4M93B

Unliganded 2 crystal structure of s25-26 fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
b'EVQLKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (IgG1k) light chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93B01
3AU1B 4D9LH 5C0CD 4Z7NE 4LKXB 3MLTA 5ADOH 4OGYH 3Q6GL 3CZFA 1I8MB 1HINL 2OCFD 4F3FB 2V9QA 3O8XA 2R1YA 3SPVA 1OAZH 2DICA 1MHHA 4J3VA 4RNRB 4OM0L 2RAMA 1ES0A 3AY4C 3B83A 4DW2L 4OZFA 4ELME 5SWZD 3QDGD 3NCJL 3VD5A 1BOGB 3F7VB 5AYUH 1RZGB 1H8OA 4GBXB 2DQCL 1XGUA 5MEPA 5J6HB 4HAFA 4UQ2B 3DBXB 4L1DA 2Z31A 3S35L 3D25A 4JRXA 4YFLI 2X7LA 5KTEH 1ZT4B 2OP4L 1U6AL 2VR5A 1JZ4A 2CMRH 5DJYB 1Z9LA 3T0XA 4BELD 5FCUL 2IBZY 5JPMB 4ODXA 2BX5A 4PJ7E 1NUGA 3QEQB 5MENB 1MHPH 1B88A 3TM6A 4I1NB 4HUNB 5LXGL 4I0PA 4YHNA 1DR9A 2YXMA 3O6KH 3FB8A 3O8XC 5IUSA 5DVKA 1K3ZA 1N5AA 3GSVB 2AK4D 5F93C 4XMKH 1I75A 2JB6B 2VZ3A 4Q2ZA 3VFVA 4BK5A 4KV5F 3O0RL 1Z5LB 3PGFH 3SGKC 3WLBA 3QDHA 2GSIB 1HYRC 3B9KB 5HPOA 3WS6A 2BDNL 3IRZA 2VXTH 1F42A 5CJQL 5I73B 3EYFA 3KVQA 3QCVL 4ZUVA 4R97C 3FZUD 3ES6A 3QXTA 4KGJA 5KVFH 1IC7H 3X3GH 1EX0A 2F53E 2PXYD 3UCRA 1KCLA 4NO3B 5KSBA 4HFWB 5DC9B 5EZOL 2X4TB 4R7DA 1VACA 1MFCL 2MJWA 4Y4FB 1VDGA 3B2UD 4WO4A 3H9ZA 1D9KD 3FFCA 1KSRA 4CRPA 3WFBL 1EFXA 5JNYB 1XGRB 3NCBB 4Q74A 3ALWA 4HK0A 2F54E 1U3YA 5DD6A 3BIKB 4JFYB 3FL7A 3H0TB 3TV3H 5IBUG 1BP3B 1JNNH 3HNVH 2HTKC 3CLFH 5FA3B 5J0BA 1UWGH 5GIRB 2OYPA 3BSZH 1A4JB 1MCOH 3D3VD 3OKYA 4ORGA 5EC2A 3WS6C 5E2WH 2FHCA 3ZMRA 1MHEA 2ZCLH 1PSKL 5GXBB 3V9FA 4WUUB 5EBLB 4K3EL 1AJ7H 4M1CC 4BH8B 5JIHA 5FDWB 4HWEH 5BRZE 2NLJA 4OLXH 3DUSB 2J8UE 3VMPA 1X5ZA 3IS0X 3EO9L 5CHNA 1BBJA 3TH2T 1OLLA 5D93C 5FF6B 5I1LB 1DLHA 4F7CB 2BSED 3BX7C 5TGBB 4ELMF 4U1LA 1PY4A 1QSFE 1BFTA 3MLXL 4BH7B 4HUXA 5I71B 2O5YH 4WTWA 3V0VA 5ACZB 4H26B 4N5UA 5CCKH 1WCQA 2AV1B 4KK8C 4UOW1 3BIBX 2NY0B 1K8DA 2IGFL 2HFGH 4OCSH 1MJ7H 1DQLL 2Q8BH 1ORQA 5GJTL 1BVLA 1WAAF 2YMXH 3CFIC 2Y5TB 2X4NB 2HVJB 1PJ9A 1T0MB 3PE9A 3QO1B 3HE6D 2DQUH 3MO1B 3VXUE 3NZHL 1JWSA 4R3SA 5B4MD 1CFNA 1DN0A 1QRKA 4XC3L 1NBZB 3IDGB 2GY7B 4P59L 4HLZH 5EO0B 1KJMA 2XWJB 5L2JB 3IDIA 4UI2A 3VDAA 3H9HA 5H2BA 5CLWA 3DO7A 2NY3B 4ODTH 4OLVL 1CE1L 3HZYB 4HWBA 4WEUD 1JPGB 4N90E 3CFBA 1IAIM 1EEYA 5AZ2L 3STZB 4BZ2L 2UY6A 5I1DB 2CRZA 3V7AG 4DK6A 3TT3H 1JCKA 1XR9B 4NQSA 2KPNA 1Q72L 3N1MC 4F8QA 4AEHH 2E7HA 3W0WB 3MRCB 4Y89A 3S98A 4M61B 4Y19A 4J3XA 4XWGH 4MS8D 1SBSL 2PNDA 1C7TA 3MODH 2ADJB 3TP4A 5E99H 3IYLW 3SGEH 1CL7I 5DO2D 3UTTA 1NCAL 4HK3N 3IU4L 3S6CA 1FVEB 5FO8B 4UILL 3U0TA 4U1HB 3FQWB 3SJVB 4L4TA 2NY6D 3NN8B 1MRDL 4Z7VF 5HYSB 1R6VA 3RQ3A 1KPVA 1BD2E 4R7NB 2JJVA 1FZJB 5INDA 3KWWB 3MUJA 1JNLH 3IDJB 3QA3B 1XZ0A 5GISL 5IBTL 4CBPA 5F71A 3EFDH 4WW2B 3L95A 2H45A 4LOUD 1YEIH 2ED8A 2C1PA 4G9FA 2ORBL 4JLRA 3V0WH 1R3JB 5KVDH 4MJIE 4HWZB 3EHBD 5IIEB 4QRRA 3TJHD 2NXYB 4MWFB 4FQCH 4J4PA 3GUTA 1OSZA 3G5XB 5CEZE 3T0BA 5D5MA 2J2ZA 5ALBL 1FAIL 3GJFA 3IDUA 4YE4L 5IQ9A 1CTNA 2I25N 1HCFX 4M6MH 4JKKA 