4M8QB

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
b'EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GEP1 Fv heavy chain
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 106
sequence length 106
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m8qB00
1I4FA 1MLCB 4HC1A 1RURL 3IU4H 5HGHA 4K7PL 4C56B 4KQ4H 3SKJH 5JDSB 1XF2A 5IHUL 5KAQG 3NCFB 5H8DA 4NRZA 5GS2H 1NFIB 3VFPA 3WNMA 2MHAA 2Z35B 1VENA 4WUKL 5F7DB 3QHTC 1YQVL 2RCSH 3QIBB 4NNYA 5DT1H 3B9KD 5HHXL 5BO1H 3QIWD 4FFZL 3BPLC 1C08A 2K3TA 3SKUD 1UWXK 1RV6X 2GK0A 2FIKB 5FAAA 1I9JH 3B8YA 1KGCE 5DMIL 1AGDA 1XR9B 1MFBL 1F2QA 4PJAA 2DL2A 4WEMB 3VXTB 3JWOH 4J3VA 1FZMB 2P5WA 4M93C 3D39E 4P23C 4OZHB 3L7EB 3LS5H 5F9OL 1HHIA 2HTKD 4HG4J 1FFRA 1Q9LB 1UCBH 2GIYA 2W0LA 4HGKC 1T5XB 1OTUC 2D7MA 2VISA 5M94B 1JGLH 1KYOJ 4OZFH 4ODUA 3QIUD 3LKSB 2NW2B 2VKWA 5DA0B 3AU1A 3G08A 1ROWA 2N7BA 4GG6A 1W72H 1JN6A 2C7UA 4QLRA 4MNQA 3NMEA 4JFDA 2OP4H 4FZEH 4DGVL 2JTDA 1HYSD 1CVSC 2HVJA 5CINL 5DJAB 2CLVA 3SDAC 4WU7B 3QXDB 2VJXA 1MRCL 5D7IE 2BP3A 3I75A 2BNRA 5DTFA 4L8BA 1FIGH 1MY7A 3BKJH 1QBMH 4MJ2A 1AO7A 4U2YA 3WE6A 4LDOB 1C16A 3EOAB 3VXMB 3G6AA 1FJ1B 3V5KB 1UKQA 3GSQA 1J5OH 3ZHLA 3G5VA 1W0YT 1UH2A 1YEGH 1DUYA 3LKNA 4FQCL 1I1AA 1KB5L 1SEBB 1YMHB 3AMLA 3GIVA 3O81A 2VLKB 5DR5H 5CCKH 4HKZB 3L1OH 4GS7B 2WINA 2WM0A 4M6NH 2OX5A 2PNDA 1A6AA 3L5JA 2EDNA 3IB4A 3CH8A 3NPSB 4YZFE 3VXQA 1QFPA 1XZ0A 4A2MA 4ELMF 3QDJE 4PRAB 5TE6H 2DF3A 3EYSL 4ZFFB 1RZ8B 5E2UL 2Q76B 4NOFA 1I85A 3TV3L 5AUMA 3FQRB 4EUPG 1HXYB 2XWTA 4JM2B 3ZE2F 4FFYL 5I1HL 5HYJD 5GS1A 4HS3A 4WNQB 5JOEA 5BS0E 3FQUB 1JZ6A 3V0VB 3EYQD 3QUZC 5C0IA 3HR5B 4GW5B 2ICWA 4FNLL 3H42L 4FG6D 1NBYB 3V0WH 5JPNA 4JZOA 1FZJB 4PRIA 3DWTA 3KPSD 3QUML 2MFNA 3WFCH 1IILE 1CXHA 4LMQE 4QRSA 4HV8A 5D72L 1GOGA 3LRSA 4HWBH 4IS6B 1EEYB 3P9LA 1V3JA 2OR7A 3MYJA 5EC1B 3FRUB 4PJHB 5IBUG 5F88B 1CLZL 4QRQB 3O6FC 1A9EA 3FO9A 5BXFB 3KGRA 3DURB 5B39A 3GZKA 1F4XH 4G42A 2GW5A 1DBJL 4NQVA 4ZAKA 4P2OA 2XWBA 4UI2A 1HNGA 1FNGA 3VXSA 3CVIL 3D85D 1CG9A 5DQDH 3BSZH 1EHLH 4HUKB 2EYTB 3V6FB 3HI6H 3RWFB 1E4XH 1UA6H 5MP6H 4DW2H 4F7PA 2C1OA 4KHTL 1A6WH 3T0VA 4NHCH 5F72S 2YEZA 1C5BH 4WJ5B 1RZFH 1V7NL 5L9DH 1EO8H 1LEGB 3CFIC 3BPOB 2CH8A 3S35X 4TPRL 5IHZA 5JMOC 4M4RA 4XBGB 5FHBL 1BOYA 4X9FA 4LHUB 2JCCE 3KXFD 2DTMH 4O2EB 4L9LA 3WHE0 1F6FB 3BP4B 5KVMC 4DUVA 2A9ML 1P4BL 5HI3C 4JPVL 1IGTB 2XTJD 1G7JA 5SWSA 2EDQA 3U1SH 3BEWA 4YHIA 1Y6KR 2Y7QB 4KKBC 3RDTA 5IW1A 2EYRA 2UYLA 4IIQA 4G7VH 4XC1L 1E0OB 3E6FB 4CN1A 4X4MA 5C08B 1YEDA 3RNKA 4OM1H 1S8DA 3V52H 2VC2L 3NAAL 1ODAA 5TFSH 4YDIL 1Y18A 4UTBL 1SJXA 3IDGA 2M26A 2X44D 3VD7A 1H3XA 4MD5A 5DJZA 3LVEA 4NC1C 1DEEB 4L8CA 3T2NH 4RFOH 3RWDB 4QCIB 5K9JH 1RIHL 4ETQB 1DP0A 4HJJH 4PJIE 1HZHH 3EO9H 3EOBB 3W9DA 5H35A 3I02B 3CFJB 3HG1B 3DJ9A 5AYQA 4YPGA 1PLGL 3Q6FB 4XB8A 1FNEB 1H9VA 4M1GL 2ZNWA 4PGEA 4LVNB 3RVTC 3NPZB 1T7ZA 4DKAA 3E2HB 5I1IL 5C09A 2W0KA 3GBMH 5IIEA 3BH9B 5JIPA 5TGBA 4X7SL 4XVUD 5GISL 1CDCA 4K7FB 3S34H 1CFTA 5ERWB 2D31B 5I71C 2ED7A 3L3KB 3OKOB 1OGAE 5FM5M 3F6IA 2K1MA 3RZCA 5F7HA 3SJVD 2NY5H 1E28B 2UZIL 5IBLD 5I66A 2VIRB 4YLQT 4ALAL 4ZXBD 4UBDC 2DLGA 4GAYB 3VGAB 3BH8B 4KZEH 1HXMA 1NAKL 1LDSA 4JO2H 1KCVL 1MWAA 4OQTH 1B88A 4BK5A 4K71B 2D3VA 1QFWI 4RMUA 4JPKL 2KKQA 2X4QA 4Q9QL 3TN0C 5HPMA 1HH9A 5E8DL 4RGMB 1RI8A 4Y4HC 4WUUB 1KB9J 1IARB 1IJ9A 4HIEB 2A6IA 5K59E 2FECL 4JFYA 4XWGL 2MKLC 1N3NB 2RFXA 4QF1A 4CBPA 1IAKB 4LU5H 3BXNB 1NDMB 4PJGF 4KRPB 4X98A 5J1TC 2PYEA 3QUXB 5D1XC 2VXUH 2KZ1B 3TH3T 3PQYA 3L3DA 4HLJA 3KS0J 1G7LA 3OPZL 1SYVA 1A7PL 3QUYB 1I1RA 1UCTA 3T77B 1J0YA 1A3QA 4NKIH 1WICA 5GIRB 4R96A 1KJ3L 1OAYL 1JYVA 4V1DD 5JXAL 3D87B 2G9HA 3PL6A 4JG0H 1MRDH 1C12B 2HFTA 3SGJA 2V7HB 3CXDL 4RISL 2OTPA 5DSCB 4K3JL 1IL1B 3C60C 2KDGA 3W9EA 4J4PC 2IAMD 4OZGE 3V7AG 3VXPB 3LZFH 1ACYL 1XFPA 2H6PB 1P9MA 4X6DE 3RWIA 3SCMB 5HVHB 4KV5E 4X80H 5JW3L 1FVCA 2FL5A 1MCOL 5JHLL 5IEKA 3QJHA 1MJUH 4NWUH 1EBAA 5IF0B 4LCWE 3WS3A 1BM3H 2K7PA 43C9A 3C6LC 4JO1H 1WISA 4OGZA 2NY1B 1LO0H 2Q7YA 5D7SL 1IAII 3L95A 4WFGE 5ICXB 2YA1A 1NC4B 5HY9B 1Q72L 1R3HB 4RMSA 4YK4C 5E03A 3VG9C 4PLOB 3S5LA 3H9HA 2K7QA 3NN8B 1YMMA 3CFDB 5KVEH 4F80A 4HD9A 4DTGH 1JGDB 3LRHA 5I1KL 3GDBA 2WLZA 1NMAH 3HNTL 5T33L 5C0RL 1RZGA 4NN5C 1A1NA 1NGQH 1FC1A 4G9FA 3PDOA 4I0CC 4R2GB 5EZLA 2NLJA 5E2WH 4X6CB 3KYNB 1RJCA 1IFHL 5SWQB 1MCRA 4LLQB 1PG7X 1O7SA 3ARDB 3F7PC 5E5MA 1E27A 1R6VA 4F3FA 4X83A 2AVGA 3UJIL 4F7CB 3NFSH 3TESA 4D0BB 1X5KA 4KQ3H 3ES6A 3BP6A 5FOBB 1KIRA 4U6XB 3GSNB 3EOTH 3WO4C 3QQ3A 1AC6A 4LRNL 2ICEB 5DUML 4P5TA 3NIDE 3MLTB 4Z7UA 3O3BA 4F8TA 4L8DB 5H37H 1S7VA 1TZIB 1QSEE 2HFGH 3L9RA 1XH3A 4X5XB 4WI3A 5F3BB 2FGWH 5C07D 2J8UE 4OLUH 3QUYD 4ZFZA 4CDGC 5DEZA 2ED9A 4JPIB 2YBRA 3HLAB 1LO3H 4HGWA 2EDBA 4KMTL 4ZNEE 5HPOA 4JY5H 4RFNB 3SDCD 3FB8A 3VFTA 4Y19D 4MNGE 2V9TA 4TUOA 3NFPB 1GXEA 4GRWH 4CN4A 5C8JB 1DN0B 2DYPA 3MOBL 2BSTA 1G0XA 4J3OC 5L0QB 3DX8B 1QFUL 1QYGL 2DJUA 4X4XA 1JPTL 3L6FB 1NFDF 2NTFB 2NY0B 3JVGA 3FN0L 4L3ED 4XPAH 1VESA 5LAXB 2X89D 4WCYL 3S96A 5JR1L 1NJ9A 5A40E 5C0BE 3UTZA 