4M8QB

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GEP1 Fv heavy chain
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 106
sequence length 106
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m8qB00
2EDQA 5CZKA 4X6CE 5CD5D 5JHDB 5ESQB 3FQWB 3LEVL 4U1SB 4L4TE 1I8MA 2OTUB 4AMKL 1J86A 4GKZA 5DR5L 2VQUA 3NH7H 1RMFL 1S9WB 5DK0A 5SX5K 4FQHA 3MNVB 4OM0L 4QHNA 1QSEA 1YPZE 4ORGB 4M7JH 2YEZA 3HRZA 3EFFA 3KGRA 4KJYA 1F4WL 1R3KB 3BD5A 3PHSA 4TPRL 5FHAH 2JB6A 5DFVD 1P84J 5JO5B 5HHOA 4UINH 4K7FB 4U0QB 1JVKA 3FB5B 4JFDB 4I77H 4TUOA 1RURL 4E9LA 3VXUD 1M1SA 4ZAKB 4P3CL 4M48L 3S36H 2XOTA 5L7XH 4L8SB 4XPHL 3C5ZA 1RUAL 4L5FL 3JV4B 3PWLA 2EH8L 5DD1L 3KPTA 1OL0A 1Z6JT 4HKJA 1XF3A 2C1PB 5CIPA 1ZVSB 5HDLA 2EIZA 3CLFL 4WTZG 4ZFFB 4XHQA 3C5ZC 1ZVYA 4BFGA 1CGWA 2VABA 2VLJE 2OR8A 3RWIA 1BZ7B 3JUYA 1GC1L 3UBXA 2QHRL 1RULL 5M95B 2GJZB 3LN5A 3TA3A 5GS0D 1MUJA 1T7XA 5IB2B 4G3YH 1D5ZA 3EJZC 3VXRB 4OCYL 1L4IA 4NO3A 4YDIL 1BFOA 2AVGA 1QFOA 1MHPL 4XMPH 5GGUB 3QEQA 5GXBB 4UNTA 4KKLC 1KB5A 2J1KA 3W0WE 1RVFL 5IT2H 5GISH 3TA3C 2V5TA 5B4MD 1DL7H 4QT5B 4G9FD 3LKSB 5FYLL 3HI5L 3MRGB 2QQLL 1SYVB 3WIHA 1HQRA 5TPWL 1VB9A 1FAIL 2XKUA 2I26N 3HB3D 5MEPB 1RUKL 3MLZH 3V4UH 1D9KD 4N8PA 4L1HA 3TZVB 5IG7A 1XGYL 4QHLA 2EO1A 4JPWH 2F8OA 4OF0A 5K59E 5GRJH 5JOFA 4NZTH 5C0BB 2VN4A 2YK1H 5AG8A 4HFUH 4HKZA 3TCLA 3W9DA 3L9RB 4CMHB 2FJFB 3I6LD 1BEYH 4G6KH 4WW1A 1LQSR 1N7ML 2NTFB 3O45A 4L9LA 5KOMC 3P40A 3LIZL 2CLZB 2YPLA 1S7QB 2E9WA 4Z76A 2VXVH 4PJ9A 4C83B 1EUTA 2G60L 1CBVH 1HK6A 2JELL 4C58B 1QKZL 3NA9L 5IB4A 1J0YA 4LHJB 1OTTD 5GS2D 4E5XB 3MCLH 5DT1H 1XGPB 3G6DL 3RWHA 1K6QL 4N8CH 4X4XB 4FNLH 4PJ9C 2G2RB 5LGKA 1RJZA 3QPXH 5JPNB 3HNVH 4J2XA 3FO9A 5D5MA 5ADPL 4ZXBA 3R4DA 1BBDL 4U1IB 4Y5VC 4XGZA 4N5UA 3MUJA 2NY5L 2VDKH 2KL6A 5E00B 4OZFA 1C1EL 4U4BA 3MLUL 4ZXBC 1CL7H 2NY4D 4XAKE 2H2PD 1MLCB 5DTFA 3TT1H 5GGQH 3EKCA 3MX0A 3CNKA 3DTXA 1AXTH 2R9HC 3C6SA 2CMRH 5GZNC 5C6PB 1WBYB 4CNIB 5CEXA 3DX7A 4JPVH 2FYYA 3OF6D 1MY7A 4LRNL 4PJDB 4U6VL 6CGTA 4PJ5B 1N2RA 4HC1A 4RFOH 5ERWA 4FFZL 4NT6A 2E9JA 2BDNL 2EO9A 3IFOB 1SVCP 1C16B 1TTGA 4WV1A 1Q0XL 3FAWA 2H32A 1A6WH 2YR3A 3LPFA 2NZIA 5I16B 5AAWA 1IC5L 3UTTE 3OKNB 1LE5B 3FQXA 3VFWB 4R96A 4M6OL 2ZPKH 2WP3T 5EU6E 5JZ7D 4LF3A 4O5LL 5D96B 4PGCA 2Q76A 1RZIA 4TNWK 4YHML 4MHHI 4YQXL 2VOTA 2J8UF 3CJJA 2UZXB 4LQFH 2DDQL 4YDKH 4NC0B 4YBQD 5C70A 1CFVL 4RFEB 1ZT1A 4HUUB 4PS4H 3MYZA 2HVKA 5DO2C 4R4BB 1N64L 1NMCC 4KUCF 5CUSH 5AYQA 4GXUM 2I5YL 4PRHE 2HFEB 3X3FH 2VUOA 5KSBE 4RWYH 5EOCJ 3Q6GL 5B21A 5EBLA 5J11C 4LHUB 4JANA 2JCCE 3A6CL 1TJHL 1ZHLA 2KPNA 4ZUWB 2FECL 3I6GB 5D7SL 2DQEH 3SKUD 1DLFL 5IHZA 5KVEL 1NUNB 1YNKH 4DVBB 2HVJA 1OWWA 1CFNA 3PE9A 3IJYA 5FECB 3E6FB 4GLRH 2NZ9C 4AEHH 1BREA 4KHTH 3KS0H 4P2RE 2D9QB 3EYSL 5E9DE 1OTSC 1OF2A 3GSRB 1NCAL 4ZSOB 4G9DA 2AK4E 3ZDZE 4XP9H 3G6JF 3WNOA 4OLVL 4FTVE 2D7PA 4QGTA 4DWHA 2DI8A 5ID0B 3LKNB 5A16B 3T4AA 4DQOH 5KANG 5J56B 4MCZB 4QXUH 2VXSH 3SGJA 3DGCR 2APTA 4A6YL 2FIRT 2G5BB 4KH2A 4PPTA 1VGEH 1WAAF 1T7VA 3KVQA 3D9AH 1HSAA 4PJAA 1EZVX 1SEBB 4Z7UB 1WBZA 1CICD 3D39A 2GTWA 3BRDA 2IQAA 1NEUA 1IZJA 4BKLA 4ZUTA 2PNDA 1Q94B 1TPXB 4FQ2L 5HYQB 1I7TA 4CU6A 1DUZB 4GBXD 4H0IA 4NO5A 4XNMA 1HCFX 5FYJU 4X6DE 1CS6A 5DHYB 1KPRA 3QULA 3ULUD 1MCRA 5HGDB 1HQ4A 1WFTA 2B4CH 3P30L 3VXOB 4MNQA 5D6CA 2ENYA 3KLDA 3H42L 3R06A 1WLHA 1IGMH 1LVEA 1FGVH 1LK3H 2BNUA 3O11B 4UILH 2AJ3A 4U6HB 1U93B 5CGMA 5DJ6A 2F53B 2EIBA 2HMID 2VLKD 3UTSD 2Z93A 4R9HA 3DMMA 1E6JL 3MR9A 4XNQA 2FCBA 5HJ3B 4DEPC 3O4LA 1U91A 4YIQB 3U4EA 1IKFL 4JO3L 3BN9D 3WFZA 4D9LH 1T20B 3LCYA 4MWFA 3SDAD 1JF5A 1G6RH 3TN0D 1QFWM 5JW4M 4W81A 2W38A 5TE7L 5T3ZH 1DQTA 2RIKA 1MH5B 3FTGB 3QG6B 4M7LT 5DS8B 4KVNH 2DM2A 3BXNA 3SO5A 2GIYA 3ARGA 3FFCD 4M43H 5D6DC 2XICA 2A9ML 1RUQL 3AU1A 2ZUTA 4OFYA 4R2GB 4MLIA 3DXAD 2OTWA 1OP5H 3BDYL 3NCEB 1OAYH 3BWAB 1AIFA 4Q9RH 5FV1L 3FL7A 4IOIA 4NFBA 4JVWA 4ZNEE 1JE6A 1TVBA 4PB0H 5EZOL 3AREA 1AO7E 5IVNA 1UKQA 2R0ZL 3IRZA 3QRGH 4K3HA 4MQTB 3DBXB 4YHNA 3VRJB 2ED9A 1UKTA 3RNKA 2AERT 5I19L 4UQ3B 2X42A 3GRWA 3P4MA 4JDZB 3DRQB 5CEZD 2VISA 3VW3L 2HT3D 4OZ4B 1NCDL 1HHGB 1LMKA 4U1GB 4X7SL 4WFGD 5F7LB 3RVWD 3ZTJH 5JR1H 5LAXA 3ULVL 2YBRB 1RK1A 1FZOA 1E4XL 1YEGH 1VA9A 3TJEL 1EUUA 5C2BL 4E41A 1FCGA 4Q6YA 2H8PB 5E8NA 1RZKC 1HHKA 1U8NB 1UYWH 3L3KB 3ZKXB 5BZDA 5JW3H 4ZFOL 3S5LB 1PKOA 4UTBL 4AEIL 5F96L 3MRCB 4APQC 1NGXB 3D18A 4I9WE 1INDH 5D72L 4EVNA 4JHWH 3QQ9C 2ADGA 3KPSA 2EZ0D 2VNCA 3HS0A 3SDDD 3C2AL 3O0RH 3QI9B 2ZOLB 3T2OA 1BGXH 3STZA 1XIWD 1GAFL 5F88B 2A9NH 4NWUL 5DUPL 1OPGH 1SJEB 1PKQE 3WFEH 3VXSB 2FIKA 1SY6H 4Y1AE 4LRIC 3QDGA 3TJHD 1S9VB 2ICCA 2JJWA 3MLSH 3NABL 5C0AB 4CN1A 1A6AB 4LDLB 3DIFB 3GFUA 1FZJB 1MREL 1IARB 4XZUA 4XXCA 3OKOB 3VWJB 1EIBA 3ILQD 5GSRB 3H9SA 4KJPC 1J9CT 4R4NC 3EHBC 1DVFC 4FQQB 4NO0B 2C3VA 1CE6B 2YMXH 2XN9A 1RQ5A 2DQGL 1N6VA 3EGSA 1FC1A 2NY3B 1SJVA 1AQKH 2A83A 1F6FB 2FD6H 3QYCA 1HH9A 1T4KA 4YC2C 1HILA 4NRYB 1IGYB 5CILL 5HHOE 4W6XB 4LQ1A 1VDGA 1OSZB 3AS2A 5FM4A 2BNRB 2R0WL 4U2YA 5HVGB 4YHLL 1KCVL 5HDOA 3DX8A 3RVVC 