1MQKL 3HZKB 4DFIA 4DWHA 3D39D 5D7IB 1I1CA 3ULUF 2LTQB 3UJTL 4G8GA 1IAIL 4Y5XC 1A3LL 1KB5B 5E8OB 4XP9H 3AXLA 5DVNA 4E42B 5BMFH 3JZ7A 3HMXL 4I77H 4F15B 2XN9B 2VOTA 1NGZA 2HMIC 1BAFL 4EDXA 2PTVA 3CUPA 3AB0B 1WZKA 2B2XH 3VGBA 2DBLH 5DJXB 3UZVB 4CU7A 4DK3A 1S7SB 2VL5B 3FCTA 3SDYL 2Z93B 2VAAA 3L3IB 5FGCE 4J4PC 3B8SA 3F12A 1XGTA 5INCB 1CE6B 2V5TA 4GKSA 4OIIL 1IT9L 3OJ2C 4ZOAA 2FJFA 2FH6A 3CVHH 1P4BL 3LHPH 4J8RA 4KTDH 1TFHA 4WWKD 1OD9A 3INUL 4OF0A 3QUYB 3U9PL 4XCFL 3BZFA 5TDOA 3FO0L 3JV5A 5CJOH 4X7TB 3VFRA 3THML 2ZCHH 4XPTL 3MLUH 3QJFA 1MVUB 3O4LD 3PWPA 2CLZB 1WQVT 3NFPB 3TYGH 1MWAB 4O51B 5DRNA 3ZT5A 1AXSB 4RGND 5GS3A 3VXNB 1F6AA 2CUHA 4UMGA 4M1DH 4JFPA 1CXHA 3ULSA 5I30H 1JPSH 2P49B 3CC5A 4QEGA 3KNBA 4I18C 3KPRD 5HBBA 1CXKA 3BPOC 3V6FB 3PWUB 3KPSE 1N8ZB 2NW2A 2VXSL 3DV4A 4OD2B 3ZKNC 4A6YA 4PS4L 5BJTA 1XGQA 1DUYA 4O2CA 4Y4HA 1M71B 1A6UH 1EMTH 5I17A 3ZSTA 5HHNA 5FB8B 3ILQD 3P4MA 1A1MB 4NQDD 5T1LA 4NKMB 4J12A 3EYUL 5H35B 3B5HA 1Q9LA 4HCRA 1AFVH 4YBLC 1A0QL 4MYWB 4LARL 5FKAA 1YQVH 2DMKA 3T08A 1NC2A 1IGTB 1HHJA 1FGVL 3ARDB 3TIDA 1PYWA 4WFFE 3ZE1E 3ALPA 3DURA 3JV6A 3SY0A 3I2CH 3LS5L 2VL4A 3T1FA 2C4FU 1CFBA 1EAPB 1T3FB 3AMKA 2X05A 5DEGB 3QXVA 3RTQC 2EH7L 1I3UA 1MIML 1VFAA 4W6WB 1DEEB 4OM1L 2E9WA 4Y4HC 2YC1B 2EH8L 2O5XL 3O6FA 5HYFA 1JHKL 4TVPD 4JFQA 4GJTB 2QJDA 3P9MB 4R4BA 3I3BA 1WFNA 5FYJU 3NCMA 4QTIH 1S9VA 3PGCB 5D1ZA 2EZ0D 2EXYC 4TNVK 2IF7A 1VKXA 1YEDA 1T2QL 1PKQB 4FG6D 3KJ6H 4OZGB 4W81A 5ILTH 1LGVA 1KN2H 3PJSB 3VXPA 3WIIH 3Q48A 4M1GL 5IF0B 1H9VA 3MJ8A 2W07A 1OP3K 4I9WE 4OZIF 2PW2A 2Q3ZA 1YYMH 2BY1A 2DQJH 4G8EB 5E6IC 1S7QA 2X1OA 4NM8L 5EOCJ 1A2YA 1GOGA 1YJDL 3KPTA 1JHTB 3MZGB 3V2AR 4Z18A 5DFTA 3QXWA 5HDLA 5C0EB 1AXTH 2GT9B 1TPXB 3Q6FA 3T3MF 4LSRL 5KJRH 3LEVH 3P0YL 2P5WE 3O6FC 1JF6A 2ADFH 5TE4H 2BRQA 3MRMB 4JKPL 2H2SD 2VZSA 4LEOB 3NAAL 5T33H 1RUQH 3IDYB 4PRBB 1U8OB 1DQML 5I1KH 3QI9B 1OP5K 3FOLB 3WD5H 3CDGA 1U42A 4GUPB 4D9LL 5CP3H 2W60A 5C6WH 5ADOL 3LZFH 2W65B 1R5VB 1ZSDA 2WIIA 3CFEA 3TA3A 3V8CA 3ARGC 3PWVA 1XF5B 2X4RA 2MKLC 1FO0A 3QUZC 5JXEA 1F6FB 1JGEA 2DLGA 3HLAB 1LE9A 3IF1B 5JMOC 1HCVA 4L8BA 5AYUL 2RCSH 3O11A 1C12B 3U6RA 1WGOA 2C3HA 2HYMA 3JXAA 3VFMB 1RUAH 1U8HA 3TNNA 2WV3A 1MELA 3ZE1F 3W39A 5KTEL 3Q5TA 4JO1H 1SEBB 3FO1A 2CMRL 3WFHA 2VDOL 4E41B 4F7MA 2C1OA 4LSTL 4P4KC 1G9NC 2E27H 1UZ6F 1EHAA 5E95B 3B6SA 1MHPL 5DC4B 4B53A 2DIAA 5HHOB 4PGCA 2UVEA 4UU9B 3O8XD 3O6KL 3TA3C 4ZFFA 1WT5C 5K9KB 5E00B 2X1QA 1HSBB 2GFBB 1VEOA 2IPTH 3RDTB 1G7HB 2AJZB 4XMKL 5JXEC 3MX0A 3GSUA 2FZ3B 3RP1A 1FFOA 3PGFL 2YHGA 4N0FB 3VXSA 4UDUA 5C7XH 2VXTL 1CDIA 4Z77B 3QNYB 3QEQE 4NQVA 1LK2A 2MSPA 2PN5A 3AS2A 5KVFL 1IC7L 4Y8DC 2WSKA 1QQDA 4JRXD 3RVXC 2V2TB 1JF1B 1OGAA 1RJYB 5FFLA 4PJFB 4JJ5A 4GG6A 2ESVA 3LMJH 1CVSC 5FK9A 4B5EA 5DJDA 3MJ7B 5F6IB 3BQUC 3T04D 7FABL 3I9GH 3V6OE 3F8UB 1BFSA 1Z3GH 35C8H 3DIFA 5BW7A 3HCVB 3AREC 3O81A 5EFIB 4KQ3H 3NCFB 3EAKA 1X5LA 5ICXA 2F19H 2D9QB 2HTKD 2XPGA 5FKPB 1JNNL 