4M7SA

Crystal structure of semet btrn in an open conformation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
249
structure length
214
Chain Sequence
MDKLFSMIEVEVNSQCNRTCWYCPNSVTGEMDPALYKTLMEQLSSLDFAGRISFHFYGEPLLCKNLDLFVGMTTEYIPRARPIIYTNGDFLTEKRLQTLTELGIQKFIVTQHAGADKEKVVYLDHSASKANMSCMVPSNLAVVTVLGNVLPCFEDFNQKMVMGNIGEQHISDIWHNDKFTSFRKMLKEGHRGKSDLCKNCNNVSVQTEEQYDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BtrN
publication title X-ray analysis of butirosin biosynthetic enzyme BtrN redefines structural motifs for AdoMet radical chemistry.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Metal binding protein
total genus 71
structure length 214
sequence length 249
ec nomenclature ec 1.1.99.38: 2-deoxy-scyllo-inosamine dehydrogenase (AdoMet-dependent).
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13186 SPASM Iron-sulfur cluster-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4m7sA00
5CZ0A 4OT7A 4O1DA 3W86A 5AYXA 4JXCA 1KLZA 5FF2A 3W1NA 1G7VA 3TROA 3W7JA 4K7YA 1O60A 5D33A 1LM1A 2E68A 1NVMA 1QOQA 4ADTA 3P82A 1EWDA 2A7NA 4N4PA 3MP3A 3H54A 2C19A 2RKXA 1OYAA 4O53A 4RX0A 2YGYA 3P74A 1FDJA 3ELFA 3G0XA 4O0ZA 1FWWA 3IGSA 5LHEA 5C5YA 1VYSX 4UTTA 4GUGA 3S6DA 3D0CA 2VXNA 3O07A 4AF0A 1R47A 1H63A 1FCVA 4R53A 3SZ8A 3LGEA 3TNOA 1S5VA 3ATZA 1TMHA 4UIOA 3UXDA 3HG5A 4KFNA 3IV3A 5EMUA 1O5XA 5F4XA 3TSBA 1FCQA 2GVJA 4JIQA 3WFAA 4NXKA 3IGUA 4QQ3A 4O1AA 3DFOA 2DJLA 4JTKA 1EUAA 2J24A 1RV8A 4H4IA 3W7KA 4FB7A 2Y61A 1HG3A 1YLVA 3G24A 3LXAA 4JIPA 2BX7A 4LS0A 3S0CA 1B9BA 1R2RA 2QUTA 3NQ8A 3W3OA 5HMSA 3HOJA 1C9DA 4UFKA 5KZMA 4FIRA 4LVAA 3W1UA 1VR6A 1G7UA 1ZALA 1ZFJA 3F1QA 4UXDA 3CB8A 4E2DA 1Z48A 3IVSA 4O14A 1I2PA 2YYUA 2BTMA 3W1MA 3NZRA 1G4EA 5DBUA 4K6AA 1ICQA 5ABTA 4GBUA 1XUUA 3E9AA 3C52A 4JYFA 2XN0A 3G22A 4IUOA 4Z1DA 1JCMP 1YYAA 3G3MA 1UCWA 1FX6A 4P2VA 3Q58A 1H51A 3T7VA 3A23A 4Z1CA 2WJZA 1B3OA 2NXHA 4N6EA 3H53A 5GVJA 3CEPA 4M6VA 3S9YA 3AO0A 4GE8A 5D32A 3W1TA 4FO4A 3WJYA 4MIMA 1QAPA 1WAUA 2CZDA 1KM2A 2QCHA 2CLHA 3EKLA 4LT9A 3OIXA 4JGDA 2A5HA 4YCPA 4WUIA 4NJHA 1W1ZA 1XFBA 2QKFA 3EEGA 1LCOA 2TRSA 1MZHA 1W37A 1F6PA 3N3MA 4QITA 1FDYA 2Y88A 4TMBA 3W1PA 3TU9A 1YTEA 1OHLA 5LKYA 3SECA 3NQDA 2WOQA 3TXVA 1MEIA 1W56A 3R89A 1XUZA 5CSRA 5EA9A 1TYGA 2C6QA 3BG9A 1XBYA 5AHMA 1GZGA 1LROA 1G69A 1H7PA 3NO5A 2E5CA 2YDAA 4HHPA 2YX0A 4MPQA 4UTMA 2J88A 4JEQA 4HIBA 4ZQRA 4O16A 3ABSA 5IM51 4IMCA 5D37A 3W72A 2BLEA 1TPUA 4DF2A 3MYPA 2EF9A 4MJMA 1GVFA 2C1HA 3NZ1A 1LYXA 1YPIA 5KMYA 3CU2A 4RR4A 1AG1O 3W7CA 1VPXA 2DZXA 3YPIA 1VYPX 1KFEA 5F1UA 5TBOA 3W7MA 1GTEA 2ZZ7A 3KRUA 3M5ZA 4JTSA 2NWRA 4O52A 5AHLA 1DVJA 3Q2DA 5TQLA 4R7JA 2O7QA 2FPYA 2QDHA 3THQA 1D9EA 4FNTA 4GUJA 5CPOA 3LTYA 4FX6M 3T44A 3L66A 4TMCA 4BWLC 4LUJA 3LCXA 1W0MA 3P5ZA 2CZFA 1HUVA 3LI1A 3M5VA 4IXHA 1T0OA 8TIMA 4KFOA 4P61A 3L68A 4WOZA 4UCGA 1ME9A 5AYZA 3LXBA 1F74A 4AHQA 3DXIA 1TV8A 3FEMA 3USBA 1CI1A 4X2RA 1DQWA 4KWVA 3N2MA 3O63A 1EEPA 3UWQA 1A50A 5DCEA 1OK4A 5D09A 5EPDA 2C16A 4JY8A 1LDCA 4MYXA 4EF9A 4LRSA 4MY8A 3E49A 2WO5A 2ZA2A 2H8ZA 1VRDA 5LHFA 4TIMA 2F7FA 2WSRA 2V81A 1JCXA 5F4SA 4CLMA 5G4WA 5AC6A 1NAL1 2VFDA 3C2EA 5FF7A 3EWZA 3C8FA 2V8ZA 3LHYA 1TRIA 3W7HA 1M5WA 1SQ7A 2FFCA 5KZEA 3MBDA 5CPLA 2ZZ4A 1T99A 3M16A 3VCRA 1KTCA 3EWWA 1VHNA 5G2HA 3FFSA 3MI3A 2QEZA 3HG2A 3QQ1A 1GQNA 2DJXA 4UFLA 3GYEA 3G0UA 2JKEA 5C54A 3BGGA 4FXSA 3W71A 3PSWA 3TCEA 3BLFA 4NNBA 4UTIA 1H7NA 5F2IA 1Y0EA 5TIMA 3R5EA 1DJNA 2YW3A 1OABA 2NX3A 4MLJA 1RR2A 3M44A 2FPTA 4FXRA 1KV5A 4UTKA 3NQEA 1VGAA 4B5NA 4NX0A 3WK0A 5D2YA 1I45A 3HPSA 4LS1A 4KKXA 1G6CA 5D02A 4UMAA 4WD0A 1B4KA 1H7XA 2AAMA 2PCQA 1R46A 2TYSA 2ISSA 1JR1A 1Z41A 3NQCA 1F73A 1PVNA 4Y9AA 1K7FA 2B7PA 2CZEA 1JULA 3L0KA 5LNRA 4FNPA 4GUHA 1VC4A 3I7RA 4LVDA 5K7JA 1TPB1 1VH7A 3NA8A 3RK8A 5T26A 5BMXA 4MVAA 3STGA 2GJNA 1P1XA 5U7SA 3NL5A 2ZRVA 1XC4A 1ZY9A 3LRLA 4OV4A 1H7OA 4A22A 1LRQA 4NX5A 3NPUA 4NNCA 1F5ZA 3L67A 5J5RA 1LORA 2E77A 5CSSA 2GQ8A 4O12A 4WXZA 4A2SA 5C6MA 4PL1A 3UWVA 3GDTA 4IXXA 5LGZA 2ZRUA 3EX1A 1GVOA 2ISWA 2WNQA 4QSHA 1B4EA 2DZPA 2G96A 3QMRA 2B0MA 3M5YA 4NXSA 1ALDA 5D2XA 1AMKA 1O4UA 4XTIA 4N6FA 2G5WA 4UTHA 4JICA 5CZSA 3BK0A 2V0TA 1KBIA 2D73A 3GIYA 1W3IA 3GB6A 3UD6A 3C56A 3UWUA 3EKZA 3CWNA 4CCDA 3UPBA 1JUBA 4K38A 4MJZA 5A5WA 5K2ZA 1OF6A 5DCDA 2QCLA 4BR1A 1J4EA 1ZHAA 3EX6A 3C0JA 4A2RA 1JQVA 2Y6ZA 3ABQA 2ZYFA 1OYBA 4UTWC 2G95A 5FEWA 4O19A 3G8RA 3PUOA 1QNVA 3NPVA 4IPIA 2DORA 1XM3A 4U28A 4AMAA 1IXQA 1L6WA 3L65A 4JX5A 4NUWA 5BW6A 3OHIA 5CKSA 3LV6A 1SO5A 3W7QA 3P84A 3HPZA 3T55A 1QWGA 3V1PA 3CLMA 3NQMA 1OX6A 2R94A 5FEZA 3RU6A 2X2GA 3R12A 1QMLA 3N9RA 4WOQA 3IEBA 1OFAA 1KFCA 3NQ6A 4FNQA 4ZL1A 2X1RA 3W1QA 4H3DA 1XCFA 4DF1A 2PURA 3PM6A 2ZA3A 4MFEA 3I68A 3MI2A 4M19A 3S5ZA 2P10A 4QIUA 2V2HA 3JR2A 3TJXA 4G1KA 4BI6A 4ZVJA 3HGSA 1CW2A 4JTEA 1GG0A 1FY6A 1O94A 2V2CA 4QM1A 2XN1A 5D38A 5EYWA 3F4WA 4FX7A 5L6UA 2J6XA 3GR7A 3JRKA 1JVNA 1L2UA 1JCJA 4PL2A 1VS1A 3DFTA 3CT7A 1AK5A 3TH6A 5LNVA 5LNSA 2A7PA 1QCWA 1OX5A 3FIGA 5D2WA 4ZQNA 4XBSA 2X1TA 3G8EA 1VJIA 2F84A 1JUEA 2C18A 1X1ZA 2JGYA 2QAFA 2TMDA 4RKAA 3B8DA 3A9IA 5HJLA 2Y7FA 3R13A 2W0UA 3L21A 4LS2A 