4M8QB

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
b'EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GEP1 Fv heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
total genus 21
structure length 106
sequence length 106
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m8qB00
2P5WE 4Y1AE 5EFIA 3SOBL 3SOBH 1FZOB 1WWWX 2ITCA 3P40A 4S1RH 4S1RL 3LB6C 1YN6B 2WBWB 1V3JA 1LILA 3HI6L 2OTPA 3HI6H 4FFWD 3QNZB 1AHWC 1V5JA 2V7HA 2C4XA 1M05B 2I27N 2ESVE 1W0WB 3TO4C 5IB5A 1QRND 4QEGA 5FB8B 2VE6A 3MLRL 3MLRH 4ISVA 1IC5H 1IC5L 4JGJA 4LVOB 1TENA 3OAZH 1XF2A 4GRMA 3BN3B 3BGFC 4JDVB 5LVEA 5DR5H 5DR5L 2WQRA 2C9AA 3JZ7A 4YPGA 3VXOA 4UILL 2NW2B 4UILH 2MNUA 3EOTH 3EOTL 3VFNA 4APQD 5HI4C 3D0LA 1WBZB 5DHVA 3G5YB 4YO0B 4PY8J 1J5OL 1J5OH 3MV7D 1WBYB 4KXZH 2YC1B 5HHPA 1NBZB 3U36B 4LHQB 2R0WH 1AQKL 1ND0A 1AQKH 2R0WL 1JWMA 3QXVA 4RGMC 1HIML 1HIMH 3S98A 4PP1C 4HKZB 1QSVA 5T1KB 3EYOA 3PL6C 5FO7A 3RQ3A 3T3MF 4Z78A 4FFVD 5ETUA 3VD3A 4L4VE 4J4PA 4MLSA 2H2SC 3SGDH 4FMKA 1U93A 3TZVB 4X7SH 4X7SL 2GJ6E 5A2IH 2VAJA 1KTLB 5A2LH 5E8DH 5E8DL 1KLUA 5EUKA 1CXKA 1IGYA 1J18A 3GIVB 1JYXA 2Z31C 4Y1AD 4WVRA 4LSRL 1U3HD 4LSRH 3O11B 4NZDA 3HCVA 3IFOB 4Y4KC 5GSVB 3KNBA 5I9QB 2IC2A 4NHCH 4NHCL 3KYMB 5GGVH 4PP2A 1F4AA 5GGVL 4D9RE 3Q5OA 4J3XA 5DD3H 5DD3L 3MODL 3MODH 3BD3A 3ZE0E 4BKLA 4KMLB 3QJHA 5JLZB 2J4WH 2J4WL 4OZGB 2NY3B 1OP3H 1WCBB 3WHE1 3QO0A 3RDTD 4BUHA 2VSCA 4HWNA 1WZLA 3RZCD 3OG6B 3VXRE 4HWEL 3K1DA 3VFMB 4HWEH 4P49A 2R2HB 5JIHA 4TSAH 4TSAL 5B4MC 2OQJA 1TZIA 2BSTA 4J3SA 3S36X 4AIOA 4Z7UA 2DF3A 3MZGB 4NUJA 4JPIB 4X9FA 1M7IB 2VDKH 2VDKL 2E7CA 3CZFB 3E3QC 3CVHL 3CVHH 4I0PD 3TM6A 1KLGB 3L3JA 1NBVH 1NBVL 3O11A 4Q97A 1JI2A 3N85L 3N85H 3TZVC 4J3VA 3VI4E 4C58B 1QHOA 4Q58C 1GOFA 5INCA 4XZUA 5I1HH 3FQWA 1JGEA 1JV5A 5I1HL 3KPRE 1Q1JL 1Q1JH 1XAUA 3LMJH 1V8HA 1WWCA 3LMJL 5HPMA 5DC9B 4KK5D 5GGSY 5JW5B 3QNXB 3SDXF 2VXTH 2VXTL 3UTQA 4PJFE 5A40E 3JUZA 4TPRH 3DV4B 4TPRL 4X9GA 4OF8A 3U1SH 3U1SL 4LAJH 4R3SB 3K81A 4QTHA 5C0CE 2C3VA 4CW1A 2YPVH 2YPVL 3RZWA 4N1CA 1G7MB 2X4QB 4MQXD 1R3HB 4PJHF 2C26A 1CXEA 5TGBB 3W5MA 4XC1H 4XC1L 1KJMA 3RPKA 1JPTL 1JPTH 3VD7A 3RP1A 1IM3B 1KLUB 3TT3L 3TT3H 2QL1A 1WVZA 5C0GA 4HK0A 1AI1L 1AI1H 4GBXD 4Y19A 4K9EC 3V4UL 3V4UH 3SDCA 3LN4B 5DEFA 5TH2A 3SDDD 2PXYB 2FJGA 2ORBL 2ORBH 4NQCE 5M7QA 4PGZA 4U1KB 3ULVD 1C1EL 1C1EH 4IEFB 1IC4H 1IC4L 1Y18B 3MRBA 4G6JL 4G6JH 3FRPG 4MS8D 4Q6IA 3PDDA 4QT5A 5FUZH 5FUZL 4XVUD 3MFFB 4K7PX 4IMKC 4H25B 4X6CF 1MCOH 1MCOL 5C0BA 1A1NB 4U6YA 3P4NB 1B0GA 1LEKA 5E8EB 3VXRA 4K55A 4L4TE 2P24B 2P7TB 5EU5B 1CE6A 3KVQA 4CJ1A 4L29B 5D7LA 4X6CE 1NBYB 3PP3K 1DUYB 1FYTB 5HXMA 5HHNB 1A4JA 2YK1L 2YK1H 5IM7A 3V6FB 4RA3A 1HI6A 4LVNC 2P8MB 5DI8B 4F7MB 4YFDB 2YRLA 1INQB 2PTVA 4HF5H 4HF5L 4UU9A 4KVCH 2FJHA 1JNNH 1JNNL 4KVCL 4X7DC 4EUPB 3OF6A 4OD2A 1CXIA 2QADC 1CICB 1AO7D 4CADB 1HDMA 3RNQB 4JFHE 3T4YA 3LKRB 4YDLC 1DQLH 1DQLL 1IZKA 4H1LB 4BQCA 4BSWB 2YD4A 5D1QB 1BVLB 2HRPL 2HRPH 1YJDH 1YJDL 1AD9A 2Z93B 3C5ZD 3KHQA 4QXWA 1LP9F 3H2WA 3P4MA 2VDRL 2VDRH 4KH2A 1MHHA 1BIIA 3EGSB 1FRGH 1FRGL 1HHKA 4JFOA 3AY4C 1E27B 4CU7A 3CSPA 3WNKA 3GB7B 4S0TD 4M03A 1RUQH 1RUQL 4JANA 4OIBA 3NCJH 3NCJL 4OCWL 4OCWH 4RCAA 4R6UA 3T0AA 3GMQB 2XY2A 3EKCA 5HD8C 5HVWA 3WYRA 3TIDB 2EO1A 3BXNA 1F11A 4J6RH 4J6RL 5FA4B 5DTFB 4JDZA 4E41D 4PRIB 1X3DA 4NNYB 5DJCB 1T66D 2XOTA 4PJXB 4XB8A 1RZJL 1RZJH 4E0RA 2JLLA 1TCRB 2Z92B 3FO9A 2LTQC 1SJEA 2B39A 5KS9B 3ME0A 1U8IA 2X4OB 2ADIA 3S5LB 2HMIC 1ZLWK 3OJ2C 5GZNC 4YIQA 1OHQA 3VGAB 9CGTA 4F7EA 5F44A 5IHBA 4BA8A 2NY5C 2EIEA 4D0DB 5DMKA 1YPZE 4TYUA 2Q3AA 3K8LA 2DQHH 2DQHL 1QO3A 5BS0D 2VSDA 2CDEB 1T7ZA 4PJ5A 2X6MA 5JOPD 4AENB 1UJTA 5HDLA 3U48A 4HS3A 1J0IA 3ROOA 2A9NH 2A9NL 3DX8B 2ED8A 2DM7A 1S9XA 3KPNB 4UB0L 4UB0H 3BN9C 2NY7H 2NY7L 4S11A 2N7BA 2VLJB 1B6UA 1K8IB 2WBJC 1RK0A 4WEBH 4WEBL 5GS2D 1MOEA 3T4YB 4IRJD 1JIBA 1QBBA 4JVUA 2B2XH 2B2XL 4JM2B 3I6KB 5H94B 5FM8A 4MDIB 5GGQH 5GGQL 1I7ZB 4X99B 1X44A 4JRXD 1E4JA 5CUSL 5CUSH 5C0IA 5T1LD 1UZ8B 4CKVX 4ETYA 4RGOH 3QHFH 3QHFL 4RGOL 2X4TB 1Q9LB 1YEFL 1YEFH 3K7UA 3MRNA 5H94A 2PYFB 5IJKA 1ZHNA 3QCVL 3QCVH 4U1NA 4WO4B 4D9QE 1YEIL 1YEIH 5TF1H 5TF1L 3SQOL 3SQOH 2RBLA 2CR3A 4Y4FD 3JV6A 3S35X 3OZ9L 3OZ9H 2MPAL 1BECA 2MPAH 1MVUA 1HHJA 2KUTA 3ABZA 4OZIA 3HC3L 3HC3H 3AFLA 3MROB 3GHBH 3GHBL 3T8XB 1FG9C 2KH2B 4PD4J 5C07A 2H26B 4PJAB 1NFDA 2E7LA 4BELD 1KCKA 1HCVA 3SKNB 3LSOB 2A73B 3DUUB 1DP0A 5H37H 4MJ5A 2QEJA 4H0GA 4MDJA 4M8VA 5FYKL 4LOUD 5FYKH 1JK8A 1B88A 1OP3K 1T03H 1T03L 1YECL 1YECH 1DVFA 3WD5H 3WD5L 5C0GB 1GZQB 4IRJB 4J2XA 3F58L 3F58H 4J3WA 4ORZC 4GAJH 4GAJL 3OGCA 1EFXB 2G2RB 1D7FA 5CP7B 1SJEB 1CFSA 5I73B 3H9SD 2DQCL 2DQCH 3FCTA 1OAQH 1OAQL 5I9QC 3EYUH 3EYUL 3O4LD 4NC1E 5EU6A 5CHNB 2IQAB 1YJDC 1LE5B 2OTUB 4R7DA 4JPWL 4JPWH 4X7TA 2KZ1B 1GH7A 5IUSA 2Y5TB 3STBA 4KJPD 3P9LB 3MBEC 3M45A 3TBYB 1H8NA 2QQQA 1I8KB 4M9PA 3SY0A 2UUDH 5F7HA 5F89A 3RJDA 3ARED 4HS3B 1ZVSA 3KWWA 2ZG2A 4QOKA 4XRCB 3KJ6L 3KJ6H 5GS3A 3UXFA 3BAEL 3BAEH 5JNYB 3WNLA 1QSEE 4OZIF 3MCKA 2YD2A 1F3JB 1F4WH 1F4WL 3FQRA 