3PP4H 3HNVL 3GKWH 4ZOCA 2ZUTA 4TVPH 3X11A 4OKVB 3CLFL 1UWGL 4A2MA 3BSZL 1MCOL 1WWWX 3WDHA 1II4E 1IQWH 4KY1H 4QRSA 4UINH 4JY5H 4FXGB 4QRPB 4JFFE 3VDCA 2ZCLL 4IS6B 1MRFH 2A0LC 4M1CD 1A4KB 1AJ7L 1XF1A 2A83B 3D18A 4KRPB 4WFGD 2I9LA 4HWEL 4LLWB 2NY4C 4OLXL 3D85A 4DGYL 4XRCB 3BJ91 2AJYH 4P49A 5F70A 1X9QA 2UZIH 4C57C 2X6MA 5A16B 5M95B 3ZYOA 3V5HB 4BKLB 5EU5A 1XCQA 4JM2B 1TTFA 4LHUA 3QZWG 2ITDB 4K07A 3FFCD 2OL3L 5EA0H 1EFXD 4P46B 3K81A 1H3TA 3UTQB 1P7QB 5MERA 3N85H 7CGTA 4KK8D 4LRIA 5DTFA 2E7LA 5DJAA 5BW7C 1L9MA 4WUUE 5T5FL 1AGEB 3U9UA 1MCJA 4P2QA 1URLA 2X1XR 4OCSL 3OZ9H 2Q8BL 2GAZB 2ED9A 1A47A 1Q9OA 4FQHB 3DRQA 4KUZH 3N1PC 1I3RA 2GSGA 5KN5A 2EIBA 3FT2B 5FGBC 4NYLA 4JFXA 1ZHBA 3LCYA 5TF1H 1RZFH 4QRTA 3JV0A 5EOQH 3FQRB 5IM7A 5C0FA 1BQSA 1EVTC 2JLLA 1BLNB 3L7EA 4ODTL 4CDGC 1PG7W 5CSGA 4R96B 3BO8A 4V1DA 2EDBA 4XCEB 4I4WA 2E7LC 3OAZK 2BP3A 2DD8H 5L8JB 1T5XB 5IROA 1DUZB 1KCUH 4XWGL 1G84A 3CJJA 4R2GC 1NSNH 1F3JA 4X98B 3RWDA 4IRZL 5E99L 4LGSB 3BGMB 5F3HA 4PJ9B 3B8YA 1OT1A 4F8TA 4NNYB 1DCLA 3HMWL 1CDGA 4RZCB 4HPYL 2BY2A 4MA1B 4MD4B 1REIA 4MQXC 3VFWB 3L3HA 3MROB 4LLVB 2DB8A 2FIRT 5KSUB 1CXIA 2I9TA 3FRPG 5AAWA 1JNLL 4NO0B 3HRZA 4G5ZH 3MNWA 4NCC2 5HI5C 3AS1A 5D1XA 4BK4A 1DEDA 3EFDL 5DS8B 5IB1B 1YEIL 4U7SA 3WNNA 4JAMB 4U1MB 3T0VA 1NKOA 1IJ9A 4FQCL 4Y19D 3PQYD 1NANH 5IB4A 5IROC 1IEBB 5EBGA 2NY5C 1KIRA 3MRIA 4M03A 2HJKB 5HHQA 3G5ZA 4Y16A 2L7JA 1TJGH 4MQSB 4KVNL 4JREC 4OFDA 5FM5M 1D6VH 2V2WB 5D2NB 1JRHH 2B5IB 4ONOA 4MNGB 43CAA 5BOZG 5AUMB 1AHWC 2VDPH 2NX5B 4H1LH 1NGXB 2K1MA 4XP9L 4Z0XB 5DMKB 5BMFL 2DIJA 4KDTA 2ICEA 3NCCB 1LE5A 4I77L 3ARFB 2FRGP 4YPJA 2HMID 1JJUA 3BP6B 5D1XC 1HXYA 2D7MA 4ZDHB 5C0AE 4M6OH 4KI5C 3MV9A 3VJ6B 2DBLL 43C9A 1ND0A 3BAEH 1UJ3C 1MFDH 4N8VB 4J4PD 5B38G 5D7IE 5K59F 1FL6A 3WJLA 2DJUA 3CCHB 3CVHL 1FH5H 1UYWH 4KTDL 4PJBE 4LCYA 5TQ0H 1LO4H 4OCXH 3U79A 5TPWH 2R2HB 4Y16C 2XN9E 1AR2A 3T65A 5F6HJ 5CJOL 1DE4A 3U2SA 4BFIA 4G8GD 3MLUL 5E2UL 1W72A 3UTSA 4LCWA 3OAUH 1Y6MR 4G43B 3T0WA 1I8IB 1TVBB 1SYSA 2EDDA 4UZGA 1EPFA 2D31B 4WTXA 4U6TA 4JPIA 4N8PA 3QXUA 5ESAB 4JANB 4JPWH 3T2OA 3J8F7 1BOYA 2VABB 4M1DL 1YA5A 5F1OB 3IDXH 3GMQB 1A1NB 4YO0B 1IKNC 5I30L 2MWCA 4OI9A 3IXAB 1JBJA 5JOFB 4M9OA 1QSVA 4OV5B 2OR8A 2ARJB 4BSVB 2V5YA 3EDKA 3VFGH 5EU6A 2JF1A 1TDQA 1A22B 4JCMA 4CADB 4TUOB 2R69H 3SO3B 3GBMH 3ZE2E 1X5AA 5F7DB 1A9BA 1A6UL 4XVTH 1EMTL 4NNXB 4X4ZA 3VGDA 1IZJA 3B9AA 1RHHA 1L6XA 4PJHA 5ALCH 5LKNA 4G42A 1JUFA 4M43L 3L5WB 4ZOBA 3I6GA 4AL8H 4TOYL 5IFAH 1A21A 1S7UB 2W9DH 1YQVL 1CLCA 2YSSA 3SGJA 1KPUB 3RX7A 5ID0B 3I2CL 4G6ML 3VFSA 3UDWA 4ZS7L 3E6HB 5IEKB 2AGJL 5FUOH 1A6ZA 2KL6A 3RTQD 4YHZH 1D6EB 1NKRA 5E4EB 4XAKE 1N7MH 1G7QB 3EIFA 4QY8A 4WRLA 4A2LA 2P7TA 4KMTH 1EO5A 2VXVH 4EXPX 5H37H 5DRXB 4E0RB 4X4XB 2E6PA 1XF2A 4LMQE 2EXYD 3GIVB 5EZLB 1RZJC 1NAMA 2Y06L 3VCLA 2PYEA 1UVQB 4KJQC 5BZWB 8FABB 4JN1H 5JR1L 1Q9WB 2JK5B 3KPLB 4NHUB 3WMSA 1T2XA 5ILTL 1NC2D 4RX4A 3BEVA 4QXGH 4NFDA 1HH9B 