4M80A

The structure of e292s glycosynthase variant of exo-1,3-beta-glucanase from candida albicans at 1.85a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
393
structure length
393
Chain Sequence
WDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Major Change in Regiospecificity for the Exo-1,3-beta-glucanase from Candida albicans following Its Conversion to a Glycosynthase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords EXO-1,3-BETA-GLUCANASE
total genus 150
structure length 393
sequence length 393
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m80A00
3W6LA 3WQWA 3WDRA 1JZ7A 1CLVA 1JZ3A 4N42A 4AW7A 1HJWA 3W82A 1KGXA 4CVWA 3A47A 1MVYA 1ESWA 5BCAA 1A47A 1UKQA 2UY2A 4GZEA 1GPFA 1JDAA 2YL6A 4GIAA 2DSUA 3QHNA 4W87A 4ZEPA 1Y7VA 2GK1B 2J7EA 2XJ7A 3U57A 1LWHA 2YL8A 1E0XA 6A3HA 3ZSSA 1SFSA 4UOJA 1MW1A 2EEXA 3VNZA 2J77A 1WZAA 2D0HA 4TTUA 1IT0A 5HPOA 1V03A 4AY1A 2OWCA 3CUHA 3BH4A 1HJXA 3GNOA 5JBEA 3SURA 4H41A 3WMSA 4Y7EA 1E73M 5CPQA 2FHBA 4HA1A 2G4FA 3N04A 4UR9A 4A4AA 4QAWA 1GCYA 3AHYA 1V6VA 4KGJA 3MUIA 4CVUA 4EKJA 1H2JA 1U33A 1HVQA 1OSEA 3LPFA 4TX6A 1B3XA 3EDDA 1OM0A 1J0JA 1C90A 3II1A 5DO8A 3VPLA 2GJPA 1H09A 1R86A 3DECA 4PMNA 5E0FA 4DWSA 2CETA 3N9KA 1W1TA 1X6NA 4LGXA 5D9PA 3S2CA 3VDAA 2BHUA 1PX4A 1WDSA 3KWXA 1WP6A 3AIVA 3BAKA 3W38A 1EHAA 2YLLA 1PAMA 4QCEA 1QHPA 4D6IA 4UQAA 2UY3A 2XGBA 3AMCA 3GH5A 3MKKA 3VDCA 1E4NA 3MUZ1 3JUGA 3TTOA 4QP0A 1JG9A 1UH2A 5GNYA 5IXEA 2F2HA 5IHSA 1B3YA 3APGA 3VIIA 4P7QA 2XVGA 4F8XA 4D6HA 3D3AA 3ALFA 5A69A 3FHAA 4W85A 5A6BD 5I3DA 3CMJA 4D6CA 5LA1A 3NCOA 1C8QA 3M7SA 1TCMA 1LWJA 2V38A 4FLQA 3GXMA 3GZAA 5A95A 4MADA 3AHVA 5I2UA 1W9BM 4UFLA 1HJQA 4U5KA 2OSWA 2WCSA 4M82A 1E6QM 2WVUA 1CXEA 4D71A 3VMOA 2VC9A 5BXTA 3RM9A 5CGTA 2WHMA 1Z32X 3B8SA 4ACYA 1QHOA 2WHJA 5A3HA 1NH6A 1R7OA 3ARXA 2QMJA 4FLSA 2VQTA 1C92A 2W67A 1CEOA 5E0CA 4V2XA 2DH3A 3WELA 1E4LA 3L4WA 1RH9A 3WMCA 2D23A 5CPSA 1F4HA 1JAEA 1KGWA 3U5UA 1BG9A 2W66A 1VEMA 1ISZA 4ZXOA 3NSXA 3ARSA 3WN6A 1UZ4A 4HOZA 3K46A 2JIWA 1ISWA 2CBJA 1CXHA 3WNOA 3BLPX 2JF6A 5CJ5A 3SEPA 3SUTA 3L4VA 1MFUA 2WCAA 1V6WA 2QLYA 1EQCA 1XSIA 2F61A 1WB0A 1GOWA 2C8NA 1G94A 4UQBA 1FA2A 1C8XA 3UG3A 3VIFA 1V3KA 4PCSA 3T0AA 1XYFA 2J7FA 3QOMA 4UQ9A 1DTUA 1HT6A 2ZUMA 2VURA 4GI8A 3VD9A 4YHGA 3IK2A 3QOKA 1ITCA 2AAAA 1CGVA 2BV9A 3G6LA 1NOUA 5CSUA 3CGTA 3L2MA 2VRQA 3OGSA 1ZBCA 4C7DA 1NWUA 3VTRA 2GJXA 1OINA 3PTQA 5GNXA 2XSAA 3AS1A 5EMYA 1QNQA 2XG9A 2GUYA 3HN3A 1JNEA 4MNKA 4WLCA 3UETA 2B31A 5BYWA 1XH1A 3WDHA 4Q22A 1QNPA 1GHSA 4PSPA 1EOMA 1CIUA 2J7DA 2FH6A 4GKLA 5F7UA 5I6SA 1J9YA 1Q6FA 5A6JA 2ZX8A 2BY2A 3IJ7A 2CHNA 2IUZA 4IUGA 3N15A 1CNVA 1E4MM 3WH7A 1YQ2A 5E6YA 5FL1A 3AIQA 5JIPA 2A3EA 1HIZA 3PZUA 4V28A 3MUY1 1TVNA 5A2AA 4E8DA 5BXPA 1UHVA 3WF2A 5M5DA 4LXFA 3VDBA 2IXUA 4W93A 4PMUA 1VF8A 4JFTA 4UFMA 1IV8A 4LYQA 3U7BA 3UERA 5CPTA 3UEQA 1V0NA 1J10A 1OD8A 1KBBA 5HOSA 2UY4A 1CDGA 4TVCA 4XV0A 2XIIA 2BXZA 3MSGA 3J7HA 2GSJA 4EAMA 2EPOA 2YDSA 1BHGA 1V3LA 4GI6A 1UH4A 1ZL1A 4GI9A 3ZR6A 4A3YA 1R87A 2YL9A 4JCMA 3EDJA 4AZHA 1JF5A 3CH9A 1TA3B 5I24A 4AD0A 2BHZA 2ZUNA 2DSKA 3AXHA 1CGXA 4Q7NA 2WSKA 1SYTA 2OYMA 3VD3A 2VX7A 1JDDA 2WB5A 4PYSA 1JD9A 4MB5A 1B0IA 3RM4A 2GDVA 4GXPA 4LPCA 5AY7A 3SCOA 4E2OA 4X0VA 3AISA 2WAGA 1JYXA 3VX1A 3BSHA 4ACZA 2WVTA 4L4OA 1GHRA 1VRXA 1BYAA 1FHLA 1SR0A 3WD2A 2ZICA 5ABFA 1K9FA 2PF0A 3AS3A 4U3AA 1G5AA 1NOWA 1J18A 1G1YA 3SCNA 1B3WA 4UNIA 2G3MA 3WDJA 2YBTA 3WF4A 1JZ4A 4CU8A 2V3FA 3GDBA 3SUSA 1CGUA 2WVSA 3GBDA 3ZT6A 1JFXA 1V6XA 1J0HA 3FNDA 1TUXA 1UD3A 3DC0A 3N12A 2XHYA 4JFSA 3OLEA 2BNJA 4AZCB 1JD7A 2Z1KA 4HPGA 2A3BA 4PN2A 2C0HA 1GOOA 1XH0A 2E9BA 3ECQA 5EB8A 2VZOA 3M46A 1BQCA 1UR2A 3AMGA 2PBGA 5M3WA 3PBGA 4QCFA 2J74A 2FGLA 2X09A 1LL7A 4LQ1A 4D6FA 3WNLA 3CUIA 3SCTA 3PZTA 3BSGA 1XHGA 4UFIA 4UTFA 2JALA 3WD1A 1JAKA 2DT3A 1K9TA 2G3NA 5I0DA 4JL2A 1J11A 2OLHA 4EE9A 5CLTA 3BXWA 2VJXA 3BMWA 4PMQA 2WM0A 1BYDA 4BQ2A 4AZCA 4U2ZA 3WQVA 3WSUA 4H7VA 2VOTA 4JKLA 3CZJA 3GNPA 1GW1A 1KR1A 2CBVA 4WKFA 4BS0A 1WAWA 4OJYA 4TVDA 3LPOA 1W9VA 1ZBKA 1VEOA 1BVZA 1CWYA 2J7BA 4AEFA 4CU7A 1CBGA 4MNLA 3TTQA 5DT5A 4DWSD 9CGTA 4J7RA 1BPLB 3EDEA 1W2VA 1QVBA 2ZXAA 2EBNA 2WBKA 4PSRA 2CITA 3ARVA 5CQ1A 1ISVA 4RE2A 4E8CA 4W5ZA 3OA5A 2YA1A 4MB4A 1NWTA 1W1VA 2E0PA 2ZE0A 1GQJA 2GJRA 2J8GA 1E1EA 1WZKA 3WEOA 5JBDA 4P7LA 4CD6A 2VVSA 3WUGA 2WLYA 2YL5A 3WBAA 1OGSA 4KMQA 3AXXA 2WZEA 3VGFA 2XVKA 1XYZA 3UCQA 4CD8A 1HXJA 2VZSA 4PTMA 3VIKA 1JYWA 4H2CA 3CUJA 1OT2A 2WLZA 1B1YA 1US3A 1B3ZA 4JFUA 5A6MA 1HX0A 1MXGA 1M7XA 3WF1A 2WMKA 1QNRA 3W25A 1ECEA 1PX3A 1QW9A 3MSDA 3VD5A 6CGTA 4YHEA 4QFUA 1GQLA 8CGTA 3OZPA 2AMGA 4KRTA 5GPRA 1DWGM 1KWKA 1E3ZA 4BZYA 4JCLA 1IZJA 1XC6A 2E8ZA 5M17A 3VMPA 5ECUA 3RO8A 2X1IA 1VFUA 3CHDA 3CUGA 4NRRA 1JYVA 2XGIA 5A94A 4JHOA 3SCPA 1MQRA 2ZX7A 1E40A 4J3VA 2XWEA 1JZ6A 5DFAA 1OWQA 3CHFA 4S3JA 1LLOA 2W5FA 3BGAA 2RGLA 3QGVA 3WL0A 2YKKA 1GORA 4IPLA 1R85A 1FHDA 1XH2A 1I1WA 2Y4SA 5D4YA 3PHAA 4B3KA 1IZKA 5BRQA 3PZMA 3LPGA 3GH4A 2Y5EA 3N13A 3TTSA 3F5LA 2VL4A 1EHNA 1CXLA 3B9DA 5BRPA 3PZNA 1W3HA 4XUYA 1K9DA 4JKMA 1OD0A 5ABHA 