2FO1A 4R8WL 1PSKH 1DANU 1UWEL 4HBCL 3EDJA 3HUJB 3KPRA 3RUGB 2IALA 15C8H 4YXKL 4LU5L 3T0VA 4Q9CA 3QIUD 3QWOA 1VFAB 2A74A 1HE7A 2YZ8A 3OKDA 3LY6A 1EEQA 4JY4B 3FOMB 5FYKL 4PREB 1IQWH 5F9OH 5I8OL 3ZHKA 5ITFA 1W72B 3DX6B 4NSKA 4NRZB 4KK9C 4LSPL 3CFEB 3H9HB 1MWAA 2MTPA 3LPGA 4KTYA 4OB5H 3SCMA 3LB6D 4X80L 3P0VH 2N4IA 2D9CA 3LMJH 2VDQH 4XPFL 5KVMC 3CFBA 3VXRD 1A7PL 5HHPB 1WIOA 1EGJL 1E6OH 4X9FA 1FIEA 2ZZUT 3SCMC 1C5DA 5DQDH 3A67H 4Y88A 2DYPD 2QR0B 3O2DA 3MLXL 2EC9T 4NZRL 1QHOA 1G9MC 4OCWL 4M1DL 5I73B 4C55A 2LAGB 4XVTL 4Z18A 4WCYL 2X4OB 4M7LL 4AENB 4Y4KC 1OW0A 1ZTXL 1U92B 5MENA 4M61A 1IGTB 3NZHH 4NBZB 5KOVC 4J3TA 3CMOH 4HH8A 1F90H 3RNQA 3NIDF 1B88A 1F6AB 2VR4A 3C5SA 4MAYD 1MHEB 3BP5B 4GKSA 4Y16B 5C7XL 2QEJA 3HCVB 3S36X 2RJMA 1OW0C 2APFA 2WWMC 2J7LA 2WM0A 4YPGA 1R3JA 1XF2A 3CDGB 2C3XA 1IM3A 4KQ4L 3HZMA 1QHPA 4IRJC 4F15B 3O4OB 2IQ9H 4U0RC 5JW5B 4LLQA 1PW3A 2YD4A 4I0PA 5DHVA 1FH5L 2EDLA 5HVHB 3ZSTA 4NQSB 2YXMA 4X0KB 2DQUL 4PJBA 1AKJB 2WSKA 3IT8D 5KN5B 4LKCB 2HJFA 4NZDA 5IOPB 2COQA 1S7UA 4KK8C 3GJFK 2BY3A 3O6LH 1NFDE 2DAVA 1O5DT 4NCDA 4QXWA 1MF2L 1X5GA 3IDYB 2B20A 2C3HA 2A6JB 1J8HB 5D5ME 3UJJL 2CLVB 4ZFOB 4XPHH 1RUAH 2N1KA 4L5FH 5H37G 3C9NA 3T4YB 1PYWA 3QUML 4PG9A 1WT5C 1FFOB 3MA7B 4WU7A 1XAUA 1T7WA 4HJ0C 4LNRB 4N8VB 3C8HA 3CLFH 2OI9B 3RI5F 3M17B 3F6LA 4YXHL 3QUYB 1H9VA 3E6HA 4Q9QH 3WNNA 5KSUA 3D3VD 1BAFL 4XRCB 5GS1A 5HHQA 2BC4A 5IMOA 4DZ8B 1GC1H 2XG5A 5DMIH 1GGTA 4ONHB 3B2UC 4POUB 2QHRH 4PJHA 4JREC 4N5ED 5T1LD 1JGUH 2CDEA 3TBTA 5AWNL 4YDIH 3U0WL 3W39B 5BQ7A 1SHMA 4Q0XL 4ZDHA 2HLFC 3V7AE 1QSFB 2XWBA 4PY7A 1BX2B 1EO5A 5C0IB 1Q9WA 1ZEAH 4RMRA 2V2TA 3MLPA 4PV9B 3QDJE 5FYLH 3LQMA 5IQ7L 2V17L 5TPWH 4K3JH 4MX7A 1FAIH 1P4BH 1JPFA 4QEGA 1BQUA 2DI7A 1X5IA 5B3JF 4PJ7A 3ZTNH 2WP3O 3MNZB 5CD5C 3MUGB 3HFML 2Q3AA 3WS3A 4J8RA 2IGFL 1MRFH 4CJ1A 4KXZH 3TF7C 1A4JB 4K55A 2QSCH 3RVTD 1AGEA 3GSNL 3KLAA 2HFTA 3BDXA 3MYJA 5J9PB 5ILTH 1CYGA 5TDNB 1AXSB 1EEZB 5HHMD 2Z91B 4HK0B 3N9GH 1XR8B 5KTEL 4BH7B 3VXUA 4JFOA 5DFVC 4R0LB 5FKPB 1CDYA 4Z7QF 2G60H 1NAKL 5JORB 1JJUA 3F62A 5FEBA 3C6LB 2YSSB 3O6KL 2DQFA 1NUFA 3UTQB 3BO8B 3ECBB 3K1DA 1K6QH 3MACH 3SGEH 3RX7A 1ADQA 1UM6L 2HH0L 4QTIL 1KTDB 1J11A 3QEGH 2DWDB 3T09A 4YHZL 2FR4B 1BBDH 5F71A 3WJLC 4F7MB 3L3DA 4QHMA 3H3PL 3MRPB 4ZNCD 4TUKH 2C7UA 2XTJB 5E0QA 1HI6B 3N0PB 1G7JA 4J3XA 3MLUH 2ZUVA 4HPYL 3QFDB 3NCBB 5LBSL 1FZKA 1VENA 4X6CF 3CXDL 4J6RH 4PJAE 4N0FA 5FYLD 4M93B 1ORQB 3BPOB 3D39E 4OGZA 5D7KD 1WJ3A 1KJVA 4R4FH 5GS0C 4G9FA 4GRLD 1MOEA 2AK1H 3BSZH 3MFFB 1YUHA 4HWBL 1KULA 1REIA 3CK0H 1RIVL 2W9EL 5K33A 3MJ8A 2ZJSH 2UWEB 2ZOKA 1YPZF 4FFZH 3RAJH 2BDNH 1QP1A 3C08H 4G8GB 5INDA 5B4MC 1YJDL 3LKPB 5C0CD 3QCVL 5I66B 1OM3L 3RIFF 1N5YH 1HXMB 4E0RA 4O2FA 5LJYH 5CZVH 3D85B 4OZHF 3BPLB 3G6AB 4LVOC 3WL9A 3KDMB 2BY0A 3SE3C 4MNQE 3HB3C 3QNZB 5FHBL 5I1GH 4UZGA 1D9KC 4LCCB 1KTRL 3D0LB 2GTZA 1BP3B 4O00A 5E08H 2C1OB 1A7OL 5F1IB 4JFXA 3MO1B 3HZYA 1F8TL 2XPGB 4U49A 1K8DB 1N64H 4P46D 3DX9A 3QJFA 3H9ZA 3O4LE 5GGVL 2GQHA 3Q6GH 4HLZH 2RHEA 1SBSL 3O8XC 4LIQH 4M5ZH 4BZYA 2X4PB 1JRHI 2NTSP 5E99L 5C9KA 5KVEH 1DLFH 1MJ7L 3C60D 5IESH 5SX4I 4RA0C 4KV5E 4R2GD 5FDWA 4IHOB 3MLTA 1OTTC 2XA8L 3BH9B 5BOPA 4G42A 2IG2H 4FQCL 4MCYB 1LEIA 4GAFB 4F8TA 3CFKA 1CDHA 1YZZA 1FFNB 3BE1H 4GW1B 1M71A 1I3VA 4BFIB 4OLVH 2A6KA 4WWKD 2IAMB 1J05A 1T5XB 3D25B 4CVZB 3O6ML 1HXYB 1JN6A 4DUWA 2WW8A 5GIRB 4YEFA 1WZ1H 5CSZA 3MCKB 4JKMA 1FYTA 5MHSE 5GRUH 3GMNB 2NY4C 4A6YH 3OF6A 4JJ5B 1MCDA 4GUPA 2ADIA 5I15H 5F1NA 3IKKA 5ESVA 5K59F 3P0GB 1KELL 2G75A 4GFTB 1LP9A 3HZVA 3U9PH 3IFNL 1P1ZB 2GSIB 2VAJA 1GGIH 3BHBA 5D93C 1GL4B 1VEPA 2Q7NA 4L29B 5IKCA 4CN6A 4E41E 1S5HB 4NN5B 5TH2B 2R1WA 1NMAL 3PABB 1K4CB 2X4UB 4NCC2 5J1SC 1GGYA 4RX4A 1V3JA 4KRPD 4L4VE 1KACB 1MRCL 5DFWH 4X9HA 5F21B 1YN7A 4UTAL 3Q2CA 3S8WA 1I7ZB 4XNUL 5EO1A 3MODL 4MNGA 3H42H 1W72H 3NACL 3RWDB 2P45B 1XGRB 4HPOH 3MV8A 4OCMC 3C8KA 2AXFA 5EB9A 1XGUA 2OLDA 1VADB 3CXHJ 4OAWB 2PO6D 2R4RL 1BD2B 4IMKC 3D0VA 1E6JH 2DJ4A 2MMXA 2AS5M 4KGJA 1GZPA 1IKFH 2YPKB 2ID5A 1DQDL 4JO3H 3CSYB 5TE7H 5DK2A 3GBMH 1ZSDB 3BAEH 5E8OA 4Z7NE 1KJ2B 3M45A 2UZIH 4AIZB 3CX2A 1T2XA 4RGOH 4ZUSB 2IH1B 3QPQD 5KVFL 4NFDA 5EC2A 4MA7H 1BFTA 4MSWB 2F54D 3VFNB 3VFRB 2XN9E 5F93C 1MEXL 1FE8L 1MELA 4JG1L 4ODUB 3W9EB 4H8WH 1RUPL 1ZA6A 2ICWJ 4JFFB 1IC4H 4GRMA 1WCBB 2FLRT 3HMXH 4ISVB 2Z31D 4JN2B 1UACL 1HKFA 2CKBB 5I19H 4Y4HC 4UNVA 4KDWA 1CLCA 3SE4C 3VD9A 3VW3H 1R3HA 3WFDL 2GUOA 1A9EB 1AGDB 4FQIH 5FDYA 3RY4A 1FG2A 3T8XA 5I8CB 4OFPA 4NQDA 1CICC 1TCRB 1NCDH 3VJ6A 3WN5B 3ZZ1A 1KCSL 2R0KL 4YUEL 4RNRA 5KSBF 3BPNC 4MD5A 2H9GB 2DLGA 1HYSD 3LKOB 5K9JL 3F65A 3IAGC 1T0MA 4DUXA 3TJEH 5C2BH 4GBXC 1QTYT 4FXLA 1MFAL 1S9KC 1ETZA 1X7QA 2ITCA 3MGAA 4WI8A 1YEJL 3BKCH 3KYAA 3NVQA 4JEGB 4UTBH 4LEXH 4ACPA 1JTPA 3QO1A 3C5JB 5E2UL 4JM2A 2VLKA 3PL6B 1KJ3H 4FZEH 1W2KT 1AE6L 3ZDZF 4O2EA 4JAMB 1F6LL 1G7LA 2HMIC 4QTHA 1FVDB 2X4TA 2QSVA 5T5NF 5GRVL 3MJ9A 2VO5A 3FFCA 1YN6B 3BN9C 5MENE 4GAGL 3VFGH 1RAMA 3ALWA 4NPYA 3NABH 3SDAC 1DUYA 3TN0C 3DXAA 3ORJA 4JFPA 5TQ0L 4PJGB 