4M80A

The structure of e292s glycosynthase variant of exo-1,3-beta-glucanase from candida albicans at 1.85a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
393
structure length
393
Chain Sequence
WDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,3-BETA-GLUCANASE
publication title Major Change in Regiospecificity for the Exo-1,3-beta-glucanase from Candida albicans following Its Conversion to a Glycosynthase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 150
structure length 393
sequence length 393
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m80A00
3UERA 1EOMA 3AS0A 1GHRA 4FLOA 2FHCA 3AHYA 2BFGA 4U2YA 4QFUA 3W25A 1B1YA 1WZKA 1V3KA 2J7CA 1ISXA 4WLCA 3ARYA 1GQLA 2Y24A 4Y7EA 5A6KA 3BXWA 4PMQA 1GW1A 3M6DA 2OWCA 1R7AA 3PBGA 4GZEA 1PBGA 3VD4A 1JYVA 1VF8A 1XCXA 3SUWA 1XGZA 2EQDA 3D5HA 4AW7A 4X9YA 4PMXA 3CHFA 3RILA 4CKQA 3ZOAA 4E2OA 3FXYA 3AYSA 1IV8A 4XZWA 1A47A 4AMCA 3VPLA 3W81A 2PWGA 4HZ7A 5CQ1A 3UEQA 4W8BA 2VCCA 3SCWA 2JFEX 1ZJAA 4AIUA 3AXXA 4MDPA 3VNZA 4UNIA 1EHNA 3GM8A 1LL6A 4KRUA 2EEXA 1J9YA 2BVYA 1E1EA 1Q6CA 4PRWA 4WKHA 1BLIA 3VGFA 3MU7A 4W5ZA 2WYSA 1OT2A 4W84A 1CXEA 4F66A 1FP9A 4CUCA 1CGYA 2WHLA 4RE2A 3A4WA 3U5UA 2XJ7A 3WF3A 2ZUVA 3IAPA 4GXPA 3L4TA 3WQ6A 4AZIA 1KXVA 4EK7A 5DFAA 5EBAA 3WKZA 1TUXA 2CETA 4Z2KA 1OIFA 1H0IA 1FFRA 1JAEA 5E9AA 4D6DA 3SCUA 4NRSA 1MQRA 2X09A 2MANA 5AC5A 1J0YA 1HKIA 2VRJA 2CBVA 1GOMA 2DT2A 1WE5A 4D71A 4ZEPA 1VIWA 1DWAM 4UTFA 1LWJA 1W1VA 3EDKA 3I3DA 4DUVA 1DP0A 1G5AA 1HKKA 4H8VA 4BCEA 3I3BA 3WH7A 2VI0A 3VMNA 2ZUMA 3VDAA 2XGIA 3AHZA 1R7OA 2XVLA 3POCA 2WC7A 3AIEA 3K46A 1LG2A 1NWSA 2XWEA 1HXJA 2CBJA 3VD5A 1DEDA 4NI3A 1ZBCA 1UKSA 4QCFA 3WF4A 1K9DA 1UWIA 2WMIB 3GXMA 1JFHA 2JEPA 3SCPA 2ZX8A 3WUGA 2VO5A 1Q6EA 3ZT5A 4CU6A 1PAMA 5I5RA 1WAWA 1A3HA 2PWDA 4KGJA 2WBGA 3W26A 1ESWA 1N82A 1BF2A 1G01A 2YA2A 4UFHA 2Y5EA 2DSKA 3WDJA 1W91A 1KXTA 5AC4A 1VFFA 1NH6A 2W66A 6CGTA 3ZO9A 3FAXA 2RGMA 4NSBA 4U3AA 2ZOXA 4RE3A 1M04A 1C8YA 4P7QA 4IM4A 2WHKA 4B3KA 2X0YA 2O9TA 4QDMA 1ODUA 4BQ2A 3S6TA 5BCAA 1MYRA 1JD9A 2CPUA 1J0KA 3AZTA 3MANA 7A3HA 1D2KA 5HOSA 4NRRA 4PN2A 2GK1A 2QHAA 2V5DA 1GONA 1C8XA 2YL9A 3VGDA 1UG6A 2FH6A 4W5UA 3WQWA 1NP0A 2QPUA 3JUGA 3CGTA 1V0KA 4JCLA 1XH2A 3QOKA 4JFSA 3GXDA 5A6JA 1U33A 5GNZA 3A47A 1BQCA 1US2A 5A3HA 2BY0A 3S2CA 4OIFA 3FHQA 5FIPA 3PTMA 2VT0A 3F5JA 5D8ZA 4CCCA 1H3GA 2PBOA 2VX7A 3AICA 4M1RA 1BGAA 3T2QA 1CECA 4P7NA 2QV4A 5BRPA 3BAIA 1WP6A 1J12A 3F4VA 3L4XA 2VX4A 1JDDA 1UD3A 4EAMA 3B9EA 2YL6A 1H5VA 4QLLA 5EMYA 1AQMA 5CG0A 1G1YA 3WH8A 5BWFA 5CXPA 3MSGA 3MUY1 1IT0A 1CNVA 1W32A 2GJXB 4MB1A 1SR0A 1V0MA 2WMJA 3VIKA 1HT6A 1DWHM 1UA7A 4D6GA 4H04A 4D6IA 2GFTA 3WDHA 1OCQA 3VDCA 1H2JA 2ZUSA 3LMYA 1ISYA 5A69A 3KL0A 4D6EA 3BMVA 1E6QM 2CYGA 1ISVA 2D24A 2NSXA 1E0WA 3K4DA 1UWTA 3WIJA 4CN1A 5D9NA 1V3LA 3CUFA 1OGSA 2NT0A 1LLOA 1E3XA 2WMIA 5A95A 2E8YA 2JALA 3W27A 3ZJ6A 1UUQA 4M29A 4UFIA 5I24A 1NWTA 4NZCA 2BY2A 1UWUA 4PMRA 5E09A 4JL1A 3ZJ8A 3GNOA 1E6RA 2BXZA 1YQ2A 5ABHA 3WUFA 4Z2HA 3NYDA 1E5NA 2EO7A 4QLKA 1K6AA 3RMEA 2V3EA 4PCSA 3W4RA 1GVIA 1B3WA 3PTQA 5D9OA 2BVTA 4IUGA 4PTWA 3ZMRA 2QMJA 1VFMA 1FHDA 1HJSA 2NW0A 3IJ7A 2YIHA 3GH5A 3A3HA 4P7LA 4MB4A 1GORA 4ZXOA 3B9DA 1W3KA 3K8LA 2XVGA 4BF7A 2DQXA 1MW0A 2WWCA 3AIUA 3VO0A 3OGRA 1QI0A 4D72A 5ABGA 5I6SA 3ZJ7A 4DUWA 1UOKA 5CPQA 3J7HA 1UZ4A 4J3UA 2F61A 3OGVA 2FGLA 4ZE4A 2VZTA 5CJ5A 4CD8A 4TTUA 1GJWA 3GBDA 3PTKA 3ARQA 4GO8A 8CGTA 4W8AA 1FH7A 2J4GA 1V3HA 2XTKA 1UH2A 1GNXA 2DT1A 4AD5A 4E4PA 4EKJA 1JI2A 2VZUA 2XFFA 1J0ZA 1CXLA 4H7VA 4UR9A 3CUIA 2VX5A 2VC9A 3DECA 3WNOA 2J78A 2Y8KA 3W6MA 1RP8A 2O9RA 3WL0A 1W1PA 2QMKA 1ZL1A 2XVPA 2UY4A 3WFLA 4KH2A 4J28A 5LA2A 3TTOA 3ARRA 2WVVA 1TCMA 3AS2A 4DM2A 4GI8A 3OA5A 3OZPA 4UFJA 3AMDA 1UH3A 4L4PA 1W2VA 2BNJA 1LF1A 4MB5A 5A1AA 3PHAA 3ARTA 4V27A 4J7RA 4WF7A 4W7WA 1E40A 5ABFA 1VFUA 1TMQA 1JZ5A 2BY1A 2WCGA 2WMFA 3W29A 1TVPA 2G4FA 4BQ5A 3AI0A 3CZEA 2WMHA 1E73M 1GPFA 1GQJA 2W92A 2WZHA 1BG4A 4D6HA 1JZ2A 3VVGA 1WZAA 1E15A 4A3HA 1H4PA 3SUVA 3NSXA 4ML4A 3UG5A 1NWRA 1RP9A 1X6NA 3AIRA 3EYPA 3CBWA 2WCSA 1BVZA 4R27A 3WMSA 2WKLA 2Z1SA 2O9OA 3WUBA 4UQDA 5AY7A 2FHBA 2CESA 4E8CA 1RPKA 5M5DA 5CPTA 3AIWA 4GI9A 4U5KA 1I1XA 3EDEA 5A8NA 1E6NA 1E5JA 4AYSA 1KCLA 3FW6A 3IK2A 2AOSA 3T2PA 4U31A 3RM8A 1C92A 1OT1A 1BG9A 1HJQA 3LPGA 3UESA 1U30A 1CTNA 1VAHA 3ALFA 1C3FA 2OSXA 4HMDA 1MQPA 1O7AA 2EJ1A 2VZVA 1G9HA 4LYRA 1CGWA 3BSGA 3THCA 5JIWA 6TAAA 3WQVA 4LYQA 1GQKA 1O6IA 2WNWA 3L4UA 2JE8A 4XUYA 1C90A 3N11A 2G3MA 3VNYA 5JUVA 1JZ3A 3WDIA 4JIEA 4J3TA 1WDRA 1W3HA 3PZVA 1CEOA 3TTYA 5JBFA 4K68A 2EPKX 3ARPA 5FL0A 1EQCA 3WL1A 4DWSD 2VVSA 3W38A 1UQZA 1UD6A 3RDKA 1D7FA 2HVMA 1WZLA 3K8MA 4U3CA 4CVUA 3IAQA 3T08A 5CLTA 4DM1A 4PSPA 5GNYA 5C71A 4V2XA 4W89A 1HL8A 1JZ7A 1UR1A 3BCDA 3CH9A 3WF1A 2XG9A 5GPRA 4W7VA 3AZSA 4JAWA 4JZ5A 3VDHA 1B3XA 1ODZA 2F2HA 2WHMA 2WZEA 4LGXA 3RIKA 4R5EA 4OOZA 1E9LA 3KZSA 1OSEA 1J0JA 4CN4A 2GK1B 3CMGA 5A6BD 3ARZA 2UWFA 3QHMA 5I23A 3VIIA 1J01A 4NF7A 2WPGA 4YHGA 4W88A 2VL4A 1QHPA 3MMWA 1CXKA 3BAWA 3DYPA 3SCRA 3T2OA 2G41A 3ARSA 4A3YA 2WANA 3WDQA 3ZSTA 1ZB5A 