3VGAC 1Q1JH 5E6ID 2AI0H 1N59B 1YYML 2DQJL 2VLJD 1YY9C 5JW4N 3UDWC 4X83A 3CIQA 3O9WB 2WINB 5BQ7A 5C0CB 4CVZB 1U3ZA 4KH2A 4XNQA 4OD3H 4YDJB 2F58H 3O6FD 1L7IH 5C0IB 1VFBA 1UA6H 2BZDA 4I3SH 2ADFL 1PKQE 4ZAKB 5TE4L 4GRLA 3QZWB 4OZGE 1DBAH 2BVYA 1TZHB 1RUQL 4JHAH 4L4JA 4EI5B 3IVKB 1CIUA 1N6UA 1NMBH 3S7GA 1YEEH 5I1KL 4HKZB 1SY6A 1UH4A 4LIQH 5FYJD 3WD5L 5SWZB 3QDGB 5C07D 2R29L 3M17A 1LD9A 4YHYB 3QQ4B 4Y8AA 5FECB 5FXCH 1QNZH 2H32H 2VSDA 1CXFA 5JW5B 4HKBA 1H5BB 1A7QH 3ARGD 3N06B 1F02I 1KTRL 3EJYC 5HDOA 4FNLH 4MLSA 4MJ2A 3GSOA 3QUZD 1JGVH 1I7ZA 4POZC 2DM2A 3G6JB 3V7MA 2AK1H 1QR1B 1KB9J 1GH7A 2C4XA 4X5WB 3OX8A 5EIIB 4QOKD 5TE7H 4NT6A 2RCSL 4NPYA 3RWCA 1X5JA 5KVEH 2VUOA 2NY1C 4L1HA 1KBGH 2AK4B 2OI9B 1RUAL 3IDNB 5IHLB 4KXZH 4WIQA 2M1KA 4JPKH 3U4BL 2IPUK 2RQ8A 4HMEA 4IEFB 3TBVA 4JO1L 1EDQA 1UM6H 4ETYA 5DD1H 4HGWA 4P4KD 4HF5H 4EDWH 5ESQA 3AGVA 2HVKB 1W0VA 5C0NC 2E27L 3PWJB 3MRNA 3X13B 5IHUH 4HX1A 3TA3D 2Q3AA 4NZTH 3MRBB 2PXYB 3LV3B 3H8NA 2IPTL 5JXED 3V7AE 1UCTA 1T7ZA 2AXJA 4PJXA 3UMTA 5IJVA 3FT3B 4NQCD 4BFEA 4LGRB 3FB7A 1MI5B 1QD0A 1KIQA 5B39G 4E41E 1D9KB 1EBAA 3JTTA 4NC2B 3X3FL 3IT8D 3MBED 3BUTA 5CJXC 5JMRA 4RFEA 3B5GA 1HNGA 3RWFB 1KXVC 4PJCB 5HHOE 3RVXD 3ARUA 3FONB 3OKNA 3QHTC 4NQTA 5D72H 5LBSH 2IQ9H 1DDHB 2D7TH 4L8CB 1DQJB 3CXDH 3D3VB 3FB5B 3MLYL 5FYKE 1IM3A 3C6SB 5IMLA 1EO8H 4JZNA 3TPUA 4YJZL 5LCVH 4W70A 5CZXC 1ZT1B 3TJEH 3BQUD 5L9DH 3CVHB 5DUPH 3KPNA 2AV7B 3I9GL 4I5BA 1F3DJ 3HI1B 2UWEE 3ARED 1I3GH 4WVRA 1ZLSL 4BZ1H 4KQ3L 2F19L 4G6KL 1OB1A 3PP4L 4TVPL 2X9YA 1R3LA 3VXSD 4P5KA 2QEJA 1IQWL 4PJFE 2OSLB 4KY1L 5EWIH 3GRWA 2C7UA 4JY5L 4UV4H 5EUKA 3D0LB 2A0LD 2I07A 5ITFA 5C9JB 2YD1A 2CKBA 5DT1H 1CFQA 1Q0YL 2NY4D 1EIBA 3FRUB 1KTKE 4ZXBB 1X4XA 3KAAA 4CNIB 4Z95H 5B38B 4PRPA 3QUKA 3QEHB 3LDBC 2G9HB 3RL2A 2UZIL 4OZ4A 3MGTB 2ESVD 3SCMA 3HE6B 4MX7A 4HS3A 1BQLH 3QWOB 4R90H 1PG7X 5F9WB 3G5VB 3QP3A 4QYOA 4ZO6A 4OUUB 2CO7B 4QRPE 1S7TB 4XGZB 2VLKD 1MCRA 1HH6B 3N85L 1OGTA 3DVGB 1VERA 5EO1A 5IMKA 5AWNH 3SKUD 3O41A 3OZ9L 5D7SL 4PB9H 2G2RB 5F7LB 3BUYA 4F2MB 3BZ4A 2GI7A 3OR6A 3C2AH 4WI7A 3ARSA 2ENSA 3O3EA 5DDHA 1F45A 4OB5H 5KS9A 2QL1A 4FXKA 2KUTA 1A6TA 2Q1EA 4TQEL 2H3NB 5LWYH 4PUBL 1J88A 4KXZI 3D85D 3WFEL 4KRMB 5TF1L 1RZFL 5EPMA 2FJHA 4LPCA 3MRGB 3T0EE 1MCWW 2GK0A 1ZK9A 1K8IA 3H7BB 4MZ3A 5IW1B 4LHUD 5C6PB 2IAMA 2NY6B 4FQQA 1D5IH 2J6EA 4GW1A 5FA4A 4CN6A 4Y88A 3LQMA 1DVFA 3O3DA 5J13B 4OZFG 4YHMH 5IW6A 3NCYP 2OXGA 2H26A 1F4YH 4GO6B 3K8KA 2VAJA 3M8OH 4R2GD 4CJ1A 3UBXI 1KCUL 1NSNL 5IB5B 3LN5B 1CD1B 4WHYG 1MHCA 2BNQB 1FL3A 3DVFA 4S1QH 5FO9A 1F4WH 4IRSD 1WVZA 3IETB 3OAYK 1WICA 2N7AA 3BWUC 4X7FC 1B4RA 2V9RA 2CDGB 4YX2L 1AKJA 2ZPKH 2YS4A 2IBBA 5FYLH 3OXRB 3K0WA 5E2JA 4G5ZL 5HI5D 5HHVH 5KW9L 1YUHB 1EH9A 1FO0H 3E2HC 3D39B 5ETUA 3ECBA 2VXQH 2XY2A 2YD5A 5BCAA 3HC3H 2FATH 3GZKA 2C3VB 3UEZA 4UV7H 3I6LE 2XFXB 1I8LA 3MXVH 3BFOA 1XH3B 2VQ1A 3FMGL 4F33A 1KCSL 3RY6C 3O2VL 1P2CB 4N9GA 5IT2L 1YECH 4ZMAT 2V6HA 