4M80A

The structure of e292s glycosynthase variant of exo-1,3-beta-glucanase from candida albicans at 1.85a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
393
structure length
393
Chain Sequence
WDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,3-BETA-GLUCANASE
publication title Major Change in Regiospecificity for the Exo-1,3-beta-glucanase from Candida albicans following Its Conversion to a Glycosynthase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 150
structure length 393
sequence length 393
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m80A00
1W9XA 5CLTA 1R7OA 4AY1A 1KR1A 1B3ZA 1NWSA 5E0CA 6TAAA 3WUBA 4PRWA 2Y8KA 4CVUA 3VD5A 3SCNA 4E8CA 2DDXA 5BXPA 4OIFA 1GHSA 2VUYA 2PWDA 3N9KA 1H5VA 4TVCA 2Y8VA 4P7LA 4PMQA 1Q6EA 1JF5A 1GPFA 4QP0A 3MMDA 1UWQA 2C0HA 1B3WA 2DSUA 3U57A 4H04A 5ABFB 2VNCA 2VC9A 1H09A 1CGWA 3WNKA 1RP9A 2CPUA 4H8HA 4JZ5A 4JIEA 1KXHA 4AZ6A 1VJSA 5JBEA 1E4IA 1W3JA 1US2A 2DQXA 1G1YA 1VJZA 4JCMA 4CD4A 4W84A 4Y7EA 4ZXOA 3VVGA 5CJ5A 1UKTA 1JZ6A 1J0YA 2WKGA 1HKIA 1LG2A 1UR9A 3B9DA 1Q4NX 5BWFA 4HA1A 2PB1A 1BF2A 3K4AA 1UR4A 1JYVA 3MV01 4OOUA 2X0YA 1IZKA 1GORA 4MJ4A 1CGVA 5IHSA 4UOQA 4W5UA 1W1PA 1SMDA 4P8VA 3SCSA 3ZM8A 3HU7A 5A6SA 2PWGA 4U3AA 2ZXBA 4AD4A 1VEPA 1L0PA 4MAVA 3TTSA 5A2CA 1J11A 1HNYA 2W66A 1I75A 4MAZA 3POCA 1UWIA 1EA9C 1GZJA 2WCAA 2WVVA 3MSGA 3WH6A 2IXUA 3PZNA 1VRXA 5M5DA 1UH4A 4V2XA 4UR9A 2WHJA 4E2OA 1V3KA 3K1DA 3LMYA 2ZUVA 1FFRA 1J0HA 2WBGA 5CZKA 4H8UA 1MFVA 1QI2A 3ZMRA 4AD2A 1E72M 2DT1A 4H41A 2JEQA 1C7SA 2J4GA 2WB5A 3A3HA 2WMKA 2JIEA 4MNLA 4P8UA 3VGBA 5EB8A 4J3SA 3OGVA 1GOKA 1HVXA 1OGBA 2ZX8A 3SCOA 1EQPA 1VEMA 1TMQA 1OD8A 1UWSA 4U2ZA 4H7VA 4W7UA 3W24A 1UR0A 3IK2A 2FDMA 4L4PA 3GYCA 3AS0A 1JNDA 4PBGA 5HOSA 3VUPA 1B3XA 3II1A 1ESWA 3AHXA 1JNEA 1LL7A 3SCQA 4CCDA 2OLHA 3FAWA 5BROA 4AIEA 5E0FA 3CTTA 3IJ8A 3VIOA 2GDVA 1F4AA 2F8QA 2J25A 4ACZA 1WZKA 4CCCA 1OIMA 3CHFA 2GSJA 3RM4A 3VGDA 2ZUWA 4UFJA 2DSZA 3AS3A 3UG3A 1J18A 3EMZA 2VX7A 1TR1A 2JF6A 3VMNA 3FY1A 3OZPA 3BAYA 2WK2A 5I77A 3AJ7A 2YL5A 3SUUA 1X6LA 2VQUA 4L4OA 2QLYA 5C71A 1VBRA 3OIHA 4EK7A 1B90A 4AD1A 1E4LA 1MQPA 4KWUA 4CN4A 3WH7A 1HT6A 2ZWZA 3CPUA 4UZSA 1WZMA 1VFUA 2G3JA 2ZUMA 5DEZA 3CZJA 1JYWA 4U2YA 3EDKA 4CN6A 2WM0A 5I6SA 3MUIA 4GXPA 4AZCA 1HF6A 1FH9A 3CBWA 1G0CA 4OUEA 3S6TA 5E9AA 5LA2A 1E5JA 5CPTA 3WBEA 4RE3A 3PN8A 1QHOA 5DT7A 1HP4A 1J9YA 1VENA 3N15A 3RDKA 3TA9A 4E8DA 2XUCA 3BAJA 3OZOA 1WPCA 2QHAA 5A2BA 1RP8A 3VD7A 1BYDA 2YDRA 4JHOA 3ZT7A 1CNVA 4XV0A 3AS1A 4M24A 1AQMA 1C92A 1GQJA 1WP6A 3WD0A 3VGEA 2WVTA 4XUYA 2YDQA 1C8YA 3WNNA 1GVIA 2WLYA 1EDQA 1LF1A 3AMKA 2J62A 3EYPA 1JGIA 1WDQA 4JL2A 3M6DA 5DFAA 1XH2A 3VOCA 3VDHA 3UG4A 4AIUA 1ZBCA 1V0KA 3PZTA 2CESA 2YA1A 3RJYA 3SUWA 1JFXA 4JFSA 4W5ZA 1QI5A 4CUCA 3VX1A 3WDQA 2VMFA 1MQRA 2A3BA 3PTKA 4GPNA 3W38A 3N12A 4F8XA 4HOZA 4HU0A 3LPOA 2CNCA 2W4XA 2ZX7A 3AROA 1ZJBA 2ZICA 5FL0A 4FLRA 1LQ0A 2D2OA 4GZIA 2CYGA 3N18A 3WL0A 2J78A 4J7RA 2BHYA 3CGTA 1P6WA 3VMPA 1B0IA 3CHCA 3VIFA 1XGZA 3ZJKA 2CITA 4X9YA 1XCXA 1CXIA 3QHMA 2XFRA 4BZYA 4HOXA 4YN5A 3QHOA 3F4VA 4AZ5A 5BXRA 4KH2A 1V03A 1UD6A 3U7BA 1W91A 1H0GA 4B15A 3GTNA 1BVNP 1KFWA 1XH1A 3AMLA 2W92A 5D8WA 3QOKA 4P7QA 1OINA 1V6YA 3O6AA 2VCCA 1H11A 2QPUA 1OT1A 3CUIA 1UH2A 5IXEA 2X2YA 4GZEA 2CBUA 3J7HA 3RMEA 4OBSA 3ZJ6A 2NT1A 1EOMA 1E0XA 4XZBA 1JXKA 3OGRA 2J77A 2VVSA 3WBAA 3EBVA 2YA0A 4AWEA 2GJXB 4D72A 3VX0A 1F4HA 1J0ZA 1E3XA 4RE4A 1CLXA 3ZSTA 1C7TA 5E6YA 3ZT5A 1XSJA 3F5KA 1JG9A 4PUDA 3KE0A 2WAGA 1UR1A 5A8MA 2QF8A 3W6MA 4UQEA 5DO8A 1RPKA 3IJ7A 3WUFA 2BHZA 4HOWA 1K9FA 1JIBA 1UA3A 1EO5A 1BPLB 3CZEA 4WLCA 4J28A 3KL0A 3WDJA 1W3HA 5E09A 2QPSA 4JHZA 4PEEA 3PZVA 3W4RA 1JD9A 4PTVA 2EQDA 3VIKA 3RO8A 3A6OA 1BHGA 5AYIA 3NCOA 3GNOA 2WVUA 3SCRA 4WKAA 2XPKA 3GXFA 2EPMX 3THDA 3VIJA 1N82A 2D1ZA 2EPOA 1UWTA 2WHMA 5I24A 1CGUA 3WEMA 2XVPA 4CD5A 1M53A 3N11A 3VIGA 3T2QA 1V02E 4X0NA 5ECUA 2ZE0A 4NRSA 4LX4A 5A95A 4W87A 5FOOA 1E56A 1FP8A 3L4VA 2PC8A 5FIPA 3SEPA 3NSMA 3WIJA 2D0GA 4IPNB 3ARRA 4W7WA 3VIHA 3AHVA 3AIVA 1MFUA 2VOTA 3WD4A 3L4ZA 2XVNA 3AXHA 3WF1A 1MWOA 2VZVA 4W88A 5CPQA 5BRQA 2AOSA 3MS8A 3SCVA 1SFSA 2E9MA 4QAWA 4UOJA 5LA1A 3ARYA 1VAHA 3WF3A 5A6MA 2VVNA 3EDFA 4AMCA 3ARXA 1H1NA 2YLLA 2OWXA 1E71M 1W32A 5AY7A 5AYBA 1W2VA 1PBGA 3MO4A 1JDCA 4TVUA 1C8XA 2CKSA 3VD3A 3MMUA 4LQ1A 4M81A 3GNRA 4Z2JA 1BSIA 3NYDA 1V6UA 5EFDA 4LYQA 1K9DA 2WSPA 1QPKA 1LLOA 1W9VA 3ZR5A 5EMYA 2OWCA 3K8KA 1EQCA 1TFVA 3AFBA 1V6VA 3WQ8A 6CGTA 4BQ5A 1E73M 2XWEA 4HMEA 3WF4A 2ZXQA 1E6PA 3VNZA 5D8ZA 4B3LA 4PMYA 4CD7A 3WD1A 1PZ2A 3GH4A 1B2YA 3BSGA 2ZUTA 2WKLA 3PZOA 4M82A 3AZRA 2DT3A 2J8GA 1ITCA 2BS9A 4HU8A 4HZ6A 4UFHA 2WMIA 3ALFA 2CBIA 3CIVA 3WD3A 2D22A 1CGXA 3WEOA 4ATWA 2RGMA 5FCZA 1BVZA 3PZQA 2GK1B 4W89A 1C93A 1VFFA 2VRKA 2Y24A 3CHDA 4QFUA 1W9DM 1TVPA 1KBBA 1LG1A 1TG7A 4J3XA 5EFFA 1UWRA 3WD2A 2IXVA 3GBDA 1VBUA 2E8ZA 1ECEA 2PF0A 2FHBA 3WQ6A 5GNZA 1K6AA 4IM4A 2EXOA 1ISYA 2D3LA 4ATDA 3DC0A 1NWTA 2WBKA 1QW9A 4LGXA 4R27A 3L4WA 1W2PA 5I3DA 2NT0A 4WSKA 2HISA 2IUZA 3WUEA 4D71A 4KGLA 4PN2A 5KEZA 4DUXA 1EDTA 2CERA 3MKKA 4ZENA 1CBGA 