4B3LA 4H8UA 3RDKA 3T08A 5IHRA 4CN4A 2TAAA 4HOWA 3W53A 4ZE4A 3WD3A 1EO7A 1ODZA 1K6AA 4PCTA 1E9LA 1JZ8A 3U7VA 4DUXA 4BQ3A 3EMZA 1VB9A 1XGZA 4RE4A 2CCRA 4XB3A 4WIWA 1W3KA 2Z1SA 5A1AA 2EXOA 1GQIA 3MANA 4AZBA 1EIBA 2J78A 3OBAA 2E4TA 2GDUA 1E15A 3VO0A 1BTCA 2FDMA 1XCXA 2WMGA 4PMZA 4BA0A 1DP0A 2FGZA 2W63A 1BFNA 2ZXDA 2VR5A 1J0YA 3FXYA 2ZUUA 2JF7A 4QLKA 4FLRA 3AHXA 4P8XA 3AMLA 4XX6A 1QHZA 4J3UA 1UKTA 3L4TA 4FK9A 3EDFA 3NSMA 4QLLA 4Z2KA 2G8ZA 2QV4A 1V3MA 4P8WA 3AZRA 3VIJA 3MV11 3NIYA 4JZ5A 2O9TA 4A3HA 4H04A 1M01A 1N82A 4KGLA 1BGGA 1UD8A 5IDIA 2CIPA 2BVYA 1HKJA 1Q6EA 1UR1A 3SUUA 1PJ9A 1X1NA 1FFRA 3SCUA 2V3EA 3FAWA 2WMFA 4QLJA 3RJXA 2PBOA 4W7UA 4GO9A 1E6XM 1EH9A 4S3KA 1PZ3A 2OWXA 3VM5A 4JFVA 2YJQA 1LJYA 5FIPA 1CECA 3AZSA 2Y8KA 1C93A 1OIMA 1AQHA 3BLKA 1I1XA 4GO8A 2EPLX 1JI1A 4XZWA 1WZMA 3WUFA 3L4XA 5D9MA 2VI0A 1US2A 2GFTA 2BY3A 1QNSA 1HP4A 4W8LA 1CENA 3QHMA 3W29A 2QF8A 1CLXA 1GQKA 1VENA 4J3SA 1OT1A 1CXFA 4AD3A 4KWUA 1JI2A 3W37A 2V5CA 3SCSA 3VNYA 4P7NA 5AC4A 1J12A 1EGZA 1JIBA 1DEDA 2W92A 2ZIDA 5D9OA 1OGGA 3L4ZA 1E3XA 3TP4A 3O6AA 4HMEA 1VBUA 2FHCA 4ZFMA 4M56A 2C7FA 2JFEX 2E9MA 3MO4A 1RD6A 3CZGA 4UOQA 1Q6DA 1UQYA 5GNZA 2WMIA 5BROA 2QHAA 1V6YA 4LYPA 3VIGA 2XPKA 2HISA 4W7WA 1FH7A 2X8RA 1UKOA 1L0PA 5IFPA 2VTFA 3ALGA 4HZ7A 3VX0A 1QBAA 1C91A 1ISYA 4AC1X 2A3AA 2W4XA 1U2YA 1TG7A 3UG4A 2WZHA 4NZCA 4CKQA 3F5JA 2BY1A 4BQ5A 3ZSTA 3OLIA 3ZQ9A 2WANA 3AI0A 1EQPA 2VRKA 3WH8A 1ISXA 3GYCA 3K8KA 3T2PA 4P7OA 1B3VA 5BXRA 2XIBA 3ZR5A 3SCQA 2WHLA 4W88A 1OBAA 1WE5A 5CGMA 5DT7A 1WNOA 4AWEA 2J62A 3ZO9A 4DUVA 4U5IA 1RP9A 2D20A 1HL9A 4UQCA 3IJ8A 3ZJ6A 1UWUA 1E1FA 4U33A 1GUVA 5D9NA 1J0IA 1C7TA 4J3WA 1CYGA 4DM1A 3DYOA 3F5KA 4DUWA 3OIHA 5JIWA 2PC8A 3N11A 3ARRA 1B30A 1OB0A 3N18A 5A2CA 1DWAM 1UQZA 1TZ7A 1UD2A 5HDRA 1E5NA 1JXJA 4HOXA 4EANA 3BAXA 4CN6A 4UFJA 1XRVA 4WK9A 2Y8VA 1XV8A 2WC7A 3AZTA 3VD7A 1HN1A 4D1IA 1GOIA 3LMYA 4W84A 3CZKA 3KL5A 1EXPA 1QNOA 2YLAA 3A3HA 3BAYA 2PWHA 2DGAA 3AFBA 1HKIA 3VILA 1E4IA 1G9HA 3VIMA 1B31A 3EMCA 4OKDA 4GZJA 1E71M 3WNKA 2MANA 3PZQA 1VJZA 4CU6A 3ARQA 4R5EA 5E09A 5FKYA 3TONA 5EFFA 3ARZA 2WNWA 4CGTA 1CPUA 1DWHM 5I79A 3WQ5A 4TVUA 3OG2A 4MNMA 2WKGA 3AYRA 1QBBA 1H0IA 2QPSA 2ZXQA 3K1DA 2D1ZA 2PB1A 3K8LA 3WDIA 4JL1A 4YN5A 1MWOA 4JKKA 5CG0A 4W89A 4AD1A 4W5UA 1E0VA 1WZLA 4UFKA 3A4WA 1KQZA 3MUAA 1GNXA 2JE8A 4UOZA 3CZLA 1NP2A 1O7AA 3RMEA 4CD7A 3SCWA 1GOQA 3FHQA 5LA2A 1EDQA 1QI3A 2OSYA 1V08A 4M24A 3WY1A 3VVGA 2ZX9A 1AQ0A 4M1RA 1GONA 2CHOA 2ZWYA 2J47A 2GJXB 1TR1A 2VT0A 5A8NA 4ZXLA 1ITXA 2Q8XA 2WC3A 3CIVA 2D3NA 3WQ4A 3RM8A 2G3IA 1UZ1A 4J27A 1V02E 1EDTA 3VINA 3FN9A 3W81A 2J79A 2JIEA 3MMDA 4GPNA 5AC5A 5CXPA 1H4PA 2JEQA 4W7VA 4M80A 1PIGA 2EO7A 4TUFA 1OGBA 2XYLA 3RJYA 1E6RA 4HA3A 3WNMA 4OZOA 1LL6A 2X2YA 3U5YA 5DMYA 1TMQA 1GVIA 4PTWA 8A3HA 1CXIA 1M53A 5E6ZA 2W91A 1WCGA 3WMBA 1BYCA 3QHOA 1BAGA 1D2KA 1P6WA 3A6OA 2DT0A 4OOZA 2WVVB 1C3FA 2HVMA 2QPUA 2DPEA 3PZGA 4XZBA 1D3CA 4CN1A 1NP0A 3DYPA 1HF6A 3ARUA 3HU7A 4D6JA 1KQYA 3N17A 3VD4A 4LX4A 3K4DA 3FY1A 1XD0A 1LG1A 2ZUSA 4M8UA 4GQQA 1UKPA 2X0HA 4J3TA 4F79A 1UA3A 4JFWA 3RIKA 3WBEA 6TAAA 4C7GA 2VUYA 4B9YA 2D22A 3SCVA 7CGTA 1TA3A 2DT1A 4CUCA 4EK7A 4Z2HA 1H41A 3VGDA 4UZSA 5A8MA 2CXGA 1MW0A 3ZJKA 1XCWA 5C71A 3KZSA 4PTXA 3WH5A 2BHYA 4AZ6A 3BAIA 4V27A 1Q4NX 1LF1A 5D8ZA 1QPKA 4IISA 4OBSA 5A8PA 3CTTA 3I3DA 2DIEA 1W9UA 4IPNB 2WMJA 4MJ2A 3VDHA 2VZTA 3VKKA 2Y24A 3CO4A 4M81A 3WNNA 1XSKA 1HP5A 2ZXBA 1KFWA 5CLWA 2YOCA 3WF0A 1QW8A 5FOOA 3CMGA 1UKSA 2D3LA 1KXQA 1W32A 2VZUA 3HJEA 3KL0A 1WKYA 1CTNA 1H5VA 2CESA 4U2YA 1UWTA 3IAPA 2PWFA 1VIWA 5KZ6A 2BVTA 2XWDA 2WWDA 4AD2A 1JF6A 1KR0A 2DDXA 3WUEA 3WQ6A 2NSXA 1EDGA 1QI5A 3GXFA 1B2YA 2G3JA 1UD4A 1NOFA 3ZMRA 1EA9C 1W91A 4FLOA 1PPIA 2V3GA 4GINA 1PZ2A 2PWEA 4YPJA 4KRUA 1GOKA 4KH2A 4W8BA 1I75A 3OZOA 4HZ8A 7TAAA 4CD5A 3GXIA 4D6GA 1VAHA 1UH3A 3T2QA 4MJ4A 1HJVA 2IXVA 2XM1A 4P8VA 4LYRA 2CKSA 3AQUA 5JBFA 3IANA 2A3CA 2E3ZA 2RGMA 5GQBA 5TD4A 4AXNA 3EYPA 2V5DA 5HNNA 1JXKA 2VCCA 3CBWA 4WF7A 2NW0A 1GJWA 1Q6GA 2VMFA 2VZVA 3CHEA 2XFFA 4PRWA 1W3LA 2J8FA 4X9YA 1ZJBA 1KBKA 1LL4A 1V3JA 4D6EA 2ZUWA 3GNRA 1H0GA 3B9EA 1VFFA 2DSZA 1KXVA 1V02A 3IAQA 3KEHA 3AMKA 3PTKA 1ZU8A 2XVLA 5EBAA 5AYIA 1W9XA 2VO5A 3VGHA 1A3HA 4HA4A 3TTYA 1E5JA 1FP8A 4P7RA 1J01A 3BAWA 3POCA 2VRJA 2DSVA 1O6IA 3K8MA 4WKAA 2WC4A 3WEZA 4W86A 2VCAA 1KCLA 3MMUA 1HKMA 1D7FA 3SIMA 4DWSC 4PMYA 4MNJA 3A4XA 2BVDA 3AS0A 2VX6A 4RL3A 2EPKX 3PTMA 1W1YA 2WBGA 4U31A 4K68A 4Z2IA 4MTVA 1AVAA 1XD1A 1NARA 1FH8A 1UWQA 2WSPA 1PX8A 5A6SA 4W8AA 5FCZA 3AIUA 3W0KA 1JFHA 2NT0A 2EPMX 2WCGA 3IJ9A 4HPHA 4Z2LA 1V0MA 5EFDA 1MW3A 2D2OA 3ARYA 4D1JA 3AHTA 1AQMA 4C7FA 2GVYA 4MAVA 1CGWA 1W2PA 2ZWZA 3VIOA 3AHZA 1BVNP 3NYDA 3D5HA 2ZOXA 4AIEA 2D0FA 1VEPA 4MAZA 3THDA 4J28A 2PWDA 4AEEA 2XVNA 4TXEA 2CNCA 4BF7A 5DEZA 1GZJA 2ZX5A 1JGIA 2WVVA 1HJSA 1K9EA 2OYLA 1VFOA 3EBVA 4IM4A 3T2OA 1E70M 3BAJA 2WXDM 2A3HA 2QMKA 7A3HA 4NRSA 3TA9A 3I3BA 1MW2A 2VX4A 2YIHA 3AXIA 2J7GA 3I3EA 3VUPA 1W9PA 2WHKA 1SMAA 2XSBA 3AYSA 1JNDA 3KL3A 2O9PA 4HP5A 2DSWA 4B16A 5LYRA 1WPCA 3WIJA 3M07A 4ATLA 4JHZA 3NSNA 4U3CA 2O92A 4ZE5A 