4M7ZC

Unliganded 1 crystal structure of s25-26 fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 54
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC01
1FH5L 5A1AA 1GZQA 4OZGF 4OV5A 5GS0C 1NMAH 2APFA 4PGJA 1MCBA 2OP4L 4L5FL 5TGBB 1HNGA 1PG7W 3VFSB 4LDOB 4JN2A 3PL6A 5T5FH 1QOKA 3L3IA 4HX1B 1LO0L 3MRCA 4NM4L 3TZVC 2CJUL 2AQ3A 3S34L 3VFOB 1P7QD 5I71C 3KLSA 4KHTH 1IGYA 1QZ1A 5KANI 5BV7L 1F11B 3THMH 1ZAGA 3RVTD 4D9RE 3DYPA 4D0DA 2LVEA 4CMMA 5KSBB 1OQXA 1QYGL 4KI5E 2M1KA 3CUPA 3RY4A 1FYTA 3FONA 1DVFC 2FATL 2DL9A 4NKIL 2ADJA 1Y6NR 4OGXL 4M6NL 3BHBA 4NRYA 4XC1L 5EG6C 1KJ2H 4ERSL 4QXGL 5MP6H 1R3JB 3B9DA 5DS8B 5DRXB 4UT7H 3WIIL 1A6ZB 5ESVA 2IADA 1CL7I 4X7FC 4PJ9D 5IMKA 1LE9B 4ONGH 4HUVB 1UXSA 2EDJA 2CRZA 4NRXB 1E4KA 4YHZL 1J8HB 4AENB 4PJEE 3UZQA 1WZLA 3VFPA 2A0LD 2OK0H 3D39A 5AUMB 3VD9A 1F4HA 1XGTB 1FVEA 4ODVH 3AY4A 1JF1B 3W5MA 2NTFB 3M1BB 2R0KL 4Z7WA 1Q9KA 1DN2A 3OAZK 3EDFA 4XVTL 1KUMA 3TJEH 5JA8B 4OFVA 1VGKA 3CGTA 3NZ8A 4HJ0C 1RUQH 1T3FB 2I26N 1AR1D 3BPLC 1F4AA 2VITB 1CDGA 3BPCA 2R23A 5I75B 1I7TB 3ULVD 1HWHB 2OQJB 2QTEA 5JR1H 2A6KA 3MA9L 1KIPA 1FNAA 2X4QB 3L6FB 5I18L 4HK0B 4MJIE 1QP1A 5SX4H 4UDUA 3NCMA 4XWOD 5CCKL 2F74B 3F7QA 1JZ2A 2YRZA 4JFOB 4NWTL 5GQBA 5T33H 3VGBA 2EDEA 2OYPA 4F15C 3HKFA 1RV6X 1SJHB 4IS6A 1PBYA 3O4LA 3LCYA 5DZNA 2OL3H 2VTFA 3VE0B 3MNVA 1I1AA 3X13B 1XEDA 3D9AH 5F9DC 2OL3A 4NC1C 5TE4H 5FKPB 4IRJC 5K33A 2Z35A 5J7CC 1MVUA 3R1GH 2HH0L 1DEDA 4R7NA 4NSKA 3CXHK 1FSKC 3FB7A 2HT2D 4KK8C 4KRPD 1C5BL 2BXYA 3VFVB 5IW6A 3GSUB 5FUOH 5CKAA 1K3IA 3KG5A 5I66A 1Z5LA 1YEEH 5ICYA 2QSCL 2YK1H 2V6HA 4YHLL 3SKOB 3MV8D 2DLFL 2G5BA 3QUYC 1N8ZB 1TNMA 1CL7L 3P9WB 1PAMA 1CD1B 4F2MB 3P0YL 2DLEA 1G0DA 3IAGC 2A9NH 1SM3H 4POUB 5I6XC 1FNSH 1UYWL 5KSUA 3QB7C 3AAZA 4LCWA 4GQ9L 1VDGA 4K8RL 5GGVL 2EYSB 4PRDB 4JFPA 4FQIH 4YDJB 2P5WB 4G6ML 2Y6SD 3DIFB 1FYHB 2C3GA 3C5SB 3QFJB 4R4FH 3GSVB 4NN5B 3M17B 2NY0D 4F7EB 4J12A 5KJRL 3PG2A 1YNKL 1V3JA 3BP5B 1IQWL 4O2FB 5EUOB 2P43B 1UKTA 3ZSSA 1UFUA 4NO2B 5F6HI 5I71B 4R96B 2D03H 4OSUL 4P2QE 5E00B 1BJ1J 4N8CL 1B6UA 3MJ7B 3MV7D 4HQQH 4G9DA 2YZ8A 2FR4B 2BVYA 4HUWA 5D2LF 1ZA3B 3G5VB 1OWRM 2HA1A 4Z5RB 4JFDE 4KPHH 4QCIB 2BOCA 3WUWA 5EO9B 1DVFB 4CVWA 4GAFB 3QDJA 3S36X 4BKLB 2A77H 3QDAA 3V6FB 4RAUB 3EFFB 3VWJB 3G9AB 1NGWA 5GGSY 4NUJA 3QIWD 3BOVA 1E4WL 4DN4H 3GJFK 4LLWA 2ZCKL 3QDGA 1X5HA 1NFDF 5FUZH 1G7IB 1WISA 3MRNB 1R3HA 5LG1A 3UTSE 5A2LH 2B0SH 4O5LL 4J3SA 1MCWW 1FFOA 1AGEA 3RNKA 5T1KD 3EYSL 1A6VH 1Q94A 3EJYD 4N0UE 5E0QA 1FORL 4J6RH 4QRPB 3V8OA 4OCYL 4JGJA 4B41A 4EQ3A 4ZUTA 1WZMA 3MCLL 1KTLB 3UZVB 2LABA 2E8YA 2PW2B 4N90D 4K8RC 5DRZA 5T1LA 5DT1H 2L7JA 4LCYA 4N0CD 2DBLL 4K3DL 4PJ7B 2FJFA 4NT6B 4ZTOL 1A3LH 1P69B 3GMLB 3L3JA 4MB4A 3MJ8B 2FBOJ 4FQHA 3BYYA 5L8KB 1OP9A 1PLGL 5IBLC 1NCWH 12E8L 4MJ4A 4DQOH 1H3PH 1WBXA 4MD0B 1NMBL 1FZMB 5DQ9A 4CAGA 5EZIH 4WI9A 1INQB 1NC4A 1A2YA 3B5HA 3PGCA 1CFNA 5EPMB 1RZKC 3IJYA 3OKLB 2H32H 2V7HB 4M9OA 2C7UA 4XVJH 1KPRB 3MREB 5GJSL 5EO0B 3HI1B 1I8LA 3DUSB 2IPTL 2H32A 5DRWA 3T65A 5EU6E 3W9DA 4ACPA 4OLEA 3HMXA 4F15B 1QNZH 2E7BA 2OR9H 1A6WH 1I3GL 1S7VB 4NZRL 1EEQA 3WS3A 1BZQK 5IVZB 4HS6A 3SHSA 4IRJB 3ZSTA 3NZHL 2I60H 1ZEAH 4PJCF 3HLAB 1B0RA 5CGYC 1NDMA 1RZ8B 4OB5L 1WUNT 4Q74A 1FSKB 4XHJC 3QUMA 4R90L 3SE4A 2A2QT 3B3IB 3CVHH 4KY1L 3U4AA 3CPLB 1I3UA 3BPNB 3LSOB 2PUQT 4QRTA 4W6YB 4EEEA 4XNQB 2JF1A 4HUXB 3CVHA 1FDLH 3BSZL 5FYLE 5FYJL 4AT6B 1HILB 4MCZA 2FGWH 4H1LH 3TO4A 5T1MB 5CP3H 3QUYB 4OM0H 4QRUA 1LILA 3WJJA 3ZDYE 2CUMA 3I9GL 4HIJB 4JFXB 3IU3A 1AD0B 5I2IB 5DMGC 2AXFB 3WFZA 5SWQB 1N7MH 2AABL 3FFCE 1QFPA 3BRFA 1R3KB 2X4SB 4NQCB 4ZFZB 3Q6GH 4L29A 1AKJB 5H2BB 3IRPX 2C1PA 4HIIB 2Q8BH 4XHQA 5IVXB 5DLML 2IFFL 4UQ2A 4TTDD 1KULA 1BP3B 1NC2A 2J1KA 3IU4L 3MOAH 5JIKA 3WCYA 4ELMA 2DM4A 5ACZA 5IHUH 1AXSA 3BDYH 4HXBH 4XXDB 4D8PB 4UU9A 4WUUB 4Y4KD 1J0ZA 4Y5XA 2AJ3B 3G6DL 2VDPL 1CDYA 3KYKL 4BQBA 5C92A 1JV5A 3REWB 4OZGB 2HT4D 2DDQL 1KELL 5L2KD 2YUWA 3LKQB 3S3JA 5IB2B 4E41A 1B90A 1CFTA 4KK6D 5I1LB 1LK2A 4NQDA 4EBQH 2HRPH 1MLBB 2XZZA 1MHHB 2ZG3A 4LAQL 3LKNA 2HWZH 4LLMB 5FO7A 5IK3A 4OLZH 3SGEI 3MSPA 5HGDB 5DI8A 5GGTH 3PWPB 4LRNL 3AMLA 3FQXA 2K1MA 4TVPH 3ZE1E 4D94A 1Q8MA 3BWAA 4CUCA 4KXZH 2BSED 5D2NC 3PHOA 2JB6A 3QP3A 3QH3B 1OTTD 2QV2A 4P4RA 3QRGH 1PKQB 4X7TB 4E0RB 1LP9E 1U93A 1BFSA 5CJBA 4C56B 1T83A 1N0XH 3TA3C 4G9FE 3CDFA 4Y0GA 2D31B 4G6FB 4HF5H 4MXVE 2E7CA 3QWQB 1KXQE 1ND0A 2IGFH 3FRUA 3G04A 1TETH 5IB5B 3CU1A 1UJ3C 3WV0A 3LRHA 4H8WH 1KYOJ 4POZD 1NH6A 4WW1A 4FXGA 2XG4A 3RKDC 3CH8A 3RWJB 2CKNA 2EH7L 3DOSA 1U8JB 3MRFA 3T2NL 4ZS6C 3V6OA 1QFWI 3QCTL 2BY0A 1YNTA 3AM8A 2KUTA 1YEGH 4JFED 4Z95H 4ODSH 5K59F 1CXIA 1IILE 2YRPA 5DZOA 4UDTB 4QRRB 2GFBA 4KJPD 3LPFA 4IM8A 4AEIH 3QEHB 5JXAH 5KVGH 3IXAA 2EDDA 4YHPA 3VI3E 2CKBB 4ONHA 5EIIB 4XPHL 1CLOH 4DGIH 4J3UA 5HGBB 5KSVB 2BHZA 2CR3A 5JW4Q 4OCSH 2YR3A 4P57A 4QHMA 2BNRA 4M1CC 4R0LB 5T1DH 4HKBA 4WI7A 5IM7B 3MLXL 2EH8H 2IEPA 1OGAD 3ZHLA 4QRSB 1S9VB 1EBAA 3O9WC 4QLRA 3SBWA 1LO4L 2YSSB 1KLUB 4PYGA 3TPUB 3EW3B 1FIGH 4GKNB 1J05A 2LAAA 