4M80A

The structure of e292s glycosynthase variant of exo-1,3-beta-glucanase from candida albicans at 1.85a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
393
structure length
393
Chain Sequence
b'WDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,3-BETA-GLUCANASE
publication title Major Change in Regiospecificity for the Exo-1,3-beta-glucanase from Candida albicans following Its Conversion to a Glycosynthase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 150
structure length 393
sequence length 393
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m80A00
1EO7A 4W8BA 4A3YA 2ZXBA 7A3HA 2A3BA 2WWCA 4M1RA 1QVBA 3FXYA 5D4YA 1JZ3A 1LL7A 1WZLA 1D7FA 2WNWA 3OBAA 5E9AA 1W3KA 2QHAA 2WCGA 2YL5A 4AZIA 3AJ7A 2EEXA 4FLOA 3WUGA 4Z2JA 4NSBA 4LYRA 1W9UA 5A6BD 3FN9A 1B3VA 3VM7A 1E9LA 3T09A 2NT1A 2WBGA 5HNNA 1J0YA 2W5FA 5A8QA 1GJUA 2CIPA 2WVVA 1BYDA 2YDQA 4FLQA 3M07A 5DF0A 3RMEA 1V02A 1KQZA 1ZBVA 1KWKA 4UFMA 3WF2A 5A3HA 8A3HA 4KWUA 5AYIA 1UKOA 3CIVA 4Z2GA 4OOUA 9CGTA 3W26A 1UWRA 3MMDA 4IUGA 1ZJAA 2DQXA 2PI6A 4AD3A 1CGVA 4JAWA 3TP4A 3WD3A 5DO8A 1C7SA 5BXTA 2WHLA 2VZTA 1JYWA 2YDSA 1QHPA 2O9PA 1CXIA 5E0FA 3WNMA 4MDPA 1EOMA 3WDIA 3ZR5A 2VMFA 2QLYA 3FY1A 4W5UA 1KBBA 1B31A 4XB3A 3WF4A 2OWCA 4KGLA 4MAVA 1K9DA 2YDRA 1UKPA 2WSKA 1U2YA 3VOCA 2E0PA 5DT5A 4DWSB 5IDIA 2ZE0A 2D3NA 1BG4A 2HVMA 2YL8A 1ITXA 1CWYA 4HTYA 4MNLA 3E1F1 1R86A 5ABFB 3OZPA 1VAHA 1WB0A 1VB9A 1V3HA 1D3CA 1CXHA 5FKYA 1G1YA 3WD0A 3CZEA 4UNIA 1UR1A 3W81A 3ZQ9A 4JFSA 4AZBA 1BVZA 2WHJA 1JXKA 2EPOA 2VRJA 1GOOA 4MAZA 1GQIA 3AI0A 4UFJA 4N0RA 3AISA 4GZIA 4X9YA 1YHTA 2W91A 2ZWYA 2OSWA 5LA0A 1UR9A 1W91A 4UFKA 5LYRA 2E4TA 3W6LA 1CBGA 2WC4A 4MADA 2D3LA 2ZOXA 4TVCA 3MV01 1UKSA 3K8KA 4PUDA 2WMKA 3TA9A 2IUZA 3SCQA 2BVDA 3AIQA 3AMDA 2XIBA 1FP9A 3BAIA 2OYLA 3K4AA 4MNMA 1AVAA 1UWQA 4CD6A 2WVVB 4PSRA 3W25A 2BY0A 1MQPA 5BYWA 3ZT6A 3AMKA 1KXHA 4GINA 4Z2LA 1UKTA 3GH7A 1QOXA 2W62A 3WDQA 3MMUA 1XH0A 3GNRA 2E9BA 1ISYA 2YL9A 1E3XA 5CZKA 5EMYA 3WDRA 1W9BM 2WYSA 4P7NA 5CXPA 2GVYA 1OB0A 1QBAA 1GOMA 4XV0A 1NOFA 4H7VA 3BMWA 1A3HA 3ZJ8A 1HJXA 3PZVA 2G3IA 4RE3A 1HKJA 2ZXAA 4HA1A 5HBFA 1JYNA 1BYCA 4B3KA 4KGJA 4D6IA 5BCAA 4MDOA 3WH6A 1BYBA 2D24A 5A8MA 5JBDA 3CHEA 4URIA 3AQUA 3MUY1 3VGGA 2WKGA 5A6MA 5CLWA 1NARA 1XD1A 4OKDA 3VM5A 2J7BA 2DSKA 3VIMA 2G41A 2J7EA 4J3TA 4C7DA 2VZUA 1E4IA 1GVIA 2YA2A 3ARZA 4PN2A 2AMGA 3FAXA 1J18A 3U7BA 2GJPA 1C7TA 1JDCA 1WDQA 2WHMA 3RDKA 1V6VA 2DIEA 1JG9A 1V0MA 3CUHA 1F4AA 3CZ8A 1KCKA 3CO4A 1V3JA 3TOPA 1JYXA 3WEOA 3AZTA 3MSDA 1KCLA 3GXIA 2G3MA 3BSGA 2CHOA 3PN8A 3UR8A 3EMZA 4WLCA 1KXTA 3RJYA 4Q7NA 1RPKA 4ZEPA 2CBJA 3WFLA 4PMQA 3APGA 3BXWA 1H3GA 2O92A 5GPRA 1E1FA 1HKMA 4CGTA 4W86A 2PF0A 3MSGA 3F5LA 3QHOA 5JBFA 2VVSA 5A6JA 1GOIA 1JF6A 1C93A 1C90A 1PZ2A 4EANA 1C92A 4RE4A 5GQBA 2WVTA 1E6QM 3THDA 4JCLA 4AZ7A 5E0CA 1AQMA 2YJQA 4GO8A 1MQQA 3GDBA 3FHAA 3WIJA 2GFTA 3ARQA 1HNYA 3DC0A 2FGLA 4M82A 4U31A 1LWHA 3AS1A 3MO4A 3O6AA 3BCDA 2CXGA 2VCBA 1OIMA 4BF7A 1DEDA 1MXGA 1FP8A 2BY3A 4CU8A 2DSVA 4AZHA 2J77A 3VDAA 1DWHM 1JNDA 4H2CA 1GPFA 1JZ2A 1V3LA 3B8SA 5AY7A 5D9NA 2Y4SA 1J10A 4PSPA 4C7FA 3PHAA 1J12A 1IV8A 2JE8A 3BAXA 4WKAA 2WVSA 1YQ2A 1VFOA 5I3DA 1B3YA 3WD1A 3L4TA 5A6LA 4U2ZA 3DYMA 3AZRA 1W9VA 1KXQA 5GNYA 3RO8A 2OWXA 1PX8A 1W3LA 3SUSA 3QGVA 2WHKA 5AC4A 4HMEA 1PX3A 4CVUA 3O9NA 5CGMA 5C71A 1K9EA 1KR0A 1G5AA 1JZ8A 1E4MM 4MB4A 1JZ7A 3AZSA 4S3KA 3AS3A 1GQLA 3W82A 5HPCA 2GUYA 3N15A 3W37A 2WBKA 5JIWA 1E73M 4D72A 5I77A 3WH8A 2EPKX 3PZIA 4TTGA 2BV9A 2PB1A 1W9XA 3WUEA 1DTUA 3OLDA 3HU7A 2ZX8A 3TTSA 4X0NA 1UR2A 4AY1A 4HPGA 2WCAA 3AHZA 3CH9A 3N17A 2JIEA 2XWDA 4HZ7A 5E6YA 1VF8A 2CPUA 4ZFMA 3K8MA 2ESCA 1CGYA 1V0LA 4ACZA 2VT0A 5BRQA 4LQ1A 4BA0A 1EGZA 1C8XA 1TVNA 1K9TA 3GNOA 4DM1A 2XUCA 3AMLA 3W29A 1SMDA 4S3JA 3ZR6A 4PRWA 4JCMA 4B16A 3EBVA 4AD5A 4W88A 2BS9A 2XVGA 1OGBA 2EJ1A 3WQVA 1BGAA 3BH4A 3K46A 2UY5A 4J7RA 3WNLA 1B3WA 1GZJA 3FAWA 1ESWA 1C3FA 3N13A 1KXVA 1QI3A 1UH3A 1UR8A 4N42A 1V08A 1E55A 1XRVA 1PEZA 2QPSA 3PZQA 1UR0A 3UG5A 1ZBWA 3RILA 4Z2IA 1WO2A 4U2YA 4JHOA 2XGIA 4D1JA 1FFRA 2VRQA 4CN6A 1HJQA 3NDYA 3UR7A 2WMIB 2WMFA 3AICA 2ZX5A 1GONA 3SUWA 4BQ5A 1KFWA 1H49A 5IXEA 1UZ4A 4UFLA 1J0ZA 3K4DA 1BGGA 2ZUTA 1XH2A 4MTVA 5GNXA 2CETA 3ZMRA 1MW1A 2BXYA 1UD4A 2G3NA 2WC7A 2DSWA 4AIOA 3VIOA 1E0XA 3CZKA 1JZ5A 1BHGA 4CU6A 1NOWA 5FL1A 1CYGA 1O6IA 1TG7A 3A3HA 1B30A 3PZUA 2ZIDA 3ZT5A 1V6UA 2CBIA 4JZ5A 4AW7A 4EAMA 3OLGA 4TTUA 4KRUA 1V0KA 4RE2A 3UCQA 4AIEA 3K8LA 3KL5A 4HA4A 3PTMA 5KEZA 1OT1A 1W1TA 4WKHA 4UOZA 3WNKA 1CDGA 5ABFA 2J8GA 4IISA 3BC9A 3SCNA 4E4PA 4NI3A 3M7SA 3GH4A 1QI5A 2YIHA 4ACZB 1UH4A 5AYBA 3ZSTA 1BAGA 1ZS2A 4HOZA 2DEPA 3PZNA 4GI9A 1CNVA 4PMOA 4JFWA 4ATDA 8CGTA 1VFFA 2CEQA 2VCCA 1U33A 4H41A 2VX4A 2VZVA 3EDKA 3SURA 2CKRA 1CEOA 2GJXA 2PBOA 3U5YA 3W38A 4AISA 2JIWA 2BY1A 3M46A 1W9DM 2GJRA 5DFAA 4MNJA 1HT6A 4BS0A 4F9DA 3ARVA 3WQ4A 3VIFA 1MFUA 5M5DA 2A3EA 3VIGA 4Q22A 3VMNA 1FH8A 3WMBA 1JAEA 4NZCA 1HF6A 3PTQA 4MNKA 2PBGA 4LYQA 2WMJA 3GXDA 2V5CA 1XCWA 1OWQA 4FLSA 3FHQA 1HKKA 4AZCB 1UOKA 2G3JA 2DIJA 3WQ6A 2DPEA 3FW6A 1VJSA 