4M7ZC

Unliganded 1 crystal structure of s25-26 fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 54
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zC01
2YA0A 4A2LA 3KLSA 1YDPA 3L5WA 1EEZB 4LNRA 3RA7L 1NFDA 2EC9T 3ZE0E 2OBGA 4Y19A 2ZG1A 4FQQB 4DZ8B 4XCCL 4Z78B 5FO8B 1B9ZA 1H5BB 3SDAD 3NH7H 3RVUC 5DJZA 3O41B 4QEGA 3QUMH 3BEVA 1JGVL 3PWNA 1XCTA 5CINL 5MENA 3IVKB 2GJZA 3RZCC 4YDLC 4YDIH 4M6AA 1PG7W 4L8DB 4MA7L 5D71L 4MNHA 1KJ2B 3CUPB 1A7QL 1SEBA 3CAFA 4KKAD 2Y36H 3BVNA 3ZL4H 2A38A 2KL6A 3CLEH 3BWAA 3S4SA 4HWEH 5EZOL 1HOCB 2VABB 1OAXL 1XF1A 3UROR 1NAKL 4PUBL 1T2XA 4HFUH 3REVB 2OMBA 5IGXL 1RUKH 2GUOB 4Z7UA 1BQUA 2KBGA 3GSQA 3X3FL 5DRZB 5J0BA 1ORQB 1OAQH 5L2KD 5KVEL 2CLRB 3QDJE 1GOFA 1NC2B 4JHZA 3OAYK 5H8DA 1X5YA 4F8TA 2JELH 2MPAL 3RWEA 3OKLB 4NRZA 1AJ7L 2HH0H 5FF6A 4JZJC 3HE7D 4OLXL 5K33A 3KYOA 3DYOA 1A0QL 3SHSA 1J8HB 3D0VA 2I60H 4L1DA 4IIQB 1P1ZB 3OKEA 1EMTH 2UZIL 4HUMB 3C09B 3ARYA 2HA1A 1A4KB 4QHLB 3P2TA 4KV5E 5B38B 4YDLB 3MOBL 3QJHA 2HKFL 4YAQB 1FZMA 2A0LC 5TE7H 1AXTH 2X4SB 4WI4A 3MLRH 4KTEL 3L3HA 1D5BB 1H3TA 1UA6H 2MOVA 3T0EA 1SMAA 3OZ9L 4WEBL 4NJ9L 4KUCD 2VN4A 3I6KB 3U7YL 3MRFA 1S7VA 1NFIB 4Z8FL 3RWIB 4LLYA 3OKNB 5FYJD 1KJMA 4NKIH 3T2NL 1SM3H 3WN5C 4TUOB 2P4AB 2DS4A 4XCFL 2DM7A 5DQJB 3AVEA 3U36A 1LEKA 4FQXC 1YZZA 4RMQA 3C5JA 1T2QH 4JQXC 3IDJA 3STLB 1NJ9A 4NNYB 4HZAA 2AJYL 4U1GC 2DJSA 4JZJB 5IQ7H 1KXTB 4UBDD 2XV6B 5L88L 1CFNB 2XICA 3W2DH 5C08E 1FN4A 1Y18A 2CIKA 2DIJA 3FFCE 4JPKL 4KXZH 5ITFA 3T65A 2GAZA 2OJEA 4PRBB 1YJDL 5L8KB 1BOGA 4PJIA 5HI5C 1EIBA 4XVSH 2EH8L 3G6JE 4PB9L 4X6FB 2D31B 2EDXA 2KKQA 2XKNA 2A2QT 4PJBA 4H0GA 1JV5B 2IPTL 4JO2L 3VFTA 1ZVHA 4RISH 5C0RH 1EAJA 3OBAA 4KAQH 4MDIA 4JRXA 2BNUB 1RMFL 5BS0A 1MRDH 5TFSH 1MQKH 2PO6A 5I1IL 1MHHA 3NZHL 1LMKA 4QRUA 4FABL 2P5EA 2DD8H 1WVZA 5ACMA 1ZANH 1HHJA 1FBIH 1EEYA 1INQA 2Z93B 4X7FC 4JFFA 1AO7D 5DK2A 1OF2B 3MGOA 4HEME 4NQDB 5I1KH 1KJ3L 5F9WC 4K8RC 2APBA 5LVEA 2CDFB 4PJCA 3AS1A 1I7ZA 3PXJA 1E27A 2XZCH 3Q6GL 4POZC 3IGAB 1DVFA 3B5TA 1MH5B 2VXQL 4CU6A 2WBKA 1IFHL 1S5HA 1B2WL 5DUBB 5D1ZA 5I6XC 1MF2L 4JN2A 3MSPA 4CADB 4I48B 3GUTA 2ADFH 5I73B 5DD6A 1SEQH 1T20B 5MEPA 4X5WA 32C2A 5HBBA 3MPCA 4NDMB 3ABZA 3ZT7A 1JWUB 1FNFA 3N1GC 1UWGH 2R2BB 4ZDHA 4LCUB 1C5BL 1G7JA 5JOPD 2NTFA 5GHWH 2CDEB 4N0CC 5EH1A 4Y4KA 3DV4B 1Z9MA 4P3DB 2WMPA 3GMMA 4HHAB 1QEWA 2WV3A 1AHWA 2OXHA 3L5IA 1Y6KR 5IQ9A 4RFNC 1AE6L 4JHAL 1I1AA 5B8CA 4MWFA 2AK4E 5F9WB 5FA3A 1BBJA 4ODXA 4WHYH 4KK8C 4PGDA 4P23C 5IW1A 2W9DH 5EWIH 4OLUH 1D5IL 1A6ZB 5JXEA 5FO7B 4JFZH 3BP4B 3HB3C 5IBUB 4WRLA 1X5IA 4N8VG 4X0KB 1X5JA 1C12B 3IETA 1QSEA 5CJXA 1QP1A 5I6XB 3H3PH 3G6DL 2VLJA 4UQ3B 3L3IA 2B2XH 4B41A 2BRQA 1XZ0A 3FO1B 1CFSB 3OF6D 3SQBA 3VCLB 3TV3L 1JN6B 3LKPB 4WFFD 2PYEE 3O3EA 2ICEA 4Q9RH 4IHOA 5C0BA 5EIIA 1QFPA 3C60A 1FAKT 1G6RA 5K9QI 1U3ZA 4LCWB 2OR9L 2RCSL 4AYFA 2IANE 1OGTB 3IXAA 5TQ0L 5C0GB 2NXYD 5E99L 4RFNB 4OKVB 1FVDA 4BQ9A 5BOPA 3O2DA 4G6FD 1LO2L 3T3PE 1KCRL 4G8EA 3T1WA 3EDJA 3UTSD 5CJOL 4M5ZH 2ED7A 4P5TA 5DJZB 5GIRA 1XGRB 4ORGA 5IFAH 3BEVB 3EFDL 4WFHE 4P23B 5CGYD 4TN9A 5HJ3A 4N0UA 1A6WL 1WC7B 4F3FA 1ZK9A 1INDL 3VGDA 3ULUD 4PJ9D 3QFJD 5I8EA 3NIGE 1KPVA 2D7OA 1SEBB 1F90L 2GK0A 4PJAF 1NBVH 3KPRB 3T0EC 3D0LA 1XR9A 4U1NB 4ZO6A 1J05A 43C9A 5F1OB 4TSBL 4M6NL 3MV7D 4ZFOA 4I3SH 4PJFA 1CTOA 4MX7A 2MFNA 2G9HA 1L7IH 5JW5B 1SVZA 5KVDH 2V5MA 4NPYB 3V79C 5H2BB 4HEPG 4Z7UB 3GSQB 2HKHH 3DECA 5FKPA 4K23H 1YNLH 1UC6A 1TVBB 1KTLA 3VXNA 2EDEA 2XTJE 5HGHA 5IFJA 1OT2A 4PP2A 3CFBA 5KOVC 2A9MH 1NDMB 2IBZX 1U2CA 2R0KL 5HDQH 3X12B 1BLNB 4Y88A 1S7RA 2EDRA 1YPZF 1II4E 4L4TE 4KGJA 5SV3A 3QRGH 1BJMA 4Y5YA 4UB0L 2OS7A 1I8IA 2VDML 3D0VB 4KHXH 3WFHA 4U7MA 4D0CA 1LO4H 1T7ZA 3OR6A 1N7MH 1P84K 3HCVA 3GRWA 4JQIH 1YMME 4GW1B 4M1DL 4KZDL 1I8MA 1E4WL 1KYOJ 5CBEB 4FQHA 4LIQH 1WWAX 5I1LA 1G7LA 1HHKA 3OQ3B 4P9ML 3WO4C 3CDGB 2VMFA 1QLFA 5FB8A 3QZWA 3L3HB 3T0EB 1GXEA 1P6AB 3MRGB 3T4YB 2C3GA 3MRFB 4OZHF 3OWEA 1S7VB 4FNLL 3RWGB 2PO6C 2V5TA 3D2UD 3HLAA 3PG2A 5SWQA 5C09B 5C0AE 1KJMB 5IBTL 1T1YB 3V0WH 1L9MA 2P8PA 1UADC 4KK9C 5FO9B 5E00B 3U4AA 3U4BL 1YEJH 1YEKH 1DQJB 1YNTB 3TYFA 5FHAL 3EO1A 5C0FA 1KEMH 1DUYB 3P3YA 3H9ZA 1U3HA 1NGXB 5DI8A 3V7AE 3DPBA 3VG0L 4QHKJ 4HGWB 1DVFC 4RGOH 2C1PB 4LHUG 1IEBA 2VZ1A 4AY0A 4JVWA 1FN4B 2CIKB 4Z0BL 5D1ZC 1MY7A 2ATKA 4JM2F 2IF7A 5HYJA 3KPOB 3N50A 5ITFB 3T65B 1F4YH 1Z3GH 4YHIA 3UTTE 2VZVA 4BSWA 4D3CL 4HIIB 3V95A 4D0DB 3E1F1 5DJYA 3SDAB 4GG6A 5GZOC 4FQ2L 3HI6H 3MJ8B 3WO4B 1EO8H 1TZHB 2XPGB 1WAAE 4Y4KC 2F5AL 1LK2A 3HNTL 4RFEB 1BVKA 2RR3A 3O3DA 1MHHB 2YSSA 5FYJH 1AHWC 4QRUB 3NPSC 1JPFA 4NNXA 5LWYL 2HFEA 5HDLA 4DZBA 2NY6D 2WZPD 4G8GE 1CL7L 5DK2B 1LO5A 4JREC 1CXEA 4EN3A 1I1AC 5B8CC 2DL2A 4OFKA 3ZHDA 3WUWG 3DRQA 3B8SA 3KPNA 5JHDD 2DIAA 3BPOC 1E27B 4TOYL 4WO4D 3F12B 5JXAL 4KVNH 3BN3B 2DWDA 4OLZH 3EDFA 1TZIB 3HE7B 2DM4A 3MQIA 1S5HB 1SBBA 4PB0H 5C71A 1HSAA 5CILH 2PUQT 3NBNA 3RUGE 3NVQA 3CSGA 5E4EC 1J9CT 4U2YA 2EDYA 4Z7WA 1IM3B 1JNNH 4OGYL 3RWFA 5DC9B 5IP4A 4HKBB 1RIUH 2VDLL 5DD6B 3MJ9H 4PLKC 1KENL 4QNPF 