5DELA 4W9TA 3DKJA 4HT3A 4MFDA 2FDSA 3OVQA 3LCIA 4GRSA 1KBJA 2NV2A 1YXCA 1QFEA 3OBKA 4JY9A 1B57A 1TV7A 2JGQA 2JK2A 3MHFA 4RZ6A 4YL2A 4UMBA 4DQWA 2IQTA 3O6YX 2LLEA 3VE7A 2ZRZA 4HPJA 1TPVA 3LLFA 1SPQA 3LRKA 1DKWA 3MYOA 3UWWA 3B03A 2FJKA 3KVMA 4YLWA 4NQ1A 3W7OA 3RMJA 5HQEA 3DKLA 1C8VA 3U2OA 4FNSA 2H6RA 3E96A 5EBUA 3MW7A 3KVLA 1I2QA 3LM7A 3LRMA 1TREA 3NL2A 5D2TA 3CEUA 1OFOA 4LW7A 1KFLA 3M41A 3IVUA 3DBPA 5FEPA 4HNUA 2CLEA 3LV5A 5AYYA 4O15A 3CIWA 3P7YA 1K7XA 4K36A 4K39A 3SSJA 2J9YA 1SW3A 1X7FA 1YDNA 2RDTA 2DZWA 4O11A 2Z6JA 2P0OA 2VFEA 1SO6A 3WJSA 1GEQA 3NM1A 2CLLA 2YPIA 1I4NA 2RDUA 3NQ7A 5LNWA 1H5YA 2V5BA 2YFOA 4CCEA 5F2LA 2DZUA 2J9XA 4GFSA 2DU2A 3MO7A 4K8HA 2YR1A 2X1UA 1F7BA 1MEWA 5I3GA 4NVTA 3STFA 1L6SA 2ZBTA 2GQ9A 3CQ0A 4LNYA 3M0ZA 3FS2A 1Q6OA 2NZLA 3BO9A 1WYIA 3TFCA 2ZA1A 2VEPA 3FLUA 3UZ5A 5BRBA 3UWYA 2BWGA 2A6LA 4MLRA 5HULA 4WXYA 3W22A 5C2XA 2CU0A 3MJYA 1GJPA 4AWTA 4CQAA 1DORA 1HO1A 3PS7A 4CNNA 3QYQA 1LBMA 3LHUA 3OA3A 2YFNA 4Y96A 4UTJA 1N55A 4DO5A 2GPTA 4GC4A 1JUKA 1KFBA 4UR7A 3FKRA 1AW2A 2RHGA 4CQ8A 1P0KA 3LBCA 1IXNA 4I7WA 1V5XA 3W1XA 1IXOA 3B0UX 2XFWA 3W7PA 3W84A 4LY8A 5DCBA 4DPQA 2YSWA 1K3UA 3P60A 1RD5A 3W7DA 1FXPA 3MHUA 1T96A 4WZHA 2GVLA 3P8IA 4Q32A 3MP4A 4C1LA 2RFGA 5K9DA 3TW6A 3CC1A 2DZSA 4WQ6A 5CGQA 1V7YA 3L0NA 4MY9A 1EP1A 3UY7A 3ZFHA 4PODA 4QAIA 3DENA 3QJAA 1W5PA 3G1VA 1K02A 4ZQMA 4E38A 1TTJA 5HWJA 1QOPA 3B0PA 3ATYA 3E02A 1H7WA 1N8FA 3UYCA 3KFTA 3O05A 3KVJA 2VC6A 1ZNNA 1A5AA 3KRZA 3B0VC 3L9CA 4IGHA 2GUUA 5F2MA 5H2ZA 3W1AA 4MUZA 4IWWA 1S5TA 3W88A 1TTPA 2YYTA 3NQVA 3HGJA 3QPZA 5E0KA 3CTLA 3NPWA 4QISA 4UC5A 1WBJA 3TDFA 3P5YA 1T8XA 3EWBX 1ICSA 4O1BA 2X1SA 1H7RA 2E09A 1TIMA 3T78A 3G1FA 2I9EA 3G1YA 1SFLA 2QUUA 3KOFA 1EPXA 1TRDA 3FYPA 4K7VA 1QPQA 2BSLA 4JYEA 4RJEA 2QJIA 3QMTA 1F05A 3TX9A 1SSGA 2EAWA 4UMCA 1A5BA 5HR7A 2BZNA 3LHVA 4I7VA 3HO8A 3C3NA 1KV8A 2J9ZA 3W23A 3STEA 1PCKA 4UFIA 1QDSA 3HB9A 3LHZA 5D04C 4JTJA 2WKJA 4J9JA 5IBXC 5D03A 1M7PA 2CLKA 1QR7A 1TQJA 1ZAJA 4FF7A 2C13A 1SZFA 3NR0A 1TJPA 3O16A 1M6JA 4HPXA 2CLFA 1PV8A 1DBTA 3DZ1A 2Q3OA 1SZEA 3N34A 3SI9A 3SW6A 1O95A 1I8JA 3MMTA 4JNMA 2OMAA 1H1YA 3BG5A 3NQAA 3QM3A 3IVTA 5BOOA 1YXYA 2XN2A 4Q4KA 3W2JA 3W7GA 2ZCGA 3SIZA 4AEOA 1GVQA 3BGJA 2OJPA 4L4MA 3G18A 4QNWA 3W7LA 3PVFA 5L9FA 4BF9A 3VNDA 2QCMA 1ZCOA 3PC0A 4WY0B 4CCCA 5HWNA 1VQTA 4HKPA 4AH7A 1DJQA 2DZVA 2Z0IA 1K03A 1RVGA 1PE1A 4OHQA 4RV8A 3NYZA 1TV5A 2DZTA 2OZ0A 3CM4A 7TIMA 3P8JA 5SWUA 2C3ZA 2Y89A 4A3UA 3N19B 3LERA 1W5NA 3I6RA 4IMEA 3V75A 4EF8A 3GAYA 4LOCA 4MZ8A 1W5OA 3CIXA 1I2RA 1FXQA 5EY5A 4Z1AA 3M43A 1FQ0A 3L2IA 1ME8A 2ZRWA 3M7WA 4IOTA 4XZ9A 2QCNA 3QFEA 1IF2A 3ABOA 4O50A 4NJGA 1JCYA 2Y70A 2PC4A 3L0GA 2Y7EA 1H60A 4IMDA 3VE9A 1WA3A 3UXAA 3QW3A 3HF3A 1LBLA 1LZOA 4TX9A 2GVGA 1OYCA 4N9BA 2NLIA 1EWEA 3SGUA 1WOBA 4XTDA 3TV8A 2AGKA 3C4UA 3NXFA 3UNDA 3H55A 3K30A 1FWNA 2NUYA 1HO4A 4EVZA 3W1LA 1XL9A 3BLEA 1H50A 5HINA 4TU1A 3KHJA 1XBXA 3SGZA 4Y90A 1G4TA 4JTFA 4Q33A 4AF0B 1MXSA 2YXGA 4IMGA 4O0KA 3WK3A 1PL9A 3LCHA 3TXZA 5F4WA 4IX2A 3S1UA 4HNNA 3PR2A 1SW7A 3QZEA 2GOUA 2ZZ6A 3EWUA 1FCBA 3KXQA 2BXVA 3MI6A 4O4VA 1Q6RA 1Q3NA 1NFBA 5DLCA 1S3HA 3ZR4A 2VKZG 1ZJIA 4DELA 1QO2A 3FJLA 4BI7A 2QCFA 1NF7A 4GWEA 1K8XA 5FEXA 1EB3A 3EX2A 2QUVA 1ICPA 3FA5A 3L5AA 1LRNA 4JS3A 2HMCA 3HPXA 3PULA 4PH6A 4NJKA 2ABBA 4JYDA 3S1VA 5C55A 2I14A 4FX8A 2A0NA 3IRDA 3NM3A 3EWYA 3TMLA 1YTKA 1MEHA 4AXKA 2ZFAA 4S2BA 4K8EA 1SUXA 2EHHA 2FQIA 1OVDA 3Q37A 5AC7A 4IMFA 1Q45A 3JS3A 4O1CA 4IJBA 4ORIA 3OEXA 4TR9A 2Q8LA 1IXPA 4GNJA 1X6UA 2QAPA 3THAA 5LSMA 4OQVA 3QRHA 5HWMA 1Z42A 5EL1A 3TUUA 2Q3RA 4O18A 4O57A 1TQXA 3N9SA 1SSDA 5AHIA 3TR2A 4RXGA 3G0SA 5K4XA 1KM6A 1UB3A 4POCA 1GT8A 4NT0A 3BARA 3TFXA 3DGRA 5E1QA 1VYRA 4O28A 1UUOA 4ORMA 2G97A 3RF9A 4ZQPA 1D3HA 4JTTA 3IIZA 5HUOA 5FI8A 3OG3A 2CLMA 3PG8A 2H90A 2AQWA 3I7SA 3HJZA 3PBYA 4JX6A 4QNEA 1G4PA 1KM0A 2TPSA 4LWWA 5FESA 2VEKA 2ZQ0A 3TE9A 3W83A 4D2JA 4TO8A 3LHWA 1XI3A 1U83A 6ALDA 1JJKA 4Z0SA 4LRTA 3W7EA 3QH2A 3B4UA 4IPJA 2ZTKA 4FEZA 2X30A 1LTDA 2H3BA 4JTIA 3HQ1A 4UTWA 1QPRA 1EP3A 1YADA 3P80A 1GPWA 2OCZA 1IIHA 1LRTA 3EX4A 1UUMA 3GK0A 3A5FA 1W8SA 3RLVA 4EOUA 3P67A 1OFBA 2PRLA 3W2LA 1K8YA 4HNTA 4PFMA 3GDLA 2CZ5A 3PF3A 4ADUA 1AL7A 3UWZA 4JN6A 3NGJA 3S8HA 2CLIA 2ZZ3A 2A85A 2Y63A 4LVFA 2WSQA 3C6CA 2VOMA 4C1KA 2ISVA 1IGSA 5CPMA 4ALDA 3MWAA 1TSIA 1G67A 4Z0JA 3GXPA 4AHOA 1Z44A 1GVSA 3GKAA 1W31A 2QCDB 3BW2A 3EWXA 3G1SA 1LOQA 5KTLA 4WX2A 3TQVA 4FNRA 2B7QA 3B05A 4XQ6A 3NOEA 4OE7A 4M6PA 1NF0A 1ZENA 2Z1BA 3O06A 3DFQA 1DOSA 3N73A 1P5BA 4L4LA 1SZGA 4WJEA 2Y7GA 4UTTC 4BK9A 1FWTA 3DI1A 1LBFA 1FCUA 1RQBA 1RZMA 3LCFA 3ZWSA 1VHCA 5AC8A 1L6YA 1BKSA 1PS9A 4YMZA 3QSRA 4JX4A 1W54A 5J5DA 1A5SA 3DU0A 1ZAHA 2QCCA 1CX9A 4RZ4A 5HNRA 1UASA 4FIQA 2HS8A 4YCOA 3O15A 3A24A 3W85A 2QCEA 1W5MA 4HSNA 5G1YA 2Y7DA 3TKFA 3PBUA 1HTIA 5HUPA 1PHQA 1YDOA 4AAJA 3C2RA 5DY2A 1GYLA 5FF0A 5D30A 1WV2A 4MKNA 4LTSA 3F03K 5KSWA 5F2GA 5AHFA 3QMSA 3UZJA 3OVPA 3Q94A 2ZDRA 5H91A 4N9DA 3IIPA 1WDWA 4GXMA 4ADSA 3ZWTA 5G4EA 1P4CA 4ONVA 3RFAA 3HMJG 2NV1A 4FNUA 3HGOA 3G1DA 6TIMA 2I1OA 3QEZA 2NUWA 2O7SA 3FJ6A 3VFLA 3EX3A 3N14A 2GJLA 4DXVA 1N7KA 3I7QA 