4R27A 4JIEA 1HL8A 4B15A 3RPMA 5ABGA 3UR7A 4TTGA 1DWIM 3HMCA 3NUKA 2WMHA 2ZUTA 3MU7A 1R7AA 1YHTA 4DWSB 3L2LA 2CBIA 5A2BA 4HU0A 1E0WA 1UWRA 4HTYA 3W4RA 4UQDA 4PMVA 3CZ8A 3L4UA 1PEZA 3QR3A 5A6BA 1E6SM 1ODUA 3ARTA 1HJUA 3VM7A 1UOKA 4PMOA 1R8LA 3VIPA 2BFGA 1UA7A 3VGEA 4Z2GA 3KE0A 1EOKA 4F9DA 3WFZA 4PEEA 4H8VA 1DHKA 2CERA 2XM2A 1LG2A 5I77A 5A6KA 2DQXA 3VU2A 3GTNA 4RE3A 1MYRA 1W9DM 1C7SA 3POHA 1SMDA 5KEZA 1G0CA 3WDQA 2CPUA 2UWFA 2O9RA 4WSKA 1UUQA 4X0NA 1MXDA 4OUEA 4NSBA 1E6NA 4MB3A 3VGGA 2XTKA 3WH6A 1PBGA 1E6ZA 3ZT5A 2W62A 3T09A 3OGVA 5DF0A 2ESCA 2VQUA 4PUDA 4WSJA 4NF7A 5CSYA 1GOMA 3NDZA 3BCDA 1W1PA 1F4AA 3W26A 4E4PA 2FHFA 2XFRA 3AMDA 4ATDA 2D0GA 3WL1A 1OCQA 2CKRA 4MB1A 1KXTA 3G6MA 4HZ6A 1MQQA 1NWSA 4AISA 1BSIA 4ZENA 4WKHA 4OOUA 4AIOA 2YA2A 3CHCA 3WEMA 1J0ZA 2J7CA 3AROA 4MDOA 3RILA 2WMIB 3NDYA 5BWFA 4AZ5A 1Q6CA 2UY5A 1E56A 1PIFA 4D72A 3WD4A 3W6MA 5FL0A 1MQPA 1NQ6A 1TFVA 3SCRA 4AIUA 4MDPA 3LPPA 3PZ9A 3WF3A 1S46A 1UD5A 3AICA 3MMWA 1FOBA 4F9JA 3FAXA 1BF2A 1NWRA 1GVYA 2X05A 2NT1A 4AZ7A 2ZX6A 1VFMA 1UR8A 5A8QA 2OWWA 5ABEA 3OGRA 3WUBA 1ZB5A 3GXDA 1JZ5A 1CZ1A 2E8YA 2VR4A 3WKZA 4HMCA 1HVXA 1U30A 4TX8A 4F66A 2GK1A 2J7HA 2YDQA 2ZUVA 4ML4A 2XFYA 3VGBA 1H49A 1UG6A 1E43A 1LQ0A 3FW6A 4UQEA 4JAWA 2J4GA 1WDPA 3DHUA 3CLWA 5HPCA 2XUCA 3UR8A 1CGTA 2PI6A 2YBUA 2Y2WA 1H1NA 3CUFA 4OIFA 1EO5A 1KB3A 3WFLA 2J25A 3S6TA 3A4AA 1V6UA 3F4VA 2E9LA 4P8UA 1UR9A 1UR4A 5I5RA 1AMYA 1BYBA 5C8BB 2VVNA 4WJXA 1HKKA 4H8HA 3WD0A 1V3IA 3AIBA 1KXHA 4OBRA 2EPNA 5C70A 3AS2A 1NM9A 3CPUA 1H3GA 2DIJA 5HXMA 2PWGA 4M29A 4DM2A 3GBEA 2DT2A 4UCFA 3WQ8A 2BS9A 3B9AA 3AIRA 4J3XA 1JYNA 3BMVA 1E6PA 3NJ3A 3GM8A 1V0LA 3E1F1 4L4PA 2WPGA 1B9ZA 1M04A 1GJUA 5IFTA 2E40A 1MFVA 1VBRA 1TE1A 2EQDA 3O2LA 3SUVA 1WDQA 1ZBWA 1UD6A 1W3JA 3ZJ8A 3UG5A 3AIWA 3BC9A 1DWJM 3W28A 1ZJAA 3GH7A 5E9AA 1JL8A 4ATWA 2VNCA 2BY0A 5D8WA 4MPKA 1HNYA 3AJ7A 3DYMA 3M6DA 3K4AA 2G41A 4HMDA 5A6LA 1FP9A 4CCEA 3WNPA 1WO2A 4ACZB 1FFQA 1X6LA 4AMCA 2F8QA 4AD4A 2JEPA 1BLIA 2X0YA 4N0RA 3SUWA 2D24A 3OB8A 2VCBA 1CGYA 4TOQA 4PBGA 2EJ1A 3ZM8A 3L4YA 4URIA 4BCEA 5A6AA 1XSJA 2YDRA 3OLGA 5I23A 3VIHA 4D6DA 4AZIA 3MV01 4UFHA 2V3DA 5M03A 1VJSA 3OLDA 2WW5A 3RCNA 1B90A 3W24A 2AOSA 3T0BA 2CEQA 4PMRA 3BCFA 3EDKA 1UWSA 2FH8A 3PZVA 1KGUA 4GZIA 1JZ2A 3AOFA 1M03A 4FMVA 1QI0A 4PUEA 3O9NA 1TVPA 5ABFB 1JDCA 4CD4A 2WWCA 4PTVA 1C8YA 3PN8A 3ARPA 3PZOA 5JUVA 3T0DA 4HU8A 2WK2A 1UWIA 3ARWA 1E72M 4BQ4A 4B9ZA 3ZIZA 4GQRA 5E70A 3THCA 1FH9A 1QI2A 5A8OA 1BGAA 3PZIA 4CCDA 2YA0A 3ZJ7A 4FF5A 3WH9A 2DH2A 1BG4A 2OSXA 1KWGA 3MS8A 3W27A 1WDRA 3AIEA 5LA0A 1OIFA 2VX5A 1J0KA 1UYQA 4UZUA 5AYBA 3WDPP 4QDMA 1QOXA 2WYSA 1UR0A 1KCKA 3VOCA 1RP8A 2XVPA 5I78A 3ZT7A 1DWFM 1CXKA 4AD5A 4PMDA 4AZGA 2W61A 1G01A 5FD0A 4Z2JA 3UESA 3EMQA 4CCCA 2WZIA 2CBUA 2OYKA 1ZBVA 1QI4A 3VMNA 1L8NA 3TOPA 1V3HA 4PMXA 1RPKA 3WENA 3DHPA 1H11A 1E55A 2BXYA 1V0KA 4AYSA 3CZEA 2DEPA 4NI3A 3ZOAA 1ZS2A 2CYGA 5CZKA 2O9OA 3N1AA 5BXSA 2J75A 2WKLA 5HBFA
chains in the Genus database with same CATH superfamily
3WQWA 4MZYA 3WDRA 1KCXA 1MVYA 1ESWA 2V82A 4R85A 1UKQA 2UY2A 1JDAA 2YL6A 4GIAA 3OBEA 1Y7VA 4PFHA 2GK1B 2V5JA 2ACUA 3MO7A 2H8ZA 2YCEA 1ITUA 4UOJA 1MW1A 3L2IA 1WBHA 1IT0A 1TB3A 2ZZ7A 5F1UA 3PSWA 2HE8A 1V03A 3DI1A 1K3UA 1HKWA 4M51A 3GNOA 1SQ7A 2XIOA 4LAKA 4H41A 1Q63A 1TJRA 4Y7EA 2VR2A 1E73M 1VD6A 1P43A 3CB8A 4HA1A 2BG5A 3TQ0A 4NXSA 4A4AA 4QJ4B 1EIXA 3FDKA 3NEHA 3CNYA 4O4WA 2AL2B 3VCNA 4TX6A 4AC7C 1TKKA 4JD4A 4ZO9A 1C90A 3KBJA 1X38A 3II1A 1R5YA 4JPGA 2BB0A 4QR6A 3VPLA 1R3TA 2GJPA 3DECA 4OT7A 4PB4A 3F4NA 4LGXA 3WX7A 5BRBA 4JXCA 1PX4A 1SO4A 1WDSA 4IH3A 4LV4A 2QUMA 3BAKA 3HG3A 4C6IA 2NQ5A 2V5LA 4DJFC 1PAMA 5H2ZA 2Y89A 1FHVA 4PH6A 3AMCA 3KVLA 4NZ1A 2AAMA 3MKKA 3VDCA 3WBWA 3TTOA 3GC5A 2KX9A 3I4KA 1B3YA 1QRQA 2X1RA 5H8MA 4S39A 4ZMGA 3GVWA 1XIBA 5A69A 3KW3A 3CJPA 3FHAA 3W7RA 4W85A 2OZTA 3DESA 1T5AA 2PFHA 4D6CA 5LA1A 2Y8UA 1DE6A 3PWGA 3M7SA 1TCMA 1LWJA 3HPFA 1ZAIA 1HJQA 1X8CA 3CQIA 2OSWA 3GVQA 2WVUA 3ABRA 4IGHA 2VC9A 3GX9A 3HGRA 4IF2A 1Z32X 1EKOA 3NOEA 4ZB2A 4JQ2A 5A3HA 1Q2SA 5LIUX 3KDOA 1CEOA 5E0CA 2Y6ZA 2DH3A 5FSDC 3T05A 1E4LA 1EWDA 1JAEA 3WLQA 2OTDA 1AJZA 2OT0A 1LDCA 3NSXA 2ACQA 3BSMA 4IOTA 1UZ4A 2DVUA 2HRWA 2JIWA 1XCFA 1T40A 3ZVHB 1W1A1 3GG8A 2PD9A 3WBXA 1MFUA 3VNLA 2NLYA 3S9ZA 4MYXA 3CU2A 4RNHA 3SRHA 2UZ9A 2F61A 5D03A 1DVJA 1GKRA 6REQB 3M0HA 3GU1A 1C8XA 3ITLA 1C9DA 3QOMA 4E2VA 2OEJA 2FZMA 2PDJA 4HPJA 2VURA 5HA7A 3IK2A 4LSBA 1B57A 3QOKA 3G6LA 1NWUA 1UIOA 3E3HA 3MQTA 3VTRA 3KLKA 3DBNA 4EIVA 4K7YA 1D3HA 3I65A 2XG9A 3KWSA 5EL1A 1JPKA 3KS5A 3UETA 1LRNA 2O55A 3URBA 1XH1A 3WDHA 5LXXA 2DY3A 1K4GA 3CUXA 3IS4A 3CAKA 2OKTA 3PFRA 2FH6A 4GKLA 4E2DA 4MIMA 3LQGA 3S1XA 5A6JA 4IUGA 1V93A 1KM6A 2X40A 4KFPA 4QQUA 1WV2A 5E6YA 5FL1A 3AIQA 3IGSA 2PU1A 4N4QA 3OYXA 5JIPA 4Z08A 4V28A 3RGTA 5LNSA 3QFWA 4MZ8A 1S5NA 5K9XA 3QMTA 2PCQA 5EBUA 1J96A 2CLFA 1VF8A 5CPTA 1OD8A 1F9CA 7REQB 4TVCA 2D73A 5XINA 1L8PA 1TE6A 2BXZA 3GD6A 3J7HA 2TSYA 2GSJA 4EAMA 2YDSA 4GG9A 4GI6A 5ECVA 4GH3A 3LU2A 4DLFA 4A3YA 1Z41A 4GH1A 5K3VA 4JCMA 3PVFA 2P0OA 3M5VA 5I24A 2QCHA 4JYDA 2FMNA 2BHZA 