4E0RA 5E0QA 1JF5A 4LAQH 5TJWK 4Y5VB 1E6OH 4UIKL 3G5VB 3AREA 5T33L 1JTTA 4XVJH 2AJ3B 5CWSB 4DVBB 4ZNEE 4EEEA 4HUKB 3DX6B 4HJGB 5EU6A 1YEEL 3GMMB 1RHHB 2W60B 3FMGL 1AHWB 4TNVF 4IRSD 3NPSB 4NQTA 1JWMA 3IJHB 3JSSA 4MMXC 4DGVH 5IQ9B 1HSBA 1NMBH 2BY2A 4MDJA 3EJYD 4HZLA 5I8KL 3HMWL 9CGTA 1G7IB 2ENSA 4JREB 1I1AB 5B8CB 3RU8H 4MWFB 2Q3ZA 4L9DA 5FA3B 4NHUA 43CAA 5HHXL 4Z7OE 4KJYA 4F7EB 4JQVA 4J7RA 1BD2E 4K3EL 1JF1A 2ICWJ 4OV5A 3NGBC 4NCDA 1RFDL 3VFRA 3TJHD 3IRPX 4ODTL 2FJFA 5E4EB 2E9IA 5E6YA 1F4AA 3DO7A 1EH9A 5CZXC 2DKMA 3QPXH 5D1QD 5C0CD 1L7TL 3L3IB 5ADOL 5CD3A 5FYKL 4PBVC 4OD1L 3QIWA 1FYTD 3C2AH 1K4CA 4YE4L 4B53A 1RY7B 4L4VE 4JKPH 1GGUA 4RCAA 1JRHH 4IHOB 5C0BB 4C59B 8CGTA 4U6VH 5FGBA 3THMH 4WJ5A 2A6KB 4I0PD 2NMSA 4LPUA 2JK5A 1T66C 2NY0D 2HRPH 3V6BR 1BBDL 1HKLH 3CJJA 1RJZB 1FFOB 4Y5YC 1YN7B 4KK6D 5BVPL 3H6JA 4XXDB 2G5RA 1CLOH 1SY6H 2F15A 4G8EB 2NY2D 2XA8L 1AO7B 2J6EL 4LCYB 4ORGB 2BJML 3QA3A 4WUUE 1A6PA 3A67H 3DBXA 5I30H 3NGBB 3OV6A 4F3FB 2CLVB 2M8XA 4CDGC 2FJGB 3W0WA 4F7MB 2ICCA 4HPOL 2EDJA 1EEUA 2VDOL 5BXFA 5LCVH 1QR1B 3MA9H 4LSTL 3WJLC 3A6CH 1A6AA 1CGVA 1X9QA 3QPQD 5IROA 43C9B 1NGPH 1B6DA 4M93C 3O2VL 4PRIE 3SDDD 4KJWC 2PKDA 2DLFL 1RK0B 3O4LD 3PXHA 2XRAL 4MX7B 4LDEB 4JN1H 5J12C 1ZVSA 2FYYB 4APQD 3RI5F 1IKNA 2DMBA 4TQEH 5C9JB 5C7XL 1HILA 5DRNB 4LPXA 1KTLB 3RRQA 3VXNB 4M6OH 4KJQC 5IVXA 3MV8E 2DQEH 3QWOA 2I07A 2Q76A 4J6RH 4C56E 5JPNA 1ZT4A 4CNIA 3OAUH 2FX9L 3L3OA 1S7RB 1U3HC 2W0PA 2B0SH 4JKKA 4MHHG 3WJJA 3G5XA 2IBGA 3T77A 1MJ8H 5EG6C 2B4CC 3P4MB 4NQCD 1RZFH 1OW0C 3EOTH 1OSZA 2J12B 2XI9A 3DVFA 3ZDXF 5DFWH 3DXAE 4TPRH 1I8MB 1W0YT 2BVOA 4IDJL 4KFZC 4K94H 4FQHB 5KS9E 4XNUL 5D8JH 1G7LB 5I1LB 2OJZH 1CCZA 1U8HA 3VXTB 4KJPC 2VXSH 4R4FL 3GSOA 1MPAL 1VGEH 3MUHL 5GISL 1UXSB 5FB8B 4PJHE 3LZFL 4CN6A 3BKYH 3C87A 4P2RA 3ULUC 1S7QA 2X4NB 4RMWA 5E9DD 4PJ9C 1MCHA 3IYLW 4M7KH 2F53E 2VXVH 5SWQB 4GH7B 3UZVB 5J12B 5I19L 4Z7VF 5IVZB 4BA8A 1L6ZA 2RAMA 3C8DA 3O45A 3SQOH 2FEEL 1GGYA 2H2SC 1QRNE 1UM6L 2LAAA 2VDKL 1N26A 4NQXB 2APFA 4MA3A 5GS1A 3CX5J 3I3DA 4U1SB 4EUPG 2VLME 4NGHL 1I1RA 4X8JA 5C0FB 4YLQT 1U3HB 1ZLUK 1U92A 1BFOB 1YQ2A 4FZ8L 1LP9A 5ID1A 4PLNC 1IGIL 5FYKE 4WUKH 3V4PH 2DQTH 3C8KA 5EZLB 2NXYB 3WDHA 3O3AA 1XF5A 3K4AA 4UOW0 4D9QD 5HYJB 3KS0H 1ROWA 4LASL 4YHIB 4BSWB 1VKXA 5EFIA 4G6FB 2X5PA 3TT3L 5KVMC 3KHQA 5E8NB 3UTSB 5HHOA 3E8UH 1UB6A 4DEPB 5IEHA 1BEYL 4F7TA 3QEUA 7FABH 1R3IL 3P4LA 3BRFA 5F1KC 5T1KD 2YK1L 3HUJF 4PJ9B 2CK0L 3LEYH 5DLML 4JKWA 3WFEH 4XAKD 4QRRD 4JFEE 1E4XH 4P9HH 3O3DB 4PJGE 3VXUD 1MCNA 3ZE1F 1DLFH 2DIBA 3MV7B 4NNXB 5GGVH 4DZBB 1TMCB 2XA3A 5DMGD 5LJYH 3P4NA 2XG5A 5HD8D 2MMXA 2NY7L 2DQJL 3Q1SH 4P2CG 4JJHA 3IAGC 1NH6A 4R0LB 4R6UA 1NEZA 2BNQE 3TH2T 3DRQB 1RZIA 4JQVC 4PLOB 4R7DA 4GLRH 2KZ1B 5D72H 3DVGA 4UAOC 5GGUB 1KT2B 1RZGB 1TQCC 1K6QL 4DKDC 3EYSH 1WBXB 5KJRL 1BZ7A 1NBYA 2IFFH 5C6PB 4I2XA 5GRVK 3VRIA 3BUYB 1NKRA 3U2SB 2FHFA 4NYLA 3QIWC 4H8WC 5DMYA 3AXLA 5IMOB 1QBML 1IGCL 3OB0H 5HHNA 1JPTH 1CFTB 3STZA 5T1LD 3T8XA 3RIFF 1RJCA 1IT9L 5D7SH 1GC1L 3QAZC 5F9OL 5FGBC 1LE9B 3RBGA 1MI5D 4J1UB 4HWZA 4MA1C 5F3BB 3BESR 1I8KB 2APXA 5JMOC 4N8PA 4LSVL 1N64H 5F8RC 1HDMA 5CBAA 1ONQB 3LDBC 5DJ8B 4AT6A 3D2UB 2FSEB 4FZEL 2VDQH 1OVZA 3QDGA 3GSRB 1WZMA 2X4TB 5D7KD 2YPLA 1P84J 4AJ0A 1IC7L 2RJMA 2GYSA 4DTGH 4JO4L 1JF1B 2ARJA 3MRMA 1ADQL 3GIVB 5DJAA 4HUVA 4OV5B 4F9LA 2EE9A 3VFRB 2OTWA 2AJSL 1TQCB 3QUKA 4NJAL 2FJFB 4M43L 3B2VH 5IROC 4NZJA 3CMOL 3CC5B 4HV8A 1HYSC 2BP3A 1GYAA 4XBPB 1WIPA 3X13B 4EDXB 1HK6A 1VACB 4OD3H 4LVOC 5FOBA 5I18L 4OQTL 3I02A 3QIWB 4M7JL 1N2RB 1H3GA 1IKNC 4HS6B 4UV7L 3HAEA 4XNXL 3QUMA 4NC2B 4DN4H 2NW2B 2E7LA 4CW1A 3CK0L 4NZUH 4ZMAT 4TVPL 4XC3H 4YFDB 4PBWD 4NQEE 1SBSL 4GAGL 4HS8H 1S7UA 2JK5B 4K3JH 1U6AL 2J8UA 1Z9OA 4DFHA 1T1XA 3PV6A 3WJJC 5CEXA 3LDBB 4NM4H 4RX4A 5BW7A 3VI4F 4MZ2A 5DQDH 1X44A 1MHPH 3LRSA 3EJYC 2W07A 4HJJL 4ZODA 4HXAL 3P9LA 4ODBD 1QD0A 4RA3A 3VMNA 5GSVA 2YPVH 3QA3B 1CDBA 5CP7A 2X4UA 3VXOA 3BH8A 5GGRA 1GGCH 2Z0BA 4YXLH 3VWJD 5INDB 3BRGC 5F96L 4EDWL 5JHDB 3PP3K 2VXUH 2AV1B 2BSSB 5BXFB 1M05B 1TITA 1XH3A 4KK5C 3JUYA 3LSOB 2D4DA 4HULB 1F4XH 4G9FE 5I1EH 4ODVH 4EOWH 1ORSA 3OKOA 3DMMD 1JF6A 1ZVSB 2GK2A 2V7NA 4LLMB 4M03A 5IIEB 1ZGLB 3ARWA 1CK0H 4XAWL 1JYXA 2X7LA 3ALPA 3FHAA 4FOMA 3X14A 2WWMC 5J1TC 5K9KA 2R1YA 4GRWH 4M61A 5GS1C 4BZ2H 1ZT1A 2Q76B 4OB5H 2XXMB 1U58B 5HI4D 2H6PB 1Z9SA 4R26H 4L3CA 4Y16A 1U8QA 1DDHB 3ZSTA 4G7YH 3L1OL 4YDVB 4H26A 4OZIF 5JHLL 4BQBA 2D0FA 3GMPB 5JORA 4IRSB 2H3NB 2F74B 1EGJH 2ZOLB 3FT4B 5D1XA 5DUMH 2R0ZH 1AR1D 1OSZB 4OF6A 3C9NB 2VIRA 4ZG1A 1JNHB 4N1EA 4ZS6C 4P4KA 3CVHH 4JRWA 4ZPVA 2C3VB 1U8HB 1Z0NA 4XXCA 3E3QC 1EXUA 3D9AH 4K7PH 1CLZL 1DBJH 5DJ0B 1T0MB 1UQSB 2XZQH 3ALWA 2QTEA 3OJDB 5C0ND 4YR6A 1S9VA 2IMNA 4OBSA 1T6VN 5HGBA 4HK3J 1OGAD 2HVJA 1DQDH 3D39D 3HFML 4MB3A 5D1QB 5C0CB 3SDDC 1PEWA 4MQXD 2HTKD 2EKSA 5FK9A 1FYTB 4UV4H 3TIEA 3QG7H 1W0VA 2GJ6E 4MA3B 5D7IE 1G0XA 1U8OA 1ZA3A 2OSLA 1F6FB 1PEZA 3LOWA 3LN9A 1BP3B 1CN4A 2XZAH 4ALAH 1QACA 1JPST 4Q2ZA 3V9FA 3ARFD 2W91A 4QOKA 4I0PB 3ZHKA 