4AZCB 5TD4A 3AMLA 4C7GA 4W87A 1JDCA 1PPIA 4ZE5A 2PI6A 2GJPA 2BHZA 4AZ5A 5GQBA 1XCWA 1JXJA 2YKKA 3MV01 4J3WA 1JF6A 4JHZA 1ITXA 4CN6A 1JD7A 2E9BA 3CHEA 2J79A 2ZXBA 2V5CA 2VCAA 1XH1A 4AIOA 4CCEA 4N0RA 4MPKA 1KR0A 3ARVA 4ATLA 3SCVA 1X1NA 2CKSA 3GYCA 2ZX5A 3N17A 1CGUA 4P8UA 6A3HA 4LXFA 3CHCA 1BYBA 4QP0A 4MAVA 1JAKA 1JZ6A 3SEPA 2G8ZA 4FF5A 2G3JA 1QNSA 2EPOA 4JKKA 4ZXLA 2WK2A 3UR7A 3L2LA 3KWXA 4AIEA 2Z1KA 3SUSA 2WB5A 3L4WA 1XSJA 3WENA 1CDGA 1QPKA 3AHVA 3GH7A 3OLDA 4WIWA 3K4AA 1KCKA 5D9MA 5IFTA 1HVQA 4CD6A 3SIMA 2C7FA 4F9JA 2DEPA 1V3MA 2PWFA 3WD2A 5EFFA 2WW5A 1Q6FA 3VDBA 2XM1A 2BY3A 3B8SA 1EDGA 3WF2A 1GVYA 5DF0A 1EO7A 4U2ZA 5A6SA 1V08A 4BQ4A 1US3A 4AC1X 4IPNB 4UQAA 4BQ3A 3W82A 4OZOA 3VGBA 1TZ7A 2CITA 4GQRA 3PN8A 9CGTA 2CKRA 3N1AA 2YDRA 5GNXA 4AEEA 3WH6A 1RH9A 4U5IA 2Y2WA 1MW2A 4HTYA 2WVUA 2WLYA 3VIFA 5D8WA 4PMYA 1W3LA 4MNLA 4D1IA 2E0PA 3PZOA 4F9DA 2JIEA 1NQ6A 4D6FA 2ZICA 1V02E 3II1A 1L0PA 2D2OA 2D22A 2VJXA 2OYKA 2D20A 2CERA 1KBKA 3BGAA 2D3NA 3WD4A 2ZWZA 2G3IA 1TR1A 1MFUA 4Q7NA 2EPMX 2V3DA 1LG1A 1V0NA 5KEZA 3TTQA 2IUZA 3BSHA 3GDBA 4EE9A 1B3ZA 4PUDA 3OZOA 4UQ9A 1XC6A 4AZCA 1DWJM 3WNLA 1AVAA 2CIPA 3N12A 3ALGA 1E0VA 4GZJA 4AD3A 1WDQA 1EH9A 1OD8A 1QBBA 3DC0A 2W4XA 2JEQA 2FGZA 2XSAA 5KZ6A 3A6OA 1B9ZA 1JGIA 1CWYA 3WF0A 4UFLA 3PZNA 1QHZA 3VMOA 1SMDA 3KL3A 4XX6A 4C7DA 4HU8A 4CU8A 3WN6A 2DH2A 2V3GA 4JCMA 5FOOA 1UZ1A 3VIJA 1KR1A 2WSPA 4GPNA 4AZGA 4RE4A 2WVVB 3WNPA 3W24A 1E3ZA 2XPKA 3WBAA 4AZHA 3AIQA 4B16A 3WDPP 5DEZA 3VU2A 2VRQA 3WQ8A 3W0KA 1MQQA 2J8GA 2ZUTA 1UHVA 1HKMA 3GTNA 1NM9A 3WUEA 1MWOA 3IJ8A 1MW3A 5ABFB 4HU0A 2ZX6A 1FP8A 5DT7A 1BHGA 1HIZA 3KL5A 4CU7A 1FH8A 1FH9A 3VIPA 2ZXAA 2WBKA 3PZIA 3VIMA 2YDSA 1WPCA 4GINA 3CHDA 1J11A 2DIEA 2J7EA 5FD0A 4J3XA 3BH4A 2VQUA 4GKLA 3WNNA 1KXQA 3G6LA 1E6PA 1UWRA 3AYRA 4UOZA 1DWFM 2DDXA 2YL5A 5DO8A 2WLZA 1XSIA 1W2PA 3M7SA 4JKMA 3RM9A 1CYGA 4CCDA 3EDJA 2UY2A 1M03A 4BA0A 3ZT6A 3WQ4A 1VEOA 2J62A 4JFUA 5M17A 4QCEA 1V6XA 1S46A 5LYRA 3WBEA 3TOPA 1B31A 2GVYA 3SCTA 3AHXA 1XD1A 3CZ8A 3ZM8A 1IZJA 5BXTA 2GUYA 3HMCA 4FLSA 4B15A 3MSDA 3POHA 2C8NA 2YBUA 3CLWA 4PMZA 2QPSA 5EFDA 3WSUA 1TVNA 1GZJA 2W63A 4S3KA 4P7RA 1VENA 1FOBA 4PCTA 4LPCA 3AROA 4MNKA 5D4YA 2BXYA 1B30A 1KXHA 5CPSA 3TTSA 3VUPA 2EBNA 1R85A 4CVWA 2YA0A 4HOXA 1ZBKA 1VJZA 3CTTA 1OB0A 3AXHA 1FFQA 2XFYA 3SURA 3U5YA 3CUGA 2YA1A 4MJ4A 4WK9A 1VBRA 3RJYA 4MADA 1V6WA 1UR4A 2D23A 3WMBA 2DGAA 3DYOA 4ZENA 1F4HA 1V3IA 1E4NA 2WMKA 1XH0A 1UR8A 4ACZB 2AMGA 1B3YA 2XWDA 3U7VA 1JZ8A 3KEHA 1CBGA 4WSKA 3AQUA 3RO8A 3QGVA 3PZUA 4PMVA 3KE0A 2HISA 2DT0A 1UKOA 2VMFA 3OLEA 2WM0A 4DWSB 2OYLA 4S3JA 2VZOA 4YPJA 3OBAA 3QHNA 1ISZA 2YDQA 1KGUA 4FLQA 2A3AA 2PWEA 3QR3A 2D3LA 1OM0A 5BYWA 4JL2A 1CGVA 2V38A 3GNPA 1TFVA 1XD0A 2ZX9A 4Z2JA 5IFPA 5LA1A 1UD2A 3E1F1 2EPLX 3AJ7A 4BZYA 4AD2A 2UY5A 1KFWA 4WJXA 1SYTA 2WAGA 1PEZA 3T0AA 5A8OA 3CZJA 4YN5A 2J75A 4OJYA 2XFRA 5I79A 1VEMA 1HNYA 4HA3A 3AIBA 4ZFMA 3CMJA 2B31A 1Q4NX 2WXDM 1KGWA 2W5FA 4W8LA 1TA3B 4UCFA 1NARA 1V3JA 3GXIA 1W9DM 1VB9A 4MTVA 1HL9A 2OSWA 1TE1A 4TVCA 2IXVA 5BXPA 4ACYA 2W62A 5E6ZA 2WMGA 4F79A 1UA3A 1K9FA 2BHYA 3BLKA 1WO2A 1PX4A 5A8MA 1GOIA 3MUZ1 3MS8A 1DHKA 1EOKA 4H8UA 1R87A 1X6LA 1F4AA 2BS9A 4IISA 1JNDA 8A3HA 1ITCA 3W28A 2IXUA 4HMEA 2OLHA 3MV11 5EB8A 2J7BA 3U57A 4LQ1A 2XVNA 1MXDA 4HPGA 1BYCA 4ATDA 1GOOA 5FKYA 3LPOA 3TONA 5CLWA 4MAZA 2GDVA 4GIAA 1VBUA 1LQ0A 3UETA 1B0IA 1KQZA 2EXOA 4UQEA 4DWSC 1J0IA 2X0HA 3L4YA 1B2YA 2PWHA 3O2LA 4HZ6A 1VFOA 3DYMA 4PUEA 2XUCA 3EMZA 1PIFA 1OIMA 4M8UA 2PC8A 5A6AA 4OOUA 1BAGA 5E0CA 2UY3A 1JNEA 3BMWA 3LPFA 3O6AA 5A2AA 3CZGA 1FA2A 4TX8A 2WHJA 2WC3A 1G94A 3LPPA 2CHNA 3RJXA 1P6WA 3F5KA 4J27A 2BVDA 1QI3A 3WD0A 5HPOA 1C8QA 1J0HA 1QHOA 1PJ9A 3WD3A 4JKLA 3ARWA 2ZE0A 2YLLA 2E3ZA 5E6YA 3WDRA 2Y4SA 3VTRA 4W93A 3EBVA 7CGTA 2VZSA 2DSVA 2VURA 4ACZA 2CXGA 1VEPA 3OIHA 3MMUA 1EA9C 3PZGA 4OBSA 2A3BA 4WSJA 1UD5A 1OBAA 3ZR6A 4DWSA 5ABEA 2X8RA 1WDPA 4QAWA 3L2MA 1NOWA 4TUFA 1BYDA 1V6VA 3D3AA 5FCZA 3VILA 1QNQA 2OWWA 3WEZA 4LYPA 2JF7A 3N9KA 1Q6GA 4AD1A 1I1WA 1Q6DA 2CEQA 3ZSSA 3UG3A 5I78A 3AHTA 3CUHA 4GQQA 2OSYA 3HU7A 4AXNA 2ZUNA 2G3NA 3K1DA 1E6SM 1FHLA 1HJWA 3VM5A 1TG7A 1HP4A 5A6BA 4M56A 1E0XA 4YHEA 1DWIM 3HJEA 1ECEA 3NSMA 5A6MA 4D6JA 4P8WA 1YHTA 2F8QA 1EIBA 1TA3A 4H41A 2DSZA 4TVDA 1H1NA 5C8BB 1C91A 1W3JA 2WKGA 3B9AA 1H0GA 2VUYA 2VVNA 3M46A 1GCYA 5E0FA 2XIIA 1JYNA 4W85A 1PX3A 3VIOA 4HA4A 3WQ5A 5CGMA 4FMVA 3ZR5A 1SFSA 3CPUA 4QLJA 1QVBA 1JF5A 1ZU8A 1UR9A 3WY1A 1E4LA 1DWGM 1LL4A 4P7OA 4H2CA 5FL1A 4MDOA 3EDDA 4B3LA 1GJUA 3RM4A 3FHAA 1HN1A 2DT3A 1XYFA 1EDTA 1CENA 1QW9A 3FNDA 1VRXA 1JI1A 1HX0A 4W7UA 1L8NA 2YJQA 1Y7VA 4P8VA 4GI6A 3HN3A 3WFZA 2XIBA 3W6LA 3VX0A 1NOUA 3W53A 2WVSA 1MFVA 1E55A 1JG9A 3AZRA 2E4TA 3APGA 2CHOA 3WH5A 4AWEA 3BAKA 4RL3A 1PIGA 5BXRA 1B3VA 2V3FA 2X2YA 3NDZA 1KWKA 3MUIA 2XYLA 1JFXA 5A94A 3A4XA 2CNCA 2J47A 3M07A 4H8HA 3VX1A 3WMCA 3NUKA 3AFBA 4KGLA 3NCOA 4MJ2A 2X1IA 1ZBWA 1UR0A 4HZ8A 2WZIA 4Z2GA 3VINA 1WCGA 5HDRA 1E4IA 4MNJA 2ESCA 2OWXA 4TTGA 2GSJA 1UH4A 4KWUA 4PMDA 2J25A 3NSNA 3VD3A 5JBDA 1J18A 3N18A 3T0DA 3T0BA 1HJXA 2ZXQA 1BTCA 