4M8NE

Crystal structure of plexinc1/rap1b complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
168
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for activation and non-canonical catalysis of the Rap GTPase activating protein domain of plexin.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
molecule keywords PlexinC1 Intracellular Region
total genus 40
structure length 168
sequence length 168
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m8nE00
1FZQA 4C0SA 1Z8FA 2W6IA 3QXCA 1FNMA 1E4VA 1FW6A 1Z3IX 4RFVA 2EQBA 3WMGA 1D2NA 4Q4AB 2D62A 1MRNA 2OT3B 1AS3A 1N6IA 2OEPA 4D80A 3GJ5A 4G5OA 1JJVA 1KGDA 4RJLA 2CNWD 3THOA 3TQCA 5CJ2A 2CHQA 2ZR9A 4JS0A 1KDOA 1QHIA 3UG7A 4BE7B 1NBME 4EFMA 4GOXA 5FUVA 1FMJA 1Z6TA 5FL7D 2AK3A 3D3QA 4QBHA 2XXAB 2HDNB 1OFUX 3DM5A 4TQ9A 4UQOA 4DDWA 4TYPA 5KO2A 4LHVA 1FUUA 4L16A 4XJXA 3T35A 2QAGC 2RAPA 5KSZA 1RZ3A 3TSWA 2WJIA 2VP6A 4O0MA 4PR0A 1T9HA 1J70A 4RZ2A 3RSLA 2OAQ1 2XEXA 3RYTC 3A4LA 2BMFA 1R0XA 5SZJA 1TQ6A 4C0KA 2IHYA 4G0NA 2QL6A 1UM8A 1R5NA 4XOIA 2FX3A 5EE0A 4BUJA 3QPWA 5E95A 4HAXA 1UBFA 4A15A 2J0UB 2C96A 3LX8A 4QGHA 3WYGA 2BIFA 1LS1A 2C9OA 2IL1A 4XTRA 4PSKA 4RCYA 2ZRIA 1DAFA 4KSBA 4TWZA 1SVLA 1VYTA 1XFAA 4NYIQ 1QG2A 2E1RA 1GL9B 3KTAB 4X8OA 3BH7A 4LX0A 1M74A 3OHMA 3U3JA 1Y3AA 4GBMA 1RRFA 3TW4A 4DLXA 1N6KA 2R6DA 2E87A 1XP8A 3BOSA 1G8PA 1SXJA 2V6IA 4LPKA 1XD2B 1UDXA 3I4LA 4IDOA 4F7WA 2ZANA 4BFZA 1KY3A 1T3SA 2F3TA 4IFEA 2GEUA 3THYB 3THXB 3SR0A 4Q9JA 2G1KA 4A2QA 2PEYA 3GLFE 1SKYE 2H5EA 1OFHA 3Q7PA 4WZ6A 1GILA 1K5GA 5FOWA 1IQPA 3E2IA 4U5XA 2NG1A 3KZ1E 4EDHA 3EPKA 1OSNA 2CVHA 2ZRMA 4B43A 5DE3A 3KKQA 4D4JA 2IW3A 1FTSA 2GF0A 1GRRA 4HAVA 1VECA 4R2HA 4OL0A 4Z1MA 1SKYB 1JXMA 3SNHA 1U9IA 4P33A 1XJ0A 4DBLC 2PZGA 4TSFA 1Z29A 4XWAA 2BWJA 1DAKA 1NSFA 3HU2A 3BC1A 4BZPA 1VYUA 1NNEA 1CEEA 2WKRA 4PPQA 4TLAA 1NLFA 5D3QA 1NL3A 2IF2A 2ZUBA 4UNPA 5FOSA 1JECA 2QG6A 2FNAA 4Q7KA 4R71A 3JVVA 4ZPXA 3L0OA 5K8IA 3OEEA 2IXGA 1JJ7A 3NIBA 3PUZA 2IBMA 1WMSA 1FP6A 1ZUHA 2CMKA 2ZI5A 4R2IA 3LO5A 2F1HA 1C1YA 1YE8A 3MSXA 2QY9A 4F4CA 4W5WA 4BFVA 3IBYA 3SQXA 1DO2A 2HJGA 1TU4A 4JLNA 1CRPA 2FH5B 4URVR 2H57A 2NIPA 1KI1A 2A5DA 2EYUA 2J9RA 4YMWA 5EQTA 2GA8A 4XVRA 3RSOA 4XVQA 1IBRA 2VH5R 3WMEA 2O8DA 1XF9A 1JALA 1X8KA 2QE7D 3BS4A 2ODBA 4IEIA 4QXAA 5BW8A 821PA 5F9HA 4KVGA 3SOPA 3F0TA 5JRZA 4KV9A 121PA 1F6BA 4BWYA 3A8TA 5EXPA 4PC1A 1I4TD 1P75A 1KK3A 4I1SA 4OQMA 2NQ2C 4EKDA 3EC2A 1DTSA 3AKDA 3LWNA 4Q7LA 3VX3A 3MWYW 1Z6YA 2FF7A 1UF9A 5AUOB 1E0SA 1DELA 5FTLA 3H0KA 4QHSA 3LVRE 2ZVPX 4D0GA 5TV2A 3VNVA 1XPUA 1P3JA 4QFMA 1IXRC 4TQUS 3H2YA 3SJCA 4B3BA 1XTRA 3B1XA 1DAMA 1EX7A 3CNOA 2A7QA 1XZQA 4I4LA 1OB2A 3CIOA 4D4MA 4BRUA 2AK2A 1AN0A 2RB4A 1CJKC 3EWSA 3U6KA 4V03A 2X1VA 3FKSD 1KDTA 3QUSA 3RWOA 2IYWA 1W47A 2BC9A 2WMNB 3WYFA 4LV8B 2JEOA 2XGJA 5EUMA 3TBKA 2REXB 4M1SA 2KSQA 1MABB 5KHOC 1MR3F 1JPNA 1OXTA 4KBFA 3M1IA 3GP8A 3G5UA 4I81A 4Q1DA 3IO3A 2XTNA 1JAIA 1YKSA 4CEIA 3B1WA 5JCPA 3P1JA 4OHWA 3K0FB 1KJZA 1Z22A 4FWIB 1OFTA 4JYBA 1JEEA 1Z0DA 2Z0MA 5JWHA 1C9KA 1RRGA 5C1BA 4PO8A 1A7JA 4MUBA 4RD2A 1ETUA 4HUQB 1MO4A 3BIFA 2V55B 4B3XA 1H8ED 2HCJB 2PEZA 3B1YA 4BECA 3OEHD 4HDOB 2FA9A 2OBLA 2ORIA 3R8CA 2OSBA 2OUKA 3ZIAA 2WKQA 2Z4RA 1PZNA 3KJGA 4IVQA 2ZREA 2ORWA 1JR3E 1Z63A 4W7SA 1NG9A 2OAP1 4E09A 2WICA 1AKYA 4PHHA 1VG9B 1VHTA 1VDZA 1W0JD 1U9IC 4TMWA 1JQJC 4TQAA 4Q4HA 3G0HA 1P9RA 2G3YA 3ETLA 3RANA 1R7RA 1Z47A 4LV5B 3WY9A 1E79D 5JLJA 4A9AA 3HR7A 2O0KA 4GOJA 1NMXA 5DYGA 3U4QA 2ONJA 2CHVA 2CLDX 2ZRLA 4WAUA 4EJSC 4RD6A 3GJ8A 2NO1A 1G17A 4V0LA 5HE9A 1US8A 2EVWX 1XTKA 4LC1A 1CRQA 4GSYA 4WZAE 5FPSA 1ZIPA 5JCZA 3GLHA 3CWZA 3GEIA 3FVQA 1UBCA 2IK8A 4BLOA 2ASEA 3MWJA 4NTZA 4FD2A 1ZNZA 3BRWD 4O25A 2KJQA 1BMFD 3CF2A 4DLTA 5JI3E 2OXRA 4KXFB 1P72A 2DB3A 1AGRA 2C98A 2VP4A 3K09C 3B85A 3QI2A 2VPPA 2W58A 3W90A 4L9SA 3NDPA 4LJ7A 2ZI9A 3K0CA 3KUCA 4P31A 4TLEA 3TUJC 1KIMA 1E2IA 3LVQE 4CYMA 3EIHA 3K70B 3KTAA 2Q3HA 4AIIA 5LD2B 4HB3A 1P4SA 5CB8A 1NY6A 1ZU5A 3AVOA 2EWWA 4O3MA 4PXAA 3ADBA 5AJZA 1G41A 1HE8B 1RIFA 1ZAKA 4M1KA 5C4GB 5KNDA 4E03A 3KJIA 2ZJZA 2WJVA 4B47A 1L7VC 2K5UA 2Q9CA 3FYHA 2FSIA 2G88A 3EG5A 1SQ5A 3CW2A 3AKYA 2IYLD 1ANKA 4Q03A 4URZR 3X1ZA 3A58B 3FKQA 4B74A 2WTUA 5BWMA 4U7DA 3VAAA 1QHSA 2GILA 2V4ZA 2VBCA 4DRZA 1G1MA 1XJCA 4M1TA 4JT4A 5SZIA 2QNRA 3T15A 2F1JA 1LVGA 3K9NA 5J47A 3WP1B 1Z2AA 1QRAA 2FN4A 2CE2X 4PC6A 3LFUA 4ZIRB 4X8LA 4AC9A 5DNYB 1AKEA 1E9DA 1HY3A 3ONWA 4ITRC 3K8YA 3T61A 2F43B 1BIFA 4PSAA 3GLHB 1S1CA 2OE2A 3FMIA 1XTSA 1OH7A 2J0UA 4EJSA 1AS0A 2FU5C 4XIGS 4B75A 3U7GA 1N2CE 1TU3A 4AKIA 1U81A 1R4AA 4MRSA 3VHXA 1NKTA 3FTQA 5KPDA 3B1VA 2W6ID 4LSGA 2W6JD 1E0JA 4YDHB 4TLBA 3QBTA 3U4QB 3HYTA 5BYJA 1A1VA 5EP1A 1U99A 4IOJA 2AFIE 1DEKA 2QP3A 3WXMA 4OHXA 3PUXA 3FHOA 3QQ5A 1OW3B 2F3RA 2QTFA 1BH2A 3U7HB 1KOFA 4D4LA 3A1SA 5DLQC 3ND9A 4JLKA 3R9WA 1RJ9A 1DAGA 2BOVA 2B8TA 3Q7QA 5JWRA 2AXNA 3AF4A 1BYIA 3K0SA 2QP4A 3GJ6A 5L3QA 1OKKA 4PHTA 3EZ9A 4Q01A 1FP7A 2N46A 3TMKA 3FHCB 4OI1A 2RGEA 4IOMA 5K8UA 2O52A 4QJ4A 2GESA 1U8YA 2W0MA 1LFDB 3OFNA 2ZJYA 4OJKA 3LQQA 3DO6A 5AJYA 4EFLA 