA 1PUDA 3NO5A 2UV8G 3V18A 5LHEA 4H8UA 1VCGA 2X2YA 4HU8A 1KW1A 3NQAA 3TUUA 2D2OA 2EPMX 3BSMA 3L12A 3TYCA 4Z08A 2NLYA 2OKOA 2WPBA 1V7AA 2PRHA 4UQEA 1B3VA 4EX4A 2AKZA 4GGBA 4H9VA 1Q8AA 3PBUA 5D9NA 3DH7A 4G1NA 5HAOA 1MW2A 3R10A 3WQ8A 1B5TA 1QI4A 7CGTA 3UVIA 1L2UA 4HK6A 3RCNA 1OFDA 2B7PA 1F6KA 1BGAA 1SVDA 3WJZA 1JCJA 4UB9A 4DJED 1JGMA 3FXGA 3DKJA 3WQWA 1QPOA 5C8BB 2WMFA 4NASA 4AQLA 3WLTA 3W2MA 3WQFA 1R38A 4FALA 2E6AA 4LS1A 1S1PA 5AC6A 3CQKA 4OZOA 1EFZA 5FL0A 2WCAA 2XWEA 3IJQA 5FEPA 3BCFA 2QCGA 2BDQA 5GVJA 1GYNA 1TX2A 2GDQA 5K9CA 5D2WA 3W24A 2W91A 4D6DA 1ITUA 2Z2UA 3SDOA 1NARA 2P88A 3MMTA 4K3ZA 1SFJA 4HA3A 3EPMA 3ANUA 3EZ4A 3G1FA 3QQ1A 2QF8A 1UPPA 1ISXA 4S3GA 3C2FA 3W1LA 5CPLA 1Q66A 1QNSA 3WEZA 1ME8A 4IIGA 3SUSA 4DBEA 1QJWA 1R3WA 3CMJA 1UPMB 4E0CA 3OGSA 1SMAA 1NF7A 1CLXA 5A8QA 1U33A 2GJPA 1CGXA 1I4NA 1RJQA 3EOEA 5E70A 2PI6A 4P8UA 1VHNA 3M6YA 3TAKA 4XSMA 4W5ZA 3R1ZA 4JZ5A 2J4GA 3HG4A 1FHDA 1YEYA 3DESA 1P5BA 1MRQA 3GR7A 3UPMA 4PMZA 4WKAA 4MYAA 4IGNA 3UXLA 1FWTA 1V5XA 3WJWA 1V6WA 1W31A 1Z69A 1KBBA 2PLMA 1AMKA 4AYSA 3UPWA 3WYZA 1W3TA 3GIYA 1ZBWA 4ACZB 1W3NA 3ITCA 1VP5A 3OG2A 1MI3A 3U2ZA 1W5MA 3WBYA 3GXPA 3AC0A 1SW7A 1UUMA 1XC6A 5JMUA 3LQGA 3CUXA 4FNPA 2ZX7A 5I06A 2RDWA 1X1OA 3TOPA 5DBUA 1XISA 3ABZA 1XIBA 2NX9A 3K1GA 4CVUA 1O1HA 1A0DA 4B16A 3GVGA 3PZNA 2XWDA 4OU1A 1TWDA 3TIMA 3OHMB 1XIFA 1E4LA 4DF2A 2OSYA 4H1ZA 4JPGA 2OX4A 1PHWA 1DIEA 4L5ZA 4LF2A 3GXDA 3N6JA 4JIRA 1WXJA 3BLOA 2CW6A 3SN1A 4GRSA 4H6EA 1Q4NX 4IHCA 1POKA 2IKIA 3D5HA 1JDCA 3RNDA 3TA6A 2DFAA 5FJUA 1W3IA 1XIEA 1GQKA 2D24A 1FWSA 3R58A 4PUWA 1E73M 3VDHA 4E38A 3AAMA 5D05A 2KZHA 3QMSA 4MUPA 1HKJA 1EYEA 4IX0A 1JZ4A 4Y6GA 4TXEA 4OQVA 5FD0A 1JRCA 4KMQA 1WDWA 5T91A 5M17A 1R9ZA 3P81A 1FCQA 2WHKA 1IXQA 1X98A 2WV8A 4JX4A 1UWIA 4JEJA 2W5FA 4L9YA 1B3XA 4K36A 1Z7AA 4KGJA 3TSDA 3OG3A 1VENA 3M0IA 4AZCB 4BI7A 1V02A 1DE5A 4Z2IA 3AXXA 3DC8A 3UW6A 1NH6A 1HJQA 1FXPA 3Q4DA 1E72M 