5DVNA 4OSUH 5EBMB 1IGFL 1T1WA 1X5ZA 1GZPA 3DJ9A 4X7TB 3O3AB 1P5VA 1XF5B 1ZHNB 5CKAA 3WIHH 3ZTJG 3M17A 2H2PC 3NFNA 4GMTH 1VKXB 4TVPE 2O61B 4M48L 2FX7L 5FHBL 4WU7A 2ZPKH 5DO2D 5AUMA 2NY2B 1F3DJ 3CVIL 1NCWL 1L9NA 3L5JA 4YFLI 1TCMA 4M3KB 4GW4A 4CL7A 3TNNA 1I9JL 5BMFH 3O81A 2NPLX 3RVWD 4F7TB 2VC2H 3W5MA 3NIFE 2C26A 2AABL 1NCBL 4U1IA 1IC5L 3U6RA 4EUPH 3WV0A 5EUOB 2P24A 3VW3L 4Z76A 3HI5H 3SDDB 1T5XA 4NBZB 3QUYD 4YX2H 4APQB 2IGFH 1F97A 4LSPL 4MJ6A 3QEGL 3GMOB 5ISZE 2KDGA 3TA3A 1U93B 3L95A 4JCLA 4JRYA 1E28B 4R7DB 3K2MC 4BUGA 3TNMA 3OPZH 3LCYA 1HHIA 4MVBD 4F9LC 4KTDL 2AGJH 2ZSWB 3DVGB 4XVTH 1CGXA 5ETUA 5JW4Q 3BSZH 4WI8A 5DVLA 3AB0C 1IILE 3HE6D 4CGTA 4HSQA 1FO0H 1T5WB 3LPFA 4NQCB 1OM3L 1E6JH 4GKZA 4PG9A 1I8LA 1IQDB 4I2XB 3QDJA 5HVGB 5M95B 3FQWB 5GXBB 1UWXH 1EX0A 4RBPK 1BM3H 2BVPA 2Y1VA 2LV4A 3H3BC 4NYLB 5DEZA 3V6FA 3NABH 1BVZA 1VFUA 3MV01 1KC5L 2WLZA 4KKNA 5EU5A 2E7LC 3F7YB 5HHNB 4RRPG 5FKAB 2R4SL 4GXVL 4HAFA 3HI1B 4OCSH 3STZB 3T8XB 1F8TH 3TESA 1O0VA 1OAUH 2Q3AA 3DUHA 4HWZB 2Z92A 5DHVA 3PDDA 3LS5H 2O5YL 1TZGL 4U1JA 4PJ7E 1WF5A 2EDBA 4LK4A 1RUAH 1F58L 3VFGH 3BEWA 3SKUD 2XXCB 2IG2H 1FVEB 2Q8AH 4EUPB 4JPIB 4KXZI 5F88B 5BW7C 2BVTA 2VSDA 4ZO8A 5JW3L 1UT9A 4HCRA 1B90A 3SKNB 4XPFL 3H7BA 2LE9A 2PCPB 4LRNL 4NQSA 4K7FA 1OP3H 2YPLB 1JPGA 4D9LL 1EO5A 4X6DF 2YPKB 1ZLVK 2HLFC 1FRGL 3BGMB 4XZUB 3TWCL 2ZUYA 2Z8RA 3MRMB 5DEFA 3QNYB 5SWSE 1CIUA 5ANMB 3RPIA 2UWEF 3TPUA 1Q0YH 5IB3A 3AB0B 3EJJX 3IJYA 5H94A 1QFOA 1D5XA 1NBQA 1U8LA 2AK4D 3RDTD 2BSTA 2D7NA 3MYZA 1J87A 3DIFA 4ZD3H 1QSVA 2FH8A 1RUPH 3JWOL 1G1YA 4WHDA 3GK8H 5FOBB 1FE8L 1FO0B 1UH2A 4WCYL 5GJTH 3OAZK 4LDLB 4G9DA 4G6AC 4PJEE 4WFEE 2XQBL 4S1RL 5C08A 1J0ZA 4HFWA 1UJ3B 3QXTA 5DR5H 4FQIH 5T1KB 3EO0A 3FFCA 4AZ8A 3D85A 2BOBB 2J8UB 3PV6B 1YN6A 4QRRB 1QFUL 3GI9H 3CZFA 5F7NC 2PYED 3VXUB 5IV2B 3S96A 4PRDB 5D1XC 4CKVX 2NLJA 4PJDA 1CD8A 4RFOH 2MTPA 1MUJB 3PP4L 1DZBA 3NTCL 5D5MF 4AIXA 5GSVB 2LU3A 5GGRB 2QV2A 3H8NA 4XXCC 3NFSL 5DK0A 1S7TA 2G60L 3LKRA 5B39G 3QIBD 2DQIL 4YPGB 4QXUL 4WFHD 4NKQB 3O6KL 1IGTB 1U3YA 2ADJA 3ULVF 1CD1B 5C3TA 3MLUH 4PIRF 2V7NB 4MAUL 4PD4K 1FIGH 4HDIB 4OFVA 3SDXA 3HZMA 3IS1X 3PGCA 2DQFA 1U95B 3WE6B 1NLDL 3BHBB 5DSCA 1FVCA 1BJ1H 1ZT1B 2V5YA 5T1LB 5J1AA 2VLKE 2DQHL 4L3CB 1MI5B 1U8QB 3I6GB 4UINH 3SJVE 4NBYB 2IPUK 5AYUL 2YBRB 1GSMA 1QPPA 3LQAC 4I8DA 4IOFC 4LEOB 5F7MC 2VIRB 2WUBH 4XPAL 2O5ZL 1AIFA 2P7TA 4MQ7A 4G8IB 1UWEH 1JGEA 1CR9H 3IFLH 1RPQA 2VLRA 4KHTL 4L4TD 2HWZL 2L7UA 3MOAL 1M7IA 2D9QB 3CDYA 4QTIH 1ZGLP 2EIZB 1RIVH 1JFQH 3P30L 1EXUB 5EUKA 1UZ6F 2PYFB 1S9VB 5HGDA 2WAHA 4AMKL 4HIHA 1LDPH 2DQDH 1IMHC 2HVJB 5HYSB 1HH6B 2WK2A 4JZOA 4ODUA 3SO5A 3EOBA 2BVYA 4NN7B 2J7LA 2EKSB 2HAZA 2A83A 3RAJL 4Z95L 4BFIB 3DMMC 4Z6AT 4M00A 3TIEB 1EK3A 3REWA 4YHLL 1UACH 3PWVA 3AUVA 2X89A 3CXDH 4BZ1H 3GBNH 3RY5A 3ES6B 5C0AD 4QOKB 3BDBA 3BP6B 5HI4C 4MAYA 4LSUL 5JW4N 1T1WB 2DYPA 2HFGL 2H1PH 4WV1A 3F8UB 5CKGA 3UC0H 3VXRE 4BSJA 1MFCH 2CUIA 3NFNB 4K3DL 3QH3A 5BV7L 1I8LC 1SVCP 4OF8A 1D6VL 3BDXA 3SGEH 4LGPB 4PTTA 4PJ8D 5AUMB 5TDNA 2DL9A 5DRWB 1P2CA 1NCDH 3VWJB 3TNNB 4Q9QH 2FGWL 1J1XL 2BMKB 1DQLL 3IFNH 3LS4H 1ZLSH 3E6HA 2B39A 4U0RC 4LEXL 2MNUA 3UTTD 4U1IB 1AGFA 1NC4D 5GJSL 3ZZ1A 3BPLB 2P24B 5HXMA 5C0NC 4HWNA 5E4IA 1Y0LB 1I7TA 5C07E 1CS6A 3DMMB 2ZG3A 3BI9X 3JV0A 4MJ6B 3ZTJH 2YKLH 1S9XA 3CFCL 3L95B 1ZEAH 4YK4B 4JM4L 2DBLH 3TNMB 1I3RA 1YEDA 3C5SA 1TJGL 2DM2A 4P46A 5E2UL 3LMJL 2IAMA 4G8GD 5ETUB 4NRYB 5FECA 3MLVH 3MNWA 4YWGL 4GKZB 4PG9B 3T3MF 1EFXD 4LARL 3QDJB 3QDME 5LXGL 1JGLL 2FGZA 3CFKA 1VFMA 3MUY1 4RMUA 3V6FB 3F6LA 4YHZH 1Z0MA 5A16B 4HIXL 1KULA 5DEGA 4X4XA 2W59A 2HT4D 2NY5H 5T1DL 4U0RB 4YUEH 3EGSB 2GIYA 3C6LA 1RU9L 3CGTA 3QFDB 3WFBL 1MIML 1YMMA 4ELKB 1RUML 5DHYA 4FFYL 1JHLL 3LIZL 4I77L 1PD6A 1OGAB 5HPMB 3BPCA 4YGVA 1UZ8B 1T0NA 4K7FB 3HRZB 1E4KA 1S7XB 1H3XA 3TIDA 4XCCH 1YEFH 2XN9E 4FXKA 4FQJL 4MS8C 3LKOA 3FRUB 4JFXA 4DKEH 3RPIB 4UT7H 4LKCA 5C0IA 4ODSL 3ARFB 5FM4A 5F7YC 1I9RH 3IJYB 1BQHA 1FGVL 1GIGL 1ZHBB 5D71H 5ADPL 3LHPL 4P49A 4OGAD 1KIRA 2N7AA 1FNSL 3DIFB 4KZEH 3GI8H 4N8VA 2YN3A 4MSWA 4QF1A 1RZKL 2JIXD 2GITA 1VPOH 4JB9H 1NAKH 4PUBH 5IGXH 1RHFA 2ATPA 4M1CC 4QHNA 4PR5A 4R2GC 2GW5A 3VFUB 4O9HL 2E8ZA 5CSGA 3ARBD 3BYYA 5C08B 4HFWB 2XG4A 3FL7A 3FFCB 3D85B 3NAAH 1U2HA 1B3JA 5F7EH 5FYJU 2IQ9H 1V7ML 4L4VD 3S8WA 3G6JB 1A0QH 2NLJB 4Q74A 5F6HI 3RJQB 1QSFD 4NSKA 1WAAA 5F97E 5EU7E 1DQTA 2CGRL 35C8L 1IGJA 2OL3L 4OCWL 4EBQL 1KCVL 4LBEB 2HP4A 3QR2A 4P3CL 4JLRA 3ZTNL 3FB7A 2P45B 3MV9E 4GBXA 1S7TB 1X6LA 4MXVE 3MODL 4KTEH 1X5HA 2JTDA 4D0BA 5JQ6H 2F58L 2O5XL 5ICYB 3ARUA 3HE6B 1F11A 4FP8H 2E9BA 1J5OL 5GGVY 4NJ9H 2ADJB 4FQCL 1QHOA 3U7YH 1HNGA 4NRXA 1NAML 3MRJB 2FB4H 4R2GB 3HZMB 3T2NH 3UYOD 2GHWB 3H9YA 3V4VH 4GSDH 5GRVL 5EC1A 1FVCB 4WGWB 4QXTB 5J1AB 1NCAH 4UUJB 1W8OA 5IWLA 1TJHH 3RUGA 4OF7A 3VFWA 3QJFA 3PGFH 1G9NH 2JJTA 3ARDA 4MAYC 5HYEA 5E2WH 4OCLC 2OP4L 1WGOA 4WV1C 1X3DA 1SJHA 5IT2L 3BKJH 3MV8D 3QXDA 3LPGA 1QA9B 5ELIA 4V1DA 4JPKH 2ITDA 1YPZE 1JGEB 3EYVB 4NKMB 1ZHLB 1T4KB 4LL9A 1SYVA 3KYKL 4D8PA 