4A29A 3S1XA 3ANYA 2FB3A 3NL6A 2FB2A 3I65A 3O6DA 1TTQA 2C14A 4M5PA 3M1ZA 4AWUA 5G1TA 3QC3A 4MY1A 1TPEA 2HS6A 3NQ2A 1X8FA 4LUIA 3W75A 3LLDA 3AJXA 5I3KA 3PUDA 1KW1A 1YXDA 1W3NA 3A21A 1NEYA 1HFBA 3TK7A 4JTHA 2PE4A 3TMQA 5I3JA 5DN1A 2A7RA 2ABAA 3M9YA 5K3VA 2NX9A 2QCGA 3W6YA 2J27A 4N9EA 3TAKA 5DY3A 3UQNA 3LXCA 4O17A 3TW7A 1BEUA 1GWJA 3LBMA 1KA9F 3QPYA 5K4ZA 3NVTA 4JTLA 1LLWA 3T4CA 5KITA 3TC6A 3GDKA 3QF0A 4NZFA 1G4SA 2JBMA 3B06A 3CWOX 2A4AA 1UJPA 4Z08A 2QR6A 1XXXA 3P81A 4UR8A 4O8RA 1KM3A 3M47A 4K37A 1D3GA 2OT0A 3IIOA 4JR5A 3S42A 2VEMA 5AN7A 1I2OA 4O13A 4E2BA 2NXGA 1OFDA 4CNPA 1TPH1 2E6DA 4O54A 3TC7A 5FF3A 4AB4A 1HL2A 3O8AA 1TPC1 1WQ5A 1VCGA 3WJZA 4E0CA 5D2VA 1OFEA 3W7NA 4ZQOA 3WK2A 5E93A 1GTHA 5KINA 1OF8A 4M7SA 3C2FA 4XKYB 3MHGA 2VFIA 3LCLA 2WQPA 4R34A 4S2CA 4M7TA 1O5KA 3FOKA 4LV4A 1SU5A 4ICNA 1ZAIA 2EKCA 5HR6A 3BG3A 3PY2A 4PCFA 1KM5A 1TPFA 1RQHA 3FKKA 4MOZA 3WK1A 3DFPA 1RPXA 4UNKA 1JCLA 3GX9A 3LDVA 1H1ZA 3U8GA 1WXJA 2YZRA 1QPNA 1A5CA 3BLIA 3C2OA 2NWSA 1XDLA 2QDGA 1KFJA 3NQFA 4AHPA 2EGZA 1DQXA 3LOTA 1I2NA 1SO4A 2R8WA 5AFDA 5LNUA 2WNZA 1TO3A 3DFNA 1R2SA 4RCXA 2R91A 5A8GA 1TPWA 1VCVA 2ZTJA 4DF0A 3NDOA 2RDWA 3LB0A 1KM4A 4LC8A 2VELA 3TSMA 1LOLA 4LV9A 4AWSA 3NNTA 4NU7A 3TQKA 3RLUA 3LTPA 5G2WA 1KLYA 5AB3A 1AW5A 3PB0A 1SW0A 3GXTA 1OX4B 4NJJA 1OFPA 2JKPA 2PRHA 4U4MA 3NAVA 3ABRA 4O4WA 3STCA 3LCGA 4I9AA 3T40A 1BTMA 4X3ZA 2VENA 1EA0A 2Y62A 5IBXA 4UTLA 2QCDA 2FPVA 1KTBA 2ZZ5A 4RK8A 4R33A 5DBTA 1BWLA 4OU1A 1OJXA 1NSJA 1OFQA 2P1FA 4GUFA 4NNAA 4CNOA 1TCDA 3W07A 4BWLA 2ATMA 3HG4A 3L5LA 3GZ3A 5CZTA 1QPOA 1WOAA 1X1OA 4OBTA 3C61A 3DH7A 3HIJA 3GLCA 5K9XA 1AW1A 3UPWA 2H8XA 4N2YA 3W7IA 4M6QA 2QF7A 3G1HA 3R8RA 4LVGA 1FWSA 1F76A 1SZNA 1VLIA 1H62A 5EKYA 1Q6QA 4HSOA 2C15A 3E12A 5K9CA 4UNLA 4WY0F 4JD4A 1JRCA 4ZZ9A 2HSAA 4UFMA 1OK6A 2UV8G 3W2KA 3G1XA 3QQ0A 1M7OA 5I3FA 1SR9A 3WJWA 3DHFA 1DHPA 3W7RA 1ADOA 4DEFA 3KX6A 3R2GA 1TTIA 4LVBA 3GVGA 1J2WA 5BNKA 1LOSA 3GDMA 4HN4A 1W3TA 2ZRXA 4XWUA 1EX5A 4PC8A 2VFGA 2TSYA 1MSSA 1PIIA 2X16A 2V9DA 2R14A 1P0NA 2CFFA 1TJRA 1A53A 4RZ5A 2A1YA 3IGXA 1K8ZA 3BPWA 4JDYA 2GQAA 4NZJA 1L9WA 3DHDA 4JTUA 4OWGA 4CQ9A 4LC6A 3BW4A 2E6FA 3SJ3A 5MHBA 4O10A 1QO5A 1YPFA 2E5BA 4PA8A 1TPDA 1F6KA 5DXXA 2CW6A 3W2MA 3TQ0A 3BW3A 2FTPA 4KFPA 2DP3A 2RH9A 2QJGA 1GG1A 3PWAA 4OV9A 1JQXA 2YCEA 1J5TA 2VFHA 4I7UA 2JKAA 3RNDA 3IIXA 1RQEA 3LTSA 3PG9A 4N02A 3NEVA 4MYAA 1DL3A 4BI5A 2V82A 4MZ1A 4YWIA 3C2VA 3QSTA 5U4NA 4EIVA 4ML9A 2NX1A 1GVRA 3IIVA 4N4QA 3PB2A 2ZZ1A 3VKJA 2OX1A 1GOXA 1PHWA 3INPA 5I3IA 3NQGA 2CWNA 4ZMGA 2A2IA 2E5DA 3L5MA 2E6YA 1K7EA 1BWKA 3DI0A 3A22A 3SY5A 3S5OA 3EXSA 2A6NA 2ATSA 5BMWA 2W6RA 4RLIA 4A21A 5G5IA 1KFKA 2E6AA 4NJIA 4FHAA 3TSDA 3DFSA 5LZLA 1OG0A 2WSYA 1GYNA 1Q6LA 1XBZA 1PCWA 5AHNA 1E51A 2Z6IA 2B7OA 4KWWA 2V30A 1FWRA 4DPPA 2NXIA 5CZJA 1OFRA 1ONRA 3QW4B 3SFKA 3HG3A 4ZQCA 3EXTA 3PBVA 4IX0A 2PRMA 4DO4A 4UTUA 4PTNA 1AL8A 2NUXA 2OT1A 3MP5A 2V2DA 2A21A 3LHTA 3PAJA 4N9CA 4UFHA 4MZYA 2ZRYA 3O1NA 4X22A 1EP2A 3GNDA 4PEKA 3TAOA 1THFD 3E0IA 3F4NA 3P61A 1JCNA 3KAOA 4Z1BA 3W2UA 3GDRA 3M6YA 1DV7A 5DXYA 5FF4A 1YTDA 4HNVA 2CLOA 4EWND 1SFJA 4XKYA 2B4GA 1LP6A 1VLWA 1TB3A 3HBLA 4DBEA 1KTNA 3PSVA 3NL3A 3MBFA 2W79A 3S1WA 3W1RA 1YDVA 3SR7A 1UBSA 5G2IA 4UUIA 3W87A 3G3DA 3TIMA 2Q8ZA 1ME7A 1XKYA 4BFAA 1U5JA 4DBDA 3W74A 4JDBA 3WJXA 4AVFA 3NPXA 3FYOA 3KRSA 3BV4A 3CPRA 4OGZA 1EIXA 4UFJA 1LLZA 2ALDA 5AHEA 3O6CA 3VI2A 3PBWA 3W9ZA 1FDZA 2Z2UA 1JRBA 3U6WA 4JTGA 3HGRA 4XBKA 1C29A 3W70A 2E1DA 1S5WA 3CHVA 2WNNA 1F2JA 3GAKA 1VCFA 4XUGA 4YXGA 2KZHA 1WX0A 3GR8A 1XBVA 4IQLA 1H61A 3GKFA 5KZDA 2B7NA 3TA6A 2QJHA 3KVKA 3W73A 3M5XA 5I3HA 1KM1A 5AOUA 1EUNA 3MUXA 4GUIA 1OX4A 1R30A 3EXRA 2ZZ2A 2FIQA 2WV8A 3OVRA 4X9SA 2YW4A 3S5YA 1W5QA 5F1VA 2WPBA 4H6KA 4Y8FA 3TJLA 3UY8A 4WY0A 3ZS4A 1WBHA 5LGXA 3BVJA 3G1AA 1R2TA 3DAQA 3EB2A 1MO0A 1VZWA 4QJ1A 1ML1A 4S1FA 3GXNA 3W2NA 2V5LA 1FBAA 4DO6A 3S5NA 5CG7A 4Y6GA 2EPHA 3GNNA 4LU0A 3LI0A 2FLIA 5D05A 5CPNA 2Y85A 3W76A 1IIGA 3N2XA 4RXFA 2HTMA 3PUEA 2C0AA 2VEIA 3NG3A 3LX9A 1XDMA 2H3DA 3P62A 1SO3A 4GJ1A 3LCWA 3B04A 1FUYA 2VFFA 3A5VA
chains in the Genus database with same CATH superfamily
5CZ0A 3O6AA 5BXRA 4JXCA 1KLZA 1WKFA 1BQGA 3TROA 1WDQA 4K7YA 2E68A 1E1CB 1ITXA 4N4PA 3VZZA 3U9IA 1PZ2A 4J3TA 3DFYA 1GW1A 1OYAA 3WD3A 3KE0A 1T8QA 4PB4A 4RX0A 2YGYA 1FDJA 4JTQA 4O0ZA 1FWWA 1XCXA 3UZZA 1UKQA 4XV0A 2XVGA 1R86A 4QRNA 4UTTA 3H2OA 4E4PA 2I5IA 3D0CA 2PGWA 3VD9A 2XVNA 5HK4A 2IKGA 1XIIA 1S2UA 2VZSA 5I79A 1H63A 4PMOA 4UIOA 4IGMA 5F4XA 1NARA 5C7VA 1FCQA 2GVJA 2D2OA 4BCEA 4TUFA 4QQ3A 2PDHA 4JTKA 4DY1A 2J24A 1RV8A 4ZB2A 1HG3A 3G24A 3EDKA 4GZIA 2QNEA 1GONA 2E8ZA 3PANA 3MS8A 1OG6A 4UFKA 4FIRA 1ZFJA 2BP1A 3P2VA 3CB8A 4JN7A 2YYUA 2X1IA 2X09A 1A47A 1E43A 3NZRA 3RIKA 1AD1A 4Z2GA 1G9HA 4GBUA 4B3LA 4AZHA 1WUFA 3RG6A 4WK9A 3WEOA 2PFHA 4IUOA 4AEEA 4EPBC 1ZPTA 4D6GA 1YYAA 1H51A 3T7VA 4Z1CA 2NXHA 1IEIA 4N6EA 1K6AA 3H53A 2JIEA 3OVGA 5D32A 5A3HA 3LA4A 1QAPA 5I07A 2O9RA 3EKLA 2PD5A 1JF6A 3VINA 2A5HA 4YCPA 4AXNA 2QKFA 4CD4A 3GXIA 5CLWA 3N3MA 3J7HA 1FH7A 2HNEA 3MUY1 1V03A 4I5RA 3ALGA 4QITA 4D1JA 3SUTA 1YTEA 3SECA 2JF6A 4A35A 1MEIA 