4M80A 4GO9A 5IDIA 2W61A 3WEOA 1DTUA 1W1TA 5I0DA 5BXSA 3IANA 5A2BA 1U2YA 3VGGA 1XYZA 5CSUA 4D6CA 3WEMA 3NJ3A 2WVTA 2BHUA 4JFTA 1JDAA 1Z32X 2Y8VA 5JBEA 1OINA 4J3SA 3U7BA 2C0HA 4IPLA 2Q8XA 4PMOA 4HOWA 1B90A 4UZSA 1WZMA 5CSYA 1KWGA 3WD1A 4HPHA 1HKJA 2VTFA 4PTVA 4OKDA 5E70A 3BAYA 2WC4A 3VD7A 1CXFA 3AIVA 4UFMA 3N13A 2XGBA 1CXHA 1M01A 3AMCA 1GUVA 3A4AA 4E8DA 1R86A 2D0HA 4CD4A 3OGSA 3ECQA 3G6MA 4PTMA 1CLVA 2TAAA 1E56A 1UR2A 5JIPA 3ZQ9A 3FY1A 1CGXA 3EMCA 2J77A 3VIHA 5I77A 1QI5A 1HP5A 4B9YA 1JYXA 2O9PA 2J74A 4J3VA 1E6ZA 1W9XA 3N04A 1JXKA 1QNPA 1QI2A 1OGBA 4TXEA 1JIBA 3OG2A 1XRVA 1WB0A 1MVYA 2DH3A 4AZ6A 4CD7A 4AY1A 3L4VA 4AD4A 1AMYA 1GHSA 1HF6A 3IJ9A 1NWUA 2JIWA 3ZIZA 3MKKA 2E9MA 1AQHA 3AMKA 4LX4A 1E4MM 3VIGA 5IHSA 1QOXA 3AS3A 1KGXA 3K8KA 1WNOA 1GQIA 3EDFA 2ZXDA 5A6LA 1BYAA 2YBTA 4FLRA 4JHOA 1QI4A 1NOFA 4MB3A 2VCBA 1UKPA 4HP5A 4XV0A 4M82A 3WH9A 1CLXA 3L4ZA 1UQYA 4L4OA 3ARXA 3BC9A 4C7FA 2WWDA 4HA1A 1C7TA 2EPNA 2W67A 3QHOA 3VMPA 4PBGA 3BAXA 1C7SA 1E71M 1CZ1A 1OD0A 2ZWYA 2JF6A 5LA0A 4EANA 4X0VA 5A8QA 1V0LA 1EGZA 1QNRA 5AYIA 1UKTA 4WKFA 4AEFA 5CGTA 2J8FA 1UD4A 2XSBA 3VGEA 4A4AA 4AD0A 2J7HA 1E70M 1V02A 2ZUUA 1W1YA 2VR4A 3F5LA 1H11A 4HMCA 2VQTA 2VNCA 5HXMA 2VX6A 3THDA 4B9ZA 1R8LA 3QOMA 3SCSA 3GXFA 3GZAA 3RPMA 2YOCA 5C70A 1HVXA 3O9NA 1EHAA 1PZ2A 5M03A 5I3DA 4JFVA 2RGLA 1CXIA 1EXPA 2XHYA 3SUUA 1UYQA 3VM7A 4CGTA 3CO4A 4UQBA 1W9VA 2AAAA 1I75A 4Z2LA 2FH8A 1PX8A 2QLYA 4PSRA 2DIJA 1KB3A 4UQCA 5DMYA 3FAWA 3PZTA 4Q22A 1KQYA 1UD8A 1KBBA 2OYMA 2X05A 1BFNA 1UKQA 1XSKA 1BVNP 1V03A 3CUJA 3RCNA 4WKAA 2O92A 1OGGA 4AZ7A 2FHFA 2ZUWA 1SMAA 3WELA 3VD9A 5A2CA 3WNKA 2A3CA 3ZJKA 4PTXA 2FDMA 3GNRA 1HJVA 2BV9A 5BRQA 4PYSA 2CCRA 4AISA 2GJRA 1XV8A 1ZS2A 3AMGA 3UG4A 2CBIA 2GDUA 2NT1A 4ATWA 4D1JA 3FN9A 1AQ0A 1CIUA 3SCOA 5D9PA 3CIVA 5HBFA 4FK9A 5HPCA 4UOJA 3OB8A 2D0GA 1JZ4A 1NP2A 4MNMA 3SUTA 1ISWA 2E40A 4AZBA 1GOWA 3NIYA 1CGTA 3ZT7A 1M7XA 3WNMA 2ZX7A 1C93A 3I3EA 1BGGA 1E43A 2PBGA 1K9EA 4OUEA 4PMUA 5IHRA 5ECUA 5A8PA 3CZLA 2WSKA 3GH4A 4PEEA 3ARUA 2PF0A 4W86A 4TX6A 3PZMA 1MXGA 2QF8A 3CZKA 1CPUA 3BAJA 4F8XA 2VR5A 1LWHA 3TP4A 1GOKA 1ZBVA 4UFKA 2J7FA 2YLAA 1JL8A 2PB1A 1H49A 2E8ZA 1M53A 1VJSA 3OLIA 2GJXA 4URIA 1E6XM 4DUXA 1H09A 3MMDA 2DSUA 3OLGA 3BLPX 4OBRA 1RD6A 1J10A 4HOZA 5DT5A 3VOCA 3AISA 4V28A 3SCQA 4TVUA 1HJUA 1W9BM 2A3EA 2VOTA 1BSIA 4CD5A 4XZBA 3UCQA 3N15A 2DPEA 4M81A 1E72M 2CBUA 2ZIDA 3VKKA 5F7UA 5I2UA 2D1ZA 2W91A 5M3WA 3AOFA 1W9UA 4M24A 3BCFA 4XB3A 5CZKA 7TAAA 2E9LA 1G0CA 3AXIA 1PZ3A 4KMQA 3W37A 4U33A 2D0FA 3GBEA 3AS1A 2VRKA 3SCNA 4N42A 2YL8A 2DSWA 1WKYA 1H41A 4UZUA 1QNOA 3VGHA 4PMNA 1V6YA 4UOQA 1EDQA 1WDSA 3MUAA 4X0NA 4Z2IA 2A3HA 1V6UA 5HNNA 5IXEA 1K9TA 1OWQA 1IZKA 1GOQA 2J7DA 1UWSA 1BPLB 1QBAA 4BS0A 4P8XA 3EMQA 3UR8A 1UWQA 3T09A 1W9PA 3DHUA 3MO4A 3PZ9A 5AYBA 3DHPA 1LL7A 1EO5A 1JYWA 1D3CA 1MW1A 2WCAA 1LJYA 3PZQA 3NDYA 5BROA 1XHGA 4TOQA 3TA9A 2J7GA 1E1FA 1EQPA 4GZIA 2XM2A 4JFWA 1ZJBA 2XVKA 4KRTA 1QW8A
chains in the Genus database with same CATH superfamily
1G4TA 2KZHA 4NT0A 2FHCA 1S5MA 1XI3A 2J7CA 1H7XA 1P6BA 3NG3A 2H8ZA 4U10A 3DI1A 3NPVA 3GIQA 1MSSA 2OWCA 3M1ZA 3FJLA 1UP0A 1PBGA 1F6KA 3VD4A 3Q67A 3GU1A 1XCXA 3BURA 2CLEA 1YNQA 2EQDA 5FJOA 1EP1A 4X9YA 3RILA 4JNMA 4CKQA 1W17A 3FXYA 4AMCA 3UEQA 4W8BA 4LAZA 1PKYA 1RJPA 4AIUA 3K2GA 1KFKA 4MDPA 3VNZA 1EHNA 1LL6A 3B0VC 3GK0A 4I8YA 4J40A 3B3DA 3EB4A 2GVEA 3MU7A 5DELA 4W84A 3NTYA 3RRXA 1EP2A 1MRAA 1XGEA 1CGYA 2WHLA 4RE2A 3DXIA 3WF3A 4IIHA 4LALA 2ZUVA 3EB2A 1X8FA 1KXVA 3VCCA 4H19A 3SJNA 3PNUA 1FY6A 1I2QA 3IUIA 3I6TA 2CETA 1OIFA 1H0IA 3H2FA 4WY0F 1ZY9A 1SJDA 3SCUA 3EWUA 2Y62A 3GTXA 2Z4GA 1J0YA 3NVDA 4LB3A 2VRJA 4GUHA 2HXUA 1XUUA 4WY0B 4J5NA 1OX6A 2E77A 4ZEPA 4AVOA 1VIWA 2Y85A 4UTFA 1XYLA 1W1VA 3WX7A 5FSEC 2OEJA 5KTLA 1TPC1 4GY0A 5T9BG 1VHNA 5LNSA 2XGIA 5CBIA 2AAMA 2ADAA 2PDMA 2WC7A 1CW2A 3LXBA 1LG2A 4FEZA 1XIMA 4PB3A 2XWEA 3FS2A 3VD5A 1BKSA 4LEQA 1XLEA 1TTPA 3ZS4A 4OU1A 4MUZA 2ALDA 1K9DA 3FJ6A 1NDWA 3G1VA 3QW4B 4XO6A 3GXMA 3Q45A 2PODA 2ZX8A 3WUGA 2VO5A 4FNUA 1W5QA 1T40A 3MT1A 1Z44A 4ECLA 1A0EA 1A3HA 2PWDA 1DJNA 2C1GA 1ESWA 1N82A 2PDFA 1G01A 2YA2A 4UFHA 4YS1A 1A5OC 1XISA 3W1PA 3CUZA 1DXIA 5AC4A 3BO9A 4IX2A 1VFFA 1S2TA 1NH6A 2W66A 1I0DA 1GKQA 3LS9A 5E93A 3C3UA 4RE3A 1ME7A 1GG1A 1DORA 4IFRA 4BQ2A 1MYRA 4JQ3A 2CPUA 1ADOA 3EA3A 1J0KA 2O56A 3OIXA 4TIMA 1XIJA 3KVMA 4M19A 4NRRA 4PN2A 2GK1A 2POZA 3S1WA 3QV8A 2A0NA 4YCPA 3VGDA 2VENA 2VGFA 1JDEA 2OEKA 1NP0A 1EBHA 3CGTA 1XH2A 1AH0A 3U3HA 5FJPA 5A6JA 3G18A 2RDWA 4A05A 1J5TA 2BODX 1N8IA 1BQCA 3RR1A 2BY0A 3S2CA 5HMSA 2ANUA 2A1YA 5GJPA 2VT0A 2QV5A 1YX1A 2PBOA 3GWQA 5ABTA 4JTAA 1YRRA 3T2QA 4P7NA 1S1PA 3SECA 3BAIA 4FAMA 1O5RA 3EGJA 2IPFA 1Y8BA 3QZAA 3F4VA 2GJLA 2IQ0A 3L4XA 4PL2A 2VX4A 2OOFA 3LLFA 4EAMA 3B9EA 5CZSA 3ZZ1A 4QLLA 1O66A 1DE5A 4FP1A 4GMEA 5CG0A 3NL2A 4M0XA 5BWFA 5CXPA 1CNVA 1M6JA 1LP6A 1W32A 4MB1A 2ZDRA 3VNJA 2GUBA 3VIKA 3BW2A 4DXVA 1DWHM 3O6DA 5BOOA 2WV8A 4O14A 4R7JA 4FNRA 1X98A 2XDFA 4D6EA 1P4CA 1KCZA 1ISVA 2PRLA 3V5CA 3UNTA 4Q4RA 2NSXA 3TV8A 1E0WA 5KZMA 4DAIA 4AF0B 5D9NA 3RR4A 3QC3A 1AH3A 1E3XA 