2ZZ3A 1UR4A 5I2UA 2E28A 1ZJAA 2FVLA 3G1SA 2R1LA 1L0PA 1ZPTA 4CGTA 2DUXA 4IF2A 1FWEC 1Z32X 3AHXA 3LEPA 4K8GA 2WOQA 4NJIA 3PNUA 5AHMA 1JG9A 2ACSA 2E8ZA 4P5UA 1RD5A 1KLYA 2WK2A 2W62A 2C7FA 5F7UA 5DMLA 4O57A 4J4KA 4PL2A 4PZVA 4UQCA 4DAIA 3SIZA 5HJXA 2VC9A 1KGXA 1Y7VA 3P7YA 2J77A 4AY1A 1C9WA 5C9ZA 1CBGA 1NOUA 5JBEA 3TCEA 4B9YA 4ATLA 4O18A 4IFRA 5TAOA 2J75A 3SIMA 1AL7A 3SCNA 3N12A 3LENA 3NGFA 2NVAA 3G1HA 2QR6A 4WGXA 4OJYA 4LVGA 4O4WA 2HTMA 2ZRVA 4KQNA 1OFRA 4ZOAA 1L6GA 4X0NA 4E4FA 5FOOA 2JE8A 1XF0A 1R87A 5LHFA 4UTFA 2Z7KA 4ADSA 4G6CA 2Z28A 2HZGA 1GT8A 2VKZG 1FH8A 1KTNA 3I6TA 1HZYA 4AZHA 3THDA 1JZ3A 2OT0A 4XZMX 4A3QA 1DJYA 5LA1A 2G0WA 4W7VA 4W5UA 4OOZA 4ML9A 3UNDA 3K4DA 2EG8A 1E40A 1B54A 4BF9A 5HBFA 3SADA 4LB3A 4BEQA 2XVLA 4H2CA 2HE5A 4V33A 4AVFA 4JYDA 4R9XA 2PC4A 4UMCA 5FJJA 3HOJA 2NT1A 3CAWA 1X6LA 2XFYA 4Y7EA 3GIPA 3TJ4A 4RXFA 3HURA 3C0JA 1PXGA 1VZWA 2NXGA 2W92A 4XQ6A 1I45A 4L65A 3KVJA 3CUGA 4L64A 5REQB 4K1GA 3OQEA 5CPTA 4LNYA 4ZCWA 3WF2A 1DP0A 5IBXC 3S5SA 4B5XA 3JR2A 2YL9A 4N9EA 4NIRA 4EPEC 5LXXA 2WVVB 2XISA 1VYRA 3EXRA 3RJXA 3GY1A 2F9RA 1GQLA 4DO6A 2E3ZA 4DF1A 3GZAA 1VFLA 4LAKA 3G77A 6ALDA 2OZTA 3DCPA 3S2MA 4B90A 2VO5A 4IP7A 1V6YA 5F2IA 2AQWA 3FSTA 1QHZA 3OLIA 2ZQ0A 3W2KA 1J9YA 4GH3A 4Q7NA 3ZQ9A 3SO7A 3FEQA 3DFYA 3MP3A 1SW0A 2J9XA 4E8CA 3UY8A 3HZ3A 5MHBA 3JRKA 1GVSA 4ES4A 2HXUA 3HMJG 3JW7A 2ICSA 4PCSA 4AHQA 4LOCA 3T08A 4XK2A 1G4SA 1Q2RA 4EACA 2JIEA 4KS0A 4Y8FA 1F73A 4EAMA 1TPEA 3WNOA 3AHZA 5MF5A 1EA0A 1O5QA 3LSCA 4QJ4B 4S2BA 1LLZA 4NZ1A 5BWFA 1UD3A 4LW7A 5C54A 3NO1A 3PBVA 2V63A 2J7BA 4XO6A 3RRXA 3UXKA 4NY2A 1J0ZA 4GXPA 3OBKA 1KR1A 3OYZA 4GO8A 4UFLA 2E9LA 1FH7A 4U33A 2YLAA 3UZ5A 2ZVIA 3H2FA 4XUGA 1QR7A 3CWHA 1KKOA 4M1RA 1SJDA 1B4KA 4MNMA 3KRBA 3E49A 4JTRA 3TAOA 3W22A 2HPIA 4UR9A 3EPNA 3PUOA 4A8RA 1S2TA 1LUCB 2PDHA 4B3KA 3PBMA 4LAUA 3HG3A 2VQTA 2NUXA 1UD8A 1QHPA 1L8PA 3DI0A 4JTTA 4GYFA 1DJZA 1W9UA 1VPYA 4MKSA 