5EU5A 3KPQA 1V7ML 1LQSR 1V7MH 4F8TA 3OKDB 2HVJB 5C6PB 5JHDE 4GKNB 1OW0A 3RKDC 4JY4A 2E8ZA 1AGFA 4A6YA 1AXSB 4WEUD 1LEGA 1GAFL 1GAFH 4UBDD 1Q8MA 4P2QA 1EGJL 1EGJH 4P46B 1VFBA 3BP4A 2FJHB 4QYOB 2DLGA 4PS4L 4PS4H 2FL5A 1F3DJ 1BX2A 1KLFA 1FIEA 4DKAA 3SE3A 3P73B 1WAAF 3AROA 5C70A 1CQYA 3DRTB 1XGQB 5JOPE 5FXCH 4LLMB 3KPMB 3W9EA 3H6JA 3FO2A 1MI5A 3MLVL 3MLVH 3RU8H 4JFFA 3RU8L 3EDFA 2A9MH 2A9ML 3OJDA 1KPVB 4ZUUB 5FCUH 5FCUL 1BWMA 4NQCB 4LLDA 3T4AA 3RVWC 4CMHC 1XGPB 3VU2A 4U3XA 1ACYH 1ACYL 3QQ3B 2JK5A 5KTEL 5KTEH 5I66A 3BE1L 3BE1H 1CDYA 4RX4A 4O9HL 4O9HH 3ARZA 1JYWA 1QR1A 1AXTH 1AXTL 2QKIB 4HV8A 3N1FC 4LIQH 4LIQL 3FTGB 4XH2A 5SWZA 4PYGA 2YRZA 1U8HB 5CS7A 4CNIA 5DUBB 3RDTB 2Y72A 3WS6C 4X4XB 5EN2B 1MCKA 4I3RL 4I3RH 1P9MC 1TZIB 1TZGL 1TZGH 4JLRB 3WDJA 2LFGA 3U4EA 4UUJB 4U4BA 1NGPH 1NGPL 1U8HA 3LPFA 3P9WB 3GEWB 3DIFB 3L5IA 3AXLB 1RSFA 4CMHB 2XG5A 5D7LB 5IWLC 5FK9A 4IHOB 5CBAB 5F7UA 3PHQA 4PJ7F 3ARDA 3MRRB 2XTJE 4PJGA 2ARJB 2MCG1 5TE6L 5TE6H 1DZBA 1FDLL 1FDLH 2NXZC 3QIUD 5HY9A 1VPOH 1VPOL 3QPXH 3QPXL 5DDHA 3ZE1F 3FO1A 2VLKA 5IP4A 4N0CD 1S9KC 5FF6A 1WBXA 3JTTA 2J3SA 3BDBA 5DRNB 2F54A 1N3NA 5LWYH 3IDXH 3IDXL 5LWYL 5FM5O 5HYSA 4MD5B 4OUOA 4EIGB 3TBTA 4DVBB 3B9AA 5EIQA 5H2BB 3V6OA 3DV6A 3C5JA 4RIRA 1B4RA 3PGFH 3PGFL 1RJLA 1DUYA 1FYTA 1GGBH 1GGBL 2OLDA 4WFGD 2WK2A 3TBTB 2PO6C 3VXSE 1QOKA 2ADGA 2FEDD 2HFEA 4YC2B 4QGTA 4ZQKB 2XI9A 3IKKA 1A1NA 3RWIA 3DYPA 4JFFB 3VWKB 4JY4B 2WBKA 3E0GA 1LEGB 4JCMA 4QRRA 1A6PA 1KTDB 1QPXA 3K4AA 5HGAB 1YEEH 1YEEL 4LQFL 4LQFH 2W1NA 1AR1D 4YHOH 4YHOL 5B8CA 4Q6IB 2XN9E 4C54A 5I1DA 3RHWK 1XF4B 3BQUD 2EE9A 3JVGA 5E2TH 5E2TL 1XIWB 1FZKB 3E1F1 2HJKA 4F37K 5B8CB 1P5UA 1NCDL 1NCDH 2AQ2A 5BOPA 5CJ5A 5ILTL 5ILTH 1AHWA 1S5HB 5J3HD 4J1UB 5F1NB 1KPVA 3CJJA 4JO4L 4JO4H 4XXDB 1HEZA 1JVKA 1S8DA 2MKLC 5IMLB 4KJYA 4MNQD 1YY9D 2JIXD 1A1MB 4ISVB 3BGFB 2P48B 4HDIB 5C07E 3QA3B 1T7WA 2V2WB 1D9KB 1B90A 4Z7UF 3C60D 1JF1B 1RURH 1RURL 4MD4A 1I1AC 3M07A 4GS7C 4YGAB 3HTLX 4WFHE 3FQXA 3MV7E 1EO5A 5EBWB 4YFEA 2DICA 1EFXA 1WZ1H 1WZ1L 5GHWL 5GHWH 5K9KA 2Y36H 2Y36L 1FN4A 1K4CB 1EUUA 1OGAB 3GSQB 4U1HA 2ITCB 1FJ1B 3QUZD 4Z7OF 4XBGA 2E3VA 3GKZA 1F6LL 2IQAA 1HYSC 5E00B 2XIDA 1KT2A 3O3EB 4X4ME 4WI8A 4Z7WB 3KLAA 3L5JA 2IPKB 5F72S 2CLVA 3AREC 3BW9B 3MRRA 1BJMA 1EVTC 2ZNXA 4OBSA 4QOKD 1MCPL 1MCPH 2EEAA 3RIFK 4UOW1 2BNUB 4QOKB 1JZ5A 3VFPA 2VJXA 1PEWA 2BVEA 2Z4QA 5EBMA 2IBGA 3LKOA 4PV8B 1NGXA 5JQ6H 5JQ6L 2DTML 2DTMH 3V4PH 3V4PL 4Z7VF 2BOCA 2DYPA 4PRID 2FCBA 3WNMA 1YDPA 4GH7B 2F54E 2FR4A 2W38A 5FO7B 3MGOB 5IB2B 1T1WB 4ELME 4NWTL 4NWTH 1Q9WA 1BZQK 5E6IC 1NCBH 1NCBL 3B9DA 1JWSB 2PYEB 5KAQF 1SJXA 1XFPA 1G7JB 5J1AB 4L8BA 2WM0A 4KZDL 5E1AA 4KZDH 3EOBA 3UTTD 3N9GL 3N9GH 3RVTD 5B38G 3IS0X 4AH2B 5M95B 4JG0H 4JG0L 1HYRC 3IVKB 2HVKA 4DOHB 4HLZG 4TUOB 1HNFA 4U3CA 4B41A 3FB8A 5CLWA 5LJYH 3IDNA 3VG0L 3VG0H 4JN2A 3SBWA 4WTZG 4HHAA 1DQTA 5B39A 5HHOB 3MV11 4NRZB 4ZUTA 3W0WB 3CIQA 4GW1A 2BNRA 1I8LA 3SHSA 3IDIB 4FG6D 1XGTB 2IMNA 1HXYB 4D8PB 3VRIA 5DK2A 3QG6A 4NRZA 1PYWB 4H8WH 4H8WL 2XKNA 3PWNB 1BM3L 1BM3H 4LF3B 3L3HB 4E9LA 4RMUA 2BFVH 2BFVL 1JK8B 4TSBL 4TSBH 3BPCB 3MA9L 3MA9H 5GRXG 3E8UL 3E8UH 3VXSD 3BISA 3U83A 1KPUA 3NCCB 1FG2A 3VRLE 2NLJA 3SGKC 2NY6B 2Y9RT 1FAIH 1FAIL 2E7HA 4M93B 4NBXB 3VW3L 5FYLE 5IR1B 3QFJB 3VW3H 5M94B 1G1CA 3IDMA 4NQVA 3MRJB 1X5AA 3DRQA 2C4FT 3DJ9A 3IJHB 4G9FE 4W4NA 3W0WA 5I6XC 1MLCB 3B4NA 5IROA 2VERN 2EZ0C 3PWVB 4GW5B 1TETL 1TETH 4WDIB 4NN5C 3LRGA 2YA0A 3DGGA 4PGDA 4NJ9H 4NJ9L 4PFEA 1S7RB 5D4QA 3U4AA 5EOTA 2A73A 2OTWA 3UBXA 4H0HB 4MWFA 2AKRB 1CICC 4DEPB 3ULUH 3ULUL 3KXFA 1S9VB 1WWBX 1T83A 2FH8A 1T0NB 2I60L 2I60H 4QRRE 2W0FB 2NLJB 43CAA 3NFNB 1ZVYA 1NEZG 2FEDC 1S7VA 4OJFH 2W91A 2ZUQB 4OJFL 4C83A 1JPSL 1JPSH 5DFWH 2ZOKA 4BQBA 5FGBA 5E2JA 2YHGA 4NCC1 3VXNB 4NZTH 4I0KA 4NZTL 3ILPB 3MJ9H 3MJ9L 4DKFH 4DKFL 2ZNWA 5E9DD 4FRWA 5F7WC 2Q8BL 2Q8BH 3SE3C 5IVZB 3WUWA 2BSSB 2ZOKB 2D7TL 2D7TH 3DHJA 3HPLA 1YQ2A 3NA9L 2APFA 3NA9H 5J06A 5AYUL 5AYUH 4U33A 5DK0B 1MH5B 2GITA 1A5FL 1A5FH 1W0YT 3MRDB 4MNQA 5KSBE 1BQHA 1U8JB 5C0EB 5IW6A 5K9QI 3F8UB 3ZTJG 5GZOC 5LKNA 3FB6B 2WINB 2X1OA 4MLIA 3LKRA 4P23C 3KPRA 2CRIA 4H1LA 4LGPB 1M1SA 4V1DA 1QA9B 1Z5LA 4BH8A 5F1OB 2ERJC 4JAMB 4WGWB 4HH9A 2C3HA 1HKFA 4BFBD 3ZO0A 4G8IA 5DURB 4G6FB 4GKZA 2NY2C 2X1QA 1P7QD 1TQBB 4H8WC 1U8OB 4NFDA 1P84J 1HXYA 3DHMA 3HMWL 3HMWH 4UAOB 4PJFA 4LARH 4LARL 4LSVH 4LSVL 3MLXH 3MLXL 4UT6H 4UT6L 5JOFB 4OF6A 5C0JB 3WE6A 5K59E 1HQRA 2EEBA 3SGJA 2Q3ZA 5E2VH 5E2VL 5FHAL 5FHAH 1S7XB 3VXMA 4OCLC 4N0UE 2GY5A 4NGHL 4NGHH 5HHXL 5HHXH 1N8ZA 2VIRA 3GJFB 1OAZH 1OAZL 5IB4B 3OX8A 3WIFA 2GQHA 5C6WH 1KUMA 5T3ZL 5T3ZH 2OTWB 3UBXB 4HSQA 4DKDC 1MCRA 2OYPA 4G9FA 4OIAA 5DUPL 5DUPH 1A1MA 2NPLX 5SWSB 3C2AH 3C2AL 5FA4A 3WDHA 4JFFE 1N6UA 4YHYC 3ARGD 1PQZA 5DJYB 3RA7L 3RA7H 2YBRB 4GG8A 1RIVH 1RIVL 3QIUA 3SDCB 3HFML 3HFMH 4ZODA 4LFHD 5D2NA 2GT9B 1INEH 1INEL 1JZ6A 1I9IL 1I9IH 5BV7B 2X09A 1JN6B 4JREC 2GY7B 2Z93A 5J6GA 2BVPB 3G6JE 3JSSA 3B9EA 5BZWA 2QHRH 2QHRL 4X6FB 4J7RA 1AGEA 1TMCB 4UUJA 2VDLH 2VDLL 3VWKA 4I0PC 