2WMIA 4DQWA 1WKFA 4G1KA 1XLAA 1VQTA 2BY2A 1JPKA 4PMRA 5E09A 2NX3A 3GNOA 1E6RA 4B5NA 4GY1A 2FMNA 4B5XA 2EO7A 2BZNA 3LGEA 1EC9A 1U1JA 1ONXA 1GVIA 3KRBA 2XU2A 4IUGA 3H2MA 2JBMA 3ZMRA 1I4NA 5LHEA 3O06A 3M0LA 1FHDA 8RUCA 1ZGDA 3EWDA 2H9AA 1JULA 2EG8A 1THFD 4MB4A 3GC5A 4ZXOA 3KZPA 1GG0A 3K8LA 4BF7A 1MW0A 3CIWA 1NFBA 1C8VA 1QI0A 1Q8AA 4PH6A 4DUWA 1K3UA 3W2UA 3V0TA 5CJ5A 4CD8A 3NQEA 4MHBA 5G2WA 3M0XA 4GO8A 4W8AA 2HPMA 1JCTA 4DELA 3SI9A 1XPGA 3UQNA 1FWGC 2Z26A 3GR8A 4JDBA 4WDTA 5EYWA 1GNXA 1NY1A 4LANA 1J0ZA 3PAJA 1NTHA 3GR4A 2GGGA 2VX5A 2VC9A 1A5NC 4C65A 1TWDA 2ZC1A 2Y8KA 4I9MA 1XLBA 1D8WA 3PUEA 1T5AA 3WFLA 3NDOA 3ZLFA 4RXFA 3TTOA 2WVVA 2FPTA 3BDKA 1FWJC 2XN0A 5REQB 2HQAA 3CT2A 1W2VA 2BNJA 3CHVA 5F4WA 3NVTA 4J2PA 3ARTA 4R9OA 1KFBA 4E38A 4WEVX 3H54A 3GHTA 4R9XA 4IPPA 3BMXA 4BI6A 3FYPA 3NSXA 3GKAA 1NWRA 3AUJA 4Y9PA 5LXXA 4ZQOA 4QJ1A 1GTEA 1NDVA 4EF9A 3EX6A 4O0KA 3WUBA 4OT7A 1TVLA 1GEHA 5KZDA 2FHBA 2CESA 4GYJA 4L65A 4ZO7A 2VC6A 3AIWA 4YVXA 1EJ7L 4FX8A 5F4XA 1HUVA 1E6NA 5LIKX 3QF0A 4I5RA 1A5UA 2G37A 3GFZA 4OGZA 1BG9A 3VZXA 2OGJA 3UESA 1U30A 2F84A 5FESA 1SJCA 1ZENA 4MGGA 4ICNA 1CGWA 1MEIA 1NSJA 6TAAA 3CXOA 1FXQA 1GKPA 2WNWA 4XUYA 4GI4A 4J3TA 3PB0A 2QXWA 1W3HA 1Y5VA 1CEOA 3E0FA 4F0HA 3SO7A 3B8DA 3TTYA 5JBFA 4K68A 2VVSA 4FSAA 4LUYA 4Z17A 2HVMA 4GOAA 3W1XA 3K8MA 4UB9A 2H6RA 4V2XA 3BLDA 3CH9A 1JRCA 3WF1A 1DJIA 2XG9A 3U4AA 2A7NA 3AZSA 5CZJA 4EIVA 3GU2A 1YIXA 2WZEA 3WLKX 1EF2A 4R5EA 1E9LA 5LZLA 5E5CA 3ARZA 4CNPA 1RPXA 4LBRA 3VIIA 2ZZ5A 3S2NA 2FZMA 4H9YA 4AB4A 4RPPA 1OFBA 3NZRA 4I9AA 3T0CA 3MMWA 1CXKA 3HIJA 4WSHA 3ARSA 4CNSA 3LTYA 2NLIA 1KRBC 2P5NA 3AMLA 4WXZA 1KRAC 3GHUA 4HPNA 4XTDA 3WLNA 2FB2A 3NZPA 1PPIA 3W3OA 2GJPA 4IHCA 3C0SA 3W7LA 4UTUA 4J3WA 4R33A 5DBUA 1JF6A 3QN3A 2Z00A 5CSSA 2ZXBA 3BV7A 3W86A 4MF4A 1RR2A 3GVQA 2PLJA 3TOYA 1XLJA 1M7OA 3S6DA 1RALA 5LNUA 2ZX5A 3N17A 1O1HA 2PDQA 1WOBA 1EEPA 5LNRA 4XK2A 1YE6A 4M7TA 1GJPA 4QP0A 1R46A 2EJAA 4FF5A 3C2YA 4NY2A 4ONVA 3UR7A 3L2LA 1F6PA 4JQ4A 5AC6A 2Z1KA 3ABZA 1QU4A 2FVLA 5CKSA 3UFYA 1XICA 1MNSA 3NQGA 2YCKX 3KX6A 1QPKA 1T7LA 2REQB 3GFYA 3VAVA 2Q09A 2ISWA 1A5KC 4FXFA 1ENUA 3F2CA 3KBVA 3V1HA 3W7RA 2QAFA 1FWEC 4LF2A 2WW5A 2XM1A 4K8EA 2J9ZA 3U6WA 4PUUA 5DF0A 1EO7A 5A6SA 3IK4A 3STFA 2FZBA 3H23A 3FSTA 3PNZA 2CITA 4F4RA 9CGTA 2CKRA 2QCGA 3H24A 3JVAA 3N1AA 2YDRA 1KTCA 2FPVA 2X16A 1ADDA 5LIXX 1EGMA 2VWTA 3EWZA 2OT0A 1BWVA 4PMYA 4LUSB 4MNLA 4D1IA 2E0PA 3PZOA 3P7YA 2J66A 5XIAA 3HZ3A 4CQ9A 1ZSXA 3VFCA 4MZ1A 2OCZA 3SRHA 3AWNA 3TH6A 2DU2A 3BGAA 2BGSA 4R88A 3QR1A 3W72A 4MM1A 1TR1A 1HKVA 1MFUA 4MWAB 2V8ZA 4JTRA 4Q7NA 2V3DA 1EJXC 5KEZA 3VKDA 2OOGA 3BSHA 3GDBA 2ZZ7A 2OX1A 1B3ZA 1K8ZA 3MSYA 4LVFA 4UQ9A 3AALA 1JJKA 1DWJM 4PC8A 3ALGA 4POCA 3UW6A 2QIIA 4OVXA 2XSAA 3OQEA 4ICMA 3QSRA 2IKJA 4ZOBA 1I60A 4UFLA 5EPDA 1KTNA 2E28A 3PZNA 1C29A 3VMOA 1DJQA 1R9XA 2J6VA 1KR1A 5HWNA 2A7RA 2WSPA 3MZNA 4GPNA 1VD6A 4S38A 1V7YA 4FNPA 4ZO8A 2PURA 2ZUTA 3NR0A 1MWOA 1TPDA 3WBYA 3M44A 4QJ3B 1FWFC 3F2BA 1HIZA 3QPZA 4CU7A 3FGCA 1QO5A 3T40A 4O1CA 2X1RA 3PZIA 3UXDA 3TROA 1TB3A 3CHDA 3EX2A 2YBVA 3BH4A 4RK8A 2VQUA 5T26A 3UYCA 2PDYA 2Z2AA 4Q8TA 3SB0A 3PUOA 2CLLA 1DWFM 1IQ8A 2PTZA 3M7SA 2XSXA 2OQHA 4CCDA 3EDJA 4NYYA 1M03A 2ZCGA 4PTDA 3WQ4A 1VEOA 2J62A 1RA5A 5M17A 2HVOA 5DANA 3FX4A 1B31A 3H4XA 4U4MA 3TJLA 3SCTA 3AHXA 3LHWA 2GUYA 2J9XA 4FLSA 3WQDA 4B15A 3MSDA 1QO2A 3Q2DA 1FWTA 4AH7A 1TVNA 1J8VA 2PTDA 2ZFAA 5DMMA 1JRBA 1OCBA 1VENA 1C9WA 3G8EA 3AROA 3UGVA 1JCJA 4HOXA 1B4KA 5IBXA 3U5YA 4LAOA 2ZADA 3R0UA 3URQA 4MUPA 1V6WA 2QUMA 4A8NA 2H90A 5G4WA 2WMKA 4ACZB 2AMGA 2XWDA 4DJED 5D2WA 3P6LA 1XW8A 3AQUA 2WZTA 3VKCA 3QGVA 3PY2A 4PMVA 4XIMA 1JGMA 2R82A 2QR6A 3C2RA 4H01A 2HE8A 1JVNA 2OPJA 4KIRA 3UWUA 2YDQA 1KGUA 1SFTA 2A3AA 3S1GA 5C7HA 3QR3A 2D3LA 4ROQA 4S2BA 1EL3A 4O50A 5FF0A 4DNHA 2GWNA 4JL2A 1LT7A 4ASTA 2ZRZA 2GOUA 3G1FA 4O19A 3GNPA 1TFVA 4Z2JA 2V30A 1SSDA 3GFXA 3WLLA 4OFCA 3ZFHA 3VXGA 3G1DA 4BZYA 4FALA 3K13A 3I65A 3BLIA 1I9CB 4H9TA 4YNGA 1PEZA 4PMJA 4H6RA 2NQJA 3HF3A 3SRKA 2NV2A 4K8HA 3BQ6A 4DNMA 4HA3A 3UGRA 3N2BA 4Z08A 3DZ1A 5D38A 4W8LA 3LA4A 1FWIC 2OSWA 1IXPA 1TE1A 2PRMA 4Z1YA 3TAKA 1ECQA 4ACYA 4F79A 1UA3A 1WDDA 3V4BA 4TV5A 2WO5A 5A8MA 3CYJA 3F4NA 5IOBA 4IISA 2ACSA 1EZ2A 1JNDA 1TPWA 3W1UA 8A3HA 3TZFA 1TR9A 1WUFA 4J35A 4GCXA 3MV11 1VJIA 3O3RA 4LQ1A 2C79A 2HNHA 1XX1A 1RCOB 3HM7A 1MXDA 4CNOA 4LBUA 4A6GA 2ABBA 5F2IA 1QR7A 3TQPA 3OODA 3UETA 1KQZA 2PDHA 4UQEA 3W7GA 1GYMA 1J0IA 2X0HA 2SFPA 2IPWA 1UIOA 2PDJA 4O4WA 4PCPA 3A24A 1OIMA 4M8UA 2D73A 3O6AA 3PBMA 1ZQ5A 2FDSA 1FA2A 4IGNA 1G94A 3LPPA 2CHNA 3P5ZA 5DX7A 5HNTA 4O1FA 3REQB 3W1MA 4B90A 1W6TA 2PF8A 3EXSA 1QHOA 2I14A 3WD3A 1TIMA 2ZE0A 3UPMA 2E3ZA 5E6YA 3E2RA 5I3IA 1QWKA 5BOFA 3RNDA 4PODA 2VURA 1YXDA 2ZA3A 3L5MA 1A5MC 1TX2A 3MMUA 2WOQA 1V93A 2ISFA 1EA9C 3SQSA 3PZGA 1EX1A 3B0YA 1ONWA 1LCOA 3ITXA 1DJXA 3Q58A 4IIBA 4JNYA 5A5WA 3L2MA 3PSVA 4TUFA 3D3AA 4LYPA 1A3WA 3HPSA 2OMAA 4AD1A 4AWSA 1VYRA 5HUOA 2QJGA 4ADSA 2ONEA 3AHTA 1ZUAX 2GZXA 4YCOA 3GW3A 4GQQA 4AXNA 2TODA 4GX8A 3I4KA 1Q7ZA 2CFFA 1HJWA 1EC8A 3S5NA 5D09A 4RNFA 1AG1O 