1US2A 4GZJA 4YXGA 3LPGA 3EX4A 3A47A 2D22A 3LCXA 3W1XA 1D2KA 3VNIA 3THQA 2QAPA 5F2LA 4B3LA 3AJXA 3ABOA 2WNQA 3F1QA 1JCLA 2L5HA 4REQA 4AIBA 5A6LA 4ICMA 3LOTA 2AGTA 1WV2A 3KBMA 2OWCA 4X9SA 4HNTA 3O6CA 5I7GA 2WSRA 3C56A 3NZGA 3UGRA 2BASA 1YTDA 2DP3A 2R82A 1TELA 1WZKA 3RF9A 3O0KA 4G8TA 1KM0A 2ZWZA 3BXWA 3BG5A 3G1AA 4AZIA 1XW8A 2G3JA 1XYZA 1C91A 1B57A 2J9YA 4WHBA 5AZ0A 3FLUA 3WNNA 3NDOA 3WSUA 1FH9A 2PGRA 1TPWA 3B9OA 1D8WA 2V9DA 4NUWA 4C6OA 3LTSA 4XBKA 2DT3A 5AHNA 3N6QA 3P0XA 1DWGM 2VZOA 4JHMA 1XFBA 2VVNA 2OGYA 1B30A 4C1LA 3W73A 1LLOA 2VUNA 4QQUA 4O4VA 1I2RA 2IKHA 5F2GA 1VJZA 2Z4GA 3E3HA 2ZFAA 2WMIB 3CUZA 2Y2WA 2WAGA 3C6CA 4ZQCA 3MU7A 5A8NA 1EL3A 4JQ1A 2CU0A 1MFVA 2FB2A 2WQDA 3WD4A 3H8AA 1JEZA 2CESA 1ONXA 4RV3A 2PDXA 2Y8UA 2G8ZA 4RNHA 3TE9A 1GK8A 1A50A 4IQLA 1MUWA 2EG6A 4NI8A 4RE2A 1NDZA 4JTLA 3C61A 1RXOB 1TPDA 2PDNA 3CWOX 3ES8A 5DY3A 2UY5A 4NT0A 4RPPA 4LVAA 4L1GA 5D4YA 2ZZ2A 2TRSA 1IEIA 1O95A 1W9DM 3W29A 4XZWA 1FVPA 3IIPA 1O7AA 2HEJA 1GNXA 4PRWA 3IV8A 3H6OA 3AROA 2TYSA 3SSZA 4N6EA 3QYSA 1JCXA 1F4AA 3U4FA 4AYGA 1XBYA 2XINA 5G4HC 1W0MA 4IJBA 1UWTA 3Q58A 1M04A 3A3WA 2BOGX 4S23A 4AX6A 4B3ZA 5C7VA 1OGSA 4DJFD 1FRBA 3ZWTA 3QKZA 1OCQA 1KBIA 2I5GA 4V28A 4JHZA 4ORIA 3TV8A 5JBDA 4LEQA 1L2QA 3INPA 1DXFA 4DJDC 4IMCA 4F3HA 3NIYA 4GIRA 4PMVA 2Y6ZA 4K6AA 1GKQA 1LRTA 4KGLA 1RVKA 1XSJA 3AXMA 3QW4B 2IMRA 2A3HA 4IGMA 3T2PA 4YHGA 4AEEA 1C93A 4NJKA 4UFIA 2VT0A 4MDOA 1E9YB 1N7KA 4PTVA 2OODA 3OQ8A 3W2UA 1FDJA 2XYLA 4D6EA 3P80A 5EMYA 3RFAA 5I24A 3AI0A 4R7JA 4AMAA 5HMFA 3TJIA 2O7QA 2HSAA 3L5MA 3W72A 3SEPA 2GDUA 4DWSB 3IV3A 5DFAA 1A3HA 1C7TA 3AU2A 1G67A 1A4LA 1SGJA 2EHHA 4F2UA 4A8IA 4ZODA 3HPAA 3N3MA 3MZNA 3VGFA 2XDFA 4EXQA 4QLJA 3W7RA 2J6XA 2PRMA 1S5MA 1UC5A 4DBWA 1FWJC 4JKMA 4JCMA 2PRLA 4XAGA 3KP0A 4IX2A 2UBPC 6XIMA 1JFXA 1CXLA 3OLGA 3AIRA 1KLZA 3LHWA 3K5XA 4DVOA 1SO4A 5EFDA 3U8GA 1CI1A 4NHVA 4C6NA 2XIMA 3WFAA 3W2NA 4LCQA 2X0YA 4PSPA 