2ZUNA 2DORA 4AUBA 4C90A 2WSKA 2OYMA 2F6UA 4PYSA 4GYJA 2Z6IA 3EOEA 1U22A 2RKXA 3RM4A 5AY7A 3VDGA 2INFA 3AISA 3ANVA 4HQVA 1A53A 4O13A 4ACZA 4IG2B 2OX1A 2Z26A 2EG7A 6ALDA 2WVTA 1QDSA 3WD2A 2EGZA 4AMAA 3QPYA 3GIQA 4UTLA 4U3AA 5AOUA 4LUJA 3QQ0A 1NOWA 1J18A 4IX2A 1G1YA 2GQ8A 4UNIA 2G3MA 3PPGA 3WDJA 4PL1A 4GYPC 3GNDA 3WF4A 2QDHA 4CNUA 3V0TA 4YNGA 4DF0A 3GDBA 4H6RA 1JFXA 3WLRA 1J0HA 3OVQA 1TUXA 4DLMA 3N12A 1QNVA 2BNJA 2NWRA 4FNQA 2Z1KA 2A3BA 8XIMA 1XH0A 5HWJA 2VZOA 1UR2A 4LF1A 4K36A 5EU9A 2PBGA 4H7CA 5M3WA 4LVGA 4QCFA 1IXOA 2FGLA 3NPUA 4H6KA 1R6WA 2DV0A 5FJJA 1K02A 3WNLA 4ZL1A 3SCTA 3BJFA 1DJNA 2DT3A 1K9TA 4L9YA 1DJWA 5I0DA 4JL2A 3R0KA 2CZVA 3BO9A 3GHTA 3BMWA 5C9ZA 4UMBA 4H7VA 2VOTA 1YBQA 3GUGA 3CM4A 3G8RA 3I4EA 3KBSA 4NASA 3PSVA 5SWUA 1ZBKA 1X7FA 1CWYA 2J7BA 4AEFA 1QFEA 5AHMA 1ICSA 1S3HA 3LRMA 1GYMA 2PURA 4I90A 1L6SA 1A4MA 3FEMA 3LHUA 3MJYA 5F4XA 4YLWA 4KS0A 4OV4A 2CITA 1ISVA 4RE2A 2WZTA 3CASA 3DG3A 4ONVA 4W5ZA 3OA5A 4MB4A 1NWTA 2ZE0A 1GQJA 4R9XA 3V3WA 1KFEA 3LBCA 3JR2A 2DZWA 1S5VA 4WZHA 5JBDA 2NVAA 8RUCA 3QV9A 4AVOA 4YCOA 2PA6A 3B0UX 2ZRUA 5FAGA 2WZEA 3BDKA 4WDXA 3TJLA 5JQ9A 4EXAA 4CD8A 1GVQA 4ORMA 2OPJA 4X22A 2HS6A 1JYWA 1MDLA 3B3DA 4FX6M 5TNVA 4GJJA 4QROA 2NVDA 1HX0A 1MXGA 3B4UA 1M7XA 4X2PA 3WF1A 1DJGA 2WMKA 1KBJA 1EPXA 1FCQA 3LG3A 4XSMA 4AYGA 2NX9A 3EOLA 1ALDA 1DWGM 4C6QA 3C0SA 1E3ZA 4JCLA 5M17A 3I6EA 3VMPA 3P0XA 1TV7A 2X1IA 2R1PA 2VP8A 4GX8A 3ZS4A 5U4NA 1YPXA 3SCPA 4UTHA 2X41A 2XWEA 3S5NA 3CHFA 4S3JA 3QGKC 3U3HA 2Y62A 3MHUA 1Z89A 2C71A 3PWAA 2FDSA 2KZHA 1PDZA 3VZYA 1GORA 2V8ZA 1R9ZA 1R85A 3XINA 3BUVA 4B3KA 1IZKA 4ZSTA 3GH4A 3VXGA 3F5LA 4NZ3A 7REQA 3UZXA 4XUYA 1Q8AA 1A5KC 1XIEA 3H7RA 5ABHA 1XINA 2I56A 2PLCA 1LYXA 1ZY9A 5IHRA 3TNOA 3ITGA 4JNYA 2J9ZA 3W53A 1PE1A 4ZE4A 3SRFA 1ODZA 4PCTA 2ZTJA 4GNVA 2NV2A 1P1XA 1XGZA 3U2CA 3I10A 3M16A 2Z1SA 3FX4A 4WY0A 3CTLA 3MYOA 1ME8A 2OQHA 3R58A 2GDUA 4JQAA 1TTIA 4HYWA 1E15A 3VO0A 4GIEA 4HNLA 1XCXA 2FGZA 2W63A 2QDGA 1M7PA 1BFNA 3H2OA 3BW4A 3AMLA 2WV8A 3F4WA 3RRXA 4FNRA 4J3UA 3L4TA 4FK9A 3W1LA 3NSMA 3W02A 1IQ8A 4HGXA 4LOCA 3TROA 4B5NA 4DJED 3VIJA 4D8AA 1I8JA 3MV11 3NIYA 4JOMA 3KRSA 3W7PA 1J2WA 4KGLA 1TPUA 1UD8A 2CIPA 3TXVA 1VBHA 4I5RA 3BTNA 4ILSA 3SUUA 1X1NA 4UMCA 4KWSA 3RJXA 1K03A 4W7UA 4S3KA 1OC6A 2E1DA 2YJQA 1DIOA 3SY1A 1KM4A 4LH8A 4LFYA 2Y8KA 1C93A 1OIMA 1E1CA 1LUCA 3VNIA 4L65A 3P6LA 2XIJA 4IHCA 5BZAA 5C9XA 1IT7A 5BNKA 1RPXA 2GFTA 4DF2A 4C65A 2DZAA 4WOQA 1ADDA 1CLXA 1GQKA 1VENA 4XVEA 3ITTA 6REQA 3UJSA 4R88A 1EJWC 1KFBA 1RQBA 3SCSA 4MKSA 1NFBA 4PBFA 2OXNA 2Z27A 2PP0A 2NV1A 3FV9A 1JIBA 4LUSB 1O95A 3H53A 1A80A 1E3XA 3LXCA 4ML9A 4R9OA 4HMEA 1VBUA 3TAOA 2C7FA 2PDQA 1JCJA 2JFEX 4GJ1A 3S5SA 1RD6A 1G4EA 4QEHA 2WMIA 5BROA 4GIYA 3I6TA 3V1HA 3NR0A 5FJUA 3OQEA 1TV2A 3UZWA 3ANYA 1L0PA 1IWAA 2IKGA 2VTFA 1JDFA 1VPQA 3VX0A 2INZA 4MLJA 1ISYA 4KKXA 4IPIA 3GDMA 5AYYA 1U2YA 4LCSA 1Q85A 2WZHA 4CKQA 4O57A 4BQ5A 2OB3A 3OLIA 3AI0A 3UPWA 1EQPA 3WH8A 3GYCA 4DIAA 1WDDA 1YRRA 2WHLA 1OBAA 2OX4A 1T41A 4DO7A 4GYPA 2E6DA 3UT0A 3SQLA 2QJHA 1TMLA 3QN3A 1RP9A 1RCOB 1I9CB 1NF0A 3QGAC 3WQEA 4X60A 1E1FA 5D9NA 4J3WA 1QK0A 4UTMA 5PTDA 4DUWA 4JTTA 2YW3A 4H8NA 2PWUA 4HSOA 5HNTA 4FA3A 1ME9A 3CWOX 4I6VA 5A2CA 3SN0A 5HDRA 3THUA 2FVMA 1TPEA 4CN6A 4RPQA 5HK4A 2WC7A 1Q5MA 1O5KA 4HJWA 3RLVA 1M5WA 3UZJA 3PWIA 3CZKA 2RDUA 2DGAA 3H7VA 1G9HA 2IKJA 4O16A 1SM9A 2YX0A 4Q3MA 2GGHA 3TKFA 1E71M 4PGLA 3PZQA 4CU6A 3O6YX 3TONA 5JMUA 3QBUA 3ARZA 5IBXC 1RXOB 4LNCA 4C6NA 3S1VA 5I79A 4O52A 4L6DA 2WKGA 1QBBA 3CWNA 1LLZA 3K1DA 2D1ZA 3LUTA 4K6AA 1GYNA 4JL1A 4JX5A 1MEHA 2E5BA 4W89A 4W5UA 4UFKA 1WZLA 3F03K 1JCNA 2VGBA 3RMEA 3TNBA 1GOQA 3RX2A 3V5OA 1EDQA 2E09A 3WY1A 2ZX9A 3A5FA 3KHDA 2IKIA 1BXNA 3N6JA 1F2JA 5EMKA 2D3NA 5C9WA 1KM0A 3RM8A 1XYMA 3UY7A 1V02E 3VINA 3FN9A 2J66A 3SR7A 1G4TA 4GBDA 1O12A 4MY8A 2Z0IA 3GE7A 1XYLA 5AC5A 4EPBC 3F2BA 3GWQA 1F76A 1ONRA 1PIGA 1IF2A 4TUFA 3RJYA 1YNQA 1G67A 1RCQA 4OZOA 1TMQA 2A0NA 3TFCA 4I9AA 4IGNA 2DZSA 4PTWA 1CXIA 3JZUA 2D2GA 2YYUA 1ZUAX 3K2GA 1OHLA 4YCPA 1ZHAA 5E6ZA 1XGDA 3GXNA 1EEPA 2ISFA 3WMBA 1UOZA 1BAGA 1D2KA 2OQLA 3FGCA 2DT0A 1K8XA 3W7CA 2WVVB 2DPEA 4XZBA 4JS3A 3ARUA 3EOUA 4F48A 4LUSA 3VD4A 5HUPA 2PLJA 2PAJA 4S1FA 1LG1A 2ZUSA 1UKPA 1I0BA 4F79A 3UY8A 2PEVA 5A8GA 1YE4A 4PEKA 4MHBA 3Q45A 1JQVA 4NJGA 3FIGA 1A5OC 3MB9A 1TA3A 1TPB1 4Z2HA 4JICA 3R4IA 3W1QA 4MWAD 4RZ6A 5A8MA 2CXGA 4ADSA 3LCGA 5BU6A 2D69A 3STCA 1XCWA 1TPVA 5C71A 2PD5A 4CNNA 3E02A 4AZ6A 1MMFA 1Q4NX 4RDZA 1Z69A 4OFCA 4E3TA 4OBSA 4Q6XA 1YX1A 3VDHA 4HZMA 3UGRA 3Q65A 3FYYA 3VKKA 4LUIA 3RCMA 1KFWA 3S5OA 2HTMA 4MJMA 1KXQA 1W32A 4IQDA 3HJEA 4EP8C 1WKYA 4HHHA 3H24A 1UWTA 2B4GA 3MBDA 2PWFA 5KZ6A 4AD2A 1M9HA 2P88A 4RNFA 2ACRA 1GZ1A 1XBXA 3JRKA 4UIOA 4BKNA 3GXFA 1OYAA 1GQNA 1UD4A 1BWVA 1SFLA 4US6A 3ZMRA 3KBMA 5BMXA 1W8SA 2W3ZA 3KBWA 4FLOA 2FJKA 1PPIA 2PWEA 3WLSA 1TSIA 2WJZA 3UU0A 4W8BA 1R9XA 7TAAA 4CD5A 1NU5A 1SZFA 1VPYA 3GXIA 4D6GA 1UH3A 3WLOA 5CJMA 3T2QA 1RHCA 3CQHA 4MJ4A 3IGHX 4MUZA 1XIDA 3R0DA 4C1KA 1LBMA 3UXKA 3NPVA 3S5YA 4Q7BA 4A2RA 4B5TA 3W7DA 3IANA 4TU1A 4YU1A 5GQBA 5TD4A 4YL2A 