3RS5A 3CRVA 1IJFA 1GITA 4B6FA 4Q18A 3AF0A 1TNDA 3GQBA 4V0OA 3C5CA 4KU4A 4N1AA 4JVNA 3KUDA 4NCNA 3DKPA 1CTQA 1OXUA 3ZVMA 4FXPA 5LB2A 3SFVA 1RYFA 4O2RA 4LV6A 4DLYA 1OE0A 4Z51A 3AVTA 2P5SA 3ADKA 4LHZA 1E2KA 1N0UA 2IT1A 2ZTSA 5M04A 3U3OA 3JZMA 1Q3HA 4LRWA 3NC1C 1IM2A 1YRAA 4ZDKA 4DDTA 4FCWA 1QVRA 2G0NA 1KY2A 3QPUA 3GCGA 1YJ5A 3PXGA 1TUEA 2OFXA 1P5ZB 4LYHA 2GXAA 3L0PA 4LJYA 5HCNA 1EFTA 2YC2C 2HJVA 2ZRHA 2ANCA 3OFND 1KI9A 2HT6A 2BJWA 3ADCA 2IS4A 2R8RA 3EIQA 1HT2E 4KO8A 3T1QA 5L3VA 2P6RA 1VCIA 5CYOA 1AIPA 3RS2A 3LRPA 5EUQB 3WNCA 1MOZA 1SVIA 4FINA 2J7KA 3AM1A 1MO3A 1E9CA 2P3SA 3UXMA 2CBZA 5A4JA 3B9QA 1WBDA 2D7DA 1P2UA 4MYTA 1DARA 1IJEA 1SKQA 4DCUA 5HPYB 2XNSA 3SE0A 4UJ5A 3X1XA 4KLZA 4B3GA 1NVVQ 4DHEA 2NGRA 5FTNA 3IQWA 1B0UA 4C0JA 2OO7A 4AYTA 3DM9B 1G5PA 1W2GA 2Q0HA 2LKCA 4U00A 3W8RA 1NY5A 2FSHA 3QKSB 1F2UB 4LJ5A 2ZR7A 3A4NA 2KBEA 3FWYA 3VQTA 1OFIA 1PUIA 1UKEA 2IEZA 1PUJA 2Z5FA 4IFBA 1U2RA 4NE2A 4LY6A 4FMCB 1OPXA 4JL5A 3VX4A 1N0WA 1SULA 1UPTA 2VRWA 1XRJA 4KFUA 3QKRA 4ABYA 1XBTA 4DZZA 4GZLA 2JLSA 3IIJA 4KFRA 4TMXA 2WWIA 5UKDA 2B7CA 4M1WA 3SS8A 4TSFD 1Q1QA 4TMZA 3PFIA 2ZM5A 1KDRA 5K8TA 3JZAA 3I5XA 2D74A 3AKCA 3BFXA 2OLKA 1WF3A 5L3SB 4GP6A 1AM4D 4UXHA 1F48A 3WBJA 2KBFA 3BBPA 4HZUB 1FX0B 4JMPA 4CT4B 1P62B 4EIWA 5TDHA 5SZHB 3QY0A 1R8QA 1ELOA 3V00A 5KPJA 3VR6A 1EESA 2FJUA 2MSEB 3TIFA 2QPOA 421PA 1H8HA 3P26A 4LJ4A 1N6HA 4US1R 5IT5A 2F55A 4C0LA 4WW0A 2PBRA 5HTKA 2PX0A 3VFDA 3VTKA 3I5YA 2F9MA 1T3LA 2LCFA 5H68A 3GD7A 4FWTA 5KU1A 3RWMB 4PX9A 4Y0VA 4A8JA 3THWB 3DPUA 3ZH9B 1Z08A 4GNKA 2RKOA 2ZS8A 3OESA 4KODA 4M4SA 1G3QA 5AUQA 4A2PA 4JVSB 5EXSA 4MDEA 1YR8A 3U44A 4NU0A 5A0FA 4B35A 1EFRD 3THYA 4Q4AA 3P4XA 5CJPA 4EQ6B 4A0RA 4RZXA 3K70D 1Z28A 4LWZA 3SU8A 2DBYA 2PJZA 521PA 2QGZA 2QSZA 3DHWC 1GOTA 3EA5A 2XTMA 1S96A 2Z43A 1E2HA 5GJBA 2FPKA 2EFCB 4MITA 3V4RA 2ZUCA 5JHGB 4JT2A 1JR3A 2J0VA 4RZUA 5BN4A 2ZE7A 5A5GA 2YWEA 3K0AB 1XD9A 1IN8A 2GAAA 2WV9A 2WOOA 5EE3A 1XEWX 5E4FA 5GJWC 4GOKA 2PMKA 3C8UA 3C41J 3B7GA 3KKMA 4NYJQ 4RY2A 2ZS7A 3H84A 1E6CA 5DN6A 3SBEA 2IYQA 1CKEA 4BGDA 3CNLA 1CU1A 5JECA 4ARZA 1T6NA 2FMXA 4YXWA 1GM5A 1GWNA 4RD0A 4LUCA 4M1MA 1D6JA 2QN6A 1E98A 1I2MA 2H1LA 4CZ2A 3EZFA 3B9PA 1JR3D 1MT0A 3F8TA 2Q9BA 2WKPA 2BCJQ 4ZCLA 1VG8A 4PPNA 1AK2A 1P6XA 4Y0AA 1N25A 5FOXA 2GZHA 3K9LA 4LPSA 4BFUA 4ZCMA 4LBYA 5EZ5A 1FL9A 3N70A 4Q02A 1GL7A 1UEJA 2N1BA 2YC4C 3DKVA 2GJKA 4DLZA 4DLSA 1NN5A 4GMXA 1GVNB 4C2TA 3AVYA 3EZ7A 2WJJA 4C7OA 2XZPA 3TSOA 3LBNA 1CF4A 1JQLB 1S2MA 1YZUA 2ZSEA 1SVSA 4BFYA 3KQKA 1I2DA 1XTIA 4HDQB 3EARA 1CP2A 4R98A 5GJCA 3GLIA 1BOFA 2QBYB 1XNJA 2V7QD 4PO9A 4HLCA 1CLUA 1S4QA 1XXHA 4DVGA 2P5TB 1XU4A 2ZSDA 4NYJR 1N3BA 4MH0R 1P60A 1XMIA 4AY2A 1OYWA 4OHYA 3DMDA 1XPRA 3AVPA 3Q85A 4US2R 2P6UA 2ZETA 2AFHE 5EE1A 1JEDA 4IDQA 2OCYC 5KOYA 4DCSA 5HZKA 1Z07A 2GJSA 2W6JA 3D31A 4D25A 3LQRA 4PAQA 2EWVA 2QQEA 1O87A 1J2JA 3ZIAD 3PJRA 4EPXA 1AJEA 3PIRA 4E5UA 1XMJA 2H16A 5TB5A 4XSHA 3CH5A 1M2OB 1XTQA 1HQYE 2FV8A 1YQTA 4I1VA 3P27A 1E69A 5DIFA 1R0ZA 2J7PA 1EG7A 2PLRA 2QMUA 3QEJA 1E2MA 2RCNA 2XB2A 2UZIR 4MGZR 3UK6A 1M8PA 3W3AA 3BB4A 1W1WA 2ZRCA 1WQ1R 2VLIA 3GEHA 3OF5A 4MRPA 3CM0A 4TMTA 4CEJA 4RVCA 3J81k 4NCKA 3BB3A 3C15C 5E7IA 2IC5A 3X2SA 1KMHB 2GCOA 2EFHB 4A4DA 2J3EA 1XD2A 2FEOA 4HLUC 4PPFA 4MYHA 3MLEA 3ZZUA 4S2EA 2R6GA 3TVDA 2LKDA 3MJRA 5D3MB 4Q4HB 2XJ4A 4OQNA 3O8RA 3PEWA 5DI9A 1ZM4A 5JSZA 3GLGB 2R9VA 4AKGA 4EAQA 3CR7A 2VP5A 1D8TA 2VA8A 4LC0A 1YU9A 4LYAA 2OHFA 4OQFA 4IDPA 2GDJA 1VPLA 3SFZA 1RC8A 3W5IA 1ZRHA 2WOJA 2C2HA 3UKDA 1ZMXA 2JIZA 4PC2A 2WBLC 3HP1A 4D0NA 2PZEA 3TNFA 4MDFA 3AP3A 1IXSB 1AS2A 5F2EA 1KSFX 2IA5A 1Q12A 2ZYUX 3OE7D 4M9XA 2HXYA 4P4TA 4YDSA 4A0HA 1II9A 2QRNA 1DADA 4TTRA 2ERXA 3O47A 3NWJA 5FBQB 4DCVA 1OXVA 1RFLA 3ND8A 4AD8A 2QROA 4BPBA 3NBZC 4JLDA 4KHZA 1ZBDA 1XB2A 2OCPA 3S1AB 1R0YA 3AVVA 4PHFA 3SJAA 3QSYA 1W44A 1GDDA 2B7BA 3AVUA 2BBSA 5C18A 2CCGA 3SDZA 3IPYA 1U8ZA 1G8GA 3DOEA 3SHWA 4D2IA 5JZVA 4LDJA 2CE7A 2V8OA 2VQSA 1VMAA 3K53A 1YR6A 4WIAA 3TW8B 2FZ4A 4ZDJA 5HKKA 4JBYA 1IN7A 3T1TA 1W0KD 1Z6GA 2OBMA 2BBTA 3OAAD 1CULC 1S1MA 2ZRDA 5CM9C 3TLXA 4C4PA 1FFHA 1XCMA 1KO8A 4PZZA 3X1YA 1ESMA 2Z4SA 4TMVA 5LBIA 2B6HA 3DOFA 2WVJA 3PR1A 3VR1A 2GJ9A 4XD7D 1MO6A 2JDID 1GRNA 2REOA 3CR8A 1RPZA 4NZYA 4B3FX 1G21E 3AP1A 3F5FA 1NN1A 2ZJ5A 4G01B 1N0VC 1OKKD 1NG1A 2QENA 2IUUA 3I62A 1VYVA 2VEDA 4J0QA 1LF5A 2GF9A 2FGJA 4ZO4A 2IS6A 4V0MA 5FI1B 3SYKA 1WRBA 1Z0KA 4IEEA 4JBWA 2QM8A 2KB0A 1NP6A 4LYFA 1WB9A 2MMCA 5KDDA 4RD4A 1D5CA 4DLVA 1HYQA 3VR2A 1D2MA 2DFKB 3BH6A 3RC3A 2QA5A 4JKIA 2GRJA 4Q66C 4W5HA 1E4YA 1BYUA 2DWPA 4WA7A 4YQFA 2A5YB 4QKQA 1RVDA 4A6XA 2JLXA 4TTQA 4JLAA 1PVOA 3PEVA 2O0JA 1FTNA 2RHMA 4ASUD 3BB1A 3KB1A 4QRHA 1WXQA 4OQXA 1W4AA 4MGIR 5TMPA 1E3MA 3KXKA 3RS7A 3VHLB 1ZC4A 1W7AA 3CPHA 3GFPA 3AP2A 5G53C 4YMUA 3RS3A 2J0SA 4BFXA 2CXXA 1W36C 2QT1A 3MWLA 5IF9A 4Z1MD 2JJ1D 1VG1A 1X3SA 2R65A 3UWOA 4M9SA 1Z83A 3SHFA 221PA 4ZKDA 2HV8A 3ECCA 5J4HA 4LBWA 2XJ9A 2HF9A 4F92B 3IBGA 1FNNA 1A5TA 2QT0A 3GJ7A 3NBFA 4US0R 1GUAA 2BBWA 1UJ2A 2WSSD 3KL4A 4B33A 2BVNA 2QMOA 4CRWB 1PLJA 3OEED 1EWRA 