4QRSA 2Z0BA 1MCLA 4R2GB 5E56A 4ODUA 4F7MA 3OG4B 4PJ8C 5CINH 4QNPF 3K3QA 3B5GA 4U7KA 5CINL 5DRZB 1BFTA 3ZL4H 3ZL4L 4TNVF 3I9GH 2AXFA 3I9GL 1ZT7A 4B7IA 4XX1E 4RX4D 3T77A 3HS0B 2EXWC 3HE6C 4FXLA 2BY0A 2ENSA 2EDOA 4AEEA 3QDMA 5I1DB 1Z2KA 3D85D 4XMKH 4XMKL 1XCTA 4K94C 4QNPE 1KXQE 5HYSG 3PWPD 5DDHB 4JHBA 4M9OA 4DCQB 3MRQA 3WNNA 2FDBP 1OGTA 5I76A 3KPPA 3SDDA 4EXKA 15C8L 15C8H 1UKQA 4ZXBC 4FQPA 2FX8H 1N3NB 2FX8L 2WUBL 2WUBH 4X6BB 3LHPL 3LHPH 3LEYH 3LEYL 4NQCD 3RY5A 2FEEL 4YHLH 4YHLL 5JPNA 4YXKH 4YXKL 2PF6A 4WNQB 2CIIA 3GSVA 1P2CB 1EJ6A 3IFNL 3IFNH 2A74B 1LVEA 3PIQA 4PJ9D 5F9WB 5IHZB 4HKXA 4Y8AA 3GMRB 4WU5A 5IB1A 4WO4C 4GRWF 4GW4B 4IDLA 4TVPH 4TVPL 3QEUB 4ZD3L 4ZD3H 2EXYD 1DFBH 1DFBL 3QO1B 1A6ZA 1G7QB 3T0EB 4EDWH 4EDWL 5ACZA 5L2KB 4KI5F 4F15C 1X5XA 1S7QB 1NBYA 3TVMC 2P5EE 1WICA 1HQ4B 3QSKB 4PJDB 2P5WA 3AU1A 3VFRA 5GIRA 1UT9A 3CFEB 3IJYA 2PCPA 4ONHA 4RMRA 3QDGE 4MAYA 1YNTA 3U9UA 2G9HA 1E28A 3CFKB 4MA3A 5HGDA 1U8QB 1I1FB 3QEQA 4EI5A 3T0BA 4R2GD 3AU1B 2EDBA 5IEKB 3MLUH 3MLUL 3C8HA 2KQMA 4RSVA 3ZE1E 2PCPB 1IQDB 3CFCL 3CFCH 4PREB 3BH8B 3IU3A 3P11H 3P11L 1T4KA 3MR9B 4Z7NE 1A3QA 1IE5A 5ETUB 1A6AB 2AJZA 3OQ3B 1SY6A 2X1PA 3AXLA 2DBLH 2DBLL 3UPRA 5F7DA 1VERA 3CNKA 1X7QB 3V8OA 3EYFB 4HXBH 4HXBL 2W9EL 2W9EH 5E6IA 4JVPA 4PRNA 1MIEH 1MIEL 2R1WA 4HS8L 4HS8H 4LMQI 5E5MB 4LK4A 2CIKA 2C1OB 3BIAX 3JWDH 3JWDL 4LCYA 4NCDA 3G5YA 3FO1B 3AB0C 3UTPE 3BH9A 1DDHA 2AJ3A 1Z9LA 1CGWA 2AABH 1HN1A 2AABL 2HT4D 4P4KB 3JTSB 3OR6A 3T3ME 3LQZA 4NO0B 4X5LA 4JZJB 3LPWA 1WV7T 2G5BB 3MRCB 3DETD 4S0SD 4NZUL 3ALXA 4NZUH 5AUMB 3DMMB 4NKMA 5DVLA 3I6LD 3RVVD 3B6SA 1UXSB 3VD9A 5HI3D 2XN9A 5IOPA 4PB0H 4PB0L 3C6LB 3IJSB 5F7KC 1P2CA 2DAVA 1KB5L 1KB5H 4GMTL 4GMTH 3CFBA 3SKMB 1ZV5A 1OLZA 2V7NB 1P9MA 4JFFD 2X1WL 5CLTA 2BMKB 2ZUQC 3K8KA 5E1HB 4RGNE 3KS0H 1P69B 1A6ZB 4AM0A 1TJIH 1TJIL 1W72B 2FHFA 2VLKE 5D2LA 1TTGA 2ZUWA 3IRPX 2JELL 2JELH 3L3JB 1KLGA 4Z8FH 4Z8FL 3CC5A 1KEMH 1KEML 4WFFD 4NRYB 3O6FD 5FECB 4PJAA 2AK1L 2AK1H 3C8KA 1WFNA 4I77L 3EYQD 2M26A 4I77H 4D0CB 3MGAA 4P46A 4X7CC 3FFCE 1H0DA 3SEPA 2A0LC 1XIWD 1AH1A 4KZEL 1JMXA 2JCCF 2R2HA 4KZEH 5ESQB 4QCIB 3QEHA 5IW3A 2WIIA 4KY1L 4KY1H 3SCMA 4CAGA 1FZJB 3W11D 4WWKC 4GUPA 5EU3B 5SWZB 2BZDA 2GSIA 3VI4F 1FL3B 3GMOB 2X4PA 2PN5A 3UTTB 3BYYA 3RNKB 1S9YA 3TIEA 1I85A 3ZKXC 1IILE 3S96A 2VC2L 2VC2H 5D7JB 2YA1A 5IG7B 3SJVB 1YMME 1MQKH 1MQKL 3PQYA 4RWHA 3WCYA 1SJVA 4LLDB 3FZUD 4IS6B 2XQYK 4ZOBA 4Y5VB 3UTSD 3Q6FB 1HQRB 2OTUA 4R7DB 1DQDL 1DQDH 1FNEB 4HUMB 2OR7A 1T5XB 3MRPA 1PQZB 1S7XA 1L6XA 4JM4H 4JM4L 4NQDA 1U93B 2EIZB 3TZVA 3BX7C 2CRZA 2IFFL 2IFFH 4JFPA 3MRDA 5KVGL 5KVGH 3LS5H 3LS5L 1V3KA 1G9EA 3CMOH 1MLBB 3CMOL 1CZ8H 1CZ8L 1JMZA 1TCMA 4P3DB 3V5HB 3KWWB 1KACB 2Y7QB 3NIDF 2XZAH 2XZAL 2GTZB 1I7ZA 3DGGB 3VA6A 2NXYD 4U1MB 1NFDF 2FIKA 3CSBA 4KQ3H 3MRKA 4KQ3L 5GS1C 1DVFD 3ARBA 3RWCB 4NDMA 3UAJC 1T04A 3GI8H 3GI8L 5JIKA 4WJ5A 5CMAA 2VR9A 5FOJA 4G8EB 4KKAC 3IDMB 4NQVB 2NY6D 2NZ9D 2V5TA 3VXUA 4OLXL 4OLXH 3ZDXE 3MXWL 3MXWH 5ITFB 2X4UA 2PW2B 4OAWA 3WEXB 3HZKB 4GAYA 5JNYA 3HPJA 1CFSB 1UADC 1QLRB 3FONA 2BVOB 2MHAB 3P77B 4Y16D 3QUYD 4E41A 3ISWA 1WT5A 4OZIB 3VGFA 4O2CB 4NC2B 1WIPA 4MHHI 2AGJL 2AGJH 2D7MA 4UV7L 4UV7H 4ESKA 2C3XA 3HI5H 3HI5L 5HYFA 4ZOCA 3OB8A 1Q9OA 1JTOA 2Y5TA 4JQXA 4HLZH 3R1GH 3R1GL 3TN0D 1VFAA 5IFJA 4ETQB 1DANT 1SBSL 1SBSH 3KXFB 2Q8AL 2Q8AH 2Q6WA 3RAJH 3RAJL 1QSFA 3GSNB 3WUWG 3FB5B 1RIHL 1RIHH 1U92B 4JQVA 3BIKA 5K9JL 4PRPB 5K9JH 3VXMB 3EZJB 1UXWA 3MUZ1 4JB9H 4JB9L 1KB5A 3CXDL 2ESVB 1L6ZA 2G5RA 3CXDH 2R9HC 4KMTL 4KMTH 4CADA 1X6NA 3K4ZA 4OF0A 4KTEL 3LD8C 3PDGA 4KTEH 4R4ND 5HDBF 3PXHA 4P5TC 4Z7WF 1DBJH 1DBJL 3B8SA 3D0VB 3FO9B 1BOYA 2FB4H 2FB4L 1VADB 5CBEA 5KOVC 5TDNB 1BIIB 5EG6C 4HZLA 1G7PB 5HGBB 2NR6C 4NYLA 1OTSC 2Z35A 4KK9D 4XP9L 1URLA 2XZQL 2XZQH 4XP9H 5D1XB 5HI5D 5IHUH 1D9KC 3VCLA 1JHKH 1JHKL 4TUJA 5JIPA 2IPUK 5T33H 5T33L 3BGMA 5CIPB 3D9AH 3D9AL 3BESR 2AQ1A 4IRSD 4WFFE 2OL3B 2NX5B 1B0RA 5F88A 5BO1L 5BO1H 5ICYA 4ZOAA 3QHTC 1UWGL 1UWGH 1J86A 3VI3E 2I07B 3IDJB 1R0AL 1FH5H 1FH5L 5F1SA 1R0AH 3U7YH 3U7YL 2GIYA 4FQXC 1A2YA 4P5MA 1IKNA 1C5DA 3SBWC 3GSWA 1FZMA 1CGVA 3LEXB 4GAFB 2H45A 5IVXB 1EEYB 5LAXA 1R5WB 3BP5A 3PL6A 4LRIA 3MUHL 3MNVA 3BKJH 3BKJL 1K5NA 4KXZI 1RZIB 3UEZA 43CAB 4Q9RH 4Q9RL 4ZOEA 5C0DB 4NQXB 4WFHD 4GQ9H 1SYSA 3A67L 3A67H 4GQ9L 3ZDZE 2ICEB 1UB5A 1F00I 2ADJB 3LAFA 1MRFH 1MRFL 5D5ME 3DX6A 3ARYA 2IFGA 5ITFA 3QISA 3UP1A 4P2RA 4I5BB 4WIQA 2V2WA 1MRDL 1MRDH 3VXRB 5I2IA 4HKJA 2W9LA 4FXKB 2WP3T 3BHBB 3UPAA 3D25B 3OR6B 4X4YA 2HFTA 3P9MB 5DJCA 1F3DH 4I9WE 4NNPL 4NNPH 1CGXA 5D5MF 1IM9B 4DZ8A 2FLBT 2QSQA 3F65A 4G80B 1NC2A 5D1ZB 4XBPA 1I3UA 1IAOB 3OB0H 3QIBD 4JFDA 4YHMH 4YHML 1GGTA 3RWGA 3UO1H 3UO1L 1E6OH 1E6OL 2WBJD 4JFOB 4RGNC 4XHJD 3QULA 3C6LA 4HWZB 5K59F 3T08A 4HMEA 4XCNB 5CZXD 1X5JA 1ZA6B 3EO0B 2YN5A 5D7SH 4P2OA 5D7SL 5DK3A 3UPRB 5I71C 3QA3A 3DNKA 1A3LL 1A3LH 3WFBH 4MD4B 4OI8A 4WI7A 4ZUVA 1W72A 2RB8A 4N0RA 3VGHA 5JQHC 4HT1H 4HT1L 4L8SA 5JO5B 1GJIA 3MLYH 3MLYL 5CEXA 1K4CA 4Q7DA 1ORQB 5CJQH 4MZ2A 5CJQL 3MRIB 3QH3B 1FNGA 