3RM8A 2XVGA 3ZQ9A 1Q6FA 2E40A 5JIWA 1O7AA 1XSKA 2FH6A 4E4PA 2J8FA 2BY0A 2XM1A 4U33A 4UTFA 4MTVA 2CKRA 4MB1A 3L2MA 1XC6A 4LXFA 1UKSA 3ZJ8A 4BQ2A 2XFYA 1PJ9A 3WUGA 4PMUA 1V6XA 4AZBA 4D6EA 1E55A 1KQYA 4UCFA 3OBAA 2YBUA 3W28A 4PSPA 1JAEA 4FLSA 1V3IA 2J7GA 3DHUA 3A4AA 1TA3A 3TOPA 4TTGA 1ISXA 1QNRA 2D20A 1HJQA 1V08A 1WAWA 1XD1A 2ZOXA 3CZLA 1XV8A 2Q8XA 1LJYA 1DWIM 1MW1A 2CXGA 1UD8A 4NZCA 5IHRA 5I5RA 1HJXA 3APGA 1PIFA 2WVSA 2W5FA 1CYGA 1NH6A 1GOIA 4QLKA 3W0KA 2J47A 1LWJA 5M03A 1X1NA 3THCA 3KL5A 3WSUA 3OGSA 1U2YA 5ABEA 2ZIDA 5I23A 3VDCA 2QV4A 1CXEA 1M7XA 2WPGA 2F61A 1UR8A 2OYMA 3AIWA 3NSNA 2YL6A 1DP0A 4J27A 1A3HA 1OGGA 2VQTA 2YL8A 1E1EA 2BV9A 3WNLA 3K4DA 3DYOA 1OSEA 1CTNA 4D1JA 2PBOA 4GIAA 4F9DA 1V0MA 3T2PA 2AAAA 1I1WA 6A3HA 1SMAA 5FL1A 1WDPA 1ZL1A 4W93A 4AD5A 4H8VA 5CSYA 3SUTA 3FNDA 1OBAA 4JFUA 3TONA 2O9PA 1WZLA 2VZSA 3WQWA 1BGGA 3M46A 1XRVA 1AQ0A 1VB9A 5I2UA 1CXFA 4R5EA 4WKFA 3OLDA 4GI8A 2CIPA 4ACYA 3WY1A 1BQCA 2O9RA 3CZ8A 4ZE5A 4JCLA 1G9HA 1HIZA 4P8WA 1C8QA 1J12A 2WVVB 4HA3A 1BG9A 3VPLA 1KXQA 3UERA 3S2CA 4TUFA 3UR8A 4EANA 1KBKA 1VIWA 2GDUA 4WIWA 2V3GA 4DWSC 5JUVA 1HJWA 2V3FA 2CETA 1V3LA 4ZEPA 4LYRA 3DECA 1B9ZA 1JDAA 3BH4A 1PIGA 3RPMA 1OCQA 1JF6A 1W9BM 4EKJA 2JIWA 2DGAA 2VI0A 3VDAA 1BYAA 1ZB5A 3I3DA 4CU8A 2G41A 1PX8A 1NOUA 2V3DA 4W8LA 4D6CA 4DUWA 1D2KA 3LPPA 4GKLA 1JXJA 2WMGA 3L4TA 4RL3A 4Z2HA 4PMNA 2VRQA 1M04A 3OA5A 2XFFA 3SUSA 4WF7A 2C7FA 4P7RA 1PPIA 2XHYA 3AMDA 3CH9A 5M17A 1OGSA 3VIMA 4BQ4A 8A3HA 3IANA 3AYSA 3WKZA 3L4UA 1EXPA 4D6JA 1Q6DA 2CBVA 4RE2A 1GQLA 2WCSA 3GM8A 2AMGA 4ZFMA 1MXGA 2UY2A 1CXLA 4GQQA 3AIEA 1SYTA 1ZBKA 4IPLA 4ACZB 4AEFA 4PTMA 1XH0A 4MNJA 4UFLA 3EDJA 2VL4A 2YLAA 4KRUA 3BAXA 4QDMA 3VGGA 2J7FA 3ARPA 1TE1A 4Z2GA 3ARQA 2YJQA 1B3YA 4FMVA 3CZKA 3WH9A 3BCDA 3SIMA 3RILA 2UY4A 1ITXA 2UY5A 4GINA 2J7BA 1W3KA 2VZOA 3DYMA 1H4PA 5HXMA 3CO4A 1BGAA 1V02A 4NRRA 2QMKA 2DT2A 2WSKA 5GNXA 5D9OA 2E9BA 5A8PA 1IT0A 3BAKA 4PMOA 1VFOA 1RD6A 1Q6CA 4EAMA 4UQDA 3NUKA 3ARSA 2O9OA 3FAXA 5AC4A 1QNPA 3O2LA 4C7FA 4Z2IA 3TP4A 3NDYA 2WZHA 2XYLA 3HN3A 4AZCB 3CZGA 3M7SA 4GQRA 4DM2A 4Q7NA 2BHUA 1FH8A 4KRTA 3BMWA 3W81A 4BQ3A 3PBGA 3HMCA 3ZO9A 3FHQA 2D23A 3PHAA 3QHNA 3WFLA 4MNMA 1L8NA 3MU7A 3CUHA 4D6GA 2JALA 3BCFA 2X1IA 3NIYA 2EPNA 1WCGA 4CGTA 4WSJA 1OD0A 3WENA 2VZUA 1U30A 3VTRA 2VZTA 1UD5A 1M03A 2VR5A 3T09A 3U5YA 4MDOA 1E6RA 1HJSA 1QNOA 1JZ7A 3F5JA 1NM9A 5CG0A 2WZIA 3WQ4A 2E9LA 1FA2A 2BXYA 5CLWA 2YKKA 1CDGA 4XZWA 4MPKA 3AYRA 2G3MA 3ZOAA 4ZE4A 1WE5A 5BXTA 2B31A 1W1YA 2DIEA 2OSYA 3PZIA 3VDBA 4JKKA 1DHKA 1UQZA 4ML4A 1IZJA 2EPLX 1JAKA 1E40A 2CHNA 2J7EA 3AOFA 1JYXA 1QHPA 4DWSA 4A3HA 1VF8A 5A8QA 1E70M 1EH9A 1HP5A 2G8ZA 5CGMA 1E4NA 3K8LA 4FLOA 4V28A 3EDEA 4JKMA 3A47A 2QMJA 2XWDA 2CHOA 3A4XA 1ODZA 1WO2A 1ISZA 1J0KA 1WDRA 3WMBA 1JYNA 2DH2A 5EBAA 3D3AA 5TD4A 3SUVA 5D9PA 1V6WA 3OLEA 3SCTA 2DT0A 4YHGA 4FLQA 3AIQA 2WWCA 5CPSA 4OKDA 1UQYA 3ZSSA 3RJXA 1GONA 1MW3A 3AMCA 2DPEA 4FK9A 5E70A 4CN1A 5HPOA 1QI4A 1HKKA 3RM9A 2PI6A 4GO8A 3E1F1 5D4YA 4AW7A 1LL4A 5D9MA 1OM0A 2XJ7A 1HJUA 2FH8A 3PZ9A 3MUZ1 1FP9A 1KCKA 4S3KA 3VINA 3AS2A 3VO0A 1NOFA 4UFKA 2VJXA 2V38A 4DM1A 3KZSA 4UQBA 2V5DA 1EHAA 3AI0A 3M07A 3WMSA 3A4WA 5LA0A 1J10A 4UZUA 1HL8A 1TCMA 5LYRA 4AXNA 2OYLA 3TTOA 3IAPA 4DWSB 2RGLA 3OB8A 5DT5A 4S3JA 1B30A 1ZBVA 2W67A 3GXIA 3ALGA 4D6DA 4D6FA 3BMVA 1B31A 1CGTA 4M29A 5A6KA 2EPKX 1E6QM 1E6NA 1E0VA 3UCQA 1E0WA 1HX0A 5A1AA 3WN6A 1UH3A 4BS0A 4PYSA 3F5LA 3O9NA 1KCLA 2Z1SA 1EHNA 1ZBWA 4UQCA 1UWUA 5HBFA 3VIPA 2ZX9A 1ZS2A 3IJ9A 1BTCA 2VTFA 5CQ1A 1GVYA 4M1RA 2WZEA 5ABFA 1W1VA 2CEQA 2JEPA 3T0BA 1BYCA 2A3HA 1H0IA 2UWFA 3AZTA 4J3WA 3QOMA 2X09A 2JF7A 5JBFA 1W1TA 2WHLA 1V3MA 3WNOA 1JI2A 1TZ7A 5M3WA 1R8LA 1J0JA 1CXKA 2VX5A 1FHDA 1NP0A 4YPJA 2DSWA 4UOZA 4M80A 1DWJM 3AIRA 4LPCA 3MV11 4ZXLA 3VKKA 2PWHA 3CUJA 3POHA 4AD0A 5A8NA 4PMVA 4KGJA 3MSDA 1QNQA 2BY2A 2ZXDA 1ISWA 5I79A 1D3CA 3B8SA 2V3EA 3TTYA 2VCBA 1JZ3A 2MANA 4AD3A 1JZ2A 4LYPA 1WNOA 4CVWA 1KR0A 1G94A 4WKHA 4HMCA 1MVYA 2VX4A 2YOCA 3PZGA 4D1IA 5A3HA 2DH3A 2WCGA 4PUEA 3AISA 2Y2WA 2WYSA 1QBBA 1UYQA 3GDBA 3OLGA 4GO9A 3U5UA 4PMXA 2VCAA 2W61A 1CZ1A 1EGZA 1LWHA 3KWXA 3AMGA 3GBEA 1JZ5A 3GH5A 4WJXA 4PCSA 1KWKA 4OBRA 3WF2A 4XX6A 2WMIB 4P7NA 4AEEA 1R86A 1QI0A 2D0FA 1GJUA 5A6BD 2UY3A 1QHZA 2Y5EA 1HVQA 4AZ7A 4JFVA 3WEZA 3IAQA 1B3VA 4V27A 3VM7A 1HKMA 1Y7VA 3VGHA 3VD9A 1OWQA 4AZGA 2W62A 1ODUA 1GQKA 1GCYA 3W27A 3TTQA 3GH7A 1DWFM 3KL3A 4MB3A 1UKQA 4PMZA 4ATLA 4U5IA 4TXEA 2FHFA 3AXIA 4PMRA 1KQZA 3U7VA 1HL9A 2JFEX 4B3KA 1IV8A 5A6JA 1TVNA 3WQ5A 1CXHA 1QBAA 3UEQA 1DWGM 3WMCA 1BLIA 1MXDA 3VD4A 3AICA 2VO5A 4GZJA 2HVMA 2BVDA 2WMJA 3WL1A 4HZ7A 1Q6GA 1UD3A 2E0PA 4OJYA 4PCTA 4Z2LA 5A6LA 5IFTA 4NI3A 1K9EA 3W6LA 5DMYA 4HPHA 1E9LA 4QLLA 3W53A 1KXVA 2E3ZA 2XGBA 1US3A 1KGXA 2EJ1A 1PAMA 2OWWA 3T2OA 3WQVA 3CMGA 5A69A 3ZIZA 2XVKA 1CWYA 3VIIA 2XIBA 1JDDA 4D6IA 1E4MM 2VR4A 5A2AA 5A6AA 1H2JA 2PWEA 1V0NA 3WNPA 1JD7A 1LL6A 3MANA 1OB0A 3WELA 1HJVA 3N17A 2VT0A 5I0DA 1EO7A 1S46A 1TA3B 3FHAA 3B9AA 2WC4A 1YHTA 3KEHA 5HPCA 1R7AA 3BC9A 3LPFA 3SCWA 2BY3A 1DTUA 1KWGA 5BYWA 4HTYA 1O6IA 2Y4SA 