2O9TA 2WWCA 3S3GA 1W56A 5EA9A 4DZIA 1XBYA 1UR4A 1ZL1A 1US2A 3TLQA 1TJ0A 4J1OA 3TN4A 1H7PA 5MF5A 3LQGA 4HHPA 2XHYA 2JF7A 2J88A 2GGJA 4JEQA 3VDHA 2FKPA 4BQ5A 1TPUA 4DF2A 5H8PA 4MWAA 1GOIA 1VPQA 3AIUA 2GGGA 2OODA 1EF2A 3NSXA 4RNJA 3KRUA 5HQLA 3M5ZA 4O52A 5AHLA 1DVJA 3Q2DA 5TQLA 2FPYA 4DJDC 1P1MA 5I24A 4HNOA 3T0TA 3LTYA 3T44A 1QATA 4MB3A 3Q67A 1JPIA 5A6SA 4W89A 1C7SA 5GNXA 2XH7A 4MJ4A 4KFOA 4AYSA 3BSHA 1RY8A 3LXBA 4MDOA 3HA1A 3K1GA 4ZOAA 2V67A 1E0TA 5C70A 4FOUA 4RPQA 1ZP3A 1YHTA 3ANUA 3KEHA 3DC0A 3UJSA 1OK4A 5EPDA 2PEVA 1R7AA 2V3DA 3IGHX 4EF9A 4LRSA 3E49A 1UP3A 5LHFA 4R88A 2V81A 1JCXA 5D4YA 1Q85A 2VFDA 5FF7A 2CLPA 3EWZA 2V8ZA 4DJDD 1W8GA 3AXIA 1M5WA 3LPOA 2J78A 2INZA 4GQBA 3BSMA 2VX6A 2PSNA 1UIOA 4Q7IA 4S39A 3M16A 3W82A 3VCRA 1KTCA 5FACA 3EWCA 5G2HA 3T2QA 1PKYA 3FFSA 2QEZA 3QY8A 3A13A 3DHPA 4H6EA 3E5PA 3HG2A 3QQ1A 5FSEC 2OEMA 3G0UA 3HV8A 4CD5A 1V77A 5FJRA 5C54A 3PSWA 3R5EA 2DSVA 4AD3A 4CNSA 4INFA 3PZVA 4FXRA 5DF0A 4BQ2A 1BTCA 3AWNA 3SADA 4ICCX 3HPSA 3HTWA 2X7VA 4KKXA 1HKMA 2BY3A 4UMAA 5A6BD 1IR2A 4WD0A 2AAMA 2PCQA 4N42A 2ISSA 3VOHA 2PBGA 1FWFC 1PVNA 1K7FA 1JULA 5JVLA 3OPSA 1K77A 3T05A 4L9XA 4S3BA 3NA8A 3IK2A 3VD4A 1XF0A 2VTFA 3G6MA 3STGA 4AYGA 2GJNA 2Q6ZA 1P1XA 3NL5A 2ZRVA 5DT7A 3ZOAA 1XC4A 3LRLA 3CAKA 3UXIA 3TTYA 3ZXWA 1I75A 3T4WA 1GQJA 3L67A 5J5RA 4GVFA 2E77A 1W3KA 3BAXA 1CXFA 4CU8A 2GQ8A 3POCA 4WXZA 2BS9A 2ZRUA 1PAMA 2ISWA 2WNQA 2DZPA 4XK2A 5D2XA 1YIXA 1AMKA 2ACQA 2XFRA 4N6FA 4C6NA 3GIYA 4YYFA 3GB6A 3UD6A 1EJ7L 1CB7B 1JUBA 3ZT6A 3FK4A 3OBEA 1PYMA 1ZHAA 3KTCA 4L9YA 3WUGA 4DIAA 3C0JA 1RALA 2Y6ZA 3CYVA 4HGXA 1E4IA 1V8EA 3PUOA 1LJYA 3EA3A 3FX4A 2PMQA 1Q7ZA 2O4MA 4Q4OA 1WUEA 8XIMA 2WMHA 4MAZA 4AIBA 4DI9A 5T9BG 5EMYA 3SUVA 3TLLA 4JKLA 5CJ5A 3W7QA 4H9ZA 1NOFA 2G50A 3VO0A 3EEZA 3V1PA 3W26A 2YA1A 4BHYA 2JIWA 1EDGA 4U2YA 1UR0A 4ERIA 2R94A 3CZLA 2CNCA 3Q45A 4WOQA 4M8UA 1OFAA 2XIOA 4FNQA 2X1RA 4UOZA 4U5KA 4D1IA 3A3WA 4H3DA 3VC6A 1XCFA 1WDPA 4MFEA 2PBOA 3P14A 3GNOA 1W91A 3I68A 3MI2A 4C5YA 3A47A 4M19A 4PUJA 1J0HA 2P10A 3R8HA 3JR2A 4BI6A 3L4XA 2P53A 5I23A 1O94A 2V2CA 3MZ2A 5D38A 3LQLA 3GR7A 3JRKA 1JVNA 1U22A 1K9FA 3T09A 3P93A 2FHBA 1WKYA 1L0PA 1NFGA 1UC5A 2PDYA 5LNSA 3H2NA 4W5ZA 3G8EA 3TONA 1ISYA 1X1ZA 3B8DA 3A9IA 4LS2A 3SGGA 4B5TA 4J40A 4MFDA 2YCLB 2NV2A 1YXCA 4JY9A 3WMBA 1LL4A 1G1YA 3KZSA 4ICMA 4RZ6A 1WZKA 5C8BB 2I17A 4UMBA 2IQTA 3VE7A 1VP5A 4HPJA 3SY1A 5HOSA 3LLFA 3MYOA 3UWWA 2PTWA 4I9TA 5FJIA 1R0MA 3R94A 1YKWA 3W7OA 4YLWA 1ZLPA 3DKLA 4DBSA 4ASTA 2CZVA 2IKHA 4FXJA 1Q6DA 3LRMA 1TREA 3NL2A 5D2TA 2FHFA 3WKZA 2YXXA 3ZLGA 1OFOA 3EOSA 1XC6A 1KFLA 2FMNA 3ZJKA 1X1NA 4HNUA 3AC0A 3HM7A 1K7XA 1P0DA 2PDUA 4I6KA 4YIWA 3N9KA 2J9YA 3JVAA 1YDNA 2F2HA 6REQB 1B1YA 1UW9A 2VD8A 3WLOA 3UR5A 3FVMA 1K8CA 1OSEA 1R3QA 1QW7A 4X2PA 3KCLA 4PGLA 2J77A 5I3GA 4W7WA 4MM1A 3WSUA 2QVHA 3DCPA 2ASHA 5ECVA 5M1TA 4GVGA 4HHLA 3VKAA 3UWYA 4JHMA 5HULA 3W22A 2YA2A 2J62A 1DIDA 3CUXA 1HO1A 3PS7A 1LUCB 2O9OA 2YFNA 4Y96A 4UTJA 2OKTA 4I8YA 4NKCA 5LIUX 4ZBCA 1KFBA 4LUTB 3LBCA 1IXNA 3VGEA 3V16A 1L6FA 4PMJA 4HOWA 1CLXA 3K46A 1K3UA 3GH5A 3GW3A 3RRXA 4EK7A 1K9TA 1O1HA 4C1LA 3TW6A 3CC1A 3VOJA 4J3UA 1SMDA 3GC2A 1KXTA 2ZXBA 4QAIA 3QJAA 5HWJA 3ATYA 1DJWA 1ITUA 2VGFA 2WZTA 4IGHA 3RPMA 2PDLA 5H2ZA 1KKRA 1DXIA 4MUZA 1V6VA 3ZZ1A 1FKXA 4IWWA 1IEQA 3H4WA 3NQVA 3QPZA 4NZCA 4QDMA 1VJSA 4UC5A 4CEXC 1FFRA 1KCZA 1ISVA 1B54A 3LMYA 3TYDA 1RBAA 2WC4A 1ICSA 4CU7A 1TIMA 2P0IA 3G1YA 2IXVA 1F3XA 2QUUA 3GU2A 3CHEA 3ITVA 3CGTA 4GNVA 4GQRA 1QPQA 2Z27A 1LG2A 3WELA 1BVZA 4UMCA 5HATA 1A5BA 3PUGA 2BZNA 3LHVA 4KEUA 3HO8A 1UPMB 1KV8A 2J9ZA 5CC7A 1QDSA 5BOFA 1IT0A 4AY1A 3UWEA 1M7PA 2EG7A 1TQJA 1ZAJA 4FF7A 1TUXA 2C13A 1VFFA 4PTDA 1M6JA 4MWAD 1PV8A 3GE7A 1XRTA 3DZ1A 2Q3OA 2XINA 2WC3A 1KXHA 3AQUA 3AISA 2Z7KA 4AZIA 4BEUA 4GG9A 4BA0A 2P76A 3QHNA 2WBGA 3O0FA 1UKPA 1NU5A 2EG8A 2O55A 3QM3A 3BJFA 3ZT7A 4KBXA 3V1HA 2WHJA 4C6BA 2F6UA 4Q4KA 1JG9A 2ZCGA 3VNYA 1JCTA 2DW7A 3AICA 4X0NA 2OJPA 3AU6A 3PVFA 3RJXA 2X0HA 4BF9A 4KMQA 3VNDA 5CLTA 1MQQA 5HWNA 1VQTA 4AEFA 2DZVA 1EQPA 3GU9A 1RPKA 2AKMA 3NYZA 2DZTA 2OZ0A 5SWUA 4GJJA 2PDMA 1FHLA 3ANVA 3BAKA 4OKDA 2DW6A 3LERA 3N2CA 4EF8A 2HVOA 2OZ3A 1XGDA 4HK7A 2HK0A 1EO5A 3NVDA 4REQB 4JTDA 3K2GA 5EY5A 4AIUA 4DNMA 1FQ0A 2OWWA 4YNGA 1ME8A 2ZRWA 3M7WA 2ZX5A 4XZ9A 1NM9A 1IF2A 4P7RA 3MKCA 4KPLA 4F2BA 1BSIA 3QKZA 1EJUC 4LEQA 3UXAA 3VTRA 4JQ3A 3HF3A 1LBLA 3EOLA 3VGDA 4HNCA 3W81A 3CPUA 3WQ5A 3SGUA 3AFBA 3SCTA 4Z42C 1Y7VA 1XD1A 4AC1X 2AGKA 3H55A 3M0JA 3SRDA 3K30A 2NUYA 2YXOA 6REQA 1XL9A 3BLEA 3AS3A 5HINA 4TU1A 3K8MA 3KHJA 1POJA 4IMGA 1QI5A 3W02A 1PL9A 4ZXOA 3RM9A 1YBQB 3LCHA 4H6RA 3HJEA 3QKEA 3W0KA 2QDEA 3S1UA 2Z1SA 1S39A 2ZZ6A 3QN3A 1CENA 4L1WA 2ZUNA 1Q3NA 2J8GA 1A5NC 2VX7A 5FJOA 2XGBA 4A3QA 3VUSA 1ZJIA 3FJLA 2QCFA 3V5FA 3RILA 3THCA 1ZGDA 1LQ0A 3FJ4A 2X41A 1C3FA 4P8UA 1CGWA 1KGUA 2HMCA 4B90A 4F9JA 1ZCCA 1XCWA 4PH6A 1HKJA 4KW2A 4JYDA 1PKMA 1B90A 4W7VA 1DWJM 1P6BA 3IRDA 4V1XA 4YTRA 4IG2A 1X98A 7CGTA 3EWYA 1XYBA 1ZJAA 3GVRA 2FQIA 4CEUC 3Q37A 1S1PA 3CHFA 4C91A 4FLRA 3ID7A 1IXPA 1BWVA 4E8DA 2WQDA 2QAPA 5LSMA 4XZWA 1Z42A 1GOQA 3TUUA 4O57A 4O18A 1SSDA 3WBEA 3PPHA 