1URLA 3BD3A 2HT4D 4Y2DB 2FR4A 1YECL 2XACC 5TE4H 4XCYA 3STLB 3SDDA 3T3PE 1MREH 5BZWA 3SE8L 2OZ4H 4CVWA 3B8SA 2CGRL 5FYLH 1ZK9A 1E6OL 5ELIA 2GT9A 2OL3A 4R0LB 3BO8A 2VL5A 5DJXB 5F8QC 1A6TB 2CKNA 2DQHH 4NO3B 1BZ7A 1NCAH 3KYMA 4D8PB 1FL6B 2WIIA 2EC9T 3RWEA 4QNPF 4KPHL 1VACB 4RNRB 4H1LA 4R26L 3OKKB 5FUCE 3IFPB 4KXZI 1X5IA 3N1FC 3DV6A 5F1OB 3ZE1F 4Q7DA 5IMLA 2AJXH 1KIUA 3VFSA 5T1MB 1U36A 2P8LA 4QRPD 1FP5A 3CDGB 2X4UA 4Z7OE 3BUTA 2ADJB 3GJFA 2B39A 3FN3A 3ARBB 3LH2H 2MCPH 2O61B 4MCZA 1U58A 4PJFA 4XP4L 3VXUE 5JLZA 4D9QD 2XWJA 2NXZD 3FT4B 4PRBB 3GSVA 4WTXA 3DIFA 4XBPB 3D0VA 2WUCH 4LSQH 1JF1A 4DCQB 1KJ2A 1JIBA 1ZKAA 1ND0A 1M7DB 4XMLH 2YMXL 3CVHL 1NUGA 4KGJA 3IDJA 4M62L 4NNYB 4S1QL 3U36B 1CQKA 4G8GB 5ANMB 1JHKL 5C6TL 2H1PH 3RU8L 4CAGA 4NT6B 3RL1B 4YDLC 4ZS6D 4CJ0A 1T1ZA 1AGDB 1JK8B 3HMWL 5EIIA 1T80A 2QHRH 4IRSA 3TLRA 2Z31B 2VZSA 4PRHB 5KSAC 5CMAA 4FXLA 3T0EC 3W5NA 2WMPA 2NXYD 3B3IA 4NO0D 4OBRA 5IT2L 4YDJA 3HI1A 2YD7A 5D2NA 1YY8B 2ZUYA 2PTTB 3G5ZA 4ZO8A 3GSOA 4BZYA 2V5TA 5LBSH 3S3PA 1DBAL 2C7UB 3ARFA 3L5HA 1A6ZA 2C26A 2QQLH 3FQWB 2QKIA 1FZOA 3SKOA 4GAGH 4R7DB 3MO1B 2B1AH 2R0WH 4I0PA 3TBWA 3P11L 2E8ZA 4FZ8H 2JELH 4NKMB 4Z6AT 4L4VE 4LRIA 1TZHA 2VDPH 4NQEA 4JREC 2BVOB 3HC3L 1X5FA 1ADQH 4APQA 4HUVA 3AS0A 4L8BB 4OCSH 1ZLWH 1CBVH 1EJOH 1AJ7L 1VSCA 1ZVSB 2HFEA 2YPVL 3MV7A 4DGIL 3C08L 4XVTH 1OSZA 3PWPE 1MFEL 1BZ9A 1HEZB 1Z9MA 3LQAL 4JHZA 4G8FA 5SWZE 3X13A 1A2YA 5I6XB 5B8CB 5ID1B 1WCBA 2HKFH 4P2RE 4LSUH 1MFAH 3I6LE 4Y88A 1J1XL 3IXTA 4NKOA 2AAVA 3OAZK 2UWEB 1JHLH 4PJCA 3M1BB 4BA8A 4P59L 5D7LD 3CZFA 5DD1L 1I3GH 5AZEH 4DGYH 4AIZA 1R3KA 2ZPKH 3AVEA 3VXQB 1TQBB 3DMMA 3GJFK 4M7JL 3O2DA 5GSRA 3U0WH 4DVRL 3EYFA 2LABA 1CGSH 2NW3A 5I73B 5LCVH 4U6TA 3U0PA 1IGFH 2ZUTA 4ODWB 4NN7C 3BRFA 5KS9B 1H0DB 1JWSA 4WFFD 4NPYB 4GG8B 4KKCC 3ULUC 4YUEL 5I1EL 3WS6C 1JNJA 1AXTL 3VFWB 1JNNH 2AEQL 4Z7WE 4HX1A 4BSWA 3OB0K 2R23A 4JZOB 3TYFB 4C58B 5T3XD 3QEGH 1T03H 1YEHH 4A6YH 4OM0L 5B3JE 4LCYB 3TZVA 1BQLL 2P5WD 4P2QA 1WV7T 1MI5A 5C0EA 4S1RH 4JRYE 1T1XB 4FXGA 1A8JH 2ITCA 2PYFA 1UJ3A 4OFYA 3AC0A 5CZVH 4P2OB 3UX9B 3LHPH 4PRPA 1IC7L 3REWB 3O3UN 5J11B 5IB3B 2AQ2A 2AK1L 4MNQD 5FGSA 3TNNA 3SBWC 1U8IB 4JFDD 2NY3B 2QADD 1OM3H 1FH5L 1D5MB 4HCRL 3PF2A 1Q9OB 4PJEA 4RA3A 2DTSA 3U30B 1PAMA 1JNLH 2FLRT 2GHWB 3KPLB 3IDNA 3GUTA 4PV9A 3KPRE 2OJZL 4MAUL 4LOUD 2D7TH 2BNRD 2N56A 3ZLQC 2BHUA 5DS8B 3PHOA 5T5FH 4U1KB 3WLBB 4JN1H 5FGCE 5C71A 4EUPB 3IDMB 1AO7D 5F6HJ 1L0XA 1W72A 4YZFF 2VLRA 1G1CA 3TT1L 4YX2L 2LVCA 1K6QH 4DN4H 1S7SA 1J1PH 1I1AD 4F37K 1BJ8A 2FB4H 4UINL 5SWSB 1IGIL 1OAKL 2IC2A 4HH9B 3TCLA 2A6DA 3LIZL 4IRZL 1YQ2A 1DBKH 4XPBH 4XXCC 4GKNA 4XCCL 1PBYA 3KPOB 2VITB 4LCUA 3QAZB 1U91B 1ZWIA 3EBAA 4XNXH 2EZ0D 3RNKB 1S8DB 3UROR 4Z5RB 1G7MB 5IBUB 4S10A 4MJ5B 4JRWA 3H3PL 1JWUA 1MCPL 5A3ID 3DUSB 4POYA 1KNOB 1PD6A 5I1LA 2YWYA 5B21A 5EZJB 5FKPB 4N0CD 4RWYH 1GH7A 2JLLA 3FO2B 5FV2A 2ZUVA 5FUOH 1CE1H 4HPOH 2IH3A 4OBSA 5GRJL 1XF3A 3UBXG 3LDBB 3V6ZA 4PJ9B 2A83B 3U9UB 3U4AA 2ESVA 1MHCA 1YEJH 3DLQR 4JQXC 4KTEH 5ISZA 1K8DB 3JSSA 3QCTH 2XZCH 2FBJH 3P73A 3RTQB 1KG0A 1WWAX 4XC3H 3JZ7A 2DM7A 4PS4L 1A7QH 1F4YH 5CD3B 4PRID 4G8IB 1XGPB 4QXUH 4G43A 1DSFL 1RUPL 3EZJB 3GSNL 4ZUWB 5JQHC 3JTTA 3H9SA 4YBHA 3ZO0A 1REIA 1VFOA 3U4BH 1XCQB 4NRXA 2QQKL 2YD2A 4OCXL 3U7WH 1U93A 2AJZB 4JDTL 2X4PB 3MRGB 3CU7A 4NZUL 2Q6WB 4WO4A 1FYTB 4XWOD 4NCDA 1OWWA 3BT2L 4XCEB 4NRYB 4ZAKD 4P2OD 4AH2B 1IT9L 2HT3C 2A2QT 3OKLB 3VXSD 5FECB 4IJ3B 4RAVA 3VFGH 4N5UA 1KULA 4F9LC 2NY3D 3QDGE 1KIQB 3LS4L 5TPWH 3ZHDA 2VXQL 4JLRA 4MCYA 2JCCF 3REVB 3T1FB 4DN3L 3HFML 1D6EA 3FRPA 1CS6A 1K2DB 3RWJA 2DDQH 3VRJB 1SJEA 3BGMB 2KQNA 5LWYL 1K3IA 3FQXA 3HZVB 5FA3A 3KPPA 3BKYL 5DZOA 3K0WA 4KAQL 1CT8B 4P9HL 2ZJSH 5DJYB 5DMGD 1JYNA 3KPTA 5IJKC 5J4MA 4U1GC 1HI6A 4TTDD 5KSBE 4N5EC 2OI9C 3E3QC 4OB5H 4FQLH 1MF2H 3EKCA 3UTTB 1FNSL 5EU3A 4Z0BH 5INDB 1UACH 5I9QC 3ISWA 3IFNH 1ORQA 4FTVE 3S4SG 4DVBA 5ADPL 3BYYA 2BOCB 4JFQB 4TNWF 3ZDYE 4PREA 5IP4A 5SWSD 5EBLB 5KN5B 1IC5L 5HD8D 3WSQL 1OT2A 5DQJA 4Z78B 2BSSB 1ED3A 4XTRC 2JB6A 2MOVA 3RDTD 3VDAA 3HZYB 2R2BA 2ERJC 4YQXH 1K4DA 1WZ1H 1X7QA 3PL6B 3DX6A 3CK0L 4YDKL 3W0WB 5BRZB 1I9RH 4LSSH 5D8JH 2YR3A 1RU9L 3ORJA 3IT8D 4C56E 4LF3B 3RUGA 4M1DH 4RMRA 5C7XH 1NAML 3FMGL 1CICA 4PJ7B 5HYJE 3B6SA 1ZHLA 5L7XH 1J0ZA 4WY7H 3RKDC 1CU4H 3T3ME 5JPMB 3AB0B 4FP8H 2AV7A 1KIPA 4YIQA 2YD8A 1ZHNB 3MRNB 3T1WA 3C2AL 4XP1H 5FO9B 1S5IH 2OM5A 1BIIA 1SM3L 3QSKB 4NYLA 5IROA 4ODXA 4HC1L 4OD3H 5FUZL 2JJTA 1T2QH 1KACB 4WTZG 3NFNB 2DWDB 1MJJA 4JPWH 3TO4C 1U95A 4FRWA 4OZHE 1N5YH 1KEMH 1CFNB 3OKMA 5F71A 5C09D 3MRPB 1TLKA 3TFKD 3SE4A 1FDLL 3ZDXE 3MXVH 1FE8H 3FB6A 4ETYA 5KW9L 2XFXB 4X6BB 4MZ3A 3RZCD 2YD5A 1RHHB 2EO9A 3OJMB 3O3AA 2BHZA 2CD0A 1AKJB 2ZSVA 4TN9A 1KLGB 5C86A 5E4EC 2I07A 2NLJB 2EYSB 5IESH 3A67H 5CILH 2FBOJ 4WFHE 1FV1A 2IH1A 2O5YH 1FG2B 5GSVA 4TSBL 5GZOD 1QNZL 3HZMB 2JB5L 4IDLA 4HIJA 1UWGH 2BCKA 3MGAA 4LPTA 3S35L 4UB0H 5E99H 5J0BA 4ZUUA 3HI5L 3OZ9L 3BWAA 3TVMA 5DRZA 1RJYA 4NZTH 1Q9KB 1U92A 4HWUA 5D1ZC 5ETUA 3VXME 3C87A 3AUVA 3CMGA 