4M7ZC

Unliganded 1 crystal structure of s25-26 fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
total genus 54
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC01
1MQKH 1UB5A 4GKSA 3MMEA 4KHXH 1T0NB 5IB4B 4PRPB 3UJTH 2V7HB 5IIEB 4ZTPH 3GI9H 3L95A 4PS4H 1QBMH 1S7VB 1MVFA 3O45B 4J3VA 3BZFA 4YBQC 6CGTA 5DTFB 3EYUL 5IB1A 3G08A 3QDAA 4K9EL 4OGYH 3IJSA 3LKQA 4GW5A 1JZ7A 3S96A 5I1EH 4HLJA 3N0PB 3LIZH 4IM8A 2DWDB 5FO8B 3LS5H 1TXKA 2OTUB 4P99A 4P2OD 3WN5B 4U7MA 1DSFL 1JNHB 3FRUA 4ZSOA 1QSFE 3QEQD 4JFEB 4KK9D 4DKFH 2CGRL 2X4TA 4JLRA 2OP4H 1LNUB 1RUPL 3S35L 4UTAH 2HVJA 2K9UA 5DA0B 5CBAA 5E24E 4WFGE 1UCBL 4KJQD 5F9OL 3BOVA 1Z6JT 4JCLA 1JGVH 1VDGA 2Q7NA 4POYA 4M3KB 4LRIA 2D0FA 3MREA 3FO0H 4P59L 4LASH 3P4MA 5GJSL 3VXSD 5DRXA 3E6FA 2OS7A 1SJHA 4V1DE 4OI7A 2CRZA 4AEHH 4H26A 4ZUVB 2BMKB 3QQ3B 2QSCL 5F1IA 3H8NA 1QKZL 1GZQA 2F19L 4JFFD 1EFXA 2AJUH 3BKJH 3PWNA 1J8KA 4JFYA 4WV1B 3BGMA 4O58H 1J87A 4B41A 1RK1B 4FTVB 1A3LH 3E3QE 3O3UN 1INDH 2EC9U 4ODWB 1VACA 3D39D 1JHLH 1FBIL 2WWMD 1CDJA 3DYPA 4YDKL 2KZ1B 3EYVB 1DVFA 3BWAB 3T3MF 1IQWH 2ZSVA 4NM8L 2CRIA 1AC0A 1X4ZA 2IANE 5DJYA 3WE6A 2AK1H 2V6HA 4I3RL 1R3LB 3HE7D 1BJ8A 4O2FA 5LBSL 5C0AA 4JANB 1F42A 3SGDH 3GJEB 3GMOA 2DQTL 5KN5B 4LPYA 3O45A 1QSFA 5EBLB 1R24B 5FYKL 1T5XB 1LE5B 3WS3B 1QD0A 4NO0D 3P9MB 4Y4FD 2D7TH 3BE1H 1GGCH 1GGTA 4OBSA 1P6AB 1J0ZA 5I0DA 4XTRC 5DT1H 1I3RB 4PJHF 3H42L 5GJTL 4F9LA 2NZ9C 3OL2A 4ZO8A 1MCLA 1CL7L 4LCUA 1GPOH 4N9OB 4L9LB 3W9DA 3NPZB 1DQLH 5IMLA 4H8WH 5ITBL 2AABH 4DWHA 1XH3B 2EZ0C 1J88A 3U9PH 2VL5B 2NLJA 4AY0A 1HIML 4KXZH 4PJGA 1XF2B 2QTEA 3W0WE 3T2NL 1F90H 3FO2A 1F4AA 2EDEA 3ZHLA 3QXVA 5T3XH 4LRNH 3B9VA 3P9LA 4L4TE 3K8MA 4D9QD 1NFDE 4W70A 4HW6A 4IMKA 5DD0L 1HHHA 2CLRB 2NY3C 2VISA 1M7XA 1V8HA 2DD8L 2DKSA 4L8BA 2F74B 4Q74A 1Z9LA 2F74A 5DD6B 5CZKA 1CXHA 2IANA 3OB0H 3VWKD 3EJZD 3GIVB 4H0IA 3RDTC 3IJYB 4JY4A 1U3HD 3GNML 3ZE2E 5ACLA 3MRJB 4YIQA 3MGAA 1W72L 1G0XA 1U8PA 2DN7A 4Q0XL 3FCTB 4YAQA 3AS3A 3VU2A 4P49A 4L5FL 2BNRA 1CR9L 4YHOH 3DLQR 2WMPA 3BXNA 5JR1H 1XCQA 3DHJA 2H45A 2WWKT 3Q1SL 4OAWB 3NPSB 1NC4D 3NCMA 3CVIH 5CGTA 4JGJA 4ESKA 3JTSA 2P43B 4WWKC 1U3ZA 4JFFE 2PO6C 3D69A 4JHAL 3RX8A 1OSZA 4JM2F 4TUJA 4FQPA 4ODSL 2WWKO 1D5ZB 2VLKD 3Q1SH 2HLAA 5JPMA 5DK0B 3QCTL 5GHWL 4ZFOL 4TTDD 5EBLA 3B83A 1ED3B 3ZKMC 3MUY1 5FUOL 4UT6H 1L6XA 1XGTA 2Z91B 3HZVA 4JHAH 4L3EE 2H2PD 1E4XI 2IEPA 5EOCL 1DBMH 3HI6H 3X12A 3P0YL 3DUUB 1CE6B 1BEYH 4NNPH 4MHHG 5F7NC 4Z8FH 1FYTD 4MQ7A 1I9RH 4YBLC 4XNUH 3PHOA 3QDMB 4KTEL 1SBBA 5BXFA 4MNGA 5SX5H 5DEFB 5I1LA 1TIUA 3VFRB 5FYKE 2I07A 5A40E 2M8XA 3IXTA 1UH3A 3SDCD 4L1DA 1WFOA 4PJ8A 3KYOA 1D9KB 3C5ZC 3MRIA 2E3VA 3QQ4B 3BPLB 1XIWD 3QUXC 1G7MB 4UQ3B 5I16A 3P4MB 4LLDA 3UTPE 4NZRL 1L0YA 1NDGA 3AB0B 1F58L 1PDKA 4LKCA 4CW1B 3SGEI 3U7YL 1U92A 2EDBA 3MRNB 4QNPE 5CIPH 1ZGLA 4L3CA 5DEGB 3ZSSA 5E2WL 4BZYA 4LSUL 3VD9A 1KIQB 3MRBA 1ZLSL 3W9EB 4M3JA 4IOIA 4LEXL 4UV4L 4PJCE 1TQCB 5JIHA 2I27N 4X6CA 3RGHA 4ZXBB 5HHOD 1B0RB 2FGWH 2NY0B 4ZYKA 2MCG1 4OF6A 3PQYD 4OCXH 3RX7A 2VLKA 2VXQL 3SDXF 4XCCL 4PRAB 4Y19B 3ES6A 1FFNB 4HK0B 4JY5H 1H3WM 4UNTA 4YC2C 3FB5A 3BGMB 4N8CH 4QRRB 3SGKA 1MWAA 3OB8A 4KRPC 4LLMA 1AQKH 1BBJA 4U1MA 1A2YA 3VFUA 1EHLH 4MSWA 1H3VA 5T5NF 1CFQA 3OAYK 4RX4D 3W9EA 4M4PA 1XAUA 2LV4A 2GW5A 1V05A 1UH2A 4P5TC 2JE8A 3DROB 2A6KB 3CU7A 2NY4B 2VSDA 1RU9L 2NY7H 4WY7L 3G5XB 4BQCA 3P40A 1QUNA 4NQDE 5IT2H 5IB4A 2D7OA 2H1PH 2R1WB 3LQAC 1MRFH 4XXDB 1WWCA 4U7SA 3F6LA 2NY5H 3GUTA 3QIUA 4GAGH 1FZJB 1IGFH 2QR0A 2BHYA 3LKRA 4PJDB 3UJJH 1HYRC 4JN2A 5JQ6L 5HHPB 3QPQC 5LWYH 4KWUA 4XC3L 3D39E 1G84A 3ZYIA 3GO1L 1W72A 4WTZG 1SEQL 3IT8D 4YNYB 1G9NH 1XR8A 1YUHB 3GBML 5BZDA 5J7CC 1HH9A 4Z78B 2C9AA 1A0QL 4HD9A 4D0BA 4MCZB 1OCWL 2YD7A 3TO4D 2BK8A 2QQNL 4M7KL 4NRXB 5FHAH 1I85C 5HDBF 3VGEA 3G9AB 4HWEH 2X42A 3FHQA 1DBAL 1TQBB 2A6JB 1CDHA 5FCUL 4JQIH 5L88L 3B2UC 1X4XA 3RJQB 3NCYP 5L2KA 4N9GB 2AV1B 3G08B 3K74B 4NSKB 3HZVB 4WU7B 1NH6A 3MRPB 4NUJB 1CDIA 3L5WA 5FB8A 1QSVA 3KPRA 1JRHI 4GRLB 2FX8H 3WXWH 43CAB 4GKSB 1KEML 2JJVA 2VZOA 3ARED 3RBGA 1NEZA 4X7CC 2OMBA 4FFZH 3ARFC 4A2MA 1KIUA 4PB0H 3IFPA 1Y0LA 1FFNA 2P5EE 2YD6A 4X5WB 2AAVA 4XGZA 2DQDL 2OXGA 4I4WB 5F97E 3S4SG 3G6JB 2PTVA 2ITCB 3D0LA 1WWWX 5E1AB 3VXMD 5GGUB 3PJSA 4DK3A 1K8DA 3D2UD 4ZUUB 3TT1H 1RULL 4OV5A 1D9KC 3C5ZB 3EO9H 2R23A 3L1OH 4PTTA 5DJ8A 3S34H 2HFEA 1RZ7L 2YXMA 4JO4H 4MD0B 3ZT6A 3WDJA 1UKSA 5EORH 1CL7I 4DTGH 5A3IC 43C9B 5J3HC 2R2EA 1V3LA 2YK1L 5DFVC 3UAJC 4KHXL 4LLDB 1FL5A 4JRWA 1T1XB 5HDQL 5F3BA 4U0RB 2VWEC 5DYOB 2PN5A 3DMMA 1UKTA 1ORQB 2UZYB 4ZTOL 3F7YB 3CMOL 35C8H 3CFCH 5T5FL 4DVRL 1RVFH 4G9FB 1DQQA 1R5VA 1FNLA 1ZHBB 4DOHE 1YMME 5GS1A 2KDGA 2J8UE 4PRIA 3MLWH 3ZYJA 2WSKA 1UYWL 3JV6A 2NX5B 5C0EB 4TNVF 1QBBA 2EC8A 4KHTL 4HS3B 4ZUSA 2W92A 4HWBA 2ZOLA 4E41E 2AJSL 1PAMA 3F6IA 3QSKB 4DK6A 1YEJH 5EFIA 3QCVL 2KL6A 2NR6D 4PLKC 4XTRD 3DARA 2VWEE 3WS3A 2F15A 1YA5A 4GAYB 3VXOB 4AEFA 4WO4B 1SMAA 2Z35B 3V9FA 2XV6B 4CN1A 3FT3A 1EHNA 2YD9A 4LLVA 2JIXD 5BW7A 1RZGA 1I7RB 5EBMB 4QY8B 1Q8MA 2P5EB 1EK3A 2XZCH 