1CDCA 3MUGB 2EDTA 1F42A 1Q0XH 4JY6B 1M7IB 4GKOA 2EH8H 5EOQL 1YJDC 1FP5A 5EUKB 1W8NA 1F3RB 4JO2H 4DN3L 3AY4C 3DXAD 3LD8C 2AK4B 3DV6B 2OK0L 3DX8B 4RQQA 4PJXE 1BIHA 4ODUB 3FB5A 5JZ7D 3JTSB 1IAOA 1BD2A 4I1NB 4CRPA 1DFBL 1J1PL 3IJSA 5HHPA 5IESL 4OZHE 2AEPL 1H3PL 1EVTC 3UBXG 4G6JL 4EZMA 3B4NA 1R24A 4XP6L 1AGCB 1BGXL 4KUZH 1YY9D 1QVOA 4Y2OA 3ZE2F 1CICD 2YWZA 1QLRB 4P46C 1JZ7A 4MAYB 3Q6GH 4MNGE 3W39A 2IAMC 2DYPB 5D6DA 1J0YA 4J4PA 1QRND 4X98A 3TO4D 2GT9B 1JTOA 1P4BL 3Q6FB 1IFHH 4H5SA 2PYEB 5MEOA 5ICZB 5CIPB 1MF2H 3QH3B 3M1BB 4LHUA 2XTJC 3QUZD 5HYQB 1OCWL 4PREA 3RVXC 2IANB 4AEFA 4ODHL 2EXYC 4KPHL 2XQYK 3QEQE 5TE6H 2QADD 4Y5XB 2LU4A 2H9GA 1AGFB 3LD8B 4WW1A 1FGNL 3C6LC 5FGCE 4NUGH 2CJUL 4WWID 4Y7MA 5I1DA 4KVCH 2ZCHH 1KJVB 4WUUA 4L9LA 5GS0C 3U1SL 2KQMA 5DFVC 4AM0B 3K46A 5TDPA 4OFYA 4QXGL 1KFAH 4KROC 3W11C 4JFED 4GMSH 1CZ8L 4UU9B 1I3RB 3C5SB 4PRIA 1GZQA 2B7DT 4S1QL 2FO4B 4XWGL 1KEGH 1D5IH 1PZ5B 4P4RB 5F1IA 3WUWA 4AENB 1ZSDB 3PHOB 1GOHA 1OTTD 2PXYD 5IHLB 3O9WD 5M7QA 4MXQD 2BNQD 1I9IL 2XTJB 4X6BA 4Z5RA 1YQVL 4RIRB 3VH8A 4XCEB 1TTFA 5LKNA 3L6FA 3KXFD 4QHMB 1T7XA 4C56A 4RGND 4PJ8C 3VXQA 2EYRB 4HGMA 4L4TB 4P57A 4OM1L 1NFDE 3OXSA 1IAKB 4Y19E 1Q94A 4WW2A 3C6LB 2KZWA 4PY7A 5CLTA 3QCVH 4GO6B 3CFEB 15C8L 1YMMB 4XP9L 3WYRA 3R1GH 2AJXH 3RGVA 2CLZB 3KDMA 5MENE 4EXPX 3MRNA 3NMEA 4QWWD 4RWYH 5KS9A 4I3GA 2CQVA 2FX8L 2HLAA 1T0NB 5F89A 3GMLA 3DX7B 3GIZL 2W9EL 4U33A 2NNAA 4Z77A 4XBGB 3TIDB 1KCRH 2I26N 2VQ1A 1WBZA 3BN9D 4PJHA 1I3UA 4FXKB 4HIEA 1P4IL 5CJOH 2CR6A 4LLAA 1WQVT 1F6AA 4PP1D 4HPYL 1ZA6B 1G9ML 4HBQA 3V2AR 2F53A 3DGGA 4K7PY 4LQ1A 5BJTA 4GBXC 4XNZB 5C0AB 1QNZH 1BQHB 2UY6A 1ZTXL 4MJIE 5DGRA 3ZKNC 5CZVL 1WJ3A 1UVQB 5KVGH 1Q38A 3MLXL 1KIRB 3QUXD 5FA4B 3SKOA 3WDIA 4ZTPH 5KZCD 3ETBF 2R1WA 4MSWB 5SX5H 5GGTH 5ECJE 2ATPB 4XPTL 4PR5B 4PJ8B 4BH7A 5IFHH 3DTXA 1K5NB 1N4XL 5CS7A 1Q72H 1MLCA 5IWLC 4CU7A 2YD2A 3UTTB 5L6YL 2JJTC 5GZNC 3ARDC 3SOBH 2E6PA 3MGTA 3T09A 5I1HL 1OD9A 3NACL 2R1XA 4ELMF 3EYUL 2Q20A 3QWRA 5KN5A 1MFAH 2VDMH 3VFOB 2BRRH 2R0LL 2A1WL 4NSKB 1N3NA 5IMLB 3PQYE 1IGJB 3DUSB 5CHNB 4JLRB 4OZ4A 1CL7I 4ZFZA 4PJGA 2AQ3A 4QHUA 2QHRH 2APTA 5BRZA 1CDJA 2AV7A 2D0GA 2QL1A 4ONHB 4KUCF 4G8GB 4NP4H 4D0BB 3CSYA 2GI7A 2FWOB 3O11B 1EGJA 3DVNA 4JFOB 1I4FB 1U8NA 4NRXB 3GMQB 5D7JD 1FFNA 4OGAC 4GAYB 4FNLH 1EFXB 1H9VA 3BAEH 3S5LB 3BXNA 1NUGA 4ZO7A 3BH9A 1BFVL 3CVHA 5C3LD 4DKAA 4HQQH 4XCNA 1G6RL 4LSQH 1I7RA 4PTUA 4G9FD 1VEPA 3RUGB 3VFWB 3WXWH 1AGBA 3O6ML 2YS4A 3QJFB 3VWKD 4JFDA 1DBML 5FHAH 5MP6H 2VZOA 3ARDB 4PJIE 3ZKSD 2WBJA 2C3HA 4NKDA 3FO2A 3L3GA 4J4PC 6FABL 3BT2L 2F8OA 2QQLH 3VJ6A 4PRPA 4X7SH 4PJBE 1HEZB 3QXDB 3LB6D 3JV4A 4Z0BH 3I50H 1TJIL 5BO1L 1VHPA 5KSUB 2CUHA 3EKCA 4NN5B 4JRXE 3BWUC 5BS0E 2OTUB 5MHSE 1SYVB 4D8PB 3K1DA 4H88H 4AEIL 3TM6A 3ZDXE 2P5EE 2OM5A 1M7DA 3MJ6A 3MRLB 4JFFE 2VDRH 4N9GB 4QRSB 1EBPA 2W38A 1ITBB 4ZFOL 2XIDA 1W0WA 2Y9RT 4QY8A 2F5AH 3IDXH 1G1CA 2MCPH 3HNTH 4PJCE 4RQQB 4F2MA 4RAVA 3FB5B 1UM5L 3DYPA 4P2OD 2CMRH 1BD2B 1JUFA 2JIXB 3DI2B 1GGBH 4L9LC 3ZSSA 4NM8L 3CIQA 2LABA 3I3BA 2FL5A 3RGHA 4HLZG 1ZAGA 5ITBL 3K1KC 5EO9A 5E6ZA 1AGEA 2RQ8A 1DL7L 1QVOB 1T22B 1FNLA 3F5WA 4HC1H 3IF1B 1QYGL 3MO1B 3W39B 2J1KA 4YBLC 5EOTA 2JCCA 2V2WA 4UILL 4U1KA 4TULL 3GRWL 4L4VB 5INCA 5MEOB 1FC2D 5T3XL 1FDLH 3RFZC 4UDTB 5E08L 5E8OA 4QGYA 2UUDH 3NZ8B 4NQEA 5DYOA 3S98A 5CD5D 3S88H 2C1OA 4YDKL 1P7QA 1NGYB 4UIKH 5HY9A 1A1OA 3MLYH 1RJYA 2XWJB 4WW1B 4WW2C 1B0GA 2FRGP 1GCFA 4KKLD 3IU4L 5C70A 3OKKA 4WUUB 3UTQA 4NT6B 4OCYH 3R06B 3RY6A 3WIIL 5T3ZL 4OZGA 4JGUA 1EV2E 3TN0A 1A7NL 1QSEE 3VXMA 3HZVB 4Z7QF 1BIIB 3ZE1E 1RVFH 2VLJE 3VD5A 1KCUL 3KJ6H 5DJCA 1S7SA 3GSNA 4U31A 3V5HB 4TTDC 4H25B 4PRIB 3BZ4A 4MNQA 2ZSVB 2B4CL 5F1IB 3LKSA 4FRWA 2QR0A 1RFDH 4KDTA 3SCMA 3OKYA 1KN4H 1MCOH 5L9DH 4POUB 3GO1H 1B0RB 4U6HA 3ROOA 4H1LB 3UXFA 4ODTH 4L5FL 5KSAD 1N5YH 5CGTA 4KRMB 3X3GL 1KGCE 4X6BB 4Z5RB 1TNNA 3VH8B 3MV8B 2QQNL 3S3SA 3L6FB 2YA1A 4HF5L 3ARSA 4MYWB 4WHTB 4C56B 1NUFA 1MJUL 4NO5A 4JZNA 1AD0B 3RVTC 3MNVA 1JJUA 4P57B 3OXSB 3QNZA 3MXVL 1AQKL 1MFNA 2Q86A 4XMLL 4FQ1H 4PY7B 2QJDA 3DXAB 4YGAB 5EPMA 3KDMB 3C08L 1BBDH 3L7EB 4TNWF 1UENA 1TLKA 4N0UE 2F8VA 5KS9B 5F89B 4HUXA 3CFJA 2DKUA 2D3VA 5GS3A 2RFXB 2NNAB 1KB5H 1WBZB 4PJHB 2AEQL 2XA8H 2J6EH 4HIEB 1SYSB 3HC0A 5DURD 2GQHA 2X05A 4E42A 4PJFE 3ULUF 5ESAB 2FR4A 5BJTB 2YMXL 4YHPA 1CICB 3FCTA 2HN7B 3GM0A 4HPOH 1LO3L 2VDOH 3MLWH 1A6VL 4O2CA 1ADQA 1VERA 3TO4B 1QRNB 1QQDA 3SKOB 3EDEA 1A3LL 1JYNA 2R1WB 2GJ6A 5CSZB 3Q2CA 3P0VH 3O2VH 4MJ5A 5D7IA 1LO0L 4MXQC 3G5YB 2XRAH 5SWSD 3QUZB 5DA4A 1F4WH 3ZYIA 5I2IB 4O2EB 3QRFM 5AWNH 3U4EA 2G2RA 4OF0A 4WU5B 2SEBA 1AI1L 4OQTA 4IMLB 3SPVA 1OP5H 2KH2B 1MLCB 2UV3A 5CZKA 2QADB 5L8LB 2DTSA 5T3XE 5IR1A 3MA7A 3FOLA 2WBJC 4G6KH 3ARVA 4B7IA 4D9RE 3KYNB 2CXKA 2BCKA 4N0FB 4CVWA 1T1ZB 2QSVA 4XB7A 2ZG2A 5IMKA 1FL5A 4X9GA 4WFED 2W0FA 4G43A 3Q0HA 5E5MA 1WZ1H 3SE8L 1PYWB 3ULSA 1ES0A 2VB5A 3GSWB 3FB6B 3FO0L 2A6DB 4JFEB 4PJGB 4CVUA 2P8LB 3CD4A 4F57H 5EO1B 5J6GA 5HI3C 1TDQA 4JFHE 1AFVH 2DWEA 1YA5A 1XGPB 1N8ZA 3S97C 