1TJGL 5ENWA 1DQTA 4BQ8A 1JRHL 2ZNXA 2IPKB 4L8SB 2Q6WA 5JORB 4B0MM 3OGCA 1FNEA 2FBOJ 3BHBB 1T7XA 2JIXA 4XPBH 5FHAH 4ZUUB 3K3QA 4WWKB 3TIEB 3MJ6A 3VD7A 2X4UB 1CFTB 3MV8A 1Y0LA 5D1XD 3CD4A 3VFTB 2GJ6A 1S5IH 3ELAT 2G5BB 1RZ8A 3PHQB 5DHYA 3KS0J 4QHUA 5GGUA 3E6FB 3EDEA 2QADC 3BAEL 3W9EA 2A1WH 5D2NE 1NFDB 3UYOD 32C2A 5IG7A 1U3HC 4MNGE 1XGYL 5C71A 2G5RA 1B90A 1HILA 2NX5E 1Y18B 3L6FB 2X70B 4K7FB 2ITCA 4NC1E 1LEKA 5D9SA 1UYWL 4WI6A 4RGNB 1K4CB 3FT4B 2EYSB 4OLYH 5TQ0L 1LO4L 5I8EB 5J12C 3CSYB 4Y16D 5TPWL 5T3ZL 2P8LB 4TTDC 2PKDA 1U9KA 4WV1C 2BNUB 4RFOH 4PGDB 3V0AC 1HQRA 3KJ4B 2PTTB 4YFLF 4FFZH 3S3JA 5HHMD 1V7NL 3AM8C 4ZS6C 3KPRB 2GIYA 1ZA6A 3OAUL 2ZSVB 3QUMH 2FEEI 1CICA 3E1F1 3MA7A 4Y1AA 2SEBA 3FO2A 1RUKH 4JPWL 4P9MH 1U8PA 4IOFC 2R9HC 3IDXL 3MACH 4NQDB 2WAHA 4XBEL 5C0BD 2FEDC 3K8LA 4QRUB 3WNMA 4C4KT 2VN7A 3BRGC 2JCCA 4YXHH 3VFGL 3TBSB 3KYOA 4NQED 3MC0A 5DD0H 4U6HB 5MI0B 4N1EA 5JOPE 1MF2H 2R69L 3GBML 1VGKA 1RJLA 2GTZA 3UTSD 1NCUA 3MV7A 4ONHB 4CVXB 4BQBA 4U1NB 2MHAA 3WE6B 3IJHA 4HC1L 1KPRA 4P5TB 3TPKA 1CICC 5ALCL 3SKMA 2LVEA 1LP9B 3HRPA 5I15H 3I02A 3PHOB 3GGWB 5IFAL 2R1XA 2YUVA 3T4YA 2H8PB 4PJAA 5B39B 2W9DL 1IM9D 3HI5L 4XPFL 4Z7UB 2LE9A 2DQEH 2FLRT 3TZVA 1BF2A 2ERJB 2YPKA 5D7JC 5GS2D 1T66C 3BEWB 2FGZA 4N9OB 5HVHB 4TSBH 2YXFA 1NCBH 1XFPA 1PQZB 3KXFB 4HBQA 5FUOL 3D48R 4NJ9H 4I13B 2OTWB 5EO9B 5HPMB 1N7ML 2P4AB 4UDTB 4LNVA 4KMTL 3U4AA 1YDPA 4PJGA 1A6AA 1PAMA 4NO2A 3BPCA 4ZO8A 4HWNA 2VXVL 5ANMB 4XP6H 5MHSD 2JJSA 1U92A 3KGRA 3OG6B 5E7BA 3HZVB 3LAFA 1NQBA 5IOPB 4OT1L 5J57B 3G9AB 5FO7B 4QNPE 4KJQD 1AGFB 1TENA 4FQLL 4TNWF 2NY5H 2WANA 4JN1L 3UBXA 1BX2B 1QLEL 3R1GH 5J6GB 1DANU 3TZVC 2NTFB 3F6LA 4QXGL 2ZOKA 1YY9D 1Q1JL 2AI0L 3NTCH 5MEQA 3FO9A 2V5SA 2ADIA 5JLZB 1S7VA 2R1WA 3GK8H 4DQOH 5BS0A 5CD5D 4OD3L 4LDLB 3VXOA 3QAZC 2F58L 3B4NA 1L7IL 4XNZC 1UA6L 2EDQA 4I3SL 2Y72A 1FSKB 3EO1B 1DBAL 1MUJB 3V5KA 4JHAL 1A9EA 2JJSC 1A3QA 4JVUA 4LIQL 2PYED 4APQB 4RAVB 2BVUA 4L3ED 3LQAC 1WBXA 5C0CE 1QNZL 2VLMD 1GGTA 1A7QL 1MNUH 3EJYD 1S78C 1U3JA 4OBRA 4DZBA 3HPJB 4FNLL 2BNRA 1I7RA 2IH1B 3TO4A 4I3RL 2HRPH 5J9PB 1ITCA 4WU7B 3VI4E 4U6VH 4FS0A 3MLTB 4DZ8A 5SWZE 3QDGE 1G1YA 4GSDL 2Z9TA 1G7PB 1EHNA 4XB8A 3B2VH 3UTOA 2NY1D 3NPSC 3IFPA 3NFNA 3SPVB 4YWGL 3OKLB 1KBGL 1I1AC 1MHHB 1HHKB 5I9QB 1QBLL 3VA6A 4JPKL 1HEZB 1MH5A 3SKNA 4XCCH 1IMHC 4ORZC 1NPUA 3QXAA 3WHE1 1J1OH 1KG0B 4GAYA 2WWKT 1UM6L 3RPKA 5CD3B 5DD1L 4HF5L 4EDWL 3G6JE 5C0ND 4P2OC 5MEPB 2DM4A 4R97B 1PKOA 6FABL 5J1AA 5IHUL 1P9MA 3GB7B 1F5WA 4OLUH 3B9DA 3JVGA 4NZTL 4JRXB 3V5DB 3T1WA 4R4NC 3OKKB 2W9EH 5HGHA 2ZP0T 1KJ2A 3ARRA 3LQZA 5SWSD 5IW3A 3HE7A 3TO4C 4ODXB 4LF3B 1WLHA 2V2XB 4H1LB 1IGMH 2NXZC 1QRND 2A74A 3GSXB 2IWGA 3C5SB 1XCTA 2VJXA 2AS5M 1B0RB 1N5AB 1MRCL 5J3HC 3IS1X 5MEOA 1UQSB 5BV7C 3OB8A 2ZJSH 5D72L 5LBSL 3WLBB 1KB9K 4KKAC 1VSCA 4LSSH 3HAEB 1OVZA 2D7TL 2ED7A 3CXDL 2VLRB 4I0CC 1UB5A 1EO8L 5CZXD 1T1ZB 5IWLA 3RIAK 5GS2H 5GJSL 2CR3A 4XPHL 3TJEL 2WLZA 