2BFVH 3KXFE 3B9KD 4XBGA 2CO6B 3OF6A 3DVIA 5AZ2L 4TVPL 2OZ4A 5A16B 1BQHB 2BCKB 1NC4A 4AIZA 1TLKA 3CK0L 4UAOB 3T04D 5BRZD 4MJID 5GS0H 1MFCL 2MMXA 4X5WA 2NY3B 4KQ4L 1MCPL 3Q6FB 5ESVB 1VENA 2BVOA 1J05B 3L3KB 2XZCL 5DD1H 1MREL 4K94C 1IL1A 3RI5F 3PWPE 1I7UB 3IDNB 1ZK9A 2JIXA 5IWLC 4FXGB 5GS0L 3FFDA 5DJ0B 43CAA 5DYOA 1WC7A 4MZ2A 5HHQB 2VAAA 1U6AH 3MFGB 1XGQA 4TULH 3MRPA 3IKCB 2ICWJ 5MEOA 4JFPB 5B4MC 1IM9B 3FOMB 4XMLL 4K71C 4FQXB 1NL0H 1CFVH 1A7BA 3HE7A 1U8NA 4ELKB 4K94L 4QXGL 3IRZA 3NVQA 5E95B 4MXVE 4R2GB 4I0CC 5D6CB 2ZUSA 4AENA 4AL8H 3H3PL 5K33A 2CXKA 1GZPA 2V17H 4X8XA 1CFSB 1HKLH 2X44D 4XZUB 5L2KE 3NFSL 1F00I 4KROC 4LIQH 2GQHA 3PV7A 3QIUC 4GS7C 1RIUL 3NFNA 4WFFE 3KXFB 3LHPH 3ZHKA 4X6CF 3MV01 4OCYL 4DN3H 2Y1VA 4YHNB 5J9PB 3S96B 3ZMRA 4FP8H 5GRWA 1MJ8H 1XGUA 3X11A 4EBQL 1KJ2L 1MHHA 2FLRT 2FX9L 2ADGB 1XF5A 4MD4A 3ZKMD 3NMEA 1FCCA 2FIRT 2Y7QA 4K7FA 5BRZA 1DR9A 2X4OA 3SKOA 2J88L 4GW1A 3SE3A 5GJTH 1XFPA 1CICB 2XRAL 1YEFH 5FKPA 2FJGB 2XICA 4Q9RH 1RJYB 1ZANL 1M7DA 4GG8B 3FB5B 2X4SA 5F1SA 3O0RH 4R9HA 2PO6B 4JB9L 3ARGA 4NRXA 1AE6L 3OSKA 3U46B 1WISA 1MJUH 1A6PA 5DZNA 3JWNC 2NY2B 4AIOA 5JHLH 5K9QI 2ILLA 1KNOA 1ZS8A 2F53B 1HH9B 2BVUA 1LVEA 5JOPD 3D85A 2W0PA 3QDGE 2OQJB 2PR4L 4ISVA 1F6AB 3ESVF 3MRRA 1BX2A 1H5BA 1P84J 4RA3A 5GS3A 3C8DA 3BISA 1OW0C 2WP3O 2F54E 1DVFD 2MQ3A 3C2SA 4KY1H 4DCQB 5E2VL 2PR4H 1I4FB 3RL1A 4ZDHA 3WJLA 4NP4H 5INCB 5LGJA 4PUBH 4I2XE 1IEAB 1U58A 4FMFA 1YYLH 2XYCA 4GAFB 4G8EA 1D9KD 3SDXE 3BIKA 5CBAB 1PY9A 5IW1A 3MOAH 4LGSB 1C8PA 4PJ8B 1ADQA 3IGAA 1CICC 5IBLD 5IHZA 1BBJB 1S5IL 3UTTD 1NDMB 1MWAB 5EOCH 3VXQA 3FOLB 3VFOA 4UV7H 2KPNA 4WUUA 2J8UF 2IAMA 2I60L 4O02L 3ULUH 1DQTA 1QLRA 1T7VA 4ZD3L 4JM2B 4J3UA 3OKLA 1PBYA 3JWOC 5HVHC 4P3CH 2YKLL 5ANMB 4X6CB 3WUWA 1B6UA 3S98A 2P49B 4MXWH 2ICES 1XIWC 1MLCA 4ZFFA 1C5BH 1AJ7L 1OAQL 4HQQH 3W0WB 4OUOA 4OQTH 2AJVH 3GSUB 4KROB 1ED3A 4FTVE 4IJ3C 3L95B 1MCCA 5CEXB 4Z0XB 4NFDA 3O41B 4JHZA 3THMH 3MGOA 1ZGLM 3DX7B 4WHTA 3TIDA 4JRXB 5DWUH 2LE9A 5DR5H 5D7LE 2CH8A 1J5OH 5DS8B 2VIRB 3FZUD 2EKSA 3HG1E 1FDLH 2FB4H 3AREA 1EHAA 3G6DL 4F7MA 1A4JB 2YD1A 3IETB 4WUKL 5BV7H 5DUBB 2CLZA 1FN4B 3TA3A 2HG5B 4ZOEA 2BSSA 1KYOK 1PZ5A 4LP4A 2BRQA 3CFBB 5TE7H 1U8NB 4I8DA 1U2CA 4N0CD 3EFFA 3TO2A 4P5TA 5IBUB 1ZSDA 3ROLA 4P48A 1NUGA 3PF2A 2MOVA 3DPBA 1XF4B 2QQKL 3L7EB 4NWTH 1T4KA 4OT1L 1ZE3C 4DEPC 1HNFA 3IKCA 1WZKA 1G1CA 1N64H 1UWEL 5DD6A 3WKMH 4J1UB 5FO9A 5TE7L 5DK0A 1LO3H 5K93A 2CLRA 3S8WA 4PREB 1N4XH 2F5BL 2J4WL 2R1XB 1JL8A 2UZXB 3PGCB 4M93B 1OGAB 1NGZB 3F12A 3HLAA 3MX0A 3RTQC 4S1QL 3HRZB 1NBYB 3ALPA 4M4RA 4YXHL 1QOKA 4JG1H 5FDWB 1T7ZA 1WLHA 2OL3B 3RU8H 3D3VD 1SHMA 5MP6H 3GEWB 1CE1L 4RGND 1R3IH 2E9BA 1ITCA 3TBSA 3BXNB 3UTQB 1AGDA 3L9RB 2YS4A 1U0QA 3KPMB 1BQHA 1G6RL 2BCKA 3GHBL 3IDIA 1L9NA 2BNRB 3FQRA 3QUML 4PRHA 5JXAL 1KB5H 3GSRA 3NGBC 1I7RA 5FHAL 3I02B 3EFDL 5L0QB 4NN7B 5EC1A 5EU7C 1RUKH 1A7PL 1HWHB 5CZXC 4CU8A 1ZV5A 4L4TD 1L6ZA 4JQIL 3KPRD 3MCLL 3X13A 2CUHA 1HSBB 4NYLB 4M7JH 5IK3A 4OLYH 3T0AA 5LWYL 4L8BB 4HWNA 2E5EA 5DXWA 1KBGH 1CFNA 4MA1C 1U8IB 4OLVL 3UPRB 4JGUA 3GSNA 5JHDA 1JWSA 2O5XH 5HDLA 3BHBA 1CQYA 4OBRA 3O9WC 3WXVL 5C92A 3RL2A 1EEQA 3CFBA 4DW2L 4XNYL 1ADQH 1M05A 5IKCA 3MGTB 4S0SD 4TNVK 3KPTA 5GS1B 1OTSC 4WUUB 2NY6C 3A0OA 4LLYA 4Y4FC 1QFWH 4Y16A 2F54A 3WUWG 3FAXA 4FQCL 5IHZB 1NSNH 4NQVB 3CVHL 3GHEL 2JK5A 1EUUA 1CFTB 1OGTA 3EYQC 3LS4H 3MRFA 3SDCA 4I2XB 2DQIL 1OD9A 1RZ7H 4OZ4B 3JWOL 5EWIH 4YK4B 5F88B 3OKOB 3D39B 3ZTJH 4I9WE 4YUEL 5AZEH 1BGXH 5JOFB 1OT1A 4P57A 1H5BC 4DJMA 3W5MA 3PP3H 1DBJL 1AXTL 2IC2A 1OP9A 4HDIB 1X7QA 4GW4B 3H7LA 4HK3J 3MLSH 1QNZL 4XHJC 4L3ED 1T7YA 4MJ6A 2ITCA 3M07A 5I71C 1JNLL 3QEQB 1AGCA 4Y5VA 1CWVA 3T09A 4AIXA 5DA4A 1CGSH 4YHPA 1OP5K 4MS8D 2E6JA 3CC5A 3L1OL 4P4RA 4PS4L 3Q5YA 1JN6A 5JIKA 1FIGH 5IW1B 2XN9E 3HE6A 4WI9A 1MLBB 3QG7H 4GH7B 2VZ3A 3BMVA 3LS5L 1DSFH 2XWJA 4YHLH 5I2IB 3MV8E 2E9WA 5TQ0H 5D70L 3RX5A 2XTJE 3QUYC 4L3AA 3DO7B 4LSPL 2BXYA 4ZAKB 1IGMH 4HCRH 3GSVA 1HOCA 4HIEB 4KRLB 4HAGA 4Y88A 4PGCA 4RAUB 4TQEH 4F7EA 4K7PL 2J8OA 2OR9L 1F6AA 3MLWL 1U8JA 2BNUB 3VFTA 4QRPE 4TN9A 4D0BB 5I1GH 1N5AB 4YDLC 3EO1B 5FOJA 2DTMH 4XP1H 2BOBB 3FB7A 1H3UA 4KJYB 2F9BT 1E4XH 3WN5A 4TQEL 4RAUA 3MOBH 1YN7A 3WJJC 4UDTB 4X0KA 5C08E 1UT9A 4YHZH 2J5LB 2XY1A 5EA0L 5B38G 5FXCH 3K3QA 2E6PA 4GLRH 3OZ9L 4URTB 2YA1A 4R2GD 4U1KB 3KYNA 5IFJA 2LU4A 3TN0D 1CK0L 4WWKA 5JW4M 4HUUB 4HKBB 3UTTA 4MD5A 4BFIB 4ZXBC 5C0FA 1T21B 5CD3B 4DFIA 3QUKB 1JHLL 4NBYB 1JGVL 2IG2H 4FQQB 4M62L 3KPSA 5EPMA 4NM4H 4HSQA 4U1MB 3SJVB 4NZDA 3QUZB 1D6EA 3GMNB 4CGTA 2R4SL 4LASL 1DN2A 4TRPL 5CP3A 1NLDH 2KBGA 3DHMA 3B6SB 4M1CC 1T83A 2EDOA 1MCNA 2NXYC 3G5ZA 4YZFE 1SVCP 3QEQA 4FQLH 5CCKL 4TVPD 3F7PC 1BOGA 4OFPA 5E00B 4MNQA 4NZJA 4M9PA 1SQ2N 3HA0A 3L5XH 4CRPA 5IUSA 2HFGH 4PJ7E 4TRPH 1IKNA 4OZHE 1ZVSB 2WBJB 1O7VA 2ZCHH 5DT1L 1R3JB 3QXTA 2G9HA 3D1MC 3LDBC 4ZMAT 4WFHD 4Y1AD 2NNAA 5C6TL 1MAML 2IAND 1MFBL 1OP3K 3FQXB 1GPOL 2DM2A 4S0TD 3EO0A 1DE4B 4GAJL 5DGQA 5LVEA 4U2ZA 4TSAL 4ZTPL 3QH3B 5ISZE 1K85A 3U7AA 2FX9H 4JO2L 