3BIKB 1ZHNA 3EJYD 1T83A 1NMBH 3WEXA 1WBXB 3TC9A 5I76A 1T03L 3UAJC 4HIJB 2XZCL 4PRAA 4FQXB 4OCSH 1OGAA 4QHKJ 3T08A 1G7QA 5D71L 1HKLL 5DMGD 2MWCA 5ESAA 3SPVA 1DJSA 1AKJD 1LK2A 4PJBE 4KUCD 5F3BB 4N0UA 4KXZI 4X6DF 1A7NL 3NCYS 3B43A 5DRZB 5HBBA 1IGIL 2DL9A 2DJUA 3ULVD 4XXDB 5ALCL 5GJTH 1A6TA 3CX5J 5CILH 3QJHA 4PRDB 1QLRB 5HHNB 1YYMH 1LEGA 5GSVB 3VMPA 2HT3C 3SKMA 2FX8L 1E28B 4XPAL 1NBZA 3QFJB 2B39A 4LMQE 3WFCH 1ED3B 3B5HA 1U8PB 3RVWC 3VGHA 3QXAA 5E4EB 1TVHA 1UWEH 4NQXA 2QBWA 1P5VA 1ZHKB 3BKYL 1MCFA 3CH8A 4LU5H 4FFWD 2HKHH 3TYGL 1CVSC 4DGIL 3KPLA 5J7CC 2FX7L 5FYKH 4HEPG 4KKCD 5J0BA 1UGNA 2ERJC 3GMPA 4Z7WF 1KPUB 2P1YA 4N90D 4JQVA 2EC8A 1MPAL 4XVSH 1ORSA 5DYOA 3ISWA 1B0RA 4N9GA 5I71B 1M7IA 3JWDH 4GW5A 2WBJD 4PTUB 3L95B 1KT2B 4X80H 3QWRA 1OQOA 1A7BA 3FO2B 5IW6A 4XPFH 4JQVC 4F7CB 4OQTA 5HGHB 2QSQA 4PJFB 4NQVA 3SDDC 4WFFD 12E8L 2DD8L 4HHAB 2DQDH 2SEBA 4HG4J 4IIQB 2P5EA 1V3LA 4X6CB 1XIWC 2AJVL 1K5NB 5DEFB 5T3XH 3VE0B 1VKXB 3LV3A 5FIEA 3A6BL 1S7RB 4JRYB 1T1WA 1NH6A 1MAJA 5MEQB 1ZLSH 4NZRH 2AJYL 3L3GA 3OR7A 4RMUA 3GB7A 4Y5XB 3ILPB 1S7VA 3TJHC 3TNMA 1V5JA 2ARJQ 2XT1B 5AZ2L 4NN6B 5H35B 4A2MA 1YPZB 3VI4F 4C4KT 1YEKL 3BJLA 1QR1A 2QTEA 5HYJE 3OG4B 1L6ZA 2CGRL 3WS6A 1KG0B 5C7XH 5KANI 3ILQC 4OZHB 2VKWA 3HG1D 4NP4L 1CQKA 2G9HA 1INEH 4IJ3B 3G5VA 5TQ2L 3MRRB 1Q38A 1QO3B 3QHFL 3VRIA 3I6KA 3QUXD 3EOTH 4XP1L 1MFBL 3ME0A 4LLDB 5EC1A 3MRFA 3TBWB 3WS6C 1A6VL 3L5XL 1MCPH 5KSVA 2Z8VC 3HE6D 4OZGA 2H3NA 2ZG2A 5I9QC 4ZO8A 2DQTH 1WZLA 2ZSVA 3ARXA 1F11B 4LHUG 4M8VA 1UQSA 4D2NA 3DSFL 3C6LD 4JHBA 5FYKD 4QOKD 1N4XL 2GK2A 5J6HB 3ZMRA 1G7MB 2EC9U 3ARPA 3U4AA 2QL1A 1IGJB 2HJKB 2FECI 4L8DA 1QQDB 4L8SC 1OAXL 5HPMB 3QIBD 4XPTH 4C56A 3UJJH 4ZFZA 3WHXB 2YA1A 4S11A 3QIUC 2B0SL 2VXTL 5A2IH 3FRPA 1N5AB 1BWMA 4FABH 4U6XA 3UPCA 5DJDA 1EXUA 3RZCA 1T21B 3WKNA 5LGHL 3OKKA 4G6FD 4YXHH 2IPTL 1NKOA 2WUCL 4X98B 3LB6C 3U0TA 5FGBA 1CFSB 3G08B 5IB5B 1BFVL 3QDME 2BFVL 4UV4L 4XC1L 3G5ZA 1YY8B 3I75A 3S88H 4HCRH 1IAOB 1HHHB 2PKDA 2V7NA 3P73B 3RTQB 5F89A 2NXYB 5FGBC 1TXKA 3GGWB 5AWNH 2X5PA 4G8GD 3WO4B 3HNSH 1DQJB 3D85D 4MAYA 3RWEB 4URTB 4WO4B 5IQ7H 1JZ5A 4JRXB 4D8PB 1G9NL 2KUTA 4OV6F 3MSPA 3UYOD 1P7QB 1VACB 4O4YH 2CDFA 4JJHA 4MAYC 3NIFE 2VMFA 5T1MA 1JUFB 3QUKA 2MSPA 1UB5B 5JXAL 1W0VB 2DLFH 2W60A 1UH2A 1AGCA 3K8KA 3LQZA 2J5LB 1CT8A 1I7RA 2C9AA 3V6ZB 1ZKAA 1IGCH 3WO3B 5CD3B 1KLUA 1FSKB 1Q9OB 3IJSB 5IM7B 3F7YA 1ZANL 2AJZB 4FQ1L 1IEHA 1K9TA 4RISL 1DP0A 3IDJB 3WSQL 5D7IA 1N8ZA 4HBQA 3HC4L 4F80A 3T3PE 1NC2D 4CDGC 3PDOA 5C0RL 2R2BA 4TVPE 4F33A 3OJDA 5EO0A 3O6KH 1KB9K 1IM9D 4EJ1C 1KCUL 1Z9OA 5IFJA 1TNMA 1MJJB 3RIAK 1YC7A 2W0FB 4AK1A 3CPLA 3FO1B 5BVJA 1S9XA 1UM6H 2IAMD 3MV9B 2HH0H 5IVZA 4P2YA 4P23B 3D3VA 4P2QD 4PLKD 4PJEA 2X4SA 4NHUB 4YHZH 5M7QA 4WEBH 1FYTE 3O3UN 1FNEA 3H3PH 1MCIA 2FHCA 5EU3B 1YYLH 1MCKA 4OLYL 2UY7A 5T1LA 5I1EH 3JWOH 4D9RE 4OGXL 5LBSH 3GI8L 5DLML 3O2WH 3RWCB 1LP9E 1DLHA 5GRXG 2EH7L 3UP1A 3IXTA 3S37H 4N5EC 3P4OA 4ERSL 1QLEH 4LBEB 4WU5B 4HWBH 5JQHC 3VCLB 2RBLA 2CKBH 1EJOH 3U30C 1J87A 1G7IA 3L5WA 2DOCA 4OFDA 5JIHA 4P57B 1J0HA 2WINA 3RX5A 1YJDH 3ZKND 4PRHB 1AGFB 2Q7YA 4HDIB 5D96C 3SJVE 1U41A 1NGZB 3ALXA 2ZUXA 3O3BA 1E4XI 3TIDB 4Y5YB 1B9ZA 1NFDF 1NDGB 4H5SA 3INUL 4TNVK 2VLMD 5E8PB 1JHLL 2DLEA 4LCIL 3NGBB 4YDVA 2YD7A 5HY9A 2Q6WA 3S5LG 1KLGB 4UAOC 5BRZB 4XCEB 1NCUA 4KI5E 1KFAH 5D5MF 4FRWA 3MV8E 3V95A 5JDJA 5JLZA 1BM3L 4P5KA 1YECL 1R5VA 3MGTB 5L9DH 2VSCA 1X5AA 4HLZG 3O9WA 3RVTC 3PQYA 3V6OC 5ICYB 5GHWL 3LZFL 3VXQA 4PUBL 3DUHA 5E9DB 2FO4B 2FB4L 4TTDD 1G7HA 4K3DL 3CVIH 1AY1L 3KAAA 3MV7B 1U8LB 2NX5D 1DQLL 2IAND 3PWPD 3RDTD 1FVCA 5IBLC 43CAA 1JMXA 1HEZB 4PJXE 2B1HH 5AZEH 1HHIB 5EU5B 4OF6A 3O41B 1A6UL 1A6ZA 3GJEA 5C8JB 3GKZA 2FJHB 2VWEC 5C2UB 4HIHB 3X12B 5JDSA 1SVZA 3S3PA 1GC1C 4MD4B 2A2QT 1WICA 3NFNB 3V5KB 2PXYD 2AJSL 1LEKB 1WITA 2Q20A 3JTTA 3CH1B 4U1HB 5I1IH 2HTKD 4PJIB 5BV7B 3QIWD 1TFHA 1IAII 4HGWB 4RRPA 5A3ID 3L5IA 4XBEH 4GRLA 4NKDA 3FB8B 2CXKA 5IV2B 2QHLA 5DI8A 4PTTA 4FQJL 4NQDE 3QR2A 3RQ3A 3VXPB 4EN3B 3OHXB 1NFIA 1KELH 1DFBL 3RZWA 3VWKD 3NN8B 4GRLC 5C0CA 2FX9L 4LSSH 4U1JA 4DKFL 5GGSB 3S98A 5CLWA 1JYXA 3W5NA 1NEZB 1FDLL 3GHBH 4X7FC 4CKVX 4KDTC 2BSSB 3PJSB 3QO0B 3U6RA 4OIBA 3FKUS 4HIXH 5HDQL 1F3JB 3VGAB 4MS8D 4WFHD 1FC2D 1U8KA 2PYED 1MRCH 4YBLB 1KB5L 4P46A 3JZ7A 4Z7WB 4YFDB 1T80A 4KK5D 4BZ2L 5DURD 4R7DB 1E27A 3MXWH 1LO3L 3NACH 4IRSB 4YE4L 3WIHL 1CZ8L 5DEGB 1WK0A 3C60A 2R8SL 5FOBA 1UJ3A 3K4ZA 3RVXD 3R1GH 5C0NC 1BFSA 2BOCA 3B83A 4KZEL 3MNWB 1F02I 5IB3A 3P9MA 2ZCLL 4HK3N 2D7QA 4U1LA 4LAJH 3C60C 4PJAF 1AO7B 4R2GC 2NY5C 3MA9L 1K3IA 3GMQA 1JGDA 2V6HA 1I9JH 3BP6B 2CR3A 4EEEA 4OFKA 4PP1D 4WW2A 5TF1L 4FQXD 5T1KB 3F12B 3KR3L 1FV1B 5DWUH 3SE9L 4G7YL 3WCYA 1OGAE 3VRLE 1J1OL 4YDJB 1H3GA 2R15A 4WWKC 1MEXH 1TITA 4ZTPH 4EXPX 1DDHA 2DM7A 4F37K 5L2KA 3MLWL 5F7FA 4IRZH 3FN0L 4BSVB 4ZUVA 4EI5B 3BI9X 1R24B 1D5IH 3OMZA 2YUWA 4OUUA 1OB1A 1UACH 2W9DH 3X17A 1NUGA 4UMGA 4D0BB 4DKDC 2V5SA 3QFJD 1GH7A 2IEPA 3IDNB 3L3OA 2BHYA 4U1GC 1NGWA 1RHHB 5E5MB 1RK0B 4EI6B 4Q6IB 2VDOH 4XNXL 