4M7ZC

Unliganded 1 crystal structure of s25-26 fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
total genus 54
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC01
4F8QA 3V7AE 4JGMA 3S35L 4UTBH 4PJCF 1D6VH 3EJZD 1NFIB 4ZUSA 3C6LA 2E7CA 2XV6B 4I9WE 5EOTA 1TVDA 1AC6A 3MRMB 2YC1A 3QJHA 2XTJE 2F53E 2GAZA 2DQIL 4M7ZB 5A16B 3PGFL 1GGIH 5HPOA 4QRRA 2C3VA 3INUH 1AXSA 1SVCP 3I85A 5IFJA 1MCJA 5KN5B 4W4OA 2VDPH 4I3RH 1NCTA 1JZ8A 3UTPD 5IEKA 1FCCA 1B2WL 3HNTL 3T4AB 3PGCA 4DGVH 1D9KC 1FVCB 4U2YA 4P2CG 1M05A 2HWZL 2XZZA 5EUOF 3GMMB 1A3RH 3G08B 3OR7A 3S3PA 2EZ0D 1JGEA 3BSZH 1RZ8B 4LDEB 3UMTA 1XGQA 2JK5A 3HUJF 2BNRA 2VN7A 2WSKA 4ZOAA 2O5YH 5FYLH 4RA3A 5EU6B 3JSSA 4HT1H 5T33H 4Q0XH 1CD8A 2WNGA 4KQ3L 4PJGA 1I9IH 3JZ7A 3QR2A 3ESVF 4BFIB 2R0WL 2B4CL 3VXOB 3I6KB 2RQ8A 4JPKL 5DK2B 5FO9B 2FJHA 1RAMA 5F9WB 5B38A 1UWGL 2VDNH 1MREH 4JHWL 4ZS6C 1T22B 5BMFL 1T3FB 4TVPL 3B9EA 3BKJL 1LE5A 5ICYB 4ODXB 4RISH 5ETUB 4MMXC 2QHRH 2Y9RT 1DANU 1ND0A 1HCFX 1LEIA 2CRMA 1TZGL 3WDJA 1HNGA 3PP4L 2ZG3A 2B5IB 3RY6C 1TPXB 3EJJX 4LCUA 3LKRB 2NY7L 3HR5B 3TPKA 2R2HB 4X9GA 1MF2L 3SGDH 4ZNEE 5E4EB 3HE7A 3IVKB 4GG6A 3PL6A 2VL5B 4XVTH 1P84K 2NX5D 5LKNA 4PG9A 4OB5L 3MOAL 5EWIH 3OPZL 2PO6A 1AD0A 1NDGB 2BVPA 5EIIB 2CQVA 1FL3B 1XF1A 1A6WH 4L3AA 4Y16A 4PRIE 1L0QA 5C07B 1F2XK 3PWPB 4NRXB 1H3VA 5KVMC 1CGYA 3RY5A 5LGHL 1QBLH 3EOAB 3MNWB 4MCZB 3WD5H 4NKIL 3P0YL 1P6FA 3QB7C 1XR9B 5CILH 1FVEA 3RY4A 1DBBH 5F6HI 4QGYA 2BSTB 5TQ0H 1A6VH 3BXNA 4P3WA 4EDWL 5FA4B 1GRWA 4IMKA 1D9KD 4JG0H 4GRMB 2X4TA 4NRZB 4X5WB 1S78D 2V5MA 1HXMA 1ZTXH 4O2FB 4QCIB 4F7MB 1U41A 4MNHB 3MRFB 3BZDA 2VLKA 3FRUB 4NJAH 3NFPB 1Q72H 3E3QC 4K7PH 5LWYH 2EIZA 3OTTA 1J05A 1K3IA 1MCHA 2EXYC 5FK9B 1FG9C 5LBSH 4OBRA 2BC4A 3VWKC 1S7RA 3D0LA 2PXYC 2V2XA 3IAPA 4JZJC 4XPHH 1Q9OB 2HN7A 1QLFA 4RAHA 5EOCH 1VACA 1FRGH 5D2LA 3RPKA 1XF2A 2I60H 4ZUTA 4F2MA 5FM5O 3QI9B 3AMLA 3EOTL 3PABB 3R06B 2FYYA 5IVZA 3T0ED 3U9PH 2DQGH 4DUXA 3WUWG 1MCWW 2CDFB 1RZ7L 4DAGL 1KEGL 4G80A 1CDBA 3ARBC 4E9LA 3S37X 2GTZA 3N1PC 4GFTB 1HQRB 3FB5B 3LQZA 5DHYA 4X9IA 3FKUS 5CBAB 4JFEA 2P5EA 1FNSL 1KJ2H 5MP6H 1CLOH 5ALBH 3MLUL 4EVNB 3O3EA 3DMMB 1V3KA 1K8IA 2ICWI 1HINH 1UM6L 3OJDB 2FX9H 3D18A 2X7LA 4G3YL 3LS4H 4M03A 2PYFA 5IHZB 1QPXA 1UYWL 5FM8A 1WZLA 4RX4A 3VXUB 4YGVB 3SCMB 1I7TA 4L3CB 3Q1SH 1XGPA 4YHLH 5LAXB 2OTUA 3MCKB 4X7TA 3RRQA 4PJ8D 1AHWC 1OT1A 1S7TB 5J3HD 4PV9B 1FO0H 3MLZH 3MOQA 2IPUG 2W65B 1AY1L 1VHPA 5T1DL 3QDGB 3QI9D 3MLWH 3QNZB 1KFAH 1NDMA 4H20H 4I5BA 5I1JL 3V5HB 4Z7OE 1J0ZA 3WIIH 3F7QA 4JFFA 3NCYS 4HPOL 2Q7YB 4WFGE 4F7CB 4G5ZL 4QOKE 5IESL 3PWVB 4AZ8A 3QCUH 4RAUB 4LF3A 4U1NA 3WJJA 5D8JH 3LPWA 3KPOB 2FATH 2V2TA 5GQBA 4HJGB 2F19H 2YD4A 4PJFB 1NUDA 1QG3A 4TRPL 3BKJH 4JY4B 4D0DB 1JE6A 3BD3A 4LPWA 2DDQH 5FV2A 3QDMA 4ZFFA 3BQUA 5EU6E 4LU5H 4XX1E 2I07B 3MNZA 4ELMB 2C3WA 4WU7A 3SHSA 4KRPC 5I74C 1OPGH 4X6DE 3U7WL 1OVZA 4WY7L 3WO3B 1FC1A 3AU1B 2DQHH 1WITA 4ODSH 2Y25A 1I7ZA 3RWJA 1T7VA 2NY1D 1S9KC 3X14B 1HSBB 3GSQA 1URLA 3QISA 3QEQB 4HJ0C 4HXAH 4Y4FD 5DMJB 4Y5XB 4UINH 5BRZD 1TJHH 2W60A 3MRRB 4M7KL 5D96C 3BHBB 1CFVL 1EEYB 1UACH 4XCCH 2GW5A 5T3XH 1JPSL 3SKOA 4L4VE 5HHVH 4JRXE 1XF4A 5LG1A 1BFSA 1INDH 5IMLB 4J6RL 1NMBL 4MAYC 3MLYL 4MJ2A 4FQCH 1J8HB 2GQHA 4POZC 5D2NB 2YBRB 5KW9L 1A6VL 5GHWL 1DBKL 2FD6H 3HG1B 4H1LG 4HMCA 4LOUC 3PHOB 1NSNL 3QO1A 4PJ5D 5EORL 4AIXA 1N4XL 2BFVL 3TFKC 1YZZA 1F4HA 3QNYA 2J8OA 2Y5TA 5I8CA 1NGPL 1KJVB 2FX8H 4FHBD 2WUBH 4JFDD 4UT9L 3MODH 3CK0H 5CEZL 4L3EE 5A3ID 3NTCL 2VDLH 2BVTA 2P24B 2XA8L 3BEWA 3MBEC 1NJ9A 1ZLWK 4DN3H 3AROA 1FE8H 2SEBA 1R3HA 2FO4A 4HJJH 3TNNA 1I7UA 4WHTA 4NT6A 4KJYB 4DKFL 1FSKB 4MDIA 1U8LA 1WIPA 2BX5A 2OZ4H 5FECA 3CFCH 1MFNA 1NEZG 4S1DD 1FYTA 1G7JB 3WS3B 4Q6IC 1DSFL 2ATPB 5D7LD 3TJHD 2AK4A 4X6DB 3KPSE 5TGBA 2FHBA 1UZ8B 4HKBB 2CLRA 3O45A 5GS0H 3WFCH 5I1EL 3QPXL 5IG7B 3EW3B 3RIFK 2A77L 5CHNA 4U0QB 4XT1C 2OR9H 1KJ2L 2ESVB 5MP6L 3OAUH 5JW4Q 1CLZH 2OCFD 3LDBC 4BUGA 4LEXL 2F74A 4OFPA 3HUJE 3HI1B 1B90A 2JCCE 4Z7VB 4PJBA 4NNYA 4OLXH 4FABL 5IVXB 2XA3A 2VABA 5KSAD 5BOPA 1JTOA 4YHKH 3B43A 1BZQK 2CGRL 5ALCL 3RJQB 3E0GA 5E8DH 3GSOA 4YUEL 3OKKA 1CIUA 3KS0J 4Q9RH 2VDKL 2IH1A 4QRUA 5H94A 3X3GL 4NQVA 5D7IE 1ZOXA 2GJ6B 3BZFB 1U8IA 4JLRA 4M43H 4M5ZL 2G9HB 2VSCA 5EZIH 2L7JA 1MEXL 4Z76A 1ZGLP 1F3RB 3FRPA 4P48A 4PLKD 1ZWIB 1A6UH 1KCRH 2LV4A 4LPVA 2J1KA 1MI5A 3QFJB 2X44D 2ICES 3EYFA 1BP3B 4YZFF 2EDHA 1BX2A 2FJFB 3L3JB 4ODUA 3BVNB 4ZFOL 4QLRA 1CL7I 1E28B 3UJTH 2OK0L 3STLA 5MENE 2VUOA 3MRGA 3P77A 1EXUB 5F9JA 4WJ5B 2CIIA 4R2GC 4OCWH 3KPMB 3B2UC 1R6VA 2G5RA 5T1KD 1FLRL 2B2XH 1R24B 1MIMH 2D0GA 2AJSL 1S9VA 1CGXA 2FEEI 3KWWA 4G43B 1KYOK 5C0CE 4X6FA 3NFSL 4P59H 1HWHB 5JXAH 4GRWB 4M7KH 1IM9A 5L88H 1G6RH 4FQJH 1EFXD 2K3TA 1JBJA 3VXQA 5D71L 4CRPA 1KCSH 2AK1H 2RCSL 4X6CA 3FQTA 3H42H 3P40A 1INDL 4LEOA 2DJSA 3RWFB 4FNLL 4RGNE 1NMBH 2V5SA 5IB1B 4MXVF 1M7DB 2BY0A 2IC2A 1RJLA 1BD2D 3H9SA 4LL9A 1A4JA 5HPMB 1KTDB 3B5HA 3IF1B 4LBEB 4OJFH 3ZLQC 2OMNA 3P4MB 1GHFL 2A1WH 4GBXA 5ERWA 4LVOB 4QXTB 1A2YA 5EUOB 5TE4L 4OIIL 4YK4B 