1NN0A 4L5BA 2Y8EA 1E1QD 3N2EA 3T1VA 2ZYVX 4RFSA 4A0GA 2ERYA 2ZPTX 4XWKA 4TZ6A 2B8WA 4Q1EA 5D3MA 4AI6A 1X1SA 2BJVA 4NONA 3QKUA 1DG1G 1JI0A 1KZ7B 4A2WA 1Y63A 4LJ8A 2NMVA 2VSFA 3I72A 1M1YE 2A5GA 2UVQA 2XAUA 4DCNA 1O3YA 2ZUDA 4L15A 2ODNA 4YC7A 1P2TA 2I3BA 1NVXQ 1KAOA 1MV5A 3CBQA 1XCGB 4Q1FA 4QG7A 4QM6A 2WSMA 1HE1C 5BXQC 1C4OA 5FOVA 4EPWA 1U8AA 4NL4H 2D4HA 1TQ2A 3OZXA 2ZU0C 3MCAA 4FCVA 4AKEA 3S1AA 2ZE6A 2QI9C 3M0EA 4XWOA 3LXRA 3QXXA 4Q1BA 5AWFC 2GK7A 2REBA 1KK2A 3UPUA 4CVNA 2ZROA 4BLTA 4KFSA 1HQCA 3ZS9A 3AVXA 3TKLA 4D26A 4RZ3A 1GAJA 1NVVR 4B3DA 3UIEA 2JLZA 3LA6A 3R7WB 2WWGA 2CL6X 1AZTA 1XDBA 2ZRGA 2DCUA 1NLZA 1E79A 4UNQA 4C0BA 3SQWA 3FMOB 4XD7A 1G7TA 5AK0A 3NC0C 1U0LA 3X1WA 4QNRA 1KNXA 4P0TA 3QF7A 4I1OA 3FMPB 3Q8XB 4GPTA 4YMSA 3B5JA 1UEIA 2ZE5A 5JSZB 4WBSA 3GLGA 2ODEA 4V0KA 3T06B 3PUYA 3L2OB 4GDFA 3I1FA 3GLIE 2FFAA 3U5ZB 1G6OA 4LCBA 5J5CA 4IW3B 1NKSA 1M7BA 2DWQA 2VHCA 3AUXA 1T3HA 4V02A 4KJZA 1FPMA 4D4KA 2AD5A 1DBSA 2AX4A 2P2LA 5KDLA 5EP3A 2O8CB 1JXOA 5FUWA 4KVAA 1XEWY 3QXJA 1OIVA 2BKEA 2QAJA 4XH9B 1GKYA 3IPXA 4URXR 3WYAA 5H8WA 2V1UA 1G19A 3W9YA 3LLMA 4QBFA 5J4KA 4NBSA 1X86B 1G7CA 1ZUNB 4CEHA 1PJRA 3IDQA 3K9HA 4C3ZA 2ORVA 1YVDA 1ZW6A 4OHVA 2QORA 2NO0A 4JLBA 3FB4A 3G82C 1WE2A 3T1OA 3PV0A 3OEHA 2RGDA 2JJ2A 3EPHA 2VP2A 3LH5A 5JRJA 2ZU6A 3FMFA 2ZRJA 1T8UA 1Q1ZA 3CF6R 1ZD8A 5CB6A 1E32A 5IK2A 5B58C 1SHKA 1SZPA 5EE5B 5G40A 4DDUA 5FOTA 4LJ6A 1M34E 4LK2A 3AV0B 2VF7A 4CF7A 1E2JA 2BKUA 5DGXA 4Q19A 2ONKA 4P4SB 1GRQA 1SXJE 2QBYA 1TF5A 5FPKA 2XX3A 1HA3A 1LW7A 2ZYWX 5AJWA 2X2FA 4NCIA 4Q4LA 3AKEA 2O8DB 2QTVB 2DFLA 5IDVA 4FMDF 2J0QA 2ZS9A 5FTJA 5FPYA 5DHFA 4DT1A 2IYZA 2W00A 1BS1A 1G4AE 1U98A 2CDNA 4QGGA 1KDPA 4MKHA 1IY1A 4M1OA 5J4LA 3A4MA 4M9QA 3QG1A 4N0EA 3LD9A 1W0JA 2VL7A 4A0FA 4Q7JB 4BEJA 1KSGA 3ZQ6A 2GZAA 3QVVA 4II7A 3I92A 4TZ0A 3ZVRA 3QF4A 4DKXA 2XTZA 1EGAA 3SEAA 4A6PA 3VMFA 4LZZA 4QGAA 4P4SA 3JVUA 2H7VA 2WIBA 1S0UA 2XNDA 2R6FA 2CJWA 2NPFA 2FEMA 2GXQA 2F7SA 1IY2A 1XD8A 2W83A 1E9RA 5J40A 1ZCAA 3I8XA 1G18A 1LF0A 1E99A 4YONB 4CT5A 2GVDC 4ZCIA 1Z0FA 3VU9B 2WWHA 4DSTA 1A82A 1N6RA 1E2PA 2CK3A 4PAMA 1IXZA 3R20A 2YV5A 3EXAA 1H65A 2J59A 2J1LA 2F1IA 2AR7A 2PZFA 3P32A 4HB2A 1ZM2A 2G77B 3MAAC 3TR0A 4AKHA 3KKPA 3OIYA 3D7MA 1JAHA 3NXSA 4NKRA 4IXMA 5FBVB 1W4RA 2GETA 4ACBA 1ZM3A 2IYUA 3O8DA 2QZ4A 2BEJA 1Q3TA 5FI0B 5KNCA 3FFAA 2ZJBA 2VO1A 3MJHA 3NBXX 3B8HA 4MGYR 3LW8A 4XSGA 1B23P 2JATA 2BMEA 2AD1A 1GNRA 3PG5A 3QKSA 1G16A 4XVUA 1CR2A 1IN5A 5GVRA 1G5RA 1L4YA 3IHLA 3X1DA 4RD3A 3R9XA 3KQHA 4HLQB 4HAZA 4MUAA 2XZLA 2VHUA 3QOFA 4KI0A 3U3KA 3ZYCA 3AB3A 4JYCA 5JS8A 4V0ME 4C2UA 3QNUA 2PL3A 4UXIA 1DVRA 4ZI2A 2F43A 5P21A 1VTKA 5JI2E 4YMVA 2YYZA 1OIWA 3GFTA 5KSYA 5H1YA 1KO5A 3IILA 1RRCA 2EFEB 3DMNA 4EFNA 2WSSA 2TMKA 4TL7A 4H9GA 1NBMA 2G9NA 2PMDA 4NCHA 4BFWA 2YVUA 2Q6TA 1XJQA 1D9XA 2ANBA 2WAYA 1EXMA 4HDCA 1P73A 4W5JA 4Q9HA 3CB4A 2ZJAA 2XXAA 4LJ9A 4JSTA 1ZD9A 3TQFA 1N6PA 1F60A 2WHXA 3QKTA 4OI2A 1QVAA 1GP2A 5CLLA 3DEFA 2C03A 1U0JA 3KKOA 2JIZD 3R9IA 4P4UA 4KFTA 1K5DA 1SVMA 4RD1A 1II8A 2JLRA 1TEVA 2DWOA 1KI2A 3B82A 3TAHA 4R7ZA 4IXNA 3BXZA 1AGPA 3EC1A 5AJXA 4B76A 4UNSA 2BMDA 2BM1A 2J87A 4JBXA 4IHQA 4DSNA 2O8CA 2A3RA 1VCNA 3B13B 5EE9A 4ASUA 3QVUA 1RJ9B 1CR0A 3TUZC 3R8FA 4RFSB 1KJWA 3AGPA 4IDHA 4B2IA 2HXSA 1LTQA 2IXFA 5FH9A 3V9PA 3GLFA 2Q9AA 3GJXC 1KMQA 3NKVA 3W5JA 2O8BB 2ZAMA 3ZDQA 3CRQA 4BASA 3WRXC 3A1WA 2XB4A 4LJAA 3T5DA 1KI7A 1N6LA 1ZNYA 2ZI7A 1HUQA 4H1UA 1KO1A 2ZRAA 1QHNA 2JDIA 5JEDA 1G8HA 5L3RA 1W4CA 2NTYC 2HLDD 5FR1A 4ERNA 2OZEA 1G5TA 2AHOA 2CK3D 2CNWA 5EZ6B 4UNRA 3QF4B 3ZD7A 1DE0A 4OJQA 5TY0A 1QHHA 2X2EA 5IHPA 1YZGA 3W34A 2H17A 5CLQA 2XNDD 4LHWA 4OK6A 3U60B 1KSJA 2ZI3A 1SVKA 1H8HD 1T5LA 2KWIA 5F9FA 2RGNC 4WVFA 5G3YA 3TE6A 4DEXA 4M22A 3HDTA 1YZTA 5FUXA 3UANA 5IK2D 3C4JA 3B60A 3LLUA 3B2EA 5GJVC 1Q20A 2WJYA 1P2VA 4MRVA 2NO9A 3CF0A 3OIVA 4FIDA 5BN3A 1K8RA 2JLUA 4G3XA 2A9KA 4IJMA 3WNBA 2RMKA 4L4UA 4F91B 1R2QA 4ESVA 1SXJC 2BV3A 3L43A 3T12A 1CJMA 3UMRA 2GJAA 4I99A 2AXPA 2B21A 4L8GA 3KFXA 4ZKEA 2RGCA 1NMZA 4L9WA 3A1VA 5FTKA 4NPHA 5J4YA 4LI0A 4DUGD 4OI4A 3A36A 3LBIA 3PUVA 4QHTA 3ADDA 1W48A 3BGWA 1SVWA 3M6AA 1ZYUA 2D06A 2Q3MA 1KMHA 2QE7A 5KTYA 2ZJOA 3LXXA 1YRBA 3TRFA 1MABA 1CR1A 1IHUA 2QU8A 2ZRFA 4D6PA 1II8B 2QGNA 3W3ZB 3LBHA 4M9ZA 2BBOA 2IX3A 4CGZA 1TAGA 4PSVA 2GJ8A 2IYYA 1ZM9A 1E9AA 3CH4B 1W46A 1OLOA 3P4YA 3HJNA 4Z8XA 5CYPA 2QP9X 5DI3B 4O2LA 1N5LA 3CZPA 4BLQA 3GLFB 4TL6A 2W2VA 4JVMA 1W49A 2XSZD 3D6TB 1N5JA 4AYWA 2HEIA 1NMYA 3NEYA 2NO7A 2OLJA 2VHQA 3LDAA 1XMVA 3B6EA 4ZDWA 4JJKA 1Z06A 1U90A 1OJLA 3HWSA 2NZJA 2A2ZA 2N42A 4JLVA 1P61B 1EFCA 3UMSA 1P7CA 1ZM7A 3IEVA 4NYMQ 2JA1A 1S3GA 4A82A 5JWOA 3A6PC 5LD2C 2CVFA 3CKLA 4Q00A 1FQKA 3REGA 1XWIA 3BFVA 3IIMA 5ELXA 5KYKA 1WDTA 1Q22A 4KITB 1HH4A 4NHOA 3RLFA 3CO5A 1ZVQA 3MGCA 2FSGA 3U3MA 2GEVA 4BFTA 5FBRB 3GMTA 4Q1AA 4JL8A 4UJ3A 3TJZA 2Z6VA 1ZNXA 2DR3A 5GVSA 1VKJA 4B48A 4Q9KA 1LNZA 4KYIB 2Z83A 2GBLA 2FFBA 2WJGA 1S8FA 2RGAA 4IVPA 1EX6A 3IIKA 1G3RA 2A5FA 4HI0E 1VCMA 2QMEA 3K70C 2OFOA 2WMOB 2PCJA 2CL0X 1G7RA 4W9MC 2RGGA 4Q47A 1JR6A 3CRW1 2OG2A 