3KVJA 1FKWA 5A6MA 4L7ZA 4P8WA 3OQ8A 3SBFA 3SAZA 1OHLA 5C8BB 1C91A 4GD0A 3IGHX 1W5NA 3OYZA 4IG2B 2VVNA 4UR8A 4LNYA 2VELA 3S5ZA 1SW3A 2XIIA 4W85A 1PX3A 2P53A 3VIOA 4FMVA 4L80A 3JZEA 1VP5A 4EXAA 3QRHA 1UR9A 4LWWA 1E4LA 4IP4A 4P7OA 3S2JA 1G69A 4AQLA 3O15A 2CZVA 1XYFA 1EJVC 2CLIA 2XIOA 2P76A 1XFCA 4HYRA 1QW9A 1VRXA 5K2ZA 1L8NA 1VR6A 2TPSA 2QIWA 3N2XA 4ERIA 2PD5A 2WVSA 1MFVA 1ZFJA 3NGFA 1GVEA 3CV2A 2PA6A 1BRLA 3CU2A 2FMOA 3NDZA 3V3WA 1Q3NA 3MUIA 1RVGA 3VOGA 1JFXA 3DH7A 4GH3A 2J47A 3AFBA 3VZZA 3NCOA 5AKQA 2CC0A 2QEZA 2WM1A 4K39A 1OCNA 2VFEA 3M41A 1FWHC 1KW1A 1WCGA 2PZ0A 4MNJA 1GW9A 2OWXA 2GSJA 1VRDA 2GQ9A 2Y7DA 4Q8UA 1LOQA 2NVAA 3OHMB 3S3GA 3TN6A 2ACRA 1LRTA 3B8UA 4H00A 2RFGA 1L6GA 1OFEA 5XINA 1OX4A 1R2RA 1HJXA 2ZXQA 1BTCA 3B8WA 3DFNA 4DBEA 5BXSA 1IE7C 2Q6ZA 3TE9A 1QPRA 3VGGA 1XCFA 4D6CA 2G5WA 1Q65A 1A5CA 3NJ3A 4JFTA 2BHUA 1JDAA 4JHMA 4WOZA 4J3SA 3VNMA 2C0HA 4PMOA 4HOWA 1B90A 1MEWA 3M7WA 1DIEA 1VPQA 4HCLA 4DZ5A 3EOEA 4A21A 4HHLA 3I7SA 5E70A 2WC4A 3AXMA 1O95A 4HA0A 1CXFA 3AIVA 1SZRA 4LAMA 7REQA 3AMCA 1GUVA 1M3UA 3A4AA 5HNUA 1R86A 3KDNA 2HTMA 3ECQA 1LWIA 5CAKA 3BV4A 3NO5A 4K7VA 3IUDA 1XINA 3L2IA 1CGXA 3VIHA 4I90A 1EF3A 1FCQA 4B9YA 3DX5A 1JCNA 1CI1A 1F3WA 3UWZA 2QF7A 4J3VA 2CLFA 4MWAE 1W9XA 3UPBA 1QNPA 3CLMA 3T81A 3KBJA 1IIGA 4PRTA 1TYGA 1YDVA 1PTGA 1XRVA 3RMJA 2DH3A 3UZXA 4O1EA 3RPTA 1M7JA 1OCJA 3GXNA 4GVHA 1GHSA 4NXSA 3MKKA 4XSMA 3W7MA 1E4MM 4LCSA 1QOXA 1MZHA 1KFJA 1WNOA 4H6KA 1A5LC 1YTDA 4V1YA 2Q3OA 2WNNA 1BYAA 1S2WA 1ZRQA 2YBTA 2BOFX 1JPDX 1NOFA 3EEGA 4XZMX 3QBUA 3WO8A 2VCBA 4XV0A 3TXZA 1CLXA 3GZ3A 2FZNA 4XBKA 2Y0FA 3LG3A 4C7FA 4IGSA 2EPNA 4GXWA 4LF1A 4UUIA 4ES4A 4ZTYA 3TR2A 3UVAA 3SN4A 3JU2A 3LHTA 1CZ1A 3MP3A 4EANA 3GW0A 5IBXC 2J8FA 2J7HA 2CZDA 1E70M 5CJMA 1FKXA 1W1YA 3F5LA 4KWVA 1K7EA 4A2RA 4JPGA 2VNCA 4FXRA 4AY7A 1R30A 3USZA 3G0SA 6REQA 4GXMA 3QOMA 1H62A 3GXFA 2E6DA 4IMCA 2V81A 3PM6A 2HWGA 2YOCA 1HVXA 3P0WA 1PHQA 1CXIA 1EXPA 4CGTA 4UQBA 2AAAA 4HZMA 1KBJA 2FH8A 4M7SA 3NL3A 4PSRA 3UR5A 3TQKA 3V16A 5DMYA 3G24A 4Q22A 2X05A 1QPOA 1BFNA 1QMLA 1UKQA 1XSKA 3YPIA 5J04A 2YFOA 3TCSA 3RCNA 3EZ4A 4BKNA 4WKAA 2HBVA 4C5ZA 2YDAA 4AZ7A 7PTDA 2CU0A 1SMAA 3WK3A 3VD9A 5A2CA 1DXFA 2FYMA 3HA1A 3DU0A 1PS9A 3QQ0A 2CCRA 3GUWA 4AISA 1F6YA 4IMAA 2GJRA 4JQ2A 4Y9MA 3UG4A 2ZRUA 2NT1A 4QS6A 5MKGA 1AQ0A 3CIVA 5HBFA 2VC5A 1W8GA 1N8WA 4LUJA 1XF0A 1A5SA 4MNMA 1PUDA 4H9VA 3NIYA 5FF2A 3ZT7A 4UTMA 1NEYA 2ZX7A 4NX0A 1XUZA 4DJEA 1FRBA 4RDVA 3L66A 3EOUA 5T9CE 3QY8A 3M0ZA 3ABRA 2YZRA 2WSKA 2PF0A 3QLLA 1F05A 5HMEA 4HQVA 1MXGA 2QF8A 4UTTA 4F8XA 1VFLA 3WLPA 1AW5A 2YLAA 3N6QA 1XLIA 2C1IA 1E9IA 1S2AA 1VJSA 1E6XM 4F3HA 4WGXA 3BLPX 1RD6A 3C52A 4IMGA 3VOCA 4MFEA 2Z24A 3SCQA 1QDSA 4TVUA 3U48A 3RLVA 2O7QA 1OYCA 4HNOA 5I00A 4BEQA 2A21A 1ZCOA 1E72M 1G7UA 1J79A 3TYUA 1R38A 3TMQA 2ATSA 4KCUA 3BCFA 2QCDB 4RZBA 2HSAA 2E9LA 3I7QA 2X0SA 4KMQA 3W37A 2C6QA 3ERPA 2DZWA 4TMBA 3A3WA 1F9CA 4I7UA 2PZNA 3VC6A 2QUUA 3DG6A 4WOQA 1WKYA 1H41A 3QC0A 3W74A 1QNOA 4PMNA 2FTYA 1Q2SA 3AWOA 4HPJA 4XAZA 8XIMA 4Z2IA 4RDYA 3VNKA 5HNNA 3HJZA 1XG4A 2XN2A 2BBFA 3LGGA 1UWSA 3MPGA 1BPLB 1QBAA 3B0XA 4P8XA 1OFPA 3ZYZA 1EO5A 1KBLA 2E7FA 1D3CA 1XG3A 1RY0A 3Q94A 4US5D 2CW6A 3IV3A 5BROA 3LHUA 4DO5A 1ZJBA 1EOMA 3AS0A 3PPFA 1L9WA 1FXPA 1SW7A 3ZWTA 3L7RA 8TIMA 1B1YA 1V3KA 3FVMA 2WJDA 1TRDA 2Y24A 3E2SA 4MMWA 3BXWA 4PMQA 4E2VA 3M6DA 4TR9A 4YTUA 1T0OA 1R7AA 3BLOA 4H9UA 1VF8A 3G0XA 5FSDC 4NZ3A 4H9MA 5CZTA 3SUWA 1XGZA 3D5HA 4AW7A 1K4HA 4E3TA 4EAYA 1XKYA 4JX4A 2YCEA 3ZOAA 4E2OA 2R91A 4N9BA 4XZWA 1W3IA 3W1QA 4ZQCA 1AQFA 3VPLA 3W81A 2D2HA 2PWGA 3MCNA 4H3DA 1VZWA 4UNIA 4CQDA 3VZYA 1UR3M 2Z2UA 2BVYA 1Q6CA 4WKHA 4DIAA 1OT2A 4QDWA 3AU2A 3LU2A 2PUZA 4F66A 3A4WA 1EFZA 1BSLA 3PANA 4C1NB 5AB3A 3WQ6A 4EK7A 4LY8A 2C19A 3UWWA 3GR7A 2BXVA 3DGRA 1H7NA 4XKMA 2FZ9A 3MI3A 5E9AA 3R8HA 4WDUA 1H50A 1MQRA 2X09A 2MANA 5AC5A 2QKFA 3LTSA 1HKIA 1XDJA 3ISIX 5BU6A 2Z27A 4D71A 4KCTA 1VH7A 4I3GA 3JZUA 1LWJA 4G56A 3FKKA 3TWBA 3EDKA 1Q85A 3A12A 5BOEA 2PP1A 4DPQA 3TYBA 1P0KA 4LBSA 1DE6A 3R58A 3VMNA 2ZUMA 4N6EA 3VDAA 1L6WA 1R7OA 3IPWA 3AIEA 4XAPA 3SY1A 4UTJA 5JMUA 4CQAA 4BF5A 1TE6A 4NI3A 2EG7A 5E1QA 1ZBCA 3KBNA 4C6LA 3VUSA 1UKSA 3C8NA 2KX9A 5ENLA 1TV2A 4OHQA 2BG5A 3N9RA 2JEPA 1HO1A 3SW6A 2EAWA 1Q6EA 5FI8A 1PAMA 4ERAA 1P48A 2RHGA 2WBGA 2FVMA 5HWMA 3ABXA 2Y5EA 4ADUA 1AJ2A 1MUCA 1W91A 4F0SA 3QFWA 5D32A 6CGTA 4DHGA 3R8GA 2OTDA 3VK5A 2A79A 2INFA 3QV7A 4NSBA 4U3AA 1XYCA 4FR1A 4P7QA 1SFLA 3CC1A 4B3KA 2X0YA 2O9TA 3LHZA 1RV8A 4S3EA 3TUUA 1XPYA 3IGUA 3S6TA 3A22A 4RZ4A 5C9ZA 1KM5A 1D2KA 1Q13A 2QHAA 2V5DA 1C8XA 2HDJA 1UG6A 3WMLA 3WQWA 1A53A 3KCJA 1PWLA 2FQIA 3JUGA 1V0KA 3BARA 1DIOA 3QPEA 3HO8A 3DIPA 3A47A 4WX2A 4QJ4B 3HGRA 4NZ4A 4B5UA 1WYIA 3DDMA 2VX7A 3AICA 1BGAA 3EWBX 5I03A 5BRPA 1RBAA 3SRDA 5FF4A 4LU0A 5C9RA 1J12A 3UZJA 4J2MA 4A2SA 1JDDA 1HQTA 3ZVHB 5G1TA 4GUIA 2YL6A 2NQZA 1F8IA 1PV8A 1AQMA 1G1YA 3WH8A 1D3GA 5C0QA 4GIRA 2GJXB 2ATMA 5IRPA 1HT6A 2OODA 1UA7A 3LHVA 3DHDA 4H04A 2PC4A 2GFTA 3E38A 2ZUSA 3KLKA 4XG1A 5A69A 1VKFA 4XISA 2I16A 1E6QM 2CYGA 3OZMA 4ZMGA 5H91A 3TVAA 2B81A 3I7RA 