3ARVA 3FW6A 3ZR6A 3BSHA 1MW2A 4K68A 1G01A 3OLIA 3BAWA 1UD2A 2EBNA 1WKYA 2VX6A 1YQ2A 1B1YA 1Z32X 4M56A 2G3NA 4CD8A 2WXDM 4F79A 7TAAA 4QCEA 4FF5A 3I3EA 1UOKA 1MQQA 2WLZA 3NJ3A 1C90A 5CXPA 2ZXAA 2BFGA 2GUYA 2VRJA 3CUGA 4WK9A 1M01A 1PZ3A 2XM2A 2CBJA 1NARA 1UUQA 2EO7A 3BLPX 5ABGA 2DIJA 1HN1A 2YBTA 3UG5A 4U3CA 3SCUA 2WNWA 3NDZA 4UQ9A 7A3HA 4MJ2A 4Q22A 2GJRA 4IUGA 3MUAA 4BF7A 4TVDA 1H41A 3K8MA 4PSRA 1GOOA 3GXMA 4W85A 4BA0A 4BCEA 4AISA 1W9PA 3BGAA 3WH8A 4AZIA 8CGTA 4N42A 4UQAA 4J3VA 2Z1KA 2V5CA 1UKPA 2A3AA 1DWHM 1W3LA 2A3CA 2XGIA 4HP5A 1GOMA 1WB0A 4HMDA 1NWUA 4MNKA 4HZ8A 3MMWA 2F2HA 5DF0A 1XHGA 3VMOA 1XYZA 3L4YA 3T0DA 3PZUA 2TAAA 5GQBA 1C3FA 1E6SM 2J7DA 4W86A 4P8XA 4QCFA 1FH7A 1GW1A 1PX3A 4A4AA 4PTWA 1HXJA 3UETA 3EDDA 3L4XA 2GJXA 1R87A 2XIIA 3N04A 1D7FA 3EMQA 4CCEA 5A94A 2J74A 2XSBA 1G5AA 2WANA 3BLKA 3ARZA 4AC1X 3N13A 1UG6A 4AIOA 1EOKA 5HNNA 1OT2A 3I3BA 4AYSA 3CLWA 1SR0A 1E1FA 2BY1A 5C8BB 4HA4A 1QW8A 2WHKA 1CENA 7CGTA 1AVAA 5IFPA 4CKQA 2ZUNA 2G3IA 4GI9A 4W7VA 3VM5A 1HKJA 3N1AA 1V3HA 1A47A 1GUVA 4IISA 4MDPA 2BVTA 3PTQA 9CGTA 1JFHA 1H49A 4OOZA 5BRPA 3GXDA 3UESA 2OSWA 4MB4A 4AZHA 4M8UA 3BXWA 4NF7A 4F9JA 4MB5A 3W37A 2OSXA 3ARUA 5ABHA 3AHTA 5IDIA 2DSVA 5D9NA 4J3TA 1RH9A 3ARTA 4JFTA 4UFIA 1CGYA 1K9TA 3VILA 3OG2A 3VGFA 4U5KA 5I78A 3AIUA 1XSIA 2NW0A 5JIPA 1AMYA 3K46A 3ZJ7A 1V3JA 3B9EA 2GFTA 3JUGA 3T0AA 2D3NA 3CUFA 1TUXA 1QNSA 1GNXA 2WC7A 2X8RA 4MADA 2J75A 4JFWA 2D0HA 4X0VA 4JAWA 2J79A 2PWFA 5C70A 2FHCA 4N0RA 3PTMA 1E15A 1CEOA 3RIKA 3T08A 1JI1A 4CD6A 2ZX6A 2YL9A 1KGWA 1BAGA 1GOWA 3RCNA 3WFZA 4TX6A 3WNMA 4J3UA 5KZ6A 1UR2A 4UNIA 1BFNA 3WDPP 2BXZA 4Z2KA 3WF0A 2W91A 1NOWA 2VURA 3HJEA 2XTKA 1GJWA 3W29A 2DSKA 2FGLA 1BG4A 2ZX5A 1QVBA 1CLVA 1CIUA 4U31A 2BNJA 3SCPA 2D24A 4NSBA 4H2CA 1V0LA 4URIA 3GNPA 2NSXA 1DWAM 5E6ZA 3D5HA 4UFMA 1NP2A 1E43A 1I1XA 1CECA 4TTUA 3LPGA 1PEZA 3WDIA 1R85A 1EDGA 1JL8A 1UHVA 3W26A 4TX8A 1KGUA 3ECQA 3ARWA 2YDSA 3G6MA 1ZU8A 1CPUA 1FOBA 2WW5A 4F66A 4C7DA 5BCAA 1FHLA 2FGZA 5JBDA 3MUY1 1GHRA 3QGVA 4W8AA 5FD0A 3WDHA 4DWSD 5CSUA 3G6LA 1X6NA 2ZUUA 4JL1A 4HPGA 3AHYA 2GK1A 5CGTA 2EEXA 1U33A 1BYBA 1W9UA 1UZ4A 4W8BA 4QLJA 1MW0A 2X0HA 1XD0A 4YHEA 3DHPA 5A8OA 3CHEA 2XG9A 4B9YA 1VEOA 1MYRA 1KXTA 1NQ6A 3CMJA 3WDRA 4CU6A 1E5NA 1H3GA 2W63A 1E6XM 1PX4A 1UKOA 4PMDA 5F7UA 1NWRA 3SURA 4TOQA 2OYKA 1VFMA 3AIBA 2ZWYA 3VU2A 1WZAA 3W82A 4EE9A 2X05A 1GOQA 2J7HA 4CU7A 1DEDA 4C7GA 2BVYA 2WMHA 3ZT6A 3AHZA 1J01A 3QR3A 5FKYA 3WH5A 4P7OA 3L2LA 2E8YA 1QI3A 4OZOA 2G4FA 3EMCA 5GNYA 2O9TA 2CCRA 3AZSA 1XCWA 1FFQA 1JZ4A 1UA7A 3BAIA 1ISVA 1QOXA 3PZMA 2A3EA 1KB3A 5AC5A 4D6HA 1OIFA 4KMQA 1WDSA 4DUVA 2GJPA 1J0IA 2J7CA 2WWDA 1UZ1A 2XSAA 1XYFA 1EIBA 4JKLA 2YA2A 3FXYA 4PTXA 4B16A 2YIHA 1ZJAA 4GI6A 1GQIA 3AXXA 3NSXA 3VNYA 1AQHA 3GZAA 1E3ZA 4XB3A 3AQUA 4A3YA 1C91A 2PBGA 1E6ZA 2DEPA 2WC3A 5BXSA 2ESCA 2ZUSA 5HDRA 3UR7A 1JZ8A 2C8NA 4B9ZA 1UD4A 2E4TA 3DYPA 2JE8A 3FN9A 5A6BA 2WMFA 2XVLA 5GPRA 2O92A 2GVYA 3W25A
chains in the Genus database with same CATH superfamily
3TJLA 1WKFA 1K02A 1B3ZA 5FESA 4L6OA 4DEFA 1EJWC 1Z7AA 4FA3A 1O1ZA 2FVKA 1OK6A 1KTNA 2G97A 2DDXA 5BXPA 3DENA 3G1HA 2VUYA 1QAPA 1GPFA 1Z3NA 1UWQA 1PZ1A 2VUNA 1IR2A 4RNHA 4AVOA 3QTPA 3WQCA 1QWGA 2YB1A 1RBAA 1GEHA 5JBEA 1K7FA 4ZVJA 4JCMA 4CD4A 2OTDA 3W1LA 3T0CA 1UR9A 3UZ5A 5BWFA 4GY1A 1SJCA 2I5QA 1IZKA 2OOGA 4QX4A 4UOQA 3EWZA 5H8UA 3JR2A 2FZNA 2X30A 1W1PA 4ZOAA 3SCSA 1XS2A 4FAMA 4U3AA 3HQOA 2I1OA 1L6FA 1S2TA 3W01A 3C5QA 1J11A 1HNYA 3G8RA 2QT3A 4Z1BA 1JCLA 1RJPA 3SY1A 1UROA 3LBOA 2WCAA 4GVGA 2WVVA 3WH6A 5LHFA 3BV7A 3NPWA 3HM7A 1NDYA 4K38A 1R2TA 3K1DA 4DVOA 2ZUVA 2H90A 1J0HA 5D33A 5CZKA 3FA3A 4BWLA 1MFVA 2Y7FA 4IMEA 4YTUA 4AD2A 1UC5A 2DT1A 3UZXA 4KERA 4N9DA 1IF2A 2WB5A 3W7IA 1A5NC 4RXFA 4P8UA 4YS1A 4B5NA 2E1WA 5EB8A 1WQ5A 4E2VA 3SCOA 1OD8A 1UWSA 4U2ZA 4H7VA 3CPRA 1XINA 4Q8UA 4Q4KA 1IWAA 1VPYA 3UZWA 4N6EA 4S3FA 5CH9A 1VHNA 1ESWA 1JNEA 1TSIA 2VDIA 1LL7A 2V2HA 1IWBA 3HGJA 3FAWA 3FCPA 4MJMA 4QJ1A 3CTTA 4B5SA 2GDVA 2J25A 2VGFA 4HA0A 3CHFA 4IQEA 2ZUWA 4UFJA 4GWEA 1S5WA 3AS3A 4DBEA 4XAFA 3BQ5A 1TR1A 2OB3A 3FGCA 1K70A 3OZPA 3BAYA 4Q3MA 2WK2A 1WA3A 1A5KC 3R89A 2CWXA 2YL5A 3D47A 2X1TA 3EX2A 2HK0A 4RZBA 4WY0F 1VBRA 3VZXA 2CLFA 1IEIA 2ABAA 1E4LA 1ME9A 1MQPA 3DBPA 4CN4A 3Q4DA 3WH7A 1HT6A 1F07A 2G37A 5AZ1A 4FP1A 4H9YA 1YPFA 1V51A 2ZUMA 3CZJA 1XBXA 3P67A 4DWDA 3MSYA 3BTNA 1Q2RA 3CEPA 5I6SA 3MUIA 3OTRA 4GXPA 5REQB 2OLSA 1HF6A 4OUEA 4RDVA 1E5JA 1GTEA 5CPTA 5HA7A 3PJWA 4L9XA 3RR4A 2OQLA 5DT7A 5E5CA 2ISFA 2XUCA 1N2VA 2QHAA 1RP8A 1JQXA 1O95A 2YDRA 4JHOA 5LNRA 1UMYA 1CNVA 4PODA 1KFJA 1XDLA 4Z1AA 1IQ8A 2YDQA 4PL1A 3WNNA 1GVIA 2WLYA 1EEXA 4ERAA 3AMKA 4JL2A 4XAGA 5AHIA 4AF0B 3M6DA 5EMLA 2OKOA 4PB3A 3VDHA 5TQLA 2E25A 1H7RA 3RJYA 4H8NA 3FS2A 1XIIA 2BBFA 5TIMA 4W5ZA 1QI5A 1LQAA 3E9AA 2OO0A 3PTKA 3LHWA 3W38A 2A2IA 1KCZA 5HWMA 4HOZA 3HGSA 1OF6A 2PDNA 2ZX7A 3M41A 3N18A 2J78A 2BHYA 3CHCA 3P74A 1KV5A 1J6PA 3ZJKA 2CITA 1EIXA 3I6EA 1FWJC 3W2KA 3WFAA 3BG3A 1EPVA 4AZ5A 3TIMA 1KA9F 1JEZA 1K6WA 3BZJA 3Q65A 4KH2A 1VH7A 3EB3A 1KW1A 1RLCL 5D8WA 2DZPA 5L6UA 4DPPA 1V6YA 1VLIA 