4QJ5A 1IN4A 4B2PA 4K81B 5CDFE 4PHGA 4QM7A 1TUIA 3E5HA 3RABA 3KJHA 1ZNWA 4Z8YA 3U61B 4U02A 3W6OA 1DG3A 2P6NA 4AG5A 2IS2A 3IGFA 5TVKA 2W2XA 2QUZA 3VU9A 3ZZTA 1II0A 3NG1A 4TYYA 1J8YF 2HLDA 1MRSA 2VP0A 1TQDA 1GSIA 1VCOA 2F9LA 2WM9B 5HCIA 1E94E 3MG9A 2VIIA 4A92A 2QPAA 2I4IA 1R8SA 1W2HA 3RS4A 1MO5A 1RKBA 3H1TA 1D2EA 2O8EB 4BZXA 3ZZ0A 1G3IA 1WA5A 3LY5A 2WWXA 3EAQA 4QBGB 1KI6B 3AEZA 5FBWB 5B64A 2JLWA 1KAGA 2DFTA 1P9WA 1RYHA 2QMHA 5BYKA 1F3OA 3I8SA 1A4RA 3DZDA 3U7EB 2ZRPA 4HAWA 2GTPA 2QAGA 1R10A 4NP6A 3KQLA 4ZDIA 3MMPA 4YLGA 5AR1A 4DSUA 4AYXA 2BEKA 3PITA 2FSFA 4DLRA 4D82A 1OIXA 4ESHA 2YOGA 1AA9A 4WXPA 2HCBA 5FPHA 1Z0AA 1KJYA 1H8EA 3KX2A 4GZMA 3RVBA 2DPXA 2OCBA 3KQUA 2O8FB 1TTTA 5HR5A 2BMJA 2GVZC 5SZKB 1ZINA 2XSZA 4BQSA 2YKGA 2OBNA 3KDSE 2VSOA 1Q44A 2WWYA 2W0SA 1T5IA 1RW4A 1UADA 4BLPA 2FPMA 2PJRA 1XMSA 5LB4A 1JB1A 2HUPA 1UFQA 1W5TA 1YZLA 2JAQA 4JLMA 2WAXA 1E2NA 1SXJD 4JL6A 2GXSA 4LBVA 4PZLA 2FE4A 5DO9A 1M7HA 2IHBA 5L3QB 3CRMA 3U6BA 3L8ZA 3FE2A 3NH9A 3QENA 1FMLA 3A1UA 3H4MA 3B1ZA 2JGNA 2NPIA 2V6JA 4TLCA 1DAHA 1QHYA 2ZRBA 2UZ3A 1XTJA 4GRAA 1A2BA 3L0IB 2WPDA 4C30A 4DIDA 2XITA 2G83A 4PZYA 4Q4JB 1NLYA 5DI3A 3TVTA 5B30A 4TMKA 4LBZA 4DDVA 1DAEA 4DUGA 3CPJB 3U7FB 5HZHA 3GJ4A 5B2ZA 3W6PA 3QIAA 4Q4JA 3WP0A 4GP7A 2GBLC 3RAPR 1D9ZA 3HPQA 3BAFA 4QNMA 2D2EA 2OILA 5HKKD 5TXGA 2ZAOA 2ZE8A 3HPRA 1F2TB 4Q7MB 1BKDR 1KKLA 2C9YA 3SBDA 4DB2A 1G20E 2GCPA 2VHJA 3WBKA 4PANA 1Q1EA 1OYYA 4A8JB 3QE0A 1OH8A 1HV8A 1JPJA 3UG6A 4HAYA 2O8BA 1NVWQ 5KUTA 5FUYA 1T0JB 3SJBA 4WOPA 1OHHD 5CK5A 4F4JA 3BE4A 3EWAA 3AF2A 2CL7X 4LYJA 2C95A 3KFVA 3WMFA 5HE8A 2WWFA 3W8NA 1F5NA 3CPEA 2ECKA 2IYTA 3GJ0A 1TX4B 2ZI6A 5DYIA 2C5LA 2AWOA 4V0NA 5CDFA 3DL0A 1X6VA 1NIJA 1LB1B 1NVUQ 4C0HA 4M21A 4Q1CA 1AZSC 1EFUA 1G3MA 1ZC3A 1DOAA 4JJZA 1CJVC 1KZGB 4NCJA 1Z5ZA 3SI7A 4A36A 4GMDA 1M7GA 3I3SR 3NH6A 1OHHA 4C7OB 1QHGA 1W0KA 3ZS8A 4B44A 4Q21A 2R6CA 4BRWA 4OBEA 1P2SA 2BM0A 2GCOB 1RE0A 2GEDA 3E1SA 3U2QA 3N2IA 3N5CA 4PTLA 4D81A 4MGKR 2PLFA 3BK7A 3RNLA 3AVQA 3L0SA 1E2QA 1GKUB 2HYDA 3CLVA 1G291 2CEAA 3BERA 3IEUA 3ASYA 4PAOA 4B71A 1Z6AA 3CWQA 3NTUA 1E9FA 2DHRA 4E07A 4N0DA 1KO4A 2FG5A 3SYLA 5J4VA 4CEIB 1CR4A 3FPAA 2G0TA 2R2AA 2MSCB 4HLUA 1TF7A 4R9UC 5JBQA 3ZVNA 5C4MA 3MFYA 4AK9A 2C9CA 3OIWA 1HEIA 2GHIA 1N6OA 4RSGA 4URUR 2YJTD 3LX5A 1A2KC 1T8TA 1X1RA 3B78A 3LW7A 4PFSA 2YOHA 1W36D 2RGNA 1BO6A 1SVOA 2D7CA 4B2LA 3AQ4A 1LS6A 2J7PD 4RCZA 4POAA 1DAIA 2O5VA 4CDGA 4I1UA 4DB4A 5CK4A 1CJUC 2WZQA 3BJIC 3BD9A 3I61A 2IUTA 3Q72A 3SN6A 4ZI3A 3W6NA 2PH1A 2C77A 1XXHB 2VP9A 4QHYA 1E1QA 3KB2A 3FKSA 3AF1A 5CM8B 5BN5A 5G41A 2AL7A 2YHSA 4PC7A 4HB4A 4ACAA 4D0LB 5K8LA 1OH5A 4WXRA 1MH1A 1VHLA 2ATXA 1NJFA 4TN1A 3TUIC 5DN6D 4WZBE 5FFMA 3GEEA 4URYR 3ZGXA 2AWNA 2PT7A 4QOSA 1OXXK 5EXXA 1GKIA 3A1TA 2YOFA 3U3RA 4TL9A 3VKWA 3AF3A 5C46F 4M1YA 5DHAA 1GNPA 1XPOA 2WJHA 4F4IA 2J45A 3O8CA 3CRRA 1LV7A 4TL8A 3DVLA 1YZNA 1HTWA 1F2UA 4HAUA 3NBYC 2IWRA 3IHWA 4EPTA 1UKYA 2O8EA 3MWKA 3IKJA 3MD0A 1KKMA 1NIPA 2H8KA 3RHFA 3ICQB 3BH0A 4F38A 4IVRA 5JJIA 4ARZB 5CIWA 2O8FA 2EFGA 3CUEF 2RGXA 4MKIA 3UATA 2H18A 2J41A 1QBKC 3Q5DA 3QJYA 3RRNA 4C0QC 1X8JA 3PVSA 3RRYA 1KSHA 1CBUA 1PLKA 3EZ6A 5FTMA 4E22A 5L8VA 2NOAA 1U94A 2SHKA 1G64A 1R0WA 1KI8A 4NH0A 2WWWA 3VNUA 2XZOA 3NHBA 3L8YA 3HYRA 2CJWB 4BLRA 3K0EA 3BORA 1XX6A 4B73A 2ZIAA 1I4LD 2EU8A 3AH8A 1KK0A 1IAQA 1Z0JA 4Q5IA 1ZUIA 3Q5EA 1ONBA 3GJ3A 4A8JC 1YZKA 2FFHA 3NDBB 4OYHA 3QPVA 4EQ6A 3C14C 2F1RA 2YWGA 4FI3C 2CCJA 4PO1A 1G8YA 3AVWA 4C9BA 4TT3D 5AJVB 2CLCX 1TPZA 2EYQA 3P20A 5TARA 2GKSA 5KDOA 3BFKA 1TADA 1TMKA 1L2TA 2JCSA 1COWD 2J5XA 2OXCA 1COWA 3HR8A 2CCKA 2ZSAA 3REFA 1YR9A 1ODFA 4HB0A 2FGKA 1KI3A 1SXJB 1WP9A 4MKGA 4URWR 4H1VA 1GNQA 3O8BA 3UWKA 1E0AA 3F3YA 2I1QA 5EJEA 1HT1E 1X8LA 1QZXA 1UAAA 2GK6A 1G3UA 3AUYA 1U0HC 4PQYA 4EPVA 2OESA 1TEXA 1R5BA 4AWXA 2A78A 2PT5A 4HZIA 4CEHB 1FX0A 2LWIA 1BMFA 2QM7A 4UNNA 5L3SA 3RDPA 1E2DA 3MUFA 4N3NA 4MQBA 3KKNA 2E9SA 3GLHE 4JKYA 4BEBA 2VSXA 4RKEA 4LHYA 3GFOA 1WCV1 1ZJ6A 3SJZA 1J8MF 4M0LA 1E2GA 4KLNA 2ZEJA 2OV2A 2AKYA 3ASZA 1XEXB 2QQ0A 2A30A 1E2EA 1L4UA 2H92A 3VKGA 3WHKA 5JJKA 5EP2A 4DLUA 4A1FA 3WRYC 5LPNA 3V4FA 3GPLA 2WIAA 3C16C 4UKDA 1G6HA 4F93B 4YXWD 1KI6A 2GXUA 1OB5A 2W2TA 4BLSA 2ZSFA 1ESNA 1NSTA 1CIPA 3VR5A 3CZQA 5LDDC 5AUNB 2XOKA 1DPFA 3RRZA 3KXIA 1N5KA 4QBIA 2DY1A 3THXA 5FBLB 3R7WA 1TF2A 1LY1A 2ODWA 2PX3A 5KSPA 2OCAA 1T91A 3NVAA 4OK3A 2GAOA 3MRSA 1JBKA 4JVLA 5FL3A 3TAUA 3FOZA 5EXTA 2P65A 4JLOA 1GTVA 4G1UC 1NJGA 2MSDB 2QRZA 5JMTA 4PPGA 3EX7C 1SGWA 2BDTA 3ICEA 4LHXA 2X8AA 5E7JA 2HT1A 4RKFA 3K0AA 4OHZA 2ZVQX 4PQFA 5JJLA 4QC2A 3FFBA 4JLJA 4IOKA 1G8FA 1NN3A 5F3WB 5JS7A 4Z54A 1DS6A 5AUPB 3CX6A 3K9GA 1Q1BA 2DYKA 4HATA 4Q9LA 4HSEA 1GFIA 4EPYA 2HF8A 4HLDA 1FQJA 2YZ2A 4NYMR 1OF1A 2NO6A 3HU3A 2ZSBA 4BFSA 3FHTA 2C04A 4HUTA 1WBBA 3KJEA 3L82B 2FPLA 5DISB 3EPLA 2FFQA 1OH6A 3EIEA 5E3HA 2UKDA 4JLPA 5BQ5A 1KYIA 2YNMA 1ZCBA 3ZLJA 2ZJ8A 3Q9LA 2P67A 3QG5A 3TK1A 2C78A 4GI7A 2AKAB 1T4GA 1KI4A 4OI0A 4UXJA 2CHGA 3VKHA 1F2TA 4M53A 4KAXA 2GWHA 2ZYTX 2YWFA 1KO7A 3LAWA 1KNQA 4PQRA 4KYUA 2Q3FA 2L0XA 5FPTA 3CNNA 