3ARDB 2MFNA 2W59A 2VDRL 3V4UH 1NFIA 2MCPL 4XI5C 2NY4C 4MDIA 3BEVB 43C9B 3BAEL 4KMTL 1TZIB 2QQLH 3RUGE 2FIKB 1KBGL 4PG2A 3I75A 4NHCH 4LSVL 1QR1B 3RVWC 3DVNB 3MA7A 5TE7L 4UT6H 3PUCA 5CD3A 2EECA 4OFPA 1X4ZA 4JM2A 2CK0H 3W11C 3ULUH 4FXKA 2G60H 3OKYA 1CLZH 1FL3B 2VJXA 4Q2ZA 1K4CA 1Q0YL 2R1XB 1TZHB 1TIUA 4LGRB 1K8IB 5FYKL 4XNUL 5EB9A 2JKXA 1OAKH 3NFNA 3D85D 1WITA 5JXEA 5EOTB 3X3FH 4DUVA 5FK9A 3RAJL 1YEDB 3O3DB 4M6MH 3UTQB 4NQSA 4NP4H 3SKMA 3MFGB 5DJ6B 2F54A 2CGRH 5FM5O 3OF6A 1NGXA 2EIEA 5SV3A 4LHJB 4M8VA 3QHZL 3ECBB 3UBXI 3MYZA 4EIGB 1U95B 4P5MA 1I8IB 2O5XH 4CKVX 3LVEA 4QOKD 1MJ7L 1A9BB 4M8QB 4ZUWA 3FB5A 3NPSC 5GPRA 5D7SL 1CN4A 4HPOL 4U4BA 3RA7L 3DMMA 5IBUG 2UYLA 1RZJL 5EU4B 1Y0LB 2DQHH 4U1SB 2Z8WC 1INDL 2O61B 4GUPA 4PJBA 3S88L 1YQVL 5D2LB 2BVPA 4JO2H 4UI2A 2ICCA 5A3IC 3T09A 1KFAH 2K9UA 3CZJA 4HWZA 1IEAA 3RVXC 4OZIF 4KKCC 4NZTL 5TDOB 3TA3B 5SWSD 1NKOA 1MCEA 2NPLX 3NN8A 3U9PL 1NPUA 1UJ3B 1TQBB 1NFDB 4X80L 2Q6WA 3IFLH 4JM4L 2R39A 4JY5H 2AKRB 1CFVL 3NOIA 2Y07H 1JRHI 1RHHB 1F3DH 3CLFH 1YY9C 4Z7UA 3V5KA 1PG7X 1KJ3H 2C3VA 5K9QG 2J3SA 4LARH 2XY2A 3HPJB 1U8NB 1JNHB 1OAYH 1LQSR 2PETA 3RNQA 3DGCR 1KEGH 2X7LB 3BH8B 3S4SG 4CRPA 2PR4L 4IOSD 4LQ1A 4IRZH 4QEGA 5INCB 2J7LA 4IMLB 5GRVK 3S7GA 4HGWB 4RX4A 4OCWH 4MNQD 4JRXD 4F37K 5DA4A 2BRRH 5IHBA 3T3PE 3RBGA 4LCIL 3QIUA 4BZ2L 4XP6H 1RZJC 4LLYB 1DE4A 4XVSL 1QLEH 3CMOH 5HYSA 4UV4L 1QFWM 3PNWB 3VD5A 1D5ZA 1JGLH 4L4VB 4KKLC 3HE6D 3JWOH 4XPGH 2D7PA 3W81A 5CEZH 1PG7H 3VMNA 1NCBH 3DVIA 4MA3B 4X6DA 1U8MA 1R5WB 5D1ZD 4Y19D 5B38G 2EZ0D 3BGMB 1ROWA 3O9WB 4P2YA 4LVNC 1MNUH 5CJXC 1ZA6B 1GGCL 3GBNH 5KOVC 4RIRB 3QDJE 4MNHA 4KVNL 1YJDC 2F53B 1L4IA 5EC1A 4JPIB 5CBEA 2H8PB 3V5HA 4FQJL 3QG7L 4FFWD 2NY4B 4HEME 4PV8A 2I9TB 4UIKL 4XCCH 4PJCB 3FQNA 1MSPA 1EZVX 1BFVH 5EIVA 2MKWA 1FPTH 5D1XD 3RFZC 3WNLA 3KXFD 5EULV 1RZGA 1XCQA 4TVPD 3SDAA 4Y5YC 5I16B 2GK0B 1KTDB 3ARWA 4POYA 1S7XA 4JDVB 1QBAA 4ZO7A 5ICZA 1JRHL 2GYSA 5HYJD 1J7VR 5MI0C 1M1SA 2KZWA 3BFOA 4S1SH 5SV4A 1H3WM 1U3ZA 2V2TB 3IYLW 4GSDL 5C8JB 4YZFF 4O00A 6FABL 1UXWA 3PXHA 3L5WB 2ZZUT 1T2XA 1KCVH 1NLBH 1ZLVH 4EVNA 1KG0B 2WQ8A 5J8OA 4K8RD 5TPWL 3AC0A 5EORL 4JDZA 3F65A 1U3JA 5M7QA 1NUNB 1A21A 1ZLVK 4NKQB 1AI1H 1EO8L 2D7MA 2RFXB 2ZUQC 5GGUA 4HULB 2I24N 5D7LA 1AQKL 4N8VG 3MRQB 5GISL 3GKWL 3AS1A 1HSAA 3LEXA 4U1HA 2FH6A 2YBRA 2XA8H 5F3BB 1ZHBB 3O41A 2YPKB 4MWFB 5D1QC 1E28A 4P59H 4PJXA 1CVRA 1UWGH 3FRPA 1DN0B 1OSPL 1JK8B 4LLDB 4OQTH 3ARUA 3WFCL 2XA3A 1AH1A 3MYJA 5BXFB 1S5IL 3ZDXF 3SPVA 1LMKA 1QSEA 4S2SB 3FQRB 3SDYL 4OQTA 3ES6A 4XCFL 4NQED 3LQAH 3RJQB 3ET9F 1SEBB 2OI9C 1NBQA 3LY6A 4EOWH 1TITA 2WUBH 5CD5D 3T0BA 1S8DA 3L3KB 4Z7QE 4MD4A 4AIZA 5E8OA 1N6QH 4MAUL 4N0YH 2VL4A 4PJFE 4EN3A 3GBML 3P4NA 4Z7WF 1YA5A 4PGBA 4TUKL 5AZEL 4AMKL 2HKHL 5C2BH 4ONFH 1MCCA 5DSCA 3ARGC 4J4PA 4JHWL 4M1GL 4XCNB 3HZMB 2DQTL 1EEUA 3IFNL 1T22A 3KYOA 3MV9E 4ALAL 4YUEH 1BX2A 1DQJB 2VDNL 3P3YA 5DK0B 3CFDA 5A43C 4I3RH 1BFTA 3HG1B 3JV4B 5DD3H 1EGJL 1W0WB 3QEQE 2W0PA 1NEZG 1F58L 4OUOA 5GJTL 4U6XA 3U9UB 4TPRH 3KPSE 3MMEB 2GCYA 4BH7A 4NO0A 4ZPVA 5JW4M 4LVNB 3QUKA 3B6SB 5AWNH 4NQDE 1OF2A 3TT1L 4ETYA 1CGSH 3RVUD 4RFEB 4OFYA 4MCYA 5T5FL 2R0WL 1AJ7H 4P3DB 3GSQA 5C09D 5E94A 5IFHL 5IIEB 2VSCA 1KC5L 4NQVA 2CXKA 4KDTC 4G80B 1PY9A 3RU8H 1DQDH 1UZ6E 3T8XA 4ZSOA 3EFDL 4X0KA 4KKAD 2J8UF 4UOJA 5JHDE 3THML 4WDIB 3MZTA 3BH9A 3MBEA 4JKWA 4NJ9H 3DX9B 2NR6D 3CZFA 1HHKB 2VZOA 5FO9B 2X10A 3M07A 2CLRA 2XTJC 1FFPB 3H3PH 5GS2H 1E27A 5J9PB 4PRHD 4M43H 3L7FA 1KN2H 5FCUL 4LPWA 3OXRB 5MI0B 1IC4H 3RL1A 3FN0L 4JJ5B 5E8EA 3IDXH 1F4YL 5JNYA 4OF3A 4RAVA 1NCAH 1FC2D 1G1CA 4WV1A 2VLRE 5MP6L 1HCFX 3GDBA 1LO2H 1EA9C 3S9DB 3AREA 4S1QL 2BX5A 4ZOEA 4XCEB 5B3NA 2ADGA 5EBLA 5D7JC 1FGVH 1J1OL 2PW1A 1U8IB 1YEFL 3UBXB 5GGRB 5GRZA 1MI5E 5I76A 3RZCA 5IQ9A 3K2MC 4FQCH 4MDJA 1TVDA 3HNTH 2XN9E 3VA2C 4Y2DA 2OK0L 1ZHLB 2ZUQB 4JZNB 4PJ5B 4J3WA 1WCBB 3ZKNC 4ZS6D 3DJ9A 1K4DB 2Y7QB 1QSVA 3T2OA 3LD8C 5IVOA 1H5BA 2VDOL 4WJ5B 2P7TA 1CT8B 3PL6C 3RIFK 4L3CB 5E5UB 1A4KA 1DQTA 5D1QB 3S5LA 2V17L 3QAZC 3TJEL 5MENE 3WKML 3T4AB 4PJDB 2WWMD 4HKJA 3HFML 3HR5B 1DSFL 4RGOL 4HLJA 1OSZA 4I0KA 4QF1A 5IESL 5DHYB 3SDCD 2IQAA 5CIPB 2IALB 2F8XC 3MRRB 1ITCA 2OI9B 4JQXA 4OCLC 3MFFA 2D9CA 4U1KA 2GJZB 3BESR 5I1IL 1I1YB 5L88L 1XZ0B 4D9RD 2ITCA 5FYLH 5GGSA 1XGUB 2DTML 2DB8A 5ERWA 2B1HH 3CX2A 3PV7A 4KI5D 3RWFB 1SYVB 2DS4A 2HFEA 5F7EH 3BKYH 2ORBH 5D5MA 3H42L 4JKPL 2VN4A 3A0OA 5ANME 5E5MA 4JPKL 4GXVL 3TBTA 5TE4L 3C9NB 3MUJA 4OZIB 3T4YB 3VG0H 1D9KA 4X4YA 1KOAA 2BMKA 5IQ7H 5DFVD 1A7PL 1EBPA 4JRYA 3P73B 3LIZH 1I8MA 1E4KC 1X5ZA 4X6CA 4H1LG 5CEXB 3F7PC 2NW3B 3NIFF 2DWEA 3CDGA 2FZ3B 4L9LA 2KZ1B 4TSCH 5HI5D 4AM0B 4S1DC 1JNNL 3UP1A 4TNVK 1FZOB 4LPVA 3JVGA 4IOIA 2Y4SA 5CUSH 3SJVA 4HKXB 3AY4C 3JV6B 5CWSB 2AJXH 2VXVL 2VLME 4PRIE 3IDYB 3V6ZA 1N59B 3QEGL 1FHGA 3UTTA 4L4TE 4X5XA 4R4ND 5HYEA 3E6FB 1S3KL 1AHWA 3FMGH 3C5JA 2VZ3A 5DGRA 5HHVH 2QSTA 4JGMA 2ZNWA 3B9AA 5E8DH 5FO8A 4OZFH 5EU3A 3HI5H 2FWOA 4RDQG 2AVGA 1C8PA 3KYAA 4GKOA 3W39A 4OZFA 4YLQT 5C0DB 2VUYA 3QIWB 2BRQA 