3KRSA 1PSCA 1E1CB 1UWTA 3IARA 4AHOA 3L0KA 1TV3A 2QDHA 1OGSA 1S2CA 1LLOA 1V51A 4HYVA 5BRBA 3R10A 3MHGA 1UUMA 3TCEA 1IGWA 3W27A 1RQBA 1I2NA 4LS0A 3KCOA 5KETA 4M29A 3PUDA 3W1RA 1DOSA 2BXZA 4GYFA 4LUTB 4NI8A 1YQ2A 1XRFA 4MWAD 4QLKA 3C0JA 3RMEA 3W73A 2MNRA 2V3EA 4Q4QA 2ABAA 3PTQA 2BVTA 4HN4A 5JXQA 2QMJA 1HJSA 1I45A 4NHVA 4F0LA 3IJ7A 2E67A 3GH5A 3A3HA 4DJEC 4DWDA 5G4HC 2JKPA 2F6XA 1RXOB 3IWPA 4O10A 3TNBA 2DQXA 1PYFA 3AIUA 3OGRA 3EX1A 2VC7A 1AUSL 2FGLA 1O5KA 1GVOA 1K03A 4ZE4A 3DFHA 2A4AA 2XZ7A 3L5AA 2QJIA 3GBDA 2ZVIA 2JGYA 4H2HA 1XDLA 3FLUA 3WJWA 4X60A 2J4GA 2C15A 3SIZA 3ME3A 2FTPA 3QQ1A 6XIMA 3GC4A 4AD5A 4EKJA 3QH2A 4H7VA 3QKZA 4ADTA 2XH2A 3WNOA 3VCRA 2WSQA 3W6MA 2Z0IA 3ITVA 1W1PA 4ZOCA 1EPXA 3R2GA 4I8DA 1ZL1A 3GYEA 2XVPA 2UY4A 3EX3A 4KH2A 4J28A 5LA2A 1JQVA 4N7QA 4DM2A 4HNNA 4GI8A 3OA5A 1JR1A 3AJXA 3LI1A 3CV6A 2AL1A 1HG3A 4A3QA 4MB5A 3QYQA 2Y1HA 4PCFA 1B5TA 1UBPC 1IEIA 2VEGA 2DZTA 3LRMA 3DEQA 5ABFA 3AU6A 2LLEA 1DIDA 2RJHA 4DF1A 3PULA 2BY1A 2INZA 2WCGA 1JZ5A 5B7YA 1FWDC 5D03A 4AXKA 5D33A 3AI0A 1GPFA 2O7SA 3MCOA 4D6HA 1JZ2A 1PTDA 3VVGA 1SFJA 3GVVA 3PBWA 1WZAA 4MPQA 1E15A 1FWNA 5FAGA 3TTEA 4AF0A 1FWWA 3AIRA 3EYPA 3IJQA 3CBWA 2WCSA 5TF0A 1BVZA 3WMSA 3TSMA 2DUZA 3MBDA 5AY7A 2QJJA 5FJUA 3K1GA 2QQ6A 4E8CA 1R3VA 3HG4A 4F0RA 1I1XA 4Q6JA 2ZTJA 3EDEA 5A8NA 1E5JA 2PMQA 2G97A 2ZBTA 3IK2A 4LRTA 1W3NA 1HJQA 4K8GA 4NJHA 3I10A 3SZ8A 2OSXA 4HMDA 1MQPA 2DVXA 2VZVA 3TW7A 1XLKA 3BSGA 2Q8LA 3WQVA 1GQKA 2P0OA 2P8BA 4ZVJA 4BK9A 1C90A 3VNYA 2G3MA 3ZXWA 4OWGA 5K9XA 1WDRA 5I3HA 4FXSA 1YBQA 1X7IA 3V0SA 3DBNA 4GK8A 1ZLPA 1OFAA 3W70A 5H8UA 1XYMA 3RDKA 3ZLGA 1D7FA 3GB6A 1HKWA 3VKAA 3KS6A 3IAQA 3T08A 3GHRA 4PSPA 4W89A 5D30A 5FEPA 4O28A 3CAKA 2IPJA 1HL8A 3S0CA 1XYAA 2EF9A 5GPRA 3ITTA 4US5A 3PC0A 1XBYA 1ODZA 4RPQA 1Z7AA 4JIIX 2GK1B 2UWFA 3QHMA 2O55A 4NF7A 2QS8A 4IP7A 4W88A 4C6QA 5EGRA 3BAWA 1XLCA 3SCRA 2DZVA 4A3YA 5EY5A 5JH1A 2ZZ2A 2OXNA 4O1BA 3ZSTA 1ZB5A 4NNAA 1LRQA 3A64A 5GJMA 4C7GA 2YXXA 4NXKA 2BHZA 1BTMA 1UOZA 4AZ5A 5GQBA 2ACQA 3OBKA 1RUSA 2MUCA 3HQOA 1ITXA 1TCDA 2V2HA 2Z6IA 1JD7A 2E9BA 1OFQA 1J96A 1XH1A 3EA1A 4GUFA 4EPBC 4JOMA 3OU8A 5CPOA 3GYCA 2FFIA 1CGUA 4IGHA 1EIXA 3WG6A 5DCEA 6A3HA 2NXHA 4UNKA 3CHCA 4AVFA 4DZIA 4O57A 3B8IA 3H26A 5AHIA 4I9TA 2HV5A 3W1TA 1XBVA 2BGNE 2VR2A 4HHHA 4IX0A 2VEMA 2WB5A 2GVJA 3WENA 1LQAA 1S5WA 1QPQA 3AHVA 4RV3A 1PWMA 2GYIA 5JVLA 3K4AA 1OC6A 5U7SA 5IFTA 4CD6A 3SIMA 2C7FA 2GGEA 1MI3A 3LXCA 4O12A 3OHIA 1Q7MA 3L65A 5EFFA 3T4CA 3CT7A 3USBA 1Q6LA 3VDBA 1TWWA 2Y88A 5HWJA 3B8SA 3WF2A 3PTDA 1GVYA 1U5HA 3FDGA 3VE9A 4U2ZA 5GVJA 1PE1A 1US3A 3TYAA 1WBHA 4UQAA 3KVKA 4WDWA 3GKFA 1S2VA 1TZ7A 4Q7BA 4GQRA 3F1QA 3M0JA 5GNXA 3NQMA 3WH6A 3MYOA 1Z3NA 1XIIA 1RH9A 4U5IA 3M5YA 4ROPA 1ICPA 2WVUA 4G7EB 1IGSA 3RHGA 3EWYA 5K4XA 1W3LA 3PPCA 4EOUA 4F9DA 1R0MA 4C6MA 1TPFA 1N55A 4D6FA 7ODCA 2ZICA 3TMLA 2H9AB 4NVTA 1P7TB 5EMLA 1VPYA 2POTA 2VJXA 3LY0A 2OYKA 4JD4A 3MB9A 3QM3A 1KV5A 2F7FA 1KBKA 1XIBA 4HSOA 4GVGA 2ZWZA 2G3IA 4Q4SA 3WK0A 3O8AA 1P0EA 4L4MA 4XWUA 3BOXA 4IMFA 1KTBA 4R7WA 4YIWA 2HEJA 4PUDA 2QPXA 3OZOA 1EEXA 3C6CA 3HTWA 1ZPTA 3N2MA 1AVAA 4GZJA 5HQLA 1EH9A 1QBBA 3NQBA 2W4XA 4DJFD 1B9ZA 1P0BA 3R25A 4RW5A 1QOQA 3IJDA 4YWIA 4HU8A 4H9ZA 4CU8A 3WN6A 1FWAC 3B4YA 3OG3A 1KO0A 5F1VA 1A5BA 2D2JA 4MYAA 4JYFA 3VIJA 2NZLA 4AZGA 2WVVB 3QSTA 3WNPA 3PK7A 1E3ZA 3P84A 2YX0A 4IJCA 2QULA 4S1FA 2V2DA 2J8GA 5K3VA 4C90A 1YDNA 3GDRA 1P43A 3IJ8A 4FXJA 2XZ9A 4IOTA 4HU0A 3SR7A 5DT7A 1TWSA 3KL5A 3DN5A 1RJQA 3CO8A 1W1A1 2REQA 4JX6A 1QW7A 4UCGA 1J11A 3C5QA 2ZDSA 3UYIA 4FX7A 4O17A 4GKLA 3WNNA 4O54A 4DYEA 4Q32A 2CZFA 4YXGA 4UTKA 4UOZA 4LEFA 3NL6A 4D2JA 2QCNA 2DDXA 3TW9A 3UWQA 2G0WA 1KKOA 2WLZA 3DFQA 1XSIA 2EKCA 1W2PA 3OVQA 4L56A 3ZLHA 1LQ2A 3NFUA 4M6UA 1CYGA 2F6KA 1EJSC 1F3EA 1XLLA 2UY2A 2PEVA 5AZ1A 3ZT6A 1CX9A 1O5QA 1X8CA 4ZBCA 4NJIA 1V6XA 3DFPA 1S46A 2BTMA 4JEJA 4MIMA 3TIMA 5K4ZA 3CZ8A 1IZJA 3HMCA 2P8CA 2W3ZA 3FDKA 1AMKA 4GH1A 3KDOA 2FZ8A 2C8NA 2Y63A 3G1SA 4LUSA 5EFDA 4PCTA 1TV5A 4L1GA 3BZJA 4MNKA 4OUIA 5D4YA 2BXYA 4GIEA 1B30A 5CPSA 3TTSA 3LSBA 2EBNA 1OADA 1R85A 3HPXA 3LUTA 4CVWA 3EKLA 4MWAA 1SO4A 4R3UA 4LV9A 2XFYA 3P81A 3SURA 3UU0A 4G5DA 2NUXA 3CUGA 4MJ4A 4MADA 1SJBA 3HURA 1UR4A 2D23A 1QAPA 3WMBA 2DGAA 3LSCA 1OQFA 4NJJA 3ID7A 3FFSA 1V3IA 4XQ6A 1XH0A 1B3YA 3U7VA 1Q63A 3AXKA 3XINA 3KEHA 5C7VA 2VEIA 3CJPA 3KE0A 3QYSA 5CPLA 2OYLA 4S3JA 2NV9A 2XH4A 1LORA 3UZZA 3QTPA 1UPMB 4FLQA 4AWUA 2PDCA 3SGZA 3EB3A 1XS2A 1EUNA 1Q45A 4DYKA 3T1GA 1OM0A 2Z29A 3VNIA 3UJFA 1Y0EA 1XD0A 4L9XA 3CQKA 2IPGA 2QCMA 2UY5A 4OV4A 2WAGA 3BPWA 1TMLA 4X63A 3CZJA 5I79A 2OQLA 1VEMA 4IICA 3TJ4A 4JTUA 1KCXA 2VEPA 1Q4NX 2WXDM 2XH0A 3OYXA 1KGWA 3RX4A 3FOKA 1ZHAA 1Z41A 4HK5A 1V3JA 4GQGA 5TNVA 4MTVA 1HL9A 1ITUA 4TVCA 3QV9A 1A5AA 4XUGA 3KHDA 1QASA 3GRIA 2G4JA 2GGJA 2BGQA 1TV8A 4LC8A 3MS8A 1DHKA 1EOKA 4H8UA 1KA9F 3WCZA 1X6LA 3IJ6A 1TUFA 3PP7A 5D37A 3NA8A 4F2BA 3E12A 4MJMA 1ITCA 4HMEA 4S3BA 2CLMA 1KM4A 2OLHA 5EB8A 4QBXA 3BSMA 5C2CA 2J7BA 2PDXA 4EVZA 3U57A 3C0LA 3XIMA 2XVNA 4HPGA 4MOZA 4HD5A 1GOOA 3I6RA 3TN3A 3TONA 4FI4A 3PVFA 5CLWA 3NQDA 3RX3A 