4ZV4A 4FCTA 3QEOA 4FN5A 3SC3A 2QTHA 1TL7C 4M8NE 4MRRA 4X8MA 5E7MA 3CX7A 4JZKA 2ATVA 1UBGA 3I32A 4IDNA 4TLDA 3QXSA 5FR2A 2IYVA 4C0AC 1GIAA 3E70C 3NHAA 1GZSA 4PC3A 2EFDB 2YINC 4X8HA 5JEEA 4AURA 4GL2A 2KI5A 2ZR0A 5G3ZA 2XOKD 1V43A 1QHHB 5CIQA 4DLWA 5JHHB 2EW1A 2PCLA 2Q21A 4QJ3A 1QHXA 1R5OA 4TYWA 1IOZA 4CEJB 1XCPA 1S9DA 1Z6XA 4S35A 1HURA 1K6MA 1Q21A 2BCGY 2ZI4A 4KBGA 4LGMA 4NDZA 4EJSB 5B57C 2O0HA 4NYIR 2JLYA 2HYIC 3LNCA 4LOAA 2VTKA 4KSCA 2QEQA 1E9SA 1GG2A 1CS4C 1W36B 3A37A 1NF3A 3LV8A 1W4BA 2ZITA 3VR3A 3KXLA 3GLGE 1UDWA 4G5GA 5ANRB 1E9EA 2I1VB 3DDCA 4FMDB 1XZPA 3ZD6A 1J7KA 2GZDA 1N6NA 4DJTA 2ZRKA 5CITA 2FWRA 1EFRA 2V9PA 1NRJB 4P3YA 1KK1A 4DCTA 1KHTA 4DSOA 1US8B 1L8QA 1I4DD 2RHDA 1FUKA 3TH5A 4FW9A 1S3SA 2OM2A 4MA4A 2IF0A 3PQCA 2C99A 721PA 1CXZA 5FOUA 1VIAA 3EASA 2GCNA 2NZ8A 1EWQA 1YR7A 3PUWA 5KSOA 4DEYA 1FOEB 3CONA 1J99A 2ZXUA 2V1XA 2QAGB 1GL6A 3SYNA 3ZJYA 1YZQA 4TYQA 3K0CC 3QXHA 4TT3A 3K09A 621PA 4DC9A 1AQYA 1Q0UA 4KCGA 1OT3A 5JFGA 1XXHE 4DWJA 1EFHA 2GNOA 2AN9A 3DZ8A 2IEYA 4QGFA 4DT1B 1PV4A 2R6AA 1NBMD 2V54A 2V3CC 3PCRB 5C2JB 1QF9A 2D3WA 1OXSC 3PENA 4MKFA 5DSZA 2JJ8A 4DIEA 4M2LA 4TYNA 2OFWA 3C7KA 1ZIOA 3FGNA 4P32A 3ZQJA 3EPJA 2QSYA 2VF8A 2VYFA 4JIMA 2RH5A 2IUSA 2C8VA 2JJ1A 3D8BA 3T34A 3RC8A 2FOLA 3VR4A 5IRCD 4XTCS 5EP4A 4AG6A 2X19A 2J46A 2P0EA 4NMMA 2R44A 3QBVA 3H86A 1QG4A 4OQLA 4B6EA 4HZUA 4ZIRA 3RRMA 1XEXA 1P9NA 5KNBA 2RGBA 3RS0A 2DFNA 3HU1A 3M4YA 4G5QA 4Q48A 1G4UR 2FDCA 4QL3A 5H70A 2D2FA 1ZP6A 2JASA 4K8OA 2IYRA 1SHZA 1IY0A 1RRPA 1E0KA 2IYXA 4G5SA 2QPTA 4ILEA 1S9HA 3UMFA 3QKRB 4IKEA 4CW7A 1Q57A 3Q3JB 4HYYA 1J90A 1CJTC 3GLIB 1TQ4A 2JLVA 1N5IA 1PLLA 3PEYA 1ZU4A 3FDIA 3OE7A 4G5RA 2IYSA 4EPRA 1V5WA 1UKVY 4B32A 2ZRNA 1MKYA 2G6BA 1M6NA 1T0HB 1QDEA 2A5JA 3NEJA 5F98A 3U44B 3T5GA 1VIYA 2F6RA 2IS1A 4B34A 1KTVA 1Z2CA 4TTPA 5GADl 3EA0A 4ON9A 1IN6A 2B92A 1YHNA 3BWDD 8OHMA 2G1JA 1E2LA 3AGQA 4DXAA 2JLQA 4MRNA 4OK5A 3THWA 2MMGA 4OKSA 3C5HA 4HUQA 5DH9A 1Z0IA 3OAAA 1E1RA 1VG0B 2X77A 1OV4A 3EZ2A 3IO5A 3IQXA 3K1JA 3TSZA 2WPDD 3K0FA 4IOLA 2JJ2D 2BHRA 4B3CA 4IRUB 1IONA 1ZD1A 4CIDA 1G9XA 3IUYA 4HEJA 3TGPA 1UKZA 1JNYA 4YMTA 2ZQ5A 3WHLA 3PEUA 4GT1A 2IXEA 2FZLA 2KE5A 2VHTA 3WNDA 3ZVLA 2CLSA 2R62A 4EUNA 3KQNA 3EW9A 4JSYA 6Q21A 4FMCF 1UBEA 1NI3A 2ZJ2A 3OIUA 2V7QA 1W5SA 2YWHA 3CX8A 1DO0A 5FL7A 1AQUA 1E2FA 4Q9IA 1E96A 2IWHA 3TR5A 1EK0A 1XEFA 4MYUA 3SZRA 4BZQA 1E1RD 1R6BX 4FMBB 1E9BA 4GFDA 3I73A 4K46A 1G7SA 4MYCA
chains in the Genus database with same CATH superfamily
2ST1A 1SCNE 1T26A 1FZQA 3MOSA 1U8UA 4GWKA 4FFBB 4MQFA 4WL0A 1R6VA 2VK8A 3WSTA 4OB8A 2O59A 2DP4E 3DC2A 1QYRA 5EKSA 3FCUB 4EGQA 2XUKA 1YOVA 3WMGA 4EOGA 4R5HA 3IYLW 2PTHA 1AS3A 3IBCA 1H69A 1SO8A 4G5OA 3BIXA 2XDAA 4ZEXA 1JJVA 1VLZA 3ABZA 1U0OC 3THOA 3TDNA 1MOSA 3MILA 4JIGA 3UG7A 2DRIA 1GUYA 1NBME 1QIKA 2NYRA 2TMYA 4KMSA 3RIGA 4GOXA 4BE7B 4CDRA 1YBFA 4ND1A 4JB2A 4Z2YA 2WM8A 2PFGA 2XXAB 4YP7A 3A1NA 4MI9A 1OFUX 3BKWA 4I4TA 2JLBA 4TYPA 3HXOA 3KOWA 1Y9ZA 3A11A 4XJXA 5B1YA 3UBTA 1IG3A 1ST2A 3OETA 1CB7A 3RTEA 3AR6A 1RKUA 5AM3A 4Z2AA 2HA6A 3AW8A 2RI6A 2RHTA 2WJIA 4CG1A 1WQ3A 3CEPB 3H5OA 3RARA 3RSLA 3RYTC 1B14A 3SQNA 5DM2A 2C2WA 1C30A 4C0KA 4G0NA 4AP5A 2QL6A 1ESDA 1R5NA 3PUIA 5E6UA 2ECPA 3IV9A 3LX8A 1P8JA 4OXYA 1FW8A 3I2HA 1SVUA 1KYQA 3WYGA 4CM4A 2ZZKA 1H0SA 2H1IA 4MW0A 2ODPA 4M55A 1NXSA 5KNLA 3KRTA 1OLSA 5REQB 3WLEA 1ZS9A 2AGVA 3WL7A 1C9MA 1DBQA 3DQZA 3GVXA 1QG2A 3F3SA 3N0TA 4XPIB 2VUIB 5DBFA 2A3NA 3ZU6A 4C4YA 4KQ9A 5K7SA 1ZG3A 1X15A 5KQPA 4LX0A 2XEDA 2II6A 1L5WA 3EVFA 5EZYA 3H11B 4DLXA 5IN4A 4M8LA 3TSYA 3BOSA 1ZGCA 1RWOA 3NUQA 4LPKA 3ZE7A 1HM5A 5FBZA 2F1OA 5IKXA 3LUDA 1A5BB 4IDOA 4FX2A 2ZANA 4F7WA 2IUYA 4D79A 1MX3A 2WTXA 3FROA 1DDGA 2LV8A 4BMYA 3PWKA 2F3TA 3O4JA 4BS9A 1G21B 2VI5A 4GZ6A 3UMBA 1F17A 3SR0A 1XAIA 3GARA 2PEYA 1ADCA 1BQ4A 3PTAA 3GLFE 2NVUB 3RIEA 3MINB 4UU0A 3AR3A 1I7NA 5T5QA 2FK7A 2QYSA 1SOVA 3W5AA 5CA0F 2QT9A 4KXWA 4KO4S 5KVAA 1QVVA 4YRJA 1NR5A 2VDQB 4CFYA 2F1KA 3STTA 3AESA 1QRUA 2OHJA 2ZRMA 3AUJB 3PJDA 3OIFA 4D4JA 3L92A 2O1WA 2OQVA 4EKIA 1GRRA 5HOEA 3DEHA 3WJ1A 1RLJA 3SNHA 4N7MA 1EZZA 4Y9UA 1FNCA 3P9ZA 2FJ0A 4DBLC 4G86A 1I6MA 2XYPA 3HVIA 1Z37A 1DAKA 1NSFA 1LBSA 4KTVE 1IOWA 3HU2A 3AEUB 2AOTA 4YP5A 4MHOA 3PI6A 2WKRA 1M73E 4TLAA 1NLFA 2CNNA 4ZJYA 1NL3A 1N0HA 4DRXA 3PYLA 1EHIA 3RTCA 6YASA 5BR4A 2QG6A 4R71A 4QEZA 3DL7A 3L0OA 5AKKA 5K8IA 1NQXA 2GUWA 2XDWA 3L7NA 4C6TA 1XZGA 2AI2A 1UOOA 1LD3A 3PUZA 1G6KA 1B15A 4GR4A 4JY7A 4QPDA 2IE8A 2CMKA 3BHJA 2ODAA 3EJ6A 3EGXB 4MW9A 4EW1A 5EIAA 2QY9A 5I51A 3AFGA 3V4SA 3V48A 4DRXB 4IFIA 2HJGA 1MEJA 1TU4A 4IG4A 2P9CA 2QVZX 2ZB4A 4JLNA 4NENB 1EAMA 2Q5OA 2O7NA 3WTBA 2ZYAA 1PBTA 5EQTA 3EYWA 4XVCA 3EGVA 4N0MA 4XVRA 3RSOA 1IBRA 3DE7X 3WMEA 2IPAB 3VM6A 1U7PA 4J9VA 3ETGA 1LPMA 2YYAA 1U8XX 2QE7D 2IDZA 2ODBA 5BW8A 5MHTA 4KXUA 1PDWA 3HJBA 2Y0PA 3HABA 4KVGA 4OHKA 4F0JA 4B3SB 1I5OA 1NFFA 2PWZA 4EHJA 4IDAA 2YX1A 4RXMA 121PA 1A9ZA 3EXG2 1AZWA 2C9BA 2HB6A 2HMTA 1GNSA 3BWCA 3FI9A 4K6CA 4BHTA 1XROA 1CERA 1I4TD 4DCMA 3EMDA 4ZREA 4D9NA 2BTEA 5FUQA 1DTWA 2JD2A 4KV7A 1KK3A 3OO1A 