3M0IA 5LZLA 3BL3A 3B40A 1JXKA 2NW0A 1A5AA 1GJWA 3TN5A 2X7VA 2VMFA 2I5IA 2AL2A 4RZ5A 2J8FA 2ZA2A 1V3JA 3LLXA 4FB7A 5KZEA 1KXVA 3IAQA 1FCBA 3KEHA 1PKLA 4AU0A 5EBAA 2CU0A 4H19A 4WOZA 2OEKA 4JIHA 1E5JA 4P7RA 1NEYA 1J01A 4NIRA 4K7VA 2DSVA 3WG6A 1O6IA 4XD4A 3O1NA 4YYCA 3WEZA 3NYZA 4W86A 4IQEA 3GU9A 2VCAA 1M68A 3MMUA 3SIMA 1H7XA 4RZBA 2BVDA 3AS0A 1DYSA 3EWBX 1W1YA 3NQEA 2YXOA 3SN1A 1MEWA 1X39A 1FH8A 1UWQA 2WSPA 3RO6A 3MYPA 3TFXA 4NYYA 4LAZA 4W8AA 3TLLA 4OE7A 4Z2LA 3UR2A 2D2OA 3A23A 3A21A 4D1JA 1UWAA 1KRBC 5C6MA 5G2HA 4NJKA 3BANA 1BVNP 4EOUA 1HO1A 1PB0A 4J28A 2PWDA 4AEEA 3FDGA 4WXZA 2XVNA 4EX4A 4BF7A 5DEZA 1GZJA 2JBMA 1JGIA 2WVVA 2ZX5A 1JVNA 3S1GA 1VFOA 3EBVA 4OVXA 1BD0A 3WLIA 4BY3A 4LAUA 3FSUA 2Z1WA 2J7GA 3HPZA 4FALA 4FNUA 3I3EA 3D47A 1F3EA 5HMSA 5I07A 1YTEA 3UWQA 3N6HA 1CB2A 1NDYA 1QASA 3AYSA 1JNDA 1YPFA 2O9PA 4HP5A 2DSWA 3TR2A 3C3UA 1PIIA 5FACA 1WPCA 5F2GA 2FZ8A 1FWRA 4JHZA 4L4MA 4U3CA 4QRNA 4JIEA 2Z29A 4B15A 1Q2RA 5CC6A 3V1PA 4N9EA 4XISA 3B97A 1QO2A 1DWIM 3HMCA 3KRZA 2X42A 2ZUTA 1SGJA 4L6OA 1DL3A 1NFGA 4XTDA 3G1HA 3L2LA 4MPQA 4B4HA 1XC4A 2GGGA 4AF0A 3L4UA 4ORIA 1PEZA 1XLGA 3QZ6A 3S4TA 1ODUA 3ARTA 5EMJA 1H63A 4YTRA 1RK5A 2HWGA 2BFGA 1UA7A 1MUCA 3KE0A 1EOKA 4ZBCA 2DJLA 4LJ3A 3WFZA 2ZRVA 1XUZA 3G1YA 1W5NA 1GVEA 3O07A 3CXOA 4GC4A 2BMBA 2YXGA 1MNSA 4G2DA 1M65A 2F38A 5A6KA 4PB5A 1VBGA 4RE3A 4G8TA 3G1VA 4UTWA 1W31A 2WOQA 1HGYA 1UUQA 1Q13A 1RUSA 3M0ZA 4AG0A 3WMLA 4NSBA 3TW6A 5D2TA 1LOLA 3SGUA 5K2ZA 1PBGA 4JTCA 2NUXA 5DF0A 3R79A 2UBPC 4NF7A 9XIAA 4JTRA 1W1PA 4I8YA 2VEIA 1IGSA 2D0GA 3ABSA 5CPMA 3WL1A 4S3CA 1OCQA 2YZ5A 2CKRA 1J5SA 2BVWA 1SFTA 5MKGB 2GJNA 4HZ6A 3LOTA 3GVRA 4AB4A 5FJRA 3PUOA 1MQQA 4LBRA 3H4WA 4M19A 1BSIA 4AISA 4ZENA 4WKHA 4KPLA 4MWAB 4L5ZA 5JH2A 3O6DA 3QJAA 1J0ZA 1YE6A 2YFOA 3RILA 5DLCA 3OHIA 4AZ5A 5CEWA 4C6FA 4CNTA 1Z48A 3O0FA 3TU9A 4PUUA 2R1KA 1MQPA 1TFVA 2R1NA 3GTIA 4MDPA 3MW7A 1UD5A 2CXEA 4K39A 1NWRA 4AZ7A 1VFMA 5ABEA 3SY8A 1GJPA 3BV4A 2I1OA 3GXDA 3BQ6A 3TZFA 2G95A 3WKZA 3GW3A 4HMCA 1HVXA 2XFWA 3MP3A 4DEFA 3IUIA 4DB7A 2J7HA 2PGWA 1E43A 1LQ0A 1PCWA 1QWKA 4PTNA 3H2CA 4DX3A 1WDPA 3LZ3A 5HPCA 3H6OA 4FI4A 2XUCA 2PDMA 2YBUA 1PUDA 1B54A 1XRTA 1H1NA 2Y88A 1EO5A 4DNMA 2Q3RA 3S6TA 2IQ0A 5IBXA 1XPYA 1JCXA 2QCCA 2ANUA 3ATYA 5I5RA 3R94A 1OABA 3M0MA 3TLQA 1JPIA 4XVDA 1XPGA 1QJWA 3E0IA 1ZQ5A 1NM9A 1GT8A 2PWGA 4M29A 4DM2A 5D38A 3SFKA 3M9YA 3AIRA 4J3XA 4R34A 1OF8A 2ZZ2A 4JR5A 3BMVA 2GGEA 2DP3A 1V0LA 3RNDA 3E1F1 3PBMA 2VEGA 4QTGA 1B9ZA 5IM51 4Y2WA 5IFTA 4A8IA 4YS1A 4I8DA 1VBRA 1P1MA 5DMLA 1WDQA 3QR1A 2Y7FA 3VZXA 1ZBWA 1W3JA 3UWVA 4A8NA 3AIWA 3L9CA 3BC9A 1I4NA 3GH7A 1IE7C 3NPWA 3CQ0A 1W37A 1H5YA 3U48A 1HNYA 3DYMA 1TX0A 3M6DA 2C0AA 4ES4A 1FP9A 2OMAA 5AVNA 3QW3A 5KZDA 3HURA 1W3IA 1X6LA 4L1GA 3G1XA 4AD4A 3XIMA 2JEPA 4N0RA 3ZZ1A 2VCBA 4TOQA 4PBGA 2EJ1A 3AYTA 4G56A 2E6FA 3UWZA 3R1ZA 4N02A 3NG3A 1YKWA 3OLGA 1AMKA 3H26A 4AZIA 3TCEA 3OLDA 4IMCA 3LS9A 3RCNA 3EEZA 2AOSA 3AUOA 1QCWA 2ZFAA 4PMRA 3VNJA 2YSWA 3MPGA 3PBVA 1G7VA 2J6VA 3PZVA 1EF3A 1T99A 1R3WA 4FMVA 4FXFA 1SO5A 5ABFB 2ACSA 2W79A 2OVLA 5HMEA 2I7GA 3M44A 2HSAA 3ARPA 4HYRA 4M7SA 3KTCA 1UWIA 3ARWA 3BJTA 5HAOA 2ZC8A 1YXDA 1NQKA 5K9DA 4JTKA 3C2YA 3ABQA 1QI2A 4ADUA 2GWGA 3MUXA 4DRSA 5GVJA 2QJMA 3MHGA 3O06A 4FF5A 3WH9A 3ZJ7A 2Y70A 3M43A 4IFRA 5L9FA 1FTXA 3W76A 3TMLA 3ZXWA 4ZTXA 3H7UA 1RCXB 3AIEA 3SSZA 1Q3NA 3VNDA 4LYKA 3NZRA 4N2YA 1PSCA 1BXBA 4GCXA 4J2MA 5I78A 2FZDA 1CXKA 4L80A 1GZGA 3GAYA 4K37A 5FD0A 1LT8A 3UESA 4KFNA 3LZ5A 2WZIA 1L6YA 1QI4A 3VMNA 1V3HA 4GUFA 4WHBA 1XISA 1E55A 4PUKA 4AYSA 3T0CA 4RDWA 2OFJA 1BRLA 5FJIA 5BXSA 2WKLA 4DWDA 3EOOA 3W82A 5TQLA 1NSJA 4CVWA 3A47A 2GUUA 1ZENA 4HN8A 1BWLA 1A47A 4ZOAA 1GPFA 3QHNA 4G7EB 3WBYA 4DELA 2J7EA 2XJ7A 2YL8A 1MNZA 6A3HA 1SFSA 1KA9F 2Z2AA 3VNZA 5HWNA 1VLIA 3F1QA 2GWNA 3HPAA 3OODA 1HO4A 2Y7DA 1RBLA 3SURA 3W1RA 2JKAA 3NZ1A 1ADOA 1TO3A 1QO5A 4JTJA 1W1B1 2PDPA 2FQIA 3D3FA 5CPQA 1Z3NA 2G4FA 2TYSA 3ISIX 2OZ8A 1W1ZA 1EP2A 2ZRXA 3OA3A 4QAWA 1V6VA 4CVUA 3MUIA 1W0MA 1H2JA 1U33A 1HVQA 1OSEA 4A05A 4RV3A 2VOMA 4Y9PA 3P8IA 4PMNA 3B8WA 2CETA 3N9KA 1W1TA 1X6NA 4WDTA 5FJPA 3AU2A 2VC5A 4Y96A 2BHUA 3HG5A 2V2HA 3PB2A 4DN1A 3KWXA 1WP6A 3W38A 1GVSA 2XH2A 1EHAA 3HV9A 1YDVA 4RCXA 2JGQA 2GZXA 4AVFA 4D6IA 2XGBA 4ZA0A 3FGCB 3K5XA 3MUZ1 2Z1XA 3T1GA 1XS2A 1UH2A 3TN6A 5IHSA 2CLLA 4P7QA 4EWND 5LNUA 4F8XA 1TVLA 3GUWA 4LV9A 4D6HA 3D3AA 3ALFA 4POCA 4LUTB 1M7JA 5A6BD 4PR4A 3CMJA 4LCQA 2RFGA 2QCEA 5LNWA 3NCOA 4JEQA 1PHQA 4HVXA 2V38A 4LWWA 5CJNA 3LHWA 4MADA 4DI9A 4CNPA 4U5KA 5E5CA 3IJQA 3MP5A 3U4FA 2NQJA 1W3TA 1T7LA 5BXTA 3B8SA 4ACYA 4M3PA 3KM8A 3P84A 1JCTA 2F6KA 2W67A 4V2XA 3ITOA 4H3DA 3WELA 4UC5A 3QV7A 5HJXA 2D23A 1F4HA 3ORWA 1KGWA 1N8IA 3E5BA 3U5UA 1BG9A 2W66A 1QT1A 6TIMA 1UPPA 3BCJA 4HOZA 1GWJA 1CXHA 3WNOA 3BLPX 3UWYA 2JF6A 1TPH1 3SQMA 4V33A 3SUTA 4ALDA 3UJ2A 4N9DA 3R11A 1EQCA 3R10A 1FBAA 2ISSA 2C1HA 2QCGA 4JTIA 4A3QA 1WB0A 4S3AA 1GTEA 3P61A 1G4SA 2C8NA 4GQ0A 1FA2A 2CLOA 3VC6A 4PCSA 3M0JA 2OELA 5AHLA 2W9MA 4GGHA 1XLFA 4QG6A 1FWCC 2Y61A 3LY0A 1ITCA 2BSLA 2VRQA 3L2MA 4C7DA 2Q3OA 2PCEA 3PTQA 