3H9HA 3LRHA 4JHBA 3TC9A 1I85A 3MUGA 5E6ID 1YEEH 1IFHH 3EO1B 4NDMA 1SJEA 3EYUL 4B41A 1I3GH 1AXSB 2XQBL 3IJSA 4XI5C 1YEJL 5HHMB 4HKJB 4L29A 3GSUB 4LOUD 3HC0A 4YHZH 3L9RB 5D7JD 5JXEA 2I24N 1RZ8A 5IQ7H 1AFVH 1BVLA 4KQ4H 2XWJB 4MMZC 5MERB 2XG4A 4OLYL 3ULSB 4ZQKA 1E4WH 2Z4QA 3IXTA 2DN7A 1WFUA 2NY4C 1OSPL 2IG2H 4XVUD 4MZ2A 2HMIC 5MENB 1MFAH 2JJVA 2NX5B 3WJLA 1JGEB 5I71B 1MQKH 2R56H 4IMLA 4XHQA 3ZT6A 1FG2A 1FBIL 4IRJD 1OLZA 2DQCL 4OZ4B 1Q9KA 1EHAA 3NCEB 1IGJB 4UB0L 1BMGA 4I18A 2DLFL 5F88A 1LEKB 5EPMB 3VFPB 3C9NA 4QHNB 3TBVA 5C9JB 1P4BL 3QUXC 4OGAC 3EBAA 1X6NA 2E9WA 2W07A 2V5TA 1AO7D 1YN7A 2QR0B 4LPYA 3RU8H 3LMJH 3LB6C 3VFNA 5D7IF 1OTSD 1NCNA 2W91A 4DN4L 5HGGS 1WBXB 3VJ6B 5E2JA 4KROB 4FZEL 4HJ0D 5JW3H 3HE7B 4JDZA 3PXHA 4YZFE 3IVKA 2QADC 3B5TA 3ARGB 5EU4A 1CXEA 4IRSA 4XMLH 5TDNB 1XF3A 4ONFL 2P7TB 3U30C 1OAKH 4NZTL 2VIRB 5DGQA 2CKBL 3V0VA 4QRPA 2A83A 4LCUB 3H3KA 4QF1B 3CPLA 4GQPH 4KAQL 4NQDB 4XPAL 3IRZA 1KNOA 1NGZB 1MCCA 1R5IA 4JO3L 4OLWL 3U0WL 5C0DB 4KI1A 5C9KA 4M7LL 5EZOH 1QUNA 4OM0L 1ZA6A 4PG9B 4NJ9H 2EXWC 3MSPA 5D1XD 5ESQB 2HJFA 4O4YH 1RZ7H 3VRJA 4DAGH 3X12B 2HWZH 4P23B 1QHPA 5I71C 5TE7L 5LGKA 1QFWI 1U8QB 1JV5B 3I50H 4E42B 1EAPA 2BSTA 2H9GB 2QLVB 3O6KL 4CVWA 4GLRH 3EOAA 3SDXB 2DWDA 2CRIA 4TTGA 5HI3D 1HDMA 4DWHA 1SJHA 4HGWB 2R0WH 3BRDA 4JPKH 4LMQI 4YNYA 4DVRH 5E8EA 2DQEH 4L9DA 4GAGL 2B1HL 3FQUA 1KG0A 3GSRA 1DBML 3TBTB 1I9JH 2BHUA 4A6YA 4HHAA 4U6VL 3HG1E 1KGCD 2BC4B 4G6JH 1DEEB 1J0JA 1MWAL 2VLKB 3FRUA 4N0YH 4OCNC 5IB5B 2Q6WA 4F3FA 4KJWC 5CINL 5C0JA 5M95B 3MJ9L 4HX1B 1VACB 4MXWH 5D2LB 4S10A 15C8L 4KMQA 2EE6A 2IADA 3M8OH 5FYKL 3R06A 4FQLL 5HDQH 1Q9OA 4JFYA 1A7BA 3QG7L 4FXKA 1W0WA 5DD6A 2IAND 1XR8A 1KTRL 2WK2A 5BV7L 5BXFB 1IGML 3G5YA 3QUYC 1MJ8H 4JRYB 4LLMB 1T7XA 1YMMD 4QTHA 4ZD3H 4K7PY 4WWKA 4UNTA 4XNUH 4UZGA 3G5ZB 4LHQB 4J3UA 4H25A 3LSOA 4CU7A 1OHQA 1RUAL 3L3GA 1YUHA 2OJEB 3BH8B 1K8DA 3OX8B 4M9PA 4LHUB 1J1PL 3BP4A 2BOBA 4NO0D 1BM3H 4QKXB 4Y19E 3DSNA 2FEDD 2NY4B 3BMWA 2NNAB 2MQ3A 2OI9B 4QT5A 3UTTE 3LIZH 1GPOL 5KSVB 4UQ3B 3VFGL 4ZSOB 4ZXBC 3MROB 5IR1B 4XP6H 4IS6B 1E0OB 3SEPA 3MV9A 1L4IA 3FO1A 2MPAL 5DJ8B 5C6TH 4K94C 3VXNA 5ID0B 4S1RL 5EU6D 5CLWA 1FVDA 4LVNB 2HRPH 1XF5A 3PHQB 4U1SB 3MJ6A 2WP3O 5JPMB 5CGTA 2ERJB 3CZFB 4FFYH 4YX2L 5IVXE 3TEUA 4OFIA 3TFKD 3FL7A 1IGYB 3AREC 4JREC 3O8XC 1KACB 3WKMH 1OD9A 2R1YA 3SOBH 1OAQL 4U1NB 5A16A 3IDYC 1AH1A 1YYLL 3DV4A 3ARVA 5JW4N 2VLLA 4CUCA 3LKPA 1NC2D 2WINB 4QRRB 3F8UB 1KUMA 3L3OA 1FGNL 4MJIA 4JZOA 1IC4H 3EOTH 3WUWA 1KLGB 4OGYL 3PWPE 4YXKL 2ZCLH 4NQCD 3FTGA 5F7EH 4PJAE 3DRQA 3MLVL 3N9GH 5HDOA 2X6MA 5E70A 1WF5A 1ETZA 3CH1B 3RTQA 3CDGB 4P49A 3MRPA 2ED8A 1M05B 4HQQH 2E9BA 4MJ6A 4KKCC 4ZUWA 4L4TE 1G7MA 3QH3A 4R2GB 5DURB 3GIZL 1XZ0B 5IEHA 3BN9C 3P30H 1SJXA 2VLRA 1UYWH 1KIPB 5KOVC 4CJ0A 4F57H 1LE5B 4TN9A 4HWUA 2P5ED 3KPQA 5FKPB 3U0WH 3QEQA 4N0FB 4LSSL 1U3YA 1S8DA 4K3DL 1UA6H 5D2LF 4YFDB 2K7QA 5IIEB 4UTAH 4JFZL 3FO9A 5IKCB 5AZEH 3QHFH 3C6LB 3HE6A 1WCBB 3S9DB 1HHHB 1UWEH 2NY0C 3P73A 4P23D 3ESUF 1T6VN 1G7PA 3WE6A 1BJ8A 3LKNB 4LMQE 3KLSA 3M07A 3O0RH 1KENL 2J8UE 2GJJA 5AWNH 2GTWB 4ELKB 2R0KL 3C2AL 3ZKXB 4YBHA 5E5MB 5C08D 5EG6C 1RZFH 5IMKA 4JKPH 4HIXH 4ZYKB 4DTGL 2RAMA 1FFPB 5GRUH 4FOMA 1ZVYA 4L4VB 2YD1A 3CFJA 3MV9D 1C12A 3F58H 5FAAA 3F6IA 1TQCB 4TUKH 1QEWB 1WT5C 4G6JL 4QHKI 5DD5H 2HVJB 3I3BA 4NNPH 1PKQB 4JFPA 4XVJH 3QNXA 3HAEA 1KPRB 4JDTL 4PBXA 3L95B 1JCKA 1WT5A 2Z31B 5D4QA 3RTQC 1YY8A 4U1HA 1JPFB 1NBVL 4OD1L 5L7XH 3SE9H 2Y06H 1LO4L 3NFPA 4IMKC 5BV7H 4QTIH 2ZUSA 3U46B 1QSFE 4PJ9B 3OWEA 3QDGE 3RDTB 1YNKL 2LQRA 3IB4A 4ZD3L 1V5JA 1NLBL 5I8KL 2MWCA 3BE1H 1LO0H 1DFBL 2DIAA 1QR1B 1AXTH 4M8QA 1G7QA 3B83A 4IM8A 2QJDA 5CEYB 2DL2A 4KV5E 1RUAH 3NGBC 4UMGA 3WFBH 1FL6B 3H3PL 1TVHA 5DJCA 4LASH 1NUGA 4XAKD 3IAGC 4YDLC 5KW9H 1SYVB 4FFVC 4HF5H 1Q8MA 3ZKSD 1QKZH 3U6RB 5HHOA 3WFDL 4IHOA 3FZUD 3MACH 4QEGA 4Z7UF 4JANB 4BQCA 1V05A 4XP6L 4HXBH 1LP9B 1LNUB 1P7QD 3EGSB 4C56D 5BV7C 1CDCA 1CFSB 1LHZA 4JLRB 1C5DA 2A6DB 3D3VB 5A2JH 5KVDL 3FB6B 2F58H 4J7RA 1D5ZA 3OJDA 5TFSH 1LGVA 3SBWA 4CW1A 3QA3A 1JGLL 2GT9B 3DSFH 2H26B 3QDJA 4GW1B 2XRAH 5E94B 4M93B 5IJVB 4G8GD 1VKXA 2DLIA 4BSVB 3SO5A 2FSEB 4L3CA 1PZ5A 1MCDA 4LKXA 2VN4A 1NEZA 4L4TA 5C1MB 3U2SB 3MJ7A 1N5AA 3KDMA 3CVIL 2PYFB 5IHZA 2NZ9C 4KDWA 2N7AA 1WFTA 4DKEL 1EXUA 4KY1H 4LARL 5IT2H 3NFNB 3FN0H 3OB0K 4FXGA 2OTUB 2ERJC 1CL7L 3ARZA 1OD7A 3O9WD 5DRZA 2A6JA 4ODUB 3EYQC 3NCJH 3TWCH 1OSZB 1JHTB 3CIQA 1ZLUH 3LS5H 2OR9L 4BYHA 1MFCH 1MPAH 2C7UB 5EOQL 2FIRT 5L9DL 4HJGA 4X6BA 3B6SB 4N0CD 3QIWB 4P5TD 5DS8B 1KPUB 1OGTA 3KR3H 3O2WH 2RR3A 4KHTL 5BRZA 5BVJA 3SE8H 3PP3K 1UWXK 3WL9A 5FYLD 4KKLC 4CVZA 2F54E 4YDVA 1F02I 5IVZB 4CADB 4UIMB 2Y4SA 5IW1B 3HMXH 5HHQA 1JGVL 4Y2DC 4UDTB 1HI6A 4L3EA 4PR5A 4TTDC 2BSSA 2CJUH 5DFWH 4P2QB 1WQVT 1QLEH 4KZEL 4I4WA 4WFGD 3QAZB 5EZIL 3VXPA 3T2NL 3BHBA 4NNXB 1U91B 2IALA 3D18B 3QQ3A 4M61A 5I1KL 3FQWA 3FT4B 3MV8B 5CEZE 4OF5A 4KU1A 3VXUA 3LKOA 4I0CC 1TMCB 4U1JA 1SEQH 2V5YA 1U36A 3EOBA 4RGOH 1BQHA 1U8NB 2ZSWB 4GS7C 1L6ZA 4HFUH 2X1XR 