4I1SA 4IFTA 4OQMA 4OU4A 1V5GA 4U8GA 3LWNA 3AKDA 4LA4A 4BIIA 5I9MA 3VX3A 1AHHA 3K6KA 2GZRA 5JVDA 3QUCA 5KTOA 4YIHA 1QRSA 1DELA 1HDGO 2Z57A 3H0KA 3RGWS 1G42A 1K2WA 3U0BA 5TV2A 1OFUA 4D0GA 2PWYA 2FZKA 3IX7A 3HXMA 4EY7A 2A1TS 2AMJA 3VYSB 4CN9A 1XTRA 1DAMA 4I4LA 3C74A 2JHFA 3UPDA 1YFLA 4RORA 1YA6A 4HX5A 2BFPA 3N2GB 5BV2P 4BRUA 3A1CA 1YNSA 2JJMA 3NDRA 2DG2A 2BHSA 5CX4A 1YB4A 2J3DA 3AEUA 1CJKC 3EWSA 2F3PA 2YQZA 3LI2A 3AT1A 4YJ3F 3W5VA 5F3RA 1W47A 5A7FA 2ZUSA 3WYFA 1NI4A 5F12A 1KY4A 4MW2A 1C80A 3B53X 1QZUA 4UMDA 2KSQA 5KHOC 2IZ6A 1YRLA 3GL9A 1DJPA 1MPXA 4YJ2F 1OXTA 2I71A 2TECE 3M1IA 3G5UA 1USWA 3E5NA 4BUZA 4EW6A 2UYOA 5K0BA 3IO3A 4W99A 3ZE0B 2DECA 3UAYA 1YKSA 1Z25A 4CMCA 5BSVA 3PQ2A 5JCPA 4CEIA 4GBED 1VE7A 4BUCA 3FJ1A 5KJ6A 3KYBA 4J91A 5KJFA 3GOHA 2VHEA 1YDWA 4IF6A 5JWHA 2VUUA 5DB4A 5LA6A 5AW0A 1RLIA 4I8XA 5AVQA 1A7JA 4RD2A 3RYIA 1D1TA 2NUPA 4GE3A 4M83A 3AR5A 3LUFA 4JQOA 9LDTA 1BC5A 1H6BA 3U09A 4X20A 3WGOA 2J5QA 5CFNA 2WW8A 3PQFA 3WS7A 4B3XA 5M5BA 3I6BA 1UXOA 3MTBA 4ARIA 4A73A 3L6OO 3B1YA 3KXPA 1WOMA 3ZN2A 4HC4A 4FEYA 3RFFA 4EHDA 1FMTA 2OGZA 2ORIA 3ZIAA 3CLSC 4NULA 2FEKA 4IVQA 1PZNA 5BN3B 1NG9A 3SWWA 4W7SA 3AW9A 2OAP1 3WLJA 1JDVA 1TQHA 4IZIA 4PHHA 2WYVA 3AJ8A 1Z2OX 4U39A 4TMWA 2ZZMA 1JQJC 4TQAA 1UJNA 1HMYA 2OZLB 2H52A 4P34A 4S05A 2JAPA 2VQ3A 4PGHA 1Z47A 3T6KA 2R86A 4IS3A 1UZMA 1H1LB 3HR7A 5JSKA 4GOJA 3H5TA 1IBSA 5K3DA 3AFIA 5H16A 2ONJA 4PICA 1O0SA 1ND6A 4BC0A 2ZRLA 3P4UA 1TO2E 2JW5A 5KNBH 4X3OA 3GO4A 1G17A 1Z16A 4IICA 1XTKA 3FBGA 1CRQA 1HLFA 3GFFA 4GSYA 2CLEB 2NZXA 4OFZA 3WMWA 2RG1A 5JCZA 3BDIA 4GSKA 4BVKA 2PPVA 3N0WA 5FADA 3FVQA 3T5CA 2JJYA 4BLOA 4YFVA 3D59A 2PUVA 1Y1KE 3CF2A 3NGLA 2ONYA 2OXRA 1P72A 4QQNA 5DF1A 3D9QX 2VP4A 3IEKA 1WSBA 3K09C 3GWZA 2VPPA 3G5LA 4KPUA 3U40A 4TVOA 3HVKA 3KUCA 4HYQA 4P31A 1UJ4A 3HZOA 3L7MA 4QO8A 1E2IA 2OC9A 2I4TA 3CJTA 3FDFA 2H1WA 4JC8A 4K40A 4CU5A 3EIHA 1K7SN 3GBPA 4Q05A 3WFIA 5IFKA 5JYDA 3LTNC 2ZIXB 3I5UA 5FI5A 5IKPA 5LD2B 2BJHA 3OWXA 1FDVA 1P29A 3IUEA 1NY6A 1EVLA 1M76A 3QA9A 4XAQA 3AVOA 3Q8KA 5DK4A 4ETWA 3ADBA 2PX5A 1KAHA 3DTNA 3HJAA 4DNFA 5CXUA 4LDQA 4M1KA 3VR6D 4J1QA 4WJKB 1HE5A 3I64A 3V1TC 4FUQA 5ALHA 1RYYA 2K5UA 2NYAA 4RKRA 2QVCA 2R8XA 3TZQA 5JXHA 1JIUA 1JIJA 1WJGA 1NVKA 1KPHA 3ZK7A 4HEA6 4B6PA 5GTDA 2HREA 3S2EA 5IWCA 1RXCA 3WOVA 1Y3FE 3PD7A 2O6LA 3EG5A 2VJDA 1DO8A 3C3JA 3CW2A 1XVIA 1E7WA 4R1UA 4RQTA 4TWRA 1LZLA 3CISA 3THSA 1DWUA 3OCXA 3I1JA 4DJ5X 2Q2QA 3FKQA 3EUFA 1Z4LA 2GR9A 2YHIB 3LECA 4UUOA 3GYGA 4UOQA 1DIOB 3JD3A 2UU9B 3VAAA 1XAJA 2P9YA 1QHSA 1WMDA 2V4ZA 1WX1A 4DRZA 1LX7A 4M1TA 5FQOA 1Z74A 2VXYA 2Z04A 5LLDA 3D6VA 2UYGA 2JFWA 4NPAA 3CSDA 5B6IA 3KAJA 3U49A 1QP0A 1BAPA 4V38A 5J47A 1QRAA 2FN4A 1NGSA 3DTVD 1AKEA 3MA0A 1QJCA 1P7PA 3F7MA 1YVRA 4KO3S 2VPYA 4YK7A 4L7QA 4PSAA 5TQ2A 2PXCA 3FMIA 4X6XA 3PX3A 1U8TA 1P1IA 1D2HA 3QTLA 2M98A 3EVNA 7ABPA 1EP2B 2DFDA 5DYWA 2Q1WA 1EGQA 1N2CE 2VH2A 2YW2A 3QU9A 2TRSB 1A8UA 1UMBA 4DQVA 4QLAA 2E21A 2YL2A 2NNLD 4NRDA 5F51A 1PK7A 4I2NA 5E8RA 5EEGA 2P2ZA 1MFZA 1L3CA 5AM0A 2W6JD 4ESOA 5KVVA 4FSDA 3S70A 4C4TA 3DPSA 1T8WA 1XWFA 2W6QA 1BS2A 1NUQA 1WMBA 4DMRA 1K06A 1Y6RA 2YQ4A 3QYFA 5T41A 3CLTC 1SXHA 2FW7A 3VHQA 3WXMA 4E0BA 4OHXA 4IIFA 1O4WA 5I4CA 4HEQA 3FHOA 4ZMBA 1XRPA 5EXDA 3VJKA 2F3RA 2QTFA 3T7TA 3WVNA 1BH2A 4TS3A 1KOFA 1SZCA 1AKUA 2Y0BA 1XRLA 3IUSA 4DA7A 2BOVA 3BXPA 2YDXA 1CUWA 2B8TA 3KVNA 3Q7QA 1DRJA 4TKUA 1YFKA 3C8DA 1DJNA 1P39A 1WPQA 3AF4A 3FHLA 4HQLA 2QP4A 3GJ6A 4I5GA 4L85A 3D2BA 3EZ9A 3KK0A 3SX4A 4Q01A 5L3QA 2FRXA 3TMKA 1XYYA 4MP8A 4OI1A 4DIBA 4LXIA 4IOMA 1LDMA 4AIRA 5K8UA 2DTEA 2O52A 2OXFA 4PYLA 2X6QA 2GESA 2NZYA 3GY0A 4XDGA 1YQUA 1LFDB 5BSUA 1O94C 5SV2A 1KGSA 1QIFA 1BWSA 2RARA 4ZT7A 1M1UA 4EFLA 2DERA 3RS5A 1X9HA 4Q18A 3GQBA 1P3DA 1TNDA 3QFFA 4RH1A 4KU4A 4N1AA 3TRJA 2I2CA 3M4JA 4JVNA 4EMBA 1A9PA 1CTQA 3DYBA 4DDHA 4WOBA 4FXPA 3SFVA 1YBHA 1LSSA 3O8NA 2ZTVA 2BISA 3AJAA 4K03A 4LV6A 5F5XA 4CPDA 4DLYA 3ADKA 3IQGX 5D01A 3CLTD 4Z51A 1UPXA 1V71A 4IX9A 3FTCA 3B1KA 3U3OA 1Q3HA 1NMQA 3RBVA 2IOFK 4H3KB 1YRAA 2R11A 4PYRA 1OLSB 1U0TA 2Y1WA 3AFOA 1DHRA 2G0NA 4FCWA 3TL2A 1YJ5A 2BGRA 2Q3JA 1TUEA 1T9AA 1P5ZB 2OFXA 1UM9A 1Y6ZA 2EC5A 1VL0A 2P4HX 1VBFA 1YJBA 1EFTA 1OWNA 1GZ7A 2KQUA 2P9HA 3GT0A 3QE2A 2HJVA 5CNMA 2ZRHA 4F5EA 1XTTA 3OQVA 3K72B 1KI9A 2E5FA 3V6LA 1KVRA 3IUMA 4ZTZB 1GGVA 5H9VA 1P2GA 1ECLA 3VDMA 2DLCX 2X7XA 3NOXA 2OWDA 4G63A 1QYDA 2B1JA 5CYOA 1MOZA 2PMCA 3K4HA 2C2KA 4FINA 3MJVA 4ZA2A 3T3MB 3UXMA 2RSLA 2CBZA 5A4JA 3B9QA 4YQZA 1SBQA 2WYUA 4ZZ3A 1P2UA 1SNYA 4N03A 1DARA 1PDVA 5ER9A 2PS1A 5LSAA 2XMZA 4W5OA 4D8VA 1GQOA 3LPMA 4KMMA 4NCBA 3UYLA 2P69A 4OQ4A 1H2FA 2AOUB 3DB1A 2AEJA 2XF8A 1BXZA 1XTZA 3ISJA 3PRYA 4L5IA 4KLZA 1HZJA 1Z18A 2RIRA 3P5BA 3WICA 4B6RA 5FTNA 4UEOA 3IQWA 4XB6B 5JMPA 1MTOA 1GT6A 2OO7A 4AYTA 1L4KA 1W2GA 4JCOA 3BZBA 1NY5A 4ALMA 3QKSB 3UB4A 1Z73A 1F2UB 4RA6B 1Y33E 4ENVA 2ZUWA 4I4NA 1GNTA 1J0EA 2ZJ0A 1PUIA 3RSZA 3STYA 2FZCA 4Q37A 2XMDA 4YV2A 4NE2A 3HMKA 2I55A 2SCUB 4FMCB 1DNPA 1Z4MA 4FE7A 5EA2A 1CHDA 1SULA 2VRWA 1EIZA 4HH0A 3OF2A 1CEQA 1JE0A 4JOSA 4DZZA 1XBTA 3TDKA 3EQ8A 