1P84J 2VXUL 1JZ4A 5F6HJ 1QRNA 3FB8B 1TJGL 4P9MH 2DQDH 5FCSH 4ZFGL 1T0MB 2YD1A 1YMHA 4PJBE 5F1NB 3L3HA 4MJID 3ZLQC 5E08L 2GEEA 4JY6A 5T1KB 1BBDH 5HDBE 5EUKB 1I1AC 4Y4FD 3MLRH 3RDTA 4X5WA 4BYHA 3P9MA 2XTJB 5IEHB 1D5BB 5E4IA 3BP4B 1P4IH 3HNSH 2AJZB 2NMSA 2B2XL 3V7AG 3OG4B 3E8UL 3P11L 5FAAA 1C7TA 3U2SA 4ELMF 2FECI 4NHUA 3C2AL 1UB6B 5IEKB 2YD6A 5FUZL 3EYVB 3VGGA 4ZFOL 4FP8H 3S4SB 4F8TA 5D4QA 3GSNH 4OI9A 3R06B 4RDQF 3IDJA 1DUYB 2HTLD 2E3VA 5C0FA 3N1GC 2APBA 2NNAA 1XR8A 1CIDA 4W6XB 3GMOB 3KLHC 4OLUH 1S7RB 4OV5B 1T21A 2EC8A 4KVCH 3S36L 4DOHB 1RVFH 1HZHL 3T08A 2B5IC 3LD8B 4ODTL 1J5OH 1X5AA 2P46B 2AI0H 1H0DA 2R69L 5IV2A 4HKZB 4JN2B 4X6EA 5BVPL 3G5XA 3F7VA 1AXIB 4JPWL 5B38B 4ZDHA 1A3LL 2ZCLL 3VDAA 4NQXA 5FDWA 1ZS8A 3CLEH 4UTBH 1RJZB 2UVEA 5ADPH 3U6RA 2BNUB 4P5TA 1IGYB 1ITBB 2EE3A 1H3PL 1JTOA 4K07A 3BZ4A 1ULVA 5EZIL 1EMTL 2IH1A 1OM3H 3BZDA 1I9RH 4X6DE 4CMMB 5C0RH 5HHXH 1G9MH 4P2QD 1S7SA 3VGHA 3O6KL 4PR5A 3CUPB 5HI3D 3IKKA 3NTCH 1FYTB 2KQMA 3HMXL 4MAYD 5JIHA 2ADJB 5AYUH 1DANU 1MHCA 4JFDD 1IM3B 3I3EA 4HPYH 4LU5H 4NRYB 2DOCA 3N85H 1RIVL 1NSNH 5I30H 2GTWB 4DKEL 3ISWA 5D6DA 2BP3A 3H9SE 1KJ2B 1BIIB 3QUML 4YC2C 1Z9SA 4FFZL 5ESVB 2WM0A 4YDIH 5E6IA 2IADB 1YYLL 4KXZI 1JYWA 5IMKB 2C5DC 1MFCL 2FECL 4MXWL 1UXSB 5HHOE 3UTSD 3VFPB 3BN9D 2XQYK 4R7DB 4EI5D 2X09A 5EBGA 1BWMA 1ZVSA 1AFVH 1FVEB 3F6LA 1AY1L 2A6JA 3W2DH 2AEWA 4N8VB 4Z7WB 1Q9KB 4HZAA 1V3MA 1EVUA 4HIEA 2NXYD 2E9WA 3KDMB 1IGIH 2AJVH 3NZ8B 5J4MA 2UZXB 3WHE1 1A7OH 3SN6N 1N5YH 4JJHA 1M71A 3K3QA 3KS0J 2ZUSA 2R23B 3GSRA 1GIGL 4JY4A 4QYOB 1T1ZB 1MJ8H 2A6KB 4HCRH 1D5XA 2UV3A 4OLXH 4OTXL 3MROA 1KIPB 1ZT4A 3BDYL 4HCRA 4UDUB 5KS9F 1I8LC 5IJVA 4KUCF 2HYMA 1T20A 3LZFH 2W60A 1JHKH 4WU5A 4P2OD 1AR2A 4O58H 5CILL 4IOFC 4IS6B 2NCMA 1RZ7L 1CXFA 4Z7VA 3MNVB 2FGZA 2EDHA 3TJHC 5DVOA 4WTZG 5EU6D 2OL3B 1A3RL 4ZAKD 1MVUB 1P6AB 3OTTA 4NSKB 1X6LA 5I8CA 3SE4C 3X11B 5IW6B 5I66B 3EO1A 3W0WA 5ICYB 4JM2F 3BQUD 5K9OB 3M8OH 1ZWIA 1AD9A 3TO4C 1K5NA 2G5BB 2K3TA 3ULUF 2J8UB 2WP3O 4HHAA 5D96B 3P30L 3WJJC 1PVHA 4MLSA 5I1HL 4C54A 1D6VH 3OWEA 1R3IL 5FYLD 4HIHA 3I02B 5TQ2H 1NUFA 3C2SA 1F13A 5HPMB 4O02H 5KSUB 5C0GA 1SY6L 2BDNL 3RPKA 4DVRH 3AAZB 5HJ3A 3FFCD 5LGKA 1OAQL 1NEZB 3NAAH 4HF5L 4JFPB 1VEOA 4QT5B 3WFBL 5F9AC 3ARGD 4CL7A 1JHLH 4R2GD 2P44B 1BGXH 1GGIL 4X4MA 4R26H 4X9GA 1K85A 4X8JB 2IAMD 5F21B 4Y5XC 3UMTA 2FX9H 1GH7A 1B9ZA 4G9DB 4YJZL 1Z0MA 4HUWB 1REIA 2ZWLT 1OGAB 3DLQR 4M00A 5AG8A 3PABA 2V5TA 4HUKB 2W0FA 4PRNA 1T89A 4OCMC 4GRMA 3S96A 5KSAC 2BOCB 2H2PC 2K7PA 4OUUA 5F93C 3VH8A 1E6JL 1GGBL 4PLKC 3VRJA 2HVJB 1IEBA 3LS5H 2D0HA 2XPGB 1U0QA 3TGXA 4C59B 2VYRE 4MGXA 4NUJB 7FABH 2A1WL 3BMVA 3PHSA 3QQ3A 4TSAH 2ATPB 4YHMH 2YPLE 2X6MA 4LLWB 3A6BL 3LKRA 1BZ9A 4AYFA 3VCLB 2I5YH 5IVNA 2HLAB 1K6QH 3HPLA 1IBGL 4KGJA 4LRIA 4PS4L 1AGEB 1QFOA 3RNKB 5J1SC 1Q94B 2P8LA 5TFSH 3ZL4H 4Q9RL 1T83C 4J7RA 3ZTNH 1K3ZA 4ZUTB 3UPAA 3D85B 2VQTA 4UB0L 5HHQA 5BMFH 5HGHA 5JW3H 1MHPH 2V7NA 5DRZB 1KPVB 1LO3L 2EKJA 5T1LB 3WFDH 4NZUH 4G8FB 5T3XE 5HHPA 2W1NA 4G9FD 2FJFB 4WIQA 1EO5A 2R1YA 1JI1A 3L3JB 5I1JL 3KAAA 2V5YA 4FQHB 5C0AB 1FC1A 4H8WC 4NHCL 4RISL 3V5DA 4QOKB 5EOQH 5L6YL 4FZ8H 3WO3B 4BSVA 1IM9A 4NO5A 1WBXB 3V6OC 3PWLB 1ACYH 1JJUA 3MCG1 1S7UA 5H35A 3ULUL 1NC4B 4U1IA 1JWMA 3L5IA 2G60L 4F7CB 1A2YB 1CLZL 2CIIA 5F7UA 3AM8C 4J3XA 1CFNB 4HDIB 4NKMB 4DWHA 3IJYB 5C9JA 3D6GA 3D0LA 1M7XA 2VWEE 4UV7H 2C7UB 3D3VA 2GJ6A 2HG5B 1QQDA 1MRDL 2DD8H 3QNZA 1MH5B 2H32B 3MGAA 4RMVA 3W9DB 4FMKA 1NDGA 3QDME 1EXUB 4U1MA 5ACMA 4UINL 5C7XH 2DKUA 2B4CH 3EGSB 3WS3B 2ED8A 2LTQC 1XIWD 4GAGH 4HS6B 4AEHH 1JHTA 1YUHA 3E6HA 4G8GE 1M7DA 3E3QE 4ORGA 5SWSB 1NDMB 1RK0B 5F8QC 2UVFA 3VFMA 3ZMRA 1MAML 4XPBL 1KLGA 4QRTB 4EDWH 3MRHA 2LFGA 3S97C 3CVHB 1ZLWH 3SBWC 5JQ6H 2AXJA 2I9LA 3TFKD 4MCZB 3MLVH 3EDJA 1QA9A 4PJEF 5D5ME 1RD6A 3IU3B 3PWNA 1FVDA 1R5IA 3LQZA 1KFAL 1FN4A 3GSWA 4AK1A 2WNGA 1U41A 1ONQA 4XTRC 2YA1A 4PG2C 3MLZH 1YMMA 1RSFA 4XX1E 2C1PB 4KK5C 1KCRL 4AIXA 5IFAL 4U6HA 4UQ2B 2DJSA 5J3HD 3GHEH 4JM2C 3PWVA 3C6LD 1NC2B 4ELMB 4MNQB 5F3HA 3OAYH 3SDDD 2E9JA 5ACZB 3ILQC 2NYYC 1AXSB 3ULUC 1NCCH 4I0PA 1IC7L 1N5AA 4UU9B 2NZ9D 3O2VH 2FBJH 1HHJB 3FN9A 3TYFB 5JXEC 3OAYK 1S78D 3HE6B 4ESKA 5CZVL 4NWUH 3DI2B 4PRPA 4P46A 1JV5B 3MRPA 1J0IA 4PJXF 5F88A 4YBHA 2QHRL 1KXTB 4Y19B 1OW0A 4P9HL 3BP6A 3I85A 4U7KA 5C6TL 2ESVA 4E41B 1KEGL 3MRMA 5KSAB 2CLVA 2PTVA 1LK2B 3IKCA 5CJQH 5AYQA 5E9DA 4D9LH 5DTFB 4O2EA 3LKNB 4MA7H 5FO7B 3DMMC 2YC1A 4L1DA 5DI8B 3BT2H 3OGOE 4WUKL 5J6HA 5FKAB 4KZDH 3FQXB 2UUDK 3ZE2F 3BWAB 4PRAA 5D1XB 3JWOL 2EO9A 3PHOB 2JB6B 4XPGL 3GMQA 4Z78B 1PG7L 5EU5B 4HSQA 3WN5A 4X7SL 2ZOLA 4M5YH 4P4RB 4U3HA 3ZDZE 1UM4H 3KVQA 1IT9L 1YY8A 3RHWF 3FZUC 2FJHA 3OAUL 5ILTH 3HRZA 5GRJH 4APQA 4PJGA 3FOLB 3IVKA 5KW9H 1ND0B 4HS8L 3FRUB 3DUHA 3T3MF 1KEML 1T5XA 1YEKH 4QHNA 4RRPA 4WTXA 5LGJA 2RCSH 4XCCL 4WW1B 4GLRI 4FXGB 4H88L 1P9MA 3K80A 1V05A 2HKFL 2P49B 2DTSA 5LWYH 3MRFB 4Q6IA 1V7NL 2H26A 4FG6C 4F3FB 5C0JA 5C0CE 1JGVL 1I1FA 1QBMH 2ATKA 5LJYH 2D9QB 4S1SL 1MCQA 2APWA 2JCCA 1RAMA 4K94H 1BFOA 