5K9JH 4OD3H 3V6BR 5D2LF 1T03L 1T2QH 5I18L 5J13B 3ULUE 4ETQB 3UCRA 3QWOA 4HFWA 4LSTL 4PJFE 1BFSA 2OK0H 5ICYB 3DVNB 4XVSH 5T1MB 3VFNA 3O6ML 1ZANH 2VC2L 4O2EB 3L3KA 5C0AE 4XVTH 2GFBB 4PFEA 4JFDE 2RQ8A 1XR9B 2WUCH 4L8CB 1BQSA 1Q9LA 1X5GA 2VDKH 4XPBL 3VD4A 2DI8A 1ACZA 5E8PB 4M6NL 2QHRL 2A6DA 2P48B 4JQVA 5KSUB 4KKBD 1ZKAA 3UTZB 4Z18A 4D3CH 3VXOA 1D5ZA 1PEWA 3CU1A 4DKEL 5EZIL 4G43A 3PQYB 3UZEA 2HT2C 3KR3H 3H9HB 2MCPL 1FV1A 4I48B 1IRAY 4A6YL 3VRIB 2Z93A 3MROA 3I6LE 2QHRH 4LFHG 3W0WD 1UEMA 5M95B 4ZUSB 4PJ5B 2LABA 3O2DL 3DI3B 3RGVB 3BZDA 1F3DH 5GGUA 4PV9A 3MNVA 4DKEH 1URLA 1R3KB 2VDMH 1NEUA 5A3ID 5SWQA 4F37K 4HX1B 4NZUL 4A2LA 1NMCB 3U0TA 4M5YL 3PDOB 4ZD3H 3SDAB 4M6ML 1RHFA 1YY9D 4XX1G 2E8YA 2VDOH 3ZKSD 2CIKB 2AK1L 5BS0B 2YKLH 5EUKA 5INDB 4BK4A 4CL7A 1Q94B 4IOFD 1I85A 1OGAA 4OIBA 5AUMA 5HHVL 5I30H 3PGCA 2DJUA 4NZUH 5JR1L 1E27A 5IV2B 2CSPA 4HUWB 1DZBA 4J4PC 1B2WH 3NCEB 1A22B 4J1UA 1D5BA 3FO9B 3DVFA 4I13B 4R0LB 3HNTH 2VDOL 4M48H 2IADA 3DX8A 1G7IA 1T4KB 4ZFZA 4N9GA 3RA7L 1PKOA 2ZPKH 4APQA 5F72S 5FYKD 4EJ1C 1VADB 2AKRA 3OKMA 2XWBA 1CL7H 4FZ8H 2EC9T 4YDJA 4CVXA 3MRHA 3FO2B 1FZKA 3U36B 1X5HA 3RVTD 4DAGH 3IKKA 3FFCE 1NGYB 2CLVA 2PTTA 4LSQH 5C08A 3FONA 4LF3B 3H7BB 4JM4L 1WBYA 3C6LB 1Z2KA 2DIJA 5D1XA 4KZDL 2BVPA 4KI5D 5CJXC 4QRRD 4CUCA 1NKOA 4Z7UB 1GL4B 4IMLB 1U8KA 2GJ6A 5DJZB 2FATH 2QSQA 2AS5M 3BKML 5DS8A 3OV6A 1JZ6A 4LMQE 4C4KT 5MI0C 1OPGL 4NC0B 4P5KB 3LD8C 1EAJA 4NQXB 2OYPA 5DD0H 1CXIA 2QQKH 4YFDB 2EYTA 1TZHA 1UM5L 2R0WL 3JUYA 5D2NC 1YEGH 2UWEE 1NUFA 3HB3D 3S7GA 5IEHA 4M5ZL 4E5XA 2UVEA 3T0DA 1Q72H 4KZEL 1CGWA 1MLCB 3HAEB 2W9DL 3VW3H 1UA6H 2XWTB 4JY6A 4Z7VE 3SE4A 3VH8G 5EU5A 1WBZB 4NJAL 1N0XL 2ESVA 4YGAB 1UM5H 3UPCA 3TYFB 2J1KA 3H2WA 4TUOB 2OXHA 1VACB 1A6TA 2DI7A 2N7AA 3TO4B 3BPCB 4L3EA 4HCRA 2NY7L 5IQ9A 2ZP0T 2HMIC 1FVDB 3VW3L 2H26A 3VCLB 4PJGF 4X8JA 4OKVB 5C9JB 2DMCA 2BP3A 3LH2L 2VITA 1OTTD 2Z8VC 3QUMH 4LKXA 2IQAB 4GRMB 3WBDA 5IESL 1IEBB 3W5NA 4HUMB 1OWRM 4BFEA 2VLME 4JN2B 4Q6IC 2JB5H 3VFVA 1RUKL 1N4XL 4ZDHB 5E6IC 5EOCJ 1G7JB 4Q97A 2ZG1A 3EAKA 4UQ3A 1MCKA 5HVGB 2FNBA 4Q9CA 3ARDA 4QOKD 2WINB 4LQFL 5IVZB 3HUJE 3V95A 2WANA 1AHWC 1RJLA 4XP5H 3FO1B 4CVUA 2GY7B 4Y5YA 5FYJL 2H9GB 4K8RD 3AVEA 1TJGH 3RY6A 3LCYA 1LWRA 2R56H 4JRYA 1JWUB 3V5HA 2FIKB 1Y6MR 5IQ9B 3F5WB 3LB6C 1I1FB 4U0QB 4DKDC 4MAUH 4GXUM 1G6RB 4Z76A 2W9EL 3STLB 2DLTA 1A9BB 4NQEA 4FXKB 3SGJA 5DF0A 3RY4A 4WO4D 5DC9B 1I8IA 1BIIA 1OW0A 3TFKD 3LKSA 4CAGA 4LSVH 4YDVA 3U2SB 1TITA 3BZFB 4Y5YC 3HTLX 4E5XB 5A2FA 4G6FB 3S36L 12E8L 1K6QL 1RIVL 1WEJL 4I3SL 4QF1B 2P8MA 1HYSC 1JFQH 5B8CC 1X5LA 2UUDH 5IQ7L 2MTPA 3T1FB 1NFIA 4OGZA 4RISL 5BMFH 3VDCA 4Q7DA 5D5MF 1VCAA 1WBXA 2W1NA 4XNYH 1BJ1H 4JFDD 4WWID 1DQJA 4PJXE 3V0WH 1LO0L 4O5LL 1ORSB 3OR7A 1L7IH 1NGQL 4DFHA 5JW4Q 4ZPVA 4OCXL 1KENH 4P4KB 1AO7B 2XG5A 1C5CL 4R4BA 4HXBL 4KMQA 5JZ7D 3GJFA 2FEDC 3BQUC 4LCCC 4N8CL 1F2XK 2X6MA 5JPNB 2BZDA 3DXAD 3V0WL 2ZUQB 3T0EE 3FHAA 3TWCH 3AGVA 3UTSA 5D7LB 2NW3A 3BW9B 4PLNC 4YPJA 4PJAA 4G9DA 2EDJA 3ALWA 4JY4B 1FIGL 1C1EL 1HI6B 2W91A 3AMKA 4Y1AB 4NKIL 5EU6D 1RULH 3D9AH 3MV7A 3V4PH 3QDHA 4YHMH 3KDMA 3EHBC 2Q6WB 3X3FL 1G7HB 4ZOBA 4OIAA 1YECH 5EZLA 1F4XH 5HGGS 1P1ZA 2A2QT 4PBWD 1N7MH 1JNLH 4DOHB 2W0LA 2KH2B 1S9WB 3PXHA 3JTSB 2CKBA 3V2AR 2CRYA 1M6OB 4X7TB 4LVOB 2P42B 3O8XB 4XXCC 1GYAA 3GJFK 4MJIB 4MA3B 3MBEC 1LE9A 1Q1JL 1TDQA 3ZKQD 1BVKA 1NFDF 1YECL 2XNAA 3KPNB 1MJ7H 2BXZA 4FFVC 4FXLA 5J56B 1RJZB 2P5EA 1RUPH 4ORZC 1GOGA 2HLFC 3CXDL 1J8HD 4CJ1A 2UWEA 1GCFA 5L88H 3G6JE 5D2LB 3I9GL 5EN2A 3O4LE 1FO0B 2C3VB 3P9MA 3CUPB 1PG7L 4TVPH 5MEPA 1HXMA 4KJPC 2FH6A 3SDCC 4FA8A 4XP4L 3FRPA 5J4MA 3BIBX 4N0YL 1TCRB 2DM3A 1CT8A 3DECA 5EULV 2QV2A 1HHHB 2R1YB 3BFOA 4N0RA 1P1ZB 2WUBH 5C0AB 5I17B 4O2FB 5HYJB 2NY6B 2IG2L 5TGBB 1Q9LB 1J18A 4RAHA 2DLGA 3V6OA 3ILQD 4HZLA 3ZLQC 5JDSA 5TH2A 3WNMA 2FHFA 1QRND 2X4UB 1AKJB 4PJEB 4A6YA 3O9WB 5LGHH 2X4NB 1INDL 1X5AA 3P0VH 2Y6SC 2EDKA 2CO7B 4MAYC 5I8EB 3PGDB 1A7QH 3IDXL 4X6EB 3U4BH 2NYYC 2WIIA 2ESVD 2BSTA 5F1IB 2AJZB 3GIZL 4M6OH 3QRGL 3U30C 5FIEA 4JZOA 4Z7VF 1F97A 4JO4L 1S7UB 3EOAB 3DRQB 5IM7B 1OB1A 1DQDL 3GRWA 1A02N 3BIAX 1RHHA 4LARH 1X44A 3OAZH 4G6AC 1Q0XH 3HUJA 1KIPB 3P0GB 4U6VL 3W11D 2YK1H 2CMRL 3SKNB 3WNKA 2G2RB 3RWHA 1E6JL 2I9TA 2W65B 3QUYD 3NFSH 4K3EH 3PP4L 4L4VE 1BJMA 2JJWA 2Y25A 3BP7A 4X4ME 4P23D 3DETC 4ERSL 4JANA 2HVJB 2DDQL 2EZ0D 3QJHA 2IMNA 4OZHB 3VWKA 3QHZL 2HN7A 4Q6IA 3RDTA 5TDPB 4DVRH 3WIFA 5IJVA 2ARJB 4WW2A 4X80H 4LLWA 2ZSVB 4LHUG 4XVSL 2FDBP 3O8XC 2NW2B 4JFEA 5MEND 2GK2A 3HZYB 4G42B 2EIEA 4ODWA 3G04B 4NKMA 4U1HA 3SPVA 3B3IA 3JXAA 4Y89A 1OGAD 2OTUA 4MDJA 5EU7E 3O4OB 4ODTH 3LKSB 2Y5TB 3CDGB 4P9MH 5KTEH 4D8PA 3U4EB 1MAJA 1FORL 3B4NA 4TSAH 3RY5A 4U6XB 1X6LA 3QQ3A 4OLUH 2GITA 3V6ZB 3EDDA 4I0PA 1C08B 1JWUA 1FL6B 3UPAA 2CDFA 4L8SC 3H42H 4PG9B 3HC4L 4U1KA 4MWFA 1ND0B 5DQ9B 5JOEA 5JHLL 1SYSB 1A1MB 1TVHA 1S7RB 3IDGB 3CDCA 4OLUL 4ZUWB 3WCYA 1KIRB 5HD8C 5F7MC 1FFOB 4QHLB 4WU5B 4P4KC 4KXZI 5EIIA 4Z7UF 5ADPL 3TBYA 4F80A 1X5JA 1D5MA 3EO1A 1T0MA 4Q6YA 5FCSH 2XN9D 3Q5OA 