2VJKA 4XQGA 2IZ1A 5UKDA 1F1JA 2FRVA 2B7CA 2NZUG 4A3SA 3PUJA 3F6CA 5KQRA 1JZTA 1MG5A 1NU6A 2V5VA 3SLGA 4AQYB 5K8TA 2VP3A 3MJTA 1QBGA 3JZAA 3I5XA 3V1MA 4F8YA 3V8NA 3BFXA 5JD6A 4RV4A 1PG0A 2OLKA 3CVXA 1Q14A 4GP6A 1IVSA 4B8ZA 4UAVA 2IEBA 1CY2A 3BXEA 3DAPA 4LQDA 1M34A 4JMPA 3ROFA 4BFXA 3ZDFA 4CKZA 1U63A 2P68A 3T5MA 4E3WA 4EYSA 2G28A 3I6ZA 1R8QA 3QVTA 2HO5A 3T7EA 4BGUA 3V00A 1WD7A 3LT1A 3VR6A 2FJUA 3TIFA 3TFQA 4CIVA 2WVGA 2WR8A 4LJ4A 1N6HA 4BC1A 2BSAA 1DIHA 2C1XA 2FPRA 4I08A 3KSAC 1YXMA 3L4JA 2P6MA 2XE4A 4OXIA 3FCYA 5HTKA 2PX0A 1U9ZA 3VFDA 5C8XA 2RDMA 2WNSA 1O8BA 3CN9A 1ULAA 3EF3A 4HWOA 4UUQA 5H68A 3WNZA 4H16A 2G4LA 3B9BA 3JWGA 3TCNA 4EFDA 4TWJA 1ADFA 2UZ1A 4OJNA 1RU3A 1R3UA 3IUPA 1OYVA 1SG6A 3ZCXA 2RKOA 2ZS8A 4OP2A 1U4OA 5AUQA 1ORTA 8ADHA 4MDEA 3I53A 2Z8ZA 4ZK2A 1CK4A 2QI9F 3OM8A 2NQTA 5C80A 3CVWA 3U44A 1R8YA 4NU0A 3MBOA 4JEMA 4WCFA 5ECYA 4FMPA 3LHIA 1RI1A 4AZ0B 3NGXA 5LMNB 1EIWA 3HDQA 2CY0A 1UK7A 3FPFA 3N3AC 4JODA 4RZXA 5HSGA 1Z28A 5IH7A 2DBYA 1Z6QA 3C6QA 3R3ZA 4FYVA 1LK7A 1JQ3A 1GOTA 3EA5A 4YB8A 1S96A 3DH0A 5FYQA 3CVVA 5GJBA 2AG6A 2EFCB 2FPKA 1M0SA 3X44A 2C92A 2R8ZA 1JKJB 4HF7A 4H6PA 4HYTA 4A1OA 1V1RA 2REQB 5JHGB 3O3MB 3OFKA 4CNQA 4OQQA 3D81A 3B6ZA 1UXJA 4RZUA 3KOUA 1XA4A 5BN4A 1Q91A 2ZWOA 1K6JA 3BA1A 1O5OA 2GPTA 3WDLA 1HKUA 5EE3A 2P8JA 1YULA 3ZWMA 1V41E 1IZZA 3NUGA 1UT5A 1JNXX 2X76A 4EKEA 1XLTC 2XGGA 1F4LA 5ALVA 1DI0A 3EPRA 1WF6A 4ML3A 3H84A 3W5SA 1FS5A 2VKQA 3N75A 4X1KA 1CKEA 2WHQA 4M1QA 3EQ9A 1IOVA 4GMFA 5KI6A 3WQBA 1Z26A 5H83A 3FXAA 1PHRA 4NXNB 1GM5A 4RD0A 3ITDA 3IDAA 1UFVA 1E98A 1Z13A 5JAZA 4UM9D 4CZ2A 4WESB 2AG5A 1ATIA 3EZFA 3KBBA 4BN0A 3DDZX 3WAGA 3ZDBA 3HJGA 1VIMA 3JQ6A 4LKRA 1AK2A 1LWOA 1N25A 4FC6A 3K9LA 4OY3A 4BFUA 1VHQA 1UFKA 1CIJA 1FL9A 2IE0A 3N70A 3EGIA 1JMKC 3FR8A 3HFJA 3C3PA 4RMIA 4BQRA 2GJKA 3Q3VA 1NN5A 4NU6A 3O4GA 3MB5A 4AJ4A 4GMXA 3I12A 3FKJA 3N8NA 5J1TB 3UJ3X 4C2TA 1YS7A 3MWDB 4C7OA 4NEGA 2A0YA 1ZHOA 2PKYX 3K8ZA 1JHXA 3VO8A 3F7OA 4ESEA 3PEWA 5HILA 1TUBA 1YZUA 2ZSEA 3ACDA 1PL6A 2QTTA 3Q11A 1GGEA 4GIBA 1K6XA 3EARA 1CP2A 3PFBA 5E9AA 4IL5A 4KP7A 3GLIA 2QBYB 1XNJA 3UMVA 1AVTA 3KWMA 3R0JA 2NP7A 1UC8A 3B6KA 5CR9A 2X1HA 3MRVA 2B99A 2YV2A 3OZSA 4C3UA 2E1PA 1PJBA 4TXMA 4B40A 3HDHA 1SY7A 4H18A 4MP6A 4NZMA 5EE1A 2AFHE 1BQEA 2KHZA 4A26A 2R5NA 5KOYA 3DWIA 3WGJA 4LJSA 4D25A 2B8JA 3ZDXB 5BYBA 1BJTA 5KKCA 4Q3DA 5F2NA 1O87A 1P7YA 4D9JA 2P5YA 4L2IA 5KWJA 4EPXA 5K09A 4E5UA 2H16A 2HA2A 4P4NA 1GSAA 4LF7B 3W0LB 1Y8QA 1HQYE 4L8WB 2FV8A 4OSEA 1U3UA 4RSHA 4CLRA 5T8KC 3ZCQA 1YQTA 3C4VA 3H2HA 4LMBA 5CU7A 2AYYA 4P83A 3P27A 3OZDA 3UT6A 3LLSA 2CF5A 4BNDB 2GK3A 3E0QA 4XLLA 5JAQA 4DMFA 4G4SP 5JS2A 3U1VA 2QMUA 2QZ9A 1E2MA 2HQRA 3E1GA 3MUNA 5BSFA 5CFMA 2JKZA 2RCNA 1G4HA 1EHCA 3NHLA 4OUDB 1C2YA 1QLWA 3AR7A 2XMPA 5KU7A 1CLEA 1CQIB 3TZBA 4BQEA 1K68A 4E13A 1M0WA 3OF5A 1YBMA 4JP2A 3CM0A 2IV7A 3ZGLA 1P4GA 3HWWA 4JX8A 4XM1A 5AW5A 1GG9A 3BB3A 3C15C 4Q82A 2VNSA 1KMHB 2C1ZA 1XD2A 3TW0A 1ZPDA 4S12A 2FEOA 1I33A 1PT6A 4H4CA 4MVJD 5LZ5A 2ZSJA 5AW7A 1QKKA 1C7FA 4A8PA 1CUAA 3EZLA 2XUOA 4HQKA 2DQKA 4CF4A 1ADYA 1AB5A 3LF1A 4DWOA 1FFEA 4NV0A 1TIPA 4PLHA 4RTPA 1LDEA 1SPBS 4OQNA 3L7KA 2ZBPA 3LU1A 5AXCA 3JPWA 4W5QA 2AJBA 3GXOA 3RUHA 4KG7A 2NTEA 2XQKA 3CR7A 4J0GA 5JBNA 2XVMA 1J9ZA 3I9V6 5DTQA 4YO8A 4AVYA 2W4MA 1CYDA 3HBLA 3NS7A 2GDJA 4IDPA 1U1FA 2HMSA 3COYA 3HEAA 4PGFA 1TJYA 2VS1A 4Y2HA 3W5IA 1KETA 2Q6IA 1E77A 3ZE6A 4HSGA 1IB6A 1ZMXA 3DEJA 3JQQA 5MGBA 1HYEA 1RZVA 1VLLA 3JQ7B 4EUSA 1O95C 2VZ9A 3W6UA 3E23A 4BMSA 2JBWA 1BEZA 3IA2A 1CDOA 3SPXA 3A1EA 4YDSA 3TLYA 1U6IA 4R83A 5IJWA 3JQ9C 1UKBA 1URPA 3IUBA 2ZYSA 3C3WA 2OD2A 3C6YA 4K9KA 5IHXA 1TZJA 3A10A 4LXYA 4WI1A 1JG1A 3FPSA 4ALNA 3ND8A 4JOQA 2QROA 1IZ7A 4ISBA 2JFPA 3JQ7A 2Q1XA 1O97D 3ZCSA 4P9NA 5KYXA 4KHZA 3NTXA 1GTJ1 4GP9A 3AVVA 5TS2A 1ULSA 3WADA 1I10A 1W44A 2VJMB 4NXMB 4TS1A 1UZUA 2Q8QA 2CCGA 3GVHA 4NU5A 3SDZA 1Y8RB 3IPYA 1CG6A 1EUDB 3DOEA 3SHWA 1XSEA 1JE1A 2H85A 3ECAA 3PHJA 2VQSA 3K53A 4LDJA 1YR6A 3H75A 4QPZA 1IN7A 1JQ5A 4RPHA 5I4BA 3OAAD 5BWBA 3PX7A 4BWFB 3K0BA 1XKTA 2YVQA 1NQUA 2HD4A 2CXOA 3LC2O 1MNQA 4DZRA 1TOAA 4H60A 3CRNA 4M0KA 3VOAA 3ZCRA 1K7YA 5FV4A 4HN4B 2WVJA 3OOSA 4GLLA 5DHTA 1XZIA 5E6SA 4XD7D 1GRNA 2REOA 3IXQA 1CUIA 2JLAA 2W5UA 5IN5A 3TNJA 4B2YA 3JWEA 1N2XA 1T6XA 1G21E 2Q8PA 3F5FA 5LU8A 4TTSA 4E5NA 1R8JA 4BBPA 3FCAA 1ZHFA 1NG1A 2QENA 3G3EA 2PZ8A 1OAOC 2X6TA 1ZA1A 1EE9A 4ZU3A 1OI3A 5BMOA 4YP1A 2CXQA 2FSUA 4QUBA 5EOVA 2WTBA 4LYFA 3P8ZA 1YBVA 4EY3A 1Z5WA 5FWNA 2IYFA 4OB6A 1D5CA 1H6DA 3HNOA 4KO1S 4DLVA 4N76A 4D9FA 5B5SA 1HYQA 1ZESA 1BX3A 1QS0A 3G68A 5H9WA 2GRJA 2RKBA 3OU2A 4C4AA 2LGJA 2ZCUA 4Q66C 1K0FA 1E4YA 2OV6A 2DWPA 2OWEA 3C6XA 2A5YB 3OOJA 1IZYA 4YQFA 3RAEC 3TIIA 1XCLA 1E7MA 4A6XA 3QU7A 4TTQA 4E1BA 3NYQA 5GPBA 3VR4H 1YL7A 2AR0A 2A92A 5FNVB 3BB1A 2OFPA 4NX2A 3TLZA 1R9GA 5BQ3A 3OURA 2RK6A 3WKDA 1U0BB 1EBUA 1L8AA 3T3OA 1V16A 4LXXA 5TMPA 3KXKA 1Q7GA 4PWYA 3DKIA 2AN5A 3V7WA 3ZGVA 3WKEA 3ZHOA 4CKCB 4RK4A 3I34X 3ETDA 3IDSA 2O3SA 3GFPA 3LDFA 3HCAA 2AFHB 4EHBA 1WB5A 4DW8A 1XAHA 2QT1A 2DBVO 2Z58A 3LT4A 3OCWA 2AJDA 