5DO2D 4XNQA 1KCVL 5D7LB 5JDSA 5I16B 2JCCF 3QUKB 4QHUA 2XY2A 3RWGA 3T0WA 4F9PA 1HEZB 5CSZB 4OD1H 4PV8B 4IRZH 3U7YH 5EU5B 3JWNC 5L7XL 3P4NA 4K07A 4AJ0A 4YDIH 3S4SB 3RVVD 5JR1H 3EYQD 3BRGC 1RFDL 3O2DH 5FUOL 1KJVA 3SKNB 4AEFA 4W6WB 3PWVA 2Q86A 1WISA 3LB6D 1VDGA 3CFEA 4UOJA 4KUCF 3CSBA 1G7LB 3V52H 1GZQA 5F7FA 4EUPH 1DUYB 4IMLB 5IROC 4AEIL 2Y5TB 5I8CB 1YEKH 5EUKB 1P1ZB 3QAZC 5KJRH 3OV6A 1YJDC 2H2SD 5DHVA 1E4XI 1CIDA 3BPCA 3QDME 4X80H 3IFPB 5CAYB 1T2JA 1II4E 2ITCA 2VITA 3ARDA 2FGZA 4HUNB 3F62A 5H2BA 5F9DC 1ZSDA 43C9A 5KTEH 2X4PA 4UV7H 5FECB 3VFVB 3B9DA 4QYOA 4Y5XA 3DX7B 4JM2B 4O9HH 3MRRA 4PLOB 4XX1G 5E1AB 1M4KA 3MMEA 2A83B 1F3JA 4DGYH 4QF1A 5FCUL 4P2RD 1KN4H 3DSFL 1MHPL 5DJYA 4Z7WA 3MFFA 3I6LD 4UUJA 5DK2A 5FO9A 1CXIA 1S5HA 3CLEL 1A1OB 5CBEA 3SDDB 3AAZB 2R29L 4Y4HA 2IPKA 3MXWL 4V1DA 4PB9L 3VGFA 5EBLA 1UQSB 2IG2L 3ULVD 1LQSR 3TYGH 4OI7A 2Y7QB 5JHDA 1ZLSH 2J5LB 2ICWB 5T1KB 2A9MH 2ZUWA 3PHOA 1BM3L 4AG4L 4W68A 2PKDA 2FD6L 5I8OH 3GHEL 5FGCE 1S9WB 5GISL 3HPLB 3QNYB 1MCRA 2P5EE 4RMTA 1AGCB 4X4XB 1SJHB 3GI8L 1DANT 4M93C 3UJJH 5EC2B 5F1OB 1NLDH 3VGHA 2D4FA 5BVPL 3ZYOA 3V4VL 1BFOB 1ZT4B 3O6FB 1HQ4B 1HK6A 3VWJD 4NOFA 3NAAH 1DUZB 1DN0A 1F90H 2B4CC 4AQ1B 3PNWB 3TO4C 4Y1AB 5JW3L 4HS3B 1JNNL 3BKYH 3EFFB 4MB3A 5J3HC 4O2CA 1F4WL 2HT2D 5GGSB 3WS3A 3GBNH 4JQVA 1X5HA 5AEAA 1BX2B 2FJFA 2H8PA 2GUOA 1KB5B 4PBWD 3UTZA 4F7PA 5FUCC 1BGXL 1ZVHA 1EHLH 3QZWG 1D6VL 1PLGH 4OUUB 2R4SH 1INEH 4HUUA 1XR8B 2R9HC 2VLKE 1ED3B 2F54A 1J1OL 4J23A 1AKJD 3D25B 1ZT1B 1O5DT 4WRLA 3S7GA 3KJ4B 3FFCB 4Z7QF 4GKSB 2W0PA 3IDJB 4D8PA 3HNSH 4Q58C 5I1KH 4X98B 3MJ8B 4OZIA 4KI5D 5KAQG 3MLXL 4U49A 3LRSA 1JK8B 4OLXL 3PQYD 4KI5E 3MLTA 4NQTA 4I3SL 1YNTB 4ZUTB 3QZWA 3KJ6L 4XWGH 5DEFA 1T1YA 2QV2A 4PS4H 1GC1H 1XGRB 4JFZH 2DYPB 5CJ8A 3LKQB 4X9FA 4YDLB 1R3JB 3KYKL 2IANB 4TQEL 2W0FA 1LWRA 2GTZB 5C0EA 4GRWH 1MCKA 2EXYD 5EU7E 1CE1H 4TUOB 3W2DH 4KKAD 1SY6H 3IJSB 1IAKA 1MELA 3DI2B 4YQXL 2P5EB 3WCYA 4QXTA 4LPCA 3AS1A 4PJ7B 4NUJB 4CAGA 1K8IB 1EBPA 4Q9QL 3C8KB 1BZ7A 2PR4L 4BZ1L 1OCWL 1J8HE 4NM8L 5FKAB 1IC5L 4CKVX 1WV7T 1P4IH 3RGVB 4YXLL 4OZFA 2AJZA 3UTSD 1AO7A 4OTXL 3TH4T 2YWZA 1IM3B 1CU4H 2I26N 2IAMA 4P57B 5DC4B 1RZIB 3IS1X 2Q8BH 1BOGB 5HVHB 4MD5A 4N1CA 3QXDB 1OAYH 4HIJB 4TYUA 1UM5H 2Q1EA 1Z9LA 2B2XL 3B3IB 3BP5B 1KXQE 5K59F 1SBSH 1NANH 5BS0B 4WO4D 5FKPA 4N8CH 1XZ0A 4WTXA 2Y06L 2Q7YA 1AHWB 4WHDA 3X3FH 5EFIA 3UBXI 2JELL 3RWHB 2DQTH 1UJ3A 4YR6A 1ZHLA 2BCKA 1K3ZA 4GXUN 1Q94A 4PJAA 3X13A 3BUYB 1GGCH 4XMPH 3L7EB 1XGUB 4LNRA 1Z5LB 1BECA 3TA3B 5D9SA 5IQ9B 1R3KB 3WD5L 1FAIH 3VI3E 3HZKA 1N2RA 2IH3A 1UXWA 1OAQH 4A2MA 2EYRA 5CJOL 1EO5A 4L1DA 4DKDC 1JHKL 4RWYL 1HILB 4PGJA 4ODHL 5IMOA 4XPFL 4JZNB 4LFHD 4M1DL 3CFJB 3RWDB 4QRPD 2F53A 1I8LA 2FECL 4P3CL 1J12A 2W60B 1ACZA 1KLUA 4Y88A 5ESAA 4NCDA 3RWIB 1ZLWH 3T0EA 4R7DA 4YDKH 2CLVB 3PDDA 4K3HA 2V9TA 1DBAH 2XWTA 3HFML 5JPNA 2YK1L 3OKEA 1DP0A 2R2CA 3HS0B 5E2WL 1BREA 1L7TH 3X17A 3C5SA 5CZKA 1FORH 1IKFL 2X40A 3JWOH 5MENA 4N68A 5I2IB 4PJIB 4OCRL 1YY8B 4U1HB 2YBRA 1SM3H 3NIDE 2XZCL 1EFQA 4M5YH 3MYZA 5GJTL 2UWEA 3B9AA 4XAKE 4N9GA 4FTVE 4Y5VB 2G60H 3N06B 4MS8C 3CCHB 3DVIA 4XP4H 4PJEA 4KTEH 5GGQL 4HK0A 3C9NB 4QHNA 1Z0MA 3BP7A 1BWWA 3K4AA 5ID1A 3TLRA 1TQBB 2ATKA 4HGMA 1CZ8L 2HJLA 3IFLL 5AZEL 2HG5A 1L7IL 5INDA 3L3IA 3CXDH 2X4NB 3QIWD 4EOWL 1LE9B 1CLOL 1KULA 1D5MB 4QHLA 2DYPD 2YA2A 3BP6B 2AV1B 4GUPB 1H0DB 3O0RL 4KMTH 3T3PF 3DO7A 2WZPD 3TYFB 4Q74A 1NJ9B 3C2AH 1ORQA 1QYGH 4HUWB 3ZTNL 2IBBA 1RIUH 2ZPKH 3JTTA 1SYVA 4NT6B 3S36H 4YC2C 2ZUVA 1OM3L 2FDBP 4G9FA 1C5DB 2PYED 1F42A 5GZOC 5HGBA 1EIBA 5AYUH 5TDPB 2BRRL 5CFHA 1RU9L 1PQZA 1LDSA 4ZDHA 3W9EA 3OKYA 4W4OC 1HKFA 4RQQA 1FO0L 4GJTB 3WNLA 5KZCD 1MHCA 3UC0H 1NCCH 1UZ8A 4HKBA 1AY1H 4P5MB 1CICA 5DGRA 4NJ9L 4Z78B 5FO8B 1DBJL 3CLFL 3AY4C 3BWAA 4HH9A 1IGTA 1FV1B 3C8HA 3IDMA 3NZ8A 3KDMB 5IWLA 1NCBL 4QNPE 1EEUA 2NW3B 3RVWC 3I50L 5IB3B 4IOIB 1F3DH 2F74B 4JVWA 2WV3A 1CBVL 2DD8L 3KPSA 4WO4B 4ETQB 1N7MH 4UQ3A 3RVXC 5IVXA 5JORA 4ZSOA 2DDQL 1B88A 3X11B 4YNYB 5SWSB 4URTB 4Q6YA 1TJIL 3GSVB 2OMBA 4M7ZC 4YFLF 4ZFOB 4XVUC 3ROOB 1C08B 5DQ9A 4PRNA 2HKHL 1F6AB 2AABL 2F8VA 4LIQL 2WWKO 1PY4A 2NY2B 4XMKH 3GO1L 5HYEA 4UDUA 4P46C 1CD9B 3RHWK 4ERSH 3O2VH 4P4RB 1J0YA 5ADPH 3BIKA 3BGMA 1MFEH 4JFOB 2NY6D 2DLTA 4YFEA 4Y19A 3FTGB 2VLLB 2W9EL 1WBZB 5TDOA 4RDQF 3VWKB 2DWEB 1QSEB 3KXFE 4MJIB 1MCEA 4MWFA 3AS3A 4PUBL 5GGTA 1AQKH 2GJ6D 2NXZB 4LSVL 5BO1L 4FQLH 1YN6B 4UDTA 1HNFA 3VD5A 1NMAL 2GJ6E 1O7VA 2BSRA 3H3BC 2VDNL 4JFEE 1EGJA 4JQXC 3RNKA 1TNMA 1INQB 2B39A 1WJ3A 2IBGA 3IDIB 3MV7E 1YEGL 1U58A 1T2QH 4CVXA 1IT9H 4JFDB 1IGFL 3C5ZA 4H1LA 5I9QB 2LU4A 4JEGB 3O9WA 4LCCB 2QSCL 1R24A 3H9ZA 1QSZA 3P9MA 3BP4B 5H35A 2FL5B 5IIEA 3CDCA 2ADIB 2KKQA 5CP3H 4QOKB 3K4ZA 1W0YT 1YC7A 4XP1H 3B4NA 5GRVL 1D6EB 4MLIA 4E5XB 3SN6N 4ZMAT 5ILTH 3NIDF 1U3HD 3L5WB 3LAFA 5FYJU 1TJGL 2BNQE 3VXQB 4RFEB 2O93L 1WTLA 5SX4H 4EN3D 2J7LA 3D85B 2LU3A 4XNMB 2VXQL 1A1MA 5FA3A 4NM4H 4JY6A 4AEEA 3CLEH 1A9EB 2OX5A 3SGDI 3GI9H 4ZOCA 4EDXA 3IKKA 2NR6D 2RBLA 4BZ2L 3MGAA 3O2WL 4Y7MA 