5L9DL 4N0YH 3S34H 1P9MC 1WEJL 3LPWA 5BO1H 4X4MA 3MRFA 5GGTA 4WENB 5CP7B 5KSBB 1I3GL 3C08H 4EUPA 4PJCE 5D8JH 4BZ1L 1IGYB 3G04A 2VE6A 4XNUL 1JYNA 5HY9A 3CX5J 1DBKH 1G9MH 1QP1A 2HJLB 3F7PC 1KCRL 3D3VE 3SDDD 3FFCB 2EC8A 5C09A 2X09A 1EFXB 1XIWA 4WJ5B 1RZJH 5DD6B 4UV4L 3ZKQD 3HPLB 1HKFA 3MV01 1IE5A 1TETH 3OXSB 4WI9A 1W0WA 2X4SA 3PHSA 1R5IA 3QIUA 3DWTA 4LNRA 2I5YH 1FV1B 3IXTB 3GSQA 4LQFL 4RISH 4Z95L 4GAJL 1N3NA 5EC2B 1E28B 4ORGB 3S96A 1RK0A 3RGVA 4OI7A 2GYSA 3WHE0 1FFPB 1MHEB 5IWLC 4X6CB 5JQHC 4XZUA 4R90L 1CFVL 3F58L 1WUNT 5F7NC 1QO3B 3QCTH 1QLRB 4XCYA 4XXDB 1BBJB 5ELIA 1B0GA 1PZ5A 3VW3H 4YFDB 1S5HA 4JO4H 1J05B 5AWNL 1JVKA 4HXAL 4PB9L 1PW3A 3GMOB 4DEPC 2PUQT 5KSAA 4C4KO 2EC9U 5TDPA 3DROA 4JVPA 4D9QD 4HUXB 3BJLA 1XIWC 2X9WA 5EU7C 1NAMH 4OB5L 3LRGA 4Z76A 4ZFOA 4Z7WA 1K8DB 5LWYL 1YEKH 3QIUC 1ED3A 1WBYA 4XBPA 4UIKH 1ORQB 1RMFH 1Q94A 4PRPD 1X5XA 1J8HA 4F7EA 3BW9B 1Q8MA 1NGYA 3RGVC 3U36B 3E3QE 3C5ZC 2QHRH 3DNKA 4U6YA 1MAJA 5A2IH 1M1SA 1JWSB 4R3SB 4LDOB 4W6YB 2CJUL 4OKDA 2LVCA 5IVXE 2P8MB 4HZLA 3VE0A 4P5MA 4HFUL 1D5IL 3CSBA 5K9OB 3ZT7A 4YXKL 3PWNA 2R23B 4ZQKB 1KJMB 1LO5B 2X4PB 5DUMH 4YHML 5JZ7C 1F4YL 1ZHLA 3IDIB 2ID5A 5FM5O 3M8OL 1CG9B 3NOIA 4WU5A 1EEYB 1JTPA 2DQHL 3QFJA 3QISA 5DI8B 5F8QC 5KAQG 5KSAC 4PRAB 1QFWI 4Q0XH 1RZIA 1SY6H 3MRPA 1SJEA 2DMBA 1TMCB 2PO6A 4EVNA 2GY5A 2XI9A 1F4WL 2VO5A 4Y19B 3SDAA 2YPLA 3BH8B 3PQYB 4LL9A 4IRJA 1YPZE 3GNMH 4RIRA 2WM0A 1FZOA 1VEMA 1HDMB 2ZPKL 4ZUSA 1N2RA 3GSRB 3MXWH 5FYLL 1VFUA 2BRRL 4HH9A 3MLSH 4NZDA 2DL2A 4RAHA 4BUHA 5HHVL 4K8RL 3QEUB 4TULH 1K5NB 4ZFGH 3S88H 3RUGB 1VCAA 2VXQL 4Y5XB 3RIFK 3HC3L 2FATL 3TBYB 3D6GA 1E4JA 4HGMA 1XF3A 3LN4A 3RKPA 2DTMH 2CLRB 3L5XH 5DRZB 3MXVL 3N50A 3FTGB 3MRDA 4HXBH 1S9XA 3R4DA 1KTLA 5HGDA 2XKNA 4BSWA 5ISZB 1YECL 5DYOA 2CIKA 5HGBA 3ROLA 1QFUH 1JPTH 3D39E 2PO6C 4K3JH 2FL5A 1PG7L 1PEZA 2BVOB 4YZFF 5D5MB 4LSQL 4RRPG 3S3PA 3C09C 3WFDH 1AKJD 1KJVA 4M9PA 2IFFH 1JF5A 2V7HA 3VXMA 4XPBL 5FHAL 5JIKA 2H32B 1W2KT 4MA3A 1PD6A 4WTZA 2ATPB 4M7ZC 1KULA 4PRIB 1S5IL 1O7VA 1GZPA 1QLFA 2QADD 3MRJA 3GMPB 1QSED 2A1WL 1U3HD 2EDYA 2D7OA 4Y0GA 5BXFA 4WW1A 2W0FB 3RJDA 5C3LD 1BQUA 2P5WD 3CUPB 3QJHA 2QQQA 4OLYL 3OG4B 4NJAH 1LMKA 5F9JA 1YN6B 3MV11 4TTDD 1A7BA 5IQ7H 4PD4J 4YDLC 3F12B 3RGHA 1I9JH 1MJUL 2UUDH 4ZS6D 4I18B 2X4QB 4FFZL 4JFOB 2JIXD 5SX4I 1NFDE 4J8RB 1INEH 3O4LE 4LHUG 1A1OA 5DQJA 4X9GA 5JPNA 3BE1L 4O00A 1HSAA 3QUML 5DK0B 1T20A 1FFNA 3BZFB 3BXNB 5EBWB 4IDLA 1OCWH 1CLOL 3QR2A 4RGNE 2GJ6D 4HJGA 5D7LB 2DLTA 4PJ8A 3L3GB 1N0XH 3VI3E 4Q9QL 1RUKL 2WWKO 2R9HD 4P9ML 4ONGH 1M6OA 5GGRA 5CMAB 4MAYC 2ADGA 2FEDD 5IEHA 1I9RH 1UACL 3QYCA 5D4QA 5E5MB 5DRNB 3KLDA 2CKBH 5CWSA 3KPRE 1IBGH 4YBLB 5CIPH 1WFOA 4OLZL 4PJ5A 5GGQL 1FYHB 3LKOA 1F6AB 2Z92B 3VD9A 3PV6B 3BWAB 4AIOA 1I8KA 4M3KB 5GS0C 2Q86B 1FNGB 1MF2L 3U7AA 3HG1D 3SDXF 4J1UB 1CT8B 5E1AB 1L9NA 4NQDE 2CUIA 1RVFH 2HJFB 1CICD 3RTQB 5TF0A 1HHHA 4G8IA 4M8QA 4ETQA 1DL7L 2GITA 2X89A 4OZHB 5TDNA 