1BD2E 5FYJL 5FYJH 1FCCA 4Y4FC 5FGSA 2WIMA 1C16A 3PNWA 4D9RD 2DM4A 4JM2D 3D1MC 4JFED 5IJKC 4Y0GA 2ZZUT 3FQNA 3MJGX 4UIMA 1JZ2A 2APBA 4YNYA 1FZJA 3SKJH 3SKJL 3STLB 4R7NA 5FA3B 4AIZA 2ICES 4OZGF 2CIIB 5MENE 3L3OB 4HK0B 4KKLD 3O4LE 5IHZA 3U0TA 1KCLA 5F1NA 3ULVE 3TO2A 1MELA 3W5NA 4QXTB 2E7LC 5HJ3B 3DARA 4HJ0D 4AY0A 2BERA 1R3JA 4M1DL 4M1DH 4PJDA 1LP9A 2BVQA 2EXWD 3HE6D 3ELAT 3V6FA 1Y18A 4XNZC 3IGAB 3FRUA 5KSAD 4IRZH 4IRZL 3TH3T 2AXGA 1UKTA 2N7AA 3X3FL 2A0LD 1SVZA 3X3FH 2EDNA 2H8PB 1DEEB 3LKOB 4PV8A 1OGAA 1FV1A 4BH7A 4X6BA 1T7YA 1NEUA 4XPAH 4XPAL 3AUVA 3PWPB 4Z7QF 2ADGB 1ZLSH 3EOYG 1ZLSL 4R4BA 4X5XB 3E2HC 3DMMA 4LCWA 4ZUSA 5GS1B 3GNML 3GNMH 5BRZA 4QHLA 2YXMA 3IFOA 1NMCC 4HGWA 3R06B 1U0QA 4B0MM 3WJJC 2GUOA 2MCPH 4N1HB 2MCPL 4EI5D 5I1EL 5I1EH 2EDJA 4FXGB 1OAXL 1OAXH 1D5XB 4L4VD 1DDHB 1IAMA 2AJ3B 3PWLB 3ZT7A 3DBXA 5TQ2L 1ZT1A 5TQ2H 3VFRB 1VKXB 5EULV 4HBQA 2Y23A 1ED3B 3OKLB 1U8LB 4LPXA 4YBQC 5D72H 5D72L 5DJ0A 4O4YL 4O4YH 5K33A 2H8PA 1X5ZA 2HLFC 5K9KB 5MEOB 2H9GB 5FUCE 4H1LG 5I15H 2FO4B 5I15L 3D2UB 4QRPD 1HYSD 3GMRA 3ECBA 1ZT4A 1HXMB 3MLWH 3MLWL 5KANI 2GYSA 3OX8B 4EIZC 4JLRA 1YYLL 1YYLH 1MI5B 3L95A 4DEPC 1YY9C 1MI5D 1ZE3C 2V5YA 1C7TA 4FQ1L 4FQ1H 2XWJA 5ANMB 1MCDA 3NCFB 3NPZB 4IMLB 1F3JA 5FO9A 1AXIB 5IQ9A 2PR4L 2PR4H 5T1KA 5AG8A 1A6UL 1A6UH 2QR0B 3MV7B 2PXYA 3HE6A 1IQDA 1T3FA 3TJEH 3TJEL 2V9TA 2DDQL 2DDQH 1KJVA 4PD4K 3WO4C 4WW1B 3S5LG 4RZCA 1VFBB 5J57B 5FAAA 1NLDL 1NLDH 2XKSA 1I8KA 4WHTA 4OLUH 4OLUL 1S7SB 5HHPB 3RPIB 2Z8VC 2GCYA 1ZSDA 5IBUB 4KRPC 1X5LA 3QP3A 3GSUA 1QNZH 1QNZL 2AVGA 1LE5A 4MXQD 2R23A 4W4OC 3EFFB 1H3GA 5GS2H 4LNVA 2RQ8A 5I1LA 1FVDB 4IHOA 4J4PD 5F6IC 1LP9B 1P7HL 1BQUA 1T21B 5D2LF 4Q6YA 3I75B 4K23L 4K23H 4GT7A 4U2YA 2P5ED 4WENB 3REWB 4ELMF 4G8GD 3WFDL 3WFDH 2EYTB 1ULVA 3T77B 2D7QA 3H9YA 3T04D 1HHHB 2D31B 2F54B 5B21A 4F9PA 3X14A 2HVJA 3GBLA 3I84A 2VDPH 2VDPL 4K3GA 4WUUB 4ZTPL 4ZTPH 3F7PC 2D03H 2D03L 3BZ4A 4U6VH 4U6VL 1XGQA 4RGND 3FOLB 3W11C 2R2CA 5KS9F 4NYLB 3IS1X 3FB5A 1M05A 1CWVA 4GKOA 4IOIB 3SDAB 3DWTA 2EIDA 1ZHBB 1CD1A 2EO9A 1EAPA 3HUJA 3DVIA 2FH6A 1OF2A 4FTVD 4X83A 4HPOL 4HPOH 1XF1A 2ITDB 3JV6B 4MA1B 1VENA 3R0NA 1XF3A 2PXYC 4XCFH 4XCFL 1T7VA 4XP6H 4XP6L 2IMMA 1J0YA 4GKNA 1RHHA 3FTGA 5BW7A 3TA3A 4LHUA 1QLRA 1D6EB 1NGWA 4HC1H 4HC1L 3KAAA 5C07D 1YPZF 3BP4B 1F5WA 5LCVL 3BPNB 2NY4D 5LCVH 4BZ2H 4BZ2L 4HWZA 2IBBA 4IM8A 2ZP0T 3MV9D 2ESVA 3MRHB 4QHUB 3HE7A 2GJZA 2AEWA 1LK3H 1LK3L 1HINL 1HINH 4O51A 4F15B 3QCTL 3QCTH 3CSGA 2C3GA 1UCTA 4DFHA 4Q9CA 4KKLC 4R90H 4R90L 5IB3A 5DZNA 5HHMB 1AC0A 4RAUA 3VG9B 5D5MB 3V6BR 4LRIC 2LV4A 3QUXB 4FN0A 1PZ5A 3NIDE 1NJ9A 1V7NL 1V7NH 1OF2B 4CMMB 3BHBA 4YAQA 5EU6E 4X9BA 3DLQR 3GDBA 3QWRA 5AAWA 5ICZA 2FSEB 1MJ7H 1MJ7L 4MXVF 2PW2A 4OAWB 3QDMD 3WEXA 2NX5A 1BLNA 2OX5A 5MHSD 4G3YH 4G3YL 1EGJA 2IWGA 4ORGB 3EFDH 3EFDL 1F97A 1V3MA 4DJMA 3V0VA 1BQHG 5DJXB 2Q76B 1ITCA 3F7QA 4Y5XC 4WW2C 1I7RA 4D0DA 1IAIM 1S9VA 2VQ1A 1N5YL 3HAEA 4LGSB 1N5YH 2A2QT 1T1YB 4POZC 2XTJC 5TDPB 4PJ7B 3O0RL 3O0RH 3TN0C 1R5VA 3D69A 5C08B 5D7IF 3B9KB 1JL8A 3B9KD 1E4XH 1E4XL 3CLEH 3CLEL 3RWJA 1EXUB 3O3BA 4K94L 4K94H 2GK2A 2W0LA 1LD9B 3KPOA 5TDPA 3QQNA 2OL3A 5JW4R 1FC2D 5ICYB 4P2OC 1LMKA 4OQTA 3IDUA 1MHCB 2CK2A 3OAYH 4APQB 5C8JB 3KPLB 3WLWD 3O8XB 4WCYH 4WCYL 3D39B 4UIKH 4JKPH 4JKPL 4UIKL 4HG4J 1OW0C 3O8XD 2YD5A 3SKUD 4ZMAT 2FD6H 2FD6L 2Z31B 1A7PL 1A7PH 3R8QA 3SGEI 1OY3B 4JFZH 4JFZL 2H1PL 2H1PH 3F12A 1L0XA 3DXAE 4K7PY 2H41A 2P45B 1JGDB 3FOLA 4YK4C 2B20A 3RUGA 4Z77A 2LU3A 4KAQH 4KAQL 5DK2B 5E1AB 3VWKC 5IFJB 2Y4SA 5ALBH 5ALBL 5ICXB 3TA3D 1XH3A 3AY4A 4MNGB 4XNYH 4XNYL 1U8PB 1ZS8B 5F1KC 3QEGH 3BPCA 3QEGL 3BXNB 4GXVL 1EDQA 1FFOB 4GXVH 3HE7D 3M17A 2ZUUA 2PO6B 2J5LC 5CGYC 4S2SA 3SDXA 1XCQA 4CN1A 3CDCA 2AJVL 2AJVH 5C6TH 5C6TL 5CJXA 2YS4A 2AEPH 2AEPL 1F8TH 1F8TL 4P48A 4MNGA 4Y2DC 1IGFL 1IGFH 4XVSL 4XVSH 3U46A 4CUCA 1WIUA 1FL6A 3RUGF 1IGIL 1IGIH 2Q87A 2IPUG 3IB4A 3GB7A 5K93A 3SDDC 4ONGL 4ONGH 3V7AE 1IGCL 1IGCH 2FSEA 5MEPB 2F8XC 2HAZA 2UUDK 1RIUH 1RIUL 4CDHA 3VXUD 5C0CD 1AGCB 3RNQA 4Y4HB 3MRPB 3TO4B 3ZDYE 4PJXA 1VGEL 1VGEH 4RRPG 5KZCD 5I16B 2CDEA 3VCLB 5JTWA 2VLKD 4PRNB 4C4KT 1FN4B 3O81A 3IJSA 3RBSA 3T2NH 3T2NL 1N7MH 1N7ML 4C56D 5D6CA 2PW1A 2FHCA 1ORSA 3RWHB 5KSAB 3CU1A 4I4WB 3UYOD 1ZHKA 4ZUWA 3FMGH 3FMGL 2P7TA 3QFJA 4U1SA 3TBWB 1S7WA 5IQ9B 3LV3B 1CXFA 4P23B 1FHGA 4HDIA 2GJ6B 2VO5A 1QO3B 4D0BB 4WJ5B 5CMAB 1ODAA 3ES6A 5GGRY 2H2PC 4LIQE 2KPNA 1MFBH 1MFBL 2VLLA 4Q74A 5JHDD 3U9UB 1JYNA 5EO0B 3B6SB 1NPUA 1I1FA 5DEGB 3QQ4B 1PYWA 4YHIA 4NM8H 4NM8L 3MOAH 3MOAL 5E9DE 3B3IA 2BCKB 4HW6A 1U8MA 3G6AA 4XXCA 1IM9D 3VH8B 5TDOA 4X5WA 4XCEA 3EFFA 5ALCH 5ALCL 4HUVB 3IDNB 1MCHA 4HKXB 1N5AA 5HHOA 1YN7B 1MCQA 4HJGA 5FDWA 1E4KA 5E5MA 2IH3B 1JPGB 2CLZA 3BDXA 1NGZB 2AERT 4LP5A 4O2FA 3HR5A 3HG1D 2J8UF 3BT2L 1H0DB 1HKLL 1HKLH 3BT2H 2HVKB 1T83C 4EUPA 2PXYD 4HGWB 5JIIA 3PGCB 5DRXB 2X9YA 2A6JB 1E4XI 5D2LB 1KG0A 4UBDC 1KJVB 4BSWA 1GPOL 1GPOH 5F97E 2VKWA 1CVSC 3BKYL 3BKYH 4AEIH 3RWEA 4AEIL 2HMID 3UDWC 4RGMB 3JV5A 2BNRE 4KKBC 1WAAA 5C0AA 5KN5B 2QBWA 1GOGA 