5DO2D 3H9SD 1V3JA 3DIFB 1U8JB 2COQA 1OLZA 4Y4KA 3VFPB 1W72B 4XBEH 4XCEB 3VGFA 3O6LH 3P4NA 4B53A 1T6VN 2DKUA 4F7TB 1GSMA 5CSZB 4K2UH 3EGSB 4R26H 1CDYA 3S88H 3QR2A 3VGGA 3BP5A 2H2SC 4MCYA 3N1FC 4MNQD 1DEEB 5D7JB 2PCPB 3BKCL 2H2PC 1U93B 4P46B 1EFXD 1M71B 5F6HJ 2IBGA 2V5TA 3D6GA 3G5YA 5GQBA 1IJ9A 1NAMB 3RKDC 3HE6B 3V6OC 5AWNH 1U8MB 4ODXB 4DUWA 1AGFB 4NFCA 2X4RA 4BM7A 5CBEA 5CLWA 3RUGA 4IRJC 4P2QA 5KJRH 1H8NA 4QXUH 5J06A 4PRAA 4JE4B 1NGXA 5GGVY 2RGSA 1KCUL 4Y8AA 2XIDA 1NGPH 1S9VB 4GO6B 3F8UB 3S9DB 2E7BA 1YY8B 1GGYA 5D6DA 1GJIA 5DHYB 1QSFD 3QEQE 3X14A 3C5ZD 2X4QA 5FKAA 1I3GH 4RZCA 2QL1A 3JTTA 2ZG3A 5SX5K 2CUMA 5DJ2B 4JN1H 4MDIB 4K7PY 1OM3H 3IS0X 5I19L 5SWZA 1PW3A 5CJBA 1J0JA 5CFHA 2QSVA 4U1NA 4E42B 4AQ1B 1QYGL 3HHRB 4F8QA 1JMXA 4POZC 5F88A 1GRWA 2R4RL 1H9VA 4LSSL 1TMCB 5KAQG 2APXA 3V6OE 3MRGA 5JLZA 3QQ4A 4NHUA 2D7QA 1KV3A 3MJ8A 5E2WH 5DHVB 3BH8B 4NUGL 4F2MA 3I50H 2QQQA 2XA3A 3M8OL 3MRCA 3RTQB 1C12A 4XP9L 3RNKA 3ET9F 3TO4C 2YD5A 4KAQH 3RFZC 1YEKL 2KZWA 1VB9A 5I9QB 1HHKA 4JHWH 4DGYL 4WCYL 1MFAL 3QEHB 1OAZH 2IQ9H 4LCWA 1J0KA 2B8OT 3O4LD 4QOKB 1QBAA 1SM3H 5C0CE 1CLOL 5HGHA 2Z92B 1EH9A 4KDWA 4KDTA 2HTLC 3CZFA 5CEYA 4UIKH 5KS9A 1J1OL 2AXJA 5F9DC 3I3DA 3X3GH 3Q3GB 5C0RL 4L4VA 4HAFA 1E4KC 4NYLA 2P8LB 3K2UL 3Q6GH 2A6IA 4Z95L 5C0DB 1ES0B 3L3HB 1INEH 3TPKA 4XNQA 3JWDH 1NUNB 4UDUB 3JV0A 1PFCA 1IGFL 2R0KL 3O3DB 4F37F 4JDZA 5KOVC 2R0LH 3MJ9L 1CLCA 5LCVL 3GSRB 1FPTL 5ESAA 4LEOB 1QHOA 3K2UH 1SEQH 3L6FA 2A6IB 1P7QB 2BNRE 5HDBE 4DVBA 5I74B 3NH7L 2GTZA 1S9KC 4X99B 1A0QH 4XPTH 2R0KH 4PJHE 4KI5C 3V6FA 1WZ1L 4QO1A 2AK4D 5ECJE 1Q0YH 2QLVB 1JPST 2V9TA 5TE6L 4S10A 5H35A 2HRPL 3PWUA 2ZKHL 1N2RB 2ED7A 4QRPD 3GIVA 1J12A 3EZ8A 5C0IB 1FSKB 5GS0C 2Y36L 4G3YH 4IS6A 4BUGA 2A0LD 3SKMA 5HVHB 5DSCA 1KJMA 4LGRB 2HJLA 3JV4A 3NN8B 5IFHH 3HPLA 3PL6B 4XAKD 2DQCH 3WMSA 5I15L 4BELD 4NKDA 5IHLB 1GIGL 4OJFL 5CKGA 3WFCL 3WEXB 1AHWB 2FB4L 1W0VA 4POUB 4PB0L 4K8RC 4NZRH 4IDJL 1I1YB 2IJ0C 4XHQA 2FEEI 1KGCE 5IP4A 3S5LA 1IGJB 2XZAH 3TGXA 4P2RE 4WNQA 3P4OB 4F33A 4ONGL 4N5ED 4PJCB 4WO4C 4IMKC 5GRVK 4YLQT 4X7DC 5FKAB 3HNSH 4CMMA 1ZT1A 3ARDD 4U3CA 3S3PA 5H37G 1KCVH 5DFWH 1U8QB 1E4WH 1LEGA 5IQ7H 4CADB 3VXMA 3KLSA 2ED8A 1FC1A 1KELH 3K4DA 1P2CA 4V1DD 4BSVA 5DDHA 1HQRA 3QXDA 2EDWA 4NKIH 3RWIA 3K46A 3WUZA 2AV7B 4AM0A 1NKRA 4ZUTA 5HHOA 5JMRA 2D4FA 3WFHB 1QHPA 2DQEL 4X6BA 2GSGB 3C60D 4NQED 1FVCB 4JAMB 3QI9A 1INQA 3JVGA 3MODL 4Z7VA 2EDDA 1JGUH 1YZZA 1MHPL 2BVQA 4FTVA 3TH3T 4BQBA 1RZIA 4G6AD 4NKOB 3CFEB 2E27H 3MA9L 2NY5L 5IMOB 3PGFH 2X7LB 4NQCE 1J8HA 1J9CT 5EOTB 5DJCB 4PRDB 5ISZB 4DTGL 4JVPA 1HWGB 3C09B 3KNBA 3VFGL 4APQD 4EI5B 1EGJH 1LO2H 3U83A 2O5ZH 2NY1B 1F02I 4L4JA 3O3BA 2P45B 1YEHH 4X98A 3QO0A 1FYTB 3ARYA 3MLXL 4NWUH 1PD6A 5D1XC 3CH8A 3E6HA 2UY6A 5CP7A 4EN3A 2J7LA 2IAMD 3S3SA 4CU7A 3C6LC 3CMOH 2HT4D 2IGFH 5IWLA 4XAWH 3VI4F 1UZ6E 4R3SA 1E28B 3IRPX 2D3VA 1HDMA 3OKEB 1UVQA 1WTLA 1VHPA 3IDGA 3VWJA 3WO4B 5CEZH 1GVIA 5D70H 3ZE2F 4OLWH 5T3ZD 5CP7B 2NXYB 5MERB 4MQSB 4R8WL 1RUQL 3HPJA 3MTRA 1IC7H 2DS4A 3U0PA 1YEIL 5HHOE 4FMKA 3ARGB 2FX8L 4OTXH 4FFYL 5EU4B 3GSXA 4M7ZC 3C08L 1ZWIA 5C07B 4HG4K 4P3WA 3DRTA 4DKFL 5E6IA 2D9CA 1CICA 3UBXG 3CLEH 1QFHA 1A21A 2DQDH 4EKXA 3G5VA 2X4OB 2NXZC 2ZWLT 1Z9OA 4KKLC 4NBXB 3RQ3A 2V7HA 1P9MC 2W0KA 5EB9A 3BWUC 1TQBC 3OZ9H 4QRPA 1JZ4A 4YEEA 2ZZUT 1UVQB 2APFA 5H2BA 1OLLA 4NT6B 1TJIL 1MFCH 1IGCH 1JF1A 1FNGA 5FDYA 1NCTA 5D1QA 4JJ5B 1J0IA 4HH9B 4LBEA 1A7QL 4XPAL 5C1MB 3SGJC 4ZNEE 1IAKA 5IROA 3U79A 3GMRB 5HJ3B 4XRCA 3T4AB 1MFNA 2BVYA 2VXVH 3O2WH 4Y2OA 3BN9D 1OTUD 3NCCB 4N8PA 1I8LA 5GGRB 1KC5H 5I1AA 5EG6C 2ZUTA 2FCBA 3LHPL 1LK3H 5ANME 5I1DA 1XGPA 1KPUB 4KUCD 3T0EA 1MQKL 3NABL 1C5DB 3P3YA 1M7IB 2MHAB 3RZCB 3VI4E 4LPUA 4PYGA 4I3RH 1BAFL 2UUDK 3OKNB 4OD1H 4RQQA 5DHXB 5LBSH 1EO8H 1I9EA 4EXPX 1CFVL 4X5XB 4JDVB 3IDMB 4ODBD 4XMPL 4Z7VB 3AM8A 1IGML 1JWSB 4AL8L 1U8LA 1JMZA 1ZT4B 2VLRE 5J0BA 1IL1B 1CGUA 2BC4A 4MVBC 3QISA 1JHKL 1YC7A 4V2BA 1PEZA 1RIUH 4H1LB 5IB3B 3SOBH 2K1MA 1LP9A 4FFWD 3BRFA 1UC6A 4XCNB 4WW2C 1XIWA 2DTML 4XP1L 4NO3B 3W39B 3T3PF 5ID1B 5A16A 3NBNA 2HTLD 4HC1H 3O6FD 4UTAL 4TTGA 4NQCD 4Z77A 3BEVA 1UQSB 1CDBA 3TBWA 4HS8L 3NZHH 1MHEA 5HYSA 3FT3B 3BP6A 4F7PB 1KXVC 3H0TB 4UNVA 4CDHA 3B43A 3KPMA 4HF5L 3B9EA 5CJQL 3CK0H 4UU9B 4P2OB 4NPYB 4MA3A 1F8TL 4KRMB 1OAUL 2IWGA 4P0DA 4KVCH 1ZHLB 1JGDA 4S1DD 3RWJB 5FDWA 2CRMA 4HUVB 5DMJB 4M5YH 4M6MH 3DV6B 4XWOD 5E8OB 5IJKA 1WTGT 4RIRA 5IW6B 5GSVB 2EDNA 2LFGA 5D1XD 2VLLA 2NX5A 3STZB 2HT3C 4N68A 1WFNA 3I6GB 1EZVX 1KXTB 4FQIH 1QBLL 3C6LD 3VI3E 1DFBH 1CI5A 4YO0B 1AD9B 3L3DA 3S37H 1CG9B 1KTRL 3DUSB 4HIXH 1KCUH 4K2UL 2RCSL 4OGXL 4QKXB 5DLML 5BCAA 3OB0K 2HJFA 2IH3A 5EO9A 1X5IA 3SDDC 2DQTH 5HYJE 4GG6A 3MNWB 4MGXA 4OQTL 5F8QC 3RWDB 1S7SB 4C56D 3CVIL 3QFJE 2PYFB 2CK0H 4S1SH 1I7ZA 3QULB 1FL3B 1P7KB 1S9XB 2R69L 5C09A 1BVLA 3THML 1QG3A 3OKKA 3OAUL 3O4LB 4KZDH 4GXVL 1U8OA 3HR5A 1OF2A 5DWUL 4DN4H 3U9UA 1TZIB 3PWJB 1UXWB 5IG7B 2AQ2A 3BKYH 5FYLH 1A3RL 3I6KA 4ZG1A 2UZIH 3MYJA 1M1SA 3MNZA 3O41A 5IMMA 3DTXB 4Z0XA 5SX4H 