5T3ZE 5J13B 2IBBA 2LAGB 4JE4B 3WSQH 2GFBA 3NCMA 1U8NB 3MRPA 1AGDA 1AXIB 1FFNB 2ZUQC 3O9WB 2BNQB 5ISZA 3RL2A 3ZKXC 3KLHD 5I19H 2X44D 1SJEA 1TCRB 3BOVA 2EE6A 1A3QA 2JB5H 4ZS7L 3M45A 3MBED 1JHKH 2FATH 1NGZB 2X9YA 4MA8L 4Q6YA 4XCNB 5A3ID 1WBYA 1QLEH 2CH8A 5IG7A 1AGBB 3VFNA 2HT3D 1QO3A 3ARRA 3S35L 1G7MA 3TH3T 1CDHA 3BKML 2WBJB 4I5BA 4GG6E 2DB8A 3N85H 3FO2B 4FZ8H 1CE6A 4P59H 3S35X 4C83A 4O5LL 2AQ2A 4KQ3H 1HQRA 1XIWA 1KBGL 1A7RL 1BREA 4HJ0D 5CJ8A 5KOMC 1KIQA 4L3AA 2Z91A 1CBVL 5I1CH 4L29B 4LASH 3IDMB 1IGYB 3MYJA 1N0XL 3V52L 4DUWA 4OZIE 3I75B 5J7CC 4KKBD 4FFZH 2EDDA 3S36L 4PJ7A 4JY4B 5EDXA 4G3YH 4M6MH 5TH2A 4ZUUB 1M7DB 5D2LA 1CQKA 3KLAB 3SE4A 5T1MB 1WITA 3S36X 5L0QC 4M9PA 3LQZA 4OLVL 2CK0H 4BSVA 2ZUQB 3QUXB 3HG1D 4F2MB 1WT5C 5I1AA 5KZCB 2E27L 5F7DA 5ESQA 1Z5LB 3ZKXB 4BUHA 1JPSL 3QNXA 3S37L 1UH4A 3FN3A 2G75A 1I3GH 3RY6C 4N0YL 4GAFB 2A6IB 1R3HA 2A73B 4JFYB 1U8IB 2NY7H 3TN0C 5DUPL 3S37X 1JNLL 4OIIL 3VFSA 4Z7WE 2E7HA 3EAKA 3F7VA 3FQXA 3TBVB 1TPXC 5EA0L 3U9UB 5LQBL 3RKDD 1DE4A 4L3EA 3F5WB 5D96C 3GSUA 3B3IA 1WWWX 3SCMC 4KDTC 4CVZB 4H0HB 3IDIB 3DX9B 1K6QH 3OAYH 5LGHH 4M7LT 1HXMA 4XNQA 4JR9H 2B8OT 3NOIA 2YEZA 4NC0B 3C5ZA 4NQEB 5EU6E 1VEMA 5DYOB 3CFDA 3QQ9D 2HJFB 2C1OB 5DZLA 1T83A 4N1CA 4OLYH 1IGCH 3MLSH 1MRFH 4MB5A 2ERJC 5L0QB 1CE1H 4HLZH 2NXZC 2HTLD 4LLUA 4S1SL 1JWSA 3HC3H 3A6BH 2OZ4L 3HRPA 1NL0H 2Z31D 3BD3A 1GC1C 1B4JL 1X5KA 3L3DB 1EO7A 3UTQB 5D7JB 5M94B 4O4YL 3LN5B 3M07A 4P2OC 4Y1AA 4AQOA 3X11B 1BQLH 1KACB 5AZ2H 5A2FA 5BVJA 2XOTA 1RULL 5DJCB 4JFPB 2EDNA 4Y2DD 1TPXB 2P8MB 3WXVH 3PHSA 2XFXA 4UOJA 5CP3H 3BZ4B 5C07D 4G9FB 2YWYA 1FZKA 5D96B 4JO4H 4ZAKD 1HHGA 2LU7A 3LKSB 4HW6A 3SCMB 2X10A 4LLQA 3ULVL 4QRTA 2AJSH 5DTFA 3ROOB 2WIIA 3ZDYF 5IHUH 2J4WL 3NCYP 3BZFA 4M43H 1A3RL 1UG9A 3CMOH 5D93B 2ZKHH 5I18H 4XX1G 1NUDA 4XNMB 3LEXA 2WM0A 5KVFL 4JZNB 3SJVA 4GRWF 2YUWA 1H0DA 3TCLB 5CD5C 3CK0H 1PQZB 3FQTA 2ERJB 2H32A 2NXZB 4M8QA 4RRPA 3TJEH 2ITCA 3QDMD 3QHFL 4QRPA 2ICES 5EPMB 5IM7B 2GCYA 1FIEA 3EOAA 3PWPA 4P2OB 4HUXB 3W0WE 1Z2KA 3PNWA 2QEJA 5CEZD 3B9VA 1P7KB 2ADIA 3BZEA 4ODWA 3BKCH 1U42A 4O2FA 5HDBE 3VGGA 4OM0L 1K2DA 1Q9OB 2J2ZA 2FNBA 4EDWH 3RTQD 1JI1A 1AKJA 4YHPB 5AD0A 4OCRL 5EUOF 3B9KD 4X6DE 1M7XA 2IPKB 2IQAA 2ZUVA 4O2CB 3MRCB 4B50A 1WLHA 5JUEH 3GB7B 5C0JB 2XN9D 5IVXE 4R9HA 2GJ6B 3I2CH 4JPWL 5D7IB 4S1DC 5HHQA 1KCSL 2WINA 1PSKL 1DBAH 1WEJH 2IMMA 3TC9A 5C2BL 3U4EB 2G2RB 3GHBH 3O0RH 1J8KA 4XAWH 3RL1B 4KMTL 1MJJB 1FH5H 2ZJSH 2HMIC 2WP3T 1Q1JH 3VXRA 1C1EH 1CXIA 1FZOA 3EYOB 2FIKB 5IR1B 3OG4B 4UQ2A 1ZT7A 5EORL 4XMPL 2VN7A 3B2UC 4MB4A 1FL5B 1XIWC 4ZYKA 5E5MB 2BY0A 1FZJB 2YXFA 4LMQI 1A4JA 1R5VB 4P2RE 3RVUD 4XHJD 3ULSB 1NKOA 4QCIA 4XT1C 5F44A 4XCYB 2UYLA 3MX0A 1MELA 1IL1B 3RZCD 3E6FA 1HI6A 4OI9A 5DRXA 5J6GB 4K9EC 1FV1A 4WDIA 4GAJL 3SE4C 3JV6B 2DWEB 3K8KA 1MWAH 1MHCA 4YBHA 5B39A 5KSAB 5ISZB 3KVQA 3NH7L 3DHJA 3QBTB 2KPNA 2CKBH 3QUML 5B38G 1EERB 1DP0A 1SJEB 3VE0A 1YNKL 5D7LA 3QIUD 2UZYB 1LP9E 3OSKA 3GEWB 4L8SB 4YDIL 1NGWA 3QXAA 3LH2H 5ENWA 5J6HA 3ULVE 5EU3B 2VH5H 3BP5B 3VFNB 1QO3B 3VRLF 5EO0A 2Y36L 3ZL4L 2H8PA 3CLEL 4HWEL 4WI9A 5I17A 4NQVB 3EDKA 3UO1H 4I5BB 3DROA 1PJ9A 5E8DH 5HHOE 3WFDH 4CAGA 1M4KA 4UZGA 4HFUL 1RUKL 4C83B 1HQRB 3D69B 1C08A 3BW9B 1KIQB 4ONGH 2Z91B 3MYJB 4M48H 1MHEA 5FHBH 1YC8A 3C5ZC 3SGJC 3NCJH 1KUMA 4XI5C 1NCWH 4PJ7B 4EIZC 5DURB 2JELL 5F6IC 1T83C 1BZQK 2HH0L 1R3LA 3BPNC 2A0LD 1I85A 4NBXB 3HPJA 4X6CF 1EJOH 5C0EA 4KRPC 2I60L 2AABH 1I3VA 1EMTL 3OB0K 1MWAB 3VW3H 5F7DB 4PJ5A 1I1CA 1UB5A 3QDHA 1HYRC 3SO3B 4NO0A 2G75B 5SWSB 4XPBL 3K4DA 3CFIC 2CKBB 5FYLD 3SN6N 2VOTA 4LSPH 3AMLA 1AXTL 1NCTA 4FQXD 2FLRT 3MLRL 1T03H 1UA6L 1WV7T 3Q3GB 5CEYB 2AXGB 2M1KA 1A7OH 5HYIA 5A3IC 3TFKC 2ZZUT 5DS8A 1K3IA 5HHME 2Y6SC 1FFRA 4NKIL 4ZUTA 1SM3L 3KPMA 3PL6A 4Q6IA 5DA0B 3GBMH 1FYHB 4PJEB 2YEZB 3LV3B 3C5ZB 1MSPA 5HI5D 2F19H 3NCEB 1T2QL 3P0YH 4YHNA 5F6IB 3UZEA 3K2UL 5JLZB 1OARH 5IQ7L 3BPNB 2IH3A 4KKBC 3GGWA 4MQSB 5J9PA 5J11C 1MVUA 1W72A 2XACC 1KNOA 4KI5E 3QDGE 4LSDA 2DQCH 4FTVA 5LGJB 4OAWA 4AEHH 4X99A 2AW2A 3SBWA 3MR9B 4XVSL 3MV9A 3QEQD 4P48A 3T0WA 1K4DA 4XNYH 4AIZB 4K8RD 3MBEB 4RISL 4WHCA 4PGBA 5C0RL 3CXHJ 4KAQL 2X1XR 1FRGH 1XFPA 1FZKB 2A74A 1HHGB 5E8PB 1MRDL 4EVNA 5KBNC 4POZD 4LVNB 4LLQB 3DUUA 4QRTB 3V6ZA 4N5EC 2DD8L 4ZUSB 4PJAA 1FBIL 5JW4M 3ZYOA 2BVQA 3HR5A 1HHHB 3CZJA 5I1KL 4QTHB 3MCKA 2CDGA 3TGXA 5K9JL 4UDUB 4LLWA 1FE8H 2VLKB 3LEXB 5E7FA 4DGIH 5IBUG 3ZYZA 3VXSE 5IW6B 3SJVB 2EDLA 1TVHA 3FRPA 3GDBA 1IEAB 3JWOC 1H0DB 1DBKH 5DMKB 1H3UA 3H42H 4WIQA 3QULA 5HYFA 1K3ZA 1QPXA 1V3LA 4N0CD 3C6SA 4PYGA 4R90H 4S1RH 1EHNA 4LF3A 2B1AH 25C8H 2P48B 4LCWD 3ARGA 2ADFL 1YPZA 1SEQL 1B0WA 5JR1H 5KSBF 5H35A 1QFUH 2Z31C 4F80A 1KPRB 5DJ2A 1DJSA 5GGTA 3S6CA 2ZP0T 4M5YL 1Q9KB 5L2JA 1ETZA 4Y19D 5I1GL 1FNEB 3LEVH 4GUPA 3NTCH 4L8BA 2ADIB 1NLBL 3LPWA 5GHWL 4KK8D 3UJTL 3ZE0F 5MEND 1K2DB 1NANH 3PWJB 1AKJB 2LTQC 3UTPE 3HB3D 1MCQA 1S9WB 3D3VA 3L3KA 1BMGA 2AEIT 2G60H 4M8VA 2E6QA 5F6HJ 4MCYB 4N5UA 2DQIH 3SY0A 1KG0B 4OZHA 1VENA 4NO3A 1CVRA 2AK1H 2DBJA 3O6KH 4LHQB 