1QSED 3N1PC 5MENA 1T7XA 4QY8A 3TVMB 5CSZB 1T2JA 4JANB 3G5ZA 4O2EB 5AZ2H 5AZ2L 1GSMA 3L5XH 3L5XL 1EAPB 2ATPA 2ZUTA 2ZOLB 1ZT4B 5E8NA 3TCXA 4OZGE 5JXAL 5JXAH 3EDDA 4XNMB 2CKBL 2CKBH 3OTTA 1YEDB 4WTZA 4FQHB 1BD2A 4LNRB 2NY2D 4DN3L 4DN3H 3MLTB 5LQBH 5LQBL 5F6HI 3QQ3A 4EI5B 4XNMA 4KROC 4H20L 4H20H 5FCSH 2GCYB 3DV4A 1AD0B 1Y0LB 3X12A 5DJ0B 3X14B 2IPTL 2IPTH 4XBGB 4F8QA 3PHSA 4WHDA 5EU6D 1IT9H 1IT9L 4PR5A 5DUBA 3RDTA 4WI4A 1YNKL 1YNKH 3JTTB 3HE6B 4BYHA 4DKEL 4X7EC 4LCIL 4LCIH 4DKEH 4L9LB 3ETBF 3KLHC 3WIHL 3WIHH 4FQIL 4FQIH 4W70A 3CK0L 3CK0H 1S7UA 4Z78B 3MNZB 3GM8A 5BZWB 4X5XA 3QJFB 1U3JA 1FFPB 4QRTA 3LN4A 1ROWA 3BH9B 5ENWA 4Z7QE 1B0GB 1LEKB 4YUEL 4YUEH 4HFWA 2F54D 4A6YB 1WC7B 2ICEA 3RX7A 3BPOB 3ARGC 3O6KL 3O6KH 4YEFA 5DD5H 5DD5L 5EC1B 4N0CC 4I9WD 5I75C 5DSCB 1GYAA 1V05A 1UKSA 5C0AD 1PX4A 1JUFB 4QTIH 4QTIL 2ED9A 4W81A 5DSCA 1ZKAA 5KG9A 2YZ1A 3TA3C 1TLKA 3P9LA 5L6YH 5L6YL 1O5DT 5T3XD 4OBRA 1OQOA 4OZHE 1IARB 5MEND 5E2UL 5E2UH 2OQJB 2RR3A 3I85A 2V9QA 1WTGT 1MEXL 1MEXH 4PTUA 4UZGA 4JFEA 1K6QL 1K6QH 4HKJB 4OZHA 3WDIA 4MJIB 5HI4D 4ZUVB 3DX9A 1EV2E 4KKAD 1XCTB 1P5VA 4U1GC 3EJZC 4DCQA 1CDUA 2C3VB 3I3EA 3FFCD 2H9GA 2VISA 1N8ZB 4NO3A 3RKPA 3C6LD 4ZUUA 3FFCB 3UJJL 3UJJH 5DJDA 2J8UB 3BQUC 3MRFA 3L9RB 4QY8B 3TVMA 5DC4B 1ETZA 4UTAH 4UTAL 4KI5C 4WNQA 3F7YB 3IAPA 4N8VA 4IDJH 4IDJL 2RIKA 3MBED 1A02N 3TFKD 2YPLD 4HV8B 1UB6A 2MQCA 2AKRA 3ZKNC 5T1LB 2ARJA 1H3WM 5F7LB 5J11B 3RX5A 3ARUA 1YMMB 5CP7A 5BRZD 5D2NB 4WV1C 5CAYB 3OJDB 4PLJC 4PY7A 1NC2D 4GXUM 3ZTNL 3ZTNH 5BMFL 5BMFH 3VGAC 4L8DA 4ONHB 4DGVL 4DGVH 4GW5A 1VESA 1KJ2A 3O8XC 1TNNA 2C1PA 2B8OT 3CUPA 3QJHB 3FAXA 4WHYH 5DQ9A 1EO8L 1EO8H 3REVB 5E99L 5E99H 4MB4A 2MQ3A 3O3UN 4NT6B 4TN9A 2GITB 3S4SB 4XH2B 3F6IA 4N5EC 4GRLC 3D69B 5C08A 1LDPL 1LDPH 2RAMA 5I8EB 1N64L 1N64H 3PGDA 1NUNB 1FYTD 2AXJA 5ESAB 4QRPE 4ZFZB 2EICA 2OM5A 2HLAA 2VLJE 2AEQH 2AEQL 3UTSB 5GGUA 4G8EA 4FFZL 4FFZH 3RZCB 4WTWA 3VMNA 4WUUD 3RY6C 3UPCA 2YD6A 3NOIA 4I18C 5DJAA 1CDGA 1EXUA 1HSAB 4KK5C 4GO6B 4LKCB 2YR3A 4KTYA 5DFVC 5DK0A 3I50H 1JHTA 3I50L 5C0AE 5GGRA 2J6EL 2J6EH 4UNVA 1UQSA 1T0PB 3C5ZA 2F53B 4BQ9A 2Q1EA 3JXAA 3W82A 3LEXA 2AK4A 4P2YA 4PJEF 4EEEA 4U2ZA 2E5EA 4OF7A 1K3ZA 3QWOA 4JM2A 2NY4C 1JTTA 2Q76A 2PO6A 3SDXB 2ZPKL 2ZPKH 4V1DB 2VAAA 4KKBD 5DT1H 5DT1L 1AGDA 4FQQA 4XMLH 4LEOA 4XMLL 3MLPA 3RVTC 3B9VA 1R3IH 1R3IL 4L8SB 3EDEA 3KHOA 2K1MA 2DLHA 1KIUA 1AY1L 1AY1H 1HHGB 3WL9B 4NKDA 3D3VA 2VAAB 4WV1A 4X0KB 3ZLQC 3QRFM 4XCNA 5FB8A 1LD9A 3KPOB 5SWQA 3ZKMC 3AC0A 1FL5B 3QUKB 3MOQA 1AQDB 3CVHB 3PXJA 1KTKE 5KS9A 3C5SA 5DJZB 4WWKA 1YUHA 1EEZB 4GW1B 4P3WA 2NXZD 1CS6A 3G9VA 3IDJA 3TIDA 5EIIB 1ADQH 1ADQL 5DTFA 1PSKH 1PSKL 3GMNA 4PGCA 3QB7C 3K4DA 1MLCA 4HH8A 1WIOA 3RIFF 3VFUA 2IBZX 3LSOA 1I75A 3EDKA 2C7UB 5T3XE 5CEYB 3VFOA 4XNXL 4XNXH 4FFWC 4E42B 3NVQA 2NR6D 4PJHA 1TVBA 4X99A 5F3BB 1FG2B 1FNSH 1FNSL 2ZSVA 4PRPD 2EDHA 1BQLH 1BQLL 2F53D 2FGWH 2FGWL 3NN8B 1CFTA 5HYQB 4P2RD 1TVHA 2W07A 4NQUA 3EDJA 5DHXB 1I8MB 2EDYA 4PJAE 4NDMB 1MREH 1MREL 2VQUA 4QHKI 1UZ6E 2BOBB 4ZO9A 4YE4H 4XXCC 4YE4L 1MJUL 1MJUH 5ADPL 5ADPH 4HBCL 4HBCH 2NTFA 1O7VA 1ZGLA 3TLRA 2X9XA 3QG6B 3AS0A 5TPWL 5TPWH 3SGDI 5IQ7L 5IQ7H 3OPZH 3OPZL 1NFDB 1W8NA 5E7BA 3QEHB 4FFVC 1OAKH 1OAKL 4U6YB 4LHUD 4M8QA 4ODVH 1YEHH 1YEHL 4ODVL 5CEYA 3VFOB 4DGYH 4DGYL 4TUOA 3O9WB 3TP4A 1MCWM 1U95B 4YK4B 5JORA 1IQWL 1IQWH 1FIGH 1FIGL 4KV5F 3O41A 3HE7C 4N0YL 4N0YH 4I13B 3EOBB 3FT3B 1HI6B 1L9MA 2CIKB 5D7JA 4QXUL 4QXUH 4I0PA 3EJJX 4K9EL 4K9EH 1UZ8A 3OB0K 4APQC 2OXHA 3TZVD 3MLSH 3MLSL 3T65A 4YLQT 5JOEA 2BSSA 2WW8A 3NPSB 1HWHB 4XNQA 4MJ6A 4JQIH 4JQIL 1UC6A 3EJZD 4PJBF 4QCIA 1Q9KA 3RUGE 4A6YH 4A6YL 3T0XA 2EIZA 1UXWB 2YKLH 2YKLL 1K2DA 3OXSB 1GRWA 2YOCA 3RZCC 1I1AB 4Z5RA 2WANA 3QUZC 4LPUA 4BSVB 1J87A 3CVIH 3CVIL 4OM0H 4OM0L 1S9YB 3SO3C 3CDFA 1CTOA 4G8GA 4X8XA 4LF3A 5BVJA 4JCLA 1KCRH 1KCRL 2NY3D 2AV1A 5C09D 3ULUC 2ZUVA 4HAFA 4YHNA 4XPBH 4XPBL 2EYRB 4HPYL 3MOBL 3MOBH 4HPYH 2CLVB 5HPOA 1PW3A 4Y4KD 3VXQB 2COQA 3BKML 3BKMH 3NIFF 4PRAA 4KDVA 4JRYD 4YZFE 5IROC 3LKNA 1FSKB 2YUVA 3RVUD 3RL2A 1OSZB 4M7ZC 3IKCB 3DTXB 1SMOA 2P5EA 4P5KB 3BN9D 2KZWA 3C8KB 3QXTA 5L2JA 1HOCB 1VFMA 4ODWA 1SVCP 4L3EA 2VLKB 2G5BA 2HFFA 3BPNC 4Z0BH 4Z0BL 5D7LD 2B4CL 2B4CH 4D2NA 5J11C 3NZ8B 5AUMA 3D2UA 5J13C 3WKMH 3WKML 5IEHB 1XGUA 2X05A 1I9JH 1CFNB 1I9JL 3QZWA 5IBLC 2YUWA 5EH1A 2X89D 1L9NA 2P43B 3E6FA 4XCCH 4XCCL 5EO9A 1JGUL 1JGUH 1OTSD 4KK9C 5HI5C 2IF7A 2WAHA 4TVSa 3HMXA 1XR8A 1F6FB 3SKMA 4L4TB 3HUJB 4QWWC 3QYCA 2Z4QB 4GBXC 5EBMB 1J1XH 1J1XL 4F7CA 2XWJB 5ANMA 1EA9C 2HKFH 2HKFL 4M1CD 5JLZA 2DTSA 2ZKHL 2ZKHH 4L8DB 2J8OA 1G6VK 1A8JH 3C9NB 3KDMB 4XZUB 3WFCH 1OTTD 1WCBA 2D9CA 3WFCL 5IM7B 5GJTH 5GJTL 3UTOA 2JK5B 1KN2L 1KN2H 3OXRA 1I8IA 1Q94B 1KJ3H 1KJ3L 2J8UE 1YC8A 2QADD 1TITA 1KTDA 4MS8C 5FM5M 1EZVX 4XPGH 4XPGL 4QTHB 4P2CG 1G7IA 3MNWA 3MO1A 4Y19D 1PAMA 5IBTL 5IBTH 3FQUB 3S9DB 3FN3A 1JNLH 1JNLL 1QRKA 1EHAA 3CFBB 4ENEC 1A3RH 1A3RL 1QG3A 3OJVC 4J23A 1NUDA 4MMZC 4IRSB 5KSBF 3MZTA 1KULA 1A0QH 1A0QL 2HJLA 5FOBA 5EC2B 4MXQC 4FQJH 4FQJL 4L8CA 