4BNJA 4Z1MD 5HXAA 4J8PA 2IXBA 2R65A 4QTUB 1TJ3A 2QPLA 3OCVA 1Z83A 3GLQA 3DV2A 2H1SA 3C1TA 2HV8A 3ECCA 5J4HA 3ENZA 2YZNA 1T34A 1CUVA 2PL9A 4KR3A 4HPWA 2WSSD 4FDMA 1GJRA 3GDFA 1PLJA 4PONA 4BIMA 4IIJA 3UA4A 4L5BA 3JRNA 1YB7A 5CA1F 1E1QD 2G09A 1E59A 1I24A 1XTUA 4HNAB 1J0BA 4MMZB 1W4ZA 1EDZA 3U9TA 3ZY4A 2X2OA 1P1BA 1C3OA 4HMPA 5ALDA 1C29B 1RWBA 3WWZA 2QJOA 2ERYA 3M4NA 4OAQA 2XT9A 3WDMA 2B8WA 4Q1EA 4XWKA 4AI6A 1L5KA 2BJVA 2X3YA 4NONA 2XTJA 2E49A 4HOYA 4GZ3A 1KE1A 1Y63A 2PGJA 3OP1A 3Q9UA 4C4OA 3QLVA 3D4BA 1GFZA 3V3KA 4MO9A 2A5GA 1KL7A 4YC7A 3ZNPA 4JITA 5FT9A 3EBPA 3CJQA 1ECGA 3GPBA 3SKVA 1NOKA 3CBQA 2ETXA 2W2MA 1XCGB 3AUSA 1TVEA 2FLKA 4ZQFA 4HTFB 2WSMA 1E1MA 3A9TA 3HEMA 4RS3A 4KOEC 5BXQC 4B5LA 1C4OA 2G9ZA 5K9ZA 4NAHA 3M1LA 2EGHA 2IPLA 1TQ2A 2OO5A 5K6AA 4NR0A 4FCVA 2OQRA 2ZE6A 2WZCA 2NZWA 3BMOA 2BZGA 3H9EO 3LXRA 3QXXA 2B0CA 4KXVA 4M99A 3TFWA 4AF8A 4QUAA 3PXAA 4RMHA 3RUIA 5TQVA 1CRLA 4DCJA 1CWUA 4W5TA 1OTHA 2ZROA 2A6PA 3BE8A 5JAOA 2RH8A 2HDOA 3UAGA 4TKZA 1UBKS 3NQ41 4ZZ0A 4RZ3A 3KTOA 3U7HB 3RT9A 4DPLA 4B6SA 1NVVR 4GC9A 1Q50A 3PXEA 4F2GA 3LA6A 3SQWA 2ZRGA 4IZ6A 4YJGB 3N7TA 3AEXA 3D6UA 3RPEA 1CS0A 3O1HB 1ACJA 1G7TA 2IP2A 1DTWB 3MYYA 3ML1A 4XD7A 4EI9A 3NC0C 2VHWA 1TYEB 4RETA 1Z4JA 3MTIA 4DSZA 2X3UA 4P0TA 2JI8A 4G0YA 2EBHX 4BDSA 4Z4QA 3JQAB 3NO4A 2XYRA 3Q8XB 4GPTA 3B5JA 3HZRA 4MV3A 2DCMA 1HQDA 2OY0A 4JKOA 2FHSA 1UEIA 2ZE5A 3JY6A 3GLGA 1KS2A 3AERA 4QA9A 3WGHA 1PCXA 3PUYA 1NXPA 4GDFA 1RI4A 2ISCA 2XT0A 3GUUA 3I1FA 3PXGA 3UJ7A 5KTTA 1G6OA 4N8SA 5J5CA 3PPIA 5EJAA 4WK2B 4JXXA 2FHPA 5EZQA 4D45A 2VHCA 2NXJA 1UWVA 2Y67A 3WGLA 4KJZA 3RRFA 4IIEA 1DBSA 1TVMA 2XKBA 1KQGA 2JIMA 1OIVA 2BKEA 3E58A 5K3FB 1GKYA 4PV7A 3VVMA 3OA2A 3OY7A 3WYAA 1CUHA 4HGYA 5BSHA 5K3EA 3W9YA 2DPMA 3JV7A 2ZT5A 1X86B 4UPEA 3CUKA 3IDQA 3K8OE 2G82A 1KZHA 2POCA 4BBAA 4E32A 2C31A 4KB5A 4F9FA 2VDPB 2QORA 3PC6A 1BWQA 4K6KA 3G82C 4UHEA 3E9CA 1VKHA 1OBOA 4HNTA 5K3SA 2FR8A 2QX7A 3QWHA 4AY6A 1TGVA 2MCFA 3T1OA 1QAOA 1QIIA 3BGIA 5EHXA 1LK0A 3LH5A 5JRJA 3FMFA 1C1DA 1O9GA 1V25A 3DW3X 3JQCA 2ZRJA 4AZTA 1EUCA 5LIPA 3NORA 3O9MA 5CB6A 1OI7A 3EXG1 3CUWA 5IK2A 3SXUB 5G40A 1Y98A 1YIOA 2EKDA 4H31A 4PG5A 2PR2A 2OP0A 3PPXA 4QYWA 1DEHA 1H42A 2ADFA 4MS3B 4WLNA 3MINA 4Q19A 4H6XA 3AWIA 2YJGA 2ZP1A 2QBYA 2XX3A 1S2LA 2WWTA 1N3IA 2ZYWX 1GN9A 4MQ4A 3UXEA 4Z4CA 2H7YA 4NCIA 1HQKA 2H2WA 4TT8A 3WQSB 1WXWA 2ZYGA 2QM0A 3LY7A 5DHFA 5TC4A 4DT1A 4KW7A 4DLAA 2AZTA 2W00A 1G4AE 2EZ9A 4I19A 1ZK3A 3ZWDA 4M1OA 2V3VA 3DLPX 4UZEA 3G2NA 3IVRA 1IIRA 5D87A 1QYIA 4BEJA 4Z7QB 2SECE 4QYXA 2J5KA 3B6MA 1P1CA 3QVVA 3KJXA 4II7A 3W7VA 4C5BA 3CMMA 1KBOA 1G66A 4GQIA 1U2TA 4DIUA 1UZAA 1Y5IA 4A6PA 2XD9A 1AHNA 4UPVA 2PNJA 5DRTA 1R4MB 3JX9A 4UFPA 3SOZA 2OCIA 1Q0ZA 4ZI7F 4XARA 1S0UA 2QOEA 2R6FA 5JLAA 1L5LA 2FEMA 1IY2A 1MT3A 4F2WA 2QJTA 2JIDA 4RPGA 2W83A 1Y3HA 1E9RA 4RHEA 5J40A 1ZCAA 3I8XA 1UWCA 2CWDA 2CFOA 5JC1A 3FZYA 3GLUA 2J5BA 4CT5A 3AQIA 4FLFA 5TPZA 5EVJA 4DSTA 3DUWA 5HGJA 3SIWA 2O7QA 1QO0A 3IKMB 4GXQA 3D3KA 3EXAA 2J1LA 2B2NA 2F1IA 3P32A 4HB2A 4HQ6A 3A7DA 1ZM2A 2ZLBA 3HGQA 4D9EA 1KC3A 3KT6A 1EK5A 3D1VA 3MSCA 3QU2A 2J9FA 2GH1A 1RMTA 1RHQA 1F38A 4NKRA 2NYVA 1N7HA 2Y1FA 5AOBA 1ZISA 3PC7A 4IXMA 3D7RA 4R0NA 3RSQA 5FBVB 5GONA 1BXGB 4F3NA 4ACBA 2FWAA 4HNGA 2HZBA 1XZKA 2CLFB 4HTAA 3TM5A 3I6MA 4F6RB 4KXNA 4MRMA 2BEJA 2J9YB 1Q3TA 2VDUE 3PHHA 1UKAA 3DO5A 4AM8A 4IO0A 3TAUA 4YV1A 3ZHXA 4AMUA 5KNCA 2NADA 1YF3A 2VO1A 3MJHA 3NBXX 3DAFA 4MJ3A 1E66A 3VUEA 3K35A 1B23P 5TR9A 3PXDA 3H0CA 4FE3A 4J0DA 2BF4A 3HJRA 1W5BA 5A7HA 3IAM6 3S55A 5CBPB 1U0RA 2XGOA 2XOEA 2ACVA 2R5WA 3HA7A 1BZYA 1EUDA 5JROA 1H4VB 5AD1A 4KACA 3FWPA 1IN5A 2A0XA 1F6DA 1Z4PX 2Y1KA 1MXHA 3E5RA 4WGGA 5C1DA 3HK2A 3R9XA 3KQHA 4EZEA 2P35A 4MUAA 1E8MA 2NAFA 2G07A 2VHUA 3I8OA 4LOIA 5BWNA 4Q7EA 3UWDA 4L0MA 3V1KA 4JI0B 2CBXA 3AB3A 2QDKA 2X5OA 3CUYA 4JYCA 2BGTA 2DE0X 5HFAA 2N9UA 3HGMA 1QIHA 3QW4B 1KEEA 3DE6X 3S99A 1VTKA 3COZA 4I1IA 4YMVA 3GFTA 1OIWA 4TSRA 1I7PA 3L7BA 2X9GA 3DOCA 4LGYA 3RRXA 3PGLA 2IQIA 1QRRA 1L5NA 4TL7A 2P1DA 2P3QA 3HM2A 1NBMA 2XE6A 1EINA 3BXXA 3PHBE 3D6NB 4H9GA 3JPYA 4CQLA 4F3CA 5BXYA 1KEEB 3UWPA 3EFHA 3KYDB 3CMCO 4IINA 3EG9B 3VGJA 3T1HB 4HDCA 1D9XA 1EXMA 4UQPA 1P73A 4IIUA 3WL5A 4Q9HA 2CSXA 3C6ZA 4LJ9A 3D8SA 1C8BA 2C5SA 1IRXA 1Z3CA 1ZD9A 2Y3IA 3LC1O 3QUAA 3TQFA 5LQKA 1YS6A 1N6PA 4Y9TA 4ZI5A 5AVVA 4TZ6A 3QKTA 3ESQA 4YAFA 5DHQA 1GP2A 4K6MA 5CLLA 3S7ZA 3DEFA 1YR2A 1RRKA 2C03A 3EOAI 4FE4A 4K2HA 3UCEA 4BQNA 3BL5A 4COOA 1GEEA 5IVDA 3TCXB 2P4SA 2GSDA 4CV0A 1Z7YA 1IEQA 4MB2A 1K5DA 3FLMA 2I2DA 4DA9A 2GZ2A 2J07A 5H4GA 4LFAB 4G89A 1KH1A 2JLRA 3RUCA 1N1GA 4OYRA 4R7ZA 1UQTA 3BXZA 4DLKA 2C2XA 4KL8S 2DSTA 4UNSA 1PZEA 1R4ZA 3QJGA 1JG7A 2BMDA 5IYZB 1BDHA 3NRJA 2Z3WA 1K27A 3VZRA 1J09A 2A3RA 1VCNA 3N76A 4CKWA 4X1IB 1JAZA 3IR6A 4AX4A 4ETNA 1DZ3A 3ND7A 2C54A 2HNKA 2XQFA 1BTOA 1VJGA 2W6NA 4TLLB 3CZ5A 1T5OA 3K05A 4RFSB 3RTDA 2AOUA 1CY8A 1D7AA 1LTQA 2IXFA 5FH9A 2LVBA 3OCJA 2Q9AA 3W5JA 4R1PA 5ILQA 1PFQA 2Y27A 3WZLA 2UYHA 1SKBA 5P8WA 1CDZA 1TAHA 3WRXC 3AY3A 2ATIA 4G84A 2H7XA 2GM3A 2XB4A 4LJAA 4FR2A 1HUQA 3LCCA