4HU4A 1PTGA 1JDAA 4RXGA 1W3JA 1SJCA 5GNYA 3AIRA 4NT0A 3NCOA 3TTQA 2PDJA 3DGRA 3I6EA 3U0HA 2GOKA 3R58A 1JZ4A 4C65A 3TC3A 1EJWC 4ORMA 2G97A 3K8LA 1VKFA 2XGZA 3AI0A 3PG8A 2H90A 3PBYA 2OKOA 1G4PA 6A3HA 3GBDA 4EAYA 2GK1A 3HQOA 2VEKA 5LIKX 4GX9A 3TE9A 3W83A 2Y8UA 1CCWB 1JD7A 3AOFA 4W8LA 4Z0SA 4LRTA 2WANA 4A05A 1LTDA 4JTIA 3TYEA 3NZQA 3EPMA 4HTBA 4DZ5A 1H3GA 3M0HA 1ISWA 1YADA 2FH8A 1OIMA 3WD1A 3GK0A 1W8SA 4EOUA 2PRLA 3W2LA 3TWBA 1K8YA 2RUSA 4X60A 1IT7A 4DXXA 3OIHA 3NGJA 3R0UA 2I5GA 2VC5A 2JQXA 3SUWA 2WSQA 1WDRA 3WMCA 3VDAA 3C6CA 4CKQA 1E56A 3AIWA 1RCOB 1W9PA 1TMQA 2VR4A 1EJXC 3APTA 1P7TA 4KESA 1UOZA 2BOEX 3IAPA 1UR2A 1E5NA 3GNPA 3WEMA 1W31A 3QR3A 3EWXA 1LOQA 4WX2A 4FNRA 3CAVA 4XQ6A 3NOEA 1NF0A 1ZENA 1BKHA 1R3SA 3GXFA 1TX2A 2PGFA 1LBFA 1RZMA 2D20A 3QSRA 5CC5A 3PHAA 1W54A 2R1MA 1A5SA 3TNBA 4REQA 4PCNA 4QE4A 5HNRA 2QJJA 2XVPA 4GYKA 4FIQA 4YCOA 3O15A 1W5MA 1HKIA 3PBUA 2C1GA 3BOXA 4E8GA 1A49A 5DY2A 4C6FA 5I0DA 4W4QA 1WV2A 2FMOA 2YL8A 1E6QM 2VWSA 1HX0A 5AHFA 3UZJA 1KBLA 1B31A 3Q94A 3UCDA 7REQB 3KW3A 3IJ9A 1F07A 3NXLA 1WB0A 3ZWTA 3T9PA 3OODA 3BSGA 3I3DA 3VGFA 4XAZA 4F2UA 3QEZA 1PTDA 2NUWA 2BBFA 1XRSA 3SSZA 1GQIA 1YBQA 8RUCA 3EX3A 4DXVA 2GJLA 3D46A 4QROA 3S1XA 3LM3A 4FPSA 3M4HA 3MWCA 2C14A 4OVXA 3UJRA 3F2DA 4DRSA 1VF8A 4TVCA 1H1NA 4MY1A 1W32A 3NQ2A 4L9ZA 3W75A 4LUIA 1PIGA 3FCPA 3PUDA 3WBAA 3GSMA 2A3EA 2PLMA 4DUWA 3EGJA 1NEYA 3TK7A 4X63A 1DIOA 3TMQA 3M9YA 2QCGA 3GUWA 1ADDA 1KA9F 2PP0A 2ZXAA 1X6NA 1K70A 3CWOX 3VOCA 3CWHA 4Z08A 1B3VA 1RA0A 4KETA 1EYWA 1XLAA 2IPGA 3WQEA 3C0SA 3NYDA 2VEMA 4PUKA 4BJHA 1I2OA 1R9ZA 4Q4QA 1QUMA 3CLWA 1S2VA 2OLHA 3H8AA 1IYXA 2P50A 3VKDA 5I09A 3DC8A 5FF3A 2EEXA 3R10A 1WDDA 4RNIA 3O8AA 4HOZA 2W5FA 3BOLA 1XLIA 5BRQA 2VUYA 4ROPA 4CGTA 1SZRA 3W7NA 1JXKA 4OTKA 3WK2A 3RX4A 5KINA 1OF8A 4M7SA 2AQVA 3M07A 1UJQA 1HZYA 2WQPA 4R34A 3UVIA 3WY1A 4ICNA 1ZAIA 1CXLA 4B5UA 3IACA 1KM5A 1TPFA 3BAJA 4XD5A 3DESA 3PTMA 1ONXA 4L1GA 1Q4NX 1XH0A 3E2RA 5FCZA 3C2OA 2NWSA 1XDLA 3EMQA 1EHNA 1EKOA 1E9IA 3GG7A 2WMJA 1TO3A 4N7QA 1R2SA 3FDGA 4RCXA 2R91A 4C90A 1IWBA 1TPWA 4TTGA 1CECA 2OQLA 5FAGA 3LSBA 3NDOA 4YHGA 4DI8A 3QTPA 3CHCA 3TSMA 4HZMA 1VRXA 1KXVA 1QBAA 4NU7A 4TX8A 2BNJA 3LTPA 4X0VA 1KLYA 3PB0A 3KZPA 3RX2A 3MMWA 2JKPA 1HJUA 4U4MA 4KWOA 4O4WA 1BTMA 4X3ZA 1HXJA 3BDKA 4CD8A 2QQ6A 5IBXA 3E38A 3N13A 1YMYA 1PWMA 2FPVA 4LXFA 4DM2A 4E2VA 4CNOA 1QK2A 1TCDA 2ATMA 3HG4A 3GZ3A 1Q5MA 1QPOA 2CC0A 1WOAA 4OBTA 4GY0A 5E5CA 1XKJA 3HIJA 3GLCA 5EBAA 4V2XA 4ZE5A 2UWFA 4Q8PA 1ADSA 3W25A 3K8KA 4G7EB 3GR4A 3AWOA 5K9CA 2X7WA 1JZ6A 3O2LA 4JD4A 4ZZ9A 3PWGA 1KGWA 3WJWA 4JIRA 1RK6A 2JEQA 4PUDA 4H8HA 4DEFA 3R2GA 4LVBA 2WBKA 3EDEA 1LOSA 2OTDA 2DV0A 2TSYA 1DQUA 3MCOA 2X16A 3OOQA 2E9BA 1LT8A 2GYIA 5BXTA 1V6XA 3BGAA 4RZ5A 4DJFA 2NLYA 3WG6A 2HXUA 1KRCC 3VDCA 1PX4A 4IISA 4HD5A 1TE6A 2D2JA 4WSKA 1XYLA 4NZJA 4JTUA 1J0ZA 2VZVA 3GNRA 2DUZA 3VC5A 4PA8A 2MUCA 2WW5A 3BICA 3URBA 4R85A 1NTHA 2FTPA 4KFPA 3UETA 2QPXA 1J5TA 2JKAA 5FOOA 5HPOA 1E0UA 5CGMA 5I77A 1CGXA 1W1TA 3WQ4A 1JZ2A 4YWIA 1QNPA 1R3VA 3ZQ9A 1JDEA 4BF5A 2VWTA 4G5DA 3VIOA 1WAWA 4O1EA 2YB4A 3RM8A 1GOXA 3INPA 3NQGA 4EAMA 2HE8A 4YN5A 3L5MA 3T08A 4IQJA 3UP8A 3ORWA 4YTTA 3QV7A 1OWQA 1UWAA 4RLIA 4L4OA 4R3UA 2DSUA 5ABGA 3WLSA 4PMQA 1S3TC 1XBZA 2V3GA 1E51A 2FHCA 4GHRA 4DJEA 2CERA 1ONRA 3SFKA 2UY3A 4ZQCA 3OLEA 2VZTA 1MUMA 4A6GA 3D3AA 1AZ2A 1YDYA 2CBUA 4PTNA 1AL8A 2NUXA 2W67A 4JQ2A 3BLLA 4KGJA 2X42A 3P61A 3E0IA 3F4NA 5GPRA 4HSHA 4GI8A 4WGHA 3KAOA 4Z1BA 1EX1A 4HJFA 3M6YA 1XX1A 1J12A 5CBIA 4PEEA 3TZFA 4Q6XA 2VZUA 4EWND 4RUBA 1FVPA 4CQDA 3N12A 1SFJA 2B4GA 2PF8A 1HP5A 4DBEA 3P6LA 3NL3A 1M1BA 2QIIA 4OUEA 3MBFA 3S1WA 1NELA 4EXAA 2PWEA 3SR7A 5G2IA 4UUIA 4B2DA 2Q8ZA 1DXEA 4AD5A 4DWSA 4DBDA 2VGIA 3W74A 3F5LA 4B91A 3UVAA 1HIZA 1XGZA 1EZWA 3CPRA 3KBMA 1EIXA 2WK2A 1JD9A 1KRMA 1HKVA 3VI2A 3F4CA 3W9ZA 1FDZA 1JRBA 1Q13A 2XDFA 3W70A 3AUOA 1S5WA 3CHVA 1EXPA 4CCZA 2KZHA 3GR8A 3FGCB 3VGBA 1FWCC 3ZVIA 2VRJA 2YL9A 2HZGA 1DJHA 4D6CA 2SFPA 5I3HA 2DGAA 2VDIA 3MUXA 1R30A 3EXRA 3WQPA 3PZUA 4X9SA 2YW4A 3S5YA 2HEJA 4Y8FA 2VM8A 2WMKA 4WY0A 1WBHA 4HCLA 1TZ9A 5AECA 1KRBC 4HBKA 4DAFA 1R2TA 4NHVA 4YS1A 4QJ1A 1ML1A 4S1FA 3GXNA 3W2NA 2PU1A 4P5UA 1TVPA 2PAJA 1CXHA 2HCVA 5CPQA 4RV3A 2FLIA 5CPNA 2Y85A 3PUEA 4AY8A 3LN3A 2D2HA 3MZNA 3P62A 4LYQA 2ICSA 1XICA 4JEJA 3VIPA 3QFWA 4DNHA 3OG2A 3W86A 5AYXA 5FF2A 1GVIA 4JNZA 3GH7A 1UR9A 1O60A 1XLDA 1ZBCA 3P82A 3GFZA 3BZGA 3MP3A 4M82A 3L4ZA 2C19A 2RKXA 4J27A 1Q7MA 3DUGA 3ELFA 3G0XA 3A4WA 5D8WA 1VYSX 3S1GA 3ITCA 4JTAA 1E6NA 4NZ5A 3O07A 2Y4SA 1QI4A 1FCVA 4R53A 2DT0A 3SZ8A 2WSPA 3IUIA 4AMCA 1FP8A 2GJXB 1S5VA 4ENLA 4M29A 1TMHA 2C7FA 3IV3A 5EMUA 1O5XA 3IJ6A 2QJNA 3TSBA 4JIQA 4Q8WA 2NQZA 4NXKA 4O1AA 3VMNA 1EUAA 1QI2A 3SRFA 4H4IA 3CZEA 2WVUA 2UY5A 2Y61A 4YHEA 1Z7AA 3LXAA 1UH3A 4LS0A 1B9BA 4MNLA 3L7RA 3NQ8A 3STPA 3W3OA 5HMSA 1C9DA 3QOMA 4US5D 1ZALA 4F0KA 3F1QA 1FRBA 3PWIA 2PWFA 4E2DA 3RM4A 4O14A 3IVSA 3MTWA 3W1MA 1G4EA 5DBUA 2WSKA 3CZJA 5ABTA 1A5OC 3IUDA 1WO2A 2XN0A 4XISA 4U31A 4UQCA 4IGNA 3G3MA 3AS2A 1FX6A 4P2VA 5LYRA 3A23A 4MWAE 3TN3A 3ZJ8A 4UQBA 3AO0A 4GE8A 3W1TA 1ECQA 2YL6A 4RW5A 2NVCA 4FSAA 