1U3HD 4M62L 1LVEA 1NMCC 4PLOB 3IXAB 1NLBL 4YHPB 1KB5H 1NKRA 4OD3H 4V1DA 3D2UA 2VDQL 3NA9H 3QIUC 5D70H 1KLFA 1KB5A 4NCDA 3JWNC 3KPRA 2LTQB 3SKNA 4Y4HD 4P57B 4DVBA 2OR8A 1ADQH 4NQEB 2I07A 4HKBB 3VFTA 4OAWB 3JWOC 2SEBA 4LSPH 4CDGC 1H3GA 2X9YA 2WUCH 4LLVA 5KS9B 4U6TA 4FOMA 2XA8L 3L7EA 2DKSA 3KNBB 1P7KA 3KR3H 1BREA 1ED3B 1J05B 3TN0D 2QJDA 1V7MH 3T0EE 4OQTL 3QDJD 2P8PA 1UM6H 5IG7A 4LIQH 3L95A 4NNYA 3QQ9D 3FCTB 1KNOA 5JPNA 4QXWA 1KTRL 3I75B 4YHOH 2JIXA 3OZ9H 3SQOH 3SDAC 4FTVA 5CD3B 3ZT6A 1O7SA 4QWWC 1CE1L 1ZOXA 2ICES 4JM2B 4OZHA 2J88L 3RPIA 4Q2ZB 2WUBL 4BQ6A 1A1OA 1EEZA 1K4CB 3VXME 5A2FA 2VNCA 4FFYH 1IGFL 1F02I 3F12A 4LEXH 3MXWH 1AGFA 3DHJA 2BY2A 3GZKA 2F54B 2DQGL 1NGXB 5DURB 3KJ4B 1IKNA 3OSKA 2D4FA 1UKSA 4NNPH 1R0AH 1UWXK 4Z0BL 5JO5A 1RUPH 2NX5E 4ZUWB 3FB5B 3QJHA 4PPTA 2VKXA 1X7QA 4XNYL 5E99H 4N5EC 3DMMB 1Z6JT 2UYLB 3OB0K 2LQRA 3WIHL 4I3RL 3U79A 3ZKXB 1A7BA 4DJMA 3GNMH 4U0RC 1X5KA 35C8H 5SWZA 4TYUA 3QI9D 4YR6A 5B8CA 2Y23A 5EBMA 4HWZB 4JFFA 3O8XA 4LSUH 3CH1B 2J6EH 1AJ7L 3NN8B 1JNLL 2BJML 1OLZA 4TN9A 1DQDL 2Q6WB 4NGHH 2X89D 4OCRL 4NRZB 3UX9B 4G6JH 5FM4A 4HFUH 3TO4D 4EN3C 4K9EL 1QSFE 2X70A 2C3WA 2HFGL 4AG4L 1QPXA 2C3VB 1EAJA 4MJ6A 4ENED 4BUGA 4J4PC 4GMTH 4RQQB 1IC4L 4KAQL 1KCUL 1EAPB 3IDXL 3LN9A 2Y5EA 5FYJU 1I3VA 4KUZL 2W9DH 1NCAL 3IAQA 4O4YH 4U1NA 1WK0A 5DR5L 1W0YT 4HBQA 1NMCB 3Q1SH 2ARJQ 3VXUE 5ITFA 1UQSA 4MQXC 3QIUB 5CS7A 2ZCHH 4P23D 4Q6YA 2VIRA 3MV9D 1AO7E 4ZXBD 1E4XH 5HYSB 1RUAL 1D5ZB 3DURB 3TV3H 2IANB 4FQCL 3SDCB 4I18A 5DS8A 4ODHL 1N64H 5HI4C 3TEUA 5DRXA 2Z31A 2YUZA 1B0GA 3R0MA 4Q9QH 1X6NA 1B2WH 1QO3B 1YC8A 1Z9LA 5CZKA 4HC1A 3QEQD 3JZ7A 3WNOA 1LE9A 4JO4H 1SYSA 1M05B 3MJGX 3HC0A 1J8HA 4MNHB 1YEHL 4DCQA 2OM5A 5EC1B 1T2QH 3KPSD 4PJHA 2E9BA 3INUH 4ZTPL 4PJIA 5CBEB 3S98A 1C12A 1MFEH 1NGYB 3GI9H 4Q58C 4YDKL 43CAB 5IROA 4CNIA 1JF1A 1C7SA 4PV8B 5E1HB 2YMXH 4P0DA 5CJ8A 1K9TA 3MBEC 3UJJH 4E5XA 3REVA 4HIXH 3TT3H 2FEEL 1RZGB 1XCQB 3SDAB 4LNRA 1P7HL 1T3FA 5JHDD 3D18B 2Q7YB 3VFRB 3IDMB 1S7XB 1F90H 2UWEA 4PJEB 2NY1C 2QADC 1MCFA 2X4QA 2GI7A 3L6FA 5KZCB 4M03A 4Z0XA 4WV1C 3UO1H 4OZ4A 2F74A 1MIEL 3AREC 2XQYG 2BY3A 4JFOA 1ZTXL 2R4RL 5CEYA 3FKUS 5JOFA 3U7YL 4XMPH 2VLRD 2QQKL 4JDZB 5A40E 4RFOL 3VE0A 3RZCC 3IGAA 1YECH 2Q76B 1DLFL 1FO0H 3C87A 4Y2DC 4YX2H 1WVZA 3MRJA 4TSCL 4A2LA 3U7WL 5GGUB 1SJEA 5D7LB 1MI5D 1XR9A 4NBZB 4LSTL 5CUSL 3LEXB 3S37L 3GSUA 4U1HB 1H5BC 2XN9D 2AJXL 2VN7A 1Q0XL 3SKOA 1E28B 4Z7OF 2IC2A 4U0RB 1MCWM 4PJXB 4DUWA 3QZWG 4FQXD 4QKXB 4WHTB 1CD1A 3ARBD 4F2MA 3MYJB 2X1QA 3SPVB 5I19H 1QSEB 5CJOL 3ES6B 5MEND 5IGXH 3N1MC 5GGRY 3FO0L 2NY2C 5I15L 1XGQA 1IVLA 2YKLL 4JQXC 2WBJA 3RUGF 1L7IL 4PLJD 3NPZB 3RIAF 5IT2L 2DLIA 4YDJA 2EDKA 4MVBD 5FM5M 2P5WA 1S8DB 1RPQA 3DIFA 1MPAH 3C5SA 5TQ0L 3QFJA 4TNWF 1O7VA 3MOQA 5E8OB 3SE8L 3WXWL 1FGNH 4HV8A 3BP5A 3BIKA 3WNNA 4F9PA 3P4NB 4L8BB 1MCPL 3QXDB 5B22A 3VFWB 2VLJB 1LE5A 2ICEA 1D9KC 2FR4A 1IGCH 3P0VL 1C5CH 1ZA3A 1NFKA 4U2YA 1T22B 4Y1AE 4Z5RA 3HNVH 4QCIA 4L9LC 3BDBA 1BX2B 1JL8A 2ZPKL 3JVGC 4HBCH 4BKLA 3CFDB 3EFFA 4NFCA 3VWJA 3V79C 3ARPA 1Y18A 3GMPB 1CD9B 3H6JA 3WD5L 4K3EH 4FABL 1G7IA 4OLUL 1PGRB 3RGVA 4F57L 1URLA 4XP9L 1AHWC 4U6XB 4Z7VF 2VLMD 3OJDA 4EQ2A 1CDJA 4WWKB 4PRID 2ESVE 4XCYA 4NJAH 3WDIA 4NO0B 4MAYB 4L4TD 1OF2B 4C4KO 3VDBA 2AI0L 1BD2A 4MCYB 3CFKB 5IB3A 4U05A 3CC5A 3GEWB 3GSQB 4OCXL 5E94B 1PDKA 2P5EA 3CLEL 2PW2A 3I3DA 4NQVB 3VFUB 1CIUA 5C08E 4ZSOB 3B8YA 3U4BH 1BJ8A 1KIUA 2Y36H 3FT4B 4X0KB 4DKFH 4B7LA 1MAJA 3GMLA 3MBEB 2W9EH 4MMXC 4PTUB 5E56A 2WZPD 4NKOA 1OARH 3RDTC 2CLRB 5J11C 4ODXA 1XT5A 4EI5B 4F80A 1FZMA 3C5ZA 4PJGE 1Z9MA 5ALCH 1INQA 3L7FB 5SX5H 3RL1B 2NY1B 5JNYB 4JHAH 4RAVB 4RWYH 1KENH 3UJTH 1RZFL 5EPMA 3D87B 2V7HA 4M5ZH 4WV1B 2NXYB 4YQXH 3ULSB 3RKPA 1AE6L 5SX5K 2D7TL 2RJMA 3AREB 4JO3L 3TO2A 1CGWA 2QKIA 2A9ML 1WBYA 2PW1B 3UAJD 4E9LA 2D0GA 4U33A 3RZCB 5IQ9B 3O6MH 4W70A 4MDJB 2ITDA 2FNBA 4L3EE 2VZ1A 1RFDH 5IOPA 5EWIL 3HLAA 1CU4L 1RZ8A 3ABZA 3C60A 3ZO0A 2PCPA 3O6LL 2XZCH 3ZT7A 1AFVL 4NM8H 4GBXD 1H5BB 3U1SL 3ZKQD 1JPTH 1DBJL 4N9OB 2FH8A 1WC7B 2P7TB 3TCLA 4JRWA 4XNQA 1A4KB 4HUXA 3ARTA 2WLZA 3U30C 3S5LB 5D72H 2RHEA 4HIJA 1AC6A 4HKJB 4ZAKB 2D4DA 4RSVA 1N5YL 4P5TC 1IKFH 5CLTA 2W92A 3QISA 4OGAC 1ZHNA 4HFWA 4ZFZA 3C8HA 4QF1B 4HCRL 3TH4T 5H2BA 2IQAB 2MPAL 2NY2B 5MEPA 4KJWC 3MFFB 4U1KB 3GMNB 2QHLA 5IVXA 1G9MC 1UG9A 2ITCB 5LKNA 1UB5A 3IFOA 3MO1A 5ERWB 5ITBL 1MWAL 1LHZA 1FAIL 5DQJB 2HFEB 4XXDA 4JG0H 3CIQA 5E5MB 1R6VA 1YN6A 3HMWL 3DV4B 4JREC 3TBTB 4MNGA 5D6DC 2QQNL 3O6FD 4JZJB 3DSFH 4GRLB 1D9KB 5E6IC 1AXTH 2E27L 3TCXA 2FD6L 4DEPB 2BMKB 3NH7H 2APXA 3LKQA 4HLZH 4GG6A 3H9SD 1OLLA 1I8MB 3OV6A 3PDDA 4J23A 3MUZ1 3OJ2C 2DWEB 3B9EA 3CDGB 4GRWH 4RAHA 4W6WB 5HVGB 3WYRA 1IC5L 4XAKE 5E2WH 3EYFA 3SJVB 5HHOD 2PXYD 15C8H 2XWTB 1RMFH 3ZYOA 3FO2A 5BS0A 2DQEH 1CXHA 3V6ZB 4RGNC 2AGJH 2F5BL 3P4LA 4MA1B 4UMGA 3UTTB 5D7KE 5FHAL 2Z8SA 4X5XB 3TP4A 5DD5L 5DEGA 1AHWB 3C5JB 3WKNA 3GO1L 3QH3A 5FO8B 5C07A 1KJVB 5EU3B 3TVMD 4HJJH 1PKQA 4JG1H 3NABH 4M4PA 4X7TA 4XP1H 3W39B 1FG2B 4OZFB 4C56A 5TF1H 2IG2L 