3T2OA 1A4JB 1MJJB 3ARWA 3BQUA 3H0TA 3OR7B 5D2NE 1C8PA 1MY7A 3UTQB 1RFDH 1RFDL 3MRGB 4EVNB 5IMLA 4PJ9A 4PRIE 4LLYB 3T1FB 4PTUB 3ULUF 2OR8A 4UOW0 3GSRB 1KEGL 1KEGH 3GUTA 5F6IB 5IBUG 1T5WA 3WNPA 5I71B 2AEIT 2Q7YA 4QT5B 1YNTB 2ZSWA 1Z6JT 3WFEL 3WFEH 4L8SC 1XIWA 1RPQA 1DCLA 4BZ1H 4BZ1L 2EC9U 3ARFD 4KRPD 1ZA6A 5F1IA 3G5XA 4X6DA 5ISZA 4PTTB 4JVWA 4U1JA 4X6EB 1CXHA 3Q3GA 3BMVA 1CICD 1BREA 3UTSE 4OT1H 4OT1L 3L3GA 3QZWG 3SDYH 3SDYL 3C6SA 3D0LB 5EZJA 5GISL 5GISH 3EYFA 5EZIH 5EZIL 3JWOL 3JWOH 4CVWA 3NCMA 5F7EH 5F7EL 1LWRA 1AD0A 2YD9A 4KROB 3O9WC 4KFZC 2FEEI 2EYSB 3FN9A 4LLYA 5J12C 1YMMA 2KKQA 3PQYE 5CHNA 2DD8H 2DD8L 2K7PA 5J6GB 1KIPA 3ILQD 3CSYB 3VFVB 3ROLB 4F57L 4F57H 3O6ML 3O6MH 5T5FH 5T5FL 3VXME 3I6LE 5I74B 5T3ZE 5JHDA 1JYVA 4ZNEA 4N8VB 2ZCLL 2ZCLH 4G6AD 3O45B 1XR8B 1X7QA 1FFOA 1K4DB 1F4HA 3FRPA 2UY7A 2DL9A 4XAKD 1MUJA 5KSBA 4GXUN 4L1HA 1YMHA 2OZ4H 2OZ4L 1QFWI 4ALAH 4ALAL 5DJ2B 2YPLB 4H0IA 4PYHA 5KOMC 4PP2B 1AGEB 5GS1A 1R3JB 2Z8RA 1F6AB 1TJHH 1TJHL 5FV2A 4G8IB 4NKOB 4Y16B 3OXRB 4BFIB 3UBXG 5EB9A 4FZEL 4FZEH 1KFAL 1KFAH 1H5BC 1OP9A 2HH0L 2HH0H 2V17L 2V17H 2E27H 2E27L 4EQ3A 1XGPA 1U8QA 4AK1A 1ZGLP 3I6GA 3FQUA 4X9IA 4EOWH 4EOWL 1AIFA 1FLTX 1MHCA 6FABL 6FABH 1HHJB 1MVUB 2P44B 3E2HB 1U8KA 1RZKC 4Y4KA 4F3FA 5IMOA 4LEXH 1BFOB 4LEXL 2IBZY 2MFNA 4U7SA 4IRJC 1K2DB 4XBEH 4XBEL 3S88H 3S88L 4KI5D 1LO3L 1LO3H 4NFBA 4NOBA 3WN5B 4RIRB 2UWEE 4L8CB 3MACH 3MACL 2YN3A 2ZCHL 2ZCHH 4P59L 4P59H 3BQUB 1KC5L 1KC5H 4WFED 3MRNB 5JDJA 3TC9A 3WFBL 5DMYA 3PUCA 4G8GB 3O3DB 5FYKD 3MRIA 3KLDA 3WJLC 1EHXA 3VXMD 2HTLC 5DD6A 2UZYB 5B3NA 4F80A 4XCYA 1IEBA 2Y6SD 4KGLA 1CDIA 2BK8A 4LNRA 4OM1H 4OM1L 3HZMA 3UYRH 1X4ZA 3UYRL 4PLNC 5FGBC 1MWAA 1A6WL 1A6WH 5D6CB 4CVXA 1LO2L 1LO2H 1WUNT 4OFPA 4HKZA 5LG1A 5FHBH 3NZHL 3NZHH 4G9FB 5FHBL 3CLFL 3CLFH 1HH9B 4AENA 1ES0B 1J0HA 3TH2T 5GGTA 1OP5K 4NZRL 4NZRH 1WEJL 1WEJH 4QRSB 1NC4B 3TYFB 4QRUB 1LGVA 4Y4HC 1JPFB 4Y2DD 3QDGA 2XICA 1A2YB 3KXFD 1B9ZA 2DQJL 2DQJH 3FCTB 4TOYL 4TOYH 3U6RA 3KJ4C 4JZOA 2GHWB 1A6TB 3BUTA 4LCCB 3EHBC 1G7JA 1T20A 5JXED 4Z9KB 1GGYA 4WFGE 3GMNB 2KQNA 2VLMD 2VZ3A 4AT6B 5JW3L 5JW3H 1FZOA 3VFUB 3PV6A 3EW3B 2YPKB 2BVUA 4U31A 1INDH 1INDL 5SV3A 3S7GA 1J11A 5CJXC 2DQEL 2DQEH 4K2UH 4K2UL 4NQSB 3LRSA 4KJPC 3OL2A 1T0NA 2NXYC 3FB7B 3E3QE 4MCZB 3NFNA 1DE4B 3RTQA 3WFHB 4ELMA 4OFYD 5TFSH 5TFSL 4R97C 4JG1H 4JG1L 3U30C 1MCSA 5KSUB 1RUML 1RUMH 4HH9B 3DGCR 4P46C 1IGTA 3DSNA 1Z9OA 1KGCD 1I1AA 1NGZA 3K80A 1H9VA 1WFUA 4JFHD 2CXGA 1UFUA 4JFDE 5LXGL 5LXGH 4M4RA 1TJGL 1TJGH 3V2AR 1JZ8A 3BDYL 3BDYH 1U8IB 4E5XA 3X17A 3DI2B 4QHMA 3T0EC 1NGQL 1NGQH 2BJML 2BJMH 4PGEA 4G6FD 3HUJF 4YHNB 4KK6D 4FQXB 2F8OA 1LEIB 4MDIA 3LRSB 4MHHG 3T1WA 1M71B 1TVBB 1AKJD 1RUPL 1RUPH 1EZVY 3WFZA 3DROA 3HUJE 3D48R 1CXLA 3S3JA 3TCLA 1DBBL 4HCRL 4HCRH 3MV01 4FTVA 1DBBH 1D5MA 3ZE2E 5IB3B 3I3DA 2UWEF 1FP5A 4P9HC 3O3AA 3KS0J 3DROB 2R4SL 2R4SH 3UTTA 1TTFA 5I1GH 5I1GL 3ROOB 2H2PD 3OAUL 3OAUH 1NGWB 3DVNA 2R9HD 4K7FA 3UZEA 4UOJA 1GZQA 4P3DA 3V5HA 1NMAL 1NMAH 2X4SB 1F2XK 4OCYL 4OCYH 4M6OH 4M6OL 4E5XB 3GJEB 4LVNB 2VXUL 2VXUH 1NANH 5CEZD 4I48B 3GGWB 3KPSB 2CRMA 4LMQE 2J12B 3KGRA 1KIRA 2X4NB 5ABDE 4FMFA 3MXVL 3MXVH 3PDOA 3I2CL 1NLBH 1NLBL 2CDFB 2JCCA 3I2CH 4ACPA 1K9TA 3IDYB 1CTNA 5C9KA 4MWFB 5A2FA 3T3PE 2F5AL 1BFSA 2F5AH 4FNLH 1GVIA 4FNLL 3UTPD 1M7XA 5I8CB 1WT5C 4N0UB 4AM0B 2EDEA 2DQDH 2DQDL 1ZGLB 3QIWD 1LHZA 4FQXD 5J9PB 2FECL 4ZUTB 4F58L 4F58H 5TE4L 5TE4H 2UYLB 4U0RC 1OWRM 3C8DA 3FL7A 5DA4A 3REWA 3CFDB 2XN9B 5IOPB 1JNHA 1ETZB 1IFHL 1IFHH 3AVEA 5DD0L 5DD0H 3FONB 1AIFB 3VXPB 1LO0H 1LO0L 2EDKA 4QHUA 3NCYS 2H2SD 2L7JA 4AIXA 3CDGB 4OV6F 3W0WD 2WWKT 1EK3A 4Y5YA 1AO7E 4WWKD 3U79A 1AC6A 3L3DA 3NGBC 3J7HA 4ZSOB 3FQTA 4NBYB 3Q1SH 3Q1SL 3FB8B 1FVDA 2BSTB 1TQCC 4CVUA 1IVLA 2ADFH 2ADFL 4JPIA 5GPRA 2EE6A 5GRJL 5GRJH 3LN9A 4MXWL 4MXWH 3V7AG 2X2YA 2AAVA 2J8UA 4MMXC 1M6OB 4QF1A 3H9HB 4JHWH 4JHWL 4YZFF 5MP6H 5MP6L 4X4XA 5L2KE 4OZGA 1FYHB 5F1IB 1T3FB 4NT6A 4PTTA 2LU4A 4E41E 1DN0A 1GGCH 1GGCL 1MHEA 4DVBA 5I66B 1U8NB 3ULVF 4M6AA 5E8PA 5DJ8B 1N2RA 1T2QH 1T2QL 4GQPH 5HTSA 4Y19B 2Q7YB 1NDGB 3VXUE 4J1UA 1OVZA 2XA3A 3GSUB 4XXDA 2OCFD 1NCCH 1NCCL 1RJYB 5F71A 3QWQB 3L3OA 4ERSL 4ERSH 2FO1A 4N1EA 2DQFA 1DQQA 4CL7A 2V2TB 5ENWB 1F6AA 2AK4D 2NY1B 4PG9A 4Y5VC 4LVEA 3S4SG 5J89A 3MRGA 4EVNA 3JV4B 4UQ3B 3SPVA 3H9SE 4OD3L 2K9UA 3ALPA 4OD3H 3D5OF 4CBPA 1NCNA 3EYOB 1J8HB 3EHBD 1NFKA 1CYGA 3H9ZA 4N90D 2V5SA 3DV6B 3CPLB 1B6DA 4PJDF 3GJFK 3O45A 3W39A 4Y2DA 5C0BB 1HH6A 5D71H 5D71L 5E6ID 3MO1B 4PJBB 1Q0YL 1Q0YH 1AP2A 2PYEE 2VZ1A 5FF6B 2Y25A 4PJDE 1FFPA 1ZWIA 5C09B 1CLZL 1CLZH 2A6DA 2BNQB 1A1OA 2VWEC 3ARFA 5HYJD 1UVQA 5GSVA 1U3HC 4U6XA 2J88L 2J88H 4DOHE 4HKBA 1J0KA 4KJYB 5GJSL 5GJSH 4DWHA 4MCYB 4YHYB 4R9HA 2V7NA 3ZHDA 1XMWA 4U6HA 3FO0H 3FO0L 2VR5A 1FO0B 3OKOA 1IMHC 2Y6SC 3MBEA 4N9GB 4ODUB 2CLRA 4MA7H 4MA7L 4XNUL 4XNUH 1ZHLB 3QO0B 4F3FB 5HHME 3DX7B 3BVNB 4RQQB 3ORJA 3C6LC 3P4OA 4LL9A 2RGSA 4YQXH 4YQXL 3DUHA 4XP5L 4XP5H 3HI1A 3OKKA 4J8RA 3IFLL 3IFLH 4DW2L 4DW2H 2V5RA 3T0WA 3PWJA 3QEUA 5HGAA 3T0ED 