1LQ0A 2B0MA 3L12A 4YTSA 4DLMA 4DWSC 3WLMA 3O2LA 1VFOA 3DYMA 4PUEA 4O4VA 3EMZA 1PIFA 3CASA 1PXGA 1BAGA 5I07A 5A2AA 5HNRA 3H2EA 3P2VA 3RJXA 4CEXC 3F5KA 3W07A 4PA8A 4ZSUA 2QJMA 1SZEA 1C8QA 3U2EA 4O8AA 4JKLA 1W1ZA 1YPFA 2PRHA 2YXOA 3R79A 3W7KA 3VNLA 5DXXA 4F48A 3HGOA 4Y8FA 1JPHA 1QFEA 2X2GA 3PPGA 4ACZA 5LXEA 3W2JA 4ZA0A 2P10A 3OIHA 1FDJA 2QJNA 3V5FA 2OU4A 1F74A 4OBSA 4L5ZA 1I2RA 5ABEA 5BW6A 1TPH1 1TJPA 3H7UA 1NELA 4IPJA 3ENLA 1NOWA 1BYDA 1PIIA 1DXEA 2WKJA 2GVGA 4PRRA 4DPPA 1T96A 4GRSA 1Q6GA 3KOFA 2DP3A 4XO7A 2ZA1A 2V5LA 4HIBA 1I1WA 3C0QA 2CEQA 2Z1WA 3ZSSA 4AUBA 3HU7A 4RNIA 2GQ8A 2Q71A 2NX9A 3QFEA 4P2VA 3G3MA 5G2IA 1TG7A 4M56A 4L6DA 3IJLA 3R8RA 3UCDA 5D2YA 1W56A 1E0XA 1J2WA 4YHEA 1DWIM 1B3OA 1RY8A 1EIBA 3LV6A 1H1NA 4W4QA 1NF0A 3B9AA 1H0GA 3PBYA 3A23A 3GAYA 2E6AA 4DBWA 4IQEA 1GCYA 5E0FA 5J5DA 4S3FA 5CGMA 1OC7A 4L6HA 4QLJA 1JF5A 2TYSA 3WY1A 3LHYA 1JUKA 1LL4A 3CS2A 4H2CA 3EDDA 3W75A 3FHAA 3GNXA 3FGCB 3FNDA 1JI1A 1K02A 3EXTA 4IMEA 4W7UA 4GIYA 3GNNA 3WFZA 2XIBA 3VX0A 1LROA 1E55A 1JG9A 1ZAIA 1Q8JA 3BZGA 2CHOA 3MUCA 1UP2A 2VFFA 1B3VA 2E5CA 1UCWA 2X2YA 4WQ6A 4AC7C 3W2LA 3T4WA 4I5UA 2EG6A 3A4XA 3HMJG 2CNCA 3NUKA 4KGLA 3QMRA 1XLFA 4MJ2A 4D8AA 1ZBWA 1UR0A 4BFAA 2WZIA 3C8FA 1E4IA 1IEVA 5HQEA 4PMDA 2J25A 4LS1A 3VD3A 5JBDA 4KW2A 2BDQA 3E96A 1J18A 3T0DA 3LLDA 3T0BA 1S5NA 3PFRA 3ABSA 3IVSA 2W61A 3WEOA 5I0DA 5A2BA 4O8RA 3GXTA 1O5XA 1U2YA 3NQ8A 3QPYA 2X7WA 3TA6A 4XVEA 1Z32X 3KHJA 1OG0A 1OINA 1G4SA 4I6KA 5BMWA 3LZ5A 3U7BA 4GUJA 3RFAA 3KP1A 3BW4A 5CSYA 3UPWA 3E6EA 1HKJA 2VTFA 1Y5XA 3L0GA 4PTVA 4G2DA 1ZCCA 2VEKA 3W7CA 4DEFA 1EJUC 3I4EA 3D3FA 1CB7B 4UFMA 1OABA 3R43A 2XGBA 1CXHA 4KEVA 3GU9A 4IZGA 3E2QA 4Z0JA 4HMNA 2D0HA 2C3ZA 3GTIA 4JQAA 3G6MA 2TAAA 1UR2A 5JIPA 4Z1DA 3RF9A 3EMCA 4FO4A 1A50A 3JRKA 2JKAA 4NAEB 1JYXA 1G4EA 3P67A 1V8EA 2W0UA 2DJLA 1BWKA 2O9PA 3TYDA 2NWSA 3N04A 1DL3A 5AHNA 1WKEA 4IG2A 2V5BA 4MLRA 1W5MA 3IUHA 1MVYA 1OZMA 4AZ6A 4CD7A 4LVGA 4GX9A 5TIMA 4DJFA 4DYJA 1U5JA 2JIWA 3ZIZA 4AHQA 3N3MA 3ABOA 3S1VA 5AC7A 2C1HA 3AMKA 1DQUA 3Q65A 1KGXA 3K8KA 1A4MA 1OK6A 4PULA 1O4UA 1GQIA 1I8JA 3OTRA 3S9YA 3IIVA 3NZGA 1OJXA 1QI4A 4MB3A 1IXOA 1CCWB 4HP5A 1QK0A 2PCEA 3WH9A 3DHFA 4D8LA 4FOJA 3L4ZA 2GL5A 9XIAA 4S2CA 5CG7A 2WWDA 4XVDA 1C7TA 3DKJA 1H51A 3MHFA 4JTJA 1FDYA 4H83A 3LD5A 3P8IA 2GWGA 3FEQA 1EGZA 2R1LA 3UWVA 5AYIA 4GQBA 1SQ7A 3W7JA 5CGTA 1M65A 2R1KA 1UD4A 3OVPA 2X1SA 1V02A 3V7PA 4W9TA 2RDXA 2VX6A 1R8LA 4ZOEA 1IEWA 5FJRA 4PGLA 4JS3A 5I3KA 3DKLA 5I3DA 2GUUA 1GK8A 1LM1A 3V18A 4I7VA 3HG2A 1W9VA 1I75A 1PX8A 2QLYA 4QROA 1EWDA 2QCLA 4GYPA 3FAWA 3N19B 1KQYA 1UD8A 4RCXA 1R9YA 1G6CA 4DI8A 4B5TA 1BVNP 3BQ5A 3GIYA 3S46A 3FEMA 3R1ZA 1TV7A 2X30A 3GUGA 3IEBA 3N2TA 4MG4A 3W7PA 4ML9A 3IV8A 4XBJA 3WNKA 4PTXA 2FDMA 3GNRA 3S2LA 2BV9A 1AL8A 1IF2A 3IIXA 3LRKA 4KEUA 8XIAA 3RPDA 4KT2A 2CBIA 3BCJA 4D1JA 1NU5A 4FK9A 3BW3A 1EBGA 2C71A 3WZ0E 3IIOA 1UUOA 4JN7A 2Y7EA 3ORWA 1FWCC 4C6OA 3UZ5A 3SUTA 3W7OA 2E40A 1GOWA 5CPNA 4XZNX 3I3EA 3V1PA 3LENA 1AK5A 1XIDA 4KKXA 1E43A 1K9EA 4PMUA 2P88A 5ECUA 5A8PA 3CZLA 4IIEA 3NXFA 3GH4A 4PEEA 3ARUA 4W86A 2NX1A 2X41A 4ZL1A 1ZJIA 1QUMA 3H4GA 3CZKA 1ICQA 1CPUA 1H1ZA 4N6FA 2VR5A 3PJUA 3S9IA 3B0UX 1UP3A 3JS3A 3RUBL 3EAUA 1OFOA 1M5WA 1FCBA 1VYPX 2PB1A 4QM1A 3EOLA 4Q4OA 1H09A 1LYXA 2DSUA 3C61A 2BB0A 3QJAA 3VOHA 3OP2A 4BWLA 4HOZA 5DT5A 2OELA 4GUGA 3AISA 4V28A 4ZFCA 1HJUA 4HPXA 5DCDA 3S1XA 2C14A 3UCQA 2XFWA 4LYKA 4B5WA 2ZIDA 3VKKA 5F7UA 1MDRA 1YPXA 1RZMA 1BXBA 1OZQA 2YW3A 3HG3A 3NZ1A 4XB3A 1EPVA 1VBGA 1A3XA 2CWXA 1W0MA 3TDFA 3APYA 1PZ3A 1LOSA 4Y9NA 3M0VA 2D0FA 3GBEA 4U33A 4MKSA 2BP1A 3TEVA 1FQ0A 4N42A 3DG7A 3SM0A 3GSMA 2VUNA 3BG5A 4DO7A 3LTPA 4LAUA 3MW7A 3VGHA 1V6YA 1EDQA 3TLQA 5TAOA 1IR2A 3T07A 4L6OA 1RLDA 3LMZA 5IXEA 1K9TA 3E0WA 4XZLX 3O05A 4GKTA 1GVRA 2ZZ6A 3SSZA 2PDIA 3ES7A 3UR8A 1VBJA 1UWQA 3PFMA 1W9PA 3DHUA 3MO4A 3VOFA 3DHPA 3UY8A 3TFXA 2WCAA 3L67A 1T8XA 3TA9A 4GZIA 2XM2A 2Q01A 5BU9A 1OB0A 1GHRA 4FLOA 3HPFA 1DHPA 3PJXA 4JDYA 2WJEA 4QFUA 2VOMA 4D9PA 1ISXA 3ARYA 1GQLA 2E1DA 4Y7EA 1WAUA 3LLXA 3C2VA 4GQ0A 3EPMA 4GZEA 4Q4MA 4PE8A 4HK6A 2D69A 4PMXA 3CHFA 2DORA 2HS6A 2QAPA 3AYSA 4QNEA 4IP5A 1A47A 7REQB 3C2FA 2HCVA 4HZ7A 4HB7A 5CQ1A 3UJEA 3P0XA 2VCCA 3QQWA 3SCWA 4B2DD 2JFEX 3THUA 4O52A 3GM8A 4REQB 1BD0A 1REQB 2EEXA 4H1ZA 1XJBA 3TYZA 1J9YA 2WSRA 4JN8A 4XKYB 4PRWA 1BLIA 3VGFA 3M0IA 4W5ZA 1CXEA 2I7GA 4XZIA 3RK8A 4CUCA 1NVMA 2XJ7A 3KS5A 1GT8A 3IAPA 4GXPA 3L4TA 4AZIA 3IS4A 5DFAA 1SO3A 1VCVA 1EYWA 1TUXA 3VNDA 3N2CA 2QDDA 1FFRA 4NRSA 1XM3A 2IW0A 4DXKA 3FJNA 2QCDA 2CBVA 2A2IA 1GOMA 4ZCWA 1B4EA 3UR2A 2GSHA 3CL8A 3I3DA 3CL7A 1DP0A 3VDGA 2F9RA 1HKKA 3BWWA 2CXEA 3UY7A 1I2OA 1VGAA 3WH7A 2VI0A 4UBPC 5DQPA 3W01A 2XVLA 1LDCA 4TMCA 5K9CA 4B91A 1TX0A 2HS8A 4NJGA 1AL7A 1HXJA 2CBJA 3E5PA 3WJSA 3OW1A 3D6NA 1R2SA 3CPRA 1UWIA 1JFHA 3WQEA 1KRCC 3SCPA 4AVNA 3E2VA 3CAVA 1DJZA 3ZT5A 4CU6A 3LK6A 3W2MA 1W5OA 6REQB 4KGJA 3UWEA 2R9RA 2RUSA 1BF2A 2C91A 3PWIA 3WDJA 2IMRA 1KXTA 3W7IA 1TJRA 4IL0A 1VYSX 1RVKA 3SFWA 4YU1A 3K30A 2NSOA 3ZO9A 1EKOA 3H7VA 2RGMA 4M6QA 2ZOXA 1M04A 3OA3A 1KM2A 4QDMA 2Q02A 