2Q7YA 3P73A 1TNMA 2A6JB 2W9DL 5EWIL 4OLUL 3VG9C 4TSCL 4AIOA 4MNGA 3RWJA 3BO8B 1EHLH 5J57B 2XYCA 2GSGA 1MAMH 4K71C 3TBWA 3VXRB 5DD1H 3MRHA 1QG3A 3H3PL 1UKTA 4YDJA 3OXRA 5SWZA 5FEBA 4X9IA 4U1HB 4RA0C 1ND0B 4FG6C 4W70A 1VFAB 3MUZ1 1F45A 5HVFB 2Z31B 1A1MB 1GGTA 4OZFH 2HFFB 2BK8A 3DURA 3CH1A 3MCLH 4U1MB 5CEZH 5B4MC 4JM2A 5KG9B 2V2XA 3ALXA 4Q9RL 4PGCA 3ILQC 1K8DB 2E5EA 4BFBD 3MGAA 4JDZA 3B9DA 4Y2DB 4XMKH 1MOEA 3IDYB 4J8RA 3QO0A 2IH1B 1HI6B 2P1YA 5C07B 4ZAKB 1KJ2H 1I85C 1WTLA 2W65A 4WDIB 5ICXB 1T04A 1F02I 3P30H 3RTQC 4KV5F 3AAZA 1B4RA 4B7LA 3B9KC 4G80A 5EZIH 3T0ED 5EBGA 3OB8A 4AMKH 4HIJB 2NZIA 1M6OB 5FOJA 4UT9H 4J3TA 3R0NA 2LVCA 4M5ZL 3JWDH 3MRQB 5IB5A 3VE0B 4RNRB 4C57C 4LKXA 2YRPA 3QXAB 1RURH 2PTUA 4K71B 3FQNA 5IW3A 1NBVL 3IDNB 1OB1A 5ACZA 2UZXB 3U30C 3QDMB 1RJLA 2DLTA 3FQUA 1L7IL 5DJDB 1SJVA 1N59A 5GRUH 5JDJA 5IKCA 1U8KA 4WI3A 4K23L 1D5ZB 1C08B 3UTOA 3PL6C 3MCG1 4Q6IC 3WHXA 4OZFB 2EE3A 4R4NC 1WCBA 5MERB 5SX4H 3IXTA 3B5GA 4LLDB 4XHJC 1LEGA 3V5DB 4J3VA 5BV7C 3G9VA 5D9SA 5TGBA 1R3LB 2EEAA 1XF4A 1CLCA 2X4OA 3HPJB 1PG7H 1J1XH 3RTQB 4HKJA 3UJJH 4PG2C 3B9KB 5C2UB 3AGVA 5C0EB 3VA2C 4KHXL 4JRXD 3G6JF 1N7ML 4HX1A 3VFMA 5BS0D 5ID0A 4JQIL 2PO6D 4GFTB 2XN9B 2BHZA 4JRYE 4P2QA 5EU7C 1UB5B 5FUZH 2P5ED 3SBWC 3G6AB 4LIQL 3HNSH 4KK9D 4JFFD 1A6TA 4BKLB 5K9QG 2DDQH 1F3JA 3QIUC 4MJIA 1Y6MR 1D9KA 4JFQA 5FM8A 3KPTA 1U8MA 3IU3A 4GS7C 4E5XA 5IOPB 3UBXA 1KB9K 2MHAB 3GSXB 5TF1L 5C8JA 4X4YA 1FFQA 1DVFD 2EDKA 3I3EA 3CLFH 3V0WL 3N1MC 3GBLA 2PTTA 5D1ZD 3PL6B 4Q6IB 4YWGH 4NCC1 3UJIH 4OIBA 4PV9A 1YEJL 1YEKL 3O3UN 5JNYA 1JGLH 3QQ3B 3KYMA 1DQQB 2PETA 5GZOD 3D87B 1KEML 5BV7B 2WLYA 2IH3B 3MC0A 3GGWB 4HIXH 2DI7A 1MVUB 1JGUL 3RZCB 4RGOL 3SKJL 2YXMA 4Y4KD 5DVMA 1VEOA 2XWBA 3O6FA 1IM9A 1HXYA 4G8FA 3AS3A 1F4YL 3ARGC 3PQYA 2MKWA 1G7HB 4HUUA 3UP1A 2ESVA 1JHLH 3LIZH 3HI6L 4X5XA 5FYLH 3BX7C 3MV9B 1EO8L 3SE9L 2V2TA 1K4DB 1RV6X 2WUCH 1LNUB 4F15C 4RDQF 1HWGB 3QIUB 1I1AD 3PJSA 4RAUA 1ZS8A 4DK3A 1CXKA 3DVIA 5FYJL 1PVHA 3DUUB 3F58L 4RAHA 4U3XA 3K0WA 4JG1H 4IRZH 1YMHA 1FGVH 4EI6A 2VLJD 4XH2B 2X4QB 2BHUA 4PLKD 1H15A 1EBAA 2BNRA 1KB5A 1PX3A 1ACYH 1ODAA 3KPSE 4DUXA 1RZKC 1YECH 4OLZL 4XRCA 2GJJA 5CMAB 1QBLH 4PB0L 5C0BD 4MD4B 3NFPB 4PJDE 4IBLT 5CILL 3C60D 4TSAL 4LF3B 3T0XA 1JNNL 4Z0XA 4UTBH 1RIUL 1YPZB 2R23A 3MJ9L 1OAKH 5FDWA 3PABB 4LAQL 4N0RA 4JHBA 1E6OL 4FFWD 1H8OA 2FZ3A 4JM2C 3WN5B 2W0LA 4K8RH 5KSVB 3W9EA 4P5TD 1NCUA 2Y07H 1R6VA 1UM4H 4FQXB 2OL3H 1E0OB 3KPLB 5TE4H 1U8PA 4IS6A 2XKSA 4P3CH 4NO2A 3VU2A 3UBXI 4PJXB 3T3PF 1RI8A 1KPUB 1YEGH 4CN4A 2AP2A 4U1GB 3SDXE 4GRMB 3EFFA 1A1NA 4ZTOH 1NMBL 5KAQG 4Y8AA 1KELH 4LIQE 4FXGB 1UXWA 1R5WA 4ERSL 5CZXD 4KMQA 1R3JA 3RU8L 1EEQA 5E94B 1UCTA 5HPOA 2NY3C 2VL5B 4Z7VA 3NIGF 4GXUM 2ID5A 4NHCH 2VAAA 2A77H 2OI9C 3JUZA 4MNGB 2IADA 1EHXA 3MXWH 4PV8A 3F65A 2GSGB 3RHWF 1XR8B 1PAMA 3SKMA 5L2KE 4YDJB 1XGQA 3CDFA 4HMDA 3T4AA 4U6TA 1T66D 3GM8A 4LLVB 5GS0L 2VLRE 3DURB 3C2AL 3WKMH 4YNYA 1XGYH 4JM2B 2C5DC 2X4PA 2NCMA 2V17H 1WK0A 5IT2H 3QEQB 5IJVA 1IARB 5T3XD 3THML 4A6YA 4HG4J 4ELME 4OTXH 5FGCB 4D9RD 3KYKH 1CT8A 2HRPL 1BVLA 1Q9LB 2VXTL 3TPKA 1HKLL 1RZ8A 5EOQH 2OL3B 4LAJH 4Y4FA 4P3WA 2L7JA 3GMNA 1DCLA 3DRTA 3AAZB 5I8CB 5E6IA 1CLOL 1SY6L 1T3FA 2NY3B 2DTMH 4CMMB 4KJWD 3RWCB 2AXFB 3NIDE 5IEKB 2QSCL 1MJ7H 3A67L 3MRRA 5F1SA 2OI9B 5I30L 4LKXB 4JFHD 2BOCA 3QZWG 1NAMB 5FYJE 5TPWH 1AR2A 4KJQD 5LCVL 1DN0A 1KLGA 5E7BA 4R4BB 3MA9L 1QTYT 4M1GH 5ACZB 1D9KC 1BGXH 1C5DB 4FQPA 4L8CA 3MRKB 5EBWA 1U3HD 3PGDA 1WFUA 3FQUB 5IHZA 5E95B 2PW2B 5K93A 1U8KB 4JDVA 4U6XB 1KLUA 1WFOA 3JXAA 3KPQA 3IDUA 4RZCA 5DVOA 4TQEL 4G42A 1A5FL 2X1OA 4I9WD 4XPGH 1YDPB 5HYJD 3L5WB 5I66A 4LNRB 4M6OL 1NFDB 4PLJC 4Y19B 2DQEL 1BZ9A 1GVIA 5H37H 1LEGB 3QEHA 4P5MA 3PWNB 2CR3A 3Q5TA 1XCTB 4KJPD 5D9SB 1FG9C 3ZDZE 5MENB 5MI0C 2RB8A 4ODHH 3L3JA 2GJZB 4GW5A 1MJ8L 4HKJB 3ILPA 1DSFH 5MEQA 1AC0A 2VDPH 1O5DT 1RZFL 1BFSA 4MNHB 3O6FC 2EH7H 1FGNH 3EOTL 2P44B 4KY1H 3BVNB 4YJZL 4K55A 3W9DA 2FEDC 3BWAB 3S4SB 1WAAF 4K94L 4JY5L 2H2SD 4JEGB 4NOBA 3F7PC 2VXSL 4EN3D 1J1OH 4QXGH 4MJIB 4G6MH 3BKYL 1D9KB 1MLBA 1FJ1A 1U8MB 3IU3B 4AL8H 4MXWL 4NFDA 1BPVA 1JHTA 3VFVA 4M7KL 4DCQA 4S1QH 2VXVL 4PRNA 5BZWA 4ZSOA 4H20L 3RWEB 3PF2A 4NRZB 5FF6B 2X40A 3SQOL 1CG9A 3QO1A 3H2WA 3KYOB 1V7NL 1I9IH 1MCCA 3AS2A 4PV9B 5JIPA 3OKEB 5JNYB 1S78C 5DZNA 1VGKA 1PX4A 4NNPH 5K9OA 3ARQA 2N4IA 1A9BA 3ARED 2FH6A 5CP3A 3GMRA 1FLRH 1BQSA 3V4PL 3QJHB 3HS0A 1FZMB 4RWHA 1S9YA 5EU6D 2Y25A 1HXYB 2ARWA 3KLDA 5JOPE 15C8H 1KCLA 3PQYB 3LKQA 4XP9H 5BCAA 1ED3A 3SGKA 1K9TA 3RIAF 5FXCH 3E8UL 4LLYB 1EVUA 4X5XB 3VXPA 2CRZA 3OKMA 4F58H 2V2TB 1FL3A 2GTZA 2J88H 3PIQA 1QBBA 2YUZA 3PJSB 7FABL 1ZS8B 3CCHA 1D5MA 3U36B 1LEKB 3LEYL 1SMOA 4W4OA 4E41A 3C5JB 3FT3A 1V3JA 4P9HL 4F33A 5CUSH 3IDJB 1NJ9B 3U0PA 1CXFA 5IMMA 1DLFL 4HBCH 4Z7QE 5GGVL 1EFQA 4Z7OF 4OGXH 3T08A 2DI9A 3GHEH 1G9MC 2ILLA 1VFBA 4JDTH 3Q1SL 1Y18B 3QYCA 5ESVA 1H15B 4GT7A 2VITA 3NA9L 2GAZB 2OJEB 5KTEH 3QIWD 2JJWA 2ZOKA 4XPHH 1BOGB 4PJIB 4WWKA 2Q6WA 2MKLC 1NGQH 4QGTA 4ZO9A 4NUJA 3QI9A 2VJXA 2XKNB 