4NQSB 4OB5L 5DUPL 2G5BB 2Q86A 2R2BA 5JDJA 4JFEE 1MY5A 1YEKH 2VLKE 4BJLA 4MJIE 3A6BH 5C8JA 4HIJB 2VTFA 4FZ8L 5CEYB 5IB2B 1NMAL 2ITDB 1UZ6F 5DQJA 4M93C 3DRTB 6FABH 3WUWB 1EEYB 1CD1B 5F9JB 4YHIB 2FJFA 2J6EA 3O6FA 4GBXD 5ESQA 1LK2A 3R06A 4DGVL 4MYWB 5CMAB 4HEME 4MQTB 5CJ5A 5D8JL 3VXSB 3VXQB 2X4RB 5BV7C 2C1PA 1K5NB 5T1DH 4UT7L 1MUJA 3HKFA 1TQCC 2JB6B 5HI3C 3U7YH 4XBPA 2MKLC 1A9EA 1RIHH 4PJ7A 4OFIA 3D85D 4LDEB 1KOAA 4Y4FA 3OJDB 5HD8D 4JG1L 3D18A 2IH1B 3BI9X 1CGXA 5LCVH 5DGRA 2W60A 4IDLA 5E2VH 3TYGH 3E6HB 3VFVB 4NC1E 1MCFA 3QO0B 1TVDA 4IRSA 1U8HA 4PRNA 5FK9B 2O61B 2VITB 3FB8B 1U3YA 3DIFA 4AG4H 4HC1A 1I8MA 1UWGH 1OAXL 3CXHK 3HCVA 1QRNB 2QQLL 1YPZB 3ZKXB 3O8XD 3JWDL 3BH9B 3Q0HA 4QTHB 1BZ9A 4JPWH 3RIFK 2X9XA 3NAAL 1CU4H 4Y4FB 3RWEA 4M1GL 2WK2A 3QDGB 4GG8A 4PP1C 3E8UL 4JFDA 4X6BB 3C09C 1AJ7H 5D7IB 3TBTA 2FRGP 4W4NA 1GOFA 2VKWA 1CU4L 1CXFA 3RWIB 1DDHB 4AMKH 3MRDA 1MRDL 2Y7QB 4K7FB 3BPNB 4P2QE 4I0PB 3DVGB 2R15A 4XCYB 3V5KB 3BH9A 2B0SH 1QRNA 5D2NE 3GSOB 5F9JA 4O58L 5TDNB 2X5PA 2ESVE 4S2SB 3A6OA 3CDGA 4GUPA 4ENEC 1WAAF 2DQHH 2PF6A 5KSBB 3FB8A 4HFUH 4HIJA 1MRDH 3M1BA 2YPLE 5FO7A 1LDPL 1U8KB 4NM8H 5HYJD 5JNYB 1YMMD 5IFHL 3C6LA 1KBGL 3MV7D 4KKAD 3ZDYF 4HWUA 1JV5B 1D5MB 3TM6A 4Q2ZB 2NY2D 1NDGB 5EWIL 5IHUL 5EIQA 2ENSA 3BT2L 3QIBC 1B0GA 1YEGL 2VR9A 4NZTH 2OSLB 4WI5A 4D9LH 1ZHKB 3IVKA 3WEXA 4FABL 1PKQA 4YX2H 1IAOB 3MRKB 4R7NA 4KK9C 2RIKA 3PWVB 5EBGA 12E8H 5EH1A 4YFEA 4OIIH 5L7XH 5J12C 3NCJH 4JFPA 4X5LA 1VFAB 4OLXH 3MO1A 1VGKA 1BVZA 5MEOB 1WGOA 2YC1B 3WXWL 5FYLD 1FL3A 2V2TA 5HY9B 2VKXA 3QNZB 1KJ2B 3SKMB 1C1EH 1CYGA 2VAAB 4JZNB 3CLFH 3QDME 3WO3B 1H8OA 4FXGA 2J4WH 1DQLL 4YHIA 3G6AB 2AABL 5C0GA 1XGRA 1HXYA 4DEPB 2Q20A 2V5YA 4J3WA 2DLIA 2YR3A 1MCWM 5C0CA 4XMKH 1J05A 1FIEA 4XH2B 5D71H 3GGWA 3NIFF 2M1KA 5DJDB 1UACL 4O9HH 4U1HB 3SPVB 1JHTB 5T3XD 3V7MA 3MLZL 2ZSWB 3MA7A 4LHJB 4MQXD 4HX1A 3DTXA 2MPAL 1F3JB 3HI1A 5GGTA 1IAII 1MH5B 3EOTH 1JPGB 1WJ3A 4MVBD 3PXJA 4ONHA 4QY8A 1NCNA 4CU6A 5JQ6H 3WLBA 1S8DB 1A6VH 5C2UB 5KG9A 4HUVA 4KK6D 5JHDD 1GGBL 1KLFA 1MHPH 2H8PA 4R4ND 2YA0A 2VAJA 4K7PH 1KACB 2A83A 3MBEA 3I9GH 1BQHG 1OCWH 2FBOJ 3HE7C 3RDTD 4L4VB 2FECI 2A6DB 1LHZA 35C8L 3ZKNC 2DMKA 3CFKB 5IEKA 1RJZA 3M17B 5IHBA 2P47B 3ZDYE 2VQ1B 2B1HH 1H3XA 3RVTC 3KPNA 1XIWB 1I9JH 1PYWB 1EBAA 1EEZA 2R9HC 1FJ1B 2GSIB 3UROR 1T1YB 1QQDB 1Z9MA 4LSPH 3HAEH 3PWPB 1FNSH 5E94A 1BJ1J 1OT2A 2ZCLH 2NZ9D 4WI3A 2D7NA 3IFLL 4ZO6A 1CLZL 3BH8A 4WV1C 1F4HA 4R8WH 3T3PE 4HIIB 3IDMA 4FFWC 4M02A 1FGNH 2J3SA 3KPLA 1AFVL 3MUGA 3WS6A 4G80B 1Y6KR 5HI4D 4GKNB 3FT4B 3TA3D 3JWOH 1WAAE 5DZLA 2A77L 1FAIH 5GGQH 1M7IA 3MFFB 4KMTL 4PV8A 2OI9B 5IMKB 5AZ2H 3QI9D 1VFBA 4K3HA 2FJHA 4KUZH 4QRUB 1N5YL 2HFGL 1DBJH 5F7LB 1FZMA 3PP4H 3CIQA 4LPTA 3RVUD 2ATKB 3NZ8B 1NJ9B 5DMKB 4KMTH 4ZPVB 3P11H 2Y06H 3F7QA 3RJDA 4UIMA 3L3GB 4H1LG 1WUNT 32C2A 3D9AL 4WIQA 1S7QB 1H3PL 1WWBX 1JVKA 2PNDA 1X5ZA 4DZBA 3ARBD 1FNGB 2R4SH 2OR8A 2BNRD 5BRZE 4NQCB 3WL9B 5KN5A 2ORBL 5F7HA 1DQDH 1U6AL 3WN5C 1RK0B 1NEZB 1L7TL 1NFKA 1T7XA 2F8OA 2VLJB 3OG6B 3CFCL 1MEXL 2Y07H 4LHUA 1KT2B 4AEEA 5FM5M 3QUXA 4XMLH 2PCPA 3RPIA 5A43C 4RMWA 1KEGH 1GGIL 4Z7QE 3KYNB 2EE2A 3ARFD 4LAQL 3LMJL 3I85A 3EYUH 4EZMA 2B39A 2FECL 1LD9B 1KPUA 3T0EB 3I2CL 1D3CA 2VDPH 4JQXC 3VXUE 4KHTH 3FQUA 3TIEA 4DZ8B 4Z7WB 1MI5B 3GFUA 5GRZA 2VDKL 2EIZA 2F8XC 4XCEA 1BAFH 5D9SB 2GUOA 1EO8L 4H26B 3VWKC 1MWAH 1YEJL 1RZ8A 3LEVH 3CFDA 2VABA 4M6NH 2APVA 4EQ3A 1EHLL 1IAKB 2DRUA 3QJFA 2XKNB 3FFCB 3GDBA 2EYRB 3VFTB 4ZS6C 1HK6A 3SGEH 4M7LL 4YR6A 1EVTC 1IQDA 3AS2A 4R2GC 4OLZH 1VFUA 3BEWA 4NDMA 4JRXE 4NDMB 1IKNC 1FC2D 4Y2DB 4HGWA 2VE6A 1ND0A 3QDJB 3VFSB 1JK8A 3MV9A 2E9IA 1FHGA 1FYTA 3GO1H 3G5XA 2YWZA 4YWGH 4BH7A 2AI0H 4U6XA 2VDLL 3M1BB 4Z0BL 5IW3A 2FEEL 1RY7B 4Z7WA 4IOFC 4OM0L 4QRRE 5AG9A 5E7BA 3B8YA 2XQBL 3NIFE 4W6XB 1OY3B 2YHGA 5C8JB 5CLTA 4GOSA 3ES6B 1MIEH 5I30L 5BV7B 3IU3A 3BO8B 4OZIA 2HWZL 2BNQB 5KJRL 3R0MA 5FHBH 4OSUL 2AP2A 4TOYL 1N6QL 2CMRH 1INQB 4OM0H 4JKLA 2KUTA 1I7TB 1IAMA 1UB5B 3L5XL 1JF6A 4ONFH 1QLEL 1EDQA 5C0CD 3QIBA 3WS6C 5I1KH 4P3DA 3TFKC 4GXVH 1RSFA 7FABL 4NHCL 1PX4A 4L1HA 3RWEB 4PGZA 4KRPD 4JKKA 4ORGA 4E0RB 3K7UA 2Y5EA 1OP5H 3V5DB 1Z5LB 5F1OB 4NJ9H 5CJOL 1VERA 1IILE 2ID5A 3KLHC 2XA8L 4KVNL 5I66B 3O3BB 4MNQE 5L9DL 4MB3A 4ZAKD 4DN3L 5JW3H 4QXUL 4O4YL 2DJSA 5F7FA 2AJZA 4Z5RA 2ZJSL 4X7EC 1SMOA 4ALAH 4EBQH 1IE5A 1TENA 5IMKA 4PV8B 1FVEB 5BQ7B 5BVJA 3QPQD 4G7YH 4O51A 2EEAA 4MXWL 3MGTA 2UY7A 3OJDA 4LNRA 1NCBH 1OAYH 1AP2B 2JB6A 3OX8B 3MRLB 1BD2E 4JAMA 1K2DA 4YHYC 3SQBA 3VMNA 5TFSL 2YUVA 3QFDB 5I17A 5LXGL 2OJZL 2RHEA 2QEJA 5KOMC 1CFNB 3ARWA 5TDOB 3H9SA 3SE9H 4EXKA 4MAYB 4RGOL 4C83B 3VXSA 4NO2B 1DQMH 4IS6B 3T77B 2FATL 1OAYL 1RIHL 3V0VB 1FG9C 4P5MB 3DSFL 4CKVX 4NNYB 1AGEA 4JREC 5C7XH 1IGIH 5E03A 4EUPA 1B4JL 3ARGC 3QIBD 2ITDA 3OTTA 1ZEAH 2D03L 2AQ1A 4XNXL 3FQNB 5FAAA 5T1LB 4HMDA 3CFKA 3PDOA 4Z77B 3TH2T 4WCYH 1VGEL 4GMTH 3AS1A 1YEDA 1AGEB 3BGFB 1BFTA 5FA4B 1I1YA 3MNVB 3JV5A 5MENA 1N59B 2PO6D 4ODHH 1Q9WB 1MCQA 4OZHF 4P2CG 2W59A 2VDNH 5C0AD 3FCTA 4R97C 5I75B 