2WW8A 1JHLL 4LAJH 1QRNB 1I1CA 3RY6A 4XWGH 1S7QA 1RU9H 2D31A 4KQ4L 1J0YA 5I1AA 4HT1H 5L9DH 2MJWA 3L3HB 2FX9L 4OCNC 2X9WA 1HYSC 2KBGA 3HE7D 4JY6B 2CUHA 1A8JH 5DQDH 2VLKA 3RWJA 4X5WB 5J11B 4JVWA 4PD4K 4YWGL 4JKMA 1OAXH 5LXGH 1NEUA 1FL6A 5JOEA 4M9PA 3B8SA 1J10A 1FRGH 3VWKB 4L8SB 2C9AA 1JIBA 1KT2B 1AIFB 4GO6B 3U2SB 4QRRA 3EDKA 4NHUB 1WSST 1N6UA 4I2XE 5F96L 3DECA 2P1YA 1MJUH 3BI9X 3MODH 4OD1H 2VH5H 4YHKL 3IDJB 3SDXE 4JDTH 2ADFL 1NBVH 3GSNB 1HHGB 3X3GH 2NNAB 3PDOB 1XR8B 1TQCC 3PQYA 25C8L 1MFBL 2G9HB 3CX5K 4P3WA 4PP1D 3ZTNL 4R0LA 2DJ4A 2DM3A 5DDHA 1CS6A 1OAUH 1OTUD 5BMFL 3BEWA 5DJAB 4LLAA 5KSBE 5D71L 2ZG2A 4PJ8A 1MQKH 4QRSA 3DROB 4P5KA 1FNEB 2GY5A 5KVDH 3T0DA 4LLUB 1IRAY 1KLUA 3TPUA 3WHXA 4E42B 5FDWB 1FE8H 4GKNA 1A7RL 2YD2A 1BEYL 1F3DJ 4FQLL 1XIWB 4KQ3H 3ARDA 3MLWL 3SO3C 1UADC 3U6RB 5EOQL 4HGKC 4C57C 3BEVA 4F58H 43C9A 5CSZA 2IH1B 4X9BA 4J3OC 3T2PA 1D5MA 1S7SB 1T89C 3QQ4B 4GKSB 1CICA 1H15B 1EH9A 4XNMB 1T2JA 3BZFA 2O93L 1J8HE 3CNKA 5EA0H 2GKIA 1FL3A 2WQRA 2R1XA 5JDJA 3AUVA 5C7XL 3PHQA 3HI6H 3EAKA 4JREB 4GAGL 3QWRD 3P0GB 4JFYA 4JQIH 3UTQA 4LRIC 4HG4K 1AQDA 5HVHC 3NVQA 4J3VA 2YPLD 1X9QA 2OTUB 1OCWL 2OJEA 3C6LB 3RUGB 5GS1B 3SDDB 4EDWL 4X4ZA 1I8IA 2FDBP 1DFBL 4OLVH 3ARSA 1A9BA 4R4BB 5DWUH 4G8IA 4OF5A 5BRZE 4LPYA 2ZUWA 2A6JB 3KJ6H 3QWOA 4WTWA 3VRLF 4KROC 2R9HD 1WEJL 3O3AA 4RGNB 4U1SA 4YXHL 4HIEB 1LEGB 5M94B 1PSKH 4UUJB 5F44A 5D2LA 5T3XD 1M71B 1KPUA 2EYRA 4XMKL 2D7OA 3GSRB 5E8NB 3GHEL 5ALBL 4JY4B 5DXWA 3QNXA 4O9HL 3MROB 1WAAE 2Q3AA 3IS0X 3ZE0F 3GI8L 4PB9L 3N1PC 4Y2DD 1GOHA 2JE8A 5IJVB 1ZK9A 5ISZA 1OTSC 4LHQB 1P4LA 3LEYL 1RJLA 3VXPA 3TM6A 2W60B 2BC4B 1MF2H 1KACB 1V3LA 1XF1A 1J1XL 4Z7VB 4BA8A 1RHHA 4CU8A 3BN3B 4N1CA 3UTZA 2B4CC 3QDMD 2DQIH 2PO6A 1L0QA 4AL8H 1TFHA 5MEQA 4X4XA 1UEYA 4QRQA 5I8CB 3HPJA 1W72A 2C4FT 3VFGH 4OI7A 4G8GD 4OZHF 1SJVA 3GFUA 4ELKA 2P5WE 1ZWIB 5INCA 1K5NB 4IMLA 3F58L 4IMKC 4HHAB 1JWSA 4HGWA 4LSSH 1TPXC 1BOYA 2PF6A 3VXRA 3UYRH 2A83A 2GY7B 1WFUA 3LHPH 4HIHB 4U49A 5EUOE 2NTSP 4F9LA 4F7TB 3PNWA 2Q7NA 1A14H 4CBPA 2DRUA 1WV7T 2WIIA 5ILTL 5HJ3B 5E2VH 5GRJL 4ZNCD 2ZUTA 4KK9C 4OIAA 1JE6A 2EXYC 1R5WA 5FV1L 4P2RB 3CDCA 3MLYL 4S1RL 1N2RA 3K46A 1CLYH 3WO4C 2E9IA 5KAQF 3G5YB 3UDWA 1LNUA 4I0PC 2F53A 2VAAA 4JFHE 3DGGA 4JPIA 4G7YL 3EYUH 4LCCA 1BLNA 1ZGLA 5IF0A 4P46C 4L9DA 1NGPH 4HWBA 3MACH 1D6EA 2OJZL 2PYEA 2I9TA 1OW0C 3SGJA 1QBML 3PABB 3PP4L 2W0FB 2WIMA 1Z2KA 5E95B 5HVFB 5HDBF 4QXTA 4QRPE 5I16A 4D3CH 3VRJB 2R0ZH 4JPVH 3TN0B 4ODBD 2AJUH 4ZD3H 2GTZB 1KB5L 2AK4A 3QQ3B 4LP4A 4ZS7L 4OQ1A 3LKRB 1ZGLP 3H7BB 4UNVA 4PJ7E 3L5WA 3HPLB 5HVHB 1X5XA 5F70A 1KG0A 2X4NA 3WN5C 3DI3B 1DQLL 1KCSL 2VXSL 3V0AC 1AGBB 2WUCL 4JN1H 4IRSD 4APQC 1G1YA 3B5GA 5EDXA 3I50H 5F1IB 2RFXA 4O51A 4XNXL 4OJFL 1P4BL 5J06A 1V7ML 5JW4N 1L6XA 2HMID 2R1YB 4OIIH 5F3BA 1IZJA 2YPKA 3AB0C 1UWEH 1P9MC 1BQLL 4JO1H 3T77A 3OKKA 4DAGH 4XPTH 3VXSA 3ZHKA 3V5DB 3SQOL 2DAVA 4D2NA 2BVUA 4Q6IC 4PV9B 1IM9B 1T1WA 3QIBD 2F19H 5BXFA 3ARVA 5H35B 4NC1E 4S2SA 3UTPE 3FQRA 1JBJA 2M26A 2CIIB 5F7FA 5ID1A 4PBXA 5C9JB 3D0LB 4N1EA 3Q2CA 1JPSH 5C0CD 3DHMA 2GJ6B 3MXWL 1QQDB 1U8KB 3QNZB 2VC2L 1GPOH 1NDGB 4PJHF 2PKDA 4K94C 2AXHA 3L3KA 1U6AH 2NY5H 2CLZB 4PJIF 3B9VA 4MQSB 1RUMH 3NCJL 2HN7A 4JVPA 4PJAA 3RTQD 4M7ZB 2AEPH 4M1DL 1JHTB 1R0AL 1DBMH 3E6HB 3DBXB 1RUPL 4NQCE 1M7DB 1T1YA 4ORGB 1E4XI 5DUMH 5JZ7C 4YDLC 1KJMB 3MJ9H 3VFMB 5E99L 1KLGB 4XCNA 2J4WH 1L9NA 3MJ9A 1CDCA 2VB5A 2I9LB 1SMOA 4L1HA 2CK2A 5A16B 1WGOA 4K2UH 2D7NA 2AJYL 2C3HA 2UWEF 3GNML 1DQJA 4IHOB 1TPXB 1T6WA 5EC2A 1L0XA 3PWNB 1FZJA 4WUUE 1P7QA 3EBAA 5J13C 5CP7A 3HG1A 1FN4B 3GSWB 3VU2A 3A6OA 1BECA 4KJYA 1PX3A 1YMMB 4OZGE 3T0ED 2WAHA 4LSUL 3UJIL 1YN7A 3U9UA 4XPAH 1DCLA 4U6HB 1QUNA 3CXDL 3N9GH 3B6SA 3WO4B 1C16A 4RFEA 4YAQA 1JYXA 3I84A 2ERJC 1NCDH 4G80A 1RJCA 3PWPE 1Q9WB 4PRPB 3VXMD 1T03H 4P46B 5DJ0A 3MRPB 3MUHL 4UTAH 3GKZA 5F88B 1A6TA 1A22B 2XQBL 4FNLH 5F9OL 1IKNC 1P6FA 3BP6B 4PJ9A 4WDIA 2NQCA 2ZKHH 4R8WH 5TE6H 3DX9A 3ZTJH 1MREL 2FEDD 4O2CA 3MRMB 4ZMAT 5CZXD 1PKQE 5C6WH 5KVFL 2CLVB 1T04B 2W9DL 5EZLA 3IKCB 5E9DB 1VPOH 5J9PA 3CSYA 2YC1B 3VW3H 4JJ5A 4K7FB 2N56A 2NX5D 5LQBL 5J6HB 4PRAB 3B2VL 4LMQI 3TV3L 1GC1H 4M93C 3BE1L 5D7IA 5GRXG 4HC1L 3R4DA 4DTGL 5JQHC 1C5DA 3WN5B 3ULVH 2JB5H 1F8TL 2XRAL 4Q9QL 2BK8A 2G2RB 3EYOA 5B4MC 1NANI 5B8CC 1U8IA 1YPZA 2VDMH 2FJHB 4JO4L 1UM5H 4DZ8A 3O8XC 5FGSA 2EIBA 3QQNA 4APQB 2AXGA 5C0BE 2F5AH 4A6YA 4JZNA 3RVVD 1P53A 3IVKB 4RBPK 1DBKL 1IAOA 3INUL 2CO7B 3GI9L 1K4DA 4QHNB 5JDSB 1INEL 2ICWI 3S35L 3ARFB 5F7WC 5FHBH 3AB0B 4JFQB 4HIXL 5DJ2A 3PWJA 4K3HA 4I77L 4PJDA 3WSQL 4KDVA 2O5ZH 3HR5A 4HWUA 2H26B 5C0JB 4YNYA 1QPPA 3U46A 5I8KL 3LMJH 3AS2A 2A6IB 4XH2B 5DHYA 2XN9B 3FTGA 1QSFD 3Q5TA 4EZMA 4LVOC 3MRRA 4XB8A 3QUXD 3L5XL 2GJZA 1BFOB 1CGYA 3MV8A 2H6PA 3K8KA 1XGUA 4FQXB 3PGFH 4V1DB 3D2UB 3A6CH 3ARBB 3WEXA 5IMMA 4LOUC 1H8OA 1KB5B 3KPRB 3QPQD 5I8EB 3IDUA 5MENB 3V4VL 4DVBB 3VXUD 1A6UL 1IGMH 5DJXB 4I18C 2EDNA 2PN5A 3C9NA 3VFTB 5HYFA 3L1OL 3MLUH 1AO7D 1GHFH 2HT3D 4YDLB 2Z31C 3DXAE 4OM1H 1F6AA 3T4YA 2SEBB 