4RE3A 5D9PA 4GJIA 3UPBA 3VDCA 3CPGA 4HGXA 3WLSA 3UJRA 3EGJA 4LYQA 3TCSA 4LXFA 3N17A 5LIKX 1RUSA 1EJWC 4GK8A 3W7CA 3RIKA 2QCFA 1HL2A 2V2CA 1YNPA 5BROA 3KEHA 1EX5A 4O1DA 1NQ6A 3KS5A 2Z26A 1X1NA 1H1ZA 1UZDA 1XCXA 2VEPA 4QQ3A 3S5YA 3UQNA 3BV7A 4J3ZA 1R8LA 5IM51 1UWUA 4G7EB 1WDSA 1MXDA 1E56A 1EYWA 1S5NA 5DN1A 1E0VA 4DIAA 4JOMA 4ERIA 4N9DA 5KINA 3CHDA 5M1TA 1T6MA 1EXBA 1NQKA 1XYBA 5EMLA 3ZR4A 1BYAA 4BK9A 3UZXA 3L4YA 3NQ2A 1LJYA 3EWZA 1A5AA 3V5CA 1TQXA 2GGIA 1T8QA 1H11A 1IIGA 3EKGA 2ZZ6A 4HNLA 2WB5A 5FIPA 3V1PA 2XSAA 1Q5MA 3E9AA 3IUIA 4HA1A 4Q22A 3WFLA 1UUQA 5HNTA 1HJXA 3EOUA 5TBOA 3ARUA 5CPQA 4H9UA 3VOHA 1JXJA 1EOMA 2EQDA 2QUNA 3EA2A 2J7HA 4JTSA 1RZMA 3UXDA 2Q3OA 1QNPA 5A8GA 5I23A 4WRHA 3N73A 1SO5A 5JH1A 1ZCCA 1Q63A 1ME9A 5JVLA 1VCFA 3LRMA 4PUKA 1LOLA 3OBEA 2NV9A 4OUEA 3WBEA 3T1GA 1CB7B 3VNLA 2VFDA 1JDAA 1JPIA 3N13A 3N3TA 3BTNA 4I6KA 4QLLA 1SYTA 3G1XA 3NYZA 3GX9A 3B04A 3MCMA 3K13A 1EDTA 1N55A 1QBAA 3WEOA 3EKLA 4L80A 5H8UA 3I4EA 1T8XA 3QSRA 2XU2A 3B0XA 4F0SA 1IEWA 3GTFA 3O15A 3QFEA 3R6IA 3V7PA 2R6OA 1Q6EA 3VOFA 4DF0A 4DUWA 1OB0A 3GBEA 3H55A 4HU4A 2A79A 3IGHX 2O9RA 1OBAA 1Q4WA 2Q02A 4PCFA 1XYLA 3FX4A 1DTNA 1W32A 1VF8A 3NQGA 4MB1A 5DXYA 1A5LC 1TTPA 1V08A 1W3KA 1LOQA 2BY2A 1BVZA 2W3ZA 3C2VA 4M8UA 3CMFA 3REQB 3GVVA 4AH7A 5T8GA 2BOEX 3IJ6A 1GOOA 3AWNA 3TYUA 1V93A 1L6FA 3AIWA 1Q2SA 5GJMA 4R9OA 4ZB2A 3FYYA 3ZVHA 2RKXA 3NQFA 1VYSX 1M68A 4LNCA 1B31A 3KCOA 4HD5A 3ZJKA 1UZHA 5EY5A 1OVDA 4L1WA 2JK2A 4PA8A 2CZDA 1VH7A 4DZAA 2P8CA 5HPOA 1RJRA 1UHVA 2CBVA 4DX3A 2UY2A 4MAVA 3RO8A 3MDUA 3U2OA 1SZRA 1KFEA 1PX8A 1ML1A 5HK4A 4YN5A 3TXZA 2YCLB 4NJHA 1TWWA 2CEQA 2VX7A 2OB3A 3HBLA 2A85A 4JQ3A 1F3EA 3FEMA 4QAIA 1E15A 1WXZA 1QBBA 5GQBA 1FTXA 4MFEA 3AYVA 3QW3A 2YX0A 4A8LA 2OU4A 1FCVA 1SJAA 4H7CA 3N2MA 3AIQA 4QS6A 3SURA 3W27A 1K9FA 4RZ6A 3SCSA 1TQJA 1A53A 3CLMA 1EO5A 3UR7A 3FVDA 1R3VA 1C92A 2O92A 1HTIA 4QHRA 5G1TA 4JL1A 2RGLA 4JR5A 2V5LA 3W07A 