1TCRB 3P4MB 1NCDL 1S9YA 3KYAA 2DQEL 1RZKC 4MAUH 5D7JD 1T66D 1EGJA 4MXVF 2DL9A 2DKUA 3U30C 3FHQA 3T77A 1NCBL 2FJGA 4DUVA 1IC4H 2XZAH 5E08H 1JFQH 4NJ9L 4L29A 2QR0A 4LPUA 4GXVL 1LP9E 1NC2B 4DTGH 4ELMA 4TUKH 1OAYH 4QWWC 1LDPH 2P8PB 4G9DB 3SY0B 1S7RB 2WQRA 4TVPE 3W82A 2J6EH 4UT6H 4MMZC 5E6IB 4XP6L 3LKNA 4Z7UE 2VLJB 3TYFB 3P4LA 3RU8L 5D2LB 4KHXH 3TFKC 2QLVB 1K3IA 1WAAA 3OV6A 2EYRA 2V5RA 4CN1A 1RFDH 3O6FB 3DVNB 4PJ7A 2BVQB 4GG8A 1L6ZA 3R1GL 1A6WH 3GIZL 15C8H 3TZVD 1G7LB 5E2TH 3WL9B 5IR1B 5L88L 4W4OA 1XF4A 3DGGA 5I18H 5C07B 4Y5VC 1B6DA 5DQ9A 5JOEA 3NTCL 2R2BB 1YEDB 2BMKA 4AEFA 1GHFL 3GK8L 3GMRB 3NABH 5B3NA 3ARGB 1SBBA 3TCXA 3MJ8B 4JEGB 3BP7B 3T8XB 3QUZB 5E56A 3RJQB 1L0QA 1H15B 4P4RA 4LKCB 5EN2A 4YGVA 3RI5K 4QHKI 1JPFB 5HDQL 4FFYH 3NCYS 5I2IB 4QOKB 4JFEE 4XH2A 1S78D 5B3JE 1ZWIB 1MNUL 1TVHA 2XWBA 1GPOH 4EN3C 1IVLA 4W4OC 1F8TH 3CDGB 4ALAH 2DLIA 1HI6B 2F54A 4P4KB 4M93C 5IKCA 2HRPL 3HC0B 1AGBA 4U6VL 1GC1C 1DQQA 5BS0D 4MD5A 2WUCL 4AK1A 3QWQB 5D96B 2YBRA 3QULA 3B2VL 2X4RB 1I1AD 2GW5A 1FO0B 5J1SC 2CXKA 4RWYH 3S36X 4HIJB 4P3DB 3BKJH 3MRLA 5C86A 4KMQA 1CZ8H 5GHWH 3KPOA 4NQCB 4XCCL 3BZEB 4D8PA 1WTGT 5SV3A 1J1OL 4UAOC 4P2OD 4HHAA 3OKDB 1IC5H 1MREH 3MBEB 3MRRB 3T0AA 4U1JA 3NZ8A 3EDJA 4OLUL 4R4ND 1VEPA 3W39B 3VXRD 1EXUA 3ARBC 1G7IA 3TO4D 2VITB 4LP5A 4XX1G 4D0BA 1IGML 2DDQH 3BQUB 4KROB 4ODUB 2X40A 3RIAF 5I16B 4ZFFB 1C5DB 2J5LC 2IALA 1CXEA 3AREB 3LSOB 5HVGB 3K4AA 1KN4H 2EEAA 1JNHA 5C70A 3W5MA 4JRXE 4KKAD 4F9PA 4ZFZB 1YEHH 2ZJSL 2Y6SC 3PNWB 3PWLB 1DLFH 4LSSL 4UDUB 3REVA 5DJ0A 4UUJB 3QDJD 5GQBA 2FSEA 1YMHA 3QEGH 4NQVB 1YQ2A 3ZHDA 4OFIA 3L3OB 1QACA 2XKSA 2NY4B 4N0YL 2E8ZA 3S34L 1AY1L 1I7UA 5F1IB 3ULUC 3ULVF 4YR6B 3TBTA 1NFKA 4ZO9A 3T2QA 2E7CA 3C08L 4JRYB 5D8JL 1WFTA 5FK9B 3ZE0E 2Q76A 2Y25A 4HIHA 5IFHL 2HFTA 4GAGL 1G9ML 1DANT 4RMUA 1MY7A 3VFUA 4Q6YA 1RZJL 3UTPD 4RQQB 3G6AA 3QUMB 3EFFA 2VLKB 3VRJA 5DZNA 3GI8H 4HIXH 4RA3A 1TETL 5ICXB 4WFGE 3M45A 3F62A 2I5YL 3TN0A 4RISL 3MYJA 2DI7A 4XNYH 5KSBE 4YHPB 1AD9A 3HUJB 3EGSA 2W59A 2EDWA 1AR1C 3FFCE 3RWEB 3IJYB 4D0DB 3TCLA 3OJDB 3QCTL 3D85B 4X6DB 4HIIA 3VMOA 4K2UH 4DN3H 4MJ5B 3WHXA 3SQOH 4JO4L 4MXQD 4P2RA 5E6YA 5T1MA 1D5XA 1CCZA 3FQUA 4NRZB 4HUWB 3RAJH 2ZUQC 4LHUB 5FHBH 5C09D 3S4SA 3SBWA 1XIWD 4G8FB 3ZKXC 2EDKA 2X4OA 3LQAH 3QIUD 2EDXA 4R2GB 3CH1B 5KANG 1JHLH 4UIKL 1MCWM 4PJIB 3DETC 5F3BA 5GZOC 5BVPH 5DMJB 3HHRB 3RGVD 1L4IA 2F74A 3C5ZD 4U31A 4KZDL 2QHRL 4XB7A 5EUOB 2G75A 3VD3A 2CLVA 1KLGB 3LKSA 4IRSB 1SYVA 5HYJB 3UZQA 3F5WB 4O4YH 1ZHBB 5JW4M 2EE9A 3VXTA 1K6QH 5JZ7D 1ZHNA 4Y4KC 1T1XA 5DUML 5I1EL 5EG6C 2XKUA 3MGOB 4ISVB 3H9YA 3HKFA 3L7EB 1EERB 4LAJH 5JDSB 1AIFA 4YHIB 5SWQB 1MLCA 3BO8B 1ZKAA 4Q0XL 3SBWC 4HJJH 2KQMA 5JA8B 2HWZH 2OK0H 5F97E 1MLBB 1UKQA 4FTVB 5I1CL 3C2SA 1VGEL 3GNML 1J8HD 2A6KA 1X5FA 1LEGB 1WTLA 3MXWL 5DURB 4OZIA 1MCEA 1PGRB 1WIOA 4RDQF 3WXWH 3S35X 3MLSL 4MNQA 3ZE0F 4MHHI 4NQUA 5GS1B 4TN9A 4TULL 3QH3B 4ZFGL 1AHWB 2EYTB 1Z6JT 3LPGA 