5EOTA 2FNBA 5HDLA 4YHML 1MIEL 2IMNA 3KXFE 4L4JA 5F7EH 2PYED 4J3SA 1ZLUH 2YA0A 4OQ1A 4H8WH 3QQ9D 3PQYD 1RJZB 2VLKE 1XH3B 3MLVH 4O02H 4CW1A 1NGZB 4E0RA 4OQTA 4JRXB 4WV1B 4XAWH 3UPCA 3PE9A 1AIFB 5E1AA 3WEXA 2VDQH 4Y2OA 2FH8A 3MRRA 1T66D 5EOQL 2K9UA 2OBGA 2KL6A 4ORGA 3RPIB 2VXTH 1X6NA 1C7TA 5MEOA 2W9DH 3MRIB 3OX8A 4LCIH 4P5MA 3VWKA 4GXUM 3PL6D 4I18C 3ZTNL 2X7LB 1KJVA 4Y16C 1WC7B 1KELL 3QZWA 3ROLA 5HGAB 4LK4A 4GLRI 4F7TB 1CLCA 1S7XA 5HYQB 1HKLL 1OAZH 5GXBB 4FQJL 3LKQA 4Z77B 2VL4A 2YHGA 1XR8A 1BREA 4Z7VB 1JZ4A 4PJAF 1LK3H 4X8JB 4PB0L 2HN7A 5ESQB 1G7HA 1IC4L 5T1KB 1NLBL 2AJUL 1NUNB 2NYYD 1W0VB 3MPCA 4Y1AA 4B53A 4U7SA 2HRPL 2VABA 1AGEB 4PJHE 1H3GA 4OFIA 5CJXC 1TETH 5DRWA 3SE9L 4GG6F 2NY4D 4UNVA 3FJTA 3TF7C 2AK4B 1YMMD 3SJVE 3O0RH 4NNPL 3ZSTA 4OIAA 5DEGA 4M1CC 5D7KE 5CJQL 1X6LA 4R3SA 1RZJH 1L9MA 4KTYA 1O7VA 4UV4H 4G9FD 3WKML 4QHKJ 4TVPL 1NCCH 3D25A 4M5ZL 1G9NL 2R29H 1B6UA 4NQDA 4X5WA 2IMMA 5IB5A 4WHTB 3DOSA 2XRAL 4AL8H 2J8UF 1NEZA 1CD1B 3O9WB 1B9ZA 3CXHK 4ZSOA 1NSNH 3FZUC 4WI9A 5KTEL 1P2CA 3P4OB 4P5TD 3WCYA 4QTIL 3HAEH 2YPKA 3GIZL 2FJFA 5I1CH 1HDMB 5C0CA 1R0AH 3EGSB 4BH7B 1N6VA 2AXJA 3IJYA 5C0JA 4M8VA 3INUH 3RAJH 4HJ0C 3F5WA 3VFNA 2X09A 1QLRA 2VLJA 5J1AB 5IFJA 2R4RL 5C08E 1U8JA 2R56L 5D9SA 4UT6L 1RZKH 2EIZA 3OWEA 3PP3K 2DYPD 4ELKB 1HINH 1GGIH 3VJ6A 5KVFH 1P84J 2GAZA 4I9WD 1T04A 4YHOH 4Y5VA 1JFQH 1D5ZB 2XA8H 4YXKH 4CADA 3QPQC 4I0PB 1BAFH 4BZ2H 4HG4K 1NGPL 3OXRA 1A5FH 3WN5A 1NUDA 3SDDD 1KYOK 3K8MA 5A16A 3HG1E 3LQZA 4ZD3H 1U3HA 5EB9A 5DYOA 2LVEA 4K9EC 4NCC1 4MAYC 4GFTB 2D2OA 3GHBH 4I5BA 4WW2F 1A1OB 4JFZL 2VZTA 4AZ8A 2LTQC 4Q9BA 4G8FB 5I19H 1U8QA 1OGTA 4E41B 2O26U 3CSGA 2V7NB 5LGKA 3L3HA 3T4AB 3L5WA 4Y4HB 3QG6A 4YWGL 3H8NA 1YNTA 1YJDL 2CMRL 2RIKA 3D6GA 1PG7L 1YEFH 3K7UA 4YE4L 4XVSH 5GS0C 5DMKA 1AGFA 1ES0A 1KOAA 4HXAH 4OKVB 3ARZA 1FAIL 3BVNB 5JMRA 3MLSH 3AREB 3BJLA 2GUOB 2ZP0T 3KR3L 1R3LB 3NTCH 4KK8C 3MV11 3WLWD 3F8UB 3SGDH 2P44B 1QSFB 4I3GA 2E7LC 1JHTB 1ZVYA 3FHAA 4MQXD 5DFWH 4JCMA 4JKMA 4W4OC 3K8LA 4XP9L 1IM3A 4MQ7A 1SMAA 4YFLF 2EDFA 4Q74A 5E8EB 3CSYA 1LP9E 2V2XB 1CTOA 2UZYB 4IRSD 1HHHB 3PJSA 4XPHL 2CR6A 3OSKA 2VH5L 5KJRL 5I16B 2XI9A 3IU3B 3Q3GA 4TUJA 4MSWB 3NGBB 3U4EA 2ITCB 5IWLA 1NL0H 1A02N 4ZTOH 1IAOB 4YHLL 3EYOB 2AQ3A 5DD0H 5DD6B 1DUZB 5GGRY 1Q9WB 1T83C 5EIQA 4L3EE 5DFVC 4XB7A 4EIGB 4MDJB 2CK2A 2QLVB 3ARFD 2YOCA 1KCSH 1D3CA 5I8EA 2UY7A 4ODTH 4I0PD 4GAJL 4AG4L 3FB7B 4M7ZB 4UQ2A 3I2CL 3RGVA 3GMNA 4NQED 1N2RA 4YXHL 3WFEH 4L1DA 3WIIL 4APQD 2Z8WC 5BVPL 5CP7A 2XNAB 3ARUA 4OZFB 4F8QA 1TIUA 4NUJB 3MV7D 4HKBB 2Z91A 4TNVK 4GRLB 2WV3A 2X40A 2PO6A 4QHNB 5EU5A 4GBXC 4PJ8C 3WXWH 1JZ2A 4NGHL 1X5YA 1AR2A 4JQVA 3WUWG 1LVEA 3JV5A 1RZ7L 1BQHG 2CDFA 4X7TA 3UDWC 4KVCL 3ULSA 5DF0A 3IFOB 4GKNB 4X6CE 1PQZB 3V4PL 5I0ZA 2P8MB 3MR9B 5HYFA 3DMMD 2PUQT 3NZ8A 4Y5YA 2ICCA 4I13B 2VZOA 3VDCA 1TENA 2Z4QB 4R8WH 5I1LB 2Z8RA 2BJMH 3I6KB 4NM8L 2HMIC 2IH3B 2DMBA 3O6KH 3C5JB 3L3JB 1XF3B 5I74C 1MJ7H 1P7QA 3CFEA 4RQQA 5F6HI 4W6WB 3OKEA 1NC2B 3VE0A 4LIQH 4QTHB 4QT5A 1BF2A 1KG0B 4XX1E 1L6XA 3U83A 5D71L 3BDYH 5I76A 2PXYA 1YNKL 3DXAA 3P30H 1TQCC 3TZVD 3E0GA 5J13C 2BVUA 1TTFA 1IEBB 2EIEA 3CCHA 4HDIB 3A6BL 1OAUL 2XKUA 4EI5B 4UNTA 4Y4KA 5I8CA 4P2QD 1OP5K 1MI5D 2PW1A 1P7HL 4IRJA 5GZND 2BNQA 3PWJB 4Q0XH 2Q8BH 5DEFB 1CQYA 4L3CA 1QQDB 3K2UL 3IAGC 2IADA 4OFYD 4YFDB 3RVVC 1LWRA 4YHPB 4PRPD 4WHYH 2BRRL 5EU6A 5E0QA 5E8NA 1YNLL 4A6YA 2X4RB 4DFIA 5E7FA 1X4XA 2AGJH 1D5XA 3TM6A 5HJ3A 5F89A 4KKAC 4PJDB 1AQDB 3HUJA 4LQFL 1A1MA 2D7OA 1WK0A 1NFKA 5TDOB 5HGBA 4NQXB 5FA3B 1HOCA 1KLUB 3VG0H 2XZZA 1WAAE 2CO7B 3LEYL 5EBMA 3PWLB 4OCYH 4H0IA 2VZUA 1CDYA 5CEZL 1OARL 3QNZB 2XXCB 3MRKA 1F4WH 1C5CH 1FHGA 4G6KL 4L4TA 3FAXA 1T21A 4HS6B 2VLRD 2W38A 3P4MB 1YEEH 3AAZA 3SGEH 1CL7I 1YPZA 5LQBL 4FABH 25C8L 3QT2A 1DCLA 5EO9A 4R97C 3G6JB 3BHBA 2OL3L 4IMLA 2YD1A 5IEHB 4U1JB 4JHAL 3MGTB 3JV0A 5MI0C 3PWNA 5IB2A 3PP4H 3QB7C 2HFFB 4EEEA 4L8SC 4K8RC 5FHAL 5F9WC 4OCNC 1E4KA 1T0MB 4P23A 3LN5B 1ZLWK 5D6CA 3VFVA 2CPCA 3DROA 1Q0XL 5EBWB 1QSZA 3UCRA 4KRNA 4YDLB 4F7EB 4B0MM 4U1MA 3RNQA 4WFFE 4Z7UF 4PTTB 1SEQL 5KSAB 4PLKC 2PCPB 2GSGB 3FT2B 4N0UB 4WFED 2X2YA 1GGCH 1NCBH 2AJ3A 3JBG7 8FABA 3BKCH 1E6JL 4G8GE 4FQIH 3QQ4A 4GW1A 2ESVD 1R5WA 2HJFA 5ANME 3RI5K 5ADOH 1LEIB 5ISZD 5DK2A 2DKMA 1JF6A 5J6HB 2X70A 3WNLA 1QA9B 2VDOL 3SDAA 1UH3A 1U8NB 4PRHE 3FQNB 3F7YA 5KVDH 4NO5B 2I9TB 3GMLA 5FUCC 1KJ2L 1LDPH 3OJDB 4OGYH 3RY5A 3OJVC 5IMOB 3H9SD 4I2XB 1HSAA 1J0JA 3MODH 2XG5A 4WW2C 3SQBA 4WO4D 5JW4M 2NY2D 4Z7QF 4ZUTB 3G5YB 4DUWA 3BZFA 4HFWA 3BP7A 3BE1H 1U8KB 3MLXH 5CLTA 1B2WL 3S4SB 4HK3N 1EHNA 5DUBB 5C3TA 5KSBF 5DRXB 4Y4FB 4MDIA 5TH2B 3NH7H 1OCWH 1PKOA 2R1WB 1U6AH 5D7JB 5JXEC 3ZYJA 1FORH 2Y36L 4QXGH 4XHQA 2B1HH 2BNRE 2R0KH 1T20B 1A3RH 1S9WB 5CKAA 4DKEH 1AO7E 1KCRL 1OWRM 1NMBH 2VSCA 2VDKH 3BZEA 4HF5H 4D0DA 3C5ZA 4TOYL 1K5NB 3LN4A 2F74A 2MPAL 1MAJA 3QUZA 3B4NA 2UWEE 2DD8L 1KFAH 4M7LL 4LLVA 4AEHL 1ZGLA 2G5RA 2VLMD 3V5DA 5JNYB 1BD2B 1G9MH 3UBXI 2EDWA 4PJFF 5JQ6H 2NY7L 3QEHA 3FO1B 3IS0X 1HQ4A 4CMMB 1R3IH 3EJZC 3MRCA 1WVZA 