3B3DA 5ABTA 2CKRA 2FTPA 3WMLA 2W63A 2PDGA 5BXTA 1S3HA 2CXEA 1WOAA 1ZRQA 2ZA3A 3VE7A 2EPNA 4NJGA 3EDEA 3PB0A 4KWOA 4GQ0A 1PTAA 3W37A 1L6YA 1BVNP 3MT1A 2BWGA 5D03A 3NZ1A 2V30A 3LLXA 3SCRA 4K37A 3CMGA 3ZR6A 2VDGA 1IT0A 4GVGA 3KRZA 3T42A 3MYOA 1LCOA 1V0LA 2NVCA 3WLOA 5G4EA 1XG3A 1QW8A 2F84A 4S3FA 3TW7A 3UEQA 1OX4A 1XLJA 3RMEA 3CV2A 2ZA2A 4ASTA 3NGJA 3E1F1 4X61A 3HGSA 1H7NA 4DY1A 1FHUA 4MNKA 2PDBA 3GM8A 1H62A 2OQYA 4M51A 2FH8A 2YA1A 3B06A 4GJ1A 4PL1A 4TUFA 1Q3NA 1UBSA 1WDDA 1UJQA 3RJYA 5E6YA 3KL3A 4BQ4A 2E6FA 4IT1A 4GO9A 4GUJA 1H5YA 4I7UA 2ZRWA 5CPOA 1VRDA 1CWYA 3UWZA 1FHVA 4FAMA 1EDQA 3KP1A 5A2AA 1ONRA 1TG7A 4IM4A 3BG9A 3R13A 4RK8A 3LHTA 3OTRA 4ZO7A 3N14A 2B7NA 4V1XA 1HW6A 1IWPA 1OCNA 3PP7A 3WNKA 1EJTC 3NTYA 3QQ0A 1J6OA 4QM1A 4ZFCA 5A6BD 2RAGA 4U3CA 4D2JA 1WAUA 1P0EA 1WNOA 1VEOA 1UWQA 1U5HA 2AKMA 2RH9A 5K7JA 2IPWA 5HPCA 4O50A 3GRIA 2TSYA 3SECA 2QLYA 1Z44A 1DJHA 3UWEA 5CG7A 4NKCA 2Z27A 2CZFA 4US5D 1V3KA 2ABAA 4ZA0A 3QR1A 3ZWSA 5MKGA 2XM2A 5I02A 3HU7A 4E2OA 1O60A 3PZ9A 3W74A 2D69A 5HJLA 3CGTA 3LTYA 1XC4A 1VFMA 4JTFA 1EXPA 1XLAA 4DQWA 4ZE5A 1LWIA 2E6DA 3AS3A 3KRUA 6PTDA 1ICPA 2BMBA 2B7OA 2V3EA 5DT5A 3LCWA 4ZB5A 3KZPA 4I7VA 3VYLA 4D6JA 3M0VA 1K3UA 4GY1A 1F3WA 1V03A 3WEMA 2QDEA 1NWRA 3ZJ6A 4PTWA 2VRQA 3CS2A 4JN7A 2OXNA 3VVGA 1F8MA 1O1ZA 3H7RA 1DXEA 5CJ5A 3L7RA 4J2PA 3THCA 4ATDA 1QPRA 1KGUA 3WLKX 2BP1A 5CC6A 1E5JA 1PIIA 2R1KA 4A21A 4O17A 3CPUA 1GWJA 4DHGA 3TU9A 1E9ZB 1BWKA 1IXOA 5TNVA 1NU5A 1EJSC 3LB0A 4I5RA 5FJIA 1EEXA 1Q6DA 3H22A 3IGXA 4FPSA 4H8HA 4I9AA 4JTIA 3VCRA 1UP2A 2WXDM 2Z1VA 4BCEA 1D3CA 1BQGA 3MHUA 3DERA 1YHTA 2XN0A 9CGTA 3F2CA 3OBAA 2EPHA 1GQJA 5I3KA 4FIRA 1TV2A 3STFA 3WDJA 4IPPA 3QQWA 4P61A 4GQBA 4NQ1A 1ZJHA 4C6FA 3ARXA 1ZL1A 1GKRA 1XKJA 3UXAA 3B9DA 5DT7A 1H60A 1NSJA 2VFIA 3G6LA 4HSHA 5LIUX 4CNTA 1XX1A 3H4XA 1JQXA 3E2QA 4BF5A 3ALGA 1G94A 1I2OA 2IW0A 4JL2A 1GG1A 2VXNA 2VELA 3E38A 1B4EA 2PWDA 4AXNA 2QHAA