4LSUH 2VIRB 2I9TB 1XGPB 1M05B 4CJ0A 4O2EB 2UZYB 2PR4H 2N7BA 4J7RA 4Y19E 3MNVB 3PQYE 5EOTA 3WBDA 4IHOB 4HXBL 4JM4H 1U41A 2BVPA 5BV7H 2P46B 3P4NA 5I66B 1M7DA 1OTUD 5K9QI 1UJ3B 3SDCD 3BKCH 2PO6D 3KPSA 1JPTL 2EIZA 3O45A 4K3JL 2YPLD 4G3YH 2QQKH 5B8CA 2PCPB 2COQA 4FQPA 4S1RH 1T22A 4Q58C 3WFDL 3QNZB 1KIRB 2IFFL 3C9NA 5ICYB 4OTXL 4E5XB 4EI6A 4KZEH 1BIHA 4AIZB 3UPRA 3BH9A 4R4FL 1U93A 1NUDA 5ICZA 4G6FD 43CAB 1ZHKB 3MCKA 1ZLUH 4BUGA 4QRRE 5HHMB 4TSCH 1B0WA 4X6CF 4JFFB 5T1KA 3P2TA 1MCPH 2R4RH 4LIQE 3AVEA 4EZMA 3CX2A 5D5ME 4HUUA 5CEYA 1DFBH 1HXYB 3OKMA 8CGTA 3IKCA 3KYNA 4PGBA 3O2WH 4NJAL 1FNLA 3P30H 3F7RA 3PIQB 3WN5A 4NWUH 5HDBE 4PR5B 1FFQA 1I9JL 4G8GE 5C0BB 1I1FA 5B8CC 3MREA 4MB5A 4GQPH 4KGLA 2WW8A 1UZ8A 5IK3B 1INEL 2EC9T 4LCYB 1NMCC 2E6QA 1KUMA 1NGQL 1YEFH 2BHZA 4NQEB 5GGTH 1WWAX 1G6RA 4HLJA 4ZTOL 2EO1A 2IAND 1X6NA 5E94B 1OCWL 2Y9RT 2P5EA 1OY3B 4U1GC 4OCYH 1IGCH 3DUUB 1N4XH 3ZTJH 4R26H 3LEXA 3QCUL 4ONGL 3WIHH 4MAYD 3L7FB 4IJ3C 4PRHD 1A64A 5DRWA 1I9RL 1DBMH 4OF6A 4LRNH 1SYSB 1LNUB 1CBVL 4EQ2A 1R24B 2IBZX 1IBGL 2APXA 3ZDYF 5C08D 1U91A 1T7VA 4WEBH 1IL1A 4PG2A 4FQXC 5FIEA 1JWUB 1J1XH 2CIIA 3V6ZB 3WN5C 5GS0D 1IM9B 3T3PF 4MQ7A 2BOCA 1FHGA 3O2DA 5E70A 1QKZH 1SQ2N 3K8MA 3PWPE 4S1SH 4HG4J 2AP2A 4J3TA 4PFEA 1WITA 4Z78B 1J0YA 2VNCA 1RVFL 3MNZA 4OF8A 1LVEA 3U7WH 3B3IB 3VFOA 4PD4K 1NFIA 4K3DH 2P24B 1I1RA 1U8MA 5E8DH 1H0DB 1NEZG 2OLDA 3RNQA 1IEAA 3GBNL 3RUGF 1R3HA 2FD6H 5GPRA 2CDEB 5KSVA 1RHHB 4X4YA 12E8H 3FQXB 4IM8A 2AJ3A 1IKFH 1T0NB 1HQ4A 5JW4R 5IHZA 1IC4L 3I6GB 5ID1B 3WO4C 2E5EA 3MRQB 5DMIL 1JFQL 5HXMA 2QBWA 1WBZA 4AQOA 3NFSH 1T1YA 4HIEA 4NKOB 4QWWD 3H42H 4TUKL 3EBAA 4LLDB 1LDPL 2R2EA 1ZAGA 3K46A 3VGAB 5FV2A 4OZHE 4O02H 1TXKA 3AU1A 2LAAA 4UT6L 4LKXA 2FB4H 5LAXB 1I8MA 4F3FA 5BRZB 1SEQL 3TFKD 2IFGA 2HKHH 3P73B 5E9DA 2EICA 4LCIH 4H25A 1RFDL 4RNRA 3GMNB 4Q6IC 4U1SA 5FUZL 1A6WL 15C8L 3FB6A 5E2TL 1BOGA 2A38A 3F7VA 1RZGA 3ISWA 4GBXA 4C56A 3WJJA 4NDMB 2Z8SA 1NAMB 1JNJA 3DYOA 1BIIB 2PYEB 3RPIA 1UWEH 5J6HA 3KLHC 4UQ2A 3DBXA 1FQ9C 2VLJE 1KF9B 4L3EB 2E6JA 4NSKB 5EB9A 5D2LE 3D1MC 1NJ9A 3H2WA 3NABL 1ZT4A 2O61B 1FLRH 5L0QC 5J56B 3BEVB 1VB9A 1XEDA 1JWMB 2APBA 5JPMA 3MA9L 4XCNB 1AC6A 3QEQA 5MENA 4Y5YC 3RFZC 2MPAH 5BQ7B 4FFYL 2Y7QB 5FYJE 3DV6B 5C07E 5L7XH 2A9MH 3BOVA 2Y5EA 1I4FA 4K7PH 1J1PL 3PDDA 4HV8A 3DXAD 1Z5LA 1YMMA 3PDGA 2GSIA 3GMMB 4DCQA 3B9KA 1IAMA 3P11H 4M5ZH 4EN3D 3NIDE 3V6OA 1ZOXA 1IAKB 4ALAL 1U58B 4HKXB 3UJJH 4YDVA 2YN3A 1F11B 5DA4A 4OFYA 1RD6A 4QOKE 1OD7A 3PABA 4NO3A 3T0ED 4HMDA 3MMEB 5I1HH 1X5GA 4HFWA 2X4TA 3GSOB 5SWSB 3EW3B 5FM4A 2Z91B 1KEGL 4RWYL 4NOFA 5CBAA 1QR4A 3BKJL 5F1NB 3QUXA 4PLKC 1U8NB 5IFJB 5L8LB 5JNYA 1XGRA 3OX8B 1QRNB 4U2ZA 4JFYA 2BHYA 1IC5L 4U0RC 5FGRA 3RWCB 4MJ6A 2P45B 4OQTA 4F58H 5FA3A 3AAZB 5GIRA 4HMCA 4HK3J 1A4JA 1KT2A 3AMLA 5GS0H 3ARBD 3TBVB 3S8WA 5D1QC 5ESQB 1W0VB 4WUUA 4BH8A 3SOBH 4NQCE 5FDWA 4OGZA 2DDQL 3DUSA 2B4CC 5FF6A 5I1LA 1R3IH 4F7CA 1NGWB 3SE8L 4N0