1F6KA 3I7RA 4HBKA 3K13A 1EFZA 2NLYA 1UH2A 2X2YA 3AJXA 1Q6QA 3Q2DA 4QRNA 4OBSA 3MC5A 3MUXA 4GUFA 4QE5A 3S4TA 2A6LA 2YCEA 4BI5A 1UJQA 3PNZA 3OGRA 3QYQA 1F4HA 4LUSA 1CLXA 1U5VA 4PB5A 3ZSTA 1C7TA 2DZBA 3F5KA 3HTWA 3EKGA 5BMWA 4L65A 3I4EA 2HBXA 4LU0A 5KSWA 2XH4A 1K9FA 1EO5A 1RQEA 1XCFA 4FHAA 1WXZA 3KW3A 1R9YA 2QPSA 4AYGA 1JUKA 2EQDA 3BL3A 4ES4A 1QPQA 2GVJA 2Z2AA 2EPMX 3BLOA 4XKYB 3VKJA 1QU4A 1SUXA 3DG7A 2WHMA 2P88A 3WEMA 2XVPA 5K9CA 3LCHA 3N11A 1XRFA 1C9WA 1V02E 3WLSA 5ECUA 4NRSA 3KS5A 1V77A 2QCLA 5FOOA 1FP8A 2QUTA 3IGXA 3SEPA 2FVMA 3NSMA 2PE4A 4RR4A 1W8SA 4W7WA 1TRDA 3GIQA 2P53A 4ONVA 3AIVA 2BG5A 1MFUA 1RPXA 3WD4A 5BMXA 2XVNA 4LRSA 2JKEA 3WF1A 4LVGA 5CPQA 2VZVA 5I3FA 5BRQA 4BR1A 1PKLA 5IDZA 2PDPA 3K4WA 2E9MA 3ARYA 3WF3A 2IQTA 3MCNA 4PA8A 1Y5VA 3LLXA 2J24A 4DIAA 4IGMA 3BE7A 3W70A 4O0QA 4WSHA 5AY7A 5AYBA 3CIXA 1XW8A 2YYUA 1PBGA 3BG9A 2HTMA 3UXKA 3VD3A 3MMUA 3C6CA 1ITUA 4GRSA 4LQ1A 3C2RA 3UZZA 1EA0A 4Z2JA 1XLDA 1V6UA 3L9CA 5CSRA 3ABZA 2ZRZA 2DJXA 3ZR5A 4HB7A 2X1RA 3BGJA 1L8PA 3S1WA 1EP2A 5HNRA 3M0VA 4MKVA 1EF3A 5HANA 3U2CA 1V6VA 3I4KA 1ZALA 4EIVA 3VKAA 1E6PA 2CLOA 5D8ZA 1FWGC 2ZQ0A 3CV2A 5HQLA 1OYBA 2XINA 1H7WA 1SM9A 4ZTYA 4HU8A 2OCZA 3OEXA 1YW1A 4UFHA 4WVXA 1AK5A 2ZKMX 1PUDA 4J4KA 1P0DA 2QJNA 4XD6A 1D3GA 3KDOA 3G1VA 1Q7MA 2RGMA 2BLEA 1BVZA 4ICCX 2GK1B 1P1XA 4W89A 1E1CB 4ERIA 2DZTA 3QRHA 2W9MA 1W9DM 2G3FA 3LDVA 2BXVA 2V5JA 3UWVA 1MEHA 5EMMA 4J3XA 1PTAA 1UWRA 4IZGA 1BKHA 1K8XA 3A5FA 2VEGA 2Y7GA 3E5BA 2ICSA 1JR1A 3GBDA 3R0KA 4A3RA 4WXYA 3DC0A 1NSJA 4MUPA 3LLDA 4Q8TA 2XIOA 3IGSA 2NT0A 3IRSA 2IUZA 4D71A 4KGLA 4PN2A 1EDTA 4EPBC 2CERA 4GJJA 3RM8A 2XVGA 5JIWA 1O7AA 1QT1A 4GA8A 1KM5A 3L23A 4UTFA 4S2BA 2CKRA 2J6XA 4KFOA 1TKKA 3GE7A 3ZJ8A 4F0HA 1PJ9A 4JTJA 2QDDA 3GZ3A 3H2EA 1F9CA 1UP0A 4AZBA 4JDYA 4D6EA 3A3XA 2YBUA 4PSPA 3E0IA 4I9AA 2E6FA 3M5ZA 1V3IA 4MFEA 3DHUA 3A4AA 1TA3A 1XYMA 2VFDA 4TTGA 1F3TA 4WY0A 5H6HA 1KRBC 2ZOXA 1JJKA 3GR7A 1SW7A 1ADSA 1H1ZA 1LJYA 2OLAA 5IHRA 5I5RA 1HJXA 5IRPA 2WVSA 4HZMA 1G7UA 3MCMA 1EJ7L 3W3OA 3M64A 1B4EA 4JNMA 5ABEA 4WOZA 3W7PA 3JZUA 3L65A 1I0BA 2DY3A 1CXEA 2GSEA 1A49A 3TYZA 2F61A 2H3BA 1PVNA 3VE7A 1DP0A 3KWSA 2FVLA 2VQTA 2YL8A 3W72A 1UUOA 2ZRXA 3K4DA 3DYOA 4I9TA 3UPMA 2PZ0A 2JGYA 4DNHA 4I7VA 1JRBA 4TV5A 4Q6JA 1LRNA 4NJKA 2AAAA 1SMAA 5FL1A 3V7PA 4AD5A 3ANVA 5PTDA 5CSYA 2GVGA 3LQGA 1LCOA 5D02A 2YXOA 4LC6A 1L2UA 3OYXA 1XC4A 5CBIA 3STFA 2VZSA 4C6CA 1BGGA 1QK2A 5C9UA 1XRVA 3VAVA 1VB9A 2O56A 3TLLA 1CXFA 1BQCA 2O9RA 3CZ8A 4HSNA 1XLEA 1G9HA 1K8YA 4HJWA 1GVQA 3LGEA 3N29A 4P8WA 5D38A 1C8QA 4JX5A 3VPLA 3S2CA 4EANA 2J88A 1XYAA 1FX6A 4LUYA 1VIWA 2GDUA 5E0KA 2V3GA 1OCJA 3DECA 1PIGA 3M1ZA 4IGHA 4QJ4B 1Z6KA 2QJGA 3RU6A 1A5MC 4CU8A 3NQGA 2G41A 1JDEA 4XTDA 4W8LA 4GKLA 4N4QA 1U5JA 3CTLA 4NVTA 4YXGA 4RL3A 2HROA 2CZFA 2VGBA 3A4JA 2XFFA 3NGJA 3SUSA 4WF7A 2F84A 2AQWA 3UY8A 3W07A 3P60A 3C86A 1GKPA 3IANA 3L4UA 4D6JA 6XIAA 1VR6A 1MXGA 2R1KA 2H6RA 1RA0A 4IPLA 1ZBKA 3HPXA 1XH0A 3QGKC 4MYAA 4MNJA 3ABOA 1R5YA 1W3TA 4KRUA 1GW9A 3VGGA 4CNNA 3ARPA 1TE1A 4CNOA 1XJBA 2DORA 3WJSA 3Q37A 3PPCA 3SIMA 3S9ZA 4TMBA 1ITXA 2J7BA 4IMGA 5G4WA 3STCA 5HXMA 5HWJA 1T40A 1V02A 4HK5A 2FTWA 2ZTJA 1F3EA 5D9OA 1UMLA 4C1KA 4ILSA 4KS0A 3KBMA 5FAJA 1VFOA 1KD0A 1HGYA 3SO7A 4UQDA 2NLIA 2D2HA 1P7TB 4GQBA 1M6JA 3WLLA 2AMXA 1QCWA 4IJBA 4XO6A 3BJSA 1UBPC 2WZHA 2J66A 1XIDA 4KF1A 2NVAA 1HFBA 4Q8NA 4DM2A 1FUYA 1FH8A 3BMWA 3VKBA 2DZUA 2Y88A 3FEMA 5AHFA 4JY8A 1HKVA 4D6GA 4B3ZA 2QULA 2X1IA 2EPNA 3TTEA 4GUHA 4DYJA 3IVTA 4IIEA 3U5YA 1E6RA 5IBXC 4Q32A 3S83A 1XIJA 2WZIA 4UTWC 2E9LA 3G77A 1LTDA 3KRBA 4J1OA 5MHBA 5CLWA 2FB3A 1QR7A 3G5EA 3AYRA 2W6RA 1EYEA 5D2TA 1WE5A 3L0NA 2B31A 3H23A 1W1YA 2DIEA 2OSYA 3PZIA 3ZFHA 3T42A 1OFDA 4DAFA 1RBOB 2E5CA 3LI1A 2QAFA 1DJHA 3C8FA 1FWSA 3S0CA 1LRTA 2PDHA 1JYXA 1QHPA 1VF8A 5BOFA 5A8QA 1E70M 4KQNA 4X3ZA 1HP5A 5CGMA 4NZ5A 2V0TA 2PZNA 4IX2A 1FBAA 1P5BA 3A47A 2CLMA 2QMJA 3P8IA 9RUBA 3UXIA 3G1FA 5FF2A 4QJ5B 3A4XA 3U3HA 5FJRA 1WO2A 1QMLA 3HOJA 5EBAA 3D3AA 3H2NA 1V6WA 1O94A 1P4CA 4Z0JA 1E9IA 2DT0A 1P48A 4Y8EA 3ZWTA 3P82A 4NAEA 4RV8A 1GONA 2INZA 2DPEA 4J2MA 1GVEA 5HPOA 4KCVA 5FJTA 4GO8A 1VD6A 3E1F1 5D9MA 1OM0A 2XJ7A 5DY2A 3TWBA 3CAVA 3H4GA 1Q63A 3VINA 4HGXA 3HMJG 1ITQA 3VK5A 1BEUA 2BOEX 4DM1A 3U0HA 3PP7A 1XRSA 3Q58A 5LA0A 1TCMA 1PHWA 3U8GA 4F4RA 2OYLA 3M5VA 1GYNA 4DWSB 5EMUA 1AL7A 4O4VA 4XQ6A 3ALGA 1Y5XA 2FZ9A 4ZODA 5A6KA 3PB2A 1LBLA 3UCQA 1VBHA 3A9IA 3PBUA 1UH3A 4DZAA 4BS0A 3EEZA 3O9NA 1KCLA 4H9UA 2OZ3A 5C2GA 2Z1SA 1DTNA 4UQCA 3N6JA 1J4EA 4AX6A 3EX4A 1FVPA 2VTFA 1W1VA 3T0BA 2A6NA 1YE4A 4DJEA 2B7OA 2UWFA 3GQYA 4J3WA 4HNUA 1CB2A 5KTLA 3HO8A 3WNOA 4JGDA 1Z8AA 1JI2A 1KNWA 2IKHA 1XLAA 2OQYA 2BZNA 1J0JA 2VX5A 3DDMA 3TW7A 1NP0A 2A7PA 2DSWA 4UOZA 4M80A 4JS3A 4PRTA 5CEWA 2HPMA 3POHA 3MJMA 5A8NA 3CB8A 3GWQA 4IPPA 3MSDA 2ZZ1A 2BY2A 2NV9A 4DJFA 3DXIA 4J40A 3F2DA 4PCNA 4I6KA 1XLMA 1ISWA 1JCNA 3B8SA 4UUIA 1ELSA 3THAA 1JZ3A 2MANA 3WQGA 4IP4A 4GQGA 3WLOA 1KR0A 4ZSTA 3TK7A 2RFGA 3W86A 2YOCA 1K8ZA 2UV8G 5A3HA 1ZAIA 3AISA 2I7GA 3BOLA 4GO9A 3GDBA 3ABXA 3CMFA 3U5UA 3KAOA 4J35A 4PMXA 