1D6VL 1GC1C 1KG0B 4HPYL 1U8PB 4XPTL 1N64L 4HIIA 4X4ZA 1VGEH 2UYLB 1FLTX 3OKKB 5A1AA 5F7YC 5CKAA 2UV3A 4PBXA 2KKQA 4D0CB 5GZOC 4OF5A 2NX5E 5IBUG 1FNAA 2FYYA 3ZKND 3P2TA 2ZNWA 2PYEE 3OKNA 1JHTA 4WFEE 4GRLC 4WI6A 2J8UB 2R2HB 1HI6A 1MPAL 3CZFB 4E41A 1FVEA 1WQVT 5BQ7A 5BVJB 5A2KH 3O3AA 2HP4A 3UTSB 1JRHH 1WFUA 3CSYA 5MHSE 4TVPE 1NAKH 2FWOB 3WLWC 2C1OA 3R8BB 3WJJA 3ILPB 4KQ3L 3ILQC 4OJFH 1QRKA 4MA8H 3RVVD 1U2HA 3KYKH 2NXYD 2OM5A 3QG6A 3FQTB 4L29A 5D72H 4I3SH 4FN0A 3BSZH 3IETA 3QO1B 4LCYA 5IW6A 3RGVA 1AD0B 3T0BA 3UP1A 5GXBB 1DLFL 1UG9A 4KKNA 3NPSC 4LIQE 4HFWB 5E9DE 4HK3N 1FYTE 4PBVC 4B7LA 5BMFL 3VXTA 3WJLC 5KVFH 4WUKH 4XNQB 4XP9H 5E5RB 5BJTB 5MENE 1I7TA 2BVEA 5MI0B 2O5XL 4PJBA 4QF1A 4JVWA 3C5SB 3IU4L 4RCAA 1G9NC 1MFAH 2C3XA 3EYOB 3GMOB 3TBWB 4DW2H 3SO3C 3T8XA 3TNMA 2NY4C 3LV3B 1WEJH 4MMXC 1CLOH 3OGCB 1CN4A 5E00A 4GQPH 3IFOB 3SY0B 3ARBA 4XPHH 3TPUA 3SKUD 5D5MB 4NKQB 5D7IE 2NTFB 4I77H 3STLA 2EE9A 1J1OH 3RKPA 1B88A 2XN9A 4NZTL 5GRYA 1JJUA 4D9LL 2XQYK 4GRWE 5HI4C 4MNHB 4WHDA 3QPXH 3MXVL 1NC2D 5ID0A 3OF6D 3GMNA 2VDQL 5SX4I 1SBSH 4OLXL 4Y8DC 2MPAH 3MJ6A 5F70A 2NY0C 5C9KA 4KKCD 1ZGLP 3C9NA 5K59F 2O93L 4RFNB 4S1QH 5GZNC 1ONQA 2ZCKH 3BRGC 3QWOB 5IESH 1CLYH 4UTBL 1BIHA 3ROOA 5DVLA 5T3XL 4X5XA 1G7QA 1R3IL 4PJFF 1MFDH 2YBRA 3HG1B 3FL7A 3ZL4H 2V7NA 2VDQH 3QIWA 3B5TA 3ULVL 4Q2ZA 5I76B 3HCVB 1VSCA 3GHBH 4ZSOE 2X1XR 1W8NA 2EXYC 5JZ7C 3O0RL 4LK4A 5GISH 3X17A 4OF0A 4X0KB 5EUOE 4AH2B 5JO5A 4Z5RB 4M8VA 5C70A 4MHHI 1MFDL 2DAVA 3ZL4L 4FNLL 4OCWH 3TIEB 1SJXA 5HGAB 3MCKB 1BD2A 2X40A 1EZVY 3AXLA 3GI8L 4UILH 3SHSA 3TVMC 2IH1A 4WTZA 2R29H 5EZOL 4RA0C 1LO2L 4HS6B 1IC4H 4DUXA 1CVSC 3DXAA 1GGBH 3QB7C 4G6JH 3HFMH 4G8IA 5D7IA 3TBTB 2AJ3B 1SYSA 3OJMB 4OZIF 5IB1B 2V9RA 1KPRA 4PG9A 4MXQC 4AM0B 4MD5B 4BFIA 3HC3L 1K6QH 3C87A 4HS6A 3TC9A 2BNQA 1A5FH 2VLRB 4F58L 3BUYA 4HJJH 5SWSA 2IFFH 5D5MA 3WFZA 2XT1B 3PIQB 3QCTH 1MF2H 3TV3H 1C16A 1EXUA 3HC3H 4P3CL 5HI3D 5E5MA 3IAQA 4F33B 5JO5B 4AH2A 1F3RB 1W0WA 1A1NA 4OZGA 2YPLA 4H25A 3RWCB 1VPOH 2NW2A 1E4WL 3MYZA 4KGJA 2H32H 1TTUA 1X9QA 4JPIA 4OCRH 2PTTB 3C08H 4OQTA 5EA0H 3WSQL 4PR5B 4OGAC 3PQYE 4YFLF 4ZFOB 2Y72A 3ZT7A 3RPKA 3LD8B 3A67L 3T0ED 3KPQA 3MRQB 1FO0H 2EDLA 2X9YA 2IPTH 2R2CA 1OGAE 1X3DA 1MSPA 1GHFH 4PJFA 2H32B 3WSQH 4N0UA 4NQTA 3NN8A 2Q3AA 2JLLA 3QIUD 5EUOF 5ID0B 2BJML 2Y07L 3QUMB 2PXYB 4F7CB 2AXGA 3FFDB 5DJ0A 4NBZB 1YNTB 2C1OB 1KB9J 1YDPB 1KB5B 3R4DA 4R6UA 3RI5K 1F58H 3U4EA 4XWGL 3HI5L 2RJMA 3UXFA 4IRZH 4PRPE 2BNQE 4U6YB 5CCKH 1CXEA 4OF8A 2LTQB 1NFDA 1E6JH 4K9EC 1PQZB 3EYOA 5B22A 4K3EL 4KC3B 4YHPB 4EUPH 2FYYB 1EO5A 1Q38A 2ZCHL 4ZQKA 4PJBB 2BY1A 4HZLB 4MJ6B 1CGYA 4PD4K 3FB6A 4AJ0A 2GSGA 4PJ9D 2DQUH 3O2VH 2HTKD 4L9LC 3C8KB 4JPKL 1VEPA 5D7JC 1LO5B 1L9MA 3WLBB 5F89A 1KTDA 4JFQA 3SDAC 3RWHB 4XCFH 4N8VG 4RMRA 1FNFA 3UYRH 1S7QA 4C54A 2XFXB 1A6AA 1LEKA 3KAAA 32C2B 2PW2A 2J5LC 3FQTA 1JZ3A 4WUUD 4F3FB 5FYLE 5KSUA 1RHHB 1HHGA 1DBKH 1PJ9A 4F57L 4S11A 3PDDA 4UB0L 3KHOA 3O6MH 4XC1L 1NBZB 1RZKH 3INUH 5L2JA 3BAEL 4NO3A 2G60L 1H15A 1KB5A 1NCDL 4NOBA 3VFMA 2IALA 2C7UB 4LCWB 2WLYA 4N0FA 1LQSR 3RZWA 4NO0A 2AJYH 3VXRB 2IFGA 3LEXB 2FEDD 1RZKL 2OTWB 5FHBL 1ZT4A 4I0KA 3S37L 5ICYA 4HIXL 5D7KD 3GSWB 4C4KO 3MO1B 2QQNH 1QLEH 4WHCA 3LEYH 3DX9B 1AP2A 1TCRA 3DYMA 1A3LL 5C0BA 3MV7B 1TETH 3HZKB 4WDIA 5J6GB 2OSLA 4PRHE 5GS2H 7FABH 3LN9A 2L7UA 4RQQB 4XBEL 4TULL 4ZFOA 5HYQA 4Z0BH 3QH3A 1IQWL 5KVGH 4RFOH 3X13B 1KJVA 2AERT 1N2RA 3RY6C 1E0OB 4KDTC 3MJ9A 2AXFB 1XGPB 2XQBH 5J6HB 4H25B 2YPLB 5M94B 3WIIL 1UB6B 4OFYD 3VD5A 5DC4B 5KANG 1R5IB 1TETL 4LCIH 2HWZH 3PJSB 4O4YH 1MAMH 4OSUH 4X99A 1NC2A 3DXAE 5F1NB 3W81A 1KEMH 4P4KA 2ZNXA 4X80L 2ATPA 1IM3A 2D7TL 3BE1L 3RWGA 3CVHH 3OR7B 3TBSB 2HJKA 2UZIL 3TP4A 1T03H 1FNHA 4QXWA 4RBPK 3B6SA 3MV8B 5F89B 2DQIH 5GGSB 3LOWA 5HHNA 1S8DA 1NBYA 1QPXA 1KPRB 4YK4C 3A6BL 3LQZA 4HKZB 1QVOA 4N1HB 4P3DB 5EPMB 4X4MA 4Y2DC 2ZOKB 5DRNA 4ODXA 1NGPL 2CPCA 3REVA 4I5BB 1AXSB 2Q76A 1F2QA 4WEBL 4YUEH 5AZEL 3CCHB 2R69H 4TNWK 2W0FA 4BSWA 1I3GL 3T2NH 1RZKC 4NUJA 3QBTB 2BOCA 5TJWK 3DYOA 3GSUA 4U05A 1MNUH 5ISZD 3NTCH 4WW1A 4U6YA 4JFZH 5C07A 1A3RH 5KZCD 5HGAA 3TLRA 5I1DB 3CMGA 1G9MC 4F7TA 1KB9K 5TF1L 5C86A 2EIBA 3G9VA 5E56A 3BESR 5CIPA 4MCZA 1NLBH 1DL7L 1G7LB 2EEDA 4JRYB 2Z8SA 5I8OH 3QDMD 3O9WD 3EYSL 4LBEB 2H9GA 3E2HC 5FF6B 2W60B 1RVFL 1IVLA 4LLQA 3Q6GL 4Z95H 2DIAA 2DQFA 2DBJA 4OFKA 1QLFB 1GOHA 4GJTB 5IVZA 4YHYB 4OD2B 4P2RB 4OUUB 3L7FA 1UWXK 5HHPA 5T3ZE 2ZUXA 5H2BB 3IF1A 1MUJB 4PJAE 1IQDB 1NLBL 3BZEB 2J2ZA 1ETZB 4Y4HD 1J1PH 4RDQG 3MGOB 1UWGL 1V3KA 2YPKA 4MX7B 1JV5A 3BP4A 4LVNC 4GQ9L 3NGBB 1G7LA 4YBQD 3ELAT 1HILB 3QCUL 4PJDE 3LKNB 5DJXB 2GITB 4GRMA 1WZMA 2IQAA 2Y4SA 3N9GH 4PJEE 5I1GL 4GKZB 4P9HL 3RRQA 3ULSA 4Y7MA 2PTUA 2YN3A 3DBXB 1IZKA 2OP4L 5EOTA 4P23B 1P4IH 3CFJA 4QXTB 1LD9A 4QRRA 4ZAKC 3D2UA 3ETBF 1RZIB 4U3HA 2EDRA 3V4VL 1XZ0B 3G04A 3VD7A 4RDQF 3HZYA 2VLRA 4ZFGL 1IBGH 1DDHA 1U42A 5C0NC 1WFTA 2OI9C 4B0MM 4RRPG 1M7DB 2JB5L 2VE6B 3NFPA 1EPFA 4MA7H 1MOEA 3BZEA 3BP7B 3NH7H 4G8EB 4MS8C 4Z8FL 4H0GA 3BEWB 5GPRA 2YUXA 