2F61A 1CGWA 1JXJA 2VX6A 1JZ6A 2PWFA 3MU7A 1WDRA 4W8LA 1K6AA 2PWGA 4OBSA 5EFDA 3ARUA 1JYVA 3ARYA 1LL4A 5ABHA 7TAAA 2DSZA 3NCOA 1TE1A 2XFYA 1NWSA 3OB8A 1NQ6A 2DDXA 3AYSA 2VX7A 4P7QA 1G9HA 2A3AA 1L8NA 1H11A 3DECA 4B15A 3B9AA 4D6FA 1TA3A 1OSEA 4GZEA 2X0YA 3U7VA 2WB5A 5ECUA 1VENA 2EBNA 1OINA 2V3DA 2YA0A 1DWGM 4UQCA 2BHZA 1ZL1A 1MW3A 1KGXA 1OCQA 1QNRA 1QHOA 1WP6A 3AS2A 1ZBCA 4QLJA 4JKLA 4JFVA 1TUXA 3UERA 4W7VA 3N12A 5M03A 1CXLA 2J7DA 4A3HA 4MB1A 3VIHA 3WSUA 2X2YA 1UH2A 2PWHA 3CHDA 3VO0A 4B9ZA 1EQPA 5DMYA 2J74A 2YL6A 1I1WA 1WNOA 1ISXA 3K1DA 4AMCA 1UWTA 3DYPA 2ZX7A 1M04A 3RPMA 3N9KA 4F66A 2HISA 2DT1A 1NWRA 1OBAA 4TXEA 1HJUA 2EQDA 2ZUSA 4QLKA 3A4XA 2E8ZA 4MB3A 5TD4A 7CGTA 3VVGA 2V3FA 2GJXB 1UHVA 2Y8KA 5IHRA 3F5KA 1J9YA 1VEOA 1R87A 3OG2A 3NUKA 5A6KA 4BQ2A 1EDTA 1HN1A 3CUFA 1UD6A 4W7UA 3CGTA 5CQ1A 2W92A 5KZ6A 3W27A 4PBGA 1BG9A 4KRTA 1J0HA 2TAAA 1TZ7A 3WD4A 1FH9A 3ALGA 2Q8XA 4C7GA 3IJ8A 4UQEA 4AD1A 1QW8A 4UFHA 3SUVA 3MV11 4F79A 2JALA 5A1AA 3TTYA 4J3XA 1J01A 3WBAA 4YN5A 2VUYA 1ZBKA 4XZWA 4GO9A 2J62A 4QDMA 3CMGA 1HL9A 3LMYA 3RM8A 3AXIA 4WJXA 1UG6A 1CXEA 5FL0A 1E0WA 2VRKA 2VQUA 3VD4A 4HPHA 3WD2A 1GOKA 2BNJA 4OZOA 2DGAA 1CPUA 3VX0A 3SCTA 4PTMA 1NM9A 1KGUA 2FDMA 2WKLA 3POCA 1TA3B 1EIBA 2CHNA 4EKJA 3AIRA 3L4VA 4QLLA 1GHSA 2XM1A 4FK9A 1H41A 2YA1A 3AIEA 1QHZA 4UOJA 1EOKA 3SEPA 4F8XA 2DT0A 3BAWA 1PIGA 3NDZA 3CZLA 1RD6A 3CUGA 1UWUA 5E09A 3OA5A 4JKMA 3PTKA 1SFSA 1LJYA 2BVYA 1GVYA 3ARSA 1FA2A 1OM0A 1NOUA 1OD8A 5JIPA 1UQYA 3WBEA 4FLRA 2IXUA 4W85A 4GPNA 3VIJA 5ABGA 2X0HA 1PBGA 1QNQA 1QI2A 2VQTA 3L2LA 2C8NA 1FOBA 3OGSA 2GDVA 3UG4A 3VUPA 2FHCA 2J7FA 4J28A 4WSJA 3KZSA 3IK2A 2J78A 4QAWA 5A2BA 1LG1A 2WW5A 3AOFA 3CBWA 4H8HA 5I5RA 1UA3A 1JGIA 2XSBA 4L4PA 2YBUA 2CBUA 5CPQA 4BZYA 3W24A 3NSNA 2VZOA 1HVXA 1HJWA 2J47A 1UD8A 2JEQA 4W93A 2OSXA 4UOQA 1LLOA 1WZKA 3WN6A 2VCAA 5FD0A 3EMQA 1E43A 3NIYA 2W67A 1AMYA 2D2OA 3FNDA 2W61A 3II1A 1TMQA 2D20A 3WF0A 3B9EA 2V38A 2IXVA 5IFPA 1MVYA 4JIEA 1EA9C 2VOTA 1KBKA 4DUWA 4KH2A 1CECA 4TX8A 1O7AA 1QBBA 5AC5A 4U3CA 3I3EA 3IJ9A 2UWFA 1XYFA 3PZOA 4W7WA 2OLHA 1CGUA 2RGLA 5EFFA 1QW9A 3W53A 3VMPA 4M80A 2WZEA 5CSUA 3CZJA 1LQ0A 1UR4A 2WXDM 3TTQA 4ZE4A 2XSAA 1E1EA 3W6MA 1W3HA 1TR1A 3SUUA 1LWJA 1NWUA 4JFTA 1VFUA 4V2XA 1EHAA 1VRXA 5M3WA 1EXPA 1I1XA 3T2PA 3VIPA 3WKZA 3M6DA 2W63A 2WMIA 5D9PA 3WQ5A 4PMNA 4UZSA 1N82A 4BQ4A 5A6AA 2BHYA 3L2MA 4LYPA 3HMCA 4YPJA 1JFXA 4D6HA 2J7HA 5I79A 4F9JA 5A94A 2C0HA 2VNCA 5EB8A 1V3KA 2WC3A 4CD8A 4IM4A 1TVPA 2GDUA 3RM4A 3UESA 4W8AA 4WIWA 2NSXA 4FMVA 1X6NA 3TONA 5CPTA 5A6SA 3GZAA 4EE9A 3ARRA 5HOSA 1QI4A 1G94A 1J0JA 2D23A 2O9TA 3ARTA 3GM8A 3F5JA 3EDJA 3SCSA 1OGSA 4WK9A 1MQRA 4V28A 1WE5A 2ZX6A 2JF6A 2XFRA 1KQYA 1CZ1A 3EDEA 2EO7A 1M7XA 1HP4A 2J8FA 3T08A 3I3DA 2XIIA 2X09A 4HOWA 2E9MA 1J11A 4PMUA 5HDRA 3WDPP 5IFTA 4NRRA 1QI0A 4ML4A 3VTRA 4DUXA 1R7OA 5E6ZA 2PC8A 1CXFA 2QF8A 1JI1A 3BAKA 1UWIA 1W1VA 1JAKA 3ZOAA 3N18A 1RP8A 1P6WA 3ECQA 4UQ9A 3VGDA 5A8PA 2VI0A 1V3IA 4H8VA 3N11A 2Y5EA 2J79A 4ZE5A 1BVNP 5I6SA 1B3ZA 2D0GA 1HJVA 2VTFA 3GYCA 4YHGA 4MJ4A 3ZM8A 2VJXA 3UEQA 1UD5A 3WDJA 4CVWA 3VGEA 3JUGA 1MFVA 3VD5A 4PTVA 2YKKA 4AZCA 4YHEA 1E6ZA 3IANA 4CD7A 1XV8A 4D71A 5D9OA 4K68A 1E40A 4P7LA 4U5KA 4OUEA 3VIKA 1Q6EA 4AXNA 4ATLA 1HIZA 1U30A 2BY2A 3BLPX 2D1ZA 4DM2A 2FHFA 2WK2A 4PMRA 3SCOA 3MUAA 3VGFA 4LPCA 2G4FA 3A4AA 2XHYA 4D6EA 2PWEA 3A47A 1BLIA 4D6GA 3GNPA 4P7OA 3BSHA 3VGBA 3MANA 2CERA 5I24A 2WZIA 2RGMA 4HZ6A 1ITCA 3T0AA 3AFBA 4PTXA 5CPSA 2UY4A 1BQCA 3WMSA 3SCVA 4CU7A 1E5JA 4AD2A 1W3JA 3L4ZA 4OIFA 4Z2HA 3L4YA 1Y7VA 3MS8A 1CGXA 4E8CA 2O9OA 1GORA 2E40A 4AC1X 2BFGA 1BSIA 4LGXA 3LPPA 3W0KA 3N04A 4IPNB 4R27A 3ZSSA 2ZXDA 3PZTA 3AMCA 1HVQA 3SIMA 3VNZA 1SMAA 4HMDA 2CITA 2UY2A 3A4WA 2ZUMA 2OYKA 1FH7A 2ZICA 4Z2KA 3WNOA 1XHGA 1D2KA 3PZMA 2WPGA 1XSKA 5JUVA 2NT0A 3D5HA 3SCPA 2XVPA 3S2CA 3VNYA 1E72M 1UUQA 1E0VA 4CN1A 2FH6A 1ISVA 1US3A 2CESA 3ZIZA 4E2OA 2D0HA 6TAAA 1OIFA 1GJWA 1WCGA 2FGZA 1BTCA 1DWIM 2BVTA 2E8YA 4ACYA 1JI2A 2ZUNA 4OOZA 3PBGA 4GIAA 3KE0A 1JD7A 4M24A 3VD9A 2W66A 1UZ1A 4TX6A 1CIUA 2W4XA 2CNCA 1RP9A 4OJYA 3VD3A 5I78A 2V3EA 4E8DA 4CD4A 4AWEA 1JIBA 1KB3A 3LPGA 4AZ5A 4NRSA 3NSMA 5LA1A 1GUVA 3OZOA 3AXHA 1RH9A 5I23A 3BCFA 4ZENA 3WQWA 1B90A 3OIHA 2JF7A 3AIUA 1ODUA 3SCUA 4GI6A 4TOQA 3MUZ1 3WNNA 4HA3A 4ZXLA 4HP5A 2EPMX 4J3WA 2VVNA 3WEMA 1WZAA 4W84A 3S6TA 3SUTA 4GKLA 4PMDA 4AEFA 1ISWA 1W1PA 1JD9A 4XUYA 1ZU8A 1Q4NX 1E5NA 1TCMA 3WEZA 2CKSA 2E3ZA 4HMCA 3CZGA 1JF5A 1W9PA 4Y7EA 2X05A 3QHNA 2EPLX 2ZXQA 1E4LA 2OSYA 2VL4A 2E9LA 4PMVA 4AYSA 1V02E 1QNPA 1V03A 2WMHA 1E4NA 3WY1A 2VURA 1PJ9A 2VX5A 4AZ6A 1CXKA 1V6WA 2WLZA 1MXDA 5LA2A 2G8ZA 3QHMA 4CN4A 5C70A 2DT3A 2DSUA 3NSXA 1V6XA 1XH1A 1FFQA 3WF3A 3A6OA 1X1NA 2WANA 4GI8A 2WWDA 5CGTA 1QPKA 2VZSA 1A47A 5D9MA 5HPOA 1CTNA 3T0DA 1XD0A 2ZX9A 1LF1A 1LL6A 3NJ3A 5C8BB 4QCFA 3I3BA 1MW0A 2XFFA 2AOSA 1HJSA 2XVLA 1WAWA 1MYRA 4P8VA 4BCEA 4DUVA 3T2OA 3AS0A 2ZUVA 4UFIA 4PMXA 3B9DA 4GQQA 3L4WA 4W5ZA 4P8XA 1W1YA 2JEPA 3IJ7A 2Y8VA 1BYAA 2XGBA 4HZ8A 4RL3A 3EYPA 1VJZA 1IZJA 3BAYA 1E3ZA 1E6XM 2ZUUA 1UD3A 1V6YA 3AIBA 3VIIA 1ZJBA 2F8QA 