3EPNA 1RY8A 1FWBC 1RK6A 1Z41A 2G0WA 1CZ1A 2OZ0A 4PCSA 2Y63A 3LSCA 4YTSA 2CZDA 3M43A 1PL9A 3GHUA 4JTLA 2WMIB 1OFEA 3GW0A 1HVQA 3W7QA 4JFVA 5M1TA 1ZP4A 1EP3A 3IAQA 1PCWA 3N6QA 2GOUA 5KZMA 4J5NA 2YCLB 2DUZA 2W62A 1LBMA 3BW2A 4GNKB 4KIEA 1I2NA 1UKQA 4FNQA 2REQA 2FHFA 1VYRA 3C8NA 1KQZA 3HB9A 4NP7A 5AHEA 2DZXA 1IV8A 3WQ5A 1CXHA 3TOYA 3T8LA 1TTPA 4DLMA 3QR0A 4GZJA 3GS6A 4HZ7A 1Q6GA 2I14A 3TKFA 4X60A 4JTKA 4HKPA 4PCTA 4Z2LA 1VLWA 3NVDA 5IFTA 3WMLA 1MRQA 4QLLA 4BHYA 2E3ZA 1KM2A 2OWWA 3T2OA 4FR1A 3DFQA 5C7VA 2ZA2A 3ZIZA 2XVKA 3VIIA 4QROA 5DMLA 2XIBA 1JDDA 4D6IA 4FIRA 1OYAA 1V0NA 3TYBA 3MWCA 4O1FA 3R2GA 3LS9A 4KEZA 1S46A 2HV5A 2WC4A 1JCMP 3WG6A 5HQMA 1OY0A 3LPFA 3SCWA 3UXAA 4C6KA 2BY3A 1J8VA 1UW9A 2Y4SA 4IQJA 3ARVA 1POJA 2INEA 3TN6A 3BSHA 4KCWA 1F2JA 3OLIA 1A50A 1WKYA 1YQ2A 1B1YA 1Z32X 3LZ5A 3SFWA 2WXDM 3G0UA 4QCEA 5GJNA 2POTA 4L9ZA 1G7VA 4LVAA 3IV3A 5A5WA 2RDUA 3TUUA 3H2CA 3B4UA 1N8WA 4MJZA 1PZ3A 4IP7A 1IT8A 2B81A 1UUQA 1J96A 2EO7A 3CB3A 3TDFA 3U2ZA 3F4DA 4KEVA 3VNIA 3G2GA 2DIJA 1XIHA 4OTKA 4IMAA 3P5YA 4UQ9A 7A3HA 1S39A 4Q22A 3MTWA 2Z27A 4CQ9A 4BF7A 4TVDA 1TV7A 3H4XA 3K8MA 4LAUA 2Q8LA 4BA0A 1S1RA 4IL0A 8CGTA 2CLHA 4N42A 4UQAA 3XIMA 1PIIA 4K7YA 3U4AA 3GFXA 2ACSA 1A3WA 2A3AA 4JOMA 1GOMA 4HCLA 2VENA 4UC5A 3T55A 4JTDA 4MNKA 5C7HA 3EWBX 4QDWA 2F2HA 3T0DA 2QCFA 4F0SA 4Z0SA 3UWUA 4W86A 1OCBA 4QCFA 1S38A 1HXJA 3B8DA 4IFKA 4DBSA 4JXCA 2GJXA 3IJIA 3EMQA 4JTEA 2J74A 4OQVA 4XSLA 1G5AA 2PP3A 3BLKA 4R3UA 3OZMA 4IPJA 1NF0A 4AIOA 2JK2A 2ZDSA 1SR0A 3PUGA 1Y8BA 1E1FA 3ITYA 2X0SA 4RCXA 1QW7A 1AH0A 7CGTA 1J6OA 3W84A 2GGGA 1LZOA 4IIFA 3WLMA 4CKQA 3H21A 1SZGA 1V3HA 3AYVA 3LRMA 2QUNA 1FWCC 1GUVA 4MDPA 4KCTA 3ITVA 3KBJA 4I9MA 2WSYA 2AQVA 4DO5A 3LHUA 1EC8A 1S2AA 4G56A 1VRDA 4M6VA 4EACA 5AHMA 2OSWA 4MB4A 4AZHA 4NF7A 1SZEA 5BOEA 3NG3A 4HHMA 5LNSA 3AHTA 3NYZA 3P2VA 1RH9A 4JFTA 1K4GA 2OXNA 3EPMA 1OFAA 4UFIA 3W1QA 2VC6A 3CQKA 2VFHA 5I78A 3AIUA 4K8HA 2Z1XA 4O28A 4WUIA 1TUXA 2X42A 3PBMA 3BLDA 4WD0A 3GTIA 2BSLA 2V5BA 3SRFA 3O6YX 4GIYA 2BDQA 2PWFA 1QPRA 1CEOA 4AB4A 4RDYA 1IR1A 3MCOA 2RUSA 3ERPA 3TN5A 4EX4A 3R79A 1XPGA 3ISIX 4IT1A 1RBLA 2VWSA 4TX6A 3ZR4A 2F6KA 1FDJA 4J3UA 4Y9MA 9XIAA 1BFNA 3LBMA 2BXZA 3QV8A 1SO4A 3R0UA 3E2QA 1BG4A 3DESA 4U31A 2D24A 3EWDA 3CUXA 3LCIA 1Q65A 2FZMA 3G22A 5E6ZA 2CLLA 4UFMA 1E43A 1V8EA 4U4MA 3C3NA 4C6OA 5I02A 1KLZA 3O7UA 1ZU8A 1FOBA 2WW5A 1IHIA 1F6PA 1FHLA 4GVHA 4GQ0A 3JS3A 5K9DA 3SJNA 4HTBA 4I5XA 3APTA 4Q8OA 3G6LA 5LGXA 1TJRA 2Z7GA 1TMHA 5CGTA 4FZIA 3TV8A 4GJIA 2BVWA 4XKMA 3VDGA 4W8BA 2V81A 4O54A 2WO5A 4ORMA 4O8RA 4QLJA 1KTBA 3W1XA 3UYCA 3OPSA 4TMCA 3LHYA 3CHEA 4CNSA 3CLMA 5J04A 4NZJA 4BWLC 1NDZA 3T8QA 3MDUA 4KKXA 3DGBA 3WDRA 4MKSA 3LBCA 1UKOA 2DFAA 2YSWA 2Q01A 5F7UA 2V82A 5MKGB 3VU2A 2BWGA 3PF3A 3BV4A 1A80A 4EE9A 2X05A 4N6FA 5F2IA 2NQZA 4V33A 2OG9A 3ZT6A 4XWUA 3ONBA 3N19B 4US5D 3ENLA 3TJIA 4UTJA 4WDTA 4HPNA 3KHJA 2QEZA 1V5XA 4H9VA 3BAIA 4MUZA 3PZMA 4QSHA 5AC5A 3M9YA 2GJPA 1J0IA 3QV7A 3B4YA 3WQEA 2C18A 5JH1A 4B16A 2V2DA 3AAMA 3FXYA 1AH4A 1GQIA 1R2RA 4JIRA 1SGJA 3SFKA 4HHLA 1RZMA 2ISSA 2WC3A 4F2UA 5K4ZA 2ZUSA 3KBSA 4JBRA 3UR7A 3MA8A 2VKZG 2ZRYA 4MVAA 3CV7A 2GVEA 4B9ZA 4PUWA 3PWIA 2R1PA 4UWMA 1OG6A 4JQAA 2WMFA 4LUTA 4XG1A 2R91A 4LUIA 2GVYA 3W25A 3NPXA 4HPXA 4JQ1A 3PJTA 5CLTA 4AY1A 3JVAA 3M7WA 1O68A 4G6CA 3T44A 6TAAA 3WUBA 1XG4A 3UWEA 4FALA 3QZEA 4BEUA 3TSBA 4CVUA 3KP1A 3SCNA 4E8CA 2PRHA 3PWAA 1GHSA 2Z28A 3TYAA 4TVCA 4PMQA 1Q6EA 4IMCA 4J2PA 5AYYA 1IEVA 4RE0A 1B3WA 2DSUA 2Z6JA 3U57A 4H04A 7PTDA 3TH6A 1RP9A 4H8HA 4JIEA 1KXHA 2QS8A 4AZ6A 1BRLB 1LM1A 3C2VA 4AHOA 5FEXA 1PTDA 1OADA 3ORWA 2FGBA 3LM3A 1I6NA 1JZ6A 1J0YA 4H4IA 1V7YA 1CW2A 3KZPA 4N7QA 3SECA 4HA1A 1BF2A 4JTAA 1UR4A 3KCLA 3NPUA 3QY6A 3ES7A 5IHSA 3WQFA 5K9XA 1GYMA 3T4WA 1SMDA 4P8VA 5A8GA 2PCQA 2PWGA 3HFTA 1W31A 1ONWA 4ZFCA 5EGRA 1L0PA 3ZYZA 5A2CA 3SBFA 1YNQA 5EMJA 1I75A 1VCGA 3POCA 4TX9A 1EA9C 4YNGA 2IXUA 5M5DA 4A05A 3ONCA 3DBNA 1O66A 5C2XA 4XZNX 3NL6A 1V3KA 3QC3A 4H19A 5FEZA 3DN5A 2Y61A 3ZMRA 1XM3A 4LB3A 2JEQA 2BGQA 3TQPA 3HV9A 2PAJA 2JIEA 3N4FA 3LOTA 1RVKA 3R12A 4WJEA 2ZX8A 3AC0A 1EQPA 4ZB5A 3PAOA 4L7ZA 3DU0A 4UTHA 2TYSA 2LLEA 2IPGA 1NJJA 3IK2A 3G1XA 3ZVHA 3GYCA 3LCFA 1W8GA 3VUPA 1EL3A 2HK1A 3NA8A 1OJXA 4ZQRA 2OLHA 4XZHA 2QF7A 1PKYA 5E0FA 3VIOA 1F4AA 1JGMA 1OIMA 3LNPA 2GSJA 3RM4A 3DUGA 3VGDA 4YCPA 5G2HA 3K1GA 3VMNA 3B0YA 3SSZA 4GBDA 3FY1A 3MZNA 5CPOA 2VQUA 1WKEA 5C71A 1LWIA 3AO0A 2PTDA 5EKYA 3MI3A 1K7EA 3LENA 3EOUA 1TWZA 1VFUA 4RX0A 5CC5A 3ITTA 3RLHA 3KRSA 1TPB1 1UJPA 2B7QA 2WM0A 2FZBA 1I2OA 4G1KA 4AZCA 3QLDA 3GAKA 2IMRA 2VEIA 1O5RA 1FCVA 3B06A 4RE3A 3CAWA 2AL2B 3PN8A 1FDZA 3KBNA 5CJNA 1J9YA 3H24A 4E8DA 5HR6A 5A2BA 3VD7A 4PULA 3VNJA 3ZT7A 3B9NA 1NFGA 2BOGX 4DF0A 2D2JA 4M24A 1AQMA 1C92A 3BICA 3WD0A 3WZ0E 3CQHA 4XUYA 4V1XA 4H3DA 1C8YA 4IIBA 3VOFA 4QG8A 1EDQA 3F2CA 1LF1A 5FJJA 2QDGA 2PD5A 5DFAA 3VOCA 3UG4A 3EOEA 1ZBCA 2GJNA 2QKFA 2C13A 4JFSA 4QDPA 4CUCA 1NU5A 1Q7QA 4ICMA 4I7UA 4TU1A 5B7ZA 3NOEA 1KBIA 1UIOA 3T78A 3AU6A 1MQRA 1X6UA 1ZJIA 4X9SA 1BWLA 3N12A 4IGNA 1QRQA 4F8XA 1C8VA 2CNCA 2ZICA 1LQ0A 2D2OA 