1MNUL 1MNUH 5F7YC 4ZSOA 1LK2B 1VEMA 3CZFA 5AWNH 5AWNL 1S8DB 5GRZA 4YXLH 4YXLL 3MV8A 1BBJB 4N90E 2EDLA 5BXFA 2EDRA 3OAYK 5GS0C 3IT8D 1HWGB 4ODTL 4ODTH 4XWOC 3C09B 5GIRB 2JIXB 1P4IL 1P4IH 1PEZA 3Q0HA 4FXGA 4MAYB 3S37X 1AHWB 3V0WL 3V0WH 3QR2A 5ESVB 4L9LC 2YD8A 3QFJE 2J8HA 1F2QA 4OSUH 4OSUL 2R1XA 3IRZA 1BEYL 1BEYH 2Y07L 2Y07H 3FFCA 5CD3B 4GG6B 5ACZB 1IM9A 3MRLB 1H3XA 2EKSB 1S7QA 1AE6H 1AE6L 3HG1A 5SX5K 5SX4I 5ACMA 4HIHA 1WBYA 1KIQB 2J2ZA 1CFBA 1JPST 1NBZA 1CQKA 2VN7A 1HOCA 3GZKA 1HH6B 5HHOD 1EJOL 1EJOH 3QEQB 3ESVF 5HHMD 1RJYA 1ZTXH 1ZTXL 3F7VB 4ZPTB 1RAMA 3QIWA 2IH1B 4PGJA 4UDUA 3TYGL 3TYGH 4Z7OE 1T89C 3GJFH 1Z0MA 1EHNA 2O5XH 2O5XL 1OAYL 1OAYH 1JF6A 1ZHNB 3BP7B 4P57A 1VACB 5HYJA 3BO8B 2YZ8A 4MNGE 1ZT7B 4EI6A 5ERWA 2CPCA 4HC1A 1ORSB 3RWHA 4JFYA 1KYOK 2YMXH 2YMXL 3VXNA 3SO5A 3N1QC 1KTRL 1R3KB 4YBLB 4PB9L 4FOMA 4PB9H 3CFJB 2FJFA 4YGVA 1QRNE 4MX7A 2B1HH 2B1HL 4BUGA 2XYCA 2XRAL 2XRAH 3ARDC 4XBPB 5KS9E 3MCG1 4HWUA 4UNUA 1U95A 4TNWF 1GC1L 1GC1H 5EWIL 5EWIH 1XGUB 3SGEH 3SGKA 4QGYA 4KRPB 4X98A 2Z8WC 4KK6C 3KG5A 5C09A 4AL8H 1JE6A 4AL8L 4RFEA 4RNRB 1CGUA 2IAMB 1BQHB 2DIJA 5IW6B 1M71A 1UB5B 4LKXA 5IB5B 5F89B 3BUYA 1OD9A 2JCCB 4JO1H 4JO1L 3VD5A 4N0FA 2EXYC 3VGDA 4N8VG 4DVRH 3QDJB 4DVRL 3EJYC 3ZKMD 1FBIH 1FBIL 2NW2A 2O93L 1UA6L 1UA6H 3O41B 4FQ2H 4FQ2L 1RZGA 2XFXB 3RJQB 3LDBB 4Q9QH 4Q9QL 1NC2B 5D1ZA 4YHZH 4YHZL 3RI5K 3FRUB 4XGZA 4MJID 3PWUB 5JZ7D 2XV6B 3BZFB 4ODXB 3PHOB 4POYA 4R2GC 4ZTOH 4ZTOL 1S9WB 2V7HB 3PG2A 4YHIB 5JPMA 1W0WA 2A6JA 4KKCC 1KPUB 3CDGA 1P84K 5IK3A 1T22A 3X11A 3MROA 1RI8A 1T89A 4PBWD 1KTLA 2HT2D 3Q6GH 3Q6GL 5FA3A 2X4NA 4AIZB 2X4RA 1U8NA 3NCBB 3IXAB 4H26B 1J05B 2O61B 3KPMA 4I8DA 3AM8A 3JVGC 4QHNB 3S35L 3S35H 3T09A 1YN7A 1DSFL 1DSFH 2K7QA 1LEIA 4NJAH 4NJAL 1BVKA 5J7CC 2Z9TA 2X4SA 1IEHA 1M6OA 3HZKA 1YA5A 1YPZA 3H3KA 1NGYB 4FS0A 2PETA 5I16A 2R8SL 2R8SH 5GGVY 3OBAA 5EOCJ 3QFDA 3FHQA 5KSVB 2Q86B 5D9SA 1AFVH 1AFVL 4LSUH 3QUYA 4LSUL 3WHXB 2NX5D 2ATKB 5DC0A 2ZSVB 1G7PA 1CGSL 1CGSH 2AI0H 2AI0L 4FQXA 4PRPE 4Y5YB 5T3ZD 4L8BB 4MJ5B 2DKSA 1BAFH 1BAFL 1QQDA 2VITB 4OGXL 4OGXH 4X5WB 1LO5B 4PJAF 1A7OL 1A7OH 4FP8L 4FP8H 4OGZA 4KUZH 4KUZL 3WS3A 4RMSA 1EHLH 1EHLL 4Z7VB 4PJ8D 4KDTC 3LD8B 4PG2C 2FATL 2FATH 3TJHC 2E8YA 4L3EE 5E9DB 2VLRA 1KCSL 1KCSH 5HDOA 4LCUB 3EO9H 3EO9L 1BLNB 4C4KO 2FX7H 2FX7L 5E4IA 1ONQA 3QWRD 4N0UA 3QI9C 1KNOB 5IESL 5IESH 4G43A 5FYLD 1IGJA 3ZKSD 1K8DB 3L3DB 2R2BB 3HPJB 2J6EA 1S7RA 3PGDB 3FB7A 5D1XD 4GJTB 2PKDA 4PGEB 1DE4A 4Y4FB 3ESUF 4TTGA 2VTFA 2EDWA 3FT3A 2ED7A 2FIKB 2X4RB 3LKPB 5KZCB 4DK6A 3ARBB 4P2QE 5BS0E 3T0EE 1KB5B 4LSSL 4LSSH 4FTVB 5FYKE 3SO3B 4IBLT 4HIEA 1MAML 1MAMH 1UM5H 1UM5L 3OKYA 2BNRB 4PJEB 3ULVL 5BW7C 4IOIA 3ULVH 1OTTC 1QSFB 3DRQB 3GSNA 2X42A 1XF5B 1W72H 1W72L 3QUKA 1I4FA 3VH8G 3GSXB 4GAYB 3F62A 2PTTA 5CZKA 3TBSA 3RKDD 1ONQB 4WU7A 4PJEA 5EZLB 5D7JD 4WUUA 3Q48A 5EIIA 2QSTA 4PJBE 2G75A 5BQ7A 3GSQA 2DI7A 1F4XH 1F4XL 1X5FA 3IXAA 3BRGC 2VH5H 2VH5L 4Y4FA 3ET9F 5JR1H 5JR1L 2DJUA 2A1WH 2A1WL 5C0ND 1A6AA 1NEZB 5FKAA 2XTLA 3BEWB 4J4PC 3VJ6B 4I3SH 4I3SL 4WI3A 3HB3D 1XGRB 1L4IA 3EYVA 1NSNL 1NSNH 1PBYA 1FNEA 3CSYA 3GK8H 3GK8L 3DX9B 4QRUA 5C0BD 1ZK9A 4OTXL 4OTXH 4IIQA 2BXZA 3KYOA 1K3IA 3K1KC 2VLRD 4WHTB 2QQNH 2QQNL 1ZSDB 5T5NF 4XMPL 4XMPH 3DETC 3KPNA 1RZFH 1RZFL 1W8OA 2VZTA 2FWOA 3U7WL 3U7WH 1T20B 1JUFA 3QXAA 4EZMA 2HT3D 1VSCA 1Q9WB 4FA8A 2YPLA 5F7DB 1DBKH 1DBKL 1GCFA 1TTUA 4G6ML 3EZ8A 4G6MH 4GG6F 1C08A 2VQ1B 1BIHA 2JIXA 5DF0A 4PJCE 2CDGB 3TVMD 1QLEH 1QLEL 1ZHBA 2VABA 2VYRE 5HYIA 4RRPA 4OB5H 4OB5L 1CICA 1EFXD 4GG6E 3TT1L 3TT1H 2FHBA 3BIKB 5ISZD 4LCCC 1H8OA 5FKPA 3VFSB 1UWEL 1B3JA 1UWEH 4NBZB 4D9QD 1UH4A 1TCRA 1AD9B 3O4LB 5FECA 2E7MA 4AQOA 1N6QL 1N6QH 1D6EA 4XPHL 2E9BA 1BBDH 1BBDL 4XPHH 2P8PA 1MWAB 4MA8H 4MA8L 4EN3C 1RJCA 3UX9B 3WV0A 4G9DA 3RVVC 4ENED 5IW1B 1BQSA 2HJLB 5DHVH 3F7YA 3ARGB 4QRRD 4UT9H 4UT9L 1D9KD 4L4VA 4O51B 1AQDA 4X6EA 2PO6D 1LK2A 1ZVHA 2E6JA 3MV8B 5JDSA 4KKNA 4NRYA 5CBAA 4IOSD 3BZDA 4XGZB 4QRPB 1HEZB 1YEDA 3BZFA 5HYEA 1MF2L 1MF2H 1U8LA 5B3JF 5IJVB 2IGFH 2IGFL 2EYSA 1IAIH 1IAIL 3P4OB 2EDQA 2XWTB 3CFJA 2KDGA 4RISH 4RISL 4JY5L 4JY5H 3U7AA 5IF0B 3VA2C 4NHUB 2BSRB 4F33A 1L7TH 1L7TL 5FUOL 5FUOH 3VDAA 4XPTH 4XPTL 2AQ3A 3FQXB 1J10A 4LHJB 1ZA3B 4U1JB 1AGBA 1RUKH 1RUKL 1UM4H 1UM4L 1KF9B 3FFDA 1MCFA 1QD0A 3UC0H 3UC0L 3O2VH 3O2VL 4NNXB 3NABH 3NABL 1FVCB 4Y5YC 4YDJA 4WTXA 1DQQB 4F7PB 5BRZB 2BVQB 1WWAX 2A6DB 2MMXA 1FNLA 2JB6B 3F7VA 2R23B 3RZCA 1XZ0B 3T0VA 3GIVA 3NIGF 5DJ2A 2D7NA 4OCMC 1BFVL 1BFVH 2GT9A 4XCYB 1G9NC 2WWKO 1EVUA 1EMTH 1EMTL 4J12A 4TNWK 4JM2F 3V52L 3V52H 2L7UA 2NY0C 3N0PB 2CO7B 4Y16C 3D2UD 2DB8A 3SCMC 3VH8A 4Y1AB 3BYTA 2NW3B 4XCEB 4JKLA 4UIMB 4KVNL 4KVNH 5JUEL 5JUEH 1CE1H 1CE1L 1K4DA 3TBYA 5D2NC 3HC4L 3HC4H 3QQ4A 3FOMA 2CJUL 2CJUH 2GK0A 3SE8H 3SE8L 1BJ1J 1NKOA 3MTRA 3L95B 3DVGB 4JDVA 3SDCD 5FFLA 2WNGA 4BFIA 2W0PA 3ZE0F 2P8LA 2JJVA 3LV3A 3OKDA 2HJFB 4L4JA 3BJ91 2PNDA 4YFLI 1LNUA 4D0BA 5I1JL 5I1JH 1T0MB 4OQ1A 1OGTB 5CJOL 5CJOH 1WFTA 3AS3A 4P4KA 1MFCL 1MFCH 3MV7A 2FO4A 5DMIL 5DMIH 5T1KD 