4MXQC 4OSUL 1FG9C 3ECBA 5K9QG 1NMCB 3RA7L 4BZ1L 5ACMA 4HSQA 4XNYH 1B0RB 1T22B 3CFKA 3R0MA 3O6FA 2HKHH 2WUBH 1PDKA 1U8OB 4DEPB 1PSKL 2EEBA 1I3RA 1CICD 5KS9E 1MCEA 3MLPA 2BSRA 3HNSL 1MFDH 2IQAA 4Y8AA 4H20H 4HJGB 4OZHF 1GC1H 5GHWL 2XKNA 3LKQB 4KROB 5HHOA 2XZAH 5D70L 2IGFH 1XR8B 2N4IA 3D48R 3C6SB 3QCVH 4AM0B 4N8CL 3T0WA 1GL4B 3TH4T 5LG1A 43CAB 3LV3A 3KPQA 1GHFH 1NCUA 4HPYL 1OP3H 4MA3A 3LY6A 4K2UH 3VGGA 5LXGL 2HAZA 5I17A 4Y1AB 5DWUL 5CD5C 3ALPA 4Z95H 4TVPE 1AXSB 3CDYA 3WMSA 4TULL 1FNFA 5FXCH 5EZIL 3U9PL 5ILTL 2AV1B 4OD2A 1U3JA 1EMTH 4HUWA 1JGVL 2IEPA 3VFOA 2WIMA 1BJMA 2BFVL 3UTQB 4OCWH 3GMRA 2X4TA 1YDPB 4KMLB 5F1IB 2R1XA 4XHJC 2SEBA 1N5AA 4HKXB 4WWKB 4X99A 3IU4L 2YSSB 4JB9H 3QFJB 5C0NC 4TUKH 3SKJL 3K81A 5MENB 5TDPA 1FGNH 1TJGH 2KZWA 4EVNA 4M61A 3VCLA 2RCSL 4PD4J 4B41A 5BO1L 5DJ8B 3TVMD 2VR9A 3HE7C 4IOIB 1I9JL 3HR6A 5JORB 2W65A 4X0KB 2CXGA 2C1PA 2AJYL 4MJIA 5HYSB 3BN9D 4FFVC 1TITA 5IUSA 5C0CB 2X9YA 2R2EA 4PBVC 5FK9B 2V5YA 3MBEC 5HHMB 3WFDL 5SWSE 4PJBB 1DFBH 3LS5L 1MVUB 3VFRB 3VI4E 5KSVB 4OF8A 4G9DB 1TJHH 4HMCA 1HQRA 1VHPA 4JM2F 4KJYA 3LSOA 1UXSA 4XP5H 2JIXB 4QHKI 1FZKA 2IG2H 5HHNA 4HAFA 4X4ME 3GHEH 1EEUA 3O8XC 2OMNA 3VWKD 2VDRH 2Y6SC 4NBYB 3FQTA 4ZTPL 5LVEA 3VJ6B 4X4YB 1UB5A 2OP4L 4FZEL 1YUHA 1W8NA 2ZCKH 1ZLVK 1I7UA 3PDGA 1TDQA 4PGCB 3PGFH 4HEME 1A7RL 2EXYC 2A6JA 1FO0H 5EFIB 1HKFA 5BJTB 1K8IB 4HUXB 3B43A 2A9NH 4PJHF 2F8VA 2HJKA 4QRTA 4B7IA 3DV4B 1FIGL 3OXRB 4XNZC 1QBML 3GSRB 3TJHD 1V05A 4GRWB 2FJHA 2C9AA 4NC0B 3TN0A 1JUFA 4ONHA 3IAPA 3O4OB 1YEGL 4Y1AD 1TTUA 5JO5A 1QBAA 1ZE3C 3BMVA 5GGRB 3VH8G 3BEVA 5CCKL 2QR0A 1Z9LA 1CFSA 3SDXF 1XCTB 1AR1D 1KN2L 3L1OL 1CTNA 1BVLA 2MWCA 4M6NL 5AYUL 3CFBA 2OTUB 1MJ8H 5D1XA 3ULVL 3QH3A 1BEYL 5I8KH 1FPTH 2YD4A 3T2PA 5FM8A 3FT3A 4JFFA 5F9AC 3L5WB 3C09C 3QG6B 1YC7A 5DI8B 4KC3B 1T7VA 3P9WB 5TE6L 3MMEA 3EFDH 2YPLB 5DMKB 1Q8MA 3DVNB 1S5HB 5I9QB 3D69A 4NQDD 1T0NB 1QRNB 2CLZA 3QA3A 2F54B 1MHHB 1T1YA 2JF1A 3B9KC 3QDHA 5GJTL 2H32H 1I8KA 4N8VB 1VGEH 3LKOB 2PKDA 1MQKL 1OD9A 3C60A 4JY6A 4NDMA 5TDNA 4J4PA 3V0WL 5ITBL 1XGTA 3MACH 1RK1B 2GTWB 3PQYE 4X7FC 3UTTE 3GBNL 3WFCL 3P0GB 3V5HB 2PR4L 4HWBL 2HTKC 3ZTJH 5C0CD 1K4CA 1AHWA 5IBTH 4JZJA 1CR9H 4QEGA 4P9MH 1MCKA 3N06B 3L7FA 1A4JB 3C6LA 4QRRA 1GPOH 3UYRH 2R1YB 1EHAA 5DHYB 4XNUH 2FZ3B 2VLJD 3MLRH 1KXVC 4H5SA 3Q3GB 3QNYB 4UQ3A 4U1NB 5FYKD 5DQDL 3MA7A 3BSZL 4R4NC 1BLNB 1EHLL 5IVZB 5J6GA 3RVWD 3HI6L 5JIKA 4FQ1L 1UA6L 5MP6L 3HC0A 2ZCLH 4F7MA 4JAMA 1XF5B 1ZLUK 2L0DA 3GSWA 3IKKA 1A6WL 2V5RA 3PGDA 4NHCL 4XCFH 5ITFA 1C5BL 1CD0A 1PYWA 1RZFL 5L9DL 3EYUH 3LD8B 4LPWA 1QFHA 4JFEA 2OR8A 3KPMA 4JFPB 5FCSH 12E8H 3QDMA 4HH8A 1U8PB 3HB3D 3IJHB 4G7YL 2Q87A 1N59A 4EN3B 1IGJB 4D9RE 1U3HD 2OLDA 2DTML 5EO0B 5F7LB 2Y06H 4ELMA 4WI2A 5GGVH 4XNMB 2A38A 3M17B 3EO1B 3PV6B 4O51A 3GK8L 4PUBH 1CFVH 3O3EA 3OF6A 1BFTA 1C5DB 5IK3A 5EU5B 3S97C 3NABH 3IVKB 2LAGB 4G7VL 3B2UD 2XN9A 4G6FB 4ZDHA 5I2IA 1JGEA 5FO7B 4QYOB 5T1DL 3GB7A 5TFSL 3UPRB 1P4IH 3CSBA 3VW3H 4XCNB 2G2RA 2O5ZH 5BVJA 5FYLD 1I75A 3MRBB 1OT1A 3WIHH 4ESKA 3D39B 3EYQC 4WI4A 2DLIA 1S7UB 3WNOA 1ZTXH 3QIBC 1H3TA 4ZYKA 1YY9C 1S78D 5E6ZA 4KK9D 4RFOL 5K9JL 3V7AE 5C0AB 4HJJL 1HZHL 1BMGA 3P9MB 4KDWA 2X6MA 2J3SA 4OUUA 5KZCD 5FDWB 4JVUA 5F97E 3NBNA 1FVEB 2R15A 3NA9H 4I18B 5IVXA 4XP6H 4ZOEA 5I1GL 3WDIA 1AFVH 4JRXE 1WZMA 5I1DB 3UC0H 4DAGH 3GBML 1NANI 5CGYC 3S34L 2Y07L 2EE3A 3ARXA 2AKRA 5D7IB 5JW5A 3W39B 2FD6H 2XICA 1H5BA 5CIPB 2NY5L 1OF2A 3RUGF 1WF5A 1KPVB 1Z6JT 2X9XA 4YAQA 1QLEL 2CLRB 1J1OH 1ZHBA 4WEBH 4I9WE 4KZEL 2YRZA 4JO2L 3TBVA 4OQTL 2FH6A 4XGZA 4S2SB 1DVFB 1H15A 4GW4B 3CPLA 3WUWB 1R5IB 1BQHB 5CEZE 1LEKA 1HHJB 2Q3ZA 1VKXB 3JTSB 2DQEH 3ARGB 1QACA 1ZT7B 1CXLA 2YUXA 3RP1A 4OF5A 2FEDD 5GRVL 4KJQD 2F53A 5E8PA 4Z7VE 2LV4A 2VXVH 2VXSH 5F96H 3RGVD 3UBXA 2VXUL 3HHRB 2MCG1 2P5EB 4ENEC 2NY6D 4KUCD 5D4QA 1D9KB 2QSQA 1EXUA 3FO0H 4J6RH 4NN6C 4GS7C 3MZGB 2WBJB 3H9YA 3P4NA 4PRNB 1A3LL 4NKIL 2WQRA 1MUJA 3V6BR 4L4TB 4JO3L 2KPNA 2AK4E 1MIMH 3NPSC 5BS0B 4EXPX 2PO6D 1OAXH 4OZIA 2V6HA 5JTWA 1CLYH 5F6IC 1MRDL 3FFCA 3E8UL 4HBQA 3RX5A 3MNWB 3ZKQD 4JM2C 5CFHA 3T0EA 1JL8A 3H7BB 4PY7A 3LZFL 1P1ZB 5F1NB 4GT7A 3HRZA 4Y0GA 5D6CB 5FCUL 4P3DB 1ZT1A 5FKAB 5DVLA 4YPJA 2APXA 3VGDA 3IRZA 3NCYS 1MJUL 1LK2B 5EA0H 1FNHA 3P0VL 5D1QB 5INCA 1BM3L 2H9GB 1LE5B 1P7QD 4JO1L 1OTTC 4LNVA 1LO0L 5FO8A 2COQA 2ITDB 2OTWB 3MLZH 3TPUA 1MRFH 4KRMB 2YA2A 4MWFB 1M71A 3I3DA 1QBLH 4OCLC 4OJFL 1QPXA 1CGXA 1LD9A 2PXYD 1H8OA 4ODBD 3DXAD 4MS8C 4XPFL 4GMSH 3BWUC 2ZSWB 5KVEL 3O6LH 4DTGL 3L3GB 4HK3J 5D2NE 4Y4KD 1I1YA 4RSVA 1JPST 1NGQL 4U1IA 3ARPA 5E2VH 4IRJD 2BXZA 2BNQD 3OGCB 5E2WL 3QJFA 4RWHA 2EO1A 4NCC2 3LEVH 3TEUA 2A0LD 5DZLA 3DARA 3EYVB 4LEXH 5EU6D 3BPNB 5TQ0H 2GSIB 4M8QB 1JNHA 5ICZB 3VMNA 2LTQB 4KQ3L 5BOZG 2J88H 3KWWB 1DDHA 5DQ9A 1V7MH 2NTSP 5T3XH 3UTSA 3P40A 1HSBA 3BUYA 3EOTL 3OKNB 4NQEE 1P4LB 4TRPH 4HHAA 4OLEA 1I7TB 3KHOA 4JQIL 4KKLC 3QO0A 1NH6A 5M95B 2HFGL 1ZHKB 3HZKB 2FGWL 1DR9A 4JY4B 2CJUH 4OLUL 5HHQA 2YXMA 3X12A 2BMKB 1J8HA 2HT2C 4P57A 4X6EA 3BZEB 3QI9B 3ELAT 1RJLA 1LO3L 