2QIWA 2QCHA 3VD5A 3GFXA 3CK5A 4JGDA 1RY0A 3PJWA 3S6TA 2X0SA 3EEGA 5MKGB 3ITXA 3L23A 2Y1HA 1W37A 1UD4A 3T2PA 2O9PA 3W1PA 2IPWA 3NQDA 1F8IA 1O68A 1IWAA 4UTFA 4UZUA 1TYGA 1OZQA 3C86A 5A6AA 5AHMA 3DFHA 3OTRA 3AYRA 2E5CA 3NO5A 4GO9A 5A8OA 4UTMA 3A3XA 4HIBA 3EB4A 3NEHA 4IMCA 5D37A 3W72A 2BLEA 3VNIA 2EF9A 4V15A 1WZLA 1GVFA 2WKLA 3NZ1A 3QY6A 3SIMA 5KMYA 3MQTA 3OB8A 4WHBA 1VPXA 2DZXA 3W7CA 1XSKA 5F1UA 4GFIA 4CQCA 2ZZ7A 3IWPA 4JTSA 1F4AA 2ZC1A 4C6PA 5CBJA 4FNTA 1Q65A 1YW1A 4MB5A 5CPOA 2DQWA 1HGYA 4F3HA 4TMCA 4LUJA 3MANA 3LCXA 2E40A 1AQMA 3P5ZA 4ZSUA 1XSJA 4IXHA 2QGYA 1EC8A 3EB3A 3U3HA 4RDYA 4WOZA 4UCGA 2IKJA 5AYZA 1QU4A 3FEMA 3W37A 3USBA 1CI1A 5LXEA 1DQWA 4KWVA 5C71A 4PUWA 4FK9A 3PBGA 2EPLX 1JL8A 4LJ3A 3N25A 3CJPA 2C16A 2DIKA 4JY8A 3BXWA 2YL5A 4MYXA 4MY8A 4H7CA 3TYAA 2H8ZA 2WVVB 3M64A 2AQOA 4TIMA 4UZSA 2HWGA 5F4SA 5G4WA 3BAIA 3EBVA 3C8FA 5LA1A 3LHYA 1TRIA 1SQ7A 4C1NB 3CXOA 4LBUA 4ZB0A 4D6EA 3MBDA 4QEEA 1K4GA 2ZZ4A 2HISA 3B9AA 1VHNA 3EWWA 5JIWA 2GDVA 3PJTA 1FH8A 1GQNA 3EAUA 1MWOA 4UFLA 4JL1A 3KCOA 2JKEA 4FXSA 3CV2A 1Y0EA 5HJXA 2ZUMA 2Z26A 2YW3A 2PDBA 2WMIB 1PEZA 4JPGA 4UOJA 1RR2A 3ALFA 3EMZA 4UTKA 2CHRA 4NX0A 5D2YA 5C9RA 3FVDA 1XG3A 1Z8AA 1F9CA 2HBVA 2TYSA 3MUCA 1Z41A 3H6OA 4LAKA 3ABXA 3H4GA 2CZEA 2W4XA 3K13A 1J8VA 1FWEC 2VI0A 4LVDA 1XS2A 5K7JA 1VH7A 4LQ1A 3RK8A 5BMXA 4MVAA 3RJYA 3KL5A 3MSRA 3QR1A 5U7SA 1TR1A 3S5SA 3UG4A 4F48A 2O56A 1ZY9A 1U1HA 1E73M 4OV4A 4A22A 2WPGA 5C9XA 1LRQA 1Q7QA 1EGVA 1F5ZA 1GVEA 5CSSA 5BXSA 1I0DA 4O12A 4PL1A 4IXXA 4DX3A 1W1YA 4Q8NA 4QSHA 1B4EA 1AJZA 2ZADA 4RE4A 3QMRA 2B0MA 3M5YA 4NXSA 3GG8A 3QGKC 4XTIA 4LCRA 2G5WA 4JICA 4A8NA 3PZTA 2D73A 2VCBA 1W3IA 3C56A 3VVGA 3EKZA 3BCFA 4S3KA 4WDWA 4CCDA 1QNQA 3KLLA 4GI6A 3CUZA 5K2ZA 4LALA 2QCLA 2XH0A 3GY1A 3EX6A 4CN1A 4QE1A 1OYBA 4UTWC 3N11A 3DN5A 1IV8A 3G8RA 2PI6A 3KP0A 1XJBA 3KBNA 1XM3A 4U28A 1A0CA 4IFOA 1M3UA 1C9WA 3DG6A 4DWSC 3VMOA 3MJMA 1L6WA 2E9LA 3L65A 4JX5A 4NUWA 3B9DA 4NI8A 3PZGA 3HPZA 2OQYA 5A8PA 2C79A 4KERA 3CLMA 3NQMA 2O4QA 2GVYA 3W28A 3RU6A 3HV9A 3N9RA 1SJDA 3IEBA 1KFCA 4TVUA 3JUGA 4QXIA 2FZDA 2ZX9A 1TIWA 3COTA 3KOXA 2ZA3A 1P43A 3LS9A 2BDQA 2PWVA 5G1MA 3KHDA 1UZDA 1UKSA 4QIUA 3SO7A 1WDSA 2BXYA 4B2DD 4G1KA 3FAWA 3B8TA 4DWSD 1CW2A 3SUUA 5B7ZA 1FY6A 2MNRA 2POZA 4FLOA 4FX7A 4ZOEA 4QG9A 4PZVA 1BRLA 1L2UA 1JCJA 4EPDC 4PL2A 1VS1A 1PUDA 4V28A 5XIMA 3CT7A 4IQDA 5D2WA 5CGTA 1ISXA 1I60A 4XBSA 4Y9PA 4E4UA 4HU8A 1VJIA 1JUEA 2C18A 2JGYA 4RKAA 1MRAA 2Y7FA 3L21A 3ZVHB 1DYSA 3DKJA 4HT3A 1V93A 3LCIA 3OVQA 3QQWA 2Z2AA 4GRSA 1KBJA 4F2TA 2ZIDA 3B97A 5I7GA 4S3EA 3OBKA 1JZ7A 1B57A 1D7FA 3CUHA 6ENLA 5JBEA 2PTDA 4PMYA 4FALA 4MKSA 4FOJA 3OA5A 2HJPA 1TPVA 2B31A 2FJKA 1A0EA 3SJNA 1XP3A 4NQ1A 5HQEA 4C7DA 4FNSA 2CEQA 1C8QA 1SFTA 2J7GA 4OECA 3ERPA 2HNHA 1PX3A 3WQDA 3G77A 4LW7A 2XFFA 4ZODA 3T0AA 3TOPA 3DBPA 4OIFA 2CLEA 4GQQA 4L6DA 4HVXA 1J01A 3LV5A 5AYYA 4O15A 2Z7GA 3SSJA 3LLXA 2VQTA 1SW3A 2A79A 4ZO9A 4O11A 3LSCA 5A1AA 2Z6JA 1R3RA 4AISA 2WMIA 1BGGA 3DX5A 4A3RA 3LUTA 1I4NA 1TWZA 5LNWA 3PZOA 4ZFCA 4CCEA 2DZUA 2J9XA 2Z1WA 2YLAA 4GFSA 2DU2A 3MO7A 4K8HA 3WL1A 3V4BA 2YR1A 1F7BA 2YBVA 2DVXA 2GQ9A 3CQ0A 4LNYA 3M0ZA 3MPGA 1Q6OA 3KDNA 3SCUA 1WYIA 3P3BA 2ZA1A 2VEPA 3FLUA 4MLRA 2A6LA 4ATWA 4MG4A 4WXYA 4K68A 3SFWA 2CU0A 1GJPA 4AWTA 2YLLA 3VIFA 1N2VA 4UR7A 4QBXA 2GJRA 2RHGA 1PBGA 2XH2A 1H49A 1V5XA 1IXOA 3GIPA 3W7PA 4LY8A 2BXZA 5EMMA 4I5XA 2VOTA 1RD5A 4IFKB 4IF2A 1W17A 4LX4A 2GVLA 4Q32A 1ELSA 3LZ3A 3MV11 2OSYA 4CNTA 5K9DA 3GYCA 1TELA 4WQ6A 5CGQA 3L0NA 1EP1A 3BQ5A 1JYXA 3ZFHA 4PODA 3UCCA 3SCOA 3WQWA 4ZQMA 4E38A 3VILA 1TTJA 1E4LA 1H7WA 1MI3A 1N8FA 3OLDA 1AQ0A 3KFTA 4O0QA 3KVJA 1YQ2A 1E9ZB 1C7TA 3W01A 1A5AA 1UR3M 2DFAA 1KKOA 4WGXA 3W1AA 2OWCA 3W88A 1TTPA 3HGJA 5CH9A 3D3FA 3Q4DA 1DXFA 4QJ4B 2PWHA 5E6YA 2NVDA 4DYEA 1YNYA 3S6OA 2J7EA 3CQJA 4QX4A 2C8NA 2X1SA 3T78A 2VX5A 3EKGA 3KL0A 5ABFB 1VFSA 3KOFA 2I5QA 1EPXA 3ITGA 1CDGA 4HK6A 2IQDA 4Z2HA 4HYWA 2BSLA 3QMTA 1MNZA 2EAWA 3FEQA 2Q8XA 5HR7A 4I7VA 3L4UA 4GISA 2WVSA 3T0DA 1BSLA 4I3GA 3UJ2A 4J9JA 2QXWA 2EKGA 3O16A 2Y5JA 2TAAA 4L6OA 2HROA 4WDXA 4D9PA 1SZEA 3SW6A 4LB3A 4HMCA 5BROA 3AROA 1RP9A 4JFWA 4HMDA 1I8JA 4PTWA 3MMTA 3MMDA 1CEOA 3P0XA 1H1YA 3N1AA 3QHMA 3NQAA 4FR6A 3GTXA 3DHUA 3IVTA 3HPAA 1GZ1A 2XISA 1JXJA 3EPOA 2EXOA 4GACA 4WR3A 4GVIA 4L4MA 3G18A 3W7LA 5L9FA 3VIJA 1O6IA 2QCMA 3WD4A 2Y5SA 1DJIA 1MFVA 1PE1A 4KIEA 3KUMA 4OHQA 3CM4A 5AZ0A 4DJDA 4I8DA 4U5IA 4LYPA 2Y89A 4GIEA 1CPUA 4IMEA 3V75A 1W5OA 1FWGC 1FXQA 3AXMA 4Z1AA 4YTQA 4A8IA 2PDGA 1E3ZA 2QCNA 3QFEA 5CC3A 1A5UA 3CL7A 1JPKA 3PTDA 3FXYA 1WXZA 3CQKA 1XYAA 1WP6A 3L0GA 2Y7EA 1JEZA 4V1YA 3VE9A 4YVXA 3M0VA 3ZIZA 3H2MA 3GNXA 4TX9A 4IIHA 2HXTA 5DT5A 1CXEA 1OYCA 3THUA 5IRPA 4DUXA 4H01A 4NRSA 3W27A 4LANA 1Z9AA 4PTXA 3TV8A 1VIWA 3UNDA 1FWNA 1HO4A 4EVZA 3W1LA 2YB1A 1REQA 4D6HA 5A6BA 2V3FA 4FS9A 3WF1A 4QSFA 3NZGA 2BOFX 3WK3A 1VEMA 4XSMA 1EFZA 3R6IA 1CWYA 3R0DA 4IX2A 1W3LA 2DH2A 3B9OA 1SW7A 3QZEA 2GOUA 3CASA 2BXVA 3AUJA 4OOUA 3FXGA 4H9VA 3T81A 5H1WA 4CVUA 5DLCA 3WF2A 1QO2A 4S3CA 4QS6A 5FEXA 1EB3A 3MUZ1 4H7VA 1N8WA 3MV01 2ZUUA 3WNKA 1ICPA 4NSBA 4LCSA 3VNJA 1TG7A 2PLCA 1XYCA 3U57A 