4NQED 2DQIL 1UM5L 1VEOA 3TPUB 2OZ4H 3I2CL 5FO7A 1CI5A 4JB9L 3T0EB 1ZT4A 2F74A 1CD1B 3OB0H 5EN2B 5A2KH 1MIEL 1Q0YH 1OQXA 3VFUB 1PKQB 4KV5F 1P53A 4N8VG 3QAZC 4OKDA 4Z9KB 4HC1L 1NCWH 4H0HB 4ELKB 5DQ9A 2PO6A 4Z5RB 4Y8AA 3MRJA 1JNHA 1AE6H 1A1MA 2P5EE 1OARL 2O61A 3H7BA 3ET9F 3OPZL 4OF5A 1OAKH 3Q1SH 4L4TD 1I8MB 4H88H 1NGYA 5I1AA 3E3QE 3OAUL 5GRYA 2HAZA 5DK0B 4FQHB 4QHNB 3WKMH 4L3EE 3FQRA 1QSEB 4U05A 5DD0L 4KY1H 2MNUA 1U3HA 2YEZB 3HRZB 3EFFB 1CXFA 4KJYB 3LEXA 4UUJA 1DBKH 1KIPA 4W4OA 5TQ0H 1R0AH 3EIFA 2F54A 3SDXE 3UJIL 2JB6B 3TP4A 3OAYH 4TOYH 5HHOB 1UZ6E 5EIQA 3QPQC 1T03H 2XXMB 4TUOB 5IEHA 3TLRA 3IU4L 4NC2B 2Z31A 3C5ZB 4KAQH 5D71H 1O0VA 2NY3C 2YUZA 3MJ7A 5DD3H 4LEOA 3PWLB 4HKJB 1XF3B 5CIPB 2EIZB 1RU9L 3LDBB 4MDJA 2VE6A 1PGRB 2Z31C 3E8UH 3Q6FA 4MMZC 4P4KD 4RAVA 3KPPA 2MCG1 2PW2A 3OAZK 4OCRH 1KJMA 2VABB 4YH6A 2CPCA 1UENA 2VLJD 4PRNA 1FRGL 4FFYL 3MGOB 3RWIB 4P2OA 4X6FA 5L8KB 1JGEB 3UBXB 3BGFC 4ZPVA 2L7JA 4C56E 4O2CB 1YMHA 3LN5B 3TA3B 4NHCL 1MUJB 2NR6D 3DI2B 2JJSC 1D5ZB 4LARL 3B3IA 4NO3B 2VDLL 1BFOB 4OF7A 3DVNA 1HYSC 3W0WD 1DSFL 3QEQB 4P49A 3TYGH 2CK0L 1HH6A 3GDBA 1LO5A 4WGVB 4Z7NF 1A02N 5FYJE 4I5BA 4JKKA 1F4AA 5IW1B 4DK6A 4DW2H 3GSWA 1RZ8A 5BZWA 1GIGH 5FUCC 4NDMA 5MI0C 3O2VL 5L8LB 2DD8H 4QHLB 2YA0A 3TM6A 5JOFB 1N6UA 1HWHB 4EOWH 5I73C 5B38G 4HKZB 3TCLB 3W9DB 1JF6A 2MHAA 1FVEA 4LASL 4HZAA 4S1RL 1ZLVH 1CR9L 1FQ9C 1N0XL 1U8QA 3K1KC 2AI0L 5CBAA 4WW1B 2J8UA 4GSDL 3O45B 4L9LB 3L3IA 4PRPE 1JWUA 4RGNE 2YPLB 1GOFA 5IFHL 3EJYC 4F7PA 4Z76B 1CIDA 2XACC 4PJ9B 2CGRH 3BVNA 3RWFA 5EUOA 4YHOL 5IB4B 4QLRA 1BMGA 1I4FA 3QHTC 4X7CC 2EE3A 3IDGA 3QNYA 5HGAB 5TQ2H 3RWHB 4JGMA 3QHFH 1C08A 1A3QA 4XP6H 3IVKA 4O9HH 5F7NC 1JTOA 1MFBH 1JPGA 2FWOA 1RJZB 3D87B 5DMGC 2JJVA 3HE7A 3TNNA 1A6VH 3FO9B 3L5XH 2IJ0C 5D5MB 4ZXBB 5DVOA 1SJXA 3JV0A 2VDNL 3SDCD 4M3KB 1JNLL 4XGZB 1FIGH 4NWTH 3ULVC 1LGVA 1TVDA 4OZFB 3LHPH 3UJTH 3BQUD 1HYRC 2BMKB 3IDYC 4XAKD 3CIQA 1JWSA 4YWGL 1CLZL 4R26L 4P5MA 5CCKH 5DTFB 1QYGH 2ED8A 3DTXB 5E7BA 3G6JA 3P0YL 1U8HA 5CEXB 1II4E 1JPTH 1WF5A 5DJ2A 2FYYB 2R29L 4PJEE 4DOHE 4G6JL 1N2RB 3GRWL 5ERWB 1MI5E 4NT6B 4D0CA 3E2HC 4KKCC 1RSFA 1KEMH 1S7TA 1WAAA 2H32B 4K7PH 1V3KA 1U36A 3UTTD 1KXVC 1EERB 1TETH 3MOBL 3VXTA 3FQXB 4O02L 4R96B 1IQDA 2WBJC 5EU6D 5AG9A 2VZ1A 2GJJA 2QQQA 5E5UB 4LF3B 2E7CA 4GKNA 5FGCB 1A3LL 4DTGH 4PGCB 2Q76B 1RZIB 4XC1H 1NMCB 1QFHA 4QHUA 2A77H 2YD2A 5HPOA 4HIEA 5BV7H 3AGVA 5H8DA 1SMOA 1CTOA 4XWOD 5D8JL 1ZT1B 5J11B 3MZTA 2HVKB 3PUCA 1NJ9A 2VLRD 3GI9H 3PP3H 3VGDA 1JL8A 2M2DA 4PJBF 1YMME 4PRHD 1P84K 1I1RA 5F7EL 3PWJA 4JKLA 4CW1A 1H8OA 4HUXA 5EBLB 3HG1A 1YEFL 4MZ3A 4HQQH 4JANB 2DN7A 3VFSA 4XPBH 1FNSH 1ZHLB 2FLBT 5IHZB 2UUDK 1I9RH 3QUXA 4Y4FD 2YKLH 2HVJB 2Y36L 3GM8A 5BOZG 4N1EA 1CFNB 3MBED 4F58L 3D2UD 5EA0H 3OGCA 3IJYB 3HE6A 1HZHL 1OWRM 1DBBL 1EJ6A 3PQYE 4HF5L 1MRDH 4XMLL 3MUZ1 4G8EA 5C92A 4P2RD 3QUXC 4JFEE 5E8DL 1OF2B 5ITBL 2AK4D 4J4PD 4G9DB 3SDYL 4FTVD 3HE6C 4QOKA 2BOBA 1KIQA 4OKVA 5LG1A 4AL8H 1I75A 1ZS8A 3T4AB 1DCLA 3QIBA 4RISH 1HINH 5I2IA 5D70L 6FABH 3C6LC 4GAJL 3S37X 5I1JL 3RWJA 2CO7B 1AFVH 2DQHL 2EXWD 5FK9A 4HUNB 5SV3A 1EGJA 43C9A 1KCUH 1HSAB 4PJAB 3QIBC 3RFZC 4M9OA 3JWDC 3TBVA 1LILA 1WBZB 4GKOA 3D39B 1I1AD 2GTWB 4HS6A 5F6IC 4PGEA 3BP4A 2IQAB 2MCPH 4GG6E 2XTJC 4ZUTB 1JGVL 1NQBA 3JXAA 1DEDA 1I7TB 4OLYH 1FO0L 4QF1A 4NO5B 1KCRL 3BPOC 4F57L 4OGXH 1KPRB 3QULB 4BQBA 3ZYZA 1NBQA 1HQ4B 3V0WH 1HSBA 2EDTA 3BH8A 4KVCH 5IVXA 4MNQB 4RMWA 4TYUA 1Z3GH 5F44A 3R06B 2QQNH 3AS1A 1DBAH 4XAWH 2ENSA 4F9PC 2BNUB 4DEPB 2AJ3B 2P4AB 1UA6L 1GGBH 5CJOL 1WUNT 5DJ6B 3MV01 3PWVA 4AQOA 1YEEL 2Z8RA 4HIIA 2I9LA 3DUSA 2Z93B 1CF8L 3GIZL 3DMMB 1T2QH 3BPLC 4OCNC 1CU4H 5E94A 3MR9B 4XNQB 4DK3A 1MCSA 3LEYH 3O4LB 3U4EB 3KNBA 4KPHH 4I0KA 4XNYL 4HH9A 4MWFB 5CHNA 5CFHA 2I25N 2XZQL 3BXNB 3ARGB 4IRSD 5E1HB 3AU1B 2V7HA 4JKPL 5FO8A 3TT3H 2OTWB 1XMWA 2XG4A 3QUMA 4KK6D 1NC2A 5JXEC 1AIFB 2FB4H 1A7RL 4IOIB 1NAMA 4K3DH 5C9JA 5D7LA 2QKIA 1D6EA 1TVBB 4QGYA 1OCWL 2F5AL 2ZCHL 1IM9A 1AO7D 3AREB 3QXWA 1T1YA 4QRQA 4YHNB 4TSCH 2NXZD 4GXVH 3HPJA 3RNKB 2NY0D 4XMKL 5TDOA 2YPVH 4P2QA 1NANH 3P4MB 1FL6A 5D2LE 5DSCA 3QDHA 4ETQA 1UCTA 2D0GA 3K2UL 2IAMC 3T1WA 3REWA 4ALAH 1KTKE 5DVNA 5LAXB 3ROOA 4Y0GA 3CU7A 5L2KE 4PLKC 2AJSH 1AJ7H 2FATL 4B7IA 4EI5D 1RK1B 1FZOB 4PGBA 3GMRA 5HYIA 4E41B 1RZ7H 3LRSA 5CSBA 1GGCL 4YK4C 5E8NB 5BZDB 1G7PA 3NIFF 2ZNXA 2WWKT 3R8QA 3FO0L 3GSQA 3MRLA 3IDXL 1CGVA 4I9WD 3D18B 5BS0A 2RB8A 4X9GA 5CIPH 4EVNB 2ADGB 3KPSB 2Z92A 1VFMA 1XF4A 3HS0B 2FX9H 3WJJA 1GHFH 3EYFA 4OI9A 2VDRL 3GSNA 2VIRA 1CXHA 3JV5A 4ODHH 3STZB 1EPFA 4MA1C 2VXUL 5JNYB 2XWTA 3ZKNC 3HNTH 2FIKB 4Y1AD 3WJJC 3T3PF 3QDGB 1M7DA 1GYAA 3PHQA 4NGHL 5DJXA 2OSLA 2ICWI 4XBPA 1KB5H 2E5EA 1EMTL 3BWUC 1MIMH 2C26A 4XZUB 2XA3A 1RJYA 2CUHA 2NX5A 3ZO0A 4YE4H 4HS8H 3D48R 3WIHH 4MDIA 3PWPA 3RDTA 4YJZL 3H9SB 4HZLB 3K8MA 5ICZA 4M3JA 5IBTH 4YC2B 4TTDC 1E4WH 2C3VB 1SM3H 2XN9B 2OQJA 3O6FD 5C86A 5ANMA 3STLA 1MHHA 3RDTC 4KZEH 3GZKA 1R3IL 3HC3H 2A83B 3PG2A 1HH9B 1T4KB 1LP9F 1U2CA 5HHOD 4YR6A 2PXYA 2DLTA 5BXFA 1URLA 4QYOA 