1QHPA 4L4TD 2I5YH 2OSLB 4JY5L 1BBJB 3WS6A 5TQ2L 3MUHL 4LLWB 4PJCE 2AXGB 4YBQD 3MXWH 3PWVA 4ONFH 1IZJA 3MV8A 4QHLA 1U8LB 7FABL 2IPUG 2A1WH 3R1GL 3VXOA 4Q6IC 1L6ZA 4C54A 5IVNA 2J2ZA 3VD4A 1UXWB 3ECBB 4LCCA 4MB5A 4F2MB 3QNXB 4P23D 1VDGA 1GGBH 4JFXB 4U6HB 1X5LA 3LQAC 4XPAL 4RDQG 2HVKB 5DRNA 2JJWA 3C5SA 5HBBA 1OTUD 4LMQI 1OGAB 1LQSR 4KY1H 1ONQA 2B0SL 1QSFE 1WITA 4XZUA 2VQ1A 4LGRB 1MREL 5DHVH 2MQ3A 4N90D 1NCDL 5J9PB 1L7IH 1BHGA 2OZ4L 4RGNB 2F19H 3GKZA 5KOMC 4ERSL 4LVNC 4S0TD 3SBWA 3E2HC 5SV3A 1MLBA 4HXBH 3VXRA 3VRIB 2DQHL 1M4KA 1NCAL 3SDAD 1B0WA 4I77L 2OJEB 4XAKD 1S9KC 4IOFC 5DJDA 1LE9B 1S9XA 2AJVH 5I15H 4MD4A 3BAEH 4AT6B 1DQQA 4CVXB 2ATKB 3GO1H 3VGAC 3OR7B 4DZ8A 3RHWK 1NCTA 1GOFA 3GMOA 1BFVH 2MQ0A 3JV6A 4K71C 2MCPL 4CKVX 1Z0NA 3STZA 3TA3B 3K80A 3MRLA 2R69L 2R2HA 3DVIA 5IMKA 2C4FT 4RGMC 5KAQF 2ZG3A 4UUJA 2WUCL 4LSQL 2W1NA 3MROB 4XXDA 2Q86B 4KRPC 5K9KB 1EAPA 3UO1H 1H3PH 3IF1A 3QUXC 5I75B 4XMLL 4AENB 3NIGF 4PTUB 5D5MA 4TNVF 1I8IA 3TIDA 4HS8H 1RURH 5DJ2A 2E6PA 4ZUVB 1FNLA 4ZG1A 3QUYC 4WI5A 3D2UA 4PP1D 3CFCH 2H1PL 5TJWK 1H8SA 1IBGL 4OZGB 2YD3A 4TSAL 4FQ2L 4RCAA 2H3NA 3C5ZD 3EFFB 3DI2B 3L5IA 3OKDA 3QUKA 3QUZD 4FFZH 4JQXA 1VCAA 5DK0A 5A1AA 5DMIH 1QLFB 4FXKA 1YA5A 2XPGB 5I74B 1I8LC 1WEJH 3PNWA 5JHDA 5GGUB 4Q2ZA 4UT9L 4ZOBA 3DBXA 4GXUN 4Z7NE 2E8YA 5HVHC 4NQTA 4YNYA 2QQLL 4LLUB 3ZYZA 5I1JH 1B3JA 4GAGL 5DO2C 3FHQA 4MB4A 1UB6B 3O6FD 2OQJB 3KHQA 2JELL 4UMGA 5CHNA 3KJ6L 4YHNB 1FCGA 4EBQH 2UVEA 2NY1C 1RFDH 1FFNB 2ESVE 1ADQL 3BD5A 4OCSL 3GI9H 1CBVL 3BP5B 4F9LA 4PR5A 4YDVB 2AXFB 3OB8A 5HHOD 4XVTL 4ISVA 1P84K 5IB1A 4Z76B 3VFUA 4TTGA 1Z5LA 2HKFL 4S1SL 2CIKB 2GJ6A 4LSUL 1MFAL 5IJKA 3IDIB 4HKJB 2QBWA 1JHLL 1CDHA 4R2GC 3EO0B 1I3GL 2R9HC 3FTGB 1KB5H 2EDDA 1UM5H 3QH3B 3ARDC 4HLZG 4XPTL 5K93A 4DGYL 1I3VA 2DKUA 2ZPKL 1QSEB 3FONA 2P7TA 2A74B 1KF9B 3U0WL 1I8MA 5HI3D 5BW7C 4LEOB 3T0DA 3MMEB 4FHBD 2VLLB 5LCVL 1F00I 4KKBD 1EEZA 1DTUA 4K3HA 4PJDE 1YEKH 2DIAA 4P3CH 1G6RA 3PG2A 5T3ZL 5IJVB 3QRGH 5EUOA 4BQ6A 3S3SA 4R97B 5I8OH 5E2UH 1BX2B 1JNNL 4NP4H 2DQCH 3VI4F 5TDNB 1VEMA 1QVOA 4ZS6C 3CDCA 3HTLX 4FFYH 4M43H 3O41A 3GI8H 3RGHA 3QEGL 4ZODA 5K9QI 5MERA 1T03L 1YEHL 4N0FA 4RFNC 3QEUB 4LLYB 3EAKA 3S3JA 4MJID 3D0LA 1PVHA 3K1KC 3BW9B 2VLME 1J0HA 2V9RA 3Q6GH 1XF4B 4JZJB 4S1RL 5L0QC 2IALA 1XIWB 3MRMA 4W6YB 2GITA 2NY0C 4P9HC 1DQDH 3TO4A 5CZVL 3LHPL 3RVTD 1MCJA 4EXKA 3LN9A 4CU8A 3C8HA 4JE4B 4XMPH 5J6GB 4Y2DC 3HAEB 3QFDB 5B4MC 2A6KB 3RI5F 3O2VH 4N0UE 1M05B 4HWNA 3U6RB 5C0FB 1JNLL 4R0LC 1IM9A 4GRMA 2W91A 3VGEA 1WBXA 5E6IB 4JN1L 4E5XB 3HMXA 2CXKA 3OJ2C 1UVQB 1FL5A 3R06A 1V7NH 3AXLB 5JOPD 3TN0D 1U8HB 4GXVH 1OLLA 3O3DA 1SJHA 1J1PL 5C9JB 1MOEA 4JANA 3TH2T 4I2XE 5FHBH 5D1ZA 2ZG2A 1OOAA 2P8PB 1LO5A 3ARBC 1DBKL 4XPBL 1FO0A 5EC2B 5D1XD 5IG7B 2HWZH 1SBSH 3UXFA 1F11A 5IVOA 4E42A 2XN9B 4JFFD 3IXAB 4XNXL 3S88L 2VR4A 5IFHL 1HILA 2IWGA 5B38A 4D2NA 4MXVE 2G2RB 4HZAA 5IHBA 2F5AH 4RWYL 4BH8B 1YN6A 4HPOL 5HYEA 4W81A 5CEXA 2R2CA 4ZYKB 4FQXB 4Y16A 4G8EB 1YEJL 4KTEL 3B2VH 1XGQB 5CEYB 2CSPA 3MFFA 3C60D 2XZCL 2FBJL 3FOLA 4J4PD 1MCLA 2LU3A 1F4YL 3BIKA 3NCCB 4OCRL 4QXUL 1HHKA 1D5BA 2Z31C 3PGCB 3GRWA 2VN4A 1GZQA 1RIHH 4HUUA 3GSXA 3MUY1 3E6HB 3U4BL 1BD2E 4I3SH 4JJHA 4PJ7F 3U7WL 2WSKA 2PW2A 1IQWH 1UZ6E 4BSVB 1G7QB 3C6LD 1JI2A 4QRRD 4LLDA 2H32A 1SYSA 4LNRA 4U1SA 3CLFL 3LMJL 1BOGA 3VU2A 3X3GH 4N9OB 5CJXA 2P24A 3VFGL 2CUIA 1ZHBB 3MJ7B 2Q8AH 1UH4A 1Z2KA 4F58H 3TBVB 1V5JA 2Y5TA 3HA0A 5TPWL 1CE6A 1OY3B 2V2WB 2GCYA 3CX2A 2UZIH 4P2RB 4UIMA 2DQFB 3FFDB 4ZMAT 3QDJA 1XT5A 4EI6B 2F8OA 3U7YH 1KTDB 2ZNXA 3N1GC 4RGOH 3N9GH 4UNUA 1BVKA 4U49A 4JFED 4ZPVB 4C55A 1PX3A 4OB5L 4FQLL 5I6XC 5B8CC 1MH5A 2BC4B 3QDMD 3WDHA 1MF2L 2EDTA 5MHSD 4Y1AE 5F3HB 1I1AC 1ZS8A 1F90H 1KT2A 4TQEH 1EXUB 1UACL 3VFMB 1WBYB 3IFNL 1MHPH 3I6GA 4EZMA 3O45B 1WBZB 4JDVA 5AD0A 3AY4A 4WI6A 3OF6D 4U3XA 3T8XA 5DC4B 1TQBC 1RULL 2E9WA 1JMXA 2VN7A 2NX5B 5AZ2L 2FIRT 1TZGH 2VWEE 1WZ1L 3GMQA 2XN9D 1ZGLP 3L5XL 3U7AA 3QULA 4FQHA 2DOCA 2DQIH 4J8RB 3RL2B 3QFJE 1RY7B 3TJEH 4M1DL 1PKQB 2ARJA 2EDOA 3VWJB 5L7XL 2D9CA 3OG6B 1A9BA 4WY7L 5E9DB 1T1WA 1CU4L 5CWSA 3M8OH 3MBEB 3OHXB 4FP8L 3CXDH 3JWDH 3KYAA 4P46B 4JDZA 4XP1L 1S5IL 5ESVA 1DE4A 1MCWW 2ADIA 4NJ9H 5H2BB 1F4HA 1S7RB 5IQ9B 2GQHA 5CJBA 3O8XB 3DX7A 4OD3L 1T2QL 3RZWA 3OAZH 4JPWL 1RMFH 3GSUA 5IW6A 5ESAA 2BVPB 5C0CE 4MX7B 1G9NC 5HHME 1N5YL 1KEML 2CDEA 4PJBE 1ORSA 2IANB 3QO1A 4LSRL 3WIHA 1M6OB 3GJFH 2JCCA 4XWOC 4GUPB 1FE8L 3ZT7A 3VI3F 2VLJE 3RJDA 5ACZA 1ZMYA 1KCUL 2UUDK 4MAYA 4P2OC 3DGGA 1JV5B 4I1NB 4IBLT 4EDXB 1AP2A 1Q94B 5J11C 1Q72H 3QEQA 4XNZB 5FGCB 2FEEL 1TVBB 5K9OB 2NY3C 4PJGB 3WD5L 5IESL 3A67L 3KNBB 2DM2A 5CILL 5I1KH 2O5YL 3U30C 3QYCA 2ATPB 5DVMA 2ICES 3OB0H 1HH6A 4FQQA 3B9DA 4U7MA 4DOHB 1UWGL 1MCCA 1A0QH 4X8XA 4TTDC 4UB0L 5HVFB 1FN4B 2W9LA 5EWIH 4NZTL 2F53D 5T1LB 1P7KB 4HHAB 3PXJA 4DZBB 3MRDA 4GRWE 5F7EL 1GAFH 4L9LC 4WDIA 4H8WL 4O2CA 5HDBE 4PLJC 3RWHA 3MLVL 1AD9A 3H0TB 4O02L 4KDVA 2CRMA 3GJEB 4PJIA 4YGVA 5HHQB 4XAWL 5GGVY 4U6YA 4X6EB 2YK1H 4LPCA 2E7LA 2VDQL 2FYYB 4L29B 4ZQKA 4G80B 