4Y16D 2VQTA 2EYTB 1S9XA 3U48A 1I4FA 3TZVC 1FNEB 2ZUQC 4W6YB 5CINL 3SDXB 5IF0A 1NJ9A 5DMKA 3QQ9D 5L6YL 2GK0B 1NMBL 3MLTA 1YEEH 5CSZA 3MRMA 4X6DF 2YUZA 3QAZC 1G0YR 2ZUVA 4YGVB 1H5BB 3VMOA 4WEMB 1RUAL 1CD9B 4YDIH 3EIFA 2B0SL 1H0DA 1FE8L 4U1SA 4B50A 2R2HA 5IVXE 1DLFH 2X4UA 4PJEA 4A6YB 2YBRB 4J23A 1KELL 4WU5A 4Y5XA 3FTGB 5C0BE 3UDWC 3WNPA 2FR4B 3RL2B 4FQXA 4D2NA 4BSWB 1KCRH 3MV7E 4HPOH 4KPHL 1IGTB 4D0CA 3S36H 4WFHE 4Y1AE 4PRBA 2VLJA 3ARZA 1RJYA 2X09A 3ARXA 5E2TH 4ODUA 2OMNA 2DQEH 1T2QL 2C1PB 3E2HB 2PYEB 2DIBA 3PP3K 1I8KA 5F7WC 1DLHA 5HGDB 4ONGH 25C8H 3OKDB 1HKFA 4BSVB 5HHQA 5MEPB 5LQBH 2ADGA 4P2OA 3GMQA 2F5BH 2DYPD 5FA4A 4LCWE 4XNZC 3ARBB 3TPUB 4PGEA 1IT9L 5J89A 2Z31C 3TNMB 5IEKB 4PJCA 1UENA 4MDJB 5LKNA 1EGJL 3BEVB 1CF8H 4WY7H 5AD0A 1DCLA 3CLFL 4IMLA 2A73B 4CVZA 4EUPB 1QRNE 5IOPB 1K3ZA 2EYSA 2QADD 3PWLB 4FQ2L 4LLWB 4GMSH 1AGDB 3MNZB 4HWBL 2WWMC 3VH8B 3I6KB 2HT4C 4N5UA 2A83B 4LMQI 1LEIA 4YZFF 4PJ5A 3PG2A 1CLYL 2VNCA 3S37X 2CIIA 5J11C 2XWBB 4BA8A 4LQFH 1E6OH 3OPZH 3IAGC 3TZVA 4JKWA 4YIQB 2ARWA 3MLYL 4EIGB 3ULVH 4UT9H 3GSWA 1TJGL 3X3FH 3FB6B 3PL6A 2YZ8A 3BZ4A 5C3TA 3ZHDA 4M7KH 3RWDA 3VXRA 2D31A 1PQZA 2P44B 3GMMB 3ISWA 4PJIE 5C0IA 1TPXB 1ZLVH 2V5RA 3MQIA 1XF4A 2NW3B 1CFBA 2D0HA 2PUQT 1OTSD 4LSVL 3PE9A 4LSDA 2HT2D 3JV6B 3K2MC 3MCG1 4WJ5A 4N8VB 1QFOA 2AXGB 4ELME 2D7MA 5DFTA 1HHKB 4H1LH 4XRCB 3T4AA 4RWYL 4O2EA 1A7OH 1FAIL 3BZ4B 5KVEL 2MQCA 3RTQA 4ORGB 1LEKB 2YC1A 4LEOA 4LCUB 3VXRD 3KLHD 1ZVHA 5F7EH 1L0XA 2H8PB 3OR6A 5BOZG 2BY2A 3N06B 2YOCA 3BGAA 3P9WB 3TNNA 4M1CD 5FYJU 3NCJL 1KG0A 1C7TA 3P77B 4XP4H 3TIDB 3BQUB 1LO0H 4LCCB 4HJJL 2WM0A 4WHTB 5GZND 4QHNA 5IFAL 3LVEA 4PR5A 3L3HA 4WWKD 1DE4A 2C3VA 4Z7UE 3U82B 3P0YH 3NCFB 1U91B 2CUIA 5CAYB 2F53E 4X9FA 1I1AC 1HH6A 2VZVA 5IOPA 5AD0B 4Z7WF 5FGCB 2X4QB 1ZWIB 1KYOJ 2HAZA 5EORL 4L8CA 3DOSA 5C0GB 4FXKA 1UACH 3OXRA 4O9HL 3GMQB 4F7CA 4K71B 1OPGH 3K4ZA 1M6OA 4IJ3B 4X7TA 3HPJB 1KJ2A 4C83A 2E8ZA 4D0DB 2V5MA 3FN9A 3LRSB 3EYFA 1Q9OA 4Y5YB 1QO3B 4RBPH 2IBZY 5IR1B 5DUML 5JMOC 3MLVL 2AJ3A 1VGKB 1A6VL 5F7UA 1ZA6B 1B3JA 5M7QA 1U3HA 3DXAB 1RFDH 4XVJL 1P4LB 3L7FB 1DN0A 2D7PA 1VA9A 1KPVB 2HFFA 5KSVB 1B0GB 1DBBH 3PV6A 1DEEA 3MREB 3WD5H 4QTHA 4MXQD 5ACMA 3MACL 4XWGH 3VD3A 1X6NA 1OTUC 4HCRL 2HFEB 5JPNA 1IM9D 5I1AB 1C16B 1EXUB 2RFXA 3QZWA 1X5YA 4OLWL 3DMMC 3PIQA 1BOGB 3D0LB 1CD0A 1KNOB 1ZS8B 2F53A 2WV3A 3C6SB 1FVDA 1MY7A 5AG8A 3V5DA 4ZSOB 4QTIL 3TJHD 3PV6B 2V7NB 1FORH 2HFFB 1FNSL 5KSVA 1EUTA 3DX6A 2R39A 5CEZE 4PGCB 4KVCL 3ROOB 1OTTC 4LHUB 2AI0L 4YXLH 2QR0B 2VDLH 5LAXA 5E8DL 4P2RD 3QIBB 1EMTL 1NFIB 3IJSB 2ZOKA 3LKQB 4PB9H 5DRNB 1EO7A 3EYFB 4G8IB 1BFVH 1S3KL 4YHKL 5T3ZH 1AI1L 5HHNB 2E7MA 3HZMA 1M71A 1J86A 5GGSA 2NY2C 3E0GA 3UBXB 1HQRB 4PG2C 3D5OF 1BWMA 3BD4A 1JCKA 1DFBL 1XGUB 3X11B 3S3JA 4BQ6A 2QBWA 3J7HA 2G60H 5I73C 2K7PA 3AU1A 5F1NA 1PX3A 3SDDD 2AJUL 3BKJL 5GRUH 3C60B 4KU1A 1A9BA 3AFLA 1NLDL 2W9EH 1IC5H 1YJDC 3KXFA 4HWEL 2GJ6B 4RSVA 4BH7B 4QRUA 4Z9KB 4OLVH 1I1FA 4JFXB 1K4CA 3C5SA 3QIWD 3U0PB 4JDTH 1T66D 2OBGA 4NQSA 4WI4A 4BUHA 4BKLB 2AXFA 5EIVA 1B0RA 3BVNA 1ZAGA 4U6HA 4MX7A 5JTWA 2IBBA 4BH8B 5GRUL 5DVNA 1U36A 3D18B 2XZQH 3UBXI 5HYEA 4P57B 3A6CL 3VXTB 1IMHC 3MRNA 3U7WL 1U92B 4YR6B 1FZOB 3KPPB 4TSBL 4RISH 2NY1D 4K3JH 3VGHA 1K5NA 4NQEE 4YQXH 2EDYA 3ZKXC 4Z7WE 2DLEA 4G6KH 4ENED 5E8NA 2OTWA 3QXAA 1FL6A 5I8KH 5B38B 5FM4A 5IBTL 4MLIA 1T04B 5CIPB 4D94A 4OB5H 2A9ML 1OAKL 2C4FT 1A7RL 1E27B 1M4KA 2GUOB 5IV2A 4LSTH 5F21B 4AYFA 3OXRB 4WJ5B 7CGTA 3IDNA 3HNVH 1MCOH 3HMXH 2BSTB 1NMAH 3KPRE 3IFOA 3SY0A 1MCDA 3AY4A 2VQ1A 4XB8A 2AEQL 3VCLA 1FYHB 4Y4HB 3LRHA 1CG9A 5DEFA 4PJHB 5BXFB 5IVXB 4PGBB 2A9MH 5GGTL 3BN9C 5KS9E 1GH7A 2R2BB 2Q86B 2OCFD 4JN1L 1QNZH 1P4BL 1HZHH 1QTYT 1UADC 4WW2B 3WIFB 5IJVB 5AYUL 4N90D 4V2CB 4Z6AT 4RX4A 5D7KE 3PHSA 4RFNC 4QHKJ 1TZIA 3S36X 3GSNB 5JHDB 3BQUA 4LCCA 3DV6A 1IGIL 3D25A 1T80A 5C09D 1BBDH 3HR5B 4L3CB 5DEGA 5ETUA 5F7KC 1AE6H 3BDBA 1HXMB 4LKCB 1N59A 4CADA 4L29B 4UAOC 2MKWA 5D93B 3B2UD 4ZQKB 3SKJH 5D2LA 5IM7A 1FP5A 3NCBB 5E8PA 2F5AH 3RIAF 4HKJB 5AAWA 5B39A 1R5IA 3CDYA 5EOQH 5I8OL 2BVPB 3PGDA 2E7HA 2L4OA 4YHOL 2VB5A 1KLGB 4ZPTB 3SO5A 4LLUA 5DI8B 1ZHBA 2OR9H 3QUMA 3HB3C 5HGDA 1V3MA 5DD5H 2ADIA 4NCC2 3I6GA 1J8HE 3QNZA 4N0UB 3H9SB 1MPAH 3MRCB 1RZFH 1J1PL 4NHUB 2Z91A 4BZ2H 5KSAC 1T83C 4MNGE 4N0YH 3VGDA 2I60H 1XT5A 3PNWB 1XF1A 2YXFA 3ZDXE 5E4EC 1JYVA 1B2WL 1VKXB 2CIIB 4C59B 5IK3B 4Y0GA 1N8ZA 4AMKL 1BECA 1NPUA 1F4WH 4Y19D 1EEZB 4KH2A 4FQJL 1KFAH 1Q94A 5AUMB 3PWLA 3AC0A 4I3GA 4H88H 3ZTNH 1DEDA 4XPGH 1IFHL 2DBLH 2XQYG 3EFFB 5E5MB 1JNNL 2ZJSH 3L5IA 5F96H 3HMWH 1DUZB 4IOSD 1XF2A 2BSRA 3IDJB 3U4BL 2JCCA 3KYMA 1X4YA 3W39A 2CLZB 5ID1A 3OGOE 1FE8H 5I1CH 1NGXB 2YPVL 3KWWA 1CD8A 1AXIB 5ICZA 5KG9B 3LDBB 3C8KA 1S9WA 2Z93B 5JIIA 1MQ8A 4FQLL 5SV3A 4OM1H 4FQQA 3IJYA 4FFVD 3LKPB 4R96A 3BPLC 3WHE1 5E9DD 3BQUD 4ZS6D 2FR4A 2VZUA 5DK2B 4OCSH 1G6VK 4GT7A 3B2VH 4O51B 5DMGC 4ZO9A 1YPZA 3W0WA 5LQBL 4M43H 4NGHL 3T08A 4OM1L 2GT9A 4UT7H 4YBHA 5KS9F 5D7LA 3QP3A 3VG9B 2NY1C 5C07E 2Q8AL 1EHXA 3GSXB 4LIQL 