4M1CD 5I1HL 1QFUL 2BSTA 3DX8B 3SE9H 3QIWA 4G7YH 5D1QD 2Y07H 2LQRA 2OX5A 2EECA 3DV4A 4BUGA 3VH8A 3KPRB 2IALB 4I2XA 3FN3A 3DV6A 3QWOB 2A74B 2HTKC 3OKDB 3FN0H 3QIWC 4AIXA 4LOUC 4K94L 4NC1C 5A3IC 1MCNA 3S97C 1ACYL 5ITFB 3VWKA 4HKXA 4NSKB 5SWZB 1ADQL 1LO0L 4OLWH 2R23A 4MQXD 3NTCL 2WAHA 2FL5A 1MWAB 4BZ1H 4KI5F 3SHSA 1YJDC 2ZWLT 4GQ9L 3SCMB 3WFBL 3GK8H 1CD0A 2J88H 2JJTA 5EWIL 3HAEG 3CFBB 3VWKC 1CXIA 3OR6A 2ATKA 3U1SH 3EYQD 4OZFH 1JHKL 2DQIH 1C5DB 1J1PH 3T0XA 2JJTC 2PYEA 4EKXA 5IK3A 1J0JA 1HNFA 4QHKI 4M5YH 5EOQL 1DN0A 2CO6B 3N1MC 3UXFA 2R39A 3LOWA 4MS8C 3PL6C 2VDPL 2R0LL 4K2UL 5MENB 3IETA 5KW9L 1F97A 3BJ91 4HC1H 1JPSH 3LH2H 4OLXH 3RNQB 2VZVA 2XY1A 3IKCB 3C5SB 4U0RB 4GKSB 1BLNA 2H32H 3ZKMD 5HD8D 1OARH 5CP3A 1R3JB 1XF2B 3R8BB 4UBDD 4LCUA 1IM3B 3HZMB 1ONQA 3ZLQC 1IAKA 4PG2A 4MAUL 4LLQB 5DD6A 3RVXC 3L6FA 4I0PB 4UB0L 5DHVB 3OAUH 5IBUB 3PHOA 3ZYIA 4F9LC 1CFBA 5DD0H 2RCSL 4PJBB 1XR9A 1EHAA 1MSPA 1KV3A 1TJIL 5LQBH 5EBWA 2HJFB 5EUOE 3IDIA 1PD6A 1DN2A 1S7UB 1Z9MA 5DJZA 4FQXC 3ULUF 4DN4L 3P9WB 3RIAF 4ZFGH 4L1DA 3HN3A 4LCWE 4ONOA 3RY6A 1ZAGA 4ZS7H 5KSAA 3BUYA 1MCCA 2X1PA 4W68A 3C9NB 3EOBA 1I3RA 4QRRE 1PYWB 3P9LA 4PG9B 5JUEL 5GPRA 4WU7B 1QFWH 2E7BA 2Y06L 4JM2F 4TVPL 5I1DB 3RY6C 4V1DE 3MUHL 3O3AA 1SQ2N 4H20H 4NYLB 1EFXD 3E6HB 5CMAA 4KWUA 5CP7A 2A38A 2R4SL 4UT7H 1D5MA 4NQEA 3VI3F 5KSUB 3D69B 4JY5H 5GS1B 5HHQB 3L3HA 2BC4B 5IMOB 4K8RH 2OP4H 5JQ6H 1H3TA 5E4EC 1OT2A 5F9JA 4PJHB 2PR4H 5EZJA 1RFDL 1BBJA 4NHCH 2I24N 2CDEB 2YWYA 3TBTB 2UVEA 2VDLH 2DIBA 4BYHA 5BQ7B 5EORL 1NC4D 1TZHA 2DBLH 1X5JA 2WLZA 4ZDHB 5F7KC 4PY7B 2XWBB 1FFQA 2VR5A 4M6AA 5J1AA 3JV4A 3ZHLA 1Q9WB 3QDJD 2V2TB 4K9EL 1D7FA 3PGFH 5JOEA 4WIQA 2O5YH 3KWWA 4TQEL 1S7XB 4MX7B 4TNVF 4NZUH 1MCBA 1JPFB 4RA3A 5HYFA 2GJ6E 2JJUA 4KJQD 2X40A 4MXVE 3PGDA 2FHBA 3SGKC 4IIQC 4PJ7B 1K8IB 1CE1H 3PGCA 2BVUA 3WS3B 4J8RB 4ORZC 4HSQA 3RP1A 4R90L 3ELAT 4BUHA 4Y5XC 4JDVA 1AGEB 4K3EL 1IKNA 4LASH 3KLAB 1IFHL 3MYJB 2EE6A 4NN6C 2AXGA 1CR9H 4KKAD 4OJFL 1N0XH 1ITBB 1JCKA 2Q86A 5DRNA 1SYVA 2NY2D 3V7MA 3VXUB 2V2WA 5IFHH 4XP4L 3S96A 4JFOB 4IJ3C 5F7MC 2IF7A 1S5IL 2GT9A 5TFSH 5E6ZA 4Z0XA 4OD1H 4JFQA 1W8NA 2DQFB 2DJSA 1OHQA 4YXLL 1T1ZA 4NQCE 4J1UA 4PR5A 4P4KA 4B0MM 4PB9L 3L9RA 2VLJA 1M05A 2VDNH 3L3DB 4NKIL 4B7LA 4RFNB 2FJFA 1JNLH 4JGUA 4P5TD 2X9YA 3SBWA 3TO2B 2C7UB 2I60H 4QXGH 2JF1A 1YDPA 1G7JB 3RRQA 1S7QA 4Z95H 1FZKB 3CVHL 5C08A 4LSUL 4YWGH 3W0WA 2H26B 4C83A 3SBWC 4N0FB 4Y19E 5C09A 3B9EA 1PZ5A 2B5IB 5TE6L 1XH3A 2NR6C 4G9FB 1P7KA 2ZUUA 4XCCH 3IAPA 4OSUL 1YUHB 2P49B 3OXSB 2EDXA 1IEBA 4G6JH 3MJ8B 4LVOB 3GRWH 2ZOKB 3DLQR 3VG0H 1FL5A 1JK8A 4OLUH 2Q8BL 5INDB 5BCAA 5HYEA 1I8LA 4FQPA 4AT6A 1G1CA 4E0RB 1OSPL 2PCPA 4O2FB 3SDXF 4XC3L 4RMQA 4O02H 3WL9B 3RJDA 1C7SA 4LVHB 4F7EA 4MNQD 1QACA 1UZ6F 2D0HA 3RTQC 1CDJA 1H3XA 2GTZB 4UOW0 4JFXB 1BQHA 3OKEA 1OAUL 2R2HA 3ARSA 3TYFA 3HZYB 4X4YA 3DMMD 1WZKA 4PJDA 3KLHC 1SYSA 3DX9B 3MC0A 3QJFB 2QADD 1NEZG 3O4LD 4UT6L 1BJ1J 5F7EH 4DZBA 1I7UA 4NUGH 4EQ2A 1F58L 5KJRH 2YUVA 4G80A 4DJMA 4YEEA 2E27L 4ODVL 3CFIC 2OM5A 1RJLA 2X4NA 2ZKHH 3ARGD 4BK5A 3NAAH 3NCJL 2W92A 3VXME 4AH2A 3MJ9L 3MLTB 4S1QH 3SDCA 4NJ9L 2J5LC 4G42B 4HF5H 1IAMA 3F7QA 1LEIB 4DGVH 4EDWH 3STBA 5A40E 2ZUQC 5E8DH 5ITBH 4MGXA 2ICWA 5D7LE 1WWWX 1M71B 3BQUA 2NY4B 2A6KB 3ARED 1J05B 3SDCC 1A3RL 5FA3A 1JN6B 2O93L 1KN2H 3V4PH 1JNNL 4OT1L 4BJLA 5CSZB 5MHSD 2C4FT 1A1OA 1FYTB 4MA3A 5D2NE 4GMTH 5D70H 3BQUC 3C87A 3WXVH 1T89C 1Y0LA 1JPST 4PFEA 4GUPB 3WUWA 2AV7A 5D93B 3PP4H 2ADIB 5F1NB 2DQHH 3DGGA 2GHWB 3QHZH 1FFRA 2G75B 3HZVB 5F7YC 4IDJL 3UTTA 3N1QC 4WI4A 1U8MA 2R2CA 3BHBB 3LSOA 5F7HA 5EU6A 2HYMA 2D0FA 2EDNA 4E41D 2DMCA 2R1WB 1A7QH 1T7ZA 5A16A 4K7PY 2EICA 2ADJA 4GW4A 1KCRH 2GEEA 4KGLA 4L4VD 4MVBD 3LN4A 5BS0E 3GSUA 2VLRA 2OR9L 1YN7B 3U4BH 5KSBA 5EO1B 2WWKO 2IMNA 4MNGB 2APXA 3BOVA 4XWOC 2KH2B 1QRNE 5F3HA 2JCCA 4Z7UA 4ODSH 5DZLA 4W6YB 5CJOH 1MWAH 3C8KB 4YFLI 5E5RB 2AXFB 2VITA 2D03H 2YC1B 1YEEH 1XGUB 1WVZA 3S4SA 1BQLL 4Y4FA 3VDBA 3KPQB 5D7IF 4NOBA 3LKRA 3D2UA 3D0VB 4Y5YC 2BVYA 4JO2H 1GZPB 1NGQL 1G9MH 2J8OA 3ES6A 2DLHA 3NGBC 4P2RA 3SO3B 4HUWA 4Y4FC 5GGSY 1OTUD 2AK4A 3ARFD 4J4PA 3MBEC 5DK2B 2XWJA 3O2DH 4FTVA 4LSVL 2DICA 5E8OB 4MJ4A 2YRPA 4PJEF 4WI3A 4JKPH 2EE2A 2CIKA 5EC2B 4Z8FL 3O11A 2PYFA 3H0TA 1FGNH 2K7QA 2RFXA 3NPZB 2B1AL 1X5FA 2AQ2A 1ZA6B 2JK5A 4ELMA 3ARWA 4GRMB 4L3CA 5L6YL 4POZD 2W59A 4Z7VE 1I1AA 3AFLA 1T20A 2D7TL 5DXWA 4HUKB 3K2MC 4PLJD 3WMSA 3KYKL 2C4XA 2EXWC 5DHVH 1MH5A 2NLJA 1EVTC 1R3HB 1U3JA 2GUOB 3T8XB 4GAYA 4NQDB 1U58A 4DAGL 3VFMA 3VJ6B 1I1AC 2YRZA 4LCYA 4U1MA 4GBXB 3CSBA 4RNRB 3UYRH 5BV7C 4MD5B 4M7ZB 5IMMB 1BOGA 2OL3L 1T0MB 3HI6H 4KQ3H 4WWID 2AEPH 4LFHG 2YA2A 5DC9B 2J6EL 1ETZB 1X7QB 2ITCB 2NYYD 1CXLA 3BGMA 4EN3C 1JRHL 1P4LA 1JFQL 3QO1B 1EH9A 3VG9B 3MREA 4JM2B 3DRQA 2VLKB 4UIMA 4OM1H 3RY5A 1G9NC 2HJLB 2FGZA 4HWNA 4O2EB 3KYOB 3UBXG 1I3GH 4XP5H 3HRPA 1CFQA 1G7LB 3FB6A 4ZUUA 1ZLUH 4QTHB 4Z77A 5FYJL 2X4TB 5HHVL 3L7FA 3FFCB 3UO1L 5ACLA 3ZSSA 5MEND 4YBLC 3KPMA 1FBIL 4NGHH 4IS6A 2J2ZA 2FEDD 1DUYB 1U8NA 4ONGH 3DXAB 