5EMYA 3M5YA 4OBTA 1QNQA 1W5PA 3EA3A 1F73A 2V2DA 4MNKA 2B31A 2P0IA 2FPVA 1QNPA 4DXXA 1BQGA 3S1UA 1B4EA 1D8CA 4NZ5A 4HD5A 1CIUA 2XISA 5HNRA 2DIKA 3LNPA 1RQEA 5AFDA 1EYWA 3EA2A 3STPA 1SZEA 4G5DA 3IJ7A 1Q8JA 3VNMA 3N15A 1XJBA 3G1DA 4DJDD 1T6MA 1SZNA 2A3EA 3BICA 3G1FA 3PZUA 3PULA 4Q7IA 4H7ZA 5A2AA 4E8DA 5BXPA 2ON3A 2YB1A 3M4HA 5F1VA 1TWIA 2XIMA 3VDBA 3GR4A 4JFTA 4UFMA 4EXQA 4LYQA 1J10A 1KBBA 5HOSA 4C91A 1AUSL 3PPHA 2IKHA 2XIIA 3DOPA 3MSGA 2JKPA 2EPOA 3P80A 3IVSA 1UH4A 1ZL1A 3ZR6A 1EUNA 3BLLA 1R87A 4JGDA 1JF5A 3CH9A 4EXBA 2FJUB 1Y8BA 3Q2DA 2DSKA 5I09A 1Q7ZA 4Q7NA 4XTIA 2F2KA 4M6UA 4FPSA 1SYTA 2BP1A 3DCPA 4BF5A 4IIBA 3B4YA 3CQKA 4GXPA 4IJBA 5G5IA 4AVNA 3UCDA 3VX1A 4H2HA 4C6MA 3BSHA 4IMGA 3GRIA 1TTPA 4L4LA 4P61A 4B92A 2NX1A 4L4OA 1GHRA 4HA0A 1SR0A 5AYZA 1FXPA 2ZICA 1K9FA 1X1OA 2PF0A 4XKYB 4LS0A 3G22A 1PS9A 4XG1A 1ZTVA 3W84A 1KV5A 3SCNA 4UTIA 4CU8A 4NKCA 3DX5A 1CGUA 3ZT6A 3IVTA 3LYEA 1Q45A 3FNDA 3TE9A 1UD3A 3DC0A 3GQYA 1A5CA 4TIMA 5C55A 4AZCB 1JD7A 2ATMA 3OZMA 5EB8A 4C5YA 3G1SA 5T8GA 4DYEA 3B8TA 3QC3A 3PBGA 2J74A 4LC8A 1OFQA 3TX9A 3GG1A 3UA4A 4D6FA 4WVXA 3UFYA 2IPWA 3UPMA 2B7NA 4ZQPA 2FB3A 2BLEA 1S1PA 4UFIA 4UTFA 1JAKA 5I00A 1OC5A 1J11A 4EE9A 5CLTA 4PODA 2FB2A 4PMQA 4AFYA 2PRHA 4X3ZA 1R3YA 5I3FA 2A85A 3VOFA 4CNSA 4QNEA 1IIHA 5C7HA 4FNPA 4BS0A 5KINA 4TVDA 3NXLA 3E6EA 2Q8ZA 3QLLA 1VEOA 4CU7A 1O5QA 3D46A 1JJKA 4LBSA 3S9IA 4MNLA 2PGRA 3HGSA 4DWSD 3W1AA 2MNRA 9CGTA 3N4AA 2PRLA 1W2VA 1QVBA 1L6WA 2EBNA 2WBKA 4ZQRA 3STGA 3B04A 4WR3A 1S1RA 3FOKA 3M41A 4GFSA 1Q7QA 2GJRA 2J8GA 4K38A 4U10A 1FHUA 4REQA 3WEOA 3EGJA 1A0DA 3FXGA 3WUGA 1G7UA 1P6BA 4US5A 4KMQA 3AXXA 2XVKA 3UCQA 1HXJA 3N2OA 3E0LA 1WBJA 1JPHA 3UW6A 2X0SA 5FEPA 4LB3A 3E9AA 2P3EA 3T7VA 1OT2A 4JN7A 1BXCA 1B3ZA 3RPTA 1GGOA 3UBPC 1OEPA 1XI3A 1QNRA 3W25A 4N6EA 1LQAA 3KCLA 2XU2A 4O18A 4FX7A 3URAA 3EOSA 4QFUA 1EX5A 3H2FA 1GQLA 8CGTA 1DIKA 2AMGA 5FF4A 5GPRA 1KWKA 1AZ2A 4IFKA 2QR6A 4UXDA 4BZYA 3QTPA 1IZJA 5CBIA 6ENLA 5GJNA 1PKMA 5ECUA 2E68A 3RO8A 4XSLA 2HE5A 3OQ8A 1JYVA 1TUFA 3CUGA 4QIUA 4FOJA 2XGIA 2Z25A 1Y5XA 1MQRA 3LCFA 5BOFA 1FWAC 1E40A 5DY3A 3A9IA 3YPIA 1JZ6A 2W5FA 3LBMA 1EB3A 5CCZA 1VKFA 3QGVA 4I9MA 4JTGA 2P10A 3A12A 4IPLA 4B2DD 1TV5A 1XH2A 3UD6A 4DBDA 5BRQA 2X1TA 4JTEA 1E1CB 1CXLA 4DJFD 5FF7A 3B9DA 1JUKA 3PZNA 1W3HA 4C6CA 3W2MA 1ZLPA 4IJRA 3G1AA 4B3LA 1K4HA 1GKQA 2J88A 1AG1O 4H8UA 3SFWA 9RUBA 4CN4A 4OGZA 4F2BA 2VWTA 2PLMA 4G6CA 5D05A 1JRCA 1H50A 3LHZA 4MGGA 1E9LA 1JZ8A 5BU9A 4DUXA 3W1MA 2PSNA 3C5QA 4Q4KA 4GVFA 1XLMA 2EXOA 4EF8A 4F0HA 2J78A 3OBAA 3WQDA 1SJAA 4JIQA 3N2MA 3H22A 1IEXA 5FI8A 1DP0A 2HZGA 1YNYA 2DUAA 3ANUA 4MF4A 1J0YA 3P60A 3C2VA 3PUGA 1XIJA 3KP0A 4B5WA 4FOKA 3W3OA 3GHUA 3WLLA 3EDFA 1MRQA 2FPYA 3UJRA 1V3MA 3IPWA 3N3TA 2Q6ZA 4P8WA 4NAFA 3D6NA 4JTAA 4UNLA 3CLMA 5LIKX 1M01A 1N82A 2QCDA 5IDIA 2GQ3A 1UR1A 1PJ9A 4I6KA 1FFRA 4OTKA 2V3EA 2VGIA 1SPQA 2WMFA 1E6XM 4DXVA 2OWXA 4NI8A 1UBSA 3VM5A 4Q8OA 1EJUC 1CECA 3AZSA 1I1XA 1S2TA 2XGZA 2CLMA 1I6NA 1WZMA 3WUFA 1PHWA 2VI0A 3REQB 1QNSA 1WKDA 3G3MA 1CENA 4CQ9A 2QF8A 4J3SA 4CQBA 1LZOA 3C2OA 1S5TA 4CQ8A 3CK5A 4C1NA 4ICNA 3QV8A 3VNYA 4P7NA 2DZPA 4IFOA 5A5WA 3M7WA 2W92A 2ZIDA 5D9OA 2Y5SA 3ITXA 2GGIA 1CW2A 2HJPA 3L4ZA 4RKAA 1J79A 1TWWA 4M56A 2XH7A 1Q6RA 4JQ1A 4ZQOA 3GFXA 3H21A 4V1XA 1UQYA 4GA8A 5IOBA 2CC0A 2QHAA 5HNUA 3LBOA 1KKRA 1ZPTA 2XPKA 4C6KA 3H2MA 2QKFA 4DBEA 4W7WA 4ZSUA 4LAMA 1EGMA 1FH7A 4FHAA 1IEWA 2X8RA 1UKOA 4E6MA 4HZ7A 4IQLA 5TF0A 3W2NA 3H55A 1C91A 4AC1X 3U6WA 3DH7A 4ZZ9A 1TG7A 1GG0A 2DUXA 2BY1A 1AL7A 2BWGA 5DCDA 2ASHA 2WANA 4NNAA 3E2VA 2VRKA 1J2BA 3MY9A 3K8KA 1F74A 4W88A 3USBA 4Q4SA 3QY8A 2DU2A 2QPXA 2GQ9A 5DT7A 4AWEA 4LCRA 4Y9OA 1HL9A 4UQCA 2QCMA 3R0UA 2F7FA 3ZJ6A 1IHIA 4MKVA 4U33A 1GUVA 1J0IA 3NO3A 1CYGA 3DYOA 3NNTA 5JIWA 2PC8A 3N11A 3R25A 3ARRA 1B30A 5EMLA 3G8EA 1I2NA 3N18A 1WDWA 4DBUA 3DFOA 3G2GA 1UD2A 5BOOA 4GY1A 4O28A 4XUGA 1J8VA 1GW9A 4HOXA 4UTKA 1ME7A 1UROA 4NQ1A 1XRVA 4LVDA 2Y8VA 4QS6A 3OVPA 3AZTA 3VD7A 1HN1A 4GD0A 5ENLA 4D1IA 3V0UA 2VEMA 4BFAA 2C16A 3GS6A 3MDUA 1EXPA 1QNOA 2YLAA 3NA8A 1NY1A 3AFBA 1E4IA 3VIMA 4A21A 4L64A 4OKDA 4GZJA 4FAMA 1OCNA 1UP0A 2UV8G 4C6PA 4DUOA 2P76A 2MANA 3I7SA 5FF3A 1XDLA 3IJDA 4R5EA 1YADA 2IPGA 5EFFA 4MYAA 4CGTA 1CPUA 1SR9A 3HF3A 1G69A 3WQ5A 4TVUA 3LCIA 3OG2A 3AYRA 3PF3A 1X98A 4O50A 2ZXQA 4QAIA 2PB1A 3QF0A 3MHFA 9XIMA 1ICQA 4JKKA 1XIMA 1FVPA 3LN3A 3A4WA 1KQZA 3MUAA 3ZFHA 1GNXA 5LKYA 2JE8A 2EKCA 2Q01A 4HHLA 4CD7A 3HOJA 5LA2A 4M24A 1AH0A 4DPPA 1UIPA 3N2TA 3T44A 2EG6A 4UWMA 2VT0A 1TR1A 4ZXLA 3QRHA 3GNXA 1FDJA 4MKNA 1EC8A 2G3IA 3HGJA 5AC8A 1RY8A 1QWGA 1AJ0A 4KCUA 3W81A 3E0VA 2X2GA 1A3WA 3C0QA 5HMDA 3SSJA 2QXWA 4GPNA 4IUOA 2INEA 2ISWA 3NQ7A 4W7VA 3IVUA 2EO7A 1RQHA 1E6RA 2H9AA 4HA3A 4AHPA 1S2CA 2X2YA 2CW6A 2ABAA 4LAOA 3VKBA 1K1DA 4TV5A 4KESA 4FP1A 1OZQA 3CUZA 3KP1A 4LU0A 1WCGA 4PRTA 3M5ZA 1BYCA 3QHOA 2ZRZA 3A6OA 1KO0A 2QPUA 1VPXA 3RLGA 4HK5A 1D3CA 1A5BA 1NP0A 3DYPA 4XD6A 4QISA 2XINA 2PS2A 3HJZA 3K4DA 3FY1A 5DX7A 1VBJA 2X0HA 3K4WA 3TN3A 3APTA 4IICA 3M64A 3SCVA 1O4UA 1QPOA 3VCCA 1US0A 3A4JA 1NIUA 1MW0A 2W27A 3N9SA 2PDIA 