4ZXOA 4J3VA 4L4OA 3SCWA 3F4VA 1WDPA 1B1YA 1NP2A 1PAMA 1UKQA 1E71M 3LPOA 4B3LA 2J25A 3VGHA 1GQJA 2CCRA 4XZBA 1GCYA 3VILA 3WUFA 3VDCA 3BLKA 4B9YA 2X8RA 1M53A 3W28A 3WH7A 1JFHA 1XSIA 5EBAA 3UG3A 1JDAA 3OGVA 5DT7A 5BXRA 3J7HA 4M81A 1UQZA 1BPLB 3WUBA 3KL0A 4AIUA 2B31A 2XWEA 4D6DA 2CYGA 3QOKA 4HU0A 1HX0A 1UA7A 1J0IA 5I2UA 4KMQA 2D22A 4JL2A 5I0DA 3WH5A 5D8WA 1PPIA 3CHCA 3VPLA 1ZB5A 3WFZA 2YOCA 2F2HA 2QMJA 1H2JA 3KL3A 2VC9A 2V3GA 2J7GA 2BHUA 1HKIA 1V3MA 4UR9A 3IAQA 1R85A 4WSKA 4CCEA 3WH9A 1K9FA 1BF2A 1GNXA 3AXXA 4QCEA 1FHLA 3ARXA 4PYSA 1GQKA 3ALFA 2MANA 2BXZA 3ZT7A 5E70A 1B9ZA 1QNOA 2FHBA 2Y2WA 5DEZA 1G0CA 4H8UA 4CCCA 3ARWA 3WNPA 4UTFA 1EHNA 3L4XA 2EXOA 1W2VA 1H4PA 2J75A 3QOMA 5BRPA 2VR4A 1US2A 1Z32X 3ZO9A 4D6CA 4DWSC 4FF5A 4LX4A 1G01A 3VU2A 4X0VA 1VIWA 1KGWA 1MWOA 3CPUA 5F7UA 4PEEA 2YLAA 3GXFA 3AMGA 1OD0A 2Z1SA 5A2AA 1DHKA 4NF7A 3RIKA 3NYDA 1ISZA 2YBTA 5M17A 2DH3A 1Q6CA 1C91A 1NP0A 2XM2A 3ARPA 3QR3A 3WF1A 4D6JA 1XSJA 3VDBA 1EH9A 1L0PA 1SYTA 3KWXA 1E6SM 4CCDA 1H0IA 3HN3A 3G6LA 1B2YA 1QNSA 1EDQA 3DHUA 3UETA 5A95A 1R8LA 3DYOA 4M56A 2WLYA 3GH5A 4HOXA 4PCSA 2C7FA 1HL8A 4H04A 1B0IA 3VX1A 1F4HA 1GOWA 2VO5A 2GK1A 1CGTA 4PTWA 3WMCA 4PMYA 3WQ8A 4WKFA 1VEPA 2CBVA 4UQAA 1R7AA 1B3XA 4U3AA 1Q6FA 4J3UA 1LG2A 5BROA 4M8UA 2WVUA 4GQRA 5FIPA 1H1NA 1WKYA 2VR5A 3WL0A 1XGZA 1VBUA 1PX4A 1JDDA 1WPCA 2EPNA 1HP5A 3GTNA 1E56A 1W2PA 4U33A 3MUIA 4AZGA 2UY3A 2DT2A 5A69A 2J4GA 3OGRA 4OBRA 2D0FA 4TVUA 4J3SA 3WL1A 1BFNA 5CG0A 3BGAA 3HJEA 4V27A 2XYLA 1GOQA 1H09A 3ZJKA 1TFVA 4WF7A 3POHA 1DWAM 5GNZA 2WSPA 4TUFA 1V0NA 1E70M 5JBEA 3GBDA 4MB5A 1W32A 2DH2A 3VINA 3GBEA 4LXFA 3ZJ7A 1E6PA 1AQ0A 2V5DA 3T2QA 4ATWA 3IAPA 3L4UA 2JFEX 1IZKA 1H5VA 1WDSA 3MMWA 4AD0A 2ZUWA 4UZUA 1C8YA 2A3HA 3CHFA 3EMCA 1UWSA 2AAAA 3AYRA 5CJ5A 5HXMA 1XCXA 4MPKA 1DWJM 2Z1KA 3O2LA 1KWGA 1PIFA 4D1IA 1X6LA 4GZJA 4P8UA 5CSYA 1E6NA 4QP0A 2WAGA 1VBRA 1Q6GA 3ZJ6A 3AROA 2QMKA 3D3AA 1AQHA 3AHVA 1M01A 2OWWA 2YLLA 1IT0A 1NH6A 3T0BA 1KR1A 2XVKA 5FOOA 2FH8A 2XTKA 3EDDA 2GK1B 3CMJA 5CLTA 1FHDA 3VD7A 3U5UA 2J7CA 2QPUA 1CLXA 1J0KA 2XJ7A 3VKKA 1CENA 4EK7A 3G6MA 3BAJA 1EO5A 4HU8A 4JKKA 3CLWA 3WENA 3KEHA 3AIVA 5D8ZA 4QFUA 4P7RA 1M03A 2O9RA 4CD5A 2WZHA 4AEEA 1MW2A 3OLIA 1I75A 1VFMA 3GXMA 3AIWA 3AHYA 3VDHA 3SCRA 2XVNA 2X1IA 5IHSA 4TVDA 4CKQA 3PZGA 4GXPA 1E6RA 3CUIA 3RM9A 1EQCA 5FCZA 5BXSA 1JZ4A 3THCA 3TTOA 4CUCA 1JL8A 4AD4A 4J27A 3RCNA 1XC6A 5BWFA 1UD2A 4U5IA 4R5EA 3RJXA 1ECEA 1NWTA 2Y24A 4PMZA 4XX6A 5BXPA 3AHTA 6CGTA 1JNEA 2A3CA 1PZ3A 2PWDA 1WZMA 4W89A 1HXJA 2NW0A 3OLEA 1ODZA 2WCSA 5A8NA 1DWFM 3PZ9A 4UQDA 5A2CA 1S46A 1E15A 4BQ3A 1VEMA 2XPKA 3MKKA 4UCFA 1EDGA 1C8QA 4JFUA 4P8WA 3WDHA 3BMVA 3AHXA 3U57A 1CLVA 5A8OA 6A3HA 4W87A 3WELA 1DP0A 3CUJA 4M29A 4PCTA 4DWSA 2QV4A 3DHPA 2GSJA 3EDFA 1H0GA 1OGGA 4PUEA 3LPFA 2ZWZA 1SR0A 2WMGA 1XYZA 1GHRA 2WM0A 1Q6DA 4UQBA 1OT2A 5ABEA 4IPLA 4A4AA 3VMOA 4JL1A 5A6BA 4JHZA 2OYMA 2XG9A 1UYQA 3W4RA 3CTTA 1GW1A 4MJ2A 4DWSD 3N1AA
chains in the Genus database with same CATH superfamily
1SZFA 1XBXA 4V1YA 2A3BA 1EWEA 4S39A 3W84A 1JZ3A 1WZLA 3KVMA 1DXIA 2WNWA 2QHAA 2WCGA 1LQ2A 2YL5A 2OR2A 4FLOA 3KRUA 4L80A 3VNDA 1W9UA 3L0KA 1LOLA 1KKRA 1E9LA 3T09A 2I57A 2CHRA 3LD5A 1EGMA 2E77A 5EU9A 3TWAA 4FLQA 2VFDA 1VFTA 4WXYA 3S5NA 5DF0A 3RMEA 1TO3A 4TV5A 1KQZA 2IPGA 1KWKA 1S5MA 3SZ8A 5AHEA 8A3HA 2A6LA 5AYIA 2ISWA 4FOJA 4JTDA 3EPNA 1OJXA 3P60A 3W26A 4XQ6A 1ZJAA 2YXGA 4AD3A 2YCLB 5DO8A 5EMMA 4LUSA 2VZTA 3DC8A 3C86A 1JCNA 3S1VA 3EX2A 1CXIA 4MDPA 3PVFA 1QT1A 3F4WA 3WDIA 3ZR5A 3BCJA 2NVAA 4GK8A 4RDVA 4W5UA 5K9XA 2QJHA 3NQ7A 3WF4A 4ILSA 6PTDA 4S2CA 4RDYA 3OYXA 4PA8A 5HR6A 3H70A 1A50A 2ZE0A 2C1IA 3CXOA 1DJNA 2VUNA 3NNTA 3FKRA 2QJJA 4Z0JA 1HG3A 4C6FA 3NEHA 3E1F1 4RUBA 1VAHA 1KA9F 1F5ZA 2YDAA 1G1YA 4ZR8A 1PSCA 1XFCA 4N02A 3G0UA 4LUJA 2SFPA 2VRJA 4Q4PA 1Q6RA 1QASA 3NPUA 3CLMA 4FNTA 3KLLA 2Z00A 3TW7A 5LGZA 1RHCA 4X9YA 3S1WA 2GOUA 3U8GA 2OSWA 4HNTA 1AW2A 4GRSA 2FIQA 1PWMA 3H26A 1FWWA 2E4TA 3W6LA 2WC4A 2D3LA 1TQXA 2ZOXA 4UIOA 2OGJA 1UKSA 1O4UA 3F4CA 2YCEA 3AMDA 1FP9A 3BAIA 3E0WA 1ADOA 1UWAA 1AW5A 5HK4A 3FK4A 1Z48A 2BY0A 1MQPA 3AMKA 4GINA 3GVVA 2X1TA 4NVTA 3GH7A 1NFBA 2P1FA 4G7FA 2W62A 4AWTA 2HQAA 4NX5A 1ISYA 2YL9A 4MKSA 3B97A 4JTTA 3E12A 2ALDA 3R11A 1QBAA 5CJNA 4XV0A 1BF6A 1P0DA 1S38A 4H7VA 3CIXA 3UZJA 4RE3A 1KM3A 2OKOA 5J04A 2PD5A 3TN5A 4UTTA 3A12A 4GH1A 1WDDA 1JYNA 4DIAA 5CJMA 4UTMA 4IT1A 4RZBA 2D24A 4URIA 4DX3A 3AQUA 4BY3A 1BVWA 2DZPA 2XN2A 3BDKA 2WKGA 2O55A 5A6MA 1W1A1 3W00A 1XD1A 4IQJA 3USZA 2FMOA 1WXYA 3YPIA 1TVLA 4C7DA 4UTUA 4ZSUA 3L5MA 3NQCA 1KBLA 2AMGA 1JQXA 3S5OA 3LI0A 4MGGA 1IWAA 3GTHA 3RDKA 3NZRA 3TNOA 2DIEA 5AN7A 4ZQRA 3IARA 3CZ8A 4RXGA 1N55A 1EP3A 1V3JA 3TOPA 5EMJA 1KCLA 2G3MA 3A3WA 1R3QA 1DJYA 2KZHA 4B5NA 4FOUA 3RJYA 4Q7NA 3NQBA 1TPB1 2QCMA 2Y89A 3OODA 1G7UA 2OT0A 4KCWA 1FXPA 4PMQA 3D47A 3EOUA 3APGA 2H3DA 3BXWA 1XF0A 2O92A 1E1FA 4YCPA 1HKMA 3P67A 4W86A 2PGFA 2CWNA 1PKLA 3FDKA 1GOIA 2ACUA 1FWJC 1C93A 2VFIA 1OFDA 3S9IA 1UC4A 1QRQA 2WVTA 1E6QM 4JCLA 1RD5A 1W3NA 1RVGA 4GO8A 3WIJA 1MNSA 4B5WA 4H6QA 4XUGA 2NZLA 1P1MA 1Y8BA 