5FGSA 2D31B 1DQLH 3OKNB 1DDHA 4OI9A 4RMVA 3U4BL 1TCMA 3ZE0E 1JVKA 1A2YB 2XNAB 4ZYKA 2MJWA 1H3PL 5KOMC 1MAML 1FGNH 3SJVE 4GBXC 4KJQC 3R8QA 4DK3A 1PFCA 1PG7L 4Y4FB 4Y1AE 3W0WD 3MLZL 4JJ5B 1DUYA 4LFHG 3SBWC 2VYRE 1NLDL 4Y1AD 4MQ7B 4LEXH 3UCRA 4LVOC 5B8CA 4M7JL 4J3SA 2NY3D 4I0PA 2HLAA 2J88H 1KC5H 3UXFA 3T2NH 2XKNA 5HJ3B 3WXVH 3ZKQD 4YHML 1A02N 1F90L 2MKLC 4F9LA 5DZLA 1UM4H 5FF6B 2VDQL 1DVFC 4CMMA 3D2UB 2AJUH 3CZJA 2RHEA 1JL8A 1RSFA 5C6WH 4XAWH 4LU5L 2VDPL 1GIGL 1XH3A 1RIHH 4FFWC 5KVFL 1DQML 2CKBB 3SKUD 1FG2B 4JPVH 1EFXA 1NCCL 5DQDH 1R5VB 4TVSa 3HLAA 5CKGA 1IKNA 1BVZA 1KN2L 4LSSH 1MI5D 1RZJH 4O58L 3OGOE 4ZNEA 2AJVL 1OP3H 4GXVL 1LEGA 4JG1L 1ZS8B 5CJQH 4JE4B 1M71A 3U36B 5T1KA 1FZOB 1UWEL 4U1IB 2UZXB 1HHKA 5JQ6L 5FUOH 1ROWA 1MAJA 4YDJB 1UACL 1AD9B 4LPUA 3AC0A 3ES6B 3QUXB 4YFLI 4D0BA 5TDNA 4XXDB 3SO3B 1FFPA 1D5XB 5EC2A 1VADB 1V3JA 3LV3B 4QRPB 5DJXA 4IRSC 4FQ1L 3GEWB 4EEEA 5ANMB 4F33B 3ZTJH 3MTRA 5HGDA 3QUYD 3FFDB 2XG5A 35C8L 1U2HA 1E6OH 1NCDH 1QBMH 1WZ1L 2ZZUT 1MHHA 1R5WA 3GKZA 2VAJA 3ZSTA 1J0IA 25C8H 2BMKB 2Z91A 3BWUC 3TBYA 4FXGB 1IEBB 3D6GA 4Y4KD 2JTDA 3EJYD 4UAOB 1NEUA 3HHRB 3QUML 1JI2A 4NYLA 5D1XB 1P53A 1CT8A 4LHJB 1FNEA 3ZDYF 4KRLB 3GGWB 1WAAA 1KB5A 2FX7L 1A7NL 3G6AA 2DQJH 5DRNB 4JGUA 5JTWA 1A6WL 2VC2H 3D85D 4M1GL 3GSRB 2ED9A 4PJ8C 5I15H 5T1LD 4X5XA 2GKIA 2VQ1A 4OBSA 2M2DA 2J4WH 5DSCA 3WFBL 1EK3A 3QRFM 4YDVB 4CADA 4LASL 1KBGL 5C2UB 1JK8A 2LTQC 1WWBX 3IDJA 5C0JB 1MJ7H 1T0PB 1OL0A 1FIGH 2GFBA 1Q9LB 4F7TB 2GIYA 3FMGH 1U8OA 4PTTA 3K2UL 3ALPA 1KELH 2WAHA 3BRFA 1ZMYA 1V7MH 3LRSB 1RUQL 5HHQB 5T3XL 5E0QA 4L8BB 4PJ5A 2MCPH 3L5XH 2H32B 1DJSA 1W8NA 1G9NL 3U4EB 1M7IB 1J8HD 3HZYB 4L8DB 2Y36H 1MUJB 4CDGC 2VO5A 3GUTB 3B9KC 1MJJA 4JB9L 5E4IA 3VXRD 5KN5A 1MWAA 4UIKL 1T04A 3MBEA 2VAAB 3MZTA 4PRPA 1GVIA 4GRLC 1VGEH 1XCTB 1A64A 2K1MA 2X4RB 4X9BA 1MLBB 3MLRL 1UKQA 2VDOL 1I3RA 4GRWE 3H2WA 1GGBH 5JDSB 5C92A 2BOBB 2ENSA 2JJUA 2DQUL 3QIUC 4U1JB 2DI7A 6CGTA 3GSNL 3EOBB 5IB2A 1OLLA 3UTSA 2AS5M 3FN0L 4M7JH 4P2OA 2LE9A 3MROA 1WC7A 2XXMB 1K6QL 5DMIL 3UTQA 4Q7DA 3D39A 4M6NH 4WV1B 5CCKL 5KSAC 2IGFL 2Q3AA 1H5BB 2PTVA 2J12B 3NTCH 4ZXBA 5HYJA 1A6UL 2NY2C 2NY3B 5EBMA 4MAYA 1GZQB 1WEJH 3CFDB 1OP9A 3FO0H 1FZMB 1S3KL 2JIXD 2D0FA 5D1ZA 5EUKA 4MX7B 4FQ2H 3WLBB 5T3XE 3V79C 4NQXB 2GHWB 3CH8A 4Z95H 5IB4A 2LAAA 1WTGT 3THMH 1G7LA 4M7LH 4P4KD 1DEDA 1RZJC 1PDKA 1T6WA 4WHYG 2XZQH 3VG0L 3N85H 4EQ2A 2OL3H 5HSFA 1CWVA 4TULH 3WFCL 5MHSD 1MIML 1CGWA 3HZKB 1TTFA 5F6IC 5IBLD 2ARJA 4PJDA 4KRPB 4J3VA 5HYIA 3T4YB 2FO1A 5F3HB 3VFVA 1HHGB 3PL6B 3KXFB 4JPWH 5DVMA 2ADGA 5CP3A 1FDLL 1T0NA 2EICA 43C9B 5E8NB 4R90H 1T0MA 2Z93B 4MNQB 3E3QE 1QYGL 2FIKB 3FHQA 4KK5D 4EI6A 1Y6MR 5AG8A 5FOBB 1RURH 4UUJB 4PGDB 4GG6B 1HILA 4PP1D 1OCWH 3H0TB 1VFAB 5IBUB 4IOSD 3C8DA 5E8DL 3C5JA 4Z0BL 5JPNB 4U6VH 3MV7A 35C8H 3NCMA 2QSQA 3KPRA 3DXAD 4Z7QE 5D70H 1A7OL 1KLUB 4HEME 4WW2F 2Q8BL 1GOFA 4FTVD 5DI8A 1LK2A 1CFQB 2ZOLA 4N8VB 4R7NA 5GS1C 3W9DB 3KPLB 4JHAH 4D9LH 3UAJD 2UVEA 4P9ML 1P4LA 4PBVC 2DF3A 4YHPA 3MRFA 4M3JA 1KCRL 2EDFA 3E2HB 4AQOA 4PJEB 2WQ8A 4GO6B 1EO8H 2O5YL 2EDKA 2HJLB 2YUVA 5DZNA 4CNIB 5INDB 3BJ91 5F3BA 4M02A 3V52L 1TCRA 3VD3A 1W72L 3ULUF 3TBWA 4L4VA 1HIMH 2PW1A 4X4ME 1JFQL 3QUZA 4KZDH 1WBYB 4AM0B 2OSLA 5BMFH 3HMWH 3DUSA 1PAMA 3SCMD 3PJSB 3LD8B 1S7XB 1X4XA 4RWYH 4Z0XA 3FRPG 5D6CA 1KIQA 1ZGLM 3PUCA 4JM2F 1V7NH 4WUKH 4LKCA 1ORQB 1ACYL 1BFVL 3OKLB 3W9EB 1LK3L 4RMRA 4RQQB 3UTZB 1KIRB 1I85C 3C6SB 2AQ3A 5FGRA 1AR2A 4NO0A 4AIZA 5E6ZA 1F3JB 1FN4A 1I1AB 5KS9A 4TSBH 4PJ9A 5EWIL 3GRWL 3T77B 5ESVA 4OQTH 3TJHC 1PYWB 2DBJA 2JB5L 2Y36L 5C0GB 5HI5C 3MRLA 2WP3T 5E2WH 4QY8B 5K33A 3VA2C 1SYSA 2VJXA 4Y8DC 1WVZA 3HZVA 1EUTA 1QSED 5BQ7A 4PP1C 2AQ1A 2VLKD 2VISA 1JNHB 2XZCH 5IB3A 5EC1B 1Y0LB 4WI6A 4HG4J 1S9WA 1F6FB 3WJLC 1I7TB 2O5XL 3REVB 1UB5A 4X7SH 1PEZA 3GHEH 4O02L 3GDBA 4YWGH 1WZKA 1OGAA 4R4BB 1T1YB 1BBJA 4JFQB 2JKXA 1B9ZA 4QXGH 3PWNA 3K8LA 1K2DA 1BVKB 1F6AA 1KTLB 4PJEE 4WUUE 3EJYC 4K9EH 3OKMA 4DZBB 1S9XA 2XQYG 2GK2A 2UWEE 1OY3B 4G6AC 4I3RL 5IOPB 4MWFB 5FHAH 4N5ED 2GYSA 1HCVA 4F7CA 4MQSB 4F15C 1OM3H 4ZFFB 4M8VA 1K4DA 3ZYZA 3CAFA 1VFBA 1T89A 2CMRL 3RIFF 5IEKB 5FM5M 3VG0H 3NA4A 4TULL 4Y16C 5I74B 3HRZA 5EDXA 4I77H 5D6DC 1UCBH 5EIQA 5IK3A 4A2LA 4HUUB 3FCTA 3VXMD 3NZHH 4JQVC 4Y5YB 3MFGB 4E41B 3STZB 2MKWA 4NN6C 5I19H 3D0VB 4YHMH 3O41A 1WAAE 1GOHA 4DQOL 5F70A 2AJXH 3NCBB 1LD9A 2VDQH 4BJLA 3KYOA 3TH2T 3BPOC 3HNSL 4PJGB 4PREA 4PJHB 4OZIB 3L5WA 4C83A 4YHOH 4LNRB 4P46D 3UPRB 1BAFL 3G5VA 2R2EA 4RCAA 5C0BB 1T22A 4ZOBA 4KAQH 3RWHA 4XNUL 1UJ3B 4YPGA 1Q94B 4PJAB 4TSCH 4KJWD 1RK1B 3OR6A 3WFHB 3EDJA 1ZEAL 4JFDE 2X41A 3O2VL 1LVEA 4MJ5B 2QKIB 2AJVH 4PY7A 3MR9B 4XVTL 2C3VB 3GSXA 5I75C 5B22A 1GOGA 4RMUA 1OF2A 2E7LC 4YK4C 1XIWB 1F58L 1I4FA 3RWDA 2EIDA 5D1QC 4JY5H 5F6HJ 3RVVC 1NDGA 5KSBF 4HWZA 4MQ7A 2DQEL 4Z7VF 4A6YH 4KKNA 4XP9L 4BH8A 4MA7H 3DHJA 5GZOD 4YXLH 4EI5A 3CC5A 2JK5B 2MCG1 4C58B 2ORBH 3BO8B 2Q20A 4H5SA 4ODWB 1YMHA 2P5WE 4UV4L 1IC4L 1G9MH 2JJTC 5FA4A 1Q9WB 5CSBA 3G6JB 1VEPA 3C08L 2EXWD 1T7ZA 2D9CA 