4GI4A 4NJKA 1EJRC 3LYEA 3IJ8A 1CLKA 2F2KA 3KL3A 2WJEA 1JF5A 3ME3A 3GTHA 4FX8A 1NDWA 2QHAA 3TP4A 3L4TA 4IPLA 4JNYA 4S2BA 3WLPA 4AD0A 4K8EA 4A8RA 2QMKA 2PWDA 5CPTA 1QJWA 4GZEA 3JS3A 3B8VA 3OEXA 3E0WA 2NQJA 4IFKA 2OR2A 4RE2A 4IZGA 4OQVA 5EL1A 1XPYA 2Q3RA 5M03A 3N9SA 4CUCA 1CXKA 4QLLA 3FN9A 5AHIA 3ARRA 4XO6A 1QHPA 1DTNA 4HU3A 3A6OA 1KM6A 1UB3A 4POCA 1W1B1 1GT8A 5E1QA 1VYRA 2QV4A 1Y65A 3IK4A 1UUOA 3NDZA 3RF9A 4JTTA 3IIZA 5J8LA 1TWIA 2CLMA 2AQWA 2HPMA 3I7SA 5E9XA 4XZHA 1ONEA 1WKEA 5AKQA 2TPSA 5FESA 2WCAA 1CXIA 5HQMA 3LHWA 4N0RA 1U83A 6ALDA 4OJYA 3L4WA 4XZIA 2DZBA 1RJQA 4XAFA 1BG4A 2ZWYA 1EQCA 2F6KA 5ABFA 3WLNA 1WE5A 1IQ8A 1JI1A 4FA3A 1V02E 3ZR6A 2XVLA 6TAAA 2B81A 4I6VA 4MWAB 1GPWA 2QDDA 4P8WA 1IIHA 4H9UA 3APGA 3MY9A 9XIAA 4HNTA 4PFMA 2NT0A 3KOWA 3WDHA 1LT7A 4LUYA 4MNJA 2J8TA 2CLIA 2CWXA 4WCJA 4JZ5A 4H1ZA 2Y63A 4WRHA 2P8BA 1XLHA 2VOMA 4C1KA 2ISVA 1HJXA 3U5UA 4ALDA 3MWAA 3B9EA 4QDPA 1Q2RA 3ARXA 1G67A 4Z0JA 1JGMA 4W5UA 4M6UA 1MDRA 1GVSA 2BGNE 3BW2A 1S46A 3G1SA 3H7VA 2W3ZA 3E0VA 1J9YA 3TQVA 1OM0A 3B05A 4OE7A 4M6PA 4GABA 2Z1BA 3DFQA 4IJRA 4D71A 2VVSA 1ZBKA 2YOCA 2QT3A 4C6JA 4L4LA 1SZGA 1WNOA 4WJEA 3V7PA 2Y7GA 4BK9A 1FCUA 1W2PA 4IM4A 3LCFA 3ZWSA 1VHCA 1L6YA 4W8BA 1BKSA 2CHOA 1CTNA 4GYPC 4F8XA 3AYTA 4JX4A 3VOGA 1ZAHA 3N2TA 3LBOA 4WSHA 2HS8A 4JQ4A 3A24A 3K5XA 2QCEA 2NV9A 5G1YA 1GYMA 3TKFA 1HTIA 1PHQA 3MSYA 3N6QA 4AU0A 4BF7A 4AFYA 1GYLA 4BS0A 5DQPA 4TOQA 4MKNA 4UQAA 5KSWA 3WDJA 2ZDRA 1Y5XA 4GGBA 4XZMX 1QWKA 4N9DA 4ZO8A 1WDWA 4GXMA 4ADSA 3FJNA 3EDDA 4HCHA 4FNUA 3WFLA 3AS0A 2XZ7A 3G1DA 6TIMA 1A5LC 2O7SA 3T07A 1OB0A 4KCTA 2Z2BA 3N14A 2BVWA 1N7KA 3I7QA 4A29A 5TD4A 2H9AA 2FB3A 3NL6A 3O6DA 3BWWA 4Q4SA 5FL0A 4M5PA 3UGVA 1HJSA 3PZMA 3M1ZA 4GLEA 1TPEA 3M0IA 4Q8OA 4J7RA 2PS2A 3KTXA 1RXOB 3AJXA 1EBHA 1UA7A 2C71A 4L1XA 1YXDA 4S3AA 4AWEA 5I6SA 1HFBA 3CV1A 1T7LA 1EJVC 4S3DA 3WLRA 3W6YA 3KRBA 4GI9A 3TAKA 5DY3A 3VKCA 1BEUA 1C92A 3LBMA 1YNPA 1LL7A 5K4ZA 3MT1A 3NVTA 3T4CA 1X39A 5JIPA 5EMKA 4NZFA 3VK5A 5REQB 2A4AA 4BQ4A 1FHUA 3ENLA 1XYZA 1LWJA 5HMDA 5AYIA 5EMLA 3P81A 1JIBA 3WLTA 3M47A 4KGLA 1D3GA 4LY4A 3IIOA 4JR5A 3S42A 3ISIX 3ZR5A 6XIAA 1W2VA 1OFDA 1JZ3A 2J7HA 3A4XA 3HQNA 3UEQA 1Z3NA 3RPTA 4AB4A 1HL2A 3RCMA 2ZE0A 4JHOA 2PGEA 1TPC1 1OC5A 1GHRA 1QOXA 3O0KA 2QUMA 1SFSA 2WZHA 1GTHA 3EDJA 3CO4A 2CBVA 3C2FA 1L2QA 4DUOA 5JU6A 2W92A 4F9DA 4QQUA 2INFA 1NWUA 1O5KA 4L61A 3DYOA 2BB0A 4QG6A 4PCFA 1XDJA 3ECQA 3DFPA 4F0SA 1Z69A 5HNTA 3ARTA 3T0BA 2DIJA 2Y8KA 1JDFA 1DQXA 3NOYA 3LOTA 5I06A 1I2NA 4WLCA 4TTUA 3N6HA 2ZTJA 3MKVA 1G5AA 4DF0A 5A2BA 3VMPA 3LB0A 2VELA 4H9TA 1LOLA 4PRWA 3WLIA 4AWSA 3GHUA 3NNTA 3URAA 3E2VA 3RLUA 2WCGA 2XIQA 1KC7A 2XWEA 1AW5A 4MF4A 4WSJA 3GXTA 3ZM8A 4NJJA 2G37A 1OFPA 3QZAA 5M2FX 1NP0A 3IV8A 3VUPA 3ABRA 1BXNA 3STCA 3LCGA 5E9AA 2VENA 4Y9MA 3H2FA 2WVTA 1KBBA 1JPDX 1YRRA 2J75A 4Z2KA 2Y62A 2CXEA 1QTWA 1S2CA 2DY3A 4RK8A 4KIRA 4R33A 4Z2IA 2VYOA 1GJUA 3W6LA 3WUBA 2WLZA 4BWLA 2ANUA 3UNTA 1H41A 5CZTA 3UU0A 3P0WA 3LNMA 3C61A 3D47A 1E15A 3LPPA 1EGZA 3R8RA 1ECEA 1XLJA 5EKYA 3E12A 5EU9A 1BF6A 1VPYA 5JXQA 4NZ4A 4KH2A 1CBGA 4LYKA 3DHFA 1ADOA 3SQMA 3KX6A 1TTIA 4LNCA 3GVGA 5BNKA 4UOQA 1XIBA 4EACA 5IOBA 3GDMA 1W3TA 2ZRXA 1EDTA 3CZGA 2VFGA 2VGGA 3E1F1 1MSSA 4GZJA 4RPPA 2ZXDA 2V9DA 2R14A 4ZSTA 1KXQA 1TJRA 5C9UA 4AX6A 2XTKA 1K8ZA 1H0IA 1SMAA 3BPWA 2PLKA 1OCNA 1L9WA 3DHDA 1HN1A 1ITCA 2KAUC 3G6LA 4CQ9A 4LC6A 1GQKA 3BW4A 3SJ3A 5MHBA 3POHA 3I3BA 4HZ6A 5DXXA 2JALA 2DP3A 1GG1A 5A95A 1KNWA 1D2KA 4HOXA 3LPGA 3RNDA 1RQEA 3VIIA 3PG9A 4N02A 1R9YA 2V82A 4MZ1A 2V3EA 1VBUA 1LLOA 4L7ZA 4DUVA 4Q8QA 4DLMA 4WJXA 1KR0A 3FNDA 4AZ6A 3IIVA 5HBFA 4LAMA 4N4QA 3GQYA 3VKJA 2OZ8A 1R85A 1TVLA 4QTGA 2A2IA 3B8UA 3VNLA 2E6YA 1K7EA 4ZR8A 1EZ2A 1BVWA 4JKMA 3SY5A 1EJSC 4AZBA 4BKNA 2XH4A 3SCPA 2ATSA 5BMWA 3HMCA 3T0CA 3VIMA 1KFKA 3PZIA 2E6AA 5REQA 2WCSA 4FHAA 1IZJA 3BAYA 3TSDA 5LZLA 1OG0A 1Q6LA 1TKKA 4DPPA 2NXIA 1OFRA 2YA0A 3A4AA 3HG3A 3TOYA 1EF3A 2PRMA 1QT1A 3S4TA 2OT1A 3MP5A 3LHTA 3PAJA 4UFHA 5ECUA 3O1NA 4RE0A 3MCNA 1OADA 2DIEA 3UW6A 4PEKA 4GKLA 1JCNA 2GGIA 4RL3A 3W2UA 3CO8A 3II1A 2HBXA 1S2AA 1XLGA 3MSDA 4B16A 3BTNA 5DXYA 5FF4A 1YTDA 4S3GA 2W91A 3F2BA 4ACYA 2PWGA 1LP6A 4HP5A 1VLWA 1TB3A 3HBLA 3GW0A 4CN6A 1QK0A 3W1RA 1YDVA 5GJMA 5TAOA 1UQZA 2HRWA 3UR8A 4BFAA 1U5JA 1CB2A 4PCSA 5D9NA 1Q8JA 2NQLA 2NQ9A 7TAAA 1FA2A 2VR5A 4OGZA 5E09A 3NQBA 4E6MA 5AHEA 1W9UA 4PR4A 3U6WA 4JTGA 3HGRA 1C29A 1BF2A 4R9XA 2E1DA 1OD0A 2HQAA 4GQ0A 4XD4A 5GQBA 3TTEA 4M51A 3GAKA 1VCFA 4LYRA 3WH9A 4FR1A 1A80A 5BWFA 3URNA 1GORA 4D6FA 2REQA 3HPFA 3WH8A 2QJHA 4PMUA 3M5XA 1UZ4A 5BCAA 5C7HA 1W1PA 2F38A 2Z29A 4Z2LA 2ZZ2A 2XWDA 2WPBA 4H6KA 4DO7A 4AZCB 4ATLA 5CJMA 3WF4A 3DAQA 1VZWA 3UXLA 1JDDA 4NG3A 1YE6A 2NSOA 5JH1A 2AOSA 2DPEA 3ONBA 2J7FA 3W76A 3N2XA 4S3FA 2C0AA 3NG3A 2PTZA 3LX9A 3IUHA 3EOOA 3CAQA 4GVHA 4XUYA 1T41A 3A5VA 4OT7A 2PUZA 2ZWZA 3W1NA 1Q6CA 3W7JA 3TN5A 1LM1A 3R1ZA 4HB7A 4ADTA 1EWDA 2A7NA 1RHCA 1EOMA 3H54A 1QNSA 4O53A 4DVOA 4AIEA 5LHEA 5C5YA 3QLLA 3KTSA 4GUGA 2AGTA 5CPSA 3HZ3A 2CXGA 4AF0A 2Q02A 1R47A 3T8QA 4AZ5A 1ZSXA 1JNDA 1KO0A 3LGEA 2PU0A 3TNOA 1V08A 1AQHA 3ATZA 3UXDA 5AVNA 1IGWA 1J0IA 