3SCMD 4JB9H 4TQEH 1TCRB 4YXKH 4DN3L 5J6GB 4X8XA 1I9IH 4WY7L 3L7EB 1U8OA 3CVIH 2VR4A 1GGTA 2X1XR 3WLWC 1NAKH 4U6VH 2PYFA 3QHTC 5IROC 5CWSA 2P8PB 4WGWB 5IG7B 3MV7A 5I19L 5GHWH 4TRPL 3IJSA 1KNOB 4UBDC 5JPNB 2NY7H 2YN5A 4XXCA 5IGXL 5EO1B 1EFQA 3LEVH 2JIXB 4G3YL 3E6FA 4XZUA 4FTVB 4YHIB 4IIQA 3HUJA 4OZHB 3HC3H 3TBVA 2ZJSH 4JANB 3RPIB 5I75C 1A1OB 2NZIA 1S9KC 3A67H 4JFZH 3QIWA 3VA6A 5C0EB 1YYML 2V5SA 1F2XK 1I3RB 3F12B 1AGFB 2DICA 2ERJB 2FSEB 4I3SH 4TTGA 3UC0H 1AGCB 1OOAA 2UZIH 3IF1A 3BKJH 4XX1G 5DYOA 4K3JL 2R29H 4Z76B 2BHYA 4RWHA 5D2NE 5D2LE 4C55A 4HLZG 5T1KA 1FLRL 3O4OC 4J8RB 4L4TB 5C0ND 1KN4L 5JO5B 1QKZL 4Z7NF 3O81A 5DA0B 4PP2B 3I6LE 4LHUD 1KYOK 1XF4A 3RWCA 2W38A 5E2UL 1BQHG 2F58H 1RULH 4OLWH 5GZNC 1NFDE 4G7VH 3W5NA 4WEBL 1WT5A 1CXLA 3J8F7 1DUYA 4YR6B 5IR1A 2XY1A 2R4SL 1E0OB 5EBMB 5E2TH 4JFFB 3O8XB 4H0GA 4WCYL 4WFHE 4RNRA 2EICA 1S7RA 5MHSE 1EZVY 1OGTA 3LS4H 2WBJC 4YEFA 4GG6F 1HN1A 5IFJB 1ACZA 1S9YA 3RP1A 4HKZA 5JW5A 3SKJH 1GAFH 2EEBA 5F7MC 2RBLA 3BKCH 5B38A 4GRWF 4NN5C 4S0TD 3QCVH 5K9JL 3KHOA 5CHNB 1F00I 1RJZA 2RR3A 4F9PC 2R8SH 4DGYH 5KOMC 3VD4A 2X70B 1LK3H 2BNUA 4OT1H 1EV2E 2EIDA 2P24B 4LL9A 4L4VE 4MJ6B 2DQJL 5LCVL 3IAPA 3JV0A 3BRDA 1J12A 2H1PL 2YRLA 4NOBA 5DD1L 4FQQB 4NZDA 2ENYA 4LVOB 1NUDA 2XWBA 3UJTL 3WE6B 4U1NB 1WWWX 3U7AA 1SMAA 4N1HB 4YQXL 3WFEL 5GGQH 3QA3A 1ZLSL 1DEEB 4HUUA 5ITFB 1UQSB 4ZNEA 3VWJC 4PBWD 4Y1AD 2VIRB 1IM3A 5I1EH 2AJSH 2H2SD 5KVEH 2YN3A 2FB4H 3MLPA 3RWEB 2GTWA 3K2UH 1IAII 5I1KH 4I18B 3RGVC 2UZYB 3B2UC 1KJ2A 1BIIA 4PJCE 1J0HA 1HDMA 2Z31B 1B0GB 3NACH 4S11A 2XZQH 3MOBL 2X44D 2EXWD 1L7TH 2WINB 1SYSB 4FZEL 3ZDZF 3HC0B 1UACL 1LDPL 4M7LL 4DCQB 1S5HA 4PJHB 1KCLA 5JPMA 3CFCH 3OAZH 4Y4KA 2HLFD 4R7DA 2XG5A 4PJIB 1ES0A 3RI5F 1C12B 1BM3H 5HHMB 5BVJA 3RGHA 4KKBD 3WNPA 4CNIB 5D93C 4N8VA 3DETD 4A2MA 1DBBL 5L2KA 5ICXA 2LE9A 1XGYL 4E5XB 3REVB 4F7PB 3MLSL 3KDMA 5C08D 1G9NH 4LNRB 2E7MA 2YWZA 4QO1A 3EO0A 3SGDH 1LEKA 1A5FH 2JELL 4UAOC 3C5ZC 2L4OA 1OQOA 4FRWA 4QYOA 1T1ZA 1R24B 2UWEB 1MCOH 2LVCA 1E4JA 2J8OA 4P4KD 2X1WL 2AQ2A 1NAMH 1MFDL 4Z0XB 4OZ4B 1A7QH 4YBQC 1NAMA 2VXQH 2R0LH 4TSBH 5CEYB 5JOFB 1JI2A 3Q5OA 3WXVH 1EHLH 2AV7A 3O4OB 2CD0A 1VB9A 3IGAB 3X14B 4KTDL 3CK0H 3EUUA 1EHNA 2B39A 3U4EB 1U3YA 1IJ9A 3MRJB 1FO0B 3TBWA 1MFAH 1J1PL 1SJEB 3C60C 3EOAB 5ABDE 1XR9B 5I1GL 3RWDA 3X11A 3G08B 3BPNC 1RMFL 3HN3A 3B9KD 4I8DA 4L3ED 1IAIL 4RFNC 3HE7B 5K9OA 1OHQA 2MHAB 2Z92B 3RJDA 1IMHC 3ALPA 2J8UA 1RIHH 3R8BB 1FBIL 2GK2A 1CDHA 1CK0H 1XH3A 5FYKE 3EOTH 3HA0A 1SVZA 4LSQH 3VGEA 4KMQA 4YPGA 3I02A 3NABL 1VCAA 4XP1L 1NBYA 5HPMA 5TF1L 4ZQKA 3V52H 3I3BA 1XGQB 2NXZC 1XGPA 2WBJB 2EEDA 1IL1A 1FP5A 5DJZA 2I27N 1NEZA 3EJZC 4RMWA 1F4WL 4Z8FL 4XP4H 4QT5A 4HT1L 2ICWB 3CFBA 1J18A 5L9DL 4TUJA 5GZOC 1QFHA 3CJJA 1NCNA 4OV6F 3BKMH 3BUTA 2DWDA 4HV8B 3BIKB 4G5ZH 4X8JA 4TOYH 1NGQH 3BGFB 3HG1E 5DK2A 3EYQD 2HVKA 1L6ZA 1LE5B 2ICEB 5C70A 2CMRL 5H37H 3VXQB 1OAXL 5LXGL 4WO4D 1T66C 4RMTA 1OGAA 4MA8L 3TWCH 1RZKL 4WI8A 3EZ8A 1FNFA 2HFFA 5K59E 2BVTA 4DKAA 2Z8RA 3IFPB 4YHYC 2XACC 3GJFH 3MRGA 4G6KH 4PB0L 2A73A 4ZYKB 1ZANL 4X83A 2CKBL 3EIFA 5DO2D 5HPOA 2HVJA 3I2CH 3GJFA 4OD1L 2XPGA 3OKNA 5EOCH 1Y18B 3PIQB 2ATPA 2KL6A 4XAKD 3KPNB 1MY7A 2D0FA 3VCLA 3RGVB 3JTSA 2HLAA 2FX7H 3OJDB 5L7XH 4M6AA 4XCYB 1MRFL 3MXVH 1CTOA 2VQ1B 5D7KD 1MQKL 3O0RL 3OG6B 2R2CA 4QTIH 1BD2B 4HZLA 2NY6D 3D69A 1FNHA 5KVDL 2BFVH 5I73C 5IB3B 3EHBC 3HC4L 3N50A 4BZ1H 1I8KB 3CC5B 5EZOH 3D85A 1FH5H 3RY6C 2P5EB 3UPRB 4UNUA 2OP4H 4L5FH 5DMJB 1KPVA 3WBDA 2M8XA 1FJ1A 1IAIM 4G8FA 5IP4A 1CBVL 2YPLB 1GOGA 1CGXA 1BF2A 2FX8L 5D93B 1UZ8A 2XXMB 4LQFL 3UEZA 1LO0H 4XP5L 5C0AA 4NM4H 4NKOB 1CFQB 1RIUL 5IBTL 4QOKA 2CJUH 1X5IA 4U1JB 3S34H 4ODXB 3PWLA 1HXMB 4UAOB 1E6OH 4RA3A 1QACA 3C5ZB 4EDXA 3QUZD 5EA0L 4F7CA 5BV7H 4PJ5E 1MCIA 4HDIA 5M95B 2P48B 1D5IL 4HMDA 4NKMA 4YDVA 3T1FB 1PZUB 1J9CT 2HG5A 2BSTA 5CINL 1MH5A 5DD6A 4J2XA 3TO2B 2VR5A 3BUYB 2FATH 1EXUA 2QKIB 4NKIH 3ZKMD 1WBYB 4KJQD 2Q86A 4YFLF 1FL5B 3EGSA 1A0QL 3O11B 4M6NH 2ITDB 4B53A 4XC1H 4ERSH 5GS3A 4LKXA 2WMPA 4QXGH 4CVUA 5IOPB 3NCYP 3DUUB 3QCUL 4R0LC 1X4YA 5SWSA 3VG9B 3C60B 2PCPB 4MS8D 1RK0A 3WIIH 4PJ8C 1UCBL 2Q87A 3TCLB 2Z93B 3KLDA 4RFNB 5FGCB 2AEQL 4IDJL 3HRPA 3DX7B 3ORJA 4RMRA 5FGBA 2YD5A 4MQ7A 1V3KA 5DVLA 2MSPA 3ARDC 4H1LA 5CP3A 4LHUG 3QDMB 3SE3A 2QLVB 4YFLI 6CGTA 2A74A 4OGYL 1ZHNB 4HFWB 1CI5A 1B4JL 5T3ZE 2AK1L 1A47A 4CJ0A 2HJFA 4OZIE 4XVTH 1A1NA 2NXZB 4G8GB 5MEPB 1CZ8L 4UT9L 1CICC 4YEEA 5GRUL 2LV4A 2J5LB 1F3RB 1WFTA 1UB5B 3IFOB 3MO1B 4MNQA 4JRXA 1C08B 4M6OL 2FO4A 4WFGE 5F7YC 2VDLL 3MA9H 1J8HD 1HHJA 3RBSA 3TYFA 3VI4F 5I18H 1JZ6A 3T04D 1YN6B 3MNWB 4OKVA 4MNGB 4AH2B 3HE6A 5CCKH 1W72L 2RIKA 5E6YA 4Y5VB 4NWTH 3QPXL 5D1ZA 1CE6A 4Y19A 4NDMA 1HKLL 2WV3A 4Y16D 3IDIB 4GG6B 3VFGL 4YHYB 5KSAA 1K8DA 2DF3A 2OXGA 1JVKA 3EYFB 5DK3A 5DTFA 4GRWB 2HH0H 2Q1EA 1C5BH 3FO2B 5BS0B 1F6LL 5BRZD 4ZOCA 5FKAA 2QSCH 2B8OT 3LH2L 1BQHB 4YHLH 5DJDB 5GGTA 5DEGB 1N4XL 5D1XA 4Z78A 2DLFH 3KXFA 4Z6AT 5EU5A 1V8HA 1PJ9A 2O5YL 4PJAF 1CL7H 2NY3C 5C07B 5HD8C 5AZ2L 2N7BA 3HTLX 1AGDA 