3E8UL 4NJAL 1YEEL 2BNRB 3SKNA 1XMWA 3E6HB 1Y6NR 4NQEA 1I3GL 1ERNA 3GMLB 3LHPH 3BUYA 4APQC 4HDIA 3VU2A 5CHNB 5JIKA 4NM4L 5E2TH 2JF1A 5JOFB 1LE9A 3MUJA 5IROA 5FM4A 4NKOB 1WK0A 4NGHL 3SPVB 3V5KA 1JF1A 4QHMA 3VG9B 3MLYH 3GSOB 2PTUA 2DQGL 2UVFA 1J1PH 2YA1A 3U1SH 3PABA 2VABB 1U92B 5GRXG 1A47A 4XBEL 1IVLA 1NSNH 2R2HA 3FO2B 4G80B 1IC7H 3SQOH 4TPRL 5HBBA 3D2UD 5B38G 2ENYA 1CDJA 4GW5B 2FEDC 2VE6A 1CICC 4S1RH 4F58H 5DJXB 2WUBL 1RJZB 3BPLC 1U3JA 1XR9A 5CD3B 1I8LC 4OGZA 1QNZL 1HKLH 4K3JL 1ADQL 5DK3A 3L5JA 2AK4D 1Z9MA 4HIXL 4U6HA 3SDCD 1A6TA 3ZKMD 3MRGB 3P77B 1B0RA 3QO0B 1VGEL 1AE6L 3FONA 5AG9A 4DUVA 4GRMA 3QHZH 4K3EL 4GAJL 3MCKA 2DKMA 2Z8SA 3KPMA 1RIHL 4OCRH 4QRTA 2UWEB 4Y4HC 1DVFD 2Z9TA 4RGNB 5ENWB 1NKRA 3QEHA 1PG7W 4QO1A 1P7KB 3GSVA 1MJUL 4HK0B 4YXHL 1JPGB 1BWMA 1UKSA 1CXHA 5DJ2B 4XP4L 3ARUA 5DD1H 5IW6B 2CIIB 1AGCA 2IQAB 3TGXA 3PHSA 4U1MB 1GGIL 1MAKA 2V2WB 5DURD 5L2KE 5TPWH 1NBYB 4Z7NF 2WBJC 3P0VH 2VXSL 2E27L 5E9DD 3FQTB 2GFBB 1EX0A 1FYHB 1RZKL 4NN7C 2M8XA 1IQWL 1XGTA 1XF2B 4E41E 5DR5L 1N6VA 2Y07H 4WEUD 2Q87A 2APVA 4FQ2L 5I8KH 1W0VB 5T5NF 1K85A 5JOPD 1D3CA 2R1WA 3QWOA 1KGCE 3MRQB 3P4LA 4EUPG 2VQTA 4CVXB 4PJ5B 2OBGA 5IGXH 4ACPA 4K71B 2GUOB 4OGXL 4ZPVB 2VXTL 2X10A 3GMNA 1H3XA 2ARJQ 1IZKA 4GKNB 3S34H 3DVFA 4NPYB 1S9YA 3HZMA 5DJ0B 5TF1H 3UP1A 1C5BL 3MV01 5F1KC 3JWDC 5CGYD 4L8BA 2QSTA 1VSCA 1JF6A 4XP5H 3MA9L 2O61B 3ARFB 1HZHL 1UXSA 1HXYB 4HXBL 4HT1L 4DZ8B 2BP3A 3B2UD 5T33L 1JUFB 1F58H 1XGPB 3PDGA 1CBVH 1MFDL 1T5WB 2B4CH 4QXWA 4X98A 2DD8H 1XCQB 3L3JA 2X4RA 1SJEB 5IWLC 4JKLA 4MCYA 2D7TL 1SEBB 4RISL 2AAVA 5E8PB 1TJIH 5KS9E 4NO5A 2AEIT 4QXUH 5EO0B 1FZJB 4POUB 5GHWH 5FA3B 4WGWB 5GGVY 4S0SD 1AJ7L 3IXAB 3HE6C 4NO2B 4I18B 1FNHA 4O51B 4NQXA 5ADPL 4WW1B 5DJZB 4O9HL 3O4LA 4PJFF 3BFOA 1OTTC 3I3DA 3EJZC 1FFNA 4GMSL 1Q9KB 5IVOA 1P84J 2R8SH 3TZVB 2P48B 4NUJA 4KI5F 2HLAB 3BYTA 4PUBH 5C6TL 2BSRB 4OLVL 3LQAL 1NCUA 4R8WH 1F4XL 3QCVL 4S1QL 3L5XL 1LO0L 4TOYL 3IDYB 3MLSL 3VE0B 1A3QA 4LSRL 1TZIB 4PRIB 1KJMB 3FQRB 1JIBA 1IMHC 4OZFB 3I02B 3TVMB 3WN5A 3HI5H 5DRWB 3W39A 2C3XA 1QOKA 1KIUA 2PW2B 3AM8A 2A73A 2AK4B 1ONQA 1YPZA 2DKSA 5B4MD 3ILQC 8FABA 1D6EA 4E5XA 5GGVH 2F15A 3BD5A 4L5FH 1KJ2B 3N50A 3GHBL 3C09C 4PGDA 4X6CF 5F96H 2H9GA 5GRZA 4KK8C 1A7PL 4DUWA 3WFZA 3FOLB 5SWQA 4WHCA 2APFA 3T0EE 3V6FA 5IP4A 1TTGA 5F7LB 1N5YH 5BS0E 3HG1D 4KKBC 3DWTA 5FO7B 1P7HL 3L3DA 2DBLH 3RIAK 2ZOKB 2OS7A 5HGAA 4OT1H 3ZKXC 3KLHC 3SGJC 1ZLUK 3CVIH 1F2QA 43CAA 5JXED 1PLGL 3TBWB 1KCVH 4DGIL 5FHBL 3EDKA 5E8EB 5EPMA 4OCXH 1NGWA 2EDJA 3BISA 1BOYA 4F33A 2ICEB 2OL3A 4M6OH 1IEHA 3LS5L 3L3KA 4YDIL 3LKSA 3EHBD 5ITBL 3MLUH 4M4RA 4P2RB 4JDVA 1YC8A 1RZGA 3RVTD 4LDOB 3T0AA 4OLZH 2NY6B 5EZJB 4WFHE 4PGZA 5CP7B 3QFJA 3GGWA 1G7IB 3T65B 2IPTH 5B8CC 4LLVB 5IHUH 4I3SH 2AJUL 4C56A 3V5DB 3UJIL 2QQNL 3JTSA 3QDAA 3RX5A 3WLWD 3SDAC 5DUMH 3CMOH 1NGYB 5D7LE 2ATPA 2JLLA 3AB0B 2ESVA 3OKLA 1GAFL 3KJ4C 1ZHNB 3CCHA 4YO0A 4OM1L 4J12A 1R0AH 1KN2H 3CSGA 5EU3B 4NQSB 3DLQR 5F89A 4H88H 3FB7B 4ODVL 4LCWB 2P49B 1OTUC 5FV1L 5IR1A 2OI9C 1NFDE 1JNLH 3WHE1 1T4KB 4JREB 4KDTA 4PRHD 2WBWB 1I9EA 4D0CA 1E4KC 3MRHB 4FTVA 3CU7A 1PSKL 5C09B 4N1HB 2IH1B 3JTTB 1M7IA 4MYWB 4NHCL 3KS0H 1F5WA 1JZ4A 5B39G 4R97C 1Y0LA 3H7LA 4R4FH 3DIFB 4OJFL 3U7WH 4DVRL 1GHFH 3O8XB 2L0DA 3BIAX 4RRPA 5HGDB 1Z3GL 4NIKB 5HYSB 4DZBA 1FNGB 2YEZB 5C0AE 1IAII 3U7AA 3DURA 4D9RD 2DM2A 3TT3L 3WUWB 2HRLA 1U6AH 2VZ3A 4PLJC 3L7FB 1IC1A 3ROLB 1QKZL 4LRNL 2QADD 3OJMB 5DMGC 2IMMA 3HRZB 5MEND 4WWKC 4JZOB 4YGVA 3SCMA 4IEFB 1FNEB 3KPSB 4L29B 1A9BA 1AFVL 4KQ4L 3FCTB 4IOFD 5KVDH 4AEIH 5IB2B 4OLYH 2YUZA 4FQIL 1YEKL 4R96B 3G6AB 1X9QA 4P4KC 4E41A 1EAJA 5DHVH 5SWSA 5EIVA 1MJ8L 4KXZI 4ZFGH 4WV1A 5C8JA 4OKVB 3HI5L 3OAZH 3IDGB 2AXFB 4OQTA 3H7BA 2J8UB 3GM8A 5C0CD 3O6ML 3UBXA 1C5CL 4PTUA 3CVHA 4G42B 1FRGL 4ODTL 3KPPA 1Q1JL 5BZWB 5C08E 4PJ8B 1TETH 5C86A 2DM3A 3CDYA 3V6BR 3G5VB 3S88L 5GGVL 4P46A 4LF3B 1N0LA 3JWDL 1Q9LA 5I1DA 1QFUL 1WBZA 3RWFA 2DTSA 3O4OC 2KBGA 2LTQB 3MCLH 5DUPH 4PJFA 4NBXB 3K4DA 5I1GL 1QD0A 1S8DB 2EEAA 2EE9A 2ADGB 3K2UH 2ESVD 3DXAA 1EGJL 2C4FU 4FZEH 4X6CB 5DDHA 2X5PA 4FN0A 4PJDB 4MA3B 4XXCA 4BA8A 3I75B 4L8DA 1MVUA 2W9LA 4LGPB 1HH6A 3OXRA 1TTUA 4LVNC 1CICD 4I0PD 3OR6B 5HGHB 5FYLE 4PJXA 1WZMA 4M4PA 4H8WH 3QQ9C 5EBWA 1YEFH 3NA9H 4NQDA 3SE8L 3HI6H 5FOBA 4AG4H 1KEML 3IGAA 5F7NC 2EDTA 5MEPB 3CNKA 1EEYA 1PKQA 1LO3H 4BH8B 3IFLH 4LQFH 3ZDXF 2H45A 2VKXA 3RWEB 1H3UA 4NZRL 4M6MH 4XBPA 4NRYB 5E5UB 5CEXB 4F58L 5DMIH 5AD0B 4BQ6A 4YHPB 4WW2B 1NFDF 3JWOC 5ITFB 5AUMA 3SDCB 4X5LA 2L4OA 4M6NL 2ZUUA 2A0LD 4MD0A 1FJ1B 5ADOL 4XCNB 8CGTA 1HDMB 4PJ7F 2PR4H 4OZ4A 3TO2A 3E6HA 2H6PA 2VLRB 4G8EA 2QQNH 2NY3C 1QTYT 3W0WA 4OF7A 3P11L 4Q9CA 2YPKA 3KPQB 1QRND 1WBYA 1Q9WA 2ZUYA 2W9DH 4JJHA 4MA8H 1ZLVK 5C09D 5JQHC 2Y6SD 2VH5L 1B4JH 2XNAA 4WEBL 4M5ZH 1MCQA 4PJEF 1JTTA 2Y6SC 3K7UA 2NCMA 4MXWL 3V5KB 4G8GE 4KHXL 5FUCE 15C8H 2H3NA 1HHGA 4PRID 1F13A 2P42B 4OCMC 4MVBD 4ORGA 1LNUA 3QI9C 4HXAL 4BQ9A 5KG9A 4IOFC 3ULVE 2PCPB 3D3VA 5C0FB 3S37H 3FB6A 3K8KA 4P2YA 4NKQB 5BV7B 3T77A 4NQDD 