1H3UA 1BPVA 3QAZC 4MA7H 4H25A 4N1EA 4O00A 4P5KB 3QXAB 4W4OA 2W9DL 3KG5A 3QIWB 1CFQA 1HN1A 1WZLA 2H2PC 5J57B 1WFTA 2FWOB 3FFCD 2YPLE 1A21A 1HHGA 5C6PB 4JFHE 1LNUB 3T0ED 1AXIB 3G04B 1QRNE 4LP4A 4LKXA 2L4OA 2F54E 3MOBH 3MRQA 5I1AB 4NHUB 4PJ9C 5FF6A 2YUWA 4I48A 1TCRB 2CKBA 2IPTH 3QIUB 1VADA 3RTQC 1JPFB 1AI1H 4ZO7A 4AEIH 3MBXH 3MCKA 2GJZB 2VQ1B 1T83A 3BZ4A 5H94A 2ZOKB 1YJDC 4PV8A 4PIRF 5CBAA 1F3JA 3MJ8B 2WBWB 4O9HH 4XRCA 3PHQA 4OLXH 3TFKC 3DX9A 4UOW1 3SE8H 4N9GA 1CIDA 3X11B 1TETL 2BVEA 1E6OH 2CIIB 2H2SC 1ZT4A 4I0KA 3O2DH 2ZCHH 3O0RL 3F12B 4JM4H 4XI5D 4JZNB 4IJ3C 1RZJL 1XAUA 4J1UB 3MX0A 5JW4N 2B7DT 3ABZA 4P4RA 3Q1SH 5LGJA 4R26H 3MUZ1 1XGYL 1PZ5B 4GBXA 4PJ8A 3OXSA 1NCCL 1P6AB 1JGUH 1I7RB 4H88H 3MRLB 4NZDA 1MCFA 1I7ZA 2FDBP 4BFIB 4UUJB 1INDH 1UG9A 4RFEA 1OHQA 1EGJL 1DLFH 1FFPA 2VKXA 4XP4H 2HYMA 3UTSD 1F4AA 1NSNL 2NPLX 1JZ7A 3J8F7 3ILQD 5JW4Q 1RIUH 2DN7A 3SPVA 4X6DA 1QFWH 5I1CL 1R0AL 4LKCA 4P49A 3SO5A 1VEPA 3ESUF 5DVNA 1PEWA 5HI4C 5HYJB 2BVQA 1J8HD 2WW8A 4L3AA 1NFDB 3INUL 4LCWA 3V7MA 5F9JB 4M62H 3WUZA 3GMPB 5FA4B 1RK0A 4G6AC 5FYJD 3PL6C 1G7PB 1VFBB 3RU8H 3T04D 2FSEB 1VFAA 4YR6A 1WIOA 1RZKL 1LO4L 3KPSB 1S9VA 4PD4K 3IDUA 1CGUA 1NBZA 1HINL 1GGIL 3MV8D 4G3YH 5KVFL 4PGDA 2QL1A 1EDQA 1R5VB 3DGCR 3PNWB 4Z0XB 2EKSA 5J8OA 4Z8FH 3WIFB 3RWCA 5B3NA 1ZA3B 3AB0C 3ZT5A 4YHOL 4NUGH 5A2KH 4ZPTA 3F6LA 1JFQL 2GTZB 2XA8L 4HIIB 5IMMA 4YXKL 2OK0L 4M5YH 5EO1B 5C0AE 2UY6A 32C2A 4UDUA 1BAFL 4YC2B 4BZ2L 1BJ1H 4ZO9A 1XGUA 1A5FL 4QO1A 3FN9A 1A22B 3D85B 5GJSH 2FATH 4X9IA 4NKQB 2HLAB 5F1KC 4ZD3L 3MLYH 4YO0A 3GHBL 1F58H 3FOMA 3HCVB 3SKMB 5IOPA 2FRGP 4JN2B 4ISVB 3VXRD 3DXAE 2FECI 1BVZA 3S6CA 4FMKA 1D7FA 1Z5LB 2YPVH 2VMFA 3EJYC 5DFTA 3MRHB 5JOFA 2J8UA 4M6MH 1JCKA 5T3ZE 3PWUA 4RA0C 1MFEH 3BKMH 5DHVA 3KXFB 1IAIH 5GQBA 4QHMA 1YEFL 5ID0A 4XVSL 1J1XH 3W81A 2MMXA 5ICYA 4MNGA 5EN2B 4ZOAA 3VXNB 2P7TB 4NN6B 2XTJB 3AS2A 4P59H 3IFLH 4D9LL 3DRTB 3MLSL 3SGKC 2Q7NA 3SO3B 2DLEA 3NTCL 1GJIA 3HUJE 2D0HA 3BJ91 4L8SA 4NO2B 2BVYA 1S7TA 1AQKL 1UM6L 3U0TA 5F6IB 3PIQB 2P5EE 2E7CA 1DBBH 4AIXA 1RZIB 2W0FB 1NDGB 1FRGH 5C0BA 4BYHA 1N26A 3MJ9L 4WV1C 3CUPA 2MTPA 3D2UD 1MHEA 4HWZA 4L4TE 4KI5E 2J4WH 3N1PC 5EOCH 1AXTH 1YPZE 5IKCA 3JXAA 3VH8A 5DJ0B 1INEH 5F21B 4WU5A 1JPGB 5ENWA 1YN7A 1KTRL 4B50A 1BQLH 5AWNL 3C9NA 3HPLB 1NL0L 4ZTOL 5GGSA 5DD0L 5JHDD 3TBSA 4F33A 1KPRB 3IGAA 1OB1B 4HZLA 4OF0A 3ULVF 1KCSL 5F70A 2IPKA 2R4SH 4WW2A 4MA1C 1AGCB 1FGVH 2FO4A 1NGWB 4ODTL 1M7XA 4HK0A 1HK6A 4RIRA 3FCTA 3SJVB 3VXUA 4C83A 3KPNA 5IVXF 3ROOB 4ZXBB 1WGOA 2HT3D 3DHMA 3WFEL 3O11B 1F02I 4K3DH 1UZ8A 3CVHB 4O2FA 5L2JA 3C8KA 4HCRH 3G6DH 2C3VB 1ETZA 1NPUA 1QR1A 1JRHI 5JXEA 2QQQA 5MEQB 1S9YB 3SKNB 1AGBB 5HGDA 3WXWL 4GKSB 2MKWA 5CJOL 3BQUA 1FL3B 2IQ9H 3LPFA 1A6VH 2GJ6D 4GSDH 1T5WA 1DBMH 3GMMB 1IEAB 4LPUA 3IETB 4QXTB 4CNIA 1N8ZB 3NZHL 4N5ED 4R7NA 1JF5A 5BZDB 4PRDB 1EBPA 1GZPA 1DLHB 2H26A 1BWWA 5IR1B 1MNUL 2G75B 2FJGA 3QPXH 1OVZA 2DWEA 4UINH 3TBYA 2Y9RT 1ITCA 5AAMA 3O9WC 4V1DB 4RMTA 4R8WL 4KXZH 2R0ZL 1QRKA 2YD9A 2BJML 2YZ8A 2YN3A 5HHPA 3WFBH 2XTLA 2CK0H 4OLWH 3KYOB 3O6KL 3TBTA 2X1WL 1MJ7L 3G6JF 4LIQL 5GGSY 2IAMB 1F13A 3MFFB 4RZCB 1N7MH 4K7PY 3U46B 1KB5A 4Q6IB 4QWWD 3BZDA 4H26A 4L4VA 4MMXC 4WGVB 4NQSB 1YYMH 2AEWA 1XF1A 5E94A 3BDYL 4IRSC 3GGWB 3RKDD 4OZIF 2J12B 3EOYG 5KG9B 2XZQH 4UU9B 1F6AA 4PG9A 4LBEB 2GFBA 1KPUB 2R39A 3ZKMD 1TPXB 3TYGH 5D2NC 3OAYK 5JZ7C 2H41A 4Q0XL 2Q8BL 5EBGA 5B22A 4NKDB 3B9AA 3SY0B 1IKFH 3TO4D 1NGXA 1R3JA 2PTVA 5SV4A 1RUAH 4NZUH 5HI5C 3L3IB 4I0PC 3F7VA 1G7IB 2AGJL 1MAMH 3BT2H 5EIVA 2WNGA 1F97A 4HBCH 4MD0A 4U1HA 4X5LA 1IT9H 4RGNE 5EU4A 2V2TA 4XNQA 2RB8A 1AH1A 1FVDA 1U8MA 1IM9D 3CC5A 3QUMA 2EH8H 4BKLB 5HHOE 2I9LB 3VG0L 1JP5A 5CSZA 4NM4H 4MJ6B 2R8SL 4OCYL 3U2SA 1A7BA 4WW1B 1F45A 1W0WB 2BOBB 1F4WL 4U1LA 1C5CL 4OAWA 3RHWF 1AD0A 2X4SB 1ZS8B 1YEEL 3BKYH 4P9HH 1QG3A 3PP3H 3L3OA 1GSMA 4GJTB 4UDTB 2X1XR 4Z7WA 4N8PA 4FABL 3BPCA 1BFOA 2E3VA 4GAFB 1RQ5A 2X42A 4MXVF 5D1ZD 3HE7A 1YEIL 3S5LG 3WL9A 4FS0A 1KGCD 1FNSH 3T8XB 2QQNH 2VRAA 3DMMC 3FB5A 3P3YA 3PP4L 4GKZA 5C07B 2W60B 5DLMH 2VDLH 3AREC 1QD0A 3ILPA 4JRYA 2W9EH 3ZDZE 3SDCB 5CSGA 1QO3B 1LP9B 4ZFOB 4Y19B 4OI8A 2C3WA 3ZKXB 4ZUSA 5FB8A 1RAMA 1ZA6B 1A9BB 3WNNA 1GGCL 3W11C 1NCBL 3MUGA 2QHLA 35C8H 4JKPL 3BKCL 4Y16D 4FQIL 5DC9B 5ADOL 1JZ5A 2ADGB 1R24B 1UZ6F 4L3EB 3ULUF 4R90H 3KPRA 3ALWA 3ZT6A 5IW6B 5IM7A 4OZ4B 4K3GA 1FFOA 1LDPL 3HE6A 3D18A 2NNAB 1J05B 2ZOLB 3NGBC 1ORSB 3BISA 3DUUA 2XV6B 5ACZB 3MUJA 3IKCA 5C70A 4OTXL 3WJJC 2X4OB 4PJXF 4I4WB 4RRPA 1TVHA 4R4BA 3MREB 3ZKND 3JUYA 3CZJA 5KW9H 1T89A 2BY2A 3JWOC 4M7ZC 4ODVH 2BNUB 5IB4B 1JWMA 2H8PA 3TNMA 4CVZA 1U6AL 4QRPB 1Z3GH 2B1HL 5KSUA 3QDJD 2R0KL 4HIHB 2Z0BA 4R4FH 4AQOA 4XH2B 3JV4B 4DKEL 3MGOB 1IGML 4TSBH 1NMBL 1KJMB 1QNZH 2NXZB 2VDKL 3HS0A 1B0GB 4GRLC 1EV2E 4HF5L 2LQRA 4WDIB 3CH1A 3NACH 4IEFB 3S35H 3CAFA 4RAUB 1IQDA 3MOQA 1CZ8H 3CX5J 5E00B 4UTAL 3BGFB 3MLUL 5FYKH 2RBLA 1KFAL 1JRHL 4X6FB 3FZUD 3T65B 1GGUA 1QPPA 2HLFC 1G9ML 4ZQKB 4JJ5B 5BMFH 5JQ6L 3F58H 1KXQE 4H1LG 4QY8B 4JFFE 1R3IL 2DLFH 1T3FB 1D6VH 