2BODX 1AVAA 3IGUA 3DFOA 3ES7A 2ZC8A 4PBGA 3W7KA 3SY8A 5F7UA 3LENA 1YLVA 2J7DA 3S0CA 1R2RA 5KZ6A 5H8MA 2QUTA 3H21A 1EL3A 4R9OA 3HOJA 3GHRA 1D8WA 4UXDA 1DJZA 4O8AA 1XG4A 1UOKA 1I2PA 4K6AA 1ICQA 2IPFA 5HA7A 2VC7A 4IG2B 5JBDA 4JOMA 3C52A 5HMFA 2J7BA 4JIIX 3DOPA 1J0YA 1JCMP 1UROA 4Q7NA 4LCQA 3WUFA 2WJZA 2J7CA 5DMNA 3H4XA 3CEPA 1TV3A 2GUYA 3S9YA 1X7IA 2QJMA 2AL1A 4FO4A 3WJYA 2OX4A 1TV2A 1B3ZA 2CLHA 3NFUA 1UBPC 3PPFA 1J18A 5TNVA 2PA6A 3AZRA 1W1ZA 1UWQA 1LCOA 1NIUA 1HGWA 2TRSA 3M0LA 4FF5A 1MZHA 1F6PA 1NQKA 2NW0A 2Y88A 4KS0A 3TU9A 1OHLA 4ROQA 2WOQA 4GYJA 2WHMA 3TXVA 3R89A 1XUZA 1WZMA 2PC8A 3LK6A 2C6QA 4C7FA 3V0SA 2GK1B 1BHGA 1VB9A 4KCVA 1G69A 2WM1A 1B2YA 4AZ7A 5CCZA 2OEJA 3QXBA 3T1GA 2YDAA 1FHDA 2YX0A 1NOUA 3EZ4A 1Y5VA 4UQ9A 4O16A 1BLIA 5IM51 3M0KA 4G7FA 5HANA 2ZUWA 3AIBA 4MJMA 3NJ3A 2C1HA 1LYXA 1YPIA 4ZGYA 3CU2A 1AG1O 3YPIA 1VYPX 1KFEA 2YKKA 4W85A 2EPNA 3OJGA 3BLOA 5TBOA 4HA4A 4AD1A 1GTEA 4LSBA 2Y8VA 2RJHA 1Q8AA 5B7YA 2NWRA 2CKSA 2VUNA 4R7JA 2O7QA 3I10A 3THQA 3MO4A 2G4JA 4GUJA 5DX7A 1Q6EA 3VKKA 4FX6M 3L66A 4BWLC 3WFZA 2VX4A 1HUVA 3LI1A 1YNQA 4DLFA 8TIMA 3WBWA 1ZU8A 5JH2A 3PPCA 2ZDSA 4XVEA 2BV9A 4P61A 1S2WA 1P7TB 4PBEA 1XD0A 3ZSTA 3WLQA 4AHQA 3DXIA 4ZENA 5AC4A 3UF9A 3CV7A 1TX0A 2CESA 3KBSA 3N2MA 1IHIA 3UWQA 5HXMA 3DDMA 4AZCA 5D09A 4Q8VA 2Z1XA 4B9ZA 1LDCA 3BQ6A 1QI3A 3N2OA 2PD9A 3E2QA 4H41A 4PSRA 5AC6A 1NAL1 3C2EA 1S2TA 4UB9A 3H70A 2A3LA 4GOAA 2CHNA 2R1LA 4EP8C 3L2LA 3KP1A 5DMLA 2AL2A 1DJYA 1T99A 4M56A 5EGRA 1ZBVA 1WCGA 2I9UA 1UIPA 4EX4A 1WKDA 3VA8A 1PB0A 2E28A 2DJXA 1UKTA 4IIBA 2XGIA 4FOKA 1OD8A 1AFSA 1YEYA 3TCEA 3BLFA 1FKWA 5TIMA 3OYZA 3GS6A 1KWGA 2NX3A 4MLJA 1A5MC 4IL2A 1NOWA 2FPTA 1KV5A 4F79A 2PP1A 3NQEA 1EYEA 2GFTA 4MTVA 1MXDA 8A3HA 4B4FA 2DSKA 4LS1A 4IFRA 1F3TA 5LIYX 5D02A 4PBFA 4G56A 1BD0A 4B3ZA 1R46A 3CL6A 4QCEA 4L5ZA 4IICA 2ADAA 1F73A 3NQCA 4Y9AA 4NRRA 1I0BA 1JYWA 3L0KA 3FSUA 2CPUA 1E72M 4H9YA 4GUHA 4MSSA 2QULA 1BG9A 1MXGA 1Y5WA 3MDWA 4KEVA 3N04A 4AIOA 4QFUA 3WQCA 3SN0A 4PMNA 4OOZA 1H7OA 5HJYA 1PIFA 3BE7A 2PZNA 4Y8EA 4NX5A 3NPUA 2NSXA 1LORA 4RE3A 5I2UA 5CAHA 5C6MA 3EA1A 2D69A 2ON3A 3ITTA 2WMGA 2EBNA 1GVOA 5LIXX 3C0QA 1BPLB 2WZMA 2AKZA 1NY1A 2G96A 4QCFA 3NSMA 1O4UA 4UTHA 1UMYA 1NFPA 3QVQA 3GVQA 2V0TA 1VFHA 4EPEC 1F61A 3UWUA 1V0NA 5JBFA 2WJDA 3CWNA 3IARA 2VZOA 1PJ9A 4K38A 5A5WA 1OF6A 3SCNA 1GKQA 5BXPA 1H2JA 1JQVA 2DT3A 3SRKA 2G3FA 3CH0A 3ABQA 1XHGA 2ZYFA 3R4IA 3CB3A 4O19A 2DQXA 1ZS2A 3NPVA 4FAMA 3SEPA 2OU4A 2D22A 1HVQA 3PTQA 2OO0A 1FWBC 1FWAC 2P8CA 4TXEA 1W3HA 5CKSA 2UY4A 3GVVA 1SO5A 2PDCA 3P84A 4JFTA 1PZ0A 1QWGA 4ZFMA 1K9EA 3AMLA 4XAGA 4DZHA 1HL9A 2G3MA 4L80A 2X2GA 2A3CA 4AZGA 3NQ6A 1XLFA 4LF2A 2VT0A 2FVKA 4YYCA 3F4DA 2C0HA 3NO3A 4DF1A 2PURA 3PM6A 3CYJA 1DE6A 2OYMA 1CGYA 3E3HA 1BAGA 1F4HA 3KOYA 1U5HA 3TJXA 3HGSA 1RLCL 3TZNA 4JTEA 4ZB5A 1NWTA 4QM1A 2ZXQA 4FLSA 3SQLA 3F4WA 2Y0FA 3HFYA 3I4EA 3GC4A 4L4PA 3GC5A 3DFTA 3VZYA 1XQLA 1AK5A 3TH6A 3VXGA 5LNVA 2A7PA 1QCWA 1E3XA 3FIGA 3UT0A 2X1TA 3PAOA 2F84A 2TMDA 2QAFA 3R13A 2OELA 5DELA 1XH1A 4DXKA 4GK8A 1FWIC 2D0GA 1W6TA 4LAOA 2FDSA 2PDKA 1V79A 1RSCA 1QFEA 5CSYA 1TV7A 1IZKA 2JGQA 2JK2A 3RDKA 4YL2A 2HPIA 9CGTA 3MB9A 2LLEA 4H19A 3N29A 3OP2A 3WO8A 5C0QA 4UNIA 1J6OA 2ZRZA 5FA5A 3LRKA 4JFUA 1DKWA 4U3CA 1GK8A 3B03A 2ONEA 4A4AA 3GHSA 4IP7A 3RGTA 5A2AA 3G1RA 3RLHA 3RMJA 1C8VA 1UKOA 2H6RA 3E96A 5EBUA 1I2QA 1OIFA 1UD3A 3KOZA 1AA1B 1AH3A 1E6PA 4M24A 1C90A 5FEPA 4JIHA 4C6EA 2OEKA 1M9HA 3EOUA 4GX8A 4PTMA 3CIWA 4MKVA 2W61A 4FZIA 4K39A 1SM9A 1VBJA 1PSCA 1A3XA 1X7FA 4D6JA 2VFEA 2XM2A 4J2MA 3WBYA 3GD6A 3R11A 3K1DA 4GY7A 1VJZA 5BZAA 1GEQA 4IP5A 3UR2A 2YPIA 4XIAA 1UWSA 2RDUA 2OSWA 1Q2SA 1CZ1A 2V5BA 1EO7A 4GC3A 5I00A 3RYSA 1PPIA 3N4AA 5F2LA 1R3YA 2W63A 1QHZA 3UFYA 1M01A 1MEWA 1SVDA 3BJSA 2BOGX 5BU6A 3STFA 4CVWA 5HMEA 2ZBTA 2Z00A 5T91A 3FS2A 2NZLA 4ZTYA 3C2YA 4US5A 4ILSA 2DDXA 4HHHA 3UZ5A 3VGHA 2BWGA 4C6DA 1OCQA 3U5YA 7ENLA 3MC5A 3MJYA 2QS8A 5HAOA 2IS7A 3RR4A 3S83A 1CGUA 4CNNA 3QYQA 4LFYA 3LHUA 1QRQA 4C6QA 2HVMA 1N55A 4DO5A 2GPTA 4GC4A 1JUKA 5D9MA 2J8FA 4QR6A 4CQ8A 5B80A 3W1XA 4Q6JA 3B0UX 3AMCA 2VURA 1XSIA 5DCBA 4DPQA 3SBFA 1LQAA 3VNZA 1US3A 4PB5A 3W7DA 4B9YA 1T96A 1T40A 1TA3A 1KQYA 2V5JA 3BMXA 2RFGA 1MFUA 2DZSA 1V7YA 4MY9A 2PPGA 4EANA 3UY7A 2PDIA 3DENA 3WNPA 1QOPA 5CXPA 5FJTA 3UYCA 3V5OA 4ZO7A 2VC6A 4MPKA 3L9CA 3IJQA 2BVYA 5F2MA 3S46A 1OINA 1GOOA 1S5TA 2YYTA 5E0KA 3CTLA 1XRFA 2PDPA 2G41A 1DTUA 1A0DA 3FW6A 3OBAA 3OQEA 4K1WA 3EDFA 1TV4A 2V68A 3VYLA 1VFUA 3AZSA 4O1BA 2XZ9A 1H7RA 4B3KA 2I9EA 1SFLA 1MQPA 3GXDA 3PTKA 3H2EA 2WJFA 4RDZA 3T6CA 4K7VA 3WYZA 3WD0A 5CJNA 3WDQA 3TX9A 4AD2A 3C3NA 4DWSB 2YBUA 3W23A 4QDWA 3HB9A 2OG9A 1O5RA 5D04C 4JTJA 2WKJA 3QR0A 4U10A 5D03A 2FZMA 1QR7A 1SZFA 2CKRA 1US0A 3NR0A 1TJPA 3AAMA 4GINA 3WQVA 2YDQA 2CLFA 4MAVA 1GJWA 4G9PA 5CBBA 1UZHA 3T8LA 3K4AA 1O95A 4JNMA 2OMAA 3OGRA 3O3RA 3BG5A 3URQA 1RH9A 1YXYA 2XN2A 3W7GA 4MB4A 1EXBA 4AEOA 1XIJA 4LPCA 4QNWA 3ZJ7A 3R25A 1XPGA 4WY0B 4CCCA 4HKPA 3VX0A 3ZT5A 1DJQA 4JHZA 3TYBA 1K03A 1RVGA 4ZEPA 2WAGA 4B92A 4NP7A 4OZOA 4KRUA 3WX7A 4RV8A 1UWRA 1FOBA 1A5KC 2C3ZA 4JTCA 4PRTA 4HZ8A 2PDNA 1UA3A 2XIMA 1D8CA