2GZXA 2ZYFA 4NQ1A 3WL0A 3LU2A 3E2VA 1UB3A 3CGTA 2XN1A 3DGRA 3VIFA 4QG6A 1Q85A 4O14A 2OJPA 3QHOA 3F4VA 4NAFA 3RX4A 3U7BA 3I6RA 1WBHA 4IL2A 4R7JA 3GTNA 2W92A 4UR8A 1THFD 3H6OA 1J5TA 3QOKA 4P7QA 2PC4A 2QPUA 1OT1A 4GZEA 3B40A 4AY7A 3FKRA 3W6YA 4GK8A 1MDRA 2DU2A 4XZBA 2J77A 3WBAA 1W56A 2YA0A 3M16A 2PWUA 3VX0A 4RE4A 5E6YA 1FKWA 5D04C 2QGHA 1K1DA 3FFSA 4M6PA 4EPDC 3EWYA 2QF8A 3GVVA 2FPYA 3WUFA 2B7NA 4AG0A 1O5XA 4LVFA 1OQFA 2OQHA 2E6AA 2BHZA 1OK4A 5KZDA 1JIBA 1UA3A 3AU2A 3MSRA 3CZEA 5E09A 4PEEA 3O6CA 4PUNA 4FI4A 4PTVA 3A3WA 3RO8A 2WOQA 4PZVA 2QXWA 4WKAA 1W54A 3T40A 4MIMA 1DXIA 1OF8A 5DMMA 3UPBA 3W71A 3BMXA 4V1YA 4GISA 2D1ZA 2EPOA 4JICA 1CT5A 4L80A 3GTFA 1LQ2A 1T99A 2XU2A 3KOZA 3MVTA 5F1UA 4AVNA 3T2QA 2IPWA 4ROQA 4JTIA 4W87A 4ZO7A 5KITA 1AW1A 2ABBA 5AHNA 2Q71A 2Q09A 2Y70A 3IEBA 3VC5A 1PDZA 3W7JA 3T6CA 4LTSA 1QDSA 3OZYA 1IXPA 1MWOA 2PLCA 3I10A 1TCDA 4K1WA 2FYMA 2WQDA 1SFSA 2Z00A 3SCVA 1VAHA 3S42A 2VYOA 3UFYA 1VFSA 3LYEA 3EDFA 3R4IA 4AMCA 3NO1A 3U6WA 2OWXA 2DW6A 2PDBA 1W32A 4XVDA 3CYJA 3QXBA 1W2VA 1JDCA 1VS1A 2E68A 3S5SA 3DHFA 3GNRA 1BSIA 4MF4A 1IXQA 3UWQA 3QW4B 1UZHA 2GQAA 4KIRA 3W75A 2RH9A 1OHLA 2OWCA 4WR3A 2O55A 1QUMA 1EQCA 1TFVA 1SR9A 6CGTA 3T7VA 1DVJA 1E73M 1OX4B 4HMEA 4JN8A 4F40A 1YDNA 3VNZA 3LCLA 1PZ2A 3L67A 1B2YA 3BSGA 5C6MA 2ALRA 3GU2A 2WKLA 3PZOA 3V5OA 1W5MA 4R7WA 1DJWA 2J8GA 1XIFA 2PD9A 4ZB2A 1CI1A 1KKRA 4IH3A 4GC3A 3SGGA 3WD3A 2D22A 4ATWA 5CGQA 5FCZA 3IIZA 3PZQA 3TN3A 1C93A 1VFFA 3LMZA 4I8DA 4GYPA 1NF7A 3M47A 2C0AA 3RU8X 3TWAA 3W7OA 2HE8A 2QIIA 1LG1A 1TG7A 4XAPA 5EFFA 5D2YA 2E1DA 2FZDA 3UJEA 3NQMA 1DYSA 2PF0A 1GQNA 1R3SA 2H3DA 2FHBA 3WQ6A 1K6AA 3PY2A 3KVMA 4C60A 2D3LA 1NWTA 2WBKA 3R43A 3OVGA 3CEUA 2R82A 3S5NA 4WSKA 4JIIX 3WUEA 1ZCOA 4JN7A 1YNPA 1G4EA 2POZA 3E0FA 1AG1O 3IGUA 1XSKA 4WDUA 2J8FA 2XM1A 4U33A 4MTVA 1VCVA 3NQAA 3HGRA 3L2MA 2C91A 1XC6A 2OX1A 3NL3A 2XFYA 4KWSA 3Q67A 3BK0A 4PMUA 3DI0A 1UC4A 1V6XA 3GC4A 4UCFA 3PK7A 3ZLGA 2GJLA 3BO9A 2CLIA 2YB4A 3ZS4A 2I5GA 1HGWA 3C2EA 2JKPA 1HJQA 3TSMA 1ZNNA 2PODA 3NAVA 1DWIM 3UW6A 3HG4A 2CXGA 3APGA 3B8WA 2YCJA 1XLKA 2QCDA 3NEHA 3CAKA 5BRBA 1LWJA 4WHBA 5C9ZA 2HWGA 3KL5A 2Z7KA 1YPIA 3EEGA 1X7FA 4E3VA 3SR7A 3CV6A 5H8PA 3VDCA 3V35A 3VKCA 2RJHA 1UR8A 5RUBA 3L21A 2XN0A 3NSNA 3R13A 2ZRVA 3TYUA 1E1EA 5DY3A 2FQIA 3WNLA 2QUVA 3CQ0A 4DO7A 2X16A 1CTNA 1OCNA 1S5NA 2OPJA 1GG1A 4PE8A 1XGEA 4GIAA 1PWLA 2SFPA 4F9DA 4O13A 2DZAA 4AUBA 3T2PA 4MKNA 3EWWA 5DBUA 1EUAA 3FK4A 3MPGA 4MLRA 3SUTA 5LHEA 3RK8A 5BW6A 4A3UA 1OBAA 4JFUA 4NJJA 5HJYA 4FNUA 2O9PA 1RV8A 5KINA 3V0UA 2PDXA 3WQWA 4PB4A 3M46A 1PYFA 2HCVA 1AW5A 1YMYA 3ATYA 2ZZ4A 3WY1A 4G7EA 1N55A 1GEQA 1ME8A 4YJ5A 3P8JA 2HS8A 2WVVB 4O1CA 4XSMA 5FF3A 4HA3A 1BG9A 1KXQA 3DI1A 3UD6A 2QCEA 1KBKA 4WIWA 3E3HA 5JUVA 1RCQA 4HNTA 1JDAA 4LS1A 1JF6A 3QJAA 2JIWA 2VI0A 3VDAA 2I9EA 1ZB5A 1Q3NA 3LN3A 3I65A 1PX8A 4TIMA 3WJXA 3KXQA 3LPPA 4E38A 3W7NA 4KT2A 3TCSA 1WDDA 4Z2HA 4LS0A 4PMNA 4JTCA 2VRQA 1M5WA 3QQWA 2DVTA 6ALDA 1KRCC 1G4TA 1PPIA 2OZ8A 2XHYA 1H63A 3AMDA 2NSOA 2G96A 3PM6A 8A3HA 1YDOA 3AYSA 4J9JA 5E1QA 2VFFA 3H7VA 1U1HA 4DUOA 2WCSA 1CLKA 2AMGA 2HDJA 8XIMA 1JVNA 3GDRA 3V75A 2AGKA 2UY2A 1RK5A 4AU0A 3XINA 2ONEA 5A6TC 4NJHA 4QITA 3I7QA 2YYTA 1SYTA 1TQXA 4PTMA 3C61A 2VL4A 2OEKA 5L9FA 2ZVRA 1O60A 1F61A 1A0DA 1EZ2A 3BAXA 3IUIA 1G6CA 4I5RA 3ARQA 4O53A 3WH9A 4C65A 3KOFA 3TMQA 1QO5A 3FGCB 3FJLA 1D3HA 4GABA 4M1BA 3O05A 4PR4A 4AQLA 2WNQA 4B92A 4GACA 4ZA0A 2WSKA 5GNXA 5A8PA 3NR0A 4LF2A 1IT0A 1TIMA 3S46A 2FFIA 2VEMA 3NUKA 3ARSA 3PNUA 3O3RA 5H2ZA 4ALDA 1QNPA 2EF9A 4Z2IA 2PLJA 3NDYA 2ZA3A 3E2RA 2PDKA 1R3QA 4L1XA 4GQRA 4Q7NA 2BHUA 4KRTA 5CC6A 3W81A 1HL2A 3PBGA 3ITCA 5LSMA 3HMCA 2PDCA 2D23A 4DJEC 3LV5A 3QHNA 1ALDA 3HF3A 3WFLA 4MNMA 1L8NA 3MU7A 4KRZA 3BCFA 4K8GA 4ML9A 3QM3A 1OD0A 3WENA 4MPQA 1E51A 1UD5A 3IACA 5JMUA 1P0NA 3LA4A 2VR5A 1P6BA 4MDOA 1HJSA 1N8IA 1ONEA 3DKLA 4DBDA 2Q3OA 3GDTA 4X2PA 1FWHC 2BXYA 2YKKA 4DJFC 3CUZA 1JUBA 1V4YA 1FQ0A 2OFJA 3ZOAA 4BK9A 3FYYA 3V3WA 4ZE4A 2DZSA 5CBJA 3V16A 3VDBA 4L6DA 1DOSA 3WBWA 3PG8A 5HAOA 3KRUA 2XIJA 3WLJA 1EZWA 1WUEA 2CHNA 4G5DA 3HURA 4DWSA 1EH9A 4FB7A 5K3VA 2VD8A 4JHMA 2G8ZA 1E4NA 1S2UA 4K1GA 1EJVC 3TW6A 4OU1A 4ROPA 2P10A 4IX0A 1KRAC 3RITA 1J0KA 1WDRA 2CZVA 2DH2A 4B90A 1TUFA 3E96A 3O16A 3CPGA 3R94A 4L61A 1XICA 3SCTA 1M65A 4FLQA 2P0OA 3AIQA 2WWCA 4OKDA 4ERGA 4GX9A 4HYWA 1A3XA 3ZSSA 4RV3A 3RJXA 1YBQA 3AMCA 4GNVA 1DIOA 1R47A 5E70A 3RM9A 3PPHA 1M41A 3QZ6A 5D37A 3AALA 1OX6A 1FWFC 5HUPA 4LUSB 3W1UA 4B91A 4LBUA 4O57A 3PZ9A 2H8XA 3F2BA 3BLIA 2MUCA 3LSBA 4S3KA 4CQDA 2XH7A 3AS2A 2QYGA 5CJMA 2V38A 3KZSA 4UQBA 1YDYA 2OVLA 4GXMA 2V5DA 5FACA 1EHAA 3QEZA 3LUTA 3M07A 1I60A 2ON3A 3QFWA 1O5QA 2Z29A 1J10A 3O8AA 1HL8A 3E5PA 5LYRA 1YIXA 5DT5A 3SADA 1B30A 1F6YA 3WLQA 4AAJA 3EGJA 1HO1A 1JCXA 3RFAA 4DAIA 4BKNA 1TPH1 3NQ8A 3H22A 3BMVA 4L4LA 1CGTA 4HSHA 1E6QM 3RXZA 1HX0A 5A1AA 1VQTA 4FNTA 3DFHA 1KM3A 3G0SA 1EHNA 4NJGA 1UWUA 4JQ2A 1RCOB 1L2QA 1KRMA 3O07A 3IJ9A 1AFSA 4M1RA 5ABFA 2WZEA 3GHSA 3O63A 3PUEA 3F7JA 4RUBA 1BYCA 2A3HA 1WYIA 5JBFA 3MQTA 4NZFA 5I06A 1TREA 5D32A 3PSWA 1TPFA 1LBFA 