4PL1A 1XDMA 2FGLA 1PZ1A 2WOQA 1LWHA 3O6AA 1SO4A 1MDLA 1MEHA 5GVJA 4N9BA 3RUBL 2BY3A 4US5D 4FNUA 4CU8A 2DSVA 2J77A 4JEQA 2Y4SA 5T8GA 4UB9A 3T8LA 4CEXC 3GAKA 3WD1A 1FHVA 1I2QA 2AL2A 3N14A 4U2ZA 1JUKA 3DYMA 3AZRA 3RU8X 3CYVA 1PTDA 4Q4MA 1KXQA 5GNYA 4QITA 4A2RA 3OYZA 1W3LA 1B4EA 3STPA 5D2YA 3VK5A 5AC4A 1W5NA 4HMEA 3I65A 1PX3A 4LSBA 5CGMA 5C71A 1TPWA 3H4GA 4R85A 1G5AA 4NJJA 4LAOA 1VS1A 3A5FA 3ABQA 4YU1A 5HPCA 3N15A 3CQKA 2WBKA 2QCCA 3LERA 1E73M 4D72A 5DXYA 4BKNA 4ZCWA 2EPKX 2PB1A 3WUEA 3HU7A 3QN3A 1CW2A 1UR2A 5E0KA 1E9YB 4N9DA 2PAJA 2XWDA 3EOSA 3TC3A 4WR3A 5J8LA 3UZWA 4NL1A 1D8CA 4KIEA 1CGYA 4MIMA 2DUXA 3LLXA 5D30A 1A5UA 2JGYA 1U83A 2VT0A 4GOAA 3VOFA 5BRQA 1ZCOA 5BW6A 2KAUC 3RF9A 3M0IA 3PB2A 3W29A 2QW5A 1AJZA 4JCMA 1V5XA 3EBVA 2QVHA 4QQUA 2XZ7A 2RJGA 4W88A 1YTKA 3WQVA 4ZOAA 4J3ZA 2OQHA 2G37A 2VD9A 4XD5A 1ESWA 4LS0A 5HJYA 3W2NA 1XLBA 3TXZA 5I06A 3S42A 1PEZA 2XIMA 1SSDA 3GR4A 4I6VA 4D1JA 4IHCA 2VFGA 3CWOX 3NDYA 3MYPA 4PTDA 2WMFA 3CH0A 4RK8A 4F0RA 4RE0A 5DXXA 4S3BA 3K4DA 1GZ1A 1RA5A 2WZTA 4GLEA 4IICA 4KFNA 1OFQA 2E67A 1UD4A 1AFSA 1FWEC 2WC7A 3HGJA 5C0QA 2EG7A 1VBJA 4AIOA 1E0XA 3ABOA 5HQEA 1G67A 4CU6A 2AKMA 5FL1A 1CYGA 3A3HA 3DDMA 3M43A 4AW7A 3E38A 5F4SA 4RE2A 3F2CA 4HA4A 5KEZA 4IL0A 3WNKA 3NZ1A 5BOOA 3BW4A 1A4LA 3O0KA 3NQGA 2I5GA 3ZSTA 3GFZA 3PZNA 1T8QA 1L6YA 2V2CA 4ATDA 8CGTA 3KM8A 2VCCA 2VX4A 3IUIA 3P3BA 1GVEA 2VZVA 3SURA 2GOKA 4QG6A 3W1XA 2PBOA 4LF1A 1F3XA 4AISA 1S5VA 1H7PA 2JIWA 1W9DM 5CPOA 1ZLPA 3ARVA 3WQ4A 1MFUA 4HK7A 1R2SA 4B91A 1FH8A 4GX8A 3S6OA 4Y9MA 4GX9A 1IHIA 3EA2A 4I8YA 4NZCA 4HU3A 4HZMA 4MNKA 3M41A 1NELA 3ITXA 1XCWA 4FLSA 1HKKA 1UOKA 4F2UA 2GWGA 3ABXA 3IIXA 1VPYA 2RDXA 2GDQA 5JVLA 4U10A 1JXJA 1Q5MA 4DJDA 3LNMA 2V30A 4W8LA 1K6AA 4JGDA 2PWGA 4CQCA 4OBSA 5EFDA 3ARUA 4DO7A 3GDLA 3OB8A 2WJEA 3TJLA 2QV5A 1G7VA 2A3AA 3IGUA 4O15A 4XO7A 1JUBA 2X0YA 2X1UA 2HK1A 1VYPX 3VKDA 1DWGM 4UQCA 4B2DD 2R9RA 2PTXA 1EJXC 3EB2A 1WP6A 5FA5A 2PDPA 1MEIA 4FX6M 1TUXA 4XTDA 3PSWA 2C91A 5M03A 1CXLA 1XICA 4QJ3B 4ZQNA 4A3HA 1JCYA 4MB1A 4FR1A 4M0XA 3VIHA 3WSUA 3QV8A 3CHDA 3VO0A 1EQPA 2J74A 1I2NA 2YL6A 1YNPA 1UPPA 1RBLA 3K1DA 2ZX7A 1M04A 4DRSA 4Q7BA 1TZZA 2HISA 2DT1A 4XBKA 4J35A 1OBAA 1HJUA 1GQNA 2ZUSA 4QLKA 2J8TA 3VVGA 3C0SA 2GJXB 1K70A 3CMFA 2Y8KA 2ZTJA 4Y8FA 3NZQA 2X7WA 2ZRUA 4PTNA 1R87A 3OG2A 4IIGA 3LBMA 3NR0A 5A6KA 2FPTA 5BMWA 1EDTA 1J5TA 3CUFA 3CGTA 1PHWA 5KZ6A 3S3GA 4PBGA 3W7DA 2QJGA 4B5VA 1JRBA 4KRTA 3VC5A 1J0HA 3WD4A 3SBFA 3LCIA 1WA3A 5AC6A 4C7GA 4UQEA 4PR4A 4UFHA 3QV6A 3LCWA 4DO6A 3MV11 4I5UA 1TRIA 3QTPA 4J3XA 3WBAA 4QIUA 3TFCA 1U1JA 3RM8A 2FVKA 4WJXA 2C6QA 2VRKA 3U2CA 3QVQA 2VDGA 4NASA 3IACA 4H6KA 1DXFA 3Q2DA 1GOKA 2BNJA 1JPMA 4B5UA 1QU4A 1NM9A 4D8LA 1KGUA 2FDMA 1I6NA 3LXBA 4QDPA 1EIBA 3AIRA 3L4VA 1XYAA 2YXXA 2XM1A 4FK9A 1H41A 3AIEA 3DHFA 3BAWA 2R14A 1PIGA 3PF3A 3M0JA 4L1WA 1VFSA 1XL9A 3HGRA 3VNJA 3L9CA 9XIMA 1LRTA 1Z44A 3CUGA 4HK5A 2JBMA 3PTKA 2CLKA 1LJYA 1YTDA 1BWVA 3CTLA 4GZ7A 1DQWA 1XYLA 4PB5A 2VM8A 4W85A 1LBMA 2J9YA 3REQA 2INEA 4L6DA 3S9YA 1E9ZB 1I9CB 1PBGA 1I2OA 1QI2A 2VQTA 2C8NA 3NOYA 3OGSA 2Y7GA 1Z9AA 2PDFA 3FKKA 2J7FA 5C5YA 4GXWA 1GOXA 2XH7A 1DIDA 1RV8A 3W7EA 4HPXA 1LG1A 2PRLA 3QYSA 4PEKA 3HV8A 3CBWA 5D2XA 3W3OA 2PP0A 3EOOA 1JGIA 3N2OA 3OG3A 2XSBA 5EMKA 4H9ZA 5HAOA 3SFWA 2CBUA 1R9XA 5CPQA 5I3KA 4Y8EA 3W24A 2VZOA 3WFAA 1HJWA 2I16A 2XH2A 2J47A 1XINA 2JEQA 4W93A 3LHVA 4IMCA 1Q7QA 3AC0A 2WNZA 1DQXA 4DO4A 3G1YA 4DNMA 3S46A 2W67A 1AMYA 1ZNNA 2GPTA 2CWXA 1ICQA 3FNDA 2W61A 3B8TA 5AHFA 4O50A 3II1A 4XZMX 2D20A 2V38A 3O15A 2IXVA 1MVYA 1TIMA 2ZA1A 1XYBA 3TWBA 2CZFA 4H9UA 4YNGA 1P7TA 1QBBA 1RQBA 4QISA 4QS5A 2NUYA 2QCLA 1IWBA 1IEQA 8XIMA 3LHZA 1CGUA 5CSUA 4RDWA 1NDVA 3SY5A 3V0TA 1I1XA 3T2PA 1BKHA 1N82A 1R3SA 3OIXA 4IIDA 2BHYA 3HMCA 3GR8A 1AG1O 1L8PA 1TJ1A 3AU6A 1JFXA 2J7HA 3FA3A 4F9JA 2C0HA 2XISA 4EF8A 1V3KA 4U28A 3AUJA 1XRSA 1Q45A 2GDUA 3RM4A 5DRCA 1IXQA 3T4WA 3FXGA 4FMVA 5CPTA 5A6SA 4AY7A 2H9AB 3R4IA 5HOSA 2WV8A 3H53A 2O9TA 3C8NA 3BW3A 4GNVA 3F5JA 4MSSA 4A8RA 4UTIA 1OGSA 3GW0A 1MQRA 4WDWA 2ZX6A 2ICSA 1ME9A 4JQ3A 3S8HA 3H2OA 3EDEA 1HP4A 3BLFA 4LU0A 2OOFA 4L4LA 4O12A 2J24A 2XIIA 2X09A 1M5WA 3GZ3A 3TYZA 2A7NA 4DO5A 1KM4A 4Q8QA 3VTRA 3CB8A 5E6ZA 1PO9A 2PC8A 2TMDA 1DKWA 5FEZA 3BAKA 1JAKA 4UQ9A 1SGJA 2ACSA 3TQKA 2YB1A 3FYPA 4JS3A 1V3IA 4FP1A 3N11A 4DJFC 3L2IA 3NXLA 3PC0A 4FR6A 2VELA 2BDQA 2D0GA 3UQNA 2BGSA 3GYCA 2X2GA 4MJ4A 3GIYA 3PWAA 4J2MA 3MPGA 5T91A 1OF6A 3UEQA 3ZXWA 3BLIA 1Q8JA 1XUUA 1UD5A 4CVWA 3GHUA 4N2YA 4S38A 3JUGA 1MFVA 1K8ZA 1O68A 3R0UA 2YKKA 4QJ5B 3P5YA 4RZ6A 4KQNA 4CD7A 2Y5SA 2YFOA 4H2HA 5D9OA 1EPXA 3IVSA 4GNJA 3LMZA 3OO2A 1Q6EA 5I00A 1NDYA 4KKXA 1OVDA 1RJPA 4JIPA 1B54A 4XKYB 9XIAA 2CLPA 5LA0A 3HBLA 2WJDA 1O60A 1BLIA 4D6GA 3GNPA 3EB4A 2PDLA 3BSHA 4Q8VA 4G9PA 4XG1A 3MT1A 1ITCA 3T07A 1IEVA 4NQ1A 1MDRA 1ML1A 2UY4A 1QNVA 1F73A 1JVNA 4L5ZA 5H6HA 3TCEA 2DORA 4CU7A 4WY0A 4UUIA 3GG7A 1W3JA 4OIFA 1G4SA 3S5SA 1HL2A 2BMBA 1GORA 4AC1X 4REQA 3M1ZA 5F4WA 3TCSA 3EX4A 5D38A 4IPNB 1DBTA 1XUZA 5CG7A 1EC9A 3TNBA 3K13A 2ZZ2A 5LIKX 4IGNA 3IV8A 3BL3A 1XC4A 3A4WA 4C6EA 