3ZJKA 5AC6A 3BK0A 1YTDA 3CTTA 3QZEA 2DIEA 1W9UA 2GL5A 3URNA 3O15A 5FF0A 4YJ5A 4RDYA 2Y24A 3CO4A 1HP5A 2Y0FA 1XQKA 3WF0A 3VZZA 2E5CA 1QW8A 3TJ4A 1U83A 2D3LA 4QG9A 2R91A 1XWYA 5G1MA 3PPFA 3W1PA 3W7EA 4QEEA 1ZRQA 4U2YA 2JKEA 1VIWA 1WAUA 4BR1A 5EA9A 2WWDA 1JF6A 4WD0A 2PDFA 3WUEA 3W7JA 1OJXA 5T9CE 2V9DA 1OCBA 2NSXA 3W00A 4IP4A 1P0EA 1EP1A 4KT2A 5FSEC 2VFHA 4DBSA 2G3JA 3ZLGA 3P67A 2ABBA 2GVLA 1YXYA 5DQPA 4MWAC 1EA9C 1TIMA 1W91A 3P5ZA 4RJEA 2V3GA 4GINA 5M1TA 1PZ2A 2YDAA 4LUYA 3WK2A 4Y9AA 4BI5A 4KH2A 3OZOA 1VAHA 1UR3M 3BE7A 4H6EA 3PNUA 1KM5A 2HROA 2I5QA 4LYRA 3LTPA 4XWUA 1OC7A 1K7XA 4L6HA 1P0BA 3V5CA 2A3CA 3STEA 4AXNA 2VGFA 4BI6A 3VK5A 2VD8A 1Q6GA 3CHEA 4Z1YA 4PRWA 4G1KA 5KZMA 5REQA 1KBKA 1LL4A 2WKJA 2R82A 4YWIA 3O3RA 1OFOA 3L5AA 2Z1VA 1V02A 1ELSA 4Y8EA 2PP3A 3HM7A 3VGHA 3RX4A 1W9XA 4GXMA 1WKEA 3C2RA 2NZLA 2HV5A 1HG3A 3BAWA 2O4MA 3K8MA 4WKAA 3W2JA 2J24A 2WC4A 2QJIA 4Z1BA 5CZTA 1D7FA 3S2JA 1YPIA 3KX6A 4MNJA 2ZA1A 4FZIA 4RL3A 1H7OA 2WBGA 4Z2IA 1K8ZA 4MWAE 1FWGC 1TR9A 4MTVA 1AVAA 3TIMA 1JULA 1TV8A 3R12A 1PX8A 3KOYA 4DZHA 3AIUA 4O17A 5D04C 1JFHA 2OGYA 3LTYA 4IL2A 3QKZA 4JQ3A 3KOFA 4C6BA 2FTYA 2CLKA 3AHTA 4MLRA 4DBWA 4MAVA 3UZZA 3QKEA 1W2PA 7ODCA 3VIOA 1R2RA 3NYDA 2HVNA 3D5HA 4AIEA 4MAZA 1XRSA 1PCKA 3EX6A 3ZWTA 2CNCA 3H2EA 3R13A 2OYLA 1F3WA 4S3FA 5GJMA 2QCNA 4IM4A 2PP1A 3T2OA 4J9JA 3OG3A 7A3HA 3AXKA 3I3BA 1I0DA 2YIHA 3AXIA 2ZZ1A 1MI3A 2XN0A 3TXZA 4XAYA 1CX9A 1RR2A 2XSBA 2B7OA 5K4XA 3SN4A 4KCVA 3LXAA 4MFEA 2ISVA 3KL3A 2XZ7A 4WXYA 2FZNA 1RALA 2ZDSA 3WIJA 2DW6A 4GWEA 4EVZA 3TN4A 3DN5A 4R27A 3RPMA 2WPBA 2PDHA 3GDRA 4J35A 3MU7A 3BWWA 3W73A 2C3ZA 1KC7A 1R7AA 2WQPA 2CBIA 2EAWA 5A2BA 4HU0A 1E0WA 1UWRA 4GACA 4C60A 4HKPA 3QY6A 1O68A 1EBHA 4GUHA 1XLEA 5FESA 4REQB 3VKCA 1SZRA 3BG3A 4IMAA 3BMXA 3R43A 3QW4B 3VCRA 4ROPA 4HNUA 1HJUA 1VIZA 1UOKA 1ZSXA 1XL9A 4AAJA 3RF9A 1S3TC 2VKZG 3GTHA 1B5TA 2BOGX 1U1UA 4IG2A 5I77A 4A6GA 5FF2A 1XYBA 5J5DA 1FWSA 3GTNA 1MYRA 2TRSA 3M0YA 3L65A 3POHA 1SMDA 1VHCA 3DXIA 1BSLA 2NLIA 3WDQA 1FY6A 4F2TA 3E0FA 3UWEA 3PJXA 1GVRA 1UCWA 3MWCA 3ZT5A 2W62A 4WSJA 3NDZA 4NAEB 1F4AA 3Q37A 2OG9A 4GYFA 4KWWA 2FHFA 3AMDA 3IIPA 3LGEA 1XIGA 4KETA 3TC7A 1PTDA 3C2EA 4JTLA 2YFNA 1SFJA 1KXTA 1Z9AA 3G6MA 4W4QA 3SRDA 4AWUA 4OOUA 1PTGA 3EWWA 3W86A 2YA2A 3WEMA 2J7CA 2E6AA 1Q66A 3DFQA 3IUHA 3MZNA 4MDOA 3WK1A 4Q4QA 2EG8A 1A5LC 1CI1A 4R7OA 3W7GA 4D72A 3WD4A 4GZ7A 3LPPA 3WF3A 3W75A 5EMUA 1J5TA 2WSYA 2QIIA 1RK6A 3NL3A 3GNNA 1JGMA 3EX4A 3FA3A 1UR8A 4UR8A 4X61A 3KCJA 4GI4A 3V75A 2O56A 1ZB5A 3HFYA 1VLWA 3E38A 2QVNA 1BTMA 2E25A 4RNIA 4I9TA 4EPKA 2PWVA 3M5XA 3TZNA 4DY1A 3RX3A 4UQEA 2J4GA 1FWIC 2HEJA 3CLWA 4GOAA 3UR8A 3E74A 4OUIA 1CGTA 4C6OA 2REQA 4H9XA 1VJIA 4HSNA 1DQXA 2XH0A 1FWFC 2NQLA 1V6UA 3LHYA 2E9LA 3NOYA 4P8UA 4MOZA 1AMYA 5C8BB 4IMDA 3NWRA 1HKKA 4PBEA 4OBRA 3GR7A 3CWHA 4RE0A 4O15A 4DO6A 4LVFA 1H3GA 2DIJA 4UCFA 5HUOA 3SJ3A 1OADA 3H4XA 2SFPA 2GOUA 1E6PA 1LBFA 2YGYA 3EB2A 2DZXA 2QV5A 3GM8A 4F0MA 2F84A 4CQCA 2VFEA 2PU0A 2PDNA 3EX1A 4R7WA 1YDNA 1QXLA 1DIDA 1MFVA 2HBXA 3NZGA 3O2LA 6XIAA 1QOPA 1UD6A 3ZJ8A 3UG5A 5CSRA 3L5LA 3QH2A 4XD5A 1ZJAA 3HPSA 5E9AA 2YCLA 4O8RA 2TMDA 2VNCA 3FJ4A 3TK7A 7TIMA 2Z2BA 5D8WA 4NXKA 4RW3A 3HG2A 3ITYA 3QEZA 4GUIA 4X63A 3CYJA 3K4AA 1DXIA 2OKOA 5A6LA 4NJIA 3NTYA 3ZLFA 3NO5A 2HK0A 4ACZB 1KW1A 5G2IA 4LC6A 3K13A 4Z0JA 1PYFA 3SO7A 5JXQA 3F2DA 1RD5A 4TX9A 5AZ1A 3MCOA 2J8TA 4RK8A 4HT3A 5I23A 1VJSA 3DZ1A 3NEVA 1IEVA 3R8HA 3EWCA 3NL2A 1YEYA 2HPIA 3T0BA 1H1YA 3W7HA 1TWDA 1UUOA 2P1FA 4I7UA 4K8EA 3S3GA 1H60A 3LQLA 4Q4PA 2RAGA 4FF7A 4HHMA 4QJ1A 4GZIA 4MG4A 3M0XA 4R33A 3CL7A 4DJEA 1FDZA 4PTVA 3VAVA 3PZOA 4HU8A 2D2HA 4KFOA 3S42A 1TWSA 1OFRA 1E72M 3PFMA 2PDKA 1XM3A 3ZIZA 5E70A 1IR1A 4O1EA 5A8OA 3DKJA 3N34A 4MY9A 2E67A 1WKFA 1FCUA 2QCLA 1PYMA 2DH2A 3G0SA 5C9RA 1EP3A 1TQXA 2YPIA 4ZQCA 5I3HA 4LS1A 3W27A 1LM1A 5LA0A 3ZLHA 2VX5A 1UYQA 2O7SA 2Z2UA 5AYBA 1RLDA 4QDMA 1QOXA 1AH4A 5EGRA 5FA5A 1RP8A 4YTTA 3W7MA 4M6PA 4D8ZA 3PJTA 1DWFM 2EKGA 3NQFA 4PMDA 2VFFA 4Z2JA 3EMQA 4CCCA 2CBUA 2WSQA 1VFHA 1KM3A 4BWLA 2Z28A 4ZO6A 1RPKA 3VE7A 3DHPA 3KTXA 4O10A 3W72A 3RLHA 1V0KA 3CZEA 5HQEA 2DEPA 2OCZA 3RR1A 4KRZA 1ZS2A 5D2XA 2J75A 3QLDA 1VYPX 5HBFA 3M0KA 3W7KA 4ZTYA 3COTA 1JZ3A 4N42A 3FS2A 1HJWA 3V18A 1M7OA 3A64A 3TJXA 4NG3A 4E5TA 3UWUA 4O14A 2HCVA 4IXXA 3V7PA 2ZZ3A 3TYZA 4Y9MA 4GZEA 4ZEPA 3BLOA 2F6XA 3HQNA 4ZR8A 3U57A 1ZJIA 1E0XA 5EYWA 3ZSSA 2J77A 1IWPA 1D9EA 4QE1A 1WZAA 2D0HA 3EZ4A 4TTUA 3TW9A 1B4KA 4GISA 3P93A 3C4UA 4AY1A 2OWCA 3CUHA 2A4AA 3O05A 4UTUA 3ZVIA 3MMTA 4DZIA 5JBEA 1FQ0A 4O4VA 1FX6A 3KAOA 4A8RA 3PANA 5LGZA 1ZAHA 3T55A 3T6CA 1VYSX 1GCYA 1SO6A 2HQAA 3O6CA 4CNOA 3LPFA 1B3XA 3EDDA 3EPNA 1OM0A 1J0JA 5DO8A 2VFGA 4F0RA 1H09A 1R86A 5E0FA 4DWSA 4JIRA 1K77A 1Q6QA 2HK1A 1UZHA 1WXYA 3S2CA 3VDAA 3AIVA 5AHFA 1X97A 2YLLA 4QCEA 1QHPA 1ZALA 4XZLX 2UY3A 1U5JA 1IYXA 1XIFA 3WQPA 1E4NA 3JUGA 3SRKA 5IXEA 2F2HA 3JS3A 1TPFA 3KRBA 3APGA 6XIMA 3TEVA 3G24A 2XVGA 3FKRA 1EJRC 1AK5A 1W6TA 3WJSA 2ADAA 5I3DA 4GYKA 1G6CA 3T8LA 4NP7A 1T8QA 5C2GA 1ZGDA 3GXMA 3VI2A 3GZAA 4Q8MA 4X9SA 3VA8A 3PTDA 2WCSA 4M82A 