1Q2SA 1XIMA 2YW4A 1R8LA 1KM1A 1BD0A 1CXKA 4RDZA 3TXZA 5CPNA 4FSAA 3AIRA 4LPCA 4ZXLA 4AIBA 4KWWA 2PWHA 3CUJA 1FWTA 4AD0A 4PMVA 4KGJA 3CYVA 4BI7A 2Y7DA 3FXGA 4M0XA 1F05A 3CQJA 4IXHA 1ZAJA 4Y9NA 1D3CA 3WQOA 3RO6A 1TX2A 2RKXA 3FOKA 3STEA 1JZ2A 4LYPA 1EB3A 3M5XA 4Q4MA 3WLPA 3QV6A 3PZGA 2QJHA 4D1IA 2ALDA 4PUEA 1HTIA 1X8FA 1Y5WA 2WYSA 3AXMA 1UYQA 1GPWA 2VCAA 3QMRA 1HO4A 2W61A 1UP3A 3LGGA 3AMGA 2VM8A 3GH5A 1F73A 1KWKA 1E9ZB 4OBRA 3EX1A 3WF2A 1ZSXA 4N9CA 4O0ZA 4P7NA 1R86A 3VE9A 3O0FA 4WQ6A 2UY3A 3B0XA 1T7LA 1QHZA 2Y5EA 1X97A 3IIOA 3MYOA 3KX6A 4CLMA 1B5TA 1B3VA 4V27A 2HNEA 3VM7A 1Y7VA 4K36A 1F3WA 5CZTA 1ODUA 3W27A 3TROA 3GH7A 4MB3A 3E74A 2YZRA 3FJ6A 4PMZA 4U5IA 1MEIA 3S3GA 3IPWA 1KFBA 2PDYA 3KCOA 4PMRA 3U7VA 1HL9A 1JCJA 3IVUA 4MHBA 5A6JA 4LCSA 1TVNA 4WRHA 3W2JA 2V69A 4NX5A 3EA2A 3UEQA 1DWGM 1JPHA 4ZO8A 4H6EA 1GTHA 2PLMA 2WMJA 3WL1A 3PVFA 2IQDA 4OJYA 1B9BA 4S39A 5A6LA 1PYMA 1RSCA 4NI3A 1K9EA 3EWXA 1KXVA 3KOXA 2EJ1A 1KGXA 3PJUA 4Q6XA 3R6IA 1ZTVA 3W1AA 4UTLA 3WQVA 4NYYA 1XLBA 3KLLA 3SJ3A 4QSFA 3PTDA 1GKRA 4FPSA 1H2JA 1YADA 1JD7A 2CU0A 3ABQA 3SQLA 1OB0A 3GNNA 3NZRA 1FCBA 5JQ9A 1EO7A 1TA3B 4Q4OA 4HN4A 4WY0B 1R7AA 4NZ1A 3NM3A 4JTUA 3ZZ1A 1KWGA 4Y2WA 2PGEA 4M6UA 1S3TC 1XBYA 1MW2A 3BAWA 1UD2A 4IIDA 4DZHA 2ZZ2A 4RK8A 5D2XA 5CC3A 4ZR8A 4M56A 2G3NA 4CD8A 4WOQA 4BI6A 7TAAA 3PJXA 1POKA 4V15A 3M0MA 4GOAA 1LOLA 2R1LA 2WJDA 3VA8A 4FF5A 1UOKA 4WX2A 2C71A 4QE4A 2NQ9A 1EKOA 3E38A 4H9ZA 5CXPA 2QCCA 2YFOA 1IEXA 2V2CA 2GUYA 4CQBA 4RPPA 1K4HA 2E67A 1NARA 3BLPX 5BOOA 1TWDA 3H53A 5ABGA 4UTMA 2YBTA 3UG5A 2ZRWA 4FOJA 4U3CA 3SCUA 3NDZA 3F03K 3PC0A 2C3ZA 2BOFX 3JZEA 4IUGA 3UJ2A 1H41A 5LNVA 4DYEA 4PSRA 1OZMA 5E93A 4BCEA 4AISA 3BGAA 1EGMA 5I3JA 1KBJA 1Q6RA 2Z1KA 3LB0A 1R9XA 3N2OA 1GZ1A 1NWUA 3RCMA 2A79A 2CHRA 4HZ8A 1PB0A 3MMWA 1ZCCA 4OV4A 2IKIA 4ZTXA 3L4YA 3K2GA 2RDWA 2J7DA 5G1TA 2C6QA 3JRKA 3GVRA 5EY5A 1TX0A 4PTWA 3UETA 4O0KA 1R87A 2XIIA 3N04A 1F8MA 5G2IA 4HIBA 2QNEA 4GFIA 4AC1X 4D8ZA 1A0CA 1V7AA 4AHPA 3I3BA 3CLWA 3V5CA 3PBWA 3GY1A 4AWUA 2CZ5A 2OO6A 4XZLX 5C8BB 2R6OA 2QAPA 4QISA 4HPJA 1D7KA 1CENA 1AVAA 5IFPA 4GI9A 4W7VA 3N1AA 4H9TA 1XQLA 2QPXA 3B8UA 1WV2A 4WJ8A 2BTMA 4RZ5A 3KTCA 2EHHA 1U22A 5BRPA 3GXDA 4CQCA 4M8UA 3ME3A 3BVJA 2VD9A 4MB5A 3A5VA 4YWSA 3A21A 4H1ZA 2OSXA 4EWND 1VBGA 2DSVA 4J3TA 1EBHA 4C6LA 2Y85A 3VILA 4DZ5A 2W0UA 5JIPA 5D2WA 3K46A 4WGHA 3ZJ7A 2GFTA 2Z24A 3JUGA 2Y62A 1C9DA 2ISVA 4JPGA 2D3NA 5TBOA 3EX3A 1QNSA 1ZENA 1SPQA 2WC7A 2X8RA 1E0TA 3GXTA 2D0HA 3QPYA 3BOXA 2J79A 1S5MA 3EX6A 2AKZA 5I3HA 1PS9A 2PCEA 1HG3A 1JI1A 3T08A 2YL9A 1KGWA 1X96A 3WFZA 5AKQA 1FHUA 4MLJA 5KZ6A 1B54A 4N9EA 5GJPA 4UNIA 3HG2A 4GYKA 4F0KA 4L4MA 2PEVA 4L64A 2GUBA 3LGDA 5FF0A 4XIAA 1ZAHA 4H9XA 2XTKA 4G8TA 3W29A 2Z4GA 3EB2A 1QVBA 5FAGA 4LAZA 8XIAA 3T1GA 3SCPA 3NNTA 1SJAA 3N2BA 3GNPA 2C16A 2NSXA 3QLLA 1NP2A 4TTUA 4NT0A 3LPGA 4UNLA 3OBEA 4A21A 3WDIA 1R85A 2ATSA 2XDFA 4I7WA 3D46A 3ECQA 3ITXA 3ARWA 2YDSA 3KP0A 3G6MA 4C7DA 2BX7A 2FGZA 2P0IA 3RR1A 1GHRA 3QGVA 1VPXA 3LG3A 4MWAA 1R2SA 1SFLA 1TYGA 3THQA 2ZA1A 3N34A 1X6NA 2ZUUA 4KW2A 1PTGA 1IE7C 3AHYA 4EXAA 2EEXA 1BXNA 1BYBA 3O1NA 3O06A 2W27A 3G8EA 2F6UA 5FJIA 4H2HA 4O15A 4JTRA 2X0HA 2R14A 1Q4WA 4DBWA 1OFBA 5A8OA 2PDMA 5CZ0A 1IEQA 3CMJA 2E28A 3FV9A 3ABRA 3H55A 3EB4A 1P0BA 4Q33A 1K03A 1NWRA 3N2MA 3SURA 2NX9A 3C2OA 3ITGA 5LNUA 4RJEA 5DXXA 2H9AA 3NURA 2BVYA 3P14A 1J01A 3QR3A 1BKSA 4YVXA 2DIKA 3L2LA 4GJ1A 1Z69A 2GGIA 3W2LA 2HNHA 4F48A 2E8YA 1QI3A 4IMFA 3QSTA 3ABSA 4QM1A 2G4FA 3RLUA 5F2MA 4NAEB 2A0NA 5CG7A 1UA7A 5CZSA 1QOXA 1KB3A 3MW7A 3V1HA 4D6HA 3MP3A 4DUVA 3GG1A 3USBA 4NI8A 4GIEA 5J8LA 2WWDA 3CWOX 2NV1A 4JTSA 1XYFA 4JKLA 4PTXA 3VOIA 2AGTA 2EG6A 1A5LC 1VHCA 4R34A 1E3ZA 3AQUA 2NV2A 2IPFA 5G4HC 3U2OA 1E6ZA 2DEPA 5BXSA 4IGSA 2E6DA 5HDRA 2PS2A 5LIWX 3COTA 3HJZA 1F76A 3HFYA 2E4TA 3DYPA 3IARA 7TIMA 2E77A 3BOFA 3QFEA 4ZL1A 3W7HA 3GG8A 1YXYA 3T0TA 4DX3A 2O92A 1F5ZA 4L1GA 1EYWA 4KESA 1W9XA 4DJED 4RW3A 3CU2A 1VGAA 1OFRA 1OEPA 2Y8KA 1GK8A 1Q6LA 1TWSA 3VD5A 1QK0A 3TYEA 2PWDA 1H5VA 2Y8VA 4P7LA 1TWWA 5F4SA 4QE1A 1JF5A 3CK5A 4QP0A 3MMDA 2C0HA 4FEZA 3WCZA 5G4EA 2VNCA 2HXTA 2VC9A 3I68A 5C9XA 3GUGA 3S9YA 3P61A 4JZ5A 2HVNA 1VJSA 1I2QA 1W3JA 4OHQA 4DJFD 1US2A 1ZLPA 2DQXA 2HSAA 2PWVA 2VR2A 4UTKA 4W4QA 1G1YA 1VJZA 3H2FA 1R6WA 3E0WA 4Y7EA 4ZXOA 3VVGA 1UKTA 3PG9A 2GDQA 2OEMA 4Y9OA 2WKGA 1L6YA 3HPAA 1Q4NX 1JYVA 4DI9A 4OOUA 1OFQA 4H83A 1GORA 1SW0A 1CX9A 2YZ5A 4X2RA 4EWJA 5A6SA 3ZM8A 3HU7A 3RLVA 4DXXA 3UXLA 3ANYA 1M7OA 4P61A 1JPKA 2F6XA 3RYSA 4MAZA 4QG9A 1T0OA 1GWJA 3R1ZA 1UWIA 4AMAA 5D05A 3KOYA 3PUDA 2DW7A 1VRXA 3O0KA 1UH4A 4UR9A 1T96A 3G18A 4YWIA 3CH0A 4LS2A 2WJEA 3LMYA 1A5SA 4RZ6A 4C1NA 5KMYA 1JUEA 2WBGA 1GJPA 2PDFA 1R3TA 1QI2A 1G4PA 2GUUA 1HUVA 1E72M 1T41A 4A2RA 2J4GA 5HJLA 3A3HA 2WMKA 1LRQA 1JPIA 4MNLA 3VGBA 2ZE3A 3KVLA 1HVXA 1VEMA 2TPSA 5C9WA 1T8XA 3TZNA 4W7UA 2FDMA 3KTSA 4L4PA 2Y8UA 2AL2A 1N7KA 7XIMA 2PDWA 5HOSA 2Z2UA 3AWOA 2I57A 3NTYA 3NXLA 3KM8A 3AHXA 3SCQA 2REQB 1EWEA 5BROA 5DRIA 2NZLA 4FNRA 6REQA 3GDKA 4ACZA 2PDJA 4KFNA 1DJIA 4D8AA 4CCCA 2Z6IA 4MG4A 3UG3A 3LLFA 2NWRA 