2X9YA 5EU4B 1HN1A 5D93C 4LLMA 2E5EA 5DJAA 3V0VB 4C54A 3V4UL 1CFSA 3SDCC 2A6DA 4KK9C 2NXZC 4WHYH 5GZNC 3MV7B 3RL1A 3FO2A 2VXTH 4YHYB 2X4QB 4BQBA 3MJGX 3WNOA 3C60A 4JCLA 2EEDA 2BY3A 4UOW1 3GSNA 3ISWA 1YMMA 5CUSH 1KFAL 5C0CB 1EERB 3DVNA 1BEYL 4EBQL 3OGCA 1N4XH 2VZVA 1DQQA 3K3QA 4WI5A 5DRZB 5JZ7C 1RHHB 1TVBA 4G6KL 5F7DA 3EO0B 1IGCH 4P3CH 3VFOA 5IFAH 5CLTA 2OZ4A 4P2QD 5LJYH 5ICXB 3AREB 2P1YA 1IC5H 2X4OB 4QWWD 4H26B 3VFTA 2XN9B 3EFDH 4ONGL 5H94B 2F54D 3ULVL 1YYLH 2B5IC 1WUNT 3SE4A 4NHUA 4CVUA 5KAQF 3FQUB 2I5YH 4LSTH 1CDIA 1OPGL 2OTWA 1CU4L 5DJ2A 1KTLA 2DQFA 4AENA 4RZCB 2IQAA 4EJ1C 3EDDA 1JN6A 4EZMA 2KPNA 3DARA 2B0SH 1EHNA 4HS6A 4EIZC 5IK3B 3G9AB 1CGSL 4N8CL 2JCCB 3RZCD 1K5NB 3MPCA 1LP9A 3DRQB 4X4ZA 4JRYA 3S3SA 5GS0C 3X3FL 1P5VA 3QHTC 4CVZB 3CH1A 4UIMA 2R1WB 3CDGA 2ILLA 1W0WB 3DI3B 1RI8A 2V6HA 1A0QL 1JPSH 1G1CA 5DD6B 1EJOL 3RNQA 4WJ5A 2XI9A 1WFNA 5H37H 5A2KH 4IJ3C 2V9QA 3C60D 2XTJB 3RI5K 2MNUA 3K1DA 2P8LB 1QSVA 1U8JA 2H1PH 2M26A 3HZMB 5DJ0A 3O6LL 5IV2B 3WO4B 1NGXB 4QT5B 3LCYA 4YHKL 5ABDE 5CZVL 4N0FA 2CXKA 1I3UA 1SBBA 3AXLB 2E8ZA 1UB5B 1RHFA 1QRNB 4U7SA 1XF5B 3PHQA 4M43L 3CX5J 4B5EA 5KSVA 1ZV5A 2EC9U 4R4BA 3JUYA 4XNZC 3ELAT 2R69L 1YEHH 3IXAA 1KC5L 4Y89A 3MV9B 1MNUL 3CFBA 1B0GB 2E8YA 1SEBA 4APQB 2EIBA 3QT2A 1K2DB 3QIUD 2VDLL 4YGAB 5TPWL 4HIHA 1S7QB 3GNMH 1NAMH 3ARPA 3A6CL 3SE4C 2ADFH 3ZT5A 3O4LD 4XH2A 4K9EL 4KTDH 3WJJC 5I18H 1KYOJ 2ADJA 2AXJA 4K9EC 2V7NB 1CD1A 3H9YA 4Y2DA 3QIWC 1I1YB 3O11A 2ZCHH 2FHFA 4PRHA 3BPCB 3MUZ1 5DHXB 4JO2H 1FNFA 4OM0H 4P2RE 3RGVD 4YHIA 1OTUD 4O4YL 5TE6L 2ZUQC 4BELD 4HPYH 4Q6IA 3EO9H 4OAWB 1A5FH 4JFHE 1GC1L 3GSUA 4J3XA 5I1EH 3OKDB 3HAEB 1CZ8H 1DQDH 4PGBA 2FGWL 4GKOA 5DRWA 5T5FL 3F7YA 3WXWH 3O6KH 3SY0A 4BK4A 4RNRA 3NZHL 5HVWA 5JQ6H 4YAQA 4G6ML 5F7HA 2COQA 3S37L 1SY6L 5I1HL 4LCYB 4G8GB 5KVEL 2YN5A 4PJGF 2NY1B 3DX8B 5I9QC 1HYSC 3UTPE 1IZJA 2EKSB 2B1HH 5C0BA 4YHOL 4IDJH 1J11A 1S7WB 5J4MA 4LCWE 5C9JA 1KJ2A 4Q9RL 3VGDA 4LCIH 5DC9B 4J3WA 5JHDB 1S5HB 4KUZH 4MJ5A 1BEYH 4EBQH 4LLUA 5I76B 5D2NC 4HS8H 5GRJL 4JANA 1EA9C 1QSFB 5D7JC 1JNLL 2YWYA 3KPRE 1GYAA 3QG7H 3A67H 3QQNA 2VDRH 4NN7B 4Z6AT 4GMSH 3NABL 5K9OA 3C5ZD 4HLZG 4LIQE 1KNOB 1NGZA 5IMKB 4J1UB 2VXQH 3VW3H 4CW1B 1JMXA 1P1ZA 4Y4KC 2VC2L 1OAXH 5F9OL 1GCFA 5TH2B 3DYPA 2Q3ZA 3EAKA 5DHVB 3FONB 3JV0A 1T1ZA 3CC5B 2IFGA 3QJFB 4G7YL 4WEMB 3ARDB 1T21B 3PIQA 3ZZ1A 3D39D 1HSAB 5F44A 2H8PB 1WAAF 3RI5F 4PJCA 2AJ3B 4HAFA 1MJ7L 1DBKH 3LN4B 1ZXQA 4P2RA 4DVBA 4XPFH 5IFHH 1NUFA 3IFOB 1U95B 4O5LH 3SKMB 4NFBA 3RVWD 2B8OT 1XFPA 2QEJA 4QYOB 3T0BA 2AW2A 4C57C 5GGUB 4HGWA 4NQEB 5ENWA 5HHOE 3MMEB 5L0QC 1RD6A 2BY1A 3H42L 1NMAH 4OUUA 4YDKL 5E8OA 2HAZA 4LRIC 1MQ8A 2VLRE 5FYKU 4UIKH 4R0LA 3W11C 1VCAA 4FQHB 2HJKB 4U3XA 4PJ7E 1Z6JT 1FORL 2UZYB 4U6XA 1YDPA 2O5ZL 3FAXA 1IKFH 4XAWL 4Z7UB 5BRZB 1BLNB 3F6LA 1Q1JH 5EN2B 1O0VA 4R0LC 1HOCB 5C2BL 4N8VG 2IADB 2LU7A 4OV5B 3BZ4B 3WDHA 1MIEL 5HY9B 4NFCA 1EUUA 4S1SL 4XC3H 2F5BH 1AI1L 3O3BA 4XP1L 5FHBH 2EYSA 5ILTL 3MCLL 1Z9SA 1S7SB 3AUVA 2D03L 3EYUH 5I1GH 5KSBE 1NAKL 2GT9A 5C09E 1C16A 4GW1A 2DQIH 4I4WB 5D5ME 5F21B 4NPYA 3U79A 5F1NA 5E6IC 1RJZA 5DFVD 3S4SG 5IQ7L 2X4UA 2VKWA 4HWBH 2NW2B 4P99A 5MI0B 1BZ7B 3FO0L 2V7HA 4XB7A 1L6XA 3S5LG 4OSUH 3ZTNH 1HKLL 4K3JH 5GGRB 3MGTB 2NLJB 3LKOB 4GQ9H 5D7KD 5E8PA 5SX4I 3UTTA 3NFNA 3ZDZF 1OQOA 1MQKL 2R56L 2R9HD 3HAEH 3U4BH 5GS3A 3QXUA 1JZ5A 1H8SA 3T4AA 5FKAA 3QXAB 3S97C 1A5FL 4XCEB 3KNBA 4HIJA 4YHYC 4OKVA 4MCYB 4JFED 4O51A 1A9BB 4HWBA 4M6ML 3UYRH 1HH9A 1ED3A 2F54B 3MJ9H 1OGAB 3ARWA 2DTMH 2GEEA 4P5TB 3CSYA 2GI7A 5CJXC 5IBLC 2AEPL 2QBWA 5C8JB 1FFRA 4LRIA 3H7BB 5I1LA 1N64H 1NC2A 2D4DA 4BM7A 3DBXB 5I8EA 3L7EA 5GRUL 2AEWA 3I6KA 1OARH 4RA0C 1ZHBB 3QRGH 5IW1A 1C1EL 1TZIA 5DR5H 5E6IB 2APBA 1KLGA 2Y23A 6FABH 2BNQD 4R4FL 1EHXA 4M1GH 5IBTL 1UXWB 2YMXH 3TO4A 3VXRE 4G8FB 1B4JL 1RPQA 2JB6B 4U4BA 3I75A 4GKNA 4XVJL 1XGUA 3OF6A 3RKPA 4MXQC 1OAUH 2IANA 3TPUA 4L1HA 5HDBF 2NQCA 3FOMA 4JG1H 3ARFA 1NKOA 3AM8C 3ARDD 1NC4A 4DOHB 2VL5A 4KK8D 5CGMA 4ZG1A 4R9HA 4Q2ZB 2YA0A 1U91A 4M61B 2IAMC 1G6VK 2F53B 4X7FC 3VRIB 3MNVA 3UPCA 4HWEL 4NRYA 1X7QB 5FB8B 4Z7WE 3W5NA 1FIEA 5EO0A 4JFFD 5E99H 1FZJA 4JB9H 2FECI 3H3PH 3SOBL 3P4NB 4YPGB 3NACH 5D7JB 4K8RC 4QWWC 5KVGH 4XBPB 1RK1A 4UBDD 2WWMD 5CINH 1QO3B 1EV2E 1XGYH 3M17B 2UYLA 3G5XB 4XBGA 4CBPA 1CCZA 1SMOA 5ID1B 4QRPE 1UFUA 4NRZA 4X5WA 2XWBB 3L3IB 1Q72L 3V4VH 3TZVA 4N9GB 4PIRF 1UVQB 2IGFH 2OXGA 4M48H 2HT3C 4Y4FC 1RIVH 2ICEA 3PWUA 3V7AG 1Z5LA 3ARXA 1G7IA 3T65A 1KJMA 3GI9L 1H8OA 5D5MF 3L95A 2NXZD 4JDVB 2D7MA 2EH7H 3DMMC 1E27B 3KHOA 1CXKA 3REWB 1PQZB 2C4FT 3F5WB 1MIEH 3B9KA 5EB9A 4U6TA 5I1AB 3SDAB 3DVGB 1KOAA 5T3ZH 2YHGA 3HI6L 1FBIH 2IQ9L 1UA6L 1VFOA 1A3LH 4QHKJ 4G7VH 3WN5C 1AGBB 2A38A 5DJYB 2QTEA 3IDXL 4WW2C 3C60B 3PWLB 4LPXA 2E6QA 3SDYL 5E1AA 3GMLA 4V1DB 2DL9A 3FOLA 1JI1A 4HFWB 5LQBL 4R90L 4OLUL 5C7XH 1QQDB 3I6GA 5C09A 5JOFA 1UH3A 1YNLH 4ODBD 4PJGE 4MLSA 3D69A 4XNXH 1G84A 5IJKC 1MCPH 5A2LH 1C8PA 5GIRA 3WKML 1QSEE 3OBAA 4NN6B 3RZCB 3ZKND 3SE3C 4B53A 1CF8H 1LILA 1J7VR 5HVFB 3FQNB 