5GGRA 4Z76B 1GXEA 4ODTL 4FHBD 4UTBH 3VXUD 1QA9A 3MJ7A 5I66A 4W81A 4JR9L 3MLTB 1QSEA 3QXAB 1Z5LA 3RNKB 5DUBA 4P46D 3B9KC 2CKNA 5C0ND 1JYXA 2BHZA 4DQOL 2VZTA 2P5WD 3TA3C 2BMKA 4XNMB 1NCWH 3MRKA 1IAOA 4R7NB 3VG0H 5I8CA 1ONQB 4P2RA 2NPLX 1FZJA 2EEBA 1QLFA 1A1MA 1TVHB 1RZJL 2DI9A 3HAEG 1IZJA 3RL1B 1NCCH 3LRSA 1CIDA 3RZCC 4XPBH 4JPIB 4C56B 5FFLA 2WLZA 2GI7A 1QA9B 3MJ7B 1RZ8B 3RWCA 5SWZB 1NCWL 1REIA 1JZ5A 1IEBA 4FS0A 3EFDH 5EDXA 3VA6A 3IB4A 5KSBA 4ISVB 3LAFA 1IKFH 1UXSB 1LNUA 3MV11 4PJDF 4JLRB 3TZVD 4ZOAA 3JZ7A 3MCLH 5ADOH 2HVKA 3GSOA 4GKZA 4HK0A 4M6AA 1JI1A 4L3EB 1QZ1A 3BUYB 4MAUL 3MSPA 5FM5O 5MEQB 3EHBD 1BF8A 3HZMB 1CDUA 4FNLH 2VERN 3ZDXF 3QFJD 5CBEB 5HHMB 3MV9B 1WBZA 2LAAA 4R96B 1A7OL 3VFSA 2P5ED 3FO1A 4LP5A 5CHNB 3GRWH 3N1MC 1KIQA 3GI8H 4UILL 1CLZH 4KRPB 5J57B 1BPVA 3QDGA 2FX7H 3DX6B 3SEPA 3QUZD 4OCMC 2VSCA 1T0NA 2RAMA 2PXYD 4LCYB 1G7JA 4OV6F 2PYFA 3C6SA 4IRSC 3IU4H 1F5WA 4V1DA 2JCCB 1ITBB 3MCKA 1B6DA 1N6UA 4M7ZB 3GHEH 1RUQH 3BJLA 3P4NB 1EFQA 1FLRH 4JZOB 5D9SA 3HNTL 4M48L 4PJXB 2K3TA 1BX2B 2NR6C 2WIIB 2I26N 2HKHH 2GTWB 1CVRA 2F54B 4FQXD 5EC2A 3H3BC 4E41B 4EUPG 5I76A 3AB0C 1YMMB 4G8FB 3ARDC 4WI7A 3WO4C 1MF2L 1V7NL 1JPTL 3NA9H 1I3VA 5D1ZB 5TH2B 4PJ7B 3HE7B 2A1WL 2X4SB 1X5KA 1U3HB 2P5WE 3S35X 5L8KB 3UTOA 2Q76B 3R1GL 5DQ9A 1RK0A 3HPLB 3L3OB 3BRDA 3LPWA 4CDGC 5JW5A 1MEXH 1JTOA 4X6CE 3NA9L 3WIHA 3A67H 5ICZB 1E4KA 4LLUB 5DI8A 4YHML 5GS1C 1UFUA 5C09E 1QQDA 1FJ1A 2GSIA 3PGFL 5SWZE 4W4OC 4CNIB 4LAQH 3VI3F 3UJIH 4IIQA 2B1AH 5CD5D 5TF0A 4D8PB 2ATKA 3OGCA 5BS0A 3CSGA 1MHEB 4XPAH 5T5FH 2O5ZL 2DICA 1NBZA 3JSSA 3SJVD 1OAZL 1JGLH 1S7TA 2IQ9L 4MA1B 4YJZL 4LSUH 5DJZA 3SGDI 3ABZA 4XZUA 5IMMB 4HJ0C 1BVKB 1L7TH 3MYJB 1Y18A 1KJVB 5C08B 4IRZL 1CICD 2HN7B 5IBLC 1A6AB 4KTYA 1HHJB 5IB3A 1UWEH 3PWJA 4HDIA 5I9QC 1IC4L 4QTIH 4YDJB 4CVXB 3L3JB 1EV2E 1RZGB 2CKBB 3PNWA 3CDFA 4P5TD 3HLAB 4UDUA 3WD5L 4AK1A 5E8DH 3LH2H 3PQYA 4NC1C 2IADB 3C2AH 15C8L 2LU3A 1A5FL 4IEFB 2WW8A 5EFIB 4MZ3A 2V2WB 3RGVD 1OVZA 1OB1B 1RU9H 3SJVE 4FFYH 3PWPA 5DJDA 4HS3A 4U1SB 5IGXH 4G9DB 2H2SD 1WIPA 3B5GA 1H15B 3J8F7 3SOBL 3VFMB 1I7UA 3O3AB 3C2AL 3H9ZA 1W2KT 4LLYB 3DUSA 1MAKA 4HC1L 3LEYL 4J3SA 4OLZL 5F6HI 5GGQL 1R0AL 2UVFA 5JORB 3ARUA 5HJ3A 4AEHL 2VDRH 3GBNH 3MV8D 1H3TA 4DVBB 3U1SL 3LRGA 5T1MA 5KVGL 3DURA 2XTJD 1IEHA 4OFVA 1UM4L 3W9DB 5JW4N 4NM4L 3T2OA 5T1KB 1FZOA 1LDSA 2Y36H 4G3YL 2Z31B 4ETQA 4N90E 3MRGB 2FD6H 4YWGL 4H5SB 5I1JH 3L3JA 3ARBC 4XNZB 3ARRA 4QCIB 2CR3A 4JM2D 1LEIB 4R4FH 4NQDB 4UU9A 4P46C 5CEZD 1OP3H 1YNKL 3DGGB 3LSOB 3QNYB 5CJOH 1ADQL 2EECA 2GHWB 4EI5D 1MVUA 1FQ9C 1NGWA 2ZUYA 4JQVC 3T0XA 1SEBB 4JRYD 3ZE0E 2YD2A 1HHIB 4U1GB 5CZVL 1T66C 3DNKA 2GFBA 4P5MA 4OZFH 1HILA 1GGIH 3HNSL 3A6CH 4P2QB 4G9FA 1GC1H 1D6EB 2WBWB 5KSAD 4RMSA 3NIDF 2OK0L 4ODUB 2P46B 3UC0L 4FQHB 4X83A 1LILA 2R1XA 4JPKH 3EW3B 1G7HA 2VL4A 2OJZH 1JIBA 1T21A 3HG1D 5CD3A 3NCYS 3QAZB 3EO9L 3UTTB 1R3HB 4R3SB 5FB8B 5D1ZA 2JCCF 1BZQK 5HTSA 1IAIH 4IIQC 4BH8A 1YMMA 4G8FA 3RZCA 3EO0B 1A4KA 2YZ1A 2KQNA 5FYJD 3UX9B 1DBKL 1PKQE 4F57H 5F9WC 1LO4L 3FT2A 4X6DA 5B3JF 1K4CB 1FAKT 4JO3H 4K3DH 2ADFH 1VFMA 1DVFC 3JTTB 4R4NC 4OLEA 4HF5H 1P4BH 4J4PA 1OQXA 3X14B 4UINH 2XZZA 3G6JA 3CFEA 4QWWC 4UUJB 4Z7OE 2DQJH 4E0RA 2XOTA 4NOFA 4OF7A 4KV5E 1XCTA 2C4FU 4QHLA 1JF1B 3IFPB 3TJHC 1DN0B 4TVSa 3DUHA 3VJ6A 3WV0A 2X9WA 4LVEA 1JF5A 1FRGH 1MJ7L 2NY4D 3DSFH 3GUTB 4KY1L 3CX2A 3WNNA 1RZFL 2NXZD 2VDML 2ZUWA 1ZA3A 4K8RH 1P4IL 4C58B 3LIZL 1AIFA 1BOYA 4FOMA 2AV7A 4NP4L 1B4JH 5CEXA 1XCTB 1D5IH 1N6QH 5DO2C 3HUJF 5AWNL 1ZT7B 4CN4A 4GMTL 1SEBA 5DZOA 3AXLB 3D2UB 5FECA 1QFPA 4RMUA 2E7LA 5EO0A 3WHXB 5HHVH 4CMMB 4J3XA 2DLFH 4W6WB 1E4XL 1MVUB 5ILTH 3ZTNL 4LHQB 2ERJC 2DBLL 1BWWA 5DJXA 1G6RA 4HHAB 2WUBL 1B4RA 3RVXD 1HH6B 3N9GL 4RMVA 4MA8L 4UT6L 2AXHA 4F9PC 3NIDE 4FQ1L 3H7BA 2GAZB 3BP4B 4AG4L 1VFOA 1UZ8B 1WT5C 5GGVL 4QGYA 3BSZL 1IARB 3MPCA 5HYFA 5HYSG 1ETZA 5EIIB 3MRBB 3QEUA 4POZD 1YEEL 5JW3L 1A9EB 5E70A 5LGHL 4JFFA 2IPUK 4D9QE 3DX9A 3VMPA 4PLJD 3P0VL 3LKRB 4PJDA 3ZDZE 3QIUB 4LSQL 2DQFB 1F4WL 3WIHL 4UZGA 3DURB 3QULA 2EYRA 1O7SA 3QRGH 2BX5A 4J6RH 1XGQB 1JRHL 1TJIH 4KGLA 3MR9A 1IGCL 5JORA 4MA7L 5DMGD 5BZWA 2VXSL 4X4XA 4YEFA 1FBIH 2GY5A 4S1RH 3ZE0F 3NACH 5D1ZC 4WFFD 4P4KD 2NTFA 5TFSH 3FMGH 3KVQA 4KPHH 4DZ8A 3ALXA 2X7LA 3M17A 3LV3A 3ULVD 3RUGF 2YUWA 5I1LB 3GB7A 3SDAA 1NL0L 1OWWA 2BOCB 5DK2A 3MBXL 2EE6A 3SDYH 1BHGA 3QHZH 3PABA 5BVPH 3QHFL 3KJ6L 1FFPB 1P7QA 4QHUA 3FQWB 3MBEB 3LKPA 1F6FB 1SM3L 2DB8A 4UV4H 4XBGB 5GSVA 4WVRA 5EZJA 2QKIA 3GZKA 2UYLA 1QVOB 4H5SA 4OT1H 3TZVB 2BVTA 4HJGA 8FABA 1UJ3C 4GW1B 4OCSL 3TESA 3QXDB 1CZ8H 1LO3L 4KJQC 4FABH 3D39A 5T1KA 3OKOA 1T22A 1Y18B 5J1AB 3RWGB 4UIMB 4PP2B 4FQ2H 2ATPB 3HUJB 4HWBH 3QG6B 3U9PL 5F71A 1K4DA 3EJZC 1A6WH 3V52L 1MJJB 2BSRB 4L8DA 3MNWA 3I02A 3GGWB 3F7RA 4XH2A 2HT3D 3ZO0A 25C8L 1EERB 1ZXQA 3IXTB 4CNIA 3G6AA 3L5HA 4JZJC 1XR9A 4PY7B 4LAJH 4ZFGH 3GMMA 1P7HL 5HYQB 5IKCB 1SJEB 1N8ZB 1R5VB 2CKBH 4ZODA 3ZDZF 5C0BB 1CF8L 4Z7NF 5CUSH 3HRZA 5LJYH 3MLZH 4HH8A 1KJ3L 3AY4C 2WQ8A 3FOMA 4YE4L 4PJFB 2O