4P2VA 2VX7A 4H00A 4PMJA 2EKGA 3QZAA 3GKAA 3AJ7A 1XKJA 1DV7A 1UWAA 3SUUA 1Z42A 1X6LA 5I3GA 5D03A 4ZOCA 4EK7A 1B90A 4AD1A 4IG2A 4KWUA 4GLEA 3CPUA 4UZSA 1WZMA 3H26A 2G3JA 4LCRA 1YKWA 5DEZA 1JYWA 3U2EA 3TQKA 5G5IA 1M68A 4FXRA 4R88A 1ADOA 3B97A 4UIOA 4LB4A 3CBWA 1G0CA 1VFLA 3GK0A 3S6TA 5LA2A 4BF9A 3APYA 2JGQA 2R24A 3NQ7A 5AHLA 1HP4A 3N15A 1I0DA 1SFTA 3BAJA 3MP4A 1WPCA 3OZOA 2YX0A 3BZGA 1BYDA 3AS1A 4OWGA 1OABA 2OELA 2WVTA 3MBDA 2NX3A 4H6QA 2WZTA 1IXOA 4M19A 5ENLA 2J62A 3EYPA 1TPUA 1XH2A 4A35A 4AIUA 5KZEA 4F0RA 1IZCA 3HPFA 1AJ2A 4S3BA 1JFXA 3QF0A 6XIMA 1P0KA 2A3BA 4G9PA 3DC8A 4GPNA 2OKTA 4FOUA 4HU4A 4DJDA 2ZTKA 3W1RA 3LPOA 3AROA 4DO6A 5FL0A 4FLRA 4GZIA 4LV4A 4J7RA 1P6WA 3OYZA 3VMPA 3M0YA 3FJNA 4X9YA 1XCXA 3LK6A 1AD4A 1CXIA 3QHMA 2XFRA 4IICA 4YN5A 1A5BA 2PDQA 4W9TA 2AQOA 1E0UA 5BXRA 1J2WA 1TTIA 1UD6A 3R58A 1W91A 3FYOA 2R1NA 4B15A 1BVNP 3AMLA 2Y0FA 2HE5A 3W7LA 4FNPA 5DELA 5CAKA 3NPVA 4YTQA 4GYPC 4CCZA 2PDGA 3GUWA 2CBUA 5LIYX 1NELA 1NFPA 1DKWA 3TQ0A 2EKCA 4C6FA 3F4CA 2NT1A 1EOMA 3SDOA 3UA4A 2Y5SA 4HT3A 3L5LA 1JXKA 4IFKB 3EBVA 4AWEA 2GJXB 4YU1A 3W1MA 1J0ZA 1SZRA 3PS7A 1E3XA 4BY3A 3BW4A 1XSJA 1JG9A 3ZVIA 4PUDA 2WAGA 1UR1A 2Y5JA 1VJIA 2GWNA 5A8MA 3STGA 3W6MA 3LNMA 4KWVA 3UPWA 5AYXA 4LANA 3IJ7A 2Q6ZA 4S2CA 4F0LA 4HOWA 2EG8A 5G1YA 5FEWA 4MY1A 1BPLB 4WLCA 1RJRA 2IKGA 4L56A 1JCTA 1W3HA 3KL0A 3RMJA 4JHZA 3WDJA 1R30A 3A6OA 3M0IA 1BHGA 5TNVA 2WVUA 2DUAA 3SCRA 1X7IA 3DG3A 1W0MA 1PSCA 1BXBA 1O12A 3THDA 4Y8FA 3VIJA 1N82A 1XFBA 5XINA 4O19A 3WYZA 5I24A 1CGUA 4FS9A 3LHZA 3VIGA 1P1MA 4X0NA 2ZE0A 4QS6A 4LX4A 1SO6A 1E56A 3L4VA 4HMNA 1N8FA 1VFTA 3WIJA 2D0GA 4IPNB 2VWTA 1QOPA 3AHVA 4UTTA 5G1MA 3UQNA 4HCHA 3L4ZA 1EP1A 4OE7A 2AOSA 2YCKX 4GHRA 4Q8PA 1WXJA 3GHRA 3URNA 3LTYA 5A6MA 3GFYA 1H1NA 4R33A 3OJGA 4GCAA 2GQ3A 1DE6A 3MO4A 4UMCA 1C8XA 2X1SA 3FVMA 3WX7A 1W3IA 2BMBA 3MT1A 5HMSA 3EA3A 2A1YA 1K9DA 2F2KA 1G67A 1QPKA 5K2ZA 1W9VA 5EMYA 4JN6A 3OQ8A 3L5AA 2GWGA 4NNAA 3U9IA 3SB0A 3WQ8A 4BQ5A 4DB7A 3WF4A 3A22A 2UBPC 4HQVA 4AY8A 3KBWA 3WD1A 3S9IA 3GH4A 3REQA 1AMKA 3VCNA 4C90A 2GOKA 4QS5A 3F4NA 1ZZMA 4CEUC 1U5HA 2ZBTA 4XAYA 4HZ6A 1H7NA 1VKFA 4HNVA 4E6MA 2CBIA 4DLFA 4ADSA 1TZZA 2FB2A 4U28A 4KETA 3SM0A 3NQ2A 1SFJA 3T81A 4REQA 2VRKA 3UY7A 5LIXX 3PFRA 4QFUA 2CXEA 1ENUA 4UBPC 2HMCA 1KBBA 4XO7A 1VC4A 1E9YB 1GZGA 3WD2A 2XIMA 3MWAA 4C6BA 4JNYA 2KZHA 3P5ZA 1YTDA 5GNZA 4QR6A 3B03A 2D73A 1ISYA 4ATDA 3LD5A 1QW9A 2CZEA 4K6AA 4Z1DA 4R27A 2I56A 3UVIA 3L4WA 4YL2A 3EKLA 1AW2A 1QWKA 2V5KA 2FLIA 1J93A 2JQXA 4DUXA 2R1MA 3I7SA 1CBGA 2RJGA 3ZQ9A 1IEWA 1XYCA 2HJPA 4OV9A 2BY0A 2V63A 4XBKA 3WUGA 3W83A 3A64A 1E55A 1KQYA 1T5AA 3N4AA 1UP2A 3OBAA 4HNNA 3W28A 4FOKA 1JAEA 1W5PA 4FLSA 2J7GA 3WLTA 3TOPA 3F4WA 1ISXA 5AVHA 4AH7A 1QNRA 2PF8A 4RNIA 1V08A 3CZLA 4GX8A 3RF9A 3QC0A 2Q8XA 3CT7A 4HD5A 3DG6A 5HATA 2PGRA 1PIFA 1FWNA 1PO9A 4UXDA 4LUTB 2W5FA 3WLHA 1A5OC 4QLKA 1YTKA 3W0KA 4X63A 1X1NA 3THCA 3OGSA 4JYDA 4JD4A 4K3ZA 4DBUA 1TV2A 5HMEA 4O1AA 3S2LA 4RKAA 1M7XA 2OYMA 3AIWA 2YL6A 3PSVA 4J27A 1A3HA 3CL6A 3DFOA 2BV9A 1SJDA 4X22A 4AHQA 3CHVA 4QHRA 1A53A 4D1JA 1YE6A 2J6VA 2PBOA 3S6OA 4K2SA 4WDWA 3SAZA 3GU9A 4M5PA 4OUIA 2PTWA 1V0MA 2BB0A 6A3HA 3GU1A 4GXWA 1ZL1A 4W93A 4H8VA 4G7FA 2DVXA 1EJXC 3H4WA 1XBVA 1HKWA 3TONA 5AC6A 4IJRA 4ZOBA 3OVRA 2NUYA 3TJ4A 6PTDA 4DZIA 3TJXA 4AXKA 4ASTA 3SN0A 1CB7B 4N02A 1AQ0A 5FJPA 3D3FA 3CAQA 5T91A 1XUUA 4R5EA 4GI8A 4NL1A 1SSDA 2CIPA 1NFBA 4ZE5A 4JCLA 3LZ3A 3FVDA 1X38A 5C9RA 1HIZA 3GDMA 1FHVA 2PRLA 4UB9A 4XZ9A 3UERA 4TUFA 3S1XA 3AWNA 4DWSC 1HJWA 2V3FA 2CETA 1V3LA 4ZEPA 4LYRA 1Y65A 4MGGA 4ZGYA 1B9ZA 3BH4A 2C1IA 3RPMA 1OCQA 4EKJA 2R8WA 6ENLA 4XIMA 3HPZA 1QOQA 3I3DA 2AL1A 1MUWA 1XISA 1NOUA 2V3DA 4DUWA 1D2KA 1R3YA 2A21A 3FYPA 3EKZA 2WMGA 3L4TA 1REQA 4RNJA 2WPBA 2GVLA 4GC4A 4Q4RA 2EG7A 3UR2A 2DJLA 3OA5A 4PBFA 4FIQA 3SN4A 2C7FA 1IIGA 5IM51 3R8RA 3CH9A 3VOHA 1OGSA 3ZVHB 1LOSA 3A24A 3DHDA 1Q6DA 2BGNE 4EF9A 3GM8A 4MY8A 2PSNA 4ZFMA 1CXLA 4GQQA 1UPPA 2XSXA 3OBKA 4GVIA 4NJIA 2VC7A 2PPGA 2QJIA 1ICQA 1XGDA 3VC6A 3QVQA 1KFCA 3GVQA 5T26A 4DNMA 3FA4A 1XRTA 3S8HA 2XH0A 4MZ1A 1LUCA 2YLAA 4JIPA 4QDMA 2J7FA 4GKTA 2YJQA 4FMVA 3CZKA 3VNLA 1VZWA 4GINA 1XIEA 4G2DA 4MOZA 1XLCA 3DYMA 1H4PA 3CO4A 3LM7A 4NRRA 2QMKA 1XG3A 3R10A 4IXXA 3CL7A 1O4UA 4QEHA 4AX7A 2E9BA 4LRTA 1NDVA 3E0VA 2GQ8A 1HZYA 2QR6A 4XD5A 2ACUA 3UG8A 5XIMA 1Q6CA 4EAMA 4PTDA 2O9OA 4LYKA 3O2LA 3LHTA 1H50A 2NUWA 4I5UA 3WJWA 3TP4A 2XYLA 1UCWA 2WM1A 3LCGA 4AZCB 3R8GA 3TW9A 1D8WA 3IV8A 3EOLA 4E2DA 2B4GA 4BQ3A 2YW3A 4R9XA 3H54A 2PDIA 1VBJA 1PXGA 2O0TA 3CUHA 2JALA 3NIYA 4HNCA 1K77A 1WCGA 3T07A 1AD1A 3QTGA 4I90A 4WSJA 1UBSA 5C5YA 4PL2A 1M03A 3CL8A 3FDKA 3T09A 4H7ZA 3IK4A 3RRXA 4EVZA 3F5JA 1JZ7A 4QXIA 3WQ4A 1FA2A 5CPLA 4LFYA 4XZWA 4MPKA 3TEVA 4L6HA 2G3MA 5BXTA 5FSEC 1UPMB 2YDAA 1O5KA 3GSMA 3GIPA 4JKKA 1DHKA 3QQ0A 4ML4A 1XDJA 1WBJA 2E09A 2EPLX 2PP0A 1OYCA 3UR5A 1JAKA 1GVRA 3PUOA 1E40A 3DIPA 3AOFA 1ZPTA 3LY0A 4A3HA 3HQNA 5EL1A 4FLOA 4V28A 2VDHA 4JKMA 3KDNA 2NUXA 4HYRA 1VYPX 2XWDA 3W76A 2CHOA 3GXPA 4NAFB 1RVGA 4WZHA 5LIKX 5B7YA 2QDEA 1VPQA 2Q8ZA 1PWMA 3OLEA 1TTQA 3N6HA <