3G6JA 2IJ0C 3P0YH 4BZYA 5I73B 2XTJE 5HYJA 1PY4A 4JAMA 4JGUA 2ZSWB 1KIRB 1UYWH 1S7QB 3FOLA 4GQ9H 1WICA 4LKCA 4K8RH 5GGVH 5I1AB 4HWBL 1JFQL 1TQBC 4FQ1L 2L0DA 4XVUD 4G6MH 3PXJA 4XGZA 1MOEA 2VLKB 3ZTJG 3EDDA 4XBEL 5KJRH 1TJIL 4PGEA 1YNKH 2X2YA 1IQWH 2PO6C 2XNAB 4XPFL 2EEAA 4F3FA 4OSUH 1FL6B 3MR9A 4N8CH 2GSIA 5IWLA 3OR6A 2XI9A 4YZFE 5GS0D 1TVHB 3JSSA 3K1KC 3QIBB 1P5VA 3K8MA 5TF0A 4R3SB 3MX0A 4LASL 5DHVH 3PQYB 1U9KA 4F9LC 2Y72A 1E4WH 3TZVD 4JN1L 1DDHA 1DL7H 5JOPE 4MD5B 2ZCKH 3FT3B 4NQEA 5JUEL 2CRYA 5DDHB 5E6ZA 4ZUUA 5KTEH 4PUBL 1QTYT 2W65A 4OAWA 4NYLB 3BEWB 4I9WE 3P9LB 4PJ8B 4O5LH 2MQCA 3C6SA 4P5KB 3T0VA 5KS9A 4LVHC 3EYSH 1FYTE 1FORH 5HDLA 4OCYH 3UDWC 3WHXB 4K23L 2D3VA 3KNBA 1NL0L 3RTQB 1ED3A 3MCLH 1DVFD 4LCCC 2F9BT 1QFUL 3ZDXE 3F7YB 3VWJD 3IXTB 4J1UB 5CSZB 5HSFA 5D7IF 4JFHD 2DBLH 4W4OA 3FCTA 3SGJC 4ZTOH 1D5MB 3K0WA 3AFLA 1CICB 3RRQA 1YPZF 3ULVF 3BZFB 1PLGH 12E8H 3D39E 4OI8A 4MXQC 4QRPD 2FYYB 3PHQB 2YOCA 4FFVC 1ZGLM 4G6AC 1QFWL 2XXCB 4JFYB 5GJSH 4Z7WE 1AQDB 3BX7C 2IPTH 5DUML 2QR0A 4JE4B 5DUPL 3QSKB 1CDBA 2OJEB 4X6FA 3MJ9L 1P84K 4PJDF 2VABB 1I4FA 1I3GH 1YQ2A 4NZRH 4J3TA 3AROA 2IPUK 4G8IB 1RY7B 4HJ0D 5C09A 5J0BA 3NZHH 4WTZA 2DYPD 3QWOB 4OB5H 3RWHA 2LU4A 4OLYL 4R90H 4KY1H 3M45A 3O3AB 2P42B 3BSZH 5FYJH 3O4LE 3F5WB 4EXPX 3U36A 1KPUB 3MCKA 5D9SA 2NY3B 2FO1A 2H9GA 2EYRB 3I9GH 1G6RH 3QNXB 1DQML 4PRHA 1YJDL 2AABH 1PW3A 3VXNA 1G6RA 3K8LA 2KDGA 3CH1A 3VFNB 4LNVA 4XNZB 1X3DA 3UTPD 1VFBB 4IRJD 5ISZB 1I9JL 1P4LB 1RJLB 3VXPB 1JGEA 4WU7A 4H25B 1QBLL 3U0PA 5DLMH 1GRWA 4ETQA 4KK8D 3IU4H 4NNXA 4NRZA 3CSPA 4C83B 1P1ZB 3LB6C 4LGPB 5JHLL 5TE6L 4Y89A 3UTZB 3QUYD 2PO6B 1TZGL 5BQ7A 5MEQB 4X4XB 5C71A 2F15A 3G6DH 4QRQB 2DN7A 2VDPH 3KYKH 4LCWE 1W72B 3HR6A 3RX7A 4RQQA 2AS5M 2DDQH 4M7KH 1EAPA 3HUJF 4NQCD 1KELH 1FAKT 4LF3A 1AKJD 4ELKB 3MGOA 2VDKL 1JWSB 1H3VA 4RMSA 3VXRB 2A83B 5FA4B 4LAQH 3ULVL 4EUPG 1PX4A 1XCTB 5F7NC 3O45A 3RVTC 4WI6A 5J12B 2WIIB 2XZAL 2D2OA 3DURA 4LRNH 1GL4B 2IANA 4WUUD 4A6YL 1B4RA 3SDCA 5DMIL 5LBSL 2EIZB 1QO3A 2ICWJ 2HJLA 3JBG7 1N2RB 4OIBA 4LVHB 4OBRA 1M05A 1F3JA 1IAKA 3OKEB 2Y1VA 1LNUB 2VAAB 2LU3A 3NGBC 3JV5A 1U8PB 3DGGB 4GMSL 1EFXB 3VXUB 1NGYA 3ALXA 3MC0A 43CAA 4LCCB 3QDGE 1BLNB 1ZGLB 5IF0B 4I48B 1UJTA 1AO7B 2BVOB 1D6EB 2PYEB 4G8EA 3SCMB 4PJ9C 1TCMA 2DQCL 3JTTA 2MMXA 3PWPD 4HW6A 3FO1A 1U8LB 4QXTB 2A0LC 2EH7H 4MMZC 4I0CC 3D18A 2Q7YA 4Q0XL 3IDMA 3VFRA 1ZSDA 3KPTA 3STZB 3T2NH 3NA4A 3KS0H 3VRIB 2VLLA 2AK4B 3PGFL 4PJEA 3QEUB 3A6CL 3QCTH 2V5MA 2CRMA 1YEIL 5K9QI 3IB4A 1J11A 5T3ZL 3FB6B 2E7HA 1IGML 1KGCE 4G6FD 2OSLA 2XKNB 2X4NB 1X5LA 1CLCA 4NQUA 4MSWA 2W0LA 5C0AE 2K7QA 4OM1L 4X98A 3SDXF 3S3PA 4TQEL 3EZJB 1CF8H 3GRWH 4XPHH 5K9KA 3ULVC 1U92B 3HAEH 2YS4A 2Q76A 2Y06L 1I9IL 1CR9L 3NIFE 3GRWA 4O51B 5IBLD 1NAKL 3SGEH 4XWOC 4PYHA 3MLXH 3DRQA 2CDEB 5C0BD 1FFNB 4XAWL 1CXEA 4ODUA 4NUGL 1RQ5A 5I8OL 2ZUYA 2GSGA 2X05A 3O2WH 1XGRA 3T77B 3OKKB 1LO4H 2MTPA 2X4PA 3VXSB 1VA9A 4Y4FA 4DGVL 2Z91A 1T1WB 4WHTA 1SEQL 3TESA 4HGMA 3KPMB 1BAFL 3PJSB 2C4FU 1OP3K 2VDRH 4ISVB 4PG9A 4KRPC 2HT2C 3QRFM 4HXAL 3BAEH 5ID1B 4KMTH 4S10A 5F89B 4EI6A 1HIML 4LSVH 32C2B 1VFUA 5TE7H 3V0WH 5CGYD 4JR9L 1YEJL 4I3SL 1MELA 4OF6A 1IE5A 3L3OB 4XHJD 1C1EH 4WW2A 3KYNA 2R29L 4QNPE 1Q0YH 4X5LA 4BFEA 2B1AH 3HS0A 4KV5F 3VGFA 2HN7B 4PJAB 4XNUH 4OD2A 3GHBL 4AJ0A 4L8BA 3QXDA 3VFWA 1T1YB 2VLJA 2VZSA 5DMGD 1WTLA 2APTA 1UC6A 2HJKA 4QTHA 3F7RA 3QHZH 2Y6SC 1HQRB 4ELME 3DXAD 2EC9T 4OLWL 2NY0C 4G7VL 2BNQD 3GB7A 1YNLH 5EC2B 3GMRB 2QSVA 1FZJB 3H7LA 3LN5B 1P7QB 3W82A 1Y6MR 4R97B 3GMPA 3NIDF 4HPOH 5D7SH 5CP7B 3RA7H 4HK3N 1RZJH 1DQQA 1OL0A 1OPGH 1I7UA 1A7NL 3IDYC 3TIDA 3WNMA 4KJYB 2WBWB 4XXCC 5E70A 1INDH 3GIZL 2XIDA 4P2QA 5JLZA 1YN7B 1NMAL 3UROR 3S88H 4WWKA 1YQVH 4IIQC 2BCKB 4JHBA 4E41E 4MAYA 1O5DT 3OGCA 4L8CB 1C16B 3SGDI 3SKJL 1WQVT 4Y1AB 4YAQB 4JFDA 3QIWC 3CFKA 3BKCL 3NGBB 4NPYA 1MLCA 4NZTH 1WAAF 3NCEB 3VFUA 3NCBB 5H37G 4KHTL 5DJ0B 4OT1L 3PE9A 5SX4I 3FT4A 1A6TB 1DBAH 2VQUA 1Q9LB 4X80H 4PBVC 2X4TB 4PJ9B 4PTUA 4JM4H 3EJYC 1CFVH 4KI1A 4O2CB 3UTSA 1UGNA 3NFSH 5EZLB 5FYJD 3MUY1 3GGWA 5ID0A 4EI5A 1N3NA 5HGAA 3UZEA 1UH4A 3CSYB 2FHCA 2DIBA 5IMLA 1AP2A 4N0CC 3CMGA 2ED7A 4BFIB 1VACB 1KJ2L 3I6LD 3TA3D 5CFHA 3ULSA 2PR4H 4GAJH 5DC4B 3K2UL 5HDQH 3NBNA 5C08B 5D7IB 1WT5C 4UT7L 1C5DB 2Z4QA 3EYOB 1HHHA 2DQUH 2XZQL 4LCIH 4ZPTA 3BDXA 1YPZB 4BZ2H 4ONGL 4NN7B 3V6OE 1L7TL 4DZ8B 5JA9A 4XVSH 3RKDD 4UV4H 5BZDB 2AXGB 4KFZC 4P4KB 4A6YB 3QJFA 4ZFFB 5DVNA 1IAOB 2XICA 4UQ3A 4ODVL 4WFHD 5AD0A 2PTTA 1MEXH 5MHSD 1WC7A 4P2OA 1QLFA 4N0FA 3O3EA 2WANA 3RZWA 1GGCH 3OKMB 4DW2H 2Z9TA 4KVNH 5DJ2B 3PWJB 4Y7MA 5EU6A 1RUQL 4ZAKA 3ILPA 5D8JH 4FQJH 2BNRE 4FHBD 4YNYB 3QG7H 3U46B 4AQOA 4KRPB 4NQEE 5TDNA 2QL1A 2GHWB 5JR1L 3FTGB 3FQUB 1WZ1H 4UIKH 3B9KB 2R56H 4N8PA 3BQUA 3ARQA 3GMNA 4L4VD 4M1CD 4ZUVA 3MV8B 5KS9E 3MRLA 1K2DA 2H6PB 4P48A 5T33L 4TSBL 2VMFA 1HINH 3WEXB 5DQJA 5IMMB 3O9WD 1LO5A 4QHLB 1JRHH 3HCVA 5BW7A 2OL3L 3DV6A 2IQ9H 3N1QC 3QDHA 1U58A 3D9AL 3DV4A 4GSDH 6FABH 4JZJA 3R1GL 3FFCA 1HH6A 1F6AB 4KKNA 4XMLH 4GRLA 