5LGXA 1CXEA 5TIMA 4D71A 3VMOA 5J04A 2CZ5A 1M1BA 4H83A 2WHMA 1FDYA 1N8FA 1QHOA 3FK4A 3C61A 2WHJA 2QQ6A 1R7OA 4GVHA 2VQTA 1C92A 3CV6A 4LTSA 1DJIA 4Q8QA 3L4WA 3E0WA 1F5ZA 5CPSA 3NQMA 1XFCA 4JTHA 1VEMA 3VUSA 1ISZA 1AW2A 1Q6OA 2NXIA 3ARSA 1VYRA 4G9PA 3TYUA 3K46A 4DZ5A 1OZMA 1TCDA 1IXNA 4UTJA 1Y5VA 3DFTA 5CJ5A 2QDEA 3B05A 3ITCA 3GFYA 3LLFA 3DFPA 4S3EA 1TWZA 4FXRA 4LRSA 4QX4A 5U7SA 3E49A 5HULA 4TR9A 3RR4A 3C8NA 1G94A 4GUGA 4UQBA 3UG3A 1R2SA 2QJJA 3T0AA 1XYFA 2J7FA 2OU4A 5CZSA 2QUNA 4FXJA 1HT6A 2ZUMA 3N19B 1NELA 3VD9A 4YHGA 4LNYA 2AAAA 1CGVA 1D7KA 1THFD 2BV9A 4JYFA 1NOUA 5CSUA 3CGTA 3OGSA 3C8FA 3UZ5A 2GJXA 1KRMA 4PRRA 3LM7A 5GNXA 1ZCCA 2XSAA 3AS1A 5LHEA 1P5BA 2PDBA 1GEHA 3HN3A 1JNEA 3N9RA 3HA1A 4Q22A 1GHSA 4PSPA 1EOMA 1W8GA 3AWNA 2J7DA 5F2MA 5F7UA 3DERA 2CHRA 3KDNA 1Q6FA 4HBKA 4QITA 4C1NB 2QS8A 4KWVA 4Z1AA 1CNVA 3WH7A 4LF2A 1AL8A 3GIYA 1UW9A 1MZRA 1VP5A 3MUY1 1UHVA 4FNTA 4O11A 4GVIA 3IRSA 5E93A 3W87A 1XIIA 2VXNA 2IXUA 5DCBA 1H51A 1JQXA 3UR5A 1Z6KA 3L66A 1IV8A 3S2LA 3UERA 1JCYA 4GLEA 2UY4A 1CDGA 1C8VA 2H3BA 1BHGA 1XICA 2A21A 1XIHA 2A1YA 3OVGA 1A4LA 5CBBA 3GU2A 1XDJA 3H8AA 4AZHA 3EDJA 3N73A 3GO2A 5T91A 4Q8VA 4A3RA 2ZQ0A 1CGXA 1KTNA 4YIWA 3QC0A 1AW5A 5FJTA 1JD9A 2GDVA 4LPCA 3SCOA 3CL6A 4Y8FA 3W1NA 3W70A 5XIAA 1FWWA 1BYAA 1FHLA 5G1YA 5ABFA 5TBOA 5CZJA 2Y7EA 1LRQA 4QQ3A 1G5AA 1B3WA 4AIBA 3AO0A 1RBAA 1JZ4A 4HK6A 1B3OA 2WVSA 3GBDA 2JQXA 2HXUA 2YBVA 3IJIA 4HHPA 3OLEA 2ALRA 3QYSA 5LSMA 3FFSA 1IXPA 4HPGA 4PN2A 3B9OA 1GOOA 2E9BA 3ECQA 4ENLA 1GVOA 2PUZA 3M46A 4C6JA 4WJ8A 1T8XA 2X09A 4RV8A 1LL7A 2QGYA 4LQ1A 1A5UA 5JVLA 1RVKA 3ABXA 3RXZA 4XO6A 2V30A 5HR6A 4X2RA 1KLYA 1WXZA 1XHGA 2JALA 2BOFX 2EF9A 4GABA 2G3NA 1Y0EA 2OLHA 1VS1A 1F07A 3BXWA 2WM0A 4BQ2A 4DNHA 4R53A 4KEZA 4JKLA 3CZJA 1KR1A 2ZKMX 2C13A 2CBVA 4IFKB 1EC9A 4ZVJA 3W7QA 4QE4A 3CPRA 1TPWA 1WAWA 4OHQA 4OJYA 3LPOA 3M1ZA 1W9VA 1BVZA 1LOQA 1CBGA 1Q65A 3W07A 2DW7A 3NQCA 2O4QA 4XZ9A 1BPLB 1OFDA 3EDEA 1UP2A 3A24A 3H23A 2ZXAA 4LT9A 4MUPA 3C2FA 3STFA 3MI2A 5CQ1A 5LNRA 2YA1A 2VDIA 4GCAA 2E0PA 4XKYA 1CCWB 1E1EA 3GVVA 2PMQA 4AF0B 1LOSA 2ZBTA 4P7LA 4TV6A 2YL5A 5EPDA 1Q7MA 3NQ8A 3L0GA 3APYA 3VGFA 1K70A 3EWZA 4GY7A 3WCZA 2VZSA 3KRUA 3PK7A 1S2VA 2ZADA 3E2SA 1L2QA 4H2CA 2TPSA 2QF7A 4XZIA 1U1HA 1XDMA 4NNCA 1US3A 3IJLA 5A6MA 4JFUA 4FS9A 1OX4B 1H7NA 1CB7B 2OZ3A 1EEXA 1ECEA 1RAKA 3OO2A 4A29A 1QW9A 3MSDA 3VD5A 6CGTA 1AZ1A 4NY2A 4O8AA 4FO4A 5HJLA 5KSWA 3OZPA 1L6FA 4B91A 3R6IA 4MZ1A 3T81A 4NVTA 5RUBA 2VDGA 1XC6A 2E8ZA 3L23A 4QHRA 4WCJA 3EA1A 4O0QA 3VNKA 4WDWA 1D8WA 3CHDA 4NRRA 2XH4A 5A94A 2KAUC 1FWDC 4I5UA 4GGBA 2ZX7A 4L56A 2L5HA 5DFAA 3IIZA 1LLOA 5CPLA 3DFHA 1F7BA 1W3NA 3NPXA 3WJWA 4V15A 1O94A 5D4YA 1J93A 4AY8A 1RZMA 3DBPA 3PZMA 2Y5EA 1U1JA 3TTSA 1N2VA 5BRPA 4J2PA 1K9DA 4JKMA 4JTUA 1V79A 3HZ3A 3T08A 3SIZA 3IV8A 3SECA 2TAAA 4M0XA 4HOWA 2WSRA 2PDGA 1EO7A 1K6AA 2BGQA 2CCRA 4WIWA 3MCMA 5A1AA 5E0KA 1GQIA 4AZBA 2A7PA 1EIBA 3EKGA 1MO0A 1BTCA 2FDMA 2WMGA 3RN6A 4PMZA 1RVGA 1XP3A 4HNCA 3BZGA 3UXAA 4DO4A 2ZXDA 5I3JA 2VR5A 3P2VA 4K1WA 4QLKA 3HIJA 4IZGA 1Q6LA 3EKLA 1SO3A 1H62A 3RK8A 2ZZ4A 5MKGA 3BG5A 2C1GA 2X1SA 4Z2KA 2QV4A 1N8WA 2I16A 1TPDA 2HNHA 3AZRA 5FEWA 2IQTA 4JZ5A 2EPHA 4A3HA 4H04A 3G18A 2BVYA 1HKJA 1Q6EA 1AFSA 2E5DA 3GKAA 3P62A 1OF6A 2E77A 3FAWA 4F40A 3AJXA 3KCOA 1WUFA 2PBOA 3V5FA 3KOWA 4JTQA 2OOFA 1YNPA 3GVGA 2RHGA 1LJYA 4GHRA 5FIPA 4IIDA 3LGGA 2QULA 1AQHA 3PAJA 3V16A 1JI1A 4NILA 3SI9A 1P48A 4QGCA 1XLLA 2CLPA 2IPFA 2BY3A 3WO8A 3IRDA 2YYTA 1S5MA 2QZRA 3QHMA 3GAKA 4H9ZA 1UMLA 4F0KA 1CXFA 4AD3A 3IIXA 3L0KA 3WQCA 3OBKA 1JI2A 4ZQNA 3W37A 1XW8A 5AC4A 3ME3A 5DELA 3B06A 1DEDA 1ITQA 3AALA 3V36A 3TP4A 3O6AA 4ZFMA 1X1ZA 2WJFA 3CT7A 3UG8A 3L67A 3IUDA 3KLLA 4UOQA 5DXXA 5GNZA 4UCGA 3HG4A 1PVNA 3TJIA 2QT3A 4LYPA 3B0VC 3AU6A 3VIGA 1FXQA 1MEIA 2HISA 3JZEA 4HPNA 4Z1DA 1L9WA 2HPMA 4CEXC 5IFPA 4LBUA 3ALGA 1QBAA 3FCPA 3OIXA 3PBUA 3F5JA 4LVAA 2GVJA 3ZSTA 5G4EA 2OODA 2V69A 1DJZA 1ISXA 1REQB 3T2PA 1B3VA 2X30A 5BXRA 3ZR5A 3SCQA 3H12A 4WUIA 3CEPA 4S3GA 1JR1A 8XIAA 2J62A 3ZO9A 4DUVA 4FR6A 4U5IA 2D20A 4EWJA 1UWUA 2FLIA 3PJWA 1C7TA 1BVWA 3KFTA 4DM1A 3K30A 3B0YA 4WQ6A 4BWLC 1UJPA 1DXFA 4GBUA 3KXQA 1TZ7A 3CB3A 4O1BA 1E5NA 1JXJA 2G97A 5J8LA 3BAXA 1YLVA 4WK9A 3OW1A 2C19A 3TSDA 3A3HA 1EJVC 4HJFA 1HKIA 3VILA 1QPNA 1TTJA 3CV2A 1RV8A 3SJNA 1OFEA 3KVJA 1VJZA 4ZFCA 5E09A 1E9ZB 2B7QA 2PE4A 5FKYA 3ES8A 2WNWA 3C6CA 4UTTC 4AWSA 2VC6A 4W9TA 4MNMA 3UJEA 1UP3A 2NUYA 4DJEC 3TV8A 3N2CA 3ZWSA 1DV7A 3WDIA 3KOZA 4YN5A 4ZB0A 1MWOA 2C6QA 5CG0A 3P81A 4UNKA 1EZ2A 1E0VA 1OK6A 1NP2A 1XBVA 3VVGA 4G7FA 2H6RA 1AQ0A 1XLBA 4KF1A 1GONA 4XZHA 3WFAA 1KTBA 2J47A 1A0CA 5AN7A 3WQ4A 4O0KA 3LXBA 4J27A 4FIRA 4EPDC 4Q4OA 4XIAA 2JIEA 4JNMA 5K9CA 1H4PA 1LTDA 3CS2A 3HPXA 4JTFA 2W6RA 4UTTA 1OGBA 2XYLA 1SJCA 5DMYA 3T4WA 3UYCA 2FZ9A 4ASTA 2X7WA 1Z8AA 3AAMA 3WQFA 1FWJC 3PUDA 3ENLA 2WNQA 1P6WA 1W5OA 1C3FA 4CN1A 1HF6A 4EACA 3HU7A 1KQYA 3N17A 4LX4A 3NQVA 1XD0A 1ZCOA 2H3DA 4M8UA 4GQQA 2NVCA 4J3TA 3KTSA 4C7GA 3CV1A 2D22A 2I5GA 2XN2A 4LB4A 2DT1A 1VFSA 4XAZA 4CUCA 4EK7A 4A22A 1M6JA 2GSEA 3VGDA 3IGXA 4GNJA 4UZSA