2BNRE 2H2PC 5CZVH 3AREA 3O8XA 4X4XA 1YNTA 2OM5A 3ZE2E 3TN0C 1SM3L 2PN5A 4I77L 3K46A 4QCIA 4F7MA 1X3DA 5BW7C 3VFSB 5F7DB 3QEGH 2DQUH 3EUUA 1NGWB 2DYPA 3BP7B 5EO9B 2CJUL 2BJMH 1E6JL 2ATKB 3QDGA 2NTSP 5GSVA 2KZ1B 3LKSB 5K9JL 4XXCC 5C0EB 2AEPH 3QFJE 4OD3H 2ZKHL 2XN9A 3FT3B 4M6OL 2EC9T 1TQBC 4P4RA 1ES0B 3DROA 4LSDA 1RZGB 1OW0A 4ZTPL 1H0DA 3E6FB 3A6CH 1YMME 2DLEA 2AKRA 1QLRA 2JIXB 3TBSB 4HKZB 4PLNC 3QRGL 1BAFH 3QXVA 2FWOA 3LY6A 3R0NA 5C0AD 5E08L 4K94H 4JY4A 4F57L 5I0DA 3HNVL 2CDFA 4O2CB 3BKCL 3QUMA 4WUUB 5LXGH 1JFQH 4D9QD 1AO7B 1QFPA 1X5KA 5HHXH 2DJ4A 2D9QB 3BKML 5FGBC 2A6JB 2HH0H 4P57A 1UM5L 1OSZA 3D25A 3QEHB 2P8LA 3OAYH 3IS0X 2CDGA 1DQDL 4D8PB 1QFOA 3QHFL 2C7UA 2WLZA 1I1AC 2GITB 4U6YA 4JKMA 2CRYA 4OI8A 4R4NC 4NO3A 2BOCA 3MBED 4UINL 1L9NA 4NC1E 4NQEE 2X4SB 5AAWA 5E56A 5A2IH 4HC1A 5F1IB 2Z8RA 3D85A 4WO4A 4ETQA 4OFKA 5T1LA 5L6YL 1DLHA 4XNMA 4YR6B 2J3SA 5L0QB 4ZUSB 1FAKT 2ZUTA 5JORB 1I9RH 4G6AD 1IGMH 1VESA 4WO4C 2VQUA 7FABH 2GAZB 2GSIB 3LKQA 5HHOD 3ROOA 3DXAB 4Z0BH 1A7QL 1G7HB 2QHRL 5CD5C 2BSSB 2WQRA 1YPZE 3MRNB 2PUQT 3OMZA 3T0XA 2BZDA 5F7UA 3L3HA 3VXTB 4HMEA 2J4WL 3HB3C 1RJCA 12E8L 1CQYA 1LO5B 3BH9A 5FDYA 5HGHA 1IEAB 3CUPB 2ED7A 3BDYL 2D2OA 4MGXA 3WDIA 5K9KB 1OP5H 5KANG 3MODL 2MHAB 5DQJB 5M94B 4PLJD 3P2TA 3T0EB 1G9MC 1KN4L 2AJZB 3AY4A 4PGBB 1UT9A 3C8KA 1WWAX 1FE8L 1MRDH 4J4PD 3A6BH 4KKAC 5FF6A 4MB4A 4XNQB 1INQA 3JWOL 2AXFA 1P2CB 4CN6A 4KZDL 1U58B 3C6LD 3PV6B 4OAWA 4BK5A 3NMEA 3KR3L 4NO5B 4KJPC 4OFYA 4S2SB 5DTFB 4XCNA 5B38B 4QRSA 1T66D 5LCVH 4X9HA 4KC3B 4V2CB 1EZVX 2GSGA 4WNQA 1I1FB 3BGAA 1RUPL 1ZS8A 2FJHB 3N9GL 3ZHKA 3SGEI 5A1AA 2BNQB 1FZOA 3RP1A 2FEEL 4TSBL 4ZO7A 2PCPA 4Y2DD 2IPUK 5C0FA 3U48A 4N90E 2BCKB 1B3JA 4X7DC 3QQ4B 1PG7X 4JFFE 4LP5A 2ITCB 5J89A 3QUZC 3QIBD 1JTPA 5CZXC 1N0XH 4MDJB 3TA3A 4PRBB 3GMRA 3DRTB 2O5ZH 1TITA 5SWZA 1TDQA 2I60L 3OZ9L 4WTZA 4Q9BA 1FO0B 5L8KB 4FQXD 4ZDHB 4XXDA 5EU7C 4X7SL 3TVMD 1FNAA 3RWEA 4HC1H 5FO8A 4HUVA 5DVOA 3HKFA 3MFFB 1IGTB 2F9BT 5C0IB 3D1MC 3IDMB 2Q76B 3NZ8B 3WXWL 1UZ6F 4OFVA 5DJDA 1RZKH 4PJIF 1BQLL 1UM6H 2E7BA 5DYOA 1ZANH 1HHJB 1F6LL 5D1XC 3WXVL 4O2FA 5F97E 3QCTH 4ZUUA 1UH2A 3BVNA 5C0BE 4DW2H 3ULVC 1RHHA 1TVBB 2I27N 3GKWH 4RFNC 5CJBA 3VXSE 3Q5TA 4EIGB 5CIPB 4YHLL 4J4PC 1PX4A 2KQNA 3BKMH 3HPLA 2J6EH 4PRNB 2VQ1B 4KK6C 3LPFA 1HXMB 3BEVA 3GJFB 2AJSH 4TUKL 5D2LE 3NPZB 1CTNA 5E4EC 2AV1A 3CFIC 4P2QE 4GUPA 2JJSA 4E41D 1JYNA 1CE1L 1RZJL 5E8OB 2OL3B 1G6RL 5I6XB 1F4AA 5SX5H 2GCYB 3U36A 2X4NA 2WIIB 4AL8H 4F2MB 4HS3A 1A6AB 2HFEB 4D9LL 5FFLA 3ULUD 4Z9KB 1I8IB 5HYQA 3GIVB 2UV3A 2PXYA 3G6JF 2FJGB 4PRAB 2HYMA 3QULA 5K9QG 1BLNA 1D5IH 5EUOE 2D0HA 4D3CL 1T20A 4BKLA 1D5XA 3RFZC 3QI9A 1MHCB 5JW4M 5KZCB 3ZDXE 1U8IB 2PYEE 4G9FB 5EA0H 1MUJA 2EDEA 3N1MC 4GAYA 3RL1B 3IDIA 3RNQB 3V4UH 5ISZE 3CSPA 3DECA 2A1WL 3WIFA 3WNMA 4FQ1H 3WO4C 1R5WB 2V17H 1DBBL 1ZLSL 5IF0A 2C1PA 4U1KA 5GGRA 5J9PA 5F1NB 4ONHB 4XPBL 1DN2A 1IFHL 3OAZK 3IU3B 5HI5D 2VDMH 5CUSL 5D7IB 3V8OA 5DFVC 3Q6FA 3PQYA 4MA1B 1LO2L 1MSPA 4HKJA 3UJJL 2NY1C 4ZTOL 1C08A 3MLTB 5IFAL 3A6BL 1BD2E 5LAXA 3MCG1 4B7IA 5DEFB 1A9EA 3VI3F 3V4PL 4XH2B 3CSYB 2YC1B 1B0GA 4APQA 2EE2A 4H0IA 3IETB 1NC2B 2YPVH 4L9LA 1IAIM 5MHSE 1AGEB 4LSTL 2DQCH 5EBMB 1FNGA 5J1AB 2BDNL 4RFOL 1H3PH 2JJSC 1ZHBA 4LAJH 1ZAGA 4PGEA 3FFCE 3TV3H 2WBJB 4FG6D 5E9DA 2BHYA 4DKEH 3ALWA 3KPOA 4AY0A 3VFRA 1CGSH 2AVGA 3O4LE 1MLCA 2X70B 3UZVB 4F37F 2DWEA 1YQVH 3RGVA 4CN4A 3UDWC 5DVNA 3SJVD 1V7ML 4H0HB 2YXMA 3TJEH 1A7RH 4MNQA 3S3JA 3HC3H 3ZKNC 2GY5A 5F3HA 4MD5B 4HIEA 3WSQL 1JZ6A 4OZFG 1RJYA 3VDAA 2EDRA 5DQDL 2EE3A 2FZ3B 3EO1A 4NDMB 1OGAD 1NGQL 3VXOA 3ZDYE 1SJVA 2IQ9H 5C0DA 1I75A 1A3LL 3H0TA 1IQDA 5GS0L 1QRNA 3UO1L 5SWSE 4MZ3A 4PJXE 3X12A 1ZHLB 4YBLB 2XWJA 3VRIA 1ZA3B 5IMLA 4RFEA 3CFBB 5H37G 3BZEA 3BPOB 3IXTB 3PV7A 1HHKB 4JHZA 1YEHL 5LQBH 4EN3C 5ACZA 5DVLA 4UQ2A 4R7NB 4MA3A 5IFJB 2R2BA 2A6KA 2VZSA 2F19L 5EH1A 2CIKB 4R26H 4BZ1H 2VWEC 2O26U 3DJ9A 1AE6H 4LPTA 3GJEA 2PW1B 3CMOL 3LV3A 4ZO9A 4M62H 3VMOA 4HBCH 4JCMA 1BJ1J 1FVCA 1F8TL 2EDYA 5I30H 5F3BB 1YPZF 5MEPA 2AJYL 3RVUD 4R7DB 1OAYL 4R97B 3O3UN 2WW8A 3GK8H 4QNPF 4AM0A 4FFWD 1U95A 5FYJE 3DNKA 3SY0B 3KLAB 2XOTA 3DGGA 4ZFZA 3ECBB 3U7YL 5IBUG 2DOCA 5GS0D 1AGFB 4J8RB 1HSAA 4DFIA 1JGDB 3P0VL 4E0RA 2CLRB 3O45B 4AK1A 4JPWL 4G6MH 3ILPA 2HTLD 4P5KA 3ULUL 4TSAH 5JNYB 3U30B 2DQJL 1EFXB 1N26A 2VR9A 4IIQB 4R8WL 4JM2D 3MLSH 3MOBH 5ESQA 5TGBB 3BKCH 4O2EA 4I2XE 1EDQA 3RZWA 4WWKB 3GBLA 2AABH 4LIQH 4NQUA 5FYKD 5F7MC 2FLRT 3GO1H 4YEEA 4HFWA 4IDJL 2CKBA 4HCRH 4KI5C 1LEGB 2HG5B 5EN2A 1M6OA 4FFZH 3FQXA 3VD4A 4MD4B 1I8MA 3D48R 5HY9A 1C5BH 1IL1A 2HJKA 1PD6A 4Z7OF 2XFXB 4U6XB 2CXGA 4HG4K 1XGYL 3JXAA 2J2ZA 4RX4D 2BFVH 4NQCE 4IDLA 3TH3T 3S8WA 4MJ4A 3KPNA 3MYJA 1JGUH 3MV7D 3VI4E 1BBJB 4JFQA 1G0XA 4QRRE 3MRJB 3MOAH 5TDPA 2BVPB 3VXUE 4M48L 3DX6B 4D9QE 5J1TC 3IRPX 5DHYB 4B50A 3VDCA 5J7CC 1T2QL 5TH2A 5C70A 3O6MH 1JYWA 4MQXD 2XTLA 1CDHA 2OSLB 3PWNB 5LGHH 4B7LA 2R29H 1T21A 2X4QA 1REIA 3PIQB 3VXME 4HKZA 1AJ7H 3R4DA 4YIQA 1HYSD 5E9DE 3RUGB 4MA1C 1TZHA 1MHHB 3LN4A 5TE4H 