2YC1A 2JK5A 3DECA 3PXHA 3CMOH 5D2LB 4XNYL 1DQJA 1IGYA 3WHXB 2HKHL 2WUBL 4PJ5A 1SHMA 2DMCA 2X4NA 4Q6YA 2NXYB 4NO0B 2HG5B 3TIEA 2PF6A 5D5MF 3DO7A 2BX5A 3ZTNH 1MFDL 3HN3A 1CDIA 2D03L 4H20L 4P4KA 1GC1L 4BSJA 3ULVC 5DJCA 2ZUWA 3QDGA 2XZAL 2EC8A 2IGFL 5CUSH 3QCVL 1Z0MA 1OPGH 2HP4A 1UYWL 1GHFL 4KI1A 3NCJH 5JA9A 1P53A 2ZUXA 4NQCA 1KENL 3QP3A 1F3JB 4FQJH 3X3FH 1TJIL 4Y5XB 5C6WH 3QPQD 4EI5C 1HWGB 1TTGA 5E8OA 3X14B 1KTLB 2EICA 5KSBA 3MNVB 2VE6A 3NCEB 4WO4C 4N9GB 4EOWH 4QRUB 2HJLA 1EFXA 3MRJB 4Y8DC 4QRRE 5MEPA 1ZT4B 4NSKA 4MAYD 3N50A 4OGAC 1A14L 3P77A 4OCWL 4FTVA 1TMCB 2Z93A 3QEQD 3OL2A 5E5UB 2VAAA 2A73B 3R8BB 3LKRB 5C0DA 5BV7H 5L88H 4U05A 2KQMA 2P42B 4TUKL 1ZSDB 1NAMB 4U2ZA 2E7HA 3HPJA 5D7LB 5HDBF 1FGNL 4M9PA 4ONOA 4P2YA 1TJGL 1MLCA 1J12A 4C56A 5C0GB 4M5ZH 5JDSA 1VEOA 5GS0D 1LO2H 1NFIA 2XQBH 2Z35A 5F7DA 5DJ6B 4Z18A 1I4FB 1OP5H 3EDDA 3QIBA 3ZL4H 5TF1H 4CMHB 5DMYA 5HGHB 3UAJC 1XF2B 2DQGH 4KTDH 4KK8D 5KTEH 4DKFH 2FX9H 2FIKA 2WANA 1DFBL 4NRZB 3VFPB 3VMOA 3RVXC 2MHAB 3ZE2E 1XR9A 1TJHL 1H3WM 3VXTA 4XP5L 2XN9E 2IG2L 1FZMA 4UIKL 4OZHA 3GHEL 1C08B 3L7EA 2VDRL 2GK0B 3O2WH 1Q9LA 1JZ8A 1T5XA 2MSPA 4ODSL 5GGTH 1MCBA 4PJAB 3LKSA 2C3XA 4KK5C 2NW2A 2EKSB 2ZCKL 3QWOA 5EUOF 2R56H 1ACZA 2P5WB 1N64H 1HHIB 4OUOA 4G5ZH 3DSNA 2VISB 4OI9A 2A9NL 4K94L 1EZVY 4C4KO 4ODUB 2J1KA 5DJAA 3AU1B 3G08B 4WU7A 4GG6B 1RSFA 1JN6B 3WJLC 4LFHD 4KDTA 5J12B 4MNQB 4JFDB 2QADB 1HE7A 2B20A 2HVJB 2CLVB 3EOAA 1DQMH 3VXMA 4QXWA 1FJ1A 1F6LL 1N4XH 3MSPA 3I75B 2BNRB 1MJ8L 5DTFB 3KS0H 1IAMA 3J7HA 1SEBA 1YMHA 1F3RB 2VLKA 3D1MC 3UZEA 4JFZH 4WVRA 1AO7B 4HKZA 3WE6B 1C16B 1MSPA 5J3HC 3G6AB 4ONGL 5DHVB 3TWCH 3GSQB 4Y4FC 3I84A 3G5VB 4KRLB 3S98A 2GK2A 3EFDL 1DUYB 3LKNB 1I1AB 3GIVB 4GBXD 4PJ8D 1HWHB 5D7JC 3VGFA 4Y89A 2IPUK 1UENA 4PRAA 2WINB 2V5SA 3MTRA 3RVUC 4ZFFA 1RZ8A 2Q76A 1A6AB 1VGEL 4KJWC 1FQ9C 1EZVX 2F53E 1L7TL 2NR6C 2PTUA 9CGTA 3FQRA 2OS7A 1HXYA 2HRLA 4JM2A 2NY5C 1FAIH 1XZ0B 3MACL 4WNQA 4TYUA 3FQUA 3V0VA 3BN9C 1L0QA 3HR5A 2Q3AA 2EE2A 4OZFG 2XQYK 3OTTA 1NBYA 1U9KA 5AUMB 4ODHH 1FZJA 4EQ2A 2XWTB 5IBTL 1NLDH 3K3QA 1CR9L 5GS1B 2HMID 4HS3B 4P9ML 3SHSA 4LCWD 4KZDH 3RFZC 4IS6A 2NX5E 5C0IB 3IDYC 1EEYA 1GPOL 1C1EH 2ICWB 4XNUL 4WU5B 1NMCC 1F8TH 2AQ1A 3MLRL 5JPNB 5EC1A 3D5OF 3FRUA 4PJHA 4PRIB 2QSVA 2ILLA 5F88A 1O5DT 4QRQA 2C3HA 4DEPC 5BXFA 3DURA 4QRSB 1PKQE 4HV8B 3LRSB 2VH5H 3P9LB 2AW2A 2ZCLL 5E9DE 4J12A 3BDXA 3MYJB 4HFUH 4XCFL 3T2OA 2LAAA 1A9EB 3FO9B 5FOJA 3SDXA 3EYUL 3V6FA 1XGRA 4KROC 3RWFA 5B39B 1VGKA 4G42B 4NQVB 4ZAKB 5D7IF 2XWBB 3VXSB 1E4WH 1FNGB 3RVVD 5DURD 12E8L 1CG9B 4WJ5A 4GLRH 1F3DH 4ZFOL 1LEGA 1UZ8B 2Y06L 4CU7A 1MFCH 4NFCA 2MNUA 4LPVA 5GGVL 4F7PB 4XBGA 2C1OB 2IANE 4LHUA 1PG7W 1QBBA 4KKAD 2XY2A 3EIFA 2WWMC 2AI0L 2YEZB 5FDYA 4O2EA 2D4DA 5BVPH 5CBEA 3WNPA 3LRGA 3BQUB 3NABL 3BP4A 2WBKA 2VWEC 5IHZB 1IGTA 2CQVA 1MAKA 2FHBA 3C2SA 4JHBA 4OFDA 4WWKC 2Y7QA 4PJGE 3V6OE 1P4IL 4L9LB 3VW3L 4LIQE 5DDHA 4NGHH 2O5ZL 3E6FA 4YHYB 1RZ7H 1I9EA 5C08A 4DOHE 1G7JB 4Q97A 4XBEL 2NZ9D 3BEWB 4OIIL 1ZTXL 4YHIB 3S36H 5JUEH 4JFOA 3RDTB 5IW1B 2EYRB 2UYLB 4IIQB 4N1CA 5IGXH 3FRPG 1YEDB 4K8RD 5GRWA 1DEEA 3NA9L 5EULV 3B5TA 1Y18B 3RWDA 2F5BH 4QCIA 4XP6L 3IDGB 5C0BD 4ETQA 1AFVL 3EOBA 4JVWA 4MD5B 3I02A 3CFJA 3HG1A 5DJZB 4PLKD 2EXWC 4L8CB 3Q6FA 1FNEA 1J0IA 2FD6L 3KLDA 4KJPC 4M02A 5AEAA 3W9DB 3BH9A 2W92A 5H35B 4K7FA 3RVWC 1UKSA 2D31A 3L3KA 3OKOA 4GQ9L 1IEHA 4YPGB 4WEBL 4JHWH 2Z9TA 2HTLD 4PGEB 3MCG1 1E28A 4PYHA 5C09B 5IIEB 4YHZL 1X5GA 2DI9A 5TGBB 4GAYA 1CFTB 3IDXH 3BH8A 5M7QA 1B6DA 2QV2A 3STBA 4V2CB 3RZCB 2VXVL 3HB3C 2VXSL 1RPQA 3SDYH 3VXUD 4ACPA 5I66B 1KC5H 5EU4B 5F96L 1HIMH 4ZNCD 3O4OC 1HXMB 3G5XA 4J6RL 1MWAB 3FO0L 4WUUA 3VXRE 3IJSA 4HIEA 1T2XA 4P0DA 1AY1H 5HXMA 1N3NA 1IAKA 3BXNA 1NDMA 2EEAA 3QUXA 2X4QB 3V95A 5JXED 5HPMB 1HH9B 1MIML 3B2UC 3BQUD 1OAXL 2A6IB 3T77A 4JFYB 2RFXB 4QF1B 1CLYL 4X98B 5GIRA 2PYEB 2VZVA 1ZLVH 1EK3A 3ALXA 3PQYB 3L3DB 1G7LB 1SYVB 1DL7H 25C8H 4HCRA 1C12A 4G6MH 2V7HA 3QWRA 4OD1H 4R96B 4K23L 5DSCA 4HT1H 1IL1A 5GGQH 2AS5M 1E4JA 1I8LA 1BBDL 1A64A 3VXPA 5FHAH 2G9HB 1RD6A 2H6PA 4MXQD 3SCMA 4NFDA 4PJIF 5D93B 5E08H 1WUNT 3W9EB 3MLZL 1MRFL 1QBLL 1NFDE 5IF0A 4L4VD 1A7OH 3RWIB 4B5EA 5EOCJ 1FVCB 2FL5B 5BCAA 1FFOB 4CL7A 5IEKB 3QJHB 2CRYA 3HC4H 5ICXA 1NC4A 5HY9A 1R3HA 4U4BA 3KPSE 1BP3B 3WS3B 5E2VL 5C9KA 43C9B 3NN8A 4J3TA 1JE6A 5ALBH 3CFDA 2Q7YB 2GI7A 3L95B 1JGDA 2M8XA 1U0QA 5DUPH 5CD5D 1NBQA 4LEXL 2BY3A 5TQ0L 3LD8C 3S5LB 3H9HB 2NY4B 3QZWG 4X6CA 1YMMB 5SWQA 5T3XL 4LLQA 3ARDA 4QNPE 4XMKH 4HWEH 1Q1JH 1FC2D 2DM3A 5EG6C 1JTTA 4EN3C 1RZGB 1A1NB 3ZE1E 4G9FB 3V4UH 3PDOB 4F7CA 1GVIA 4D0BA 5EZLB 3V4VH 4IDJH 5K59F 4XHJD 5FOBA 3GSNA 1WSST 1QHOA 2CJUL 2ICEA 5C0ND 5E5MB 1E27B 4F3FB 3MLTA 5HDQH 4L8DA 1UM4H 1BQSA 1TZIA 2I5YL 3ES6B 4NWTL 3ARRA 2ZWLT 3BP6B 4X5XA 5F3BA 1KIRB 2Q20A 3QQ3B 4JPIA 4P5TB 3ZDZF 3TT3H 3MXWL 3HLAA 3PUCA 1NKRA 2DMKA 3HE7D 4Z7UB 4YBLB 4TOYH 3O3BB 5TE7H 2IBZY 1S7VB 2A1WL 2EEDA 3L9RB 3UP1A 3NFPA 2XTJE 4AEHH 4FA8A 2VDNL 3AM8C 3DSFH 3WXVL 4HEPG 4ZFZB 1DN0A 3GM0A 2YBRB 3MV9A 4FN0A 4JRYD 