1IARB 4XI5D 2NY4D 5TPWH 4TTDC 5ADOH 5FUOL 5EORH 1YEEL 2YK1L 2GAZA 1U8OB 2CSPA 2NY0B 3RVWD 5IJKA 4Y4KC 3ULUE 2IAMA 2HP4A 1ORSA 3W11D 2PYFB 2XWTA 1AQKH 3MV7B 2A9NL 3GKWH 1SM3L 3STLA 4WO4B 2R15A 3IJSB 2OCFD 5B3JF 5IBUB 2F54E 5H94A 1FNSL 8FABA 2GITA 5DRNB 4XZUB 3CU7A 3BMWA 4IIQB 3HUJB 4KK6C 3CCHA 1OSPH 1TJHH 3TBVB 1KJVA 5GIRB 4FQIL 3WFCH 1S5IH 1TLKA 2XWJA 1FG2A 1TTFA 4KDWA 4R4FL 1EUUA 4XCFH 1G7QA 2C26A 1G7JB 2R2BA 4CN1A 5KANG 3VGDA 3D1MC 2D03L 4OF7A 1JGDA 3IF1B 3TC9A 5DYOB 1OP5H 3L9RA 1OTTC 4HQQL 4YE4H 3G6AA 5H8DA 4L8DB 4WHYH 3SGKA 3B43A 4KPHL 4MAUH 1OP5K 3GBMH 5A3ID 4TUKH 5AZEH 4AMKH 1LP9A 2HKHH 2A77L 1XF4B 3RWCB 4DK3A 1CD8A 4JHWH 2E6PA 3VWKA 4L8SA 4M1GH 4G9FA 1KT2A 3RVXD 1AIFA 4DN4L 4KKCD 2DQTH 3IFNH 4XBGB 4POZC 1BQUA 1HH9B 5D96C 3QFDB 4WWID 3T0AA 3VJ6B 4UOW0 2VDNH 2B0SL 5IR1B 2E5EA 5J1TC 5INDA 4PLNC 1VGEH 3GSNA 1HHGA 3PDOA 1A6VL 3TYGH 4Z7UE 2EDWA 4J6RL 5FGRA 1EGJH 4RNRB 2AAVA 3GSOB 2BFVL 2G9HA 5FYKD 2EDFA 5EZJA 1YY9D 4BZ1L 1OGTB 1F58H 5GJTH 4MB3A 5DJAA 4KJPC 2DQFA 1S9YB 1ZMYA 1T0NA 3DROA 5DT1L 1FNEA 5JW5B 4U31A 1DTUA 4LLUA 4L4JA 4PY7A 3TT1H 4I2XB 4E42A 4X9FA 2R0WH 2COQA 1XIWA 2YEZA 3SDXB 5IFHH 1A1MB 2P47B 1NCWL 4DQOL 1KC5H 3Q0HA 1J88A 4I1NB 2IANE 4KRNA 1E6OL 2OTWA 3EFDH 1IAMA 4FQ2H 3CFJA 3HG1D 1T6VN 5JW4R 8CGTA 5CEZE 1FZKA 3ZYIA 3NFPA 2XWBB 3G6JF 3QQ4A 4KKLD 4GKSA 4XVJL 3DTXB 1H15A 2WWKT 4XNMA 5FA3B 3QA3B 3BW9A 4X7CC 1A3QA 4HUUB 1ZV5A 1WBZB 1QNZL 5FCUH 2OR9L 1A6WL 3FN0H 1F4YH 2ED9A 1Y6KR 1I85A 1HDMB 1ZEAL 2I60L 5F6IC 2OTUA 4S1QH 3C6LA 3CVHL 3RUGA 5GS1A 3SDDA 1J1OH 3OBAA 1YEFH 4GAYA 2QEJA 1S5HB 1D3CA 1FDLL 4L3AA 4R4BA 5JPMB 4Y4KB 3NIGE 4GT7A 2FGWL 1BOGA 4OM0L 1ES0B 3KPOA 4I4WB 3QT2A 5BVJB 5E7FA 4BH8B 1N7ML 2VDOH 2V9TA 1HK6A 5L2KB 3Q6GL 5ICXB 1FQ9C 2DMCA 4Y16B 1LEGA 2H45A 4ZG1A 3MQIA 4UUJA 2V17H 2C1OA 5ETUA 2VR9A 5JTWA 1HQ4A 3EO0B 2Q8BL 1LEKB 5F7KC 3WKMH 3HFMH 3QZWA 4KRMB 4PGDA 5E8NA 1DSFH 5KG9B 3MOAL 4MLIA 3LPGA 4RGOH 5DUBB 1JWUA 1WIOA 5IHUL 5D7LE 4HXBL 1T5WA 5IESH 5BRZB 5BV7C 3P4OA 1XF3A 1RJYB 5I1IH 1NAMB 4URTB 4PJ5D 5L88H 4GJTB 2BSRA 2IPUG 2BC4A 4PJXE 2DI9A 4NZJA 2DTMH 2AV7B 3KPLA 3IJHA 5HY9A 5D1QD 3H42H 4JKPH 1QSEE 3UYPA 1DZBA 3K81A 4HMEA 5EIQA 4JPKH 2V9QA 4K7PX 3TBWB 3V8CA 4EBQL 4GXVH 2HRPL 2ADIA 3BIBX 2IBBA 1F6FB 3RWDB 1JGUH 1SBBA 2HWZL 5J89A 1I7ZB 4OLZL 4S0SD 1A7PH 5GGTL 1VERA 3IDGA 3ZE2E 4TVPL 5FGBC 2M2DA 5GSVA 2CR6A 1JNNH 1XH3B 3SE3C 3AU1B 3QRGL 4YPGB 1CG9A 4V2BA 5BO1H 2VLJE 2VXVH 1NBYB 4F7TA 2Q3ZA 4ZQKB 4K7PH 4JFEB 3QEGH 5EU7E 4HS3A 1XGPB 1N0XL 5ESQA 1IL1B 5DJZB 1S3KH 2H41A 5T3ZD 1U3HA 1I9EA 4P2RA 2IGFL 1TETL 3T3ME 3CFBB 1J0KA 5IB4B 4TUJB 3KPQA 2DIJA 5T5NG 4H8WL 3G5YA 1M7IA 2DWDB 4LSDA 2VXUH 3TZVB 5DK2B 5LAXB 1TJGH 4Y4HA 4CJ1A 2HVKB 4WFGD 3HE6C 3GMMA 4ZFGH 3B4NA 3LN4B 1BF8A 3H9HA 5D1ZC 2EZ0C 1Z0NA 2WBKA 5E08H 2HFFB 3LPWA 1YEGL 4Z95L 4ODSL 1IGJA 3MRGB 4M48H 2A73B 5IHZA 3TN0A 4AEIL 3GJFB 3DARA 3OKNB 5JXAL 5KVGL 2GTZA 5FF6A 5I17B 4FFWC 1KB9J 3TBYA 4NIKB 1CLOL 4DGIL 2B2XH 3E8UH 3P11H 3H7BA 4OCSL 4ZSOE 4U6YA 3JTSB 4QY8A 1DL7L 3C2AH 5D1XC 5T1DL 2E6JA 5F6IB 4D0BB 4F33A 1F45A 5KTEL 2EH8L 5T5NF 2MOVA 4G42A 4ZFOA 4HZLB 3OB8A 1AGBA 3D69B 2E7LA 3H3BC 3QHFH 3SOBH 2HRLA 5F1IA 1FIGL 4GXUN 1VEMA 1N26A 2XTJD 3S36H 4F37F 2VISA 1FJ1B 1HZHH 2B7DT 3V4UL 2DLHA 3UCRA 1UZ8B 4ODTH 1ODAA 2R69H 1SJXA 3DYOA 5BVPH 4JZOA 4JPWH 1FNGA 1FCCA 2X4RB 2QQLL 2OX5A 2ZCLH 3EO9H 4UT6L 3FO9A 4PV9A 5IB1B 2CK0L 4EDXB 3RL2B 1QBBA 3BPLB 5D7JD 2DYPB 3RQ3A 3QULA 5IWLC 2DM2A 5IW1B 1EMTH 1OAKL 5HTSA 1NQBA 5FOBA 5BV7B 4WFEE 4YDVB 4M61B 4OF0A 3X3FL 2BSTB 3O6KH 1U8KA 4KI5F 4M6ML 5DD6B 4NP4L 3WS6A 3ZKND 4QGTA 3HMXH 3QI9A 2CGRL 1VKXA 2CLZA 3PL6D 2Q86B 4DZBB 1ZHKA 1FVCA 3TNMA 3HAEG 3U0WH 1UCTA 3BZEA 2O5XL 4M3KB 1AC0A 1RIVH 4LKXB 1H8SA 4HWEH 3DBXA 5DMKA 2IH3A 4DKEH 4HH8A 3QUMH 1KJMA 4FFZH 1UVQB 1T80A 5JOPD 5CD5C 2YXFA 1YYLH 3ZYZA 1MFCH 2DQHL 2X89A 1MFNA 4MXWH 4MYWB 4I9WD 1G7MA 5A16A 4IMKA 2OLDA 4MQ7B 4CVZA 3TPKA 3LKOA 4IHOA 4BELD 4H1LB 1FYTD 2YUVA 4JO2L 4MZ2A 1NCTA 1S9WB 5C2UB 1AY1H 4YIQA 1GGUA 2A74B 1G6RL 4P2CG 1X5YA 4GW1B 4W4OC 5F9JB 2HJFB 4PJFA 2PTUA 1A1NB 3MNZA 5I6XB 4W81A 3I6GB 3BYTA 4JRYE 1CD0A 4KRLB 2DLTA 4X6CE 1G0YR 4JRXB 4NCC2 5B39G 1JPGA 1GIGH 1HHIB 2FO4B 3IFLL 4P23A 3WDHA 4JY5L 3MV9A 4OTXH 3SJVE 2Y07L 2XFXA 4ZXBA 1VESA 3JWDH 3CLFL 5MEOA 3D39D 1ERNA 4OKVB 1LWRA 4S1DD 2IMNA 1U8HB 1Q9WA 3UTTE 2JLLA 1KJ3L 5D1ZB 4LARL 1CE6B 5GRVL 4NDMB 3RWGB 3QEQA 3KJ4C 4X99A 1OAYL 5CILH 3J7HA 5HGGS 1RZ7H 4IDLA 4M7KL 1BVLA 3RVUC 1T04A 5CAYB 5A2JH 3FQWA 4IRZL 3KPSA 1K8DB 1A3RH 2EKSB 2UUDH 3DWTA 1PYWB 4OCWL 5FDYA 1QRNE 1J87A 2BRRL 2MNUA 3L3GB 4YGVA 4ODWA 4K7FA 3V7MA 4CU6A 4XP6L 3ZKXC 4KKAC 1EO7A 1QLEL 3CMOL 1GCFA 4WW2F 2JJWA 1JGLL 2A6DB 2NR6C 3KXFB 5CEZL 3K4AA 1NCBL 3P30H 4GW5A 5I1HH 5JHDA 1TDQA 2G2RA 1AGDB 3LRSA 3G6JB 4MHHG 4UILH 5DF0A 1R3IH 1CCZA 1MNUL 1OD7A 2VSDA 3O4LD 5HYJB 1PEWA 3GBNL 4JAMB 5DD0H 1W8NA 1I1AD 4Y8DC 3PDGA 3T1WA 1SY6H 2BDNH 4HMCA 4LKCB 4U0QB 3PV6B 1F4XH 1OAQH 1SY6A 5F97E 4LEOA 5JDSA 3WFBH 3ARFA 4NCC1 4JFQA 4XGZB 2VLRA 1XF5B