2OYKA 1FH7A 3CL6A 4O14A 1FDJA 4ZB5A 4Q4KA 4HPJA 3SN0A 1XLDA 4ADSA 3SCPA 3KXQA 4A29A 2V9DA 4S3AA 5ABTA 2G95A 4LY4A 5D04C 5CSSA 1E0VA 2NLYA 1G69A 2PLCA 2ABBA 2QF7A 4IFKB 1MZHA 2Q09A 4E2OA 5LXXA 2Z7GA 4UNLA 1ZTVA 1WCGA 2FGZA 1BTCA 1VYSX 3NAVA 3VZXA 4UR7A 2FVLA 4OQVA 1PTGA 1W8SA 4IXXA 2W66A 2ZRXA 1QR7A 4OJYA 3VNIA 3CJPA 3GX9A 4E8DA 4CD4A 4AWEA 3H22A 1JIBA 1PDZA 3WLJA 3TLQA 4FPSA 2HK0A 1OCNA 3DERA 3OZOA 4KRZA 3NO3A 4GVIA 1WXZA 2NV1A 4C1NB 4ZENA 1R3WA 5U7SA 5C9XA 4WJ8A 3OIHA 1FQ0A 4TOQA 3CK5A 4XVEA 3T1GA 3VOHA 4J3WA 1IF2A 5G2IA 3HMJG 3WEMA 1NFPA 3PBMA 1SW7A 4R53A 4TMBA 1W1PA 1JD9A 1TCMA 3KTSA 3WEZA 2E3ZA 1AD1A 2HNHA 1DJZA 1DOSA 5FF7A 1EUAA 2HNEA 3QYQA 3NQDA 2GQ3A 3QHNA 2OSYA 3RRAA 3NFUA 2BB0A 4PMVA 2C16A 4JTUA 3TN4A 3BK0A 1UJQA 2DZVA 3O8AA 4AZ6A 1DIEA 4Z42C 4S3CA 1V6WA 3NM3A 4QROA 5CPNA 1IT8A 1TJ2A 3QJAA 4CN4A 5C70A 4V33A 3NSXA 1ADSA 3HQPA 1FFQA 2Q71A 3WF3A 2NWSA 1ZY9A 2WANA 1EXBA 4GI8A 1GVRA 2VZSA 5LNSA 3HG2A 4QM1A 1XD0A 1L6GA 1CCWB 2GJNA 2VDIA 3PP7A 4KERA 1MW0A 3TN6A 4JQ2A 2XVLA 4BCEA 4DUVA 2NX1A 3UVAA 4AIBA 1MZRA 2ZUVA 4GQQA 3PNZA 1KO0A 4Q8OA 1YMYA 3KW3A 3IJ7A 5BU6A 4CNOA 3BGGA 1FWDC 3C3UA 1C9WA 1KBJA 2BP1A 3PAOA 3LEPA 1IZJA 4CQ8A 1RJRA 3R12A 4ZFCA 3B8WA 2ZZ7A 3GVQA 3VCCA 5DY3A 4ZXOA 3JR2A 4J3VA 1VKFA 3BUVA 3SAZA 1R47A 1WDPA 5G2WA 3H2FA 2CLOA 3C2OA 4DUOA 3LYEA 3MUCA 3W1AA 5TAOA 3GVWA 1TV3A 2UV8G 4DJEC 2W27A 4XZBA 4EPEC 1A0CA 4F0HA 1QK2A 3B0XA 1XIDA 4M6VA 3WUFA 1O94A 3W28A 1JFHA 5DT7A 3SSJA 3B0PA 5BXRA 2ZBTA 1F61A 1EYEA 1KBIA 2DUAA 5CZ0A 3WUBA 4ADTA 3LLFA 1UP3A 2R1KA 4AIUA 2O7SA 2XWEA 4D6DA 2CYGA 2V5BA 1N8FA 1J0IA 4C60A 4KMQA 2VGBA 5HINA 4QSHA 3GK0A 3N4EA 2YOCA 1TWWA 2VC9A 2J7GA 3WLPA 5LZLA 3RR1A 1YPFA 4Y6GA 1R85A 3BZGA 4N6EA 3WH9A 1GNXA 4DB7A 3G0SA 1BD0A 1GQKA 3ALFA 1XIGA 2MANA 4HCDA 2BXZA 1B9ZA 2Z2AA 2FHBA 5DEZA 1EJRC 2F84A 4O28A 4LW7A 3JU2A 4H6RA 4UTFA 3QOMA 5BZAA 5T9CE 4O54A 4D6CA 4DWSC 4LX4A 1G01A 3WYZA 4X0VA 4EVZA 2IKIA 1VIWA 4S2BA 3B0VC 1US0A 3U2EA 1OD0A 2Z1SA 4PCNA 3W87A 3NYDA 4DEFA 1R3YA 2TSYA 4Y9PA 2H8XA 4Q4SA 1JGMA 2XM2A 2NUXA 3ARPA 5GJNA 3QR3A 4HPNA 2WPBA 4ZO9A 3KWXA 4OT7A 3G6LA 4HYVA 1ZJIA 3V4BA 1GVFA 1ZGDA 2P0OA 4UTLA 4FB7A 3GH5A 3CEUA 4PCSA 2C7FA 1HL8A 4H04A 5K9CA 1HTIA 4HNOA 2PDXA 1RK6A 2VO5A 1NDZA 2DZTA 1NIUA 4JTRA 3TU9A 2WO5A 3QY7A 3WQ8A 3C4UA 4WKFA 1R7AA 4YWSA 4ZO7A 2XIQA 1XGEA 3PG8A 4OGZA 1D3HA 3B9NA 3OVQA 2VR5A 1XGZA 1WPCA 2EPNA 1HP5A 3H7RA 1W2PA 2G5WA 2H3BA 4NNCA 3AXKA 1XWYA 3MUIA 3WLRA 4AZGA 4E0CA 2PE4A 1V93A 1RSCA 1Z7AA 3VNLA 3W7GA 3HPZA 3RAOA 4BK9A 4J3SA 1N8IA 3UU0A 3WL1A 2CLLA 3QV9A 4OECA 4XD4A 4KETA 3S1UA 4B5SA 3TR9A 1U5JA 1B5TA 3UR5A 1GT8A 4M6QA 1A5KC 4MB5A 3VE9A 3SDOA 5MKGB 3EX3A 4JYEA 5HMEA 1NF0A 3K30A 1SFLA 2XFWA 3GXNA 2VXNA 3VINA 1EBGA 4O10A 1DL3A 3L4UA 1THFD 3DFYA 3CAWA 1IZKA 1SJDA 1R2RA 3GVGA 2GUBA 4BF5A 2OT1A 4ZQMA 2HPIA 1TX0A 4GZJA 1OX6A 1E6NA 2VC7A 5LIXX 3R8GA 4M7TA 4QG9A 2GSHA 2OZ8A 4K8GA 2E25A 4XWUA 2WAGA 3GC5A 1PB0A 3DBPA 4C91A 3UXAA 1VBRA 3ZJ6A 2V5JA 3GTFA 1XYCA 3N19B 3D3FA 3RGTA 3GVRA 3D3AA 2CZ5A 3T0BA 3SI9A 5FOOA 4Z1DA 3DUGA 1Z69A 1XCFA 2OKTA 3OBEA 5CLTA 3W7OA 1CLXA 3H2CA 1Z6KA 1J0KA 5T26A 1CENA 3O7UA 1MUWA 3M16A 1YIXA 4WGHA 1YDOA 5D8ZA 4QFUA 1JPKA 2O9RA 4P7RA 1M3UA 1T5AA 4JNMA 1WV2A 4AEEA 1MW2A 4Q8NA 3OLIA 4KEUA 4WXZA 4XZLX 4QAIA 3DX5A 1AH4A 3O07A 3SCRA 3VDHA 4DJED 4O4WA 4MUZA 2C0AA 3CT7A 1F3EA 2Y62A 1S2WA 1F6KA 4UTTC 4D8AA 4POCA 3S1GA 4NZ1A 2TYSA 1JZ4A 4HHMA 2ZZ6A 3THCA 3TTOA 4IMFA 2FZDA 5CZJA 3R1ZA 1UPMB 3QEZA 1XC6A 1W6TA 1YNYA 3ES7A 3C0QA 1YDVA 4R5EA 3W7MA 3GXTA 3CT2A 4UMBA 1NWTA 1W8GA 4IMGA 3MI3A 4W89A 1YRRA 4RNJA 4IPPA 3M0XA 3GIQA 4QXIA 1S46A 1FWCC 4FI4A 1EJWC 1VEMA 2XPKA 5K4XA 4UCFA 4BEUA 3C0LA 2R1PA 3CL8A 3AHXA 5AC7A 1CLVA 4E2DA 4GE8A 4K36A 3R8RA 1WDWA 2A85A 4C6OA 1DP0A 2V5LA 2QV4A 4YTRA 2GSJA 3E49A 5JQ9A 1HO4A 1H0GA 3PB0A 4PUEA 5DMMA 4PB3A 1IT7A 3BTNA 1PE1A 3D46A 4YJ5A 3WLSA 1Q6DA 3S2LA 2O7QA 1DYSA 4Y96A 5TBOA 2MUCA 2WQPA 1IEWA 5A6BA 2G50A 3IWPA 4BWLA 4K1WA 2QEZA 3CTTA 3W1PA 1Y0EA 3QFEA 4DWSD 3ZVHB 4WX2A 1QOPA 3RX2A 3K1GA 4JX6A 4A3YA 7A3HA 3LI1A 4M1RA 2I9EA 5D4YA 3LCFA 1GVQA 1D7FA 4MF4A 2WZMA 4A05A 1RVKA 1W3KA 2QGHA 4KEMA 4AZIA 4LBSA 1DXEA 1RZMA 1QK0A 4NSBA 3M5YA 1J4EA 2NT1A 4H01A 3O63A 3KRBA 5BNKA 2XN1A 3G1DA 3LU2A 3KZPA 5LIUX 2PDWA 4LCRA 1R0MA 1AK5A 1V02A 4MM1A 4LBRA 4L61A 1L2QA 3W7LA 3VOJA 3OP2A 4AAJA 3PS7A 4JOMA 3CIVA 3IRSA 1R2TA 1UWRA 1I4NA 4FS9A 4JDBA 4XZHA 3GFXA 2DQXA 2PDGA 4XIMA 4O1AA 4JAWA 1FWAC 3TP4A 3WD3A 1C7SA 1JYWA 1E1CA 2YDSA 3SJ3A 4FOKA 3QPYA 4RJEA 3B9OA 1EOMA 2VMFA 2QLYA 2QCDA 4XISA 1TMHA 1YBQA 2YGYA 2OWCA 3WBYA 4MAVA 1K9DA 1ONRA 1TRDA 4DWSB 2D3NA 1BG4A 2HVMA 1A5BA 2GZXA 1CWYA 3LLDA 1WBHA 1UW9A 4HTYA 1OQFA 5F2IA 4IFOA 3MBDA 3ONBA 1WYIA 3NM1A 3THQA 3OZPA 2VDHA 1KRBC 1CXHA 3UR2A 1XISA 1A5MC 2X0SA 3PBUA 3ZQ9A 1UR1A 4GGHA 4JFSA 1TYGA 1X1OA 1W54A 3NQMA 1TPVA 4EIVA 1EP1A 4IL2A 1SQ7A 5KZMA 3PTDA 5GJPA 3V36A 3FA4A 3W2JA 4N0RA 3LCXA 4GZIA 1F6PA 1VJIA 3LS9A 4L4MA 1YHTA 4JPGA 3ZLGA 3GNNA 3MWAA 1TSIA 3M64A 1W91A 4UFKA 2V2DA 5LYRA 4IIFA 3MBFA 5G4WA 5JH2A 3DAQA 3W2KA 3WLLA 3MP4A 4PUDA 