1C5CH 1C5CL 4KRNA 1U8OA 1OARH 1HSBA 1OARL 4OV5B 1JNHB 5I1KL 5I1KH 5JPNB 3ARBC 1WCQA 4MJ2A 1I3VA 3TBVA 2UWEB 2ICWJ 4L4TD 1A7QH 1A7QL 3E6FB 4S1QH 2IEPA 3BOVA 4S1QL 4U7MA 5EO9B 5IT2L 1PDKA 2BNQD 1DANU 1GGIL 1GGIH 3D87B 3BIBX 3MPCA 2BVYA 1XR9B 3BD5A 1A14L 1A14H 3FAWA 1ZEAH 1ZEAL 2A77L 2A77H 3HCVB 2G60L 2G60H 5HYJE 4NOFA 1ZHKB 4ZUWB 3QIBA 5DGRA 4O5LH 4O2FB 4O5LL 1JWMB 4LCWD 4NN6C 5FV1L 5L2JB 1C16B 3S97C 4BQ8A 4L3CA 3WUWB 4PR5B 43C9A 1VKXA 3NFPB 3DXAD 4C59B 3X13A 4PBXA 4P0DA 3V6OC 1CFVH 1CFVL 3RDTC 3VFNB 4YFLF 3IYLW 4OV5A 5D93C 4W68A 5BZDA 1NUGA 4LPTA 1J8HA 1P53A 1S5IL 1S5IH 4K8RL 1WJ3A 4K8RH 3CCHB 1DLHB 3MRMB 5IWLA 2W0FA 4OGAD 2F8VA 5DFTA 4HUWB 4ODWB 2BCKA 1II4E 4PJGE 2APTA 3R4DA 3DMMC 3TO2B 4R26L 4R26H 4PJBA 5I1IL 5I1IH 5JHLH 5JHLL 1CI5A 2IADB 2DI8A 1A7BA 3GGWA 3S8WA 5C0DA 3MREB 3R0MA 1U3HA 1E4WL 1E4WH 3BEVB 1UJ3C 3VDBA 1T6WA 2IH3A 1GZPB 1I8IB 1Q94A 1QSFE 4WO4A 3EBAA 5DWUH 5DWUL 5FYJU 3GSWB 4YEEA 3S37H 3S37L 4MJ6B 3DVNB 2BRRL 2BRRH 2XWBB 5F70A 4X4YB 1EEYA 4PIRF 5FKPB 2HLFD 1RMFH 1RMFL 1KG0B 2D0FA 3LY6A 4QRQA 2HFFB 4N8PA 3EIFA 4IRSA 4LCWE 3T8XA 1IAOA 1AGFB 5EPMB 1KNOA 1NH6A 4BSVA 4Z76A 5JMOC 4JY6B 4A2MA 3TEUA 5EO1A 5ICXA 4ODHH 4ODHL 4FQQB 1CD8A 2J7LA 3M1BB 3BEWA 3G04B 4CN4A 2LQRA 1MIMH 1MIML 4KUCD 3ZT5A 2JF1A 5HD8D 1CG9A 3EUUA 4OZFA 1NUFA 3QDMB 4NUGH 4NUGL 3AAZB 3IDIA 4OCSH 2NY4B 4OCSL 4LQ1A 2C4FU 3OHXA 3CU7A 3RL2B 4JFDB 1R24B 3CXHJ 2BC4B 1R5WA 1JRHL 1JRHH 4NO2A 4LPWA 3V0VB 1REIA 1U8JA 5C0EA 2HT3C 4OFDA 4NIKB 2P42B 3T0DA 3MGTA 1D6VL 1D6VH 3IXTA 5I18H 5I18L 3OMZA 1MFDH 1MFDL 5HDBE 1T1YA 5IEHA 3MSPA 2O5YL 2O5YH 4OZ4A 3F5WB 4WO4D 4P9HH 1MWAH 1MWAL 4P9HL 4ETQA 3VXTB 3GBNH 3GBNL 2Q6WB 1KT2B 3O3EA 4IRJA 1HZHL 1HZHH 4K7PH 4K7PL 5FGRA 4UDTA 3MYJA 5E94B 4AQ1B 1DBML 1DBMH 4NWUL 4NWUH 5EBLB 4NNYA 5T5NG 1U58B 4LBEB 1LE9B 5DS8A 5AD0A 4Q0XL 4Q0XH 32C2B 3RGHA 5A2JH 1B0WA 5D1QD 5CWSA 5GSRA 4U1IA 2QSVA 1A6TA 5EOTB 3QQ9D 4PLKD 3V5DB 5LGHH 5LGHL 1X4YA 5D1QA 2R39A 4MNQE 5E8EA 2WUCL 2WUCH 4E42A 2R4RH 2R4RL 3AREA 3DUSB 1RK0B 2Q20A 4LEOB 3RWCA 4LAQL 4LAQH 4PJIB 2I26N 4TUJB 2ESVD 2YEZA 4GOSA 1NAML 1NAMH 1CVRA 5CIPA 3ARQA 4U1SB 3TBWA 3B43A 4Z6AT 3V9FA 3GMQA 4AH2A 4TQEH 4TQEL 4URTB 2FYYB 2F53A 5GRUH 1PKQA 5GRUL 1R5VB 3Q5YA 4K07A 5C0CA 3AM8C 2DJSA 4JDTL 4JDTH 2MSPA 1Z9MA 3C09C 4K3JH 4K3JL 4MSWA 2VXQH 2VXQL 4BFGA 2FYYA 1IGJB 4PGBA 2C1PB 4JM2C 2GW5A 4Y4HA 4NFCA 2WBJB 3D39A 5D6DC 1JJUA 5DJXA 1QHPA 3MFFA 4F7EB 5HI3C 1E27A 4LPVA 4XT1C 2VUOA 4HAGA 5JPMB 4FABH 4FABL 3MRHA 3NGBB 1IC7L 1IC7H 3KPSD 2QLVB 3WFHA 1OB1B 4HZLB 1RVFL 1RVFH 4I18A 3ZKQD 1NCUA 2NMSA 3MMEA 4GUPB 2OMBA 5C9JB 5IMMB 4JN2B 2E9JA 3FHAA 2XNAB 2KBGA 5I17A 3M17B 4P46D 5F8RC 4NKDB 4JRWA 5ID0B 1B4JH 1B4JL 4PLJD 3QXDB 3VRLF 2SEBB 4MB5A 2BOCB 4HS6A 1UEMA 1KJ2B 4GMSL 4GMSH 1X5HA 3LN5B 1FLRH 1FLRL 2RFXA 5MEQA 2DIAA 4ZXBB 5D7IA 3MGTB 4ZXBD 4NP4H 4NP4L 5TGBA 2OJZL 2OJZH 4OZ4B 4WW1A 3S4SA 5EUOE 3BW9A 3GO1H 3GO1L 3VXRD 5T1LA 4NQSA 3ZE2F 3DURA 2W9DH 2W9DL 2GSIB 3TYFA 4ZFFB 3ZKXB 5E0QA 3TN0A 1J05A 2YD1A 3NH7L 3NH7H 3PV7A 4HUXB 4LCYB 3HZYB 4L9LA 4MQ7B 1EPFA 1MFNA 3S96B 5HHQB 4P5TA 3UJTL 3UJTH 4U1MA 1LO4H 1LO4L 3WS3B 3FZUC 2V9RA 1FGVH 1FGVL 2QQLH 2QQLL 4LDOB 4NQDB 3ROLA 4ODXA 1FFNA 3QDGB 3QXUA 2X4UB 5L8LB 1QBLL 1G0DA 1QBLH 4JQVC 3JV0A 3G6DL 3G6DH 4YR6B 1ITBB 4LLUA 1AP2B 1KB9J 2I24N 1HHHA 3SKOB 2HLAB 3P0YH 3P0YL 1AJ7L 1AJ7H 1MUJB 1DEDA 4H5SB 4RDQF 2HFEB 3WSQH 4W6YB 3WSQL 4NRXB 1NCAH 1C12A 1NCAL 1UXSA 1SHMA 4JFQA 3P30L 3P30H 4RNRA 1I3RA 4GKSA 2HRLA 4P57B 4TVPE 4Q6IC 2NY6C 2NZ9C 2FRGP 3B2VH 3B2VL 3V95A 3M1BA 2NY0B 1D9KA 1H15B 1AR2A 4OZHB 1NGXB 1IGMH 1IGML 4G7VH 4G7VL 5J8OA 1NAKH 1NAKL 4ONFH 4JGUA 4ONFL 5FM4A 1CN4A 2V2XA 4I2XA 4BQ6A 4U3HA 1R3KA 4OIIH 4OIIL 4X4MA 3ZYJA 5IK3B 3X11B 4B7LA 5CJ8A 1BOGA 5SWZD 3VE0B 1H15A 4M61A 3VFMA 1WLHA 1MCBA 3ZYZA 3MJ6A 4YC2C 4OZHF 4W6XB 4U05A 1WZMA 3RRQA 2VE6B 4ZAKC 4W4OA 1F13A 1FFQA 1U2CA 3STLA 3DMMD 4RFNB 5E95B 4RAVA 2XQBH 2XQBL 5H35A 5EC2A 3PJSA 1ZLVH 2NY2B 1CK0H 1CK0L 5I1LB 1C12B 3G5VA 4MAUL 4MAUH 1CDCA 3W81A 2YC1A 3BEVA 4JR9L 3NFPA 4JR9H 4QXTA 3QH3A 1WC7A 2XZZA 3SGJC 1QVOA 1XZ0A 5A3IC 8FABA 1ADQA 4ZNCD 3VMPA 5FYJD 1SEQH 1FAKT 1SEQL 5EU6B 3QG7H 3QG7L 3KJ4B 3D85A 3FN0H 3FN0L 3O6FA 3NIGE 4QKXB 2HTKD 3EYQC 4PREA 4R3SA 2D0HA 4X80H 4X80L 2AK4E 3OGCB 2VWEE 1KIPB 2QR0A 5L9DL 5L9DH 3D85B 4LU5H 4LU5L 5L7XH 5L7XL 1FV1B 5E6YA 4ZS6C 2M8XA 1F4YL 1F4YH 4FZ8H 4FZ8L 5E6IB 2B1AL 2B1AH 2H6PB 3G5ZB 4H5SA 5IMKA 2VZSA 4PJ7E 3VWJD 4HUVA 2IG2L 2IG2H 4C57C 4IRSC 2GFBB 1SJHA 3WBDA 1DBAH 1DBAL 3QAZC 5H37G 4KJWD 4OFVA 5IHUL 1A1OB 1P7KA 1WFOA 3CDYA 2P8LB 1S7TB 3B2UC 2CQVA 3RGVB 5EOQH 5EOQL 3CX5J 3T2PA 3RGVD 1R5IB 4P99A 4HIXL 4HIXH 3LQMA 3DYOA 2V2XB 4I2XB 3SKOA 1ZHLA 4OQTH 4OQTL 4NN5B 2PTUA 4RBPK 3HR6A 3DXAB 4HIIA 4RWYH 4RWYL 3MNVB 4HUUA 5GRVK 3KPPB 4YX2L 2HKHH 2HKHL 3SDDB 4CNIB 4YX2H 1I8LC 4U1LB 3VDCA 1I7UB 4DUXA 2UYLA 2DN7A 5C0AB 3TNMB 3K8MA 4G7YH 4G7YL 3R06A 2F15A 2I9LB 4U1LA 4I0PB 1KGCE 3LQAL 3LQAH 4PRHD 3ULUD 2HJFA 1UG9A 4P2RB 3OV6A 4TNVK 4GW4A 3SDXE 1NANI 1QP1A 3MJ8A 4JFDD