4JFPB 2W0PA 5JPMA 1ZHNB 4PBWD 4S0SD 3L5JA 4LLYB 1SEQL 1J18A 5JOPE 4IRSC 1MNUL 2R2EA 4ZNEA 3WEXB 2BCKA 3T0BA 1V7NH 2VZOA 5EPMA 5I76B 1VEMA 2ARJA 5FUOH 1NGPH 5C6TL 2I07A 2O5ZH 4HT1L 5GGTL 4PRAB 4GG6F 3ARBD 3QEUA 4I0PD 3CFCL 4EZMA 4KK6C 3IU3A 4G7VH 5T3ZE 1OGAB 4YFEA 2CUMA 1G7QB 2X41A 1X5HA 2OK0H 5ESAB 3IFLH 3SPVB 1TTUA 2VZ3A 5TGBA 1LK2B 2H1PH 3DSNA 1AD9A 5DK3A 3I9GL 4N0UB 2NXZC 5MEOA 3EW3B 3F5WA 1A6TB 2NY0C 3PXHA 3QJHB 4JFHE 5I8KL 1JBJA 1FPTL 1LEGB 4JRWA 3SKMB 2QQKL 2DMBA 2C3GA 1J88A 5JHDE 3AXLA 4LVEA 2ERJB 4Z0BL 3QXAB 1TVHB 3DHJA 1QUNA 1MFDL 2EYSA 4EI5C 4ODXA 1T3FA 1H3PH 3GNMH 1AHWA 4NO0A 1CE6A 5ICXA 3NFSL 3KPLB 4KZDH 5FXCH 3GMPB 3EOYG 1ACYH 4NQEE 1ROWA 2VC2H 3IJHA 4MLSA 1ADQH 1S7WA 3SQOL 1ORSB 1B0RB 1QBLL 4N9GB 1AHWC 4NM8H 1M7IB 4GQ9H 2DIJA 4Q6IC 4JZJA 1EK3A 4OZFG 2CRIA 1ZT7A 1B90A 3CXHK 4MMXC 2EDJA 1VPOH 5IW6B 4JFDE 1MJUL 1TZGL 4NQVB 4Y1AA 1TQCB 5AEAA 1KEGL 2SEBB 4LL9A 1Z5LB 2I27N 3HUJA 1DQML 4LSRL 3LV3B 1P69B 3RUGA 1L6XA 1T1WB 4TSBH 4FFVD 5DD5H 3L3GB 3OR7B 3GB7B 7FABH 4F7TA 3S7GA 4JFZH 4WW2F 1YNLL 4L3AA 2R0LH 4PJ8D 1HDMA 4I3SL 3L1OH 2O26U 5HYJD 5F6HJ 4UDUA 1QR1B 4B41A 3V4VL 3V9FA 3C8DA 1Q1JH 1IC1A 2G9HB 3O6FA 4FG6D 3G5VB 3P3YA 5I9QB 2P46B 3VRIB 3I6KB 5CJXA 4CU8A 5EC1B 3MRFB 3ZT5A 5DVLA 1ZLWH 4MAUH 4X99A 5KSVB 4OZGB 3O6FC 2H3NB 3CCHA 3ROLA 3SE8H 2PTTA 1QD0A 2X4OA 5D1QA 1U8JA 2ZSVB 3S3SA 1UQSB 3VFVA 1T5WA 4M1CC 2X1XR 4XBGA 1EBPA 4OV5A 4U2ZA 4U3CA 3QIUB 3OBAA 4LGPB 4L8DB 4Y16A 4CVXA 4QRSB 5D1QC 5GS2H 4ETYA 3FT3A 5C0BE 1K85A 3HKFA 4ZFZB 1FL3A 3IDUA 5A2LH 1D5XA 3LDBC 3M07A 4HK3J 5F70A 4MB4A 2CLRA 3CLEH 1I1YA 3P11L 4U6XB 5DJDB 1EXUB 3RZCB 2ATPA 2D2OA 3OKKB 1B4JL 1VERA 1C5BL 4JQXA 4OZIB 3L7EA 4MQXC 3IF1A 1YA5A 3EO0A 5C08E 2Q8AL 2LVEA 4P59L 4OGYH 3U0TB 3QCTL 5ID1A 1EHLL 3QDMD 1A0QL 5C09E 3TV3L 5IOPA 2KZWA 3G5ZB 2DYPB 3I75B 5FOJA 1H3VA 3EYQC 2X4RA 2V7NB 1D5BA 3R0NA 5F89B 2BVQA 2HKFL 4G8IA 4ZOCA 1UCBL 3TWCL 4PP2A 4TUJA 4BSJA 4JO1L 4IOFD 5KVGH 1MVFA 4K9EH 4P4RA 4MAYB 1QSVA 1AC6A 2BK8A 3H3KA 3B9KA 4UU9A 4LNRA 5IW3A 5E6ID 4OLEA 2ORBL 1KCLA 2AABL 5KVDL 3GSOA 3HMWL 3EYOA 2Z8SA 5B39G 2CDFB 5CEYA 5MP6L 5T1MB 3ZKMC 2YUXA 4X8XA 3U36A 5HD8C 3MLVL 2IPUK 5BVPH 1LO2H 3QUKB 4R6UA 4J23A 4PJDE 4UBDC 3MXVH 2W60B 4NJAH 1YY9D 4PJ5E 4R90H 1AGCB 3LQZB 1CT8B 3CX5K 1I7RB 3F7RA 5DUMH 1J8KA 4K3EH 4HJJH 2VDML 1RZKL 1KLUB 4L9LC 2MKWA 4OJFH 5CSGA 1NFDA 1UKSA 1CGTA 2P24A 4I1NB 4I4WA 3F7YB 2MPAL 1EHXA 5D7IB 1N8ZB 4XCFL 3RVUC 4RSVA 5KZCB 4M6MH 5D9SB 3PDOB 4TVPD 2R2BB 3ABZA 2J4WL 4F33B 3BYYA 3OJDB 1JGLL 4P9HL 1YEHL 5IFJB 1FYHB 2P8LA 3CPLB 5BVJB 1EFXA 2KZ1B 3F7VA 2WIIB 5IVZB 3IS0X 3D3VB 3F58H 4L8BA 3FN9A 4PJEB 2X4SB 2L4OA 5J9PA 2WUBL 5EFIA 1FYTD 1FNEB 1QNZL 4AG4H 2HRLA 4KKNA 4HG4K 1XZ0A 5FM8A 5T1LB 4BH7A 4D9RD 1Y6NR 1TNNA 3NFPA 1Z2KA 2EDOA 4JG0H 1NC4A 5JORA 3U30B 2OMNA 1KIRB 2R56L 1DLHB 1BIIA 3IXTB 3QDJA 4HWZA 2EKSA 2F19H 1F4XL 2DQCL 3P4OB 4ZSOE 4LSQL 4EDXA 5LXGL 4WV1C 1PLGH 1G7IB 2XTLA 4MNHA 3L5WB 2PW1A 1EAPA 2WINB 2YN5A 2DQJL 2BRRH 5ENWB 4RX4D 2DMKA 4UAOB 3SJVD 2Q7YB 5EUOF 5LWYH 5GJSL 1TENA 2VLRE 1WEJH 4JR9H 1HIML 4KJQC 4H5SB 4M1GH 3S6CA 2FDBP 2FBJH 3ULUH 5CBEB 5HY9B 3ULVF 2Q6WB 1A8JH 4LMQI 4KI5D 1PG7W 4J12A 3MV8D 1NCBL 4Z7UE 1J1XH 3FQUA 5FGRA 5JLZB 4P5KB 1WCQA 2VYRE 2GFBA 5HHMB 1R5VB 4U33A 5B38A 2HFFB 3O9WB 3MFFA 3PQYB 1CLOH 2J12B 3VXQB 5DRXA 3U48A 4UT6H 2UWEA 4KKAC 4KDVA 1G7HB 1XCQA 1OY3B 2W1NA 4OIIH 2YS4A 4MXWL 2NY2C 1FVCB 2DKSA 1N6QL 3DVGA 43CAB 3MBXL 1CXEA 4HXAL 3WDIA 4HUMB 1A2YA 2E8YA 3NCJH 4LAQL 2ADFH 3MJ9H 1A6ZB 4HWEL 1IILE 3GJEB 4P5TA 1A14L 2F53E 1EO8L 1CVRA 3TH4T 3TO4D 5JDSB 4K8RC 1GPOH 2XPGA 3MCG1 1L7TL 1PG7L 2E6QA 4S2SA 4ELME 3JTTB 2VAAA 3N50A 1U2HA 4P5TC 3SGJC 1WFUA 4X6EA 1U6AH 3JBG7 3GJFA 5A1AA 1S78D 25C8L 4MXVF 2HT2D 3QQ3B 4GRLB 4NKDB 3FZUD 5F1OB 3BKJH 4KHXH 4M6NL 4NQDD 1QEWA 4JHZA 4P9ML 1P2CA 5CEZH 4IHOA 1NFIB 1QBBA 3QUZA 4MB3A 3SGDI 3QH3A 5C0CB 3BIBX 4U1JB 3JSSA 2IH3A 3S34L 2X70A 1MY5A 3N06B 4M7KL 3SOBL 3MTRA 4RMVA 2VQ1A 1P6AB 1PG7X 3ZKSD 1D3CA 2JLLA 3U6RB 3U7YL 4FP8L 4C59B 4JM2D 3DURB 3QXUA 1U8KB 3PV6A 3RGVD 4CGTA 2OR9H 4P46B 2BX5A 2IFFL 2EXYD 1E27B 2C4FU 4DN3H 1VESA 2H41A 1WWBX 2HFGL 3DMMC 4JPKH 5C0FA 1OP3K 2E6JA 5I18L 3DYMA 3RPIA 3C60B 3GKWL 4YHIA 3WXWL 3RKDC 5FOBB 4YHPA 1UJ3B 1X4YA 4M62H 4OQTH 1EFQA 4ONFL 2BOCB 4OD3L 4KUZH 5CAYB 5HGGS 5IB3B 3GSVA 3P9MB 4U1LB 5FCUH 3ARGC 5EOCL 2D3VA 4GJTB 3VXNA 3GMQB 1I9IL 1U8IA 4WWKB 1JGDB 4H1LA 3RU8H 4LIQE 1XEDA 3OWEA 1JZ7A 4WW2B 4UT9H 1NSNH 1OGAD 2WBKA 2KBGA 2AJXL 1XGRA 3EO9L 4LDOB 3QZWA 1WGOA 1RIUL 3AREC 1ERNA 5J4MA 4BQ6A 4LLMA 1DDHB 3VXSE 3DUUA 1RUML 5EZIL 4PBXA 4OTXL 5L2KB 4OAWA 4PIRF 1IC7L 5K9KA 1PEWA 5L6YH 5C0AE 3FQNA 4MHHG 4OUUB 5IBUG 5IVXF 1OB1B 4CADA 1NCNA 4G6MH 1LDPL 2D7TH 1KXQE 2AXJA 3L3OB 1NGWB 1KJ2A 2AEIT 4IMLA 4DAGH 3MRQA 4JQIH 4HWUA 4NN7C 3PXJA 3LS4H 4L4JA 4KRPB 2GW5A 1V7ML 4L4VA 7CGTA 1EEYA 3QAZB 2F74B 4RMSA 2AJUH 2AGJL 5EBMB 4KTEL 1YC8A 4Y7MA 4HXBL 3EDKA 2F8XC 1JRHH 4MVBC 3RA7H 1P4IH 3ARQA 3GMMA 3QWRD 4YGVA 5SX4H 1BOYA 3CFDB 2FH6A 2BNRE 5DQ9B 2PO6B 