2BZNA 2IUZA 3DESA 3B0UX 3AIQA 4LCQA 1Z3NA 2OYLA 1QOQA 3HO8A 1AVAA 1UWQA 3BQ6A 1XBYA 4GVHA 3W2UA 3ZT6A 4KEZA 1DVJA 4O0KA 4JD4A 3ELFA 3UWVA 3WDQA 3MMUA 3GNRA 3UF9A 2PGRA 5L6UA 1LZOA 2NQHA 2R82A 4P7NA 2ZRWA 2R1NA 4GYKA 4L65A 1FKWA 1NOFA 2C71A 1TV8A 3OA3A 4QEHA 3T42A 4YLWA 3ZJ8A 1HKJA 3NQ2A 2ZXAA 5EMLA 1VR6A 5HBFA 1K8CA 1BYCA 4B3KA 4KGJA 2FVMA 3WH6A 1H61A 2Q3RA 5A8MA 4E4UA 2PDQA 4C6CA 4BR1A 3VGGA 1FTXA 3NL3A 2WNQA 2PCQA 4EXAA 2VGGA 4ZOCA 4NJGA 3VNMA 2J7BA 3MMTA 3V7PA 1Q8AA 4A22A 4H9VA 2IS7A 2J7EA 2FFIA 2VZUA 4F3HA 2ISSA 1E4IA 3BWWA 3IIVA 4KPLA 3P0WA 3TAKA 5TF0A 4GJ1A 1J18A 2IKGA 3E0VA 3RX3A 1JDCA 4QE1A 1S5WA 1WDQA 2WHMA 1RCXB 3PPFA 1TV7A 2X1RA 3L66A 2GGJA 3CUHA 5F1UA 4YTTA 4NJKA 3WEOA 4DF0A 4Q8TA 3AZTA 3MSDA 3BSGA 1ZAIA 3LQGA 3GR7A 4JTLA 3PN8A 1FUYA 3HB9A 3EMZA 3UR8A 5D03A 4MWAC 4WLCA 3IGHX 4YYCA 1EJ7L 1RPKA 3ZWTA 1AH0A 3C8FA 2PTWA 1S5NA 4CGTA 3JZEA 4RNFA 5HULA 3F5LA 3QHOA 1ICSA 3KOXA 1FCUA 4TQTA 5A6JA 2PLKA 2VENA 3S1XA 1W1ZA 4C6LA 2YCJA 1C92A 1TV4A 3FOKA 2V69A 4K8EA 2VGFA 3RU6A 1MQQA 3GDBA 3FHAA 1ZHAA 2OJPA 3ARQA 3DC0A 4US6A 3MO4A 1FWGC 2I17A 5AECA 4Z1YA 2VCBA 4F2BA 2BGNE 3TLLA 4DJDC 2ZRZA 1K7FA 4GJIA 4JIHA 4OFCA 2C79A 4AZHA 1JNDA 1XDLA 3BOXA 4FNPA 4H2CA 3COTA 3DG7A 1V3LA 4XO6A 3N2TA 5AY7A 5D9NA 4PSPA 4C7FA 1XIMA 2JE8A 2CLEA 1YQ2A 5I3DA 1B3YA 3RRXA 3L4TA 2WJFA 1QO2A 2D69A 1LYXA 3MJYA 4TMCA 4Q8MA 3RO8A 1EC8A 1IZCA 3NQ6A 4RLIA 4WUIA 3TZNA 2OLAA 3QGVA 2WHKA 4AU0A 2FB2A 4J2PA 3ENLA 3RLHA 2GVEA 3O9NA 1K9EA 3R0KA 4RCXA 1E4MM 4X63A 2PDCA 3EKGA 1XQKA 1GQLA 2P8CA 2R6OA 3TW9A 4KIRA 4O16A 1GTEA 5JIWA 5I77A 2BV9A 1E0UA 4DYKA 2ZX8A 3O16A 3EXSA 5CCZA 1FHUA 3CC1A 4AY1A 2WSYA 3CH9A 3UVIA 4ZO8A 3N17A 1HKWA 3LHTA 2QJMA 4HZ7A 4NKCA 2BWGA 3N3MA 2CPUA 3BURA 4GYPC 2ESCA 2I7GA 4XKMA 3HF3A 2AQVA 4ACZA 2Z7KA 1XS2A 4MZ8A 1QXLA 3A3XA 4A8NA 2G97A 5CZTA 2XUCA 3UT0A 3TK7A 3ZR6A 3NZPA 1ITUA 1EBHA 2BS9A 1OGBA 5KSWA 2OMAA 1BGAA 3WBXA 3I10A 4UTWC 1GZJA 2Y85A 3FAWA 3GE7A 3N13A 1KXVA 3VAVA 2OQLA 4X2RA 1UR8A 4N42A 1E55A 5BMXA 3KP0A 5HNRA 4JN8A 4LAMA 1UR0A 1X38A 3RILA 4JHOA 1AL7A 4CN6A 2AL2B 3PUDA 1TIWA 4LS1A 3GNXA 1P0EA 1W5PA 3QW3A 2ZX5A 1GONA 6XIMA 3UXDA 3SUWA 2GVLA 4BQ5A 4GBUA 3BG3A 1FVPA 1LLWA 1UZ4A 4HYWA 4UFLA 1BGGA 3NL2A 1XH2A 2V0TA 3CS2A 2YCLA 2X41A 3W23A 2G3NA 1Q7ZA 3VIOA 2HVOA 1BHGA 3BJFA 1VCFA 3GDTA 1TG7A 5BOEA 3PZUA 2J9XA 4JZ5A 3WQDA 2PDMA 1VIZA 1OK4A 3OLGA 2YR1A 3EZ4A 3UCQA 4NIRA 2ZZ3A 3F2DA 3KL5A 5K3VA 1TQJA 1J79A 3PTMA 2I56A 1YNQA 4ZTYA 3S0CA 4LAZA 3WK1A 5G4EA 4IISA 3BC9A 3VCNA 3M7SA 1P43A 1EJTC 3WJWA 7REQA 2V63A 3P2VA 2YIHA 3SQMA 4JTIA 4G5DA 1UH4A 5AYBA 2REQA 3CQHA 1K7XA 1CNVA 1B4KA 2LLEA 3DFNA 1VFFA 2CEQA 3TYCA 1U33A 3PM6A 2Y8UA 3VNKA 3N9RA 2CKRA 4IG2B 4PUNA 3AU2A 3C2VA 1M7PA 2BY1A 2A5HA 2QVNA 3H4WA 3PUOA 4F9DA 3EWDA 4R9OA 1BRLA 3UJFA 4Q22A 2VFFA 3WMBA 1PYMA 1SU5A 4KCVA 1JAEA 4JICA 2PDIA 4MWAD 1HF6A 3PTQA 2PBGA 2WMJA 3GXDA 4Z0SA 2RDWA 2V5CA 1OWQA 5LNUA 4AZCB 5LIYX 1RBAA 3W83A 4DWDA 3KAOA 3BO9A 5A8GA 4A3QA 2DIJA 4HHHA 2DZSA 4DBEA 2DV0A 2VX6A 1JZ6A 4EWND 2A3LA 3MU7A 4LRTA 1W37A 1V77A 4U4MA 2XN0A 2DQWA 5CH9A 4KCTA 1J5SA 2PF8A 3G1RA 1LL4A 5ABHA 4HK6A 1A0DA 1TE1A 1XYMA 1NQ6A 3Q4DA 1EIXA 3AYSA 4P7QA 1SZGA 1G9HA 2DW7A 3M0KA 1H11A 4DN1A 3F7JA 3B9AA 4D6FA 3EWXA 1OSEA 4GUGA 4G7EB 3U7VA 2WB5A 5ECUA 5KETA 1RCQA 3VDGA 3ATYA 3UA4A 1VENA 4IQEA 2YA0A 4RPQA 1M65A 2BHZA 5C7HA 2CW6A 4R34A 3INPA 4MVAA 3ZLFA 1X39A 4EPKA 2CZEA 4EP8C 1ZBCA 2IMRA 4QLJA 1QTWA 4ICMA 2ZA3A 4JFVA 4ROQA 1IGSA 4C6QA 2J7DA 3BLOA 5FAGA 2CFFA 1PYFA 2OELA 2X2YA 1XLJA 4CNNA 1SZRA 2PWHA 4M51A 1IXPA 3RITA 1TWSA 3UZZA 3PANA 3UZYA 4AMCA 2G0WA 1UWTA 2HXTA 4MMWA 1HZYA 4F40A 4K2SA 3GDRA 3UWYA 2EQDA 4MY1A 2DVTA 3N2BA 5FSEC 1SFJA 3F5KA 1J9YA 5RUBA 2R94A 4IWWA 2PP3A 3TV8A 2A1YA 5C54A 4E5TA 4Q6JA 4W7UA 5CQ1A 1TB3A 1S5TA 5LKYA 1LRNA 2PP1A 4RR4A 2PEVA 1L6FA 1RJQA 3M0YA 2Q8XA 3IJ8A 1SO3A 1QW8A 3SUVA 4F79A 1T96A 3KOFA 4LFYA 4YN5A 1ZBKA 3VA8A 4QDMA 1HL9A 5D09A 1EGVA 1GG1A 1Y5WA 4J9JA 1XLHA 1UG6A 5FL0A 3QPZA 3UXIA 4TU1A 4HPHA 3WD2A 4M19A 4ZQPA 1X8FA 4W4QA 1WQ5A 1DJIA 1MEWA 1CPUA 3WJZA 3SCTA 1X6UA 3N34A 3RX4A 4LB3A 2QUVA 1EF3A 2E6AA 4EKJA 1DTNA 1MUMA 1W0MA 3GHRA 4H00A 1OCBA 2UZ9A 3GNDA 4OE7A 3W02A 4E8GA 1AD4A 1UB3A 5BOFA 4GACA 3S5ZA 5JH1A 3NDZA 4IFRA 4LAKA 1FWRA 1UWUA 3OA5A 5AVHA 1ZFJA 1SFSA 4ICCX 3W72A 1LDCA 5C6MA 3ARSA 3B03A 4C1LA 1NOUA 1JEZA 5JIPA 3W1UA 4PRRA 3WBEA 3Q65A 4EF9A 2IXUA 3VIJA 4ADUA 5ABGA 4FZIA 4QE5A 5I3HA 3CV2A 4WDUA 3TDFA 3KFTA 4NZFA 1RXOB 1FOBA 3U9IA 1FDYA 2C15A 3O05A 1J93A 4J28A 3WLMA 2WM1A 3LZ3A 3URQA 3USBA 3QC3A 4I9TA 5DELA 3S9ZA 3E5PA 4QRNA 1UA3A 3N4AA 1A53A 3DOPA 1X97A 2O56A 4BZYA 1K7EA 1HVXA 4DZ5A 3VUSA 1EPVA 1UD8A 3LM3A 3OHIA 2OSXA 4DXKA 4US5A 2YZRA 1R3VA 5FD0A 3W2LA 3EMQA 3NIYA 3AYTA 1AJ2A 4KBXA 4WDTA 2D2OA 4INFA 3RN6A 4QR6A 3VABA 1IEIA 3LA4A 2J27A 1G4EA 3B9EA 1IR1A 5EGRA 1T40A 1EA9C 5LNRA 4H4IA 4KH2A 3H7VA 3I68A 3GFYA 1T99A 3L7RA 4W7WA 3PZOA 2RGLA 3VMPA 4M80A 1WKEA 3CQJA 1LQ0A 3DGBA 2XSAA 1E1EA 4R7JA 4JFTA 1VFUA 3KVKA 1EHAA 4K38A 4ONVA 3TN3A 1EXPA 3VIPA 3WKZA 1AZ2A 1MNZA 1PXGA 3PWIA 3UCDA 9RUBA 