1P5UA 4GKNA 4R3SA 4WFFE 4PJBB 5F71A 5GSRA 3EYSL 1MAJA 3VFTB 2IFFL 3JTTA 4HD9A 1ZMYA 5FUOH 4MDIB 4JRXB 2X2YA 3M8OH 5D2NA 5BS0B 4OZIA 2F54A 2PO6B 3EYUH 3QQ4A 4F7PA 2NX5A 2P5EB 1HHJB 1EEYB 1INQB 1NMAL 4U2ZA 4OKDA 4JFFB 2R0LH 2A1WH 5D7SL 3V4UH 4U3CA 5HGGS 3MGOB 3ET9F 1XGUA 4IS6B 4KI1A 4HAGA 1MREH 4PJCB 1G6VK 3WD5H 3R4DA 1I7ZB 1N64L 2ICWI 3BIKA 4YHOH 1LK3H 3UAJD 3W0WD 4Y4FC 5JXEC 1HNFA 3WLBA 3UX9B 1DVFB 1R5WB 3INUL 4YXHH 3FB8A 3QFJE 1HYSD 5D1ZB 5CJXC 4JN2B 3G08A 3TZVA 3DSNA 3U46A 5ALCH 3GUTB 4LCIH 2VAAB 3MV7E 4DTGL 1TQBC 1XGTA 5MEPB 4X5WB 3IAPA 32C2B 2IADB 2DQGH 2YD1A 4BH8A 5K59E 4G7VH 1UCBL 1CYGA 2R8SH 3VDBA 1JNJA 3RWHA 4ZDHB 3SE3A 4LPVA 3SDYL 1G0DA 4OT1L 1ZXQA 3B2VL 4V1DE 1G7JB 4G5ZH 2NTFB 4HH9A 4Y4KB 2C9AA 3C60C 4OD3L 2FECI 1BFTA 1KB9J 1MAKA 1YEIH 3P40A 5E2VH 4EQ3A 1QEWB 6FABH 3O2DH 4DN4L 3RHWK 1EAPA 1J18A 2VE6A 4NZUL 4OF5A 3TBTA 4TUKH 3GJEA 4WTZA 4XC3L 1TJIH 4FFWC 4Q0XH 4AG4H 3O8XA 1BBJB 4ODXB 4GQ9H 4P5TC 4RMTA 3BPOB 2BC4A 4PGDB 3AS0A 1MCFA 5IW1B 1FFPA 1RZ8B 3IS0X 5DWUH 1E4JA 4Y4FB 3V0VA 5IB2A 4NM4L 3GMNB 4KK5D 1MQ8A 3DRTB 4YIQA 5AZEH 2ORBL 1ZLVH 5KS9F 5DQDL 4P2RD 2BVEA 1T21A 5CAYB 3IETB 1QSEB 1HINH 4ZQKA 2VLJB 4M4PA 4HKZA 3SDCA 2YPVL 4YXLL 1GGCL 1TQBB 1KTDA 1XZ0B 3BQUA 4YXKH 5DD0H 2WWMD 2VXUL 5HGAA 3SGDH 1DN0B 3O3EB 1M71A 2ICEB 1MRCH 1XEDA 1CGSH 5EIIB 4L8CB 4ZOAA 2Z9TA 3ARTA 1AQDA 5HVHC 1F4XL 3C60B 4N1HB 4ODVL 1TIUA 1G6RB 2D7TH 4EOWL 4HT1H 3CPLA 3FO9A 5I15H 1HIMH 1KLUB 3IXAB 1CK0L 3KPQB 4G42B 4UILH 5DF0A 3GRWH 5I66B 1FVDB 5T3XH 4FFVD 3L5XL 5DMIH 4ZS6D 1BZ9B 4OB5L 2X70A 4P5TB 5GIRB 5HHOD 2DLHA 3G5ZA 4R26L 4G7YL 3OGCA 5HJ3B 4N0UB 4XC1L 1NCCL 3ILPB 5EZJA 1GAFH 3O6LH 1EGJL 3RX5A 5GGSY 5DUML 4RMVA 2R0ZL 2HT2C 5I8EB 1KPVB 3U9PH 1S3KH 2GK0B 2BSRA 3TH4T 3D0LB 1XR9B 3F7QA 2JF1A 1J05B 3K8MA 3TT1H 3FHQA 3RWDA 3ZYJA 1NDGA 3O3BA 4ZFOB 3CVHL 4PJFB 3SGKC 3K3QA 1LE5A 2G9HB 3PV7A 3RP1A 4JPVL 4ZOBA 3MBXH 1NSNL 1GL4B 5FKPB 4X6DA 5DD5L 3D9AL 4K7PL 4M7LL 1FCCA 2XZQL 4ESKA 1KCUH 5HGHB 4HH8A 5IFJB 4MJ2A 4PP2B 5HVHB 3CFBB 5FDYA 1WWBX 1MCPH 4K7PX 2UWEA 2B4CH 2QKIA 1DQDL 5L7XH 2R4RL 4IMKA 1CIDA 1CG9B 1S5IH 3V5KA 4YZFE 4HS3A 4UV4L 2H2PD 4Y5YB 1G7QA 4ETQA 1I8IB 3WFHB 3X3GH 4D0CB 1LGVA 3OR6B 1DBBH 4UIMA 3HCVB 5HHMD 1CFQA 2XZAL 4ALAL 3TBYA 1A9BB 1MJUH 1FNGA 4WWKC 1NQBA 4OSUL 5JIIA 1HHKB 3HS0B 3ULUH 4R96A 2AKRA 1QLFB 4OGZA 4XGZA 3QZWB 2Q8BH 4X5LA 2Y5TA 4GMTL 1MNUH 3LVEA 4CVXA 2WIMA 2ZPKL 4M93B 3GJFA 2PN5A 2OZ4A 4I3RH 3HLAB 3VXPB 3OKMB 2DQUH 2YR3A 3OR7A 3QDGD 1MEXH 5BMFL 2P8PB 5D5MA 2A9NH 2VC2L 2YPLD 2WSKA 4P5KA 1KOAA 1HN1A 1EZVY 4Y4HA 4HKXA 3OTTA 4EN3C 3WNLA 3FT3B 2NR6C 4S2SA 2HVKA 3TYFB 3D25A 4ZXBA 1MIEL 2YMXH 3EO1B 3HI5L 5EN2A 1A2YA 5GGSA 5DI8B 5TQ2H 3BDYH 4DKFH 4YX2L 4NKOA 2IGFL 1A6VH 5F70A 3KR3L 3TYGL 4K3GA 1IEBB 4M7ZC 2BFVH 3H9SA 3L7FA 2OXGA 2ATKB 2VITB 3TZVC 5ALBH 5GRZA 3TVMA 5FFLA 4X4ZA 1NPUA 5J3HC 2ZOKB 5IJKA 3OPZL 4IRJA 5F3HA 5DJYB 2P5WA 2B1HL 2AGJL 4GG6B 4CDHA 1PKQE 3BMWA 4XVTL 3AREC 1X5FA 3V8OA 5C0DA 3SE3C 2YUVA 3CSPA 4XP5H 1E6JL 2XNAA 4GRWE 3RJDA 2DOCA 1LK2B 4OZIB 2DJUA 3WS3A 1BVKB 5KW9H 1BM3L 1OTSD 4RX4D 2EDQA 5BRZE 2YSSB 3NABL 4PRHA 4RMRA 1YEHH 2ZNXA 1JPFB 3QDAA 2L4OA 2HFEB 4HWUA 2HG5A 4JO1L 3ESVF 3CSBA 4OCSL 3GSNL 1F8TL 1LO5B 1OAUL 4EN3B 1IZKA 1P4LA 2HLFD 2AJUH 3O8XC 2YZ1A 3LS5L 3FTGA 3KPNB 1YYML 3FO0H 5ACLA 1QSZA 1RUAL 4MCZA 3VFGL 3BIKB 2IG2L 2Q8AL 4ZPTA 2DWDB 3WLBB 3UYRH 4NWTL 1EEZA 3FB8B 1HSAB 3G08B 4N90D 4DZ8A 4Z78A 1BOYA 4Z7WB 3RWFB 4JFDE 1H5BA 5FO8A 4H8WH 1MFEH 2D03H 5JW4R 2R9HC 3O4LE 4E0RB 5C6WH 3D1MC 1F2QA 3BQUC 3WEXA 1H3WM 4G6AD 1Q0YL 3FN0H 3AREB 4L8DA 4PRPE 1C5CH 3RWHB 1CXLA 1KJ2A 1OSPH 2J8OA 1JZ4A 1GH7A 1Q9WA 4Y16D 5EU6B 4MQTB 1HOCA 2MQCA 1S7WA 2NZ9C 3EW3B 3REVA 2YRZA 2GUOA 4W6XB 5GJTL 1EAPB 1JWMB 2E3VA 2BXYA 4O5LH 5D1XD 5DHXB 2VE6B 4O02H 1KBGH 1HSBB 4MDJB 4HZLB 1CBVH 4ETYA 2CRIA 1TTUA 3V52H 5AG8A 5CGMA 1NC2A 4P4KD 4FQIL 4NHUB 5DR5L 3MLZH 43CAB 3N0PB 4ZFGL 1FORH 1RZJC 4KJYB 4TNVK 4FMKA 4O58H 1FFPB 3OKLA 4ZFFA 3GI9L 2UUDK 4IDLA 4YIQB 3UPAA 3TF7C 4UAOB 3UAJC 4PGEA 1T21B 1J8HA 4RFOL 1R0AH 4YBQC 1P6FA 4IIQA 1CGUA 1P1ZA 2DMCA 3DO7B 4GRLA 4HKZB 5JOEA 5E9DE 2X09A 1A4KA 5T5FH 2W1NA 5CD3B 2JCCE 5B22A 5HGAB 3KPPA 1K4CB 2EC9U 2X4SA 2E7CA 1W2KT 4LFHD 4MZ3A 4TRPH 3QAZB 5HYSG 5LQBH 5EA0H 4WJ5B 1DANU 4MA1B 2FBJL 4QOKD 3B43A 1NFIA 3FO9B 2O26U 4IMKC 3VRJA 3VXSA 3OKNA 2DRUA 4IOFD 2GSIA 4TUOA 5TDOA 1RIHL 4RGMC 5DQJA 4B0MM 3V6OA 4X9FA 3G9AB 4C54A 1XAUA 5DJXA 1CLYH 3STLA 4UINL 3QCUH 2R56L 3DBXB 2GY5A 3NCCB 5EZJB 3OKDA 1CFNA 4OZGE 2PR4H 3W0WB 5CCKH 5DT1H 3VXME 3NCYS 1A6AB 5A2LH 5HHVL 1UWEL 2CO6B 5ILTL 1PLGH 3U7WH 1CR9L 3IFLL 4MNQE 3D48R 4XAKE 3NIFF 1A14H 4LVOB 1GHFH 1LE5B 2EDHA 2VLLA 4X6CE 1WFNA 4QTIL 2NY1D 4X6DB 2Y5EA 3TA3D 1HILB 5IVXB 3D5OF 1BWMA 3QWOB 1LDPL 2DQDL 1JI2A 2BNUA 2I07B 2X42A 4EI5A 4IJ3C 3RI5K 5JPNB 4ZXBC 1ZT4B 4CNIB 4KRLB 1CTNA 3L3OB 2N56A 1MFBH 3G5XB 2C3WA 3PE9A 3T77B 4UT6H 2J4WH 4BFGA 2ZCLL 2DJ4A 1OF2A 3ULVC 1UACL 3QDJD 4NQDA 3T04D 1OT1A 3TVMC 2VQTA 1IE5A 3CXDL 2CDFA 4FFVC 2X9XA 2NW3A 