1DSFH 5JO5B 4DCQB 2P4AB 3S5LB 3GSNB 5BJTB 4C56E 2G5BA 3C60C 1S7UA 5F9JB 3V7MA 1QBBA 3G5YB 2NX5E 3QUZD 4J3OC 1JPTH 4P2OB 4HLZH 1E28A 2EZ0C 4NO0B 4AIZB 4RFNB 1S7TA 1ACYH 1BFVH 2W38A 1X5YA 4UT7L 5EZLB 1T83A 4I13B 1H5BA 5F7KC 4PJXF 3RZCC 2AEQL 4KMTL 1FFOA 5ISZD 4U2ZA 2F53D 3VFTB 1OSPH 2CDGB 4KRPD 3W0WE 1MFAL 4X83A 4Z7UA 2OTWB 3THML 1OP3K 5I1LB 3HN3A 3QXWA 1D7FA 1F00I 2B7DT 3PL6D 5I6XC 2Z92A 5D5MA 1HOCA 3PP3H 4YUEH 2CRZA 2XN9D 3TESA 4C4KT 3WEXA 2MQ0A 3ZE2F 1G1YA 5T3XD 2YRPA 2XKUA 1G7HA 4WU7B 4U1SA 3BPNB 5GGRY 3IF1A 2H32A 2XT1B 4BFGA 1DBJH 3CLFH 3U4EA 5CZXD 4Y16D 5DD1L 2APWA 3RU8L 3RBSA 5EO1A 2VZUA 1DE4B 1H15B 5C0AA 2YPLE 1A4KB 3LKNA 4LAQL 1WIUA 5DXWA 4EVNA 4UILL 4ZSOE 2GTWA 5J13C 1W8OA 4ZTPH 2EDNA 2R23B 4ZPTA 4OLEA 2V7HB 3QDJE 4ONFH 1PSKH 3RVTC 3OB0H 3VXTA 3DHMA 2CKBH 4HCRA 3PG2A 5DUBB 2EDOA 5MI0C 1H3TA 4OSUL 2HLFC 3GJFH 4KDVA 2HT4D 4XGZB 1DTUA 1U3HA 4P3DB 1XIWA 4M5YL 3SKOB 1GGUA 2QQLL 1NFKA 1A7OH 1RUML 3PDOA 1Z3GH 3QIUB 3RTQB 1VB9A 1KT2A 2Z4QB 2ZNXA 1P2CA 4KHXH 3RGHA 2FBJH 4JFPB 2X1OA 4JRWA 3P4OB 4K3GA 3T0VA 1OT2A 4JN1H 1WC7B 3NFSH 4KK5C 4P59L 4P5TA 4DFHA 5ITBH 3O41B 4IRJA 1BQLH 3WLBA 3L5IA 1YMHB 4FQXB 4HIHB 1YNKH 4NBZB 4WDIB 2HVKB 4LLYB 5AYQA 1W72B 3V6OC 1O7SA 1CS6A 4XRCB 2GJZA 4NWTL 5IHUL 4GAGH 5F88B 4ELMA 3J7HA 4TRPH 3V6OA 4Y4FA 4X6EA 1JF1B 3ZKMC 1WCBA 4G8FA 1MCOH 1KCUH 4QXUL 2L7UA 4M6AA 3REWA 1C5CH 4YHIB 1J5OL 3AVEA 3EOYG 4XB8A 2QSCH 25C8L 4TSCL 4ZS6D 2DQHL 4Q6IB 3WFDH 3OKDA 1VEMA 4XC1H 4QRQB 4PY7B 2FH6A 3TVMC 5D1ZD 3I84A 3QEUB 4MNQD 5D6CB 3V6OE 3F7YB 1FYTB 1NCBH 3TIEA 3QUYA 4GG6F 1UENA 1ZA6B 5A2FA 3ARQA 1ODAA 1TJHL 2IBZY 3T8XB 3VH8B 2DM7A 1N3NA 5F7YC 5E03A 2JB5H 1JJUA 1ZHKA 2HP4A 2DQTL 1QEWA 5HVHC 1KLFA 4X7CC 1EAPB 2R1XA 1XIWC 1VFAA 5GIRB 3B8SA 1CFQA 1A6TB 2Z31A 4P23A 3C5JB 4BSVA 5DEGB 4PB0L 4BSWA 5I1CH 5BQ7B 4ZUUB 1F3DJ 3D69B 1ZE3C 2Q76A 4K7PX 1KV3A 5DI8B 4OCYL 1IBGL 4O02H 5I76A 2ORBL 3FQNA 4JO1L 4MNGA 4YWGL 2W9EH 4M1DH 4MXVE 3OKKB 1OAZL 1P4BH 5BW7A 1QR1A 1NH6A 1JHTA 1A0QH 4NQVB 4M8QB 5EOQH 1ES0A 3QUZB 4POYA 5L9DH 3TBTA 4HDIB 4ZOEA 2G9HA 3DUSB 4J1UA 4DN4H 2VXUH 2J8UF 1UEYA 1T03L 1W2KT 2E7HA 5F71A 3FFDA 1TCRB 3DX9B 5ADOH 3FT3A 2NPLX 1DEEA 5F8QC 1I8IA 4G9DB 1BIIB 1M1SA 3NH7L 4X4MA 4Z77B 1NBYA 1AR1C 3TCLA 1KXTB 1R3IH 5J13B 4RFOH 4KKCD 4WTZG 4LLWB 1MRFL 3WIHL 1Y18B 2LVCA 1KIRA 2FHCA 3WS6A 4K71C 3JV5A 3HB3D 1MH5A 5T3ZL 4HIIA 1MY7A 5I1IL 5KS9B 1QA9A 5KANI 4L8SC 3VWJA 3UX9B 3WS6C 4NO3B 1NL0L 5C0GA 3TO4D 3VDBA 4GW5A 4Z8FL 4XVSL 3VGEA 4LHUA 5DRNA 3PGFH 1MOEA 4EOWH 1FN4B 1I1AA 1LDPL 3GNML 4P4KA 1EMTH 3IU3A 1QQDA 3I6GB 1RVFL 4WV1C 5CD3A 3K2MC 3P0GB 5BZDB 2NXYB 4MAUH 4OZIF 3CXHJ 3PQYB 3LEYH 2C1PB 1ADQH 1JWMB 2ZCHL 3ZO0A 5IUSA 1B2WH 4IIQC 2DLGA 1YYMH 3UJIH 5T1LB 1CFNA 3ZHDA 3FHAA 3CZFA 4PTTB 4K23H 4LSUL 4GKZA 4UNUA 4GAJH 1CR9H 1F4YL 1P7KA 1A3RL 4OCLC 1JP5A 1ZVSB 5EO9A 3LN9A 5DJ8A 3UC0L 3VXNB 3QEGL 4QHUB 3CX5K 3VGAC 2KUTA 5DJZA 4OFDA 4XI5D 1JRHI 3GSXB 3RY6A 5CS7A 4EUPB 4Z7UE 2HTLC 4WU5A 1MEXH 1IEAA 3CUPA 2R1YB 3HE7C 4TVPE 3D9AH 2QADB 4PRPB 4X4YA 3B9KD 5JLZB 5MEQB 4HZLB 3WHXA 3VFRB 4KRMB 3NIFF 1A14L 4XCYA 5KSBB 2PO6C 4C55A 1D9KA 2BVOA 4NQCA 4KWUA 2P5WA 1MCOL 4MXQD 5CMAA 5KVFH 2NXYD 2VLJD 3BAEH 3IDNA 3BOVA 4P2OD 3W39B 5I15L 1PEWA 5IEHB 4EI5B 1MCBA 1VPOL 3QXAA 2VITB 5HYJE 1FLRH 3BO8A 3TN0D 2PETA 3C08H 1YEIH 4DEPC 4PREB 1EVTC 5ACMA 5GSRA 4IJ3B 4APQD 1Z9OA 3MA9H 3N0PB 3VFUB 5CGYC 5IVNA 3T0DA 4AH2B 2MPAH 5IB4B 2EDQA 5KSUA 4RSVA 2CK0H 3WMSA 1QFWH 4LP4A 4HMDA 3R1GH 4KROC 4LCWD 2BNUA 5F9OH 4L3ED 2QR0A 1RJLB 1DQJB 3GSWB 4PRBA 3ARGC 4NKIH 2YD3A 3D3VE 5JIPA 4YJZL 1BJ1H 3BUTA 3W5MA 3QQ4A 3JUZA 2JB6A 3G6JE 3V6FB 1LO5A 3BH9B 5I8OL 1IAOA 1UC6A 1IBGH 5JW5A 4XBEH 3RAJH 3L3DB 2QKIA 2RGSA 5E8NA 1U8PA 1A1NA 2PTTB 1CXFA 3FOMB 4N90D 4PLKC 3MRDA 2HFFB 1I3VA 5JHDE 2ZCLL 5I73B 3OKOB 3CD4A 4N0CC 1JGUL 4FMKA 3QWQB 4V1DE 1JWUB 5C0IA 4K7PL 4WCYL 3F12B 5LWYL 2YPLB 4I2XA 2HJFB 2B1AL 1YQVL 5ECJE 5DJDB 5K9QI 4HQQL 2IFFL 1ADQA 1UADC 3IFPA 3VGGA 3KPRB 1JRHL 3EFDL 4ONGH 4HWZB 3L3KB 4PRIA 3I9GH 5D96B 4E0RB 4V2BA 3WLWC 4OV6F 4L8CB 4ZO6A 4N8VA 4BQ8A 4S2SA 1NCWL 2VZ1A 3BD4A 3VWKD 5HI4D 2PW2A 4HGKC 3DGGB 4ZFZB 2Q7NA 3U9PL 5CKAA 2I9TB 2F5BL 4OZIE 4LGRB 2DJUA 3GMPA 4FQQB 3S96B 5LCVL 3VFPA 4UB0H 3CU1A 1QBAA 1WWCA 1QSFD 2BXYA 5I17A 4NKMB 4Z7WB 3J8F7 3HRPA 1JPTL 2FGWH 5KS9F 5DRXA 1TVHB 5DJCB 4UBDC 1Y6KR 3QWRA 4R4ND 1HHIB 1RUPH 1A6AA 1LDPH 5F9WC 1FL5B 4YE4L 2E27H 1G7QB 4NFDA 5CEYA 3QULB 3MRHA 5SX5K 4ZAKC 2CO7B 3ARGA 3MA7B 3QPQC 3FQXB 3RX8A 4BKLB 2GCYA 2Z8WC 5GGTL 2DB8A 1IL1B 3I3EA 3VXMA 3GIVA 1JZ2A 4QHMB 2XFXA 3KPTA 5J6HA 1OWRM 1DCLA 2XQYK 3DX6A 3MRBA 3DUUB 4XPAH 3HR6A 3HMXL 1X5GA 3EGSA 3ARBA 2CD0A 5D93B 3VMPA 3VRJB 3RL2A 1R3LB 3T08A 3PXJA 1S9YB 1HQ4A 5GS2H 2FSEA 3DYMA 1PZ5B 1MRCL 3NPSB 3LSOB 1MF2H 3MJ9A 4HC1L 4HS8L 4G5ZH 5TE7H 5IESH 3EFFA 2VRAA 2VERN 1N64L 3M45A 1AGDA 2YZ8A 1B0RB 1LO4H 2G5BB 2V9RA 4QTIL 1U8KB 3OPZH 4MSWB 1C1EH 1P4IL 3EZJB 1EO7A 3H8NA 3UZEA 3RTQD 5DLML 4F7PB 2VR5A 3D87B 5MEOA 2DQDL 4X6CE 5ID0A 1QVOB 3LN5B 2NR6C 4A6YB 4J