3GC4A 4GC4A 3L2MA 1VCGA 2E09A 4JX4A 5FJIA 5I79A 2VNCA 2Z1WA 4CD8A 3TJ4A 3R79A 1KNWA 3UESA 2NSXA 2HE5A 3REQB 4ZSTA 3C0JA 1OX5A 2GJLA 2QJIA 3ARRA 1G94A 1J0JA 2I9UA 3MUXA 1UIPA 3ARTA 3GM8A 3EDJA 4R3UA 3KOWA 4V28A 1IYXA 1WE5A 4LEFA 4IMAA 1KQYA 1SZNA 4DQWA 3T08A 3Q37A 3I3DA 5I3IA 1J11A 1VP5A 1VLWA 4J40A 3CIWA 4DUXA 4HVXA 5CPMA 2IKJA 1JI1A 3UWWA 1UWIA 1W1VA 3N18A 4JYFA 3QLDA 1P6WA 4GNKB 2R1MA 2VFEA 3VGDA 3W9ZA 2P3ZA 4LYKA 5A8PA 5HQLA 2VI0A 3M44A 4FX8A 5F4XA 3QQ0A 3JZUA 3N25A 3P8JA 2J79A 4ZE5A 1IIGA 1HJVA 1KV5A 3LTYA 1JCXA 4YHGA 4PCFA 3NZGA 1KFCA 2NSOA 3ZM8A 3WDJA 5HWJA 1EJUC 1W5QA 3HG5A 3U48A 3VD5A 3SRFA 5GJMA 2XZ9A 4OUEA 4DF2A 4M6PA 3WLKX 1QPRA 1HIZA 1TJPA 1U30A 4O8RA 3THUA 2PLMA 3V3WA 2Q02A 2XSXA 4LRSA 2BY2A 3SCOA 4PMRA 3VGFA 2RJHA 2G4FA 3A4AA 2XHYA 4D6EA 3CO8A 1GZGA 4NP7A 3HIJA 5CKSA 5I24A 2CERA 2WZIA 2GGIA 3M6YA 5K9DA 1MI3A 3HG4A 4HZ6A 3T0AA 4JIIX 3IJIA 4PTXA 5CPSA 4O19A 2P50A 1BQCA 2ZVRA 4LS2A 1E5JA 2ONEA 3BJSA 5I3FA 3L4ZA 3L4YA 3PG9A 1XIIA 1CGXA 4MLRA 1TV2A 2O9OA 1X8CA 1RCOB 2E40A 3UGVA 4TX9A 3N04A 4R27A 4WY0F 3IGSA 3AMCA 4F0LA 1YADA 1HGWA 4CQAA 3VNZA 2RHGA 3KCLA 3Q58A 2PRHA 4HMDA 3A4JA 3KTCA 3KDOA 3W1NA 2ZUMA 3DHDA 3KBJA 4O1CA 5HJXA 4GIYA 4Z2KA 3WNOA 1H62A 2WPGA 3BJTA 4FNRA 3N3TA 4JYDA 2GVJA 4LUTA 2XVPA 3S2CA 2P76A 3GDMA 4WOQA 2GUUA 1ISVA 6TAAA 3B8VA 1OZQA 3P8IA 4A3UA 2E1DA 1LLZA 3DN5A 2FZBA 2V5KA 3VD9A 1ICPA 3CB3A 3GKFA 1UZ1A 2X42A 1XKYA 5I78A 5MF5A 2F6KA 3NOEA 1KB3A 2AGKA 4NRSA 3WJXA 5HNTA 3NSMA 2QNEA 4F48A 1DIOA 3B4UA 1RH9A 3FSTA 2NQZA 1ZSXA 2HV5A 5FSDC 5LSMA 3UWEA 1B90A 3QKZA 2JF7A 3AIUA 3UXLA 3WLOA 4GI6A 4V1XA 4B2DA 3L5AA 4HA3A 4ZXLA 2VVNA 3HPSA 3KUMA 4O1FA 3SUTA 4PMDA 3V1PA 4TV6A 4XUYA 1XKJA 1ZU8A 3D6NA 3FSUA 1E5NA 3WO8A 1DPMA 3LCHA 3WMLA 3C5QA 3CZGA 1Z8AA 1Z42A 2X05A 1GYLA 2EPLX 4LVGA 3DFQA 4ASTA 1E4LA 4WY0B 4XVDA 2I1OA 4AYSA 1V02E 1WKDA 2INZA 1QNPA 1V03A 2WMHA 4Q4QA 1PJ9A 2VX5A 1CXKA 4LANA 3S2NA 4PULA 3W86A 1MXDA 1OG0A 3QHMA 2DT3A 2DSUA 1F3WA 5DRIA 1FXQA 4N4QA 1X1NA 2YCKX 5FESA 3KCOA 1K8YA 1A47A 5D9MA 1UBPC 5HPOA 2BG5A 2VWTA 3G1SA 2PPGA 5C8BB 1K77A 3I3BA 4Q8PA 2XFFA 2AOSA 1MYRA 2XGZA 4H8NA 3L4WA 2X30A 1W1YA 2QUTA 4AF0B 1TPC1 3IS4A 1RBOB 4HZ8A 1Q2SA 1VJZA 5C2GA 5AHMA 3G1XA 4Z1BA 3Q45A 3R7MA 4L1GA 3VIIA 1ZJBA 4AVFA 1IEXA 2F8QA 3ITVA 4L4OA 2IQTA 4GISA 3SCWA 2YBVA 4PZVA 3EA3A 4Q4RA 3F4VA 4X9SA 5BU9A 1RUSA 1QFEA 1B1YA 1NP2A 1SFTA 3H21A 5AKQA 1PAMA 3NPVA 3LPOA 1A5CA 2J25A 3VGHA 1GQJA 4DBSA 1GW9A 4J5NA 3BMXA 3JVAA 3PPGA 2GQ8A 4G1NA 1WUFA 1FX6A 1M53A 4R7WA 1XSIA 4MZ1A 1JDAA 4HTBA 3NVDA 3OGVA 3N73A 3C2RA 4BI7A 2RH9A 3CWHA 1MRQA 4M81A 3W73A 5KZEA 1UQZA 1BPLB 4GA8A 3NXFA 3DIPA 4I5XA 3LUTA 1M7OA 2B31A 3QOKA 4ZBCA 1NF7A 3HA1A 1HX0A 1OZMA 1UA7A 4TR9A 2OZTA 4N4PA 1PPIA 3M4HA 1U22A 1ZB5A 2HS8A 3HG3A 1O5KA 1VRDA 1H2JA 3KL3A 1BKSA 2V3GA 4ALDA 3IAQA 4GUHA 4WSKA 4CCEA 3QR1A 4JTQA 3WQGA 3IV3A 4QCEA 1WOBA 4CCZA 3ARXA 3WCZA 1TWIA 2Y0FA 3SO7A 2E68A 4JTKA 3ZT7A 1Y5VA 3AUOA 4R7OA 2V67A 1G0CA 4CCCA 4ZVJA 5B7YA 1EHNA 3F1QA 4AWSA 4ES4A 1EYWA 2Y7EA 2EXOA 1W2VA 2J75A 3ERPA 5BRPA 1L9WA 3OEXA 1NEYA 1FCQA 3ZO9A 1KGWA 3MDUA 3CPUA 4F0MA 5I3JA 4PEEA 3NWRA 3E2QA 3GXFA 5KZDA 5C55A 4AVOA 3TSBA 3AMGA 2C18A 4C90A 1DHKA 3UZ5A 3R6IA 4EWJA 2YBTA 4GWEA 2RDUA 5C2CA 3KS5A 5M17A 1GK8A 3O6CA 2QUUA 3TROA 3ZFHA 1CX9A 1YTEA 2BVWA 4LV4A 1Q63A 1I0DA 3WF1A 4D6JA 1XSJA 3VDBA 1EH9A 1L0PA 4CCDA 3HN3A 2QGYA 3I4EA 4NZ3A 4D8ZA 3UETA 3BGJA 5A95A 1CI1A 1SW0A 4OUIA 3GU1A 3CAVA 4M56A 3W88A 3FJ6A 1KRAC 3JRKA 4NAEA 1F4HA 4K1GA 1NSJA 4Z1CA 2GK1A 3E3HA 1CGTA 3WMCA 4PMYA 2ZA2A 2GGGA 2CBVA 4DF1A 4UQAA 5REQB 1B3XA 1AZ1A 2CLFA 4GCXA 4K8HA 2F9RA 5BROA 2X1SA 2WVUA 3TSDA 1H1NA 3KHDA 1WKYA 3WL0A 1VBUA 1PX4A 2EG8A 3GTNA 1E56A 4U33A 1M41A 3HJZA 2PURA 4WOZA 4HNUA 2UY3A 5A69A 1V7YA 2J4GA 2VEKA 2FMNA 2E28A 5FF4A 4OBRA 3V35A 3URAA 4TVUA 2Y5JA 4B3ZA 1HFBA 4LF2A 3TQVA 3DI0A 4FHAA 4AY8A 4N7QA 3F03K 2XYLA 3CQ0A 5DQPA 1GOQA 1H09A 3UCCA 4WF7A 4XD6A 3R10A 3TYEA 2QZRA 2DP3A 4GY0A 1V0NA 1E70M 3GBDA 4JXCA 4C6NA 3T0CA 2IPFA 2PDUA 1LP6A 1F7BA 2ODOA 4LXFA 2PU1A 3IPWA 3T81A 5EY5A 2QAFA 1OY0A 4HN4A 2JFEX 1GVSA 2Z4GA 3PBVA 4AD0A 4UZUA 2YPIA 3CHFA 3SJNA 4BFAA 4GVGA 1UWSA 4Q8UA 2ON3A 5HXMA 3DFSA 1DWJM 1P4CA 4D1IA 1X6LA 1ZPTA 4P8UA 3GB6A 5IRPA 4FX7A 4QP0A 4IFKA 2QMKA 1AQHA 3O1NA 4E38A 2NQJA 2YLLA 1IT0A 1NH6A 2FH8A 2XTKA 3BSMA 3OVGA 1TJRA 1XDJA 1A5OC 1V8EA 3DG3A 2J7CA 4QSFA 2QPUA 1D3GA 4BI5A 1PV8A 3B8DA 3BPWA 4XZNX 4D9PA 1VPQA 1BSLA 3E9AA 3E5BA 3FIGA 1O5XA 5AOUA 5KMYA 1F8IA 2DJLA 1T6MA 3CLWA 4MY9A 4WJEA 1DQUA 1M03A 3CAKA 4CD5A 5C9RA 2Z0IA 3AHYA 4H7ZA 3LRLA 4YIWA 3KDNA 2X1IA 3M47A 1W5MA 3CUIA 1IXNA 4O52A 5BXSA 4QTGA 3BV4A 3UW6A 4CUCA 1JL8A 4AD4A 1RLCL 4O13A 2EAWA 2QULA 3SQLA 5BWFA 3RJXA 3PNUA 4JTCA 4XX6A 1OG6A 4PMZA 5CBIA 6CGTA 3STCA 1JNEA 4YMZA 2PWDA 1WZMA 2C19A 3T0TA 3OLEA 3HV9A 2PTZA 1DWFM 4UQDA 1IE7C 4LVAA 5A2CA 4JFUA 1MMFA 4P8WA 3BMVA 3MKVA 4UC5A 2WKJA 6A3HA 1VGAA 1WX0A 2DVXA 3W7IA 3EDFA 2DUZA 4F2TA 2JGQA 3F4NA 1SR0A 2WMGA 2Q8ZA 4H19A 4UQBA 4YVXA 2RUSA 4Q32A 4IPLA 5DX7A 4UWMA 3FVDA 1YXDA 4NG3A 1XIBA 1W17A 4V15A 2NV2A 1UYQA 