4HGWB 4BQ8A 5C2BL 3DX8A 4OZGF 5EPMA 3L6FA 1N0XH 2NTFA 3FB8B 3VFTB 4KY1L 4OSUH 4X6DF 4TUOB 1WQVT 4KV5F 4U31A 2B4CL 4JKKA 4BZ1H 5LAXA 3G9VA 1L7IL 2DYPB 1UKTA 2BSTB 2F19L 2Y6SD 4P4KB 4LSVH 1NEZG 1Q0YH 1CGYA 4X4XB 5EU7E 2I27N 4Y2DA 4NZJA 3DPBA 4OV5A 3STLA 2D4FA 1RUQL 3QQNA 3S96B 5GHWH 4NQCB 1NJ9B 6FABL 3KPRD 4R0LA 4HULB 3UTZB 5HYSG 5J89A 4MA1B 5DJXA 1WAAA 2FR4B 3HE6D 2AJVL 4XCYB 5I15L 3SDDB 5SX4I 3BAEL 4NO3A 5BZWB 2VB5A 4LSPH 4D8PA 1FL6A 5LXGH 2EECA 5DWUH 2GT9B 1VACA 4NJAL 2OL3B 4RNRA 1BFVL 3GBLA 3BO8B 1CXFA 3OKKA 1DVFC 3IFPA 2VL5B 4MGXA 3LCYA 4UV7H 4TULH 5EZIH 1YYLH 5A2FA 5T1MA 3ARGC 1BZ7B 3KYMB 3CDGA 4FOMA 5DXWA 2ADJA 2WIIB 3ARBA 3RWEB 5H37G 4H1LB 2O61A 3EHBC 3UJTH 2Y25A 3DV6B 4NOBA 5IMLB 3UO1L 1H3PL 4PRBA 4KWUA 2DI7A 3HPJB 2P8LB 4G6JH 3VFSB 5F7MC 4LDEB 1D9KC 2X4UB 4HS8L 4XBPA 3GJFB 3HNVL 4DCQA 3GM8A 2WBJC 4MCZB 1U58B 4PJFB 3NIDF 3CFCL 4Z9KB 5JLZB 1ZV5A 2XWJB 4U0QB 1M7DA 2RAMA 1MELA 3GSVB 4KI5C 3DIFB 1D5IH 5CZKA 1OAQH 3WYRA 3U36A 3D0VB 4YBQC 4G8GA 3QISA 5ANMA 1JF1B 2V17H 1KJ2B 2QSCH 5L6YL 4NT6A 3RL1A 1ND0B 2XG4A 3RIFK 1JK8A 5I18H 2J6EH 2Z31A 4PRHA 3IDJB 2AJYH 4JKLA 1FYHB 1WEJL 1JPSL 5EZOH 5FYKU 1E4KC 2DQUH 3WFDH 4RMQA 1YY8A 2EDKA 4V1DE 1T1ZB 1CL7H 5I1JL 1MPAL 2PTTA 5EIIB 4IRSB 5L8KB 4PJ5D 4RBPK 5CMAB 3QWOB 2O5XH 3B3IB 5D1QC 4YDJB 3HI1B 5IFAH 4ZTPH 1N6QH 5D2NB 3FQWA 4EBQL 1A6UH 4LSTL 1RFDL 4OIBA 4R7DA 3MO1A 4N8VG 4P4KD 4I3RH 3GI9L 1GIGL 3T3PF 3G5ZB 4R4ND 4XPGL 5E4IA 4NKMA 2EIBA 3GSOB 3QDGD 1A7RH 2GKIA 3WFZA 1I9IH 3PHSA 3ARFB 4RAHA 1A6ZB 2BVOA 2R0LH 4XVJH 3K4DA 5CKGA 2QKIB 1FZOB 4NQCD 3SKOB 3B9EA 2RHEA 1ZVSA 3TBWB 3FL7A 1TFHA 1CCZA 1TZHB 5GS3A 4NQEB 1MCNA 4W4NA 1HEZA 5ID1A 4JGUA 5B8CA 2CRIA 4APQB 1EFXD 4HUVB 2CR3A 3AGVA 1UM5L 1U3YA 2HFEB 3MV7B 1KN2H 2UWEA 3BPNC 3M1BA 1FBIH 1OSZB 4FTVD 4Z7OF 3OG4B 2E27L 5AYUH 1BZ9B 3X13B 1A2YB 4U3CA 3ULVH 1BEYH 2OR9H 1WCBB 3DTXA 3IXTB 1YEKL 2EH7L 4NKOB 5I30H 4P3CL 4PJCB 4B7LA 2B2XH 2BRQA 3QRGL 4JG1H 4KGLA 3CZFB 2AJSH 1RVFH 5I8OL 4PP1C 1U2HA 4ODWA 4NP4L 4AIZB 4C56D 1R3KB 2DQCL 1CYGA 2X5PA 3DMMB 5KS9A 1H0DA 3QI9C 4M43L 5GSRB 3GI8L 2RR3A 4NPYA 3C5ZC 3FAWA 4IOSD 3WFHA 3EYFB 4GG8A 5GJTH 2NW3B 1OTSC 1MQKH 3VFWA 3U0PB 3QIBD 4HQQH 1YY9D 3QCUH 4OT1H 3WBDA 5ITBH 1VFUA 3TYFA 3N85H 1I1CA 1JWSB 3Q6GL 3GBNH 4YHKH 4LCYA 2DJ4A 1J87A 1MWAL 2PR4H 5C07E 4KMQA 2PN5A 4OLYL 4HX1B 4BSWB 1DQDL 2BDNH 3Q5TA 2R23B 1OW0C 4CRPA 4F9PC 1T1XA 4FFWC 4XMPL 5CGYD 3TZVB 1L9NA 4Y19E 1CN4A 4R9HA 3O2VL 4P2QB 3HKFA 4O58H 4RGNC 1PJ9A 3REWA 1MI5B 5C0EB 1T0PB 5IB3A 4BUHA 5KVGL 1CLOH 5JIHA 4FXGB 3SDXB 4LL9A 1U8IA 1XGRB 2PYFB 1G6VK 1UJ3B 4FQ1H 2I26N 1VPOH 1VGKB 3MYZA 3F65A 1D5MA 4FMFA 1Q9OA 4WFHD 3A6CH 4PRPB 1H3VA 3KPLA 2VYRE 3NIFE 1RUKL 3TNNB 4KKNA 1A6PA 4GXVL 5DS8A 5GGTA 4U1KA 3WLBA 4EUPA 2AEPH 4PJEB 3IDMA 3BN3B 3ZE0E 4G7YH 3VXMD 3IDNB 3GUTB 4PV9B 4Q9RH 5CBEB 3D9AH 4LVOB 2HWZL 1SBSL 3TA3C 3PHOB 4ENED 2VLKD 3QEQE 5EORL 3GK8H 4PLNC 4HH9A 1W72B 1IGCL 1MQ8A 2VLRB 3KPOA 3H7LA 2VITA 4M00A 5DDHB 1S7SB 1U91A 3MA9H 5CGMA 2F5AL 5I75C 4QRPE 2DM4A 5F7UA 5T1DH 4Z5RA 1G7MA 1CIUA 4K3EH 4MJ5A 3TCLB 2A6DB 1LGVA 3DUSA 4JFOB 1KNOA 5EZJA 4L1HA 4J7RA 5FKPA 4D9QE 3ARQA 3B2VL 3EDEA 4LCUB 3FO2A 1A7NH 1ZWIB 3KLAA 3K4ZA 4JM2D 4Z7WF 4PJ9A 4IMKC 1JWUB 2A83A 3U9UA 1K8DA 1K9TA 2IFGA 3RTQA 3PDDA 5B3JF 1G0YR 5CD3A 4G8IA 1XGPA 4I3SL 4OLVH 3RY6C 3V6ZB 1IQWL 3NCYP 5CZXD 1EUUA 4ZUWA 2ESVB 5I1GH 1MHCB 1OTTD 5ISZB 4LSDA 3P73B 4QOKA 1XCQA 3VMPA 4YXLH 1KCLA 5D2LE 3X3GL 1M7IA 2AJZA 2X4PA 2Y07H 3MRGA 4G43B 2Q6WA 4H8WC 2Q8AL 5F8RC 1FYTA 4F58L 3B5GA 4MS8D 3JTTB 3H9SB 4XCEA 4NRYA 2QEJA 4AH2A 1EX0A 4NRXB 3OKLA 5D7KD 5FECA 3NOIA 1U93B 1QLEH 4WO4B 2NY2B 2G60H 3U7YL 3S7GA 3H9ZA 1KIQA 1Q38A 4RGOL 5KOVC 3REVA 3T1FA 3N9GL 5L2KA 3MCLH 2DB8A 1MCQA 2EC9U 1UWEL 5DD5H 3U82B 1K2DA 5HHVL 5DGQA 3VRJA 4RAVB 3KAAA 3BGMA 5FYJH 3ULUH 2JJSC 3HZVA 3G5XB 1F90L 1CT8A 4OFPA 4TQEL 5DJYA 3IJSB 4JLRB 4MCYB 1MHPL 4AY0A 4LHUD 1D6EB 3RWJB 5DHXB 3UTTA 1SJEB 2YWZA 3ZZ1A 5INDA 3FQXB 1BGXH 4KKLD 3KPPB 5E6YA 1P69B 4YEFA 1TZGL 1IVLA 1HI6B 1A3LH 4EIZC 2BOCA 4JFQA 4OI7A 1FAKT 4L5FH 5EBLA 2CUHA 4S1DD 5KN5A 4JO3H 2HT2D 2DQIL 2X10A 4Z78A 2BSSA 5EU3B 3TJEL 3OAUH 2QTEA 3HZYA 5D96C 1KXTB 1ORQB 1CF8H 5D7LE 4DVBB 5C08D 4PREB 3W0WA 3M8OL 5BRZA 1CK0H 3JWDL 1KB9K 3E8UH 4LF3A 4OF6A 5DQJB 5T5NG 3OBAA 1ED3B 2JB6B 4PJ7A 2R2BB 3SOBH 1K4DB 4NJ9L 1X7QB 5JPMA 3DX6B 1RZJC 4LARH 5FCUH 1MCIA 1YC8A 1ZHNA 1RMFL 3MRNA 1WT5C 3RUGB 5FO9A 2UVFA 1CICB 1AHWC 1NCNA 4JZJC 3B6SB 1ZHLB 3P0VH 1XIWC 2AV7B 2P49B 3HG1D 3NFNA 1KIPB 2DWDA 4KFZC 4TSCH 4YIQB 3QHFL 1CFNA 2QSTA 4M7KH 4MLIA 5T3XE 3MJGX 1N0LA 1X5AA 1BIIB 3BMWA 3MRPA 4NYLB 4OJFH 4ODXB 4XPFH 2I25N 3IYLW 4AQ1B 2N1KA 4PJAE 1MJJB 2XFXA 1U95B 4IOFD 2P5WE 4X6BA 3U79A 1RHHA 4KHXH 3OKMB 1SJVA 4JO4L 1AKJA 3RKPA 3V79C 1KLGA 1PX4A 2EYSA 3FB6B 1A0QL 5E6IC 2JJUA 5EWIL 4GG6E 1FG2A 5ALCH 1B4JH 2I60H 3O3AB 3QG7H 1RZKC 2DL9A 3BESR 3HZMA 2ZSVB 4MNQE 3RY4A 1GAFL 4JFDE 2I07B 1F3DJ 3SGKA 3KLHC 1MCWM 3SQOH 1MEXL 4WUUD 1Q9KA 1FV1B 2IH1B 4F15B 1IRAY 5GSVB 4KRPD 2YK1L 1ZLSH 4JQIH 2A77H 5HTSA