4EBQH 2P5ED 2E3VA 5E2TL 1JNHB 1A1MB 2O61B 3H7BB 2BJMH 4X7TA 4EXKA 3HUJE 4LLVA 3RUGE 5I0DA 5BJTA 4H25A 3S35H 4YAQA 1F4YL 3ARFA 4L9DA 5FYJH 4JY6A 1NGYB 5IGXL 5I1AB 5BO1L 1MFCH 2ZCKL 3BZEA 4AYFA 4L3ED 3GBNH 3FQRB 2KDGA 4JO4L 1GCFA 1J10A 1U3HB 4A6YB 1BIHA 1CK0L 1IAIL 4X5LA 3IGAA 1OTUC 2ICES 3ARFC 4XXCC 3LEXB 4UUJB 1KIPB 2H45A 1A5FH 4MYWB 2F54B 5D4QA 4D94A 1MNUH 3K8LA 4LHQB 1FFPA 3TCXA 3AM8A 3OSKA 1N3NA 1JI1A 4X5XA 5C0GA 5C6TH 5IEHB 3MLRH 4TULH 1MCEA 3X3GL 2Z31B 1MCWM 1N59A 3MJ7B 3UDWA 4LEOB 3NH7L 2K7PA 4NNPH 4POZC 1YQ2A 1FO0A 4MDJB 2VE6B 5ALBH 3VFPA 2NW2A 3BGFB 4HW6A 4DGYH 3Q6FB 2NPLX 4RAVB 3TVMD 3KPPB 1KJMB 4PLJC 4X83A 2H6PA 1FPTH 2N7AA 1U3ZA 3DO3A 4PRNB 5FHAL 2QQKH 3A0OA 4P2OB 4X6FB 1MCLA 4C56D 4UINL 4ZPVB 2A1WH 3B3IB 1GVIA 3S36L 3DVNB 5L7XL 3NA4A 35C8H 3UTZA 3RZCD 1F3DH 1HH6B 2VH5H 1DBMH 3WLWD 1PX3A 5J6GA 1LO5B 2K1MA 2NYYC 5MI0B 2I9TA 3IS1X 5FYJD 4I5BB 2Y4SA 3GSWB 2EEDA 1RZ8B 5BZWB 5GSVA 5ETUA 2X4QA 4NDMB 2FZ3A 5B3NA 1P5UA 3OJMB 1KN4H 4X9BA 1J8HE 4TSAH 3KPNA 4OF8A 1CDIA 3T04D 5IWLA 1RZJL 1T22A 4YNYA 5T33L 5D1XD 5E1AA 1ZHKA 2MHAB 4QRTA 1FVEB 5E95B 5IT2L 4NBYB 2ESVA 3DYPA 3OJ2C 3OAZH 4JFYA 5EOTA 1U8QB 5GISL 3LEVH 1UXWA 1DL7L 5CBAB 2J8UB 2FEDC 5IWLC 4PRPD 1YNLH 3L3IB 4RGND 1JWUB 4PRIA 3PNWA 4AMKH 2VXQL 3ARBA 5DR5H 4F7PB 3HC0A 1RMFH 4S10A 3H3BC 3UX9B 1H15A 3BVNB 3RWFB 4OM0H 5EUOB 9CGTA 3MLZL 1I4FB 3IDGB 5HGHA 5LCVL 3QNYB 1F4WH 4X4ME 3ARBC 4I0PC 1C08B 2FGWL 4TPRH 4JPWL 2GKIA 5GRJL 1ZHBA 4NZTL 4OI7A 2XZAL 2FWOB 1JPGB 1TZIA 3KS0J 2YK1L 3HE7B 3TNNB 1QSFE 1T0PB 5J13B 5C3TA 1ZOXA 1RURH 1R5WA 1MFEL 4P3CH 4M48H 3AS0A 3ILPA 2ILLA 5KZCD 4G6KL 5H94A 3BUTA 4ZPTA 2EH8H 5DD1H 2VXVL 1JWSB 1IGFL 1NAML 2FHFA 5D1ZD 4P5MB 3AS3A 1GOGA 1CBVL 5DGRA 3T2PA 1BF8A 3E2HB 2UVFA 3G6JB 4S0TD 5IP4A 1U8HB 2ICEA 3MCLL 3ZDXE 4G8FA 3Q3GA 5DJ2B 5DT1L 2BVTA 2CJUL 4N8CL 1DR9A 5F9AC 1OTSD 1MI5D 2WBJB 3QPXL 4QKXB 3QNXA 3N1PC 4D0CB 1KBGL 4HX1A 4WHTA 1RULH 3P11H 1TCMA 2D31B 4KMTL 1INQA 3UTPE 3ZHDA 1S7TB 2EYRA 3BZDA 3K74B 5GS1C 3KPOA 4OCYH 1C5BH 5I30L 3VXTB 4GS7C 1MHPH 1D6VL 1RVFH 5E03A 1LHZA 1CL7L 3HAEA 4GKNB 4FMFA 3KYMA 5C0DA 4QHUB 3HI5H 1IZKA 2QQLH 1JHTB 5GGQL 4HIEB 1AQDA 2HP4A 5IEKA 2Y5TA 1AXTL 4I3GA 5KG9A 2IMMA 2BXZA 4JPVL 1NJ9B 4PJ8A 1YMMD 1RUKH 3LAFA 1H0DA 4FFVC 5HYJA 3UZEA 4RFOL 3PWJB 1XGYH 4CW1B 5F9WB 4HUXB 2XTJE 3HG1B 1UB6A 2ORBH 3VFSB 1A6WL 4HUVA 4PJ8C 5KVDH 1AI1L 3HMWH 5T3XE 3QUXB 4LGSB 1GZQA 2XKNA 3G08A 3ARUA 3TIEA 3L5HA 4HMEA 5MP6H 3OGCB 3ZE0F 3HE6B 1N7MH 3MLVH 3O9WD 4FG6C 3PQYD 3LIZH 4RGMC 4ZS6D 1KENL 4G8EB 3BD3A 3MROA 4JFED 8FABA 1XF5A 4PS4L 5JHLL 2UWEE 1YQVL 1TMCB 2JELH 4H26A 3DJ9A 1QKZH 3NA9H 3JTSA 4QOKB 2BOBB 3X3FL 1KIQB 3G6DH 4OKVB 4RWYL 1ZVHA 5DDHA 1IT9L 1AC0A 1ZS8B 1VFBA 3QIBB 1XF1A 5ADPH 5IHBA 2DQEL 4K94C 5F6IB 4FXKA 3RWJB 3V0VA 2AEWA 2NY5H 5FK9B 1JGLH 2W9LA 2LFGA 1CLYL 5EULV 43C9B 1C1EH 4AEHL 1MCQA 3TBVB 4KHTL 4G6FB 5L0QB 4HS6B 4RAUA 4RFNC 4NBXB 5HVWA 2G5RA 1FNGB 3BP4B 3MQIA 4W6WB 3QDMA 4XP9L 2OR7A 3GMOB 2UUDH 1S8DA 1CDUA 2GI7A 4LRNH 4U6VH 3TBSB 1IBGL 2AJZA 1KNOA 3PWNA 4QF1B 4UQ2A 2WIMA 4OCXL 2B5IC 1HSBB 1Q0XH 1VGEL 2R56H 3BH8B 4K07A 4ODWA 5IVXB 3D6GA 1IC5H 3CD4A 4WRLA 4X6BA 4OD2A 2RGSA 3D9AL 4M6OH 3WYRA 3I3DA 5IHUL 5E6IA 4O5LH 4XPGL 4YHMH 4RZCA 4YQXH 2AXHA 3PWVB 2I9LB 2P8PA 3GSXA 2DDQH 3DUSB 3OZ9L 3UPAA 1CFVH 1U0QA 1QVOA 4AZ8A 5E94B 5E6IC 4LVHC 3T2NL 3KNBB 1DEEA 3TESA 1TQBB 3RWGA 4HH9B 1HIMH 2I5YH 1OD9A 5L88L 2VJXA 5E70A 1ZK9A 5CHNB 5KAQF 3MRMA 5I1LA 2MQCA 3A6CH 2B4CL 3MLYL 1TJHH 5K9QI 3V0AC 1T2JA 4MD0A 2V7HB 5D7SH 3SY0A 5FO8B 2Y1VA 4PLNC 1YY9C 1IGML 1JZ4A 1FGVL 4O51B 1BVKA 4ZO6A 5J89A 3REVA 1W0WA 3QUMB 1NC2B 4Z7OE 2Y72A 2HN7A 1NAMB 5C9JB 5HYSA 5D7LB 2QKIB 1D6EB 2EE9A 5J12B 4JPIA 3EYSH 2BNQA 1IM9B 2ITDA 1NCAH 1T1YB 3MUY1 1F2QA 2EDBA 1N6QH 4QRQB 3MBXH 1ZWIA 4D9LL 4HXAH 3HPJB 1YNTA 1U8OB 5TDOB 4P2QB 1FL6B 5HTSA 5T3ZL 5DSCB 4HMDA 4ETQB 4KVNL 5MERA 3ARZA 2H2PC 2XV6B 4YK4B 5L2KD 3ROOB 2AQ1A 5GGRA 1BD2E 1OAYL 4PGBB 3GMRB 4KJWD 4CMMA 4PB0L 3EYVA 3LRSB 4NKMA 3K0WA 25C8H 1H5BA 1IRAY 3QRGL 4K9EC 4HEME 4FQ2H 3ULSA 3GSQB 3MRLB 5I74B 4WHDA 5BS0B 4PJDF 1LNUA 4MA1B 3FT4A 4JE4B 4JZNA 1JYVA 2Z92B 5JZ7C 1XF4B 5F8RC 3SJVA 5FO9A 3EYFB 3RVVD 3UC0L 5IB1A 4MXQD 3GSNB 5JR1L 2VIRB 1O7VA 4MD4A 3P30H 4D9QE 1ES0A 5I75B 3NZ8A 3U0PA 4YBQC 4JFFE 2L7UA 5DC0A 4M8QA 3OKLA 5E8EA 2XWTB 4U1HA 1MCOL 1QR4A 1YEGL 1R3LA 1M7DB 3PHQB 5DJXB 5ISZA 2OSLB 4XBPB 1H8NA 4KK9D 3M8OL 2GITB 4RBPH 4KI5C 2Y5EA 2JIXD 1INDL 5HGBA 1T1XA 1RJYB 4JHWL 1UXSA 2NX5B 3MJGX 4F2MA 4MDIB 2IANB 3PWPB 2HFGH 3RDTB 3O0RL 1A4KA 5ICZB 4R97C 4PV8A 4PJXA 4MA8L 2FJGA 1BGXL 3F6IA 2A9MH 1RUQH 3OX8A 4V2BA 2A9NL 1OPGL 1U3HD 3SO3C 4LPXA 2OQJB 4OD3H 5ANMB 3STLB 3BDYH 1SY6L 2RR3A 1UWGL 3TO4A 3MLSL 5EOCH 3CVHA 3MRBA 3HZKA 4YR6B 2PXYB 3TH2T 5BXFB 5EZOH 4QYOB 3DROA 5DZOA 4QRPA 1XGQA 5DUBA 2R0ZH 2BSTB 3TFKD 4FMKA 3TO4C 3QIWB 4XVJL 3BEWA 3DV4B 3ZTJG 3VH8B 3DYOA 3WNMA 3C2SA 4GQPH 4I2XB 5EZIH 4CAGA 1S78C 4X7SH 1U95A 2HT2C 3VWKB 4HKXB 3BP7A 2F8VA 1AQKL 4LKXA 3ULVH 3FZUC 4PJGE 2R23B 1E4XH 4P2OD 3VMNA 