4BZ1L 4K9EL 2BVOB 1FNGB 2YC1A 4IRJC 2VUYA 3PWLA 1CFVL 1QKZH 3IGAA 1MH5A 2AKRB 4KRNA 1MFCL 3GSOB 5DUBA 4P2RB 4CADA 1S7QB 4I48A 3ZMRA 4YHKH 3KAAA 1OP5K 1KYOK 1T20A 4PFEA 2VWEE 3S34H 2HFTA 3K80A 3O45B 3BJ91 3IFNL 3LS4L 3QSKB 4P5KB 4LCUA 3W82A 5F9DC 2CDEA 5GS1B 4S2SB 4OM0H 2HVKB 3DV4A 4IJ3B 4P3DA 4Z7NE 4ZXBB 1KIUA 4NN6C 4OI7A 4X8JB 4HHAA 3P11H 1U92B 1KN2L 1LP9B 5ID1B 3C8KB 4X80H 2YKLL 3U48A 4JPWH 2XTLA 3TVMB 1H5BC 5EFIB 2DBLL 4NZDA 4IRJB 2CPCA 5HHOB 1A6ZA 5FO7A 4KMTH 4NZRH 1UB6B 1RUQH 4PS4H 2JJSA 1HZHH 5IEHB 1FNAA 3JV5A 1FAIH 4X0KA 5C08D 3MLVL 3QEUB 2XNAB 3MACH 4MD0A 3FFCD 3D85D 5A2IH 4UQ3A 1U36A 2NY4C 4PJEF 3WS3B 1A6UH 1CFSA 4XMPH 4YHZL 4U1LA 2EDOA 3VCLA 4JG0L 2VDNH 2YZ8A 3LKPA 2HG5B 2NY5L 5I1JH 3P4NB 3CU7A 4KI5C 5KSBE 1P4LB 4MS8D 4XBEH 1NEZB 5DGQA 2EIBA 1RZIB 4NN6B 4MCZB 4UI2A 1OGTA 5C0GA 1A9EA 4HWBH 4OKVA 4FHBD 5E2TH 4IIQC 2C7UA 3C09C 3QQNA 2Y7QA 4FXLA 1YEFL 4GRLC 1BZ7B 1NBYB 5GRWA 3WNPA 1AY1H 4OIAA 1DANT 1XGRA 3HAEH 3VRIB 4M1CD 5BQ7A 4P23A 4R2GD 2EDWA 1JMZA 1YNKH 5HHMB 4DKEL 3WEXB 1WC7A 4UT7L 3AXLB 3MLPA 1I9RL 2VR5A 2F8XC 5F7UA 1L0XA 2VQUA 4WENB 3BRDA 1KIPA 5SV4A 4KZEL 1Q9WB 3GI8L 3KPRA 4ONFH 4K07A 4U1NA 4U49A 5I8OH 2NY4B 1PY9A 4U3HA 4WI7A 1VPOL 3IKCA 1S7WB 4JB9L 2R2EA 5JW5A 3EZJB 4NPYA 5DZOA 5H2BA 5D2LE 1HDMB 5CBAB 3RIFK 4AT6B 1OTSC 3O2WL 1OD7A 1TVBA 3QDGB 2YD6A 3HMXH 3V6OC 4XVUD 1GPOH 2VLRD 1NDMA 4U4BA 3NAAL 1EPFA 5F7EL 3X12A 1BLNA 2IQ9L 4ZFFB 2ARJB 5DJAB 4HUVB 2OTWB 1X5GA 3QUKB 4PGEB 3JVGA 4GRLB 1OLLA 4GW1A 4HK0A 4HV8B 4L3EE 4RDQG 1A64A 3U79A 1OGAE 1OTUC 5CBEA 3D39E 3I02B 4XPBH 4KQ4H 3KPPB 3HAEB 3QUMB 3CDGA 1F5WA 4FQLH 4CW1B 4YEEA 2IWGA 2X89D 5JQ6L 4ACPA 2E7MA 3KHOA 3MRGA 4FP8L 3T4YA 4EI5C 4MAYD 3EJZD 1S7UB 2JLLA 3RWGA 5FAAA 3UZQA 5TF0A 2DYPD 2FB4L 2V9QA 4Y16C 1T1XB 3VRJB 3VXSB 5C09A 3KPSA 5CEXB 1T1YA 2GSIB 5FO9A 3V4VL 1TETH 3FAXA 4GSDL 5E00A 4C55A 5TDOB 2R29L 4XP4L 5JO5A 4WY7H 1NCAL 3LRSB 1INEH 1WIUA 1TJHL 4TVSa 1DQJA 1YNTA 3P9LB 1GGIH 5DJXB 4YH6A 4BQ8A 3PGFL 1G9NL 2FD6H 5CP7B 2X4UB 3VI3E 3VXOB 3BH8B 2WNGA 2IAND 3K2UH 1DUYA 4P4KC 5E5RB 1NGXA 5KANG 2AJVH 5E2WL 5GGQH 4Y1AE 3OKDB 4LMQE 4HGWA 2C1PA 1XH3B 3WLWD 3BKJL 3DO3A 3KPOA 3NCFB 5DFTA 4HIIA 5I73C 1ORSB 4D0DA 2VLLB 3VMOA 3OKOB 4R8WH 3SDAA 1OAYH 1XMWA 1Q0XL 3MJ8A 3J8F7 4LU5H 1ZHKA 1TZHA 2XPGA 2X7LB 3OMZA 5FV2A 3X14B 5K9KB 3RNKA 2R1YB 4M61B 3DLQR 3DETC 1IBGL 3PDGA 2OQJA 1QFWH 4P46D 4EI5B 4RFEA 3IB4A 3LQAH 2IAMD 4WI2A 4Y16B 2EO1A 3N9GH 3G04A 3JZ7A 4QKXB 4H26B 5JORB 2CO7B 2HJLA 5D1XB 2XTJD 5CFHA 3UEZA 2P49B 5K9JH 4QRPE 5L2KA 4KUZL 2NW3B 3RVXD 4FS0A 4XP1L 1IQWH 2YC1B 1R5IA 4P4KB 1MCBA 2BDNH 3F12A 4ZPVB 5EOCJ 2EYSA 1IC4H 3PWLB 3PWPE 5LGKA 2EXYD 2JJSC 1TZIA 3HE7A 1IKFH 3C6LD 1T7YA 3ORJA 5F7KC 5GRJL 1IM3A 1YMMD 2I25N 4YR6B 4HKBA 3DGCR 5HGBB 4ELMA 5GS0D 3MLTA 5FIEA 4OI8A 4Y5VA 5T5NF 3IT8D 5DFVD 4M5YH 3G5VA 5I1GH 2AJ3A 5CWSA 5FK9B 4KROD 4U0QB 5TE6L 3W11D 4DVBA 3ME0A 1W0VB 2NY1C 1NLBH 5E1AA 1NUNB 1IAIH 3DX6A 1U8OB 1ZA3B 4HJGA 2OSLB 3UJTH 3TA3C 3U7AA 2VR4A 4NUGL 2CKNA 1RHHA 2W60A 4Q2ZB 4M62H 4KVCL 2ZCHL 2CRYA 3IJHA 4W68A 1CVSC 5DQ9A 4OCXH 3QWQB 1GZPB 1G7IA 1KFAL 5D4QA 3M17B 4L4JA 4A2MA 3CX5K 4GMSL 4F7EA 4WU7B 2VUOA 2ADGA 1W72L 1YYLH 1BQHG 1KEGL 4TSCH 4GW4B 3EYFA 4W4NA 1FPTL 5DHVH 3DNKA 2C3XA 3GSVA 4MD0B 3EO9H 3GZKA 4Q9BA 2VISA 3U6RB 3V7AG 2R39A 4U1LB 4HCRH 5EBLA 4Z76B 3WO3B 3QHZL 1UKQA 1T5XB 3MJ9A 2DAVA 4W6WB 2AJZA 2R0WH 5E70A 4EXKA 1AXSA 2NY1B 2QHLA 1ZE3C 2VSCA 3QCVL 1RZ7H 2A6KA 2CXGA 3TA3B 4DQOH 4LCCA 3OG6B 4JRYB 1NCNA 3R1GL 2AJXL 4GBXD 2I9LA 4XTRD 5D7LE 1HHIB 4RWYL 1BAFL 1A9EB 12E8L 3ZKND 1RJZA 1FFOA 1ZLWH 1YN7A 3GNMH 3TO2A 4XXDA 2C7UB 2Y7QB 3JVGC 1LEIA 1AO7A 4YHMH 4LCYA 4MXVF 5BZDA 5BQ7B 4PYHA 2DM3A 3CNKA 5LG1A 2BVPB 2CLVA 1QNZL 4NWUH 5CJQH 2EDFA 5EU5B 1S8DA 2FJGA 4F7MA 2DI8A 2CUMA 5A43C 1CQYA 5KVGL 1KIPB 1QR1A 4YQXL 3WNOA 5AG9A 3P9WB 4ZTPL 5GZND 2Z92B 3ARDD 3S5LG 4FA8A 5DHVB 3IKCB 1RK0A 2R2EB 4U1JB 5GGTL 2FYYA 3BEWB 2DN7A 4JJ5A 4LSRH 1OLZA 5IFHL 1CD9B 5C9JA 4HXBH 4V1DD 5DRNA 3H7BB 3RA7H 3UTZA 4NQSB 1Q72L 1JPGB 5CSBA 4ENEC 1FC1A 4NC1E 4PJ5E 1MCIA 3FZUC 3SOBL 1JGVH 5DEFB 5CINH 3P77A 3P4MA 3TPUB 5IB3B 3S3JA 1MFAL 4MA7H 5H94B 1D5XB 4NZTL 2BRRL 1U8LB 4J3UA 2BSTB 1A7QH 1J7VR 1WICA 4AH2A 4LQFL 1WCQA 4HK0B 1BD2D 4CU8A 1SY6A 5EZOH 3SDAC 2VKXA 1OAXH 2QHRL 1OQOA 1DQML 4ZUVA 3VXTA 4PJXF 4G9DB 3X3FH 4NP4L 1UXSA 3WJLA 5KVEH 2X4NA 4PPTA 8FABA 3H7LA 1J12A 3EO0B 4KKAC 3BAEL 4J4PD 4ZOEA 5TF1H 1YN6B 2MPAH 3KPSB 5IVZA 1AJ7H 3CZFB 4LOUD 4OLXH 3OF6A 3K4ZA 5EB9A 3B83A 3S96B 4HQQL 4LHUD 4NQXA 5JO5B 4LSQL 4PJDB 4FTVE 2VNCA 3B6SA 5F21B 3WXWL 2UZIH 4MD5A 4U1SA 4X7EC 5MP6L 1J88A 1JP5A 4XVUC 1X7QA 3GJFK 2H45A 2MQ3A 1BFOA 1JGUH 2QQLL 3MOBH 2I27N 2HKFH 3HE7C 5DK0B 5EZLA 4X7SL 2I5YL 3SKJH 3LKRB 1RAMA 4LSSL 3I50L 1OW0A 3EUUA 1KSRA 1TENA 5DD3L 3OZ9H 4WEBH 5F7FA 4WUUD 5E8NA 3UTSA 4Z8FH 4Y5VC 4H88L 1ZHKB 3SE9H 2VZ3A 3SDXB 4PJAE 4OFYD 3PGCB 2DQFB 5E8EA 2VDRL 3MMEA 3RNKB 5DSCB 4N9OB 3DYMA 2P43B 4XCFH 3BMVA 4PJ9A 3QFJA 5EOCL 3IDXL 2OQJB 2MCPL 4PRID 3VGAC 4OUOA 3K8LA 1CWVA