3W4RA 3AO0A 1ZCCA 5I23A 3B8IA 3N1AA 1EO7A 1XR2A 2ZYFA 3UPMA 2ZXBA 4ECLA 1XW8A 2NX9A 3FXYA 1LL7A 1LWIA 3N2CA 4LB4A 3W7NA 3H54A 1DV7A 1JQVA 3AJ7A 3WUGA 5HUPA 3RLUA 3P81A 1H51A 4YVPA 4PFHA 5A6BD 3FN9A 1B3VA 3VM7A 4FAMA 5HNNA 1J0YA 1GTHA 3W22A 3N4FA 5A8QA 1Z89A 1QMLA 2CIPA 4EX4A 2WVVA 4A21A 2YDQA 3Q94A 1B9BA 1M6JA 2A6NA 4KCUA 1ZBVA 3GG0A 3NGFA 4UFMA 3WF2A 4HT3A 1PKMA 4KWUA 1EX1A 3CU2A 3LSBA 2XINA 3RPTA 9CGTA 2PMQA 2PI6A 5FJRA 3GYEA 2WHLA 4GHRA 1XPGA 1ITQA 1QHPA 2O9PA 5E0FA 2V2HA 2CC0A 4AG0A 4NUWA 3FY1A 4NZ4A 3GWQA 5DLCA 3FJLA 1F6YA 4YVVA 4EPBC 3AAMA 4HYRA 3E96A 4KGLA 1UKPA 4XBSA 2WSKA 1U2YA 3VOCA 1F05A 2YL8A 4ZQOA 3LTPA 5LIWX 3W7KA 1F9CA 3T6CA 5ABFB 3C61A 4HA0A 1VB9A 1V3HA 2FJUB 3NL5A 1ZALA 1IGWA 3OBKA 2DY3A 3WD0A 3CZEA 4UNIA 3W81A 2QDHA 3EOLA 2DIKA 4C6IA 4Y9OA 4AZBA 1BVZA 2WHJA 4NHVA 1JXKA 2EPOA 1GOOA 1GQIA 3AI0A 1TREA 3CPGA 3LG3A 4OBTA 3DFHA 1QWKA 3UYIA 1FCBA 4AYGA 1UR9A 4S3GA 2VEFA 4FO4A 1CBGA 3W1TA 1NTHA 3S2JA 2B7OA 4HNNA 3W71A 4XSMA 1QPNA 2WMKA 5DCBA 3SCQA 4GUIA 2ISDA 3ITYA 3HFTA 4GG9A 2FFCA 3DBNA 4CD6A 4PSRA 3W25A 3CPRA 3OJGA 5BYWA 4Z2LA 1QO5A 1UKTA 2Z29A 1XLIA 3GTXA 1QOXA 3NPWA 4M5PA 1H63A 3QPEA 1XH0A 5KITA 4HU4A 5CZKA 5EA9A 3WDRA 1W9BM 4X22A 3V0UA 2GVYA 3UY7A 3TJIA 1OB0A 1GOMA 2PSNA 4WD0A 2HEJA 4XZ9A 5CEWA 1XM3A 3PZVA 4MY8A 1ENUA 4DPPA 6XIAA 1E1CB 2QPXA 5BCAA 3CUXA 4TIMA 4MDOA 1P0KA 5JBDA 3OTRA 3MUY1 2BLEA 5AYYA 5CLWA 1NARA 4C6KA 3SGZA 4OKDA 1YBQB 1R38A 3VM5A 2DSKA 1KTNA 2G41A 1TUFA 4DNHA 2E6DA 2UBPC 2YA2A 2QUMA 4PN2A 3V18A 3FAXA 3U7BA 1S39A 3QMTA 1XBVA 2FTYA 3C3NA 4IIEA 4XAZA 2GJPA 1C29A 1C7TA 4O18A 4RNHA 2VGIA 2OQYA 3EAUA 1JG9A 1V0MA 2A21A 4IF2A 1KCKA 3P5ZA 3CO4A 3V0SA 1JYXA 3RNDA 5CC5A 5IOBA 5BWAA 1YXCA 2AL1A 4EAYA 2CHOA 5M2FX 3W70A 3RMJA 3HFYA 2Q8LA 4ZEPA 1JJKA 4Y9NA 5GPRA 1H3GA 4RZ4A 3MSGA 2W0UA 3KS6A 4QBXA 2VVSA 4GBDA 4AX7A 3WK2A 7XIMA 1PZ2A 3EWBX 4EANA 3H8AA 4RE4A 2FTPA 3NQ8A 3TMQA 2OGYA 5GQBA 1LTDA 3THDA 4AZ7A 3T44A 5E0CA 3W7CA 2E1WA 1HW6A 1W56A 3MI6A 4PBEA 4HD5A 1HNYA 3QR0A 3RR4A 3UYCA 2C1GA 2GVGA 5KINA 3G24A 1QDSA 3BCDA 3TSMA 3PAJA 1OIMA 1P48A 4BF7A 1DEDA 1MXGA 2X7VA 1FP8A 1DWHM 4F4RA 2VD8A 4LUIA 1GPFA 3ATZA 3EWZA 3B8SA 3UJRA 3I6EA 1IV8A 2NXIA 5CC6A 3BAXA 4WKAA 2WVSA 1SZEA 3EX6A 2PWVA 1AUSL 5A6LA 4B5XA 3PFMA 4B4FA 3ZWSA 3T05A 1W9VA 3QQWA 2ZVIA 4DVOA 1PX8A 3UG8A 3SUSA 1I8JA 3RYSA 4QQ3A 1KR0A 3AZSA 3OVRA 4QGCA 2PZNA 1XG4A 1I45A 3W82A 2GUYA 3W37A 4ZMGA 4I9JA 3WH8A 5HANA 4TTGA 5H1WA 1KTBA 1S2UA 1DTUA 3OLDA 5CAHA 3TTSA 4O4VA 4X0NA 3TYDA 4MHBA 1WUEA 4HPGA 5E9XA 5E6YA 4ZFMA 3VZYA 3HOJA 3B3DA 3K8MA 4M7SA 1EX5A 2OFJA 4IXHA 1VC4A 3N9SA 4LQ1A 4BA0A 5AHIA 3TIMA 3P61A 4PBFA 1K9TA 1H7WA 3GNOA 4DM1A 5C9ZA 2ZQ0A 2PGEA 4S3JA 1Q65A 3ZVHA 4B16A 3VOGA 3UPWA 2XVGA 3P14A 2PDNA 2BX7A 2QAPA 1KC7A 2UY5A 3WNLA 1SJCA 1B3WA 1C3FA 1IR2A 4NY2A 3WQFA 1UH3A 3QZAA 1V08A 1XPYA 3C2YA 2CU0A 3K5XA 2DZWA 1R3RA 2QPSA 1OFAA 1OF8A 3UG5A 4Z2IA 3WLTA 4U2YA 2XGIA 4RNIA 4JIQA 1FFRA 4H1ZA 3RG6A 4RDZA 2WMIB 3G8EA 5CC3A 3AICA 4E3TA 3WX7A 7ODCA 4Q3MA 2C3ZA 1D8WA 1W1B1 2ZUTA 3MCMA 4FIRA 1MW1A 3OZMA 5IBXA 4Q4OA 2BXYA 1GYMA 4S23A 1X96A 2DSWA 3CZKA 4ORIA 7ENLA 1JZ5A 1GKPA 5I3GA 3E02A 1A80A 4AHPA 1O6IA 1Y65A 1B30A 3ZT5A 1V6UA 3SIZA 3ITTA 4EAMA 1TPEA 4TTUA 4KRUA 5JXQA 3LBCA 3GU9A 4KWWA 4NYUA 2Y1HA 4L6HA 4WKHA 4UOZA 3DCPA 5HMSA 3LRMA 2FLIA 2J8GA 1ZQ5A 5FEPA 3SCNA 1VCVA 4E4PA 3IJ6A 1U1HA 1QI5A 3NQAA 4ACZB 4AC7C 5LHFA 1BAGA 3EEZA 2DEPA 3CNYA 1YE4A 4JFWA 3KLKA 4H41A 1KFBA 1CEOA 3R25A 3PJXA 1A3XA 2ZZ1A 2GSEA 3HQOA 4IP5A 5DFAA 2A4AA 4MNJA 4BS0A 1S2AA 3A13A 2OODA 2OZ3A 3VIFA 2NXGA 2I5QA 1F76A 3VMNA 2VHLA 4H7CA 1O5RA 3WLNA 2G3FA 1KLZA 4G1KA 3O6YX 4IMDA 4H83A 3DKJA 1LM1A 2NV9A 5DBTA 3KRZA 1V4YA 3A23A 3WQ6A 2DPEA 1HUVA 1NQKA 2F61A 1CGWA 3MB9A 2F7FA 2I5IA 3ES8A 3UA3A 2MNRA 1WDRA 3E74A 1UUMA 1R5YA 4GUFA 7TAAA 4G2DA 3G1AA 3NCOA 3PJWA 2XFYA 3RO6A 2Z1XA 2PU0A 4Q6XA 2DDXA 4K7VA 3IVTA 4ZQCA 2EKGA 1L8NA 5DBUA 3DECA 4B15A 3UFYA 1TA3A 4IPJA 1K4GA 5E1QA 3BW2A 3W85A 4IQDA 2EBNA 2V3DA 3RLGA 4NJIA 5LNWA 1ZL1A 5I02A 3SRKA 4JY8A 1KGXA 1OCQA 4AEOA 4JKLA 1MO0A 3GW3A 3QZ6A 3UERA 4W7VA 3N12A 1FWHC 3CL7A 1YPIA 3P62A 1UH2A 3NTYA 7REQB 3LOTA 4G6CA 1FWTA 3QTGA 1UP0A 1I1WA 2REQB 1ISXA 1C9DA 5AVNA 4S3EA 2PDKA 3RPMA 3N9KA 4F66A 4IJCA 5I03A 1NWRA 3MSRA 1MUCA 3A4XA 3TR2A 2E8ZA 4DZIA 3RPDA 2TPSA 5TD4A 3EWCA 1QJWA 3KVJA 2V3FA 2QYGA 1PVNA 1SUXA 1VEOA 4KEVA 4N6FA 5H8MA 1OC5A 1X98A 3QY6A 1ZUAX 3P84A 4UMAA 1HN1A 1BRLB 3N6JA 1QPQA 2W79A 4H6EA 1BG9A 4JQ4A 3M9YA 2TAAA 5H8UA 1FH9A 3ALGA 1H7RA 3HQNA 2WSRA 1DJQA 3FGCB 3AWNA 3TE9A 2Z2BA 2V81A 2JALA 4IIHA 3TTYA 1F07A 1J01A 1CB2A 4MKVA 4XZWA 2YXOA 1Q6QA 5FACA 4ICNA 3OQ8A 3KBVA 3LMYA 3AXIA 2WQDA 1CXEA 5FF2A 2VQUA 3E2RA 4O53A 4DJFD 4OZOA 2DGAA 2ATMA 5C9UA 2PDYA 3A64A 4JTAA 3VX0A 3CM4A 4PTMA 3LGDA 3U2ZA 3POCA 1XX1A 1ZAHA 4NJHA 3TMLA 5XIMA 3L5LA 4TO8A 2NVDA 3LGGA 1QHZA 4UOJA 4F8XA 1HKVA 4XAPA 2DT0A 1M1BA 1XRTA 1EA0A 2Z6JA 1H1YA 8TIMA 4GC3A 4NZ5A 3CZLA 3TYBA 5E09A 4B92A 2BVYA 3PPHA 4NNAA 1GVYA 3JS3A 1OM0A 4ZB0A 1Q66A 1OD8A 1K3UA 1UQYA 3NDOA 3KP1A 3ISIX 4FLRA 5T9BG 3GHTA 4XAYA 3NVTA