4ZTOL 2JCCF 4UDTA 3AY4A 4Z7UF 4UOJA 1J0ZA 2DL2A 3OR6B 2ATKB 3F7PC 4Q74A 4M7ZC 3F12A 3S35X 4NO2A 5DA4A 4AEIH 3ULUC 1L9MA 5F96H 1PSKL 3WIFA 3V5HA 2IBBA 1PJ9A 5IR1A 1UZ8A 2PYEB 1A6PA 5D72H 3RGVA 15C8L 5DURB 3C2AH 1DN0B 3FRPG 5F9OL 5FA4A 3VG9C 1MCJA 4JM2C 2BY2A 3X14B 1GAFH 4I0CC 4NWUH 5DUPH 5IMKB 3RGVC 3ESVF 3IETB 2OBGA 2AKRA 1KYOJ 4OB5L 2EXYC 3T77A 3EO1A 3P0VL 4W70A 1BLNB 2VDQL 2FSEA 1UFUA 4ELMF 1E6OL 4U1NA 3OAYK 4OLZL 3PDDA 4LCUB 1MREH 1ONQB 2ESVE 1IAKB 5B8CA 2BHUA 3BZ4B 1L0YA 4C57C 1I1FA 1P9MA 5DD6B 3A67L 3L6FB 5BO1H 3DPBA 1ITCA 3PDGA 1EO7A 3PHOB 3L3JA 4PRIE 4WUKL 1T83C 2NY1D 1IAIH 1XR9B 2X44D 1G0XA 1P9MC 1V05A 3FB7A 3MFGB 4BH8B 3IDIB 3NZHL 3AROA 2DQGH 1I8KA 4XH2A 4EUPA 2DS4A 4PJFE 5DJZB 3BZFA 2V2XA 3H2WA 4LCWD 3HE7D 3X3GH 5KSAB 3BUYB 4GRWE 3RHWK 2V5RA 3GHEL 4JRYE 4LPTA 2R0WH 3EOBB 4QRRD 1I3RB 4U7KA 4YHLH 1KCVH 3P9LB 2IQ9L 4LLAA 4R8WH 2B2XL 1A1NA 4V1DD 2XFXB 4HBCH 3DOSA 3O3AB 5CMAB 5CP7B 4YXKH 1D5MB 4NQEB 4AJ0A 3L3HB 4OZHE 2EDWA 2GSGA 5I8OH 2GAZA 3O6LL 5F9JB 5F6HI 5EZJB 4LSPH 1BBJB 4FZ8L 1ZGLP 4TNWF 1F00I 1NLDL 4Y2DD 1TZHB 3MRNB 1U42A 2EZ0C 1U3YA 1A7PH 2MOVA 5J1AB 3GUTA 1EGJH 4PRBA 1RZGB 4WI5A 3KWWB 5H37H 5DJYA 1S7SA 1G9EA 1ZLVK 4Q9QL 3K3QA 4U7SA 2GJ6D 3MLXH 4L4TB 4J3VA 1TQCC 4OCWH 4M1DH 3H7LA 3PGDB 1XCTA 4XVTH 2VLLA 4GT7A 4WCYH 3MGOA 3PV7A 4M7LH 3T0DA 4KC3B 5DMIL 1JGEA 1OAZL 4L3EA 1ZTXH 4RCAA 3PGCB 4POYA 4O2CA 2OTPA 4WFEE 1JGUL 1RZJH 2AP2A 1VSCA 4Z78A 2Z8WC 4JDVB 4WNQA 5T33H 3E3QC 5I6XC 3SDXA 3DI3B 4ZYKA 5LVEA 1CG9B 2AXGB 3RL1A 3IDMA 1ZEAL 4GXUN 4RQQA 3B9AA 4BA8A 4KQ4H 2Q86B 5DRNB 2V2WB 3B4NA 5AYUL 2VXQH 3BISA 4K3JL 4NRXA 1RD6A 5I8EA 3S96B 5EDXA 1FH5H 5IW1A 1P4BL 3U9UB 4UNUA 1FAKT 2GT9B 4Z0XB 4HS3A 2DQUH 4JFQB 3ZTNL 3OXRA 4NQUA 1CXKA 4NQCD 4X8JA 5LCVH 4CDHA 1T1ZB 3U82B 1H8SA 4J1UB 2FGWH 4PR5B 2P42B 4M4PA 1I85A 1MRFL 1OAQL 2XZAH 4P4KB 3TVMA 3G04A 2OL3A 2X7LA 2QSCL 1PZUB 1UVQA 1NDMA 2M26A 4G6AD 1MF2H 4JDTL 2VLJB 1M05B 5EIVA 3JWNC 5ILTL 1MFEH 2J6EA 4JRXE 3O8XD 1I85C 3GEWB 3FONA 3NPSB 3TVMC 3N9GL 2F15A 1F3RB 1YDPB 3FCTA 5C0EA 3QUMH 1MFNA 3QEHA 2XQYK 3RBGA 5C08B 3W0WB 1IGFH 1NAMH 1Y18A 4U6YA 4Y19D 1TLKA 4PD4J 3HUJF 5C09B 3RUGF 1PZ5B 1XH3B 1P7KB 5HGAA 1BAFH 4Y5VA 2LABA 3OQ3B 3MACL 2CJUH 2EDFA 1IEBB 3NCYP 3RZCC 3RJQB 2YD3A 3WLWC 1K2DA 2HA1A 1KBGH 1MHCA 1FL5B 4FN0A 3QEGL 1JK8B 4KMTH 4M00A 4P99A 3PP3K 4AT6B 5FAAA 5I30H 4Q58C 2PCPB 3U0WH 3UEZA 4TUKL 4LSDA 1D6VH 4Q0XH 5DJ0A 3D5OF 4YGAB 5HHXL 4ZMAT 3TH3T 4RRPG 4F7EB 2BMKA 3EJJX 4U3XA 3HTLX 3VFTA 5D1XA 5EU7E 4J6RL 3DO7A 2V17H 5GGTA 5CS7A 1CFTA 3EFDL 2VB5A 1BQHB 3OKEB 4R4FL 2R2HB 2CK2A 3TYFB 3MV9E 3WFHA 4PRPA 2JB5L 2AK1L 2DTSA 3BSZL 3VGFA 4X4YB 5D1XC 3CK0L 5F97E 1SYSB 2ZJSL 2A6IA 2PETA 3QA3A 2CIIA 1LE9A 3HFMH 3RAJL 4DZBB 1I7UB 3C08L 2VL5A 2IGFH 2NW3A 5DQJA 1J0KA 3BKML 3W81A 1MJ8L 4G80B 4YDLC 4RGNC 1QG3A 3FOLA 1N5YL 1AI1H 3GSNH 5CZVL 3SKNA 4L8CA 1RJLB 5IJVA 2ZUQB 2X4NB 2ZUSA 4PGDA 4LDEB 1KSRA 4YHKL 3VXMD 4AH2B 5EU4A 4CRPA 5I1GL 2B7DT 1HOCA 5JW4N 5KTEH 3SDCB 5E08L 2Y7QA 1KENH 3S9DB 1JNJA 5DFTA 4NNXA 5JHLH 1NAKH 1FP5A 1YQVH 5D7LD 2ICWB 2NNAA 3BQUB 1PY4A 2HLAB 4IDLA 5FKAA 5D1ZA 2BNQE 4N0YL 5FA3B 1M6OA 1IT9H 4A2LA 4LIQL 4M5ZL 4EIZC 2EEBA 4QTIH 1A1OB 5ELIA 4MA3B 5CKGA 2PF6A 5FF6A 1Y0LB 1QA9A 5D1ZC 1QOKA 5BRZE 4WTZA 3WUWB 5IESL 4D0DA 2AV7B 4AM0A 1MI5A 1JMZA 3AMKA 3DGGB 1CLYH 2BXYA 3SKOA 3QQ4B 4QWWD 2IG2L 4HPYH 2OJEA 3UTTB 4F3FB 1U8MB 3CXDH 3LSOB 5KS9A 5EU6B 4IM8A 3X13A 3G5YA 3BE1L 5DVMA 4MQ7A 4DUVA 1KPVB 1OOAA 4BQ9A 3MV7E 1RIVH 1IBGH 1WZ1L 2BVOA 2W9EH 4YBHA 4HJGA 2EDYA 2ADJB 4GW4B 4XB7A 5GRUL 5J1TC 5BS0D 3LN4B 4OCXH 3GSUB 1BJ8A 2VLRB 2X6MA 1YMMA 2P5WA 5AUMA 1CCZA 2R1YA 4Y4HD 3QCVH 2R69L 2GYSA 5KSBB 1OM3H 5I15L 4IEFB 3UROR 2E9BA 3MMEA 3PIQA 1QRND 5IHUH 5F3HB 5JA9A 4CL7A 2JCCB 3U9PL 3KJ4B 4XPGH 5FHBH 1ULVA 2VITB 4BELD 4WEMB 1GGIL 4Y89A 2CD0A 3S4SB 3EZJB 4Y4FB 1A7OH 4BK4A 3OZ9H 1SMAA 3LKRB 3MBEB 2HG5A 4PJIE 3D2UB 1A22B 4YFLF 3HI1A 3Q5TA 2F58L 5ISZE 1BZ9A 1F8TH 4JHAL 3T2NH 3ES6B 5I17A 2AEQL 1NLBL 3IB4A 5SV4A 4FHBD 4P2RB 5JA8B 4JFEA 5B39A 4HUWB 2X2YA 2UY6A 5C07A 3KYNA 5L88H 2AK4B 5GGVH 3WV0A 2XWJB 1SBSH 3JV6A 4FTVB 3O9WC 4FOMA 3ZDXF 3O3EA 4NIKB 3MLYH 4ZS6C 4ZO9A 4YPJA 5E99H 3HHRB 4MJIA 1MJ7H 2CIKB 3CAFA 1W72L 3CZFA 1ZE3C 4HPOL 3GMLB 2PYFB 3H0TB 1OVZA 4U31A 2XA8H 2RFXB 4FQCH 3ARDD 2JK5B 4ELMB 4L3CB 2VZUA 5A2JH 4JZOB 5CP3H 2LE9A 5D6DA 1I1AB 3EDDA 3W82A 3BW9A 2NY6D 4Z7WE 3O6MH 4QRPE 4GG6A 1PDKA 3GBML 1T0NA 2NLJB 5DMKA 3BAEL 4QY8A 4LLWA 2UZIL 4P48A 4GAYB 5FM5O 1U58B 1B2WL 4RGOL 3VFMB 2BSRA 3V6FA 4LCYB 4U1MB 3B6SB 3UAJD 4PLOB 4X6DB 4MA7L 1BOGB 1ACZA 5SWSA 1LWRA 3B8SA 5FCSH 3IFNH 1MVUA 4H8WL 4LLUB 4R3SA 1IC4L 4BSWB 4X7EC 3BGMB 3HMXL 1P4LB 2V5YA 3AB0B 1QPXA 3MREB 4F8QA 1NMAH 5EH1A 4UIMB 2X09A 3VI4E 3QSKB 4FQIL 2UWEF 1IJ9A 4NNYA 1WIPA 3CDYA 3LKQA 3UC0H 2Q1EA 5DJCA 4NKQB 4KMLB 1CFQB 3FB6B 4UTAH 1RHFA 2CSPA 4ZUUB 3FQTA 4XNUH 1IEAA 4Z77B 3QISA 3MODH 2XRAL 2EDDA 4APQA 3L7FB 1MCOH 1KTLA 3KPMB 3G9VA 5IUSA 4P46C 1DE4A 2J3SA 2Z4QB 1A21A 4IS6B 1O7SA 1HCVA 3BKCL 5JPMB 2R4RH