2G50A 1ODUA 1JD9A 3B06A 4WDXA 3MANA 7A3HA 2JGQA 4AY8A 5HOSA 3PWGA 1NJJA 3KBSA 1NIUA 4TQTA 3VCNA 4WGHA 4N02A 1GONA 2QCEA 5LIWX 1GEQA 1QTWA 2OT1A 3PSWA 4W5UA 2QPUA 5I02A 2F38A 3G0UA 2I9EA 3QOKA 3GLCA 5MKGB 2VKZG 1E9YB 2B7QA 3NZQA 4TX9A 1US2A 4WXYA 4OIFA 4N9CA 3WLTA 4Q8MA 3FHQA 3PTMA 1EWEA 4NZJA 4DZHA 3F5JA 2NQHA 4C1NA 3A5VA 3TSBA 4M1RA 3ONBA 1CECA 1RK5A 3VKBA 4HHPA 2UZ9A 1RBOB 1WP6A 2P3EA 3U0HA 4A22A 3V5OA 1BF6A 3CL6A 3TWAA 4Z42C 1EP3A 2NUWA 1OG6A 1JCLA 3MUY1 1IT0A 3GG8A 3H55A 4ZQRA 1LTDA 2WMJA 1Q6RA 4DO4A 3E74A 4K2SA 1P0DA 3WDHA 1OCQA 3V0UA 1GVSA 3LMYA 1ISYA 1W5PA 3KL0A 1T41A 3G1XA 3WLIA 1NDYA 1QRQA 4C6BA 3BVJA 4GYPC 1OC5A 1FTXA 4CN1A 3M5ZA 5EU9A 4HJWA 1LBLA 3QW3A 1V3LA 4OTKA 5HANA 3CUFA 2NT0A 3DFTA 1F3XA 3GTFA 3KAOA 4NIRA 3M9YA 5E9XA 3CWHA 2FJUB 3WBWA 5C9WA 4IIGA 1UUQA 4UFIA 5I24A 5PTDA 4EXQA 3MMTA 1NWTA 4NZCA 1RHCA 5AC8A 3WK1A 1IR1A 4G9PA 4ZO9A 3KWSA 3T0TA 5ABHA 3WUFA 3ELFA 4Z2HA 3BOFA 2OEMA 1K6AA 3NOYA 4C5YA 1O1ZA 1ONEA 3TAOA 3NURA 4M1BA 1VFMA 5L9FA 2YIHA 1NFPA 3MA8A 2J13A 3MJMA 5BZAA 4P7LA 2W79A 2HMCA 4EACA 1W3KA 2I57A 2NQ9A 2BASA 3W1NA 2XVGA 2WWCA 3VO0A 2OZ8A 4GISA 5I6SA 3ZJ7A 5CPQA 3J7HA 1UZ4A 2VDHA 2YCLB 1M9HA 3OGVA 2OKTA 2VZTA 1PDZA 4TTUA 1GJWA 2Y6ZA 3NEHA 5G1MA 3ARQA 3B04A 8CGTA 1U1HA 1W3TA 4BWLC 2Q8ZA 1GYNA 1V3HA 2XTKA 1UH2A 2BOGX 1TRIA 4S3GA 3P5YA 4XZHA 4E4PA 1JI2A 2XFFA 4JTLA 1CXLA 3CUIA 3DECA 5RUBA 1VIZA 4KS0A 2J78A 1TPUA 2O9RA 3TJIA 3WL0A 2GGIA 4KFPA 2B7NA 1YE4A 5JH2A 4QQ3A 3ARRA 1IWAA 2YPIA 1H7RA 4AG0A 3ZVHA 3I6EA 4NP7A 3CWOX 5JQ9A 1WXZA 3CAWA 3OZPA 4V33A 3AMDA 1UH3A 4L4PA 2R1NA 1H7OA 4ORMA 5A1AA 4DUOA 4V27A 4J7RA 4W7WA 1E40A 1VFUA 4GACA 1A0CA 4UWMA 2WMFA 3W29A 1TVPA 2G4FA 4BQ5A 2W9MA 1DKWA 3CZEA 2W92A 5GJNA 3S9ZA 1FWBC 3GDMA 3ITCA 2YZ5A 4I7WA 2ACUA 3SUVA 3G2GA 5EBUA 3UG5A 2JQXA 4DF0A 4RNJA 2WKLA 2Z1SA 3HBLA 3NL5A 1GYLA 4MKNA 1YPIA 5CSRA 3VABA 1GVFA 3CUXA 3DENA 3FYOA 4ZGYA 1K8CA 1RPKA 3Q37A 5M5DA 5CPTA 2HVNA 4GI9A 4U5KA 1YYAA 4AYSA 3RRAA 3FA4A 3T2PA 4QTGA 4FOUA 4U31A 4R53A 3RM8A 1C92A 1K6WA 4LUTA 1R5YA 3LQGA 1CTNA 3UA3A 2GOKA 1VAHA 3ALFA 1O7AA 2EJ1A 5DBTA 1YDOA 4QDPA 3RU8X 4LYQA 3PF3A 3L4UA 1RLCL 3QKEA 3O7UA 5JUVA 1JZ3A 3WDIA 3PZVA 3N4AA 1XP3A 2EPKX 3ARPA 1EQCA 1X96A 2BOEX 3W85A 1UD6A 5CBBA 2IKGA 3D0CA 1WZLA 4CVUA 3FKRA 5CLTA 5C71A 4K6AA 3S1UA 5C2GA 1GZ1A 1JZ7A 4PUKA 5J8LA 1ZJHA 4NL1A 1U83A 1VS1A 1UJPA 4JAWA 3VC5A 2PE4A 1B3XA 1SU5A 4AIBA 2XISA 4LGXA 3RIKA 4OOZA 2Z6JA 3R94A 4OV9A 2PSNA 1GOXA 3CMGA 4NNCA 1G4PA 4H4IA 1K4GA 5I23A 1HFBA 1T6MA 3T6CA 2PWVA 2PDGA 4YHGA 4F2UA 2ODOA 2VL4A 3RG6A 4ZSTA 3P61A 3WDQA 3R11A 4AZCB 3LRLA 2AL2B 2QCCA 1RK6A 5TD4A 2YYUA 4W87A 2XIJA 3INPA 2OJPA 3B9OA 2FFCA 1ML1A 1XCWA 2YKKA 1EJTC 4JHZA 4B2DA 2J79A 2V5CA 2Z7GA 2VCAA 4AIOA 1H1YA 3HPAA 4IFOA 4N0RA 4MPKA 1KR0A 3ARVA 3SCVA 1X1NA 5AHFA 4R7OA 1R9ZA 2AKZA 3RU6A 1CB2A 1DTNA 5MHBA 1FBAA 3MCMA 4BI7A 4HT3A 1S3TC 3M16A 4YLWA 2A3LA 4GNJA 1F3TA 1BYBA 3H21A 3LI0A 4MAVA 1JZ6A 2G8ZA 2G3JA 1QNSA 3KRZA 4JKKA 2WK2A 3U9IA 4AIEA 4LFYA 3SUSA 1AZ2A 3L4WA 1XSJA 1CDGA 1GTHA 3HG5A 3GH7A 2QUTA 3N4EA 3VI2A 1KCKA 5D9MA 4M51A 5HR7A 2RDTA 1HVQA 3L5LA 1ADSA 1H7WA 3C86A 4JTHA 1US0A 4A29A 2DEPA 1V3MA 2PWFA 1UC4A 3WD2A 4S39A 3E0LA 2XIQA 1Q6FA 3JW7A 4LVAA 1EDGA 3E49A 4HKPA 3F4DA 2HE5A 4AC1X 4BEUA 1VBHA 4IPNB 4BQ3A 4OZOA 3VGBA 3D47A 4GWEA 4DY1A 2Z25A 4QNWA 4AEEA 1LUCB 2Y2WA 1MW2A 3N14A 5EA9A 3OBEA 2WLYA 4Q33A 4LCRA 3EX4A 3VIFA 4ERGA 1X6UA 2C0AA 3NPUA 1NQ6A 1XRTA 3G22A 1TQJA 4RNHA 1AD1A 3II1A 3HPZA 2D22A 3RLUA 2D20A 1RD5A 2CERA 4O15A 3AYVA 3OPSA 4J1OA 2EPMX 1M68A 4ALDA 4Y9AA 4DBDA 4MSSA 1RJRA 3TQ0A 2Q3RA 4KRZA 3B4UA 2WNZA 4Q8NA 3S5YA 4JR5A 2QZRA 4E0CA 3H12A 2CIPA 2I56A 1E0VA 4HSHA 4AD3A 3UCCA 4XAGA 3A6OA 3B9NA 3LCFA 3NQAA 4IQDA 2FKPA 1JGIA 1CWYA 3WF0A 5EL1A 1A49A 4RUBA 2R8WA 4GABA 1SMDA 3KL3A 4XX6A 2DH2A 3KOWA 2V3GA 4JCMA 5FOOA 4UMBA 3QY6A 2PGFA 3HOJA 3W24A 4AZHA 5E0KA 3QLDA 4JNZA 2I1OA 3N34A 5DEZA 1U22A 1OK4A 4KCWA 3GTNA 1NM9A 3DESA 1MW3A 3KOYA 5ABFB 2ZX6A 1FP8A 2VEFA 5EMUA 1FH9A 3VIPA 3P14A 2VFHA 1XIGA 2PD9A 2YDSA 1WPCA 4ORIA 4GINA 2RH9A 3NQFA 5KSWA 4FZIA 2DIEA 2J7EA 4J3XA 3SY8A 4L9YA 1R3TA 4UMAA 2PTXA 1KXQA 1E6PA 2CZEA 1WKDA 5EMJA 4WR3A 1NQKA 4UNLA 4EWJA 2V5KA 2YL5A 3DC8A 4KEMA 3CB8A 2ISVA 4JKMA 3RM9A 3C56A 1PZ1A 3T44A 2P1FA 3H7RA 1F61A 4M3PA 4O16A 1X7FA 3DCPA 4IXXA 1TZ9A 1BKHA 1V6TA 4N9DA 3WBEA 1P1MA 1XD1A 3ZM8A 5BXTA 3H2NA 3VKJA 1FHUA 3DG3A 4G7EA 1S5VA 3POHA 2YBUA 3CLWA 4PMZA 3M5XA 4US6A 4AEOA 3WSUA 1GZJA 1KLZA 4IFKB 2W63A 3GS6A 1ONRA 1P7TA 3MHUA 1PZ0A 1YBQB 1KXHA 3URAA 4LB4A 4JTDA 1UZHA 4IUOA 2YA0A 3E0VA 3MYPA 1ZBKA 2OO6A 3AXHA 3QR0A 4LS2A 3WQOA 1Z42A 4O0QA 4C6FA 2KAUC 2CLKA 4WK9A 1VBRA 4GNKB 3IVTA 4ZENA 2QNEA 3R12A 1E4NA 5AHLA 4IWWA 2Z1BA 1WQ5A 4WSKA 3RO8A 3EEZA 5C55A 3PZUA 2GDQA 1DIKA 3R13A 2DT0A 4Q3MA 2GQAA 3OLEA 4DWSB 3TYCA 1FHVA 2VZOA 4PR4A 3OBAA 3AYTA 1PL9A 3QHNA 1MNZA 1ISZA 4KWOA 4ZQMA 4A35A 3VE7A 1FCUA 1CLKA 4L4LA 5EMKA 3QMSA 3S4TA 1POKA 3KLLA 5BYWA 3LNPA 4JTCA 1QCWA 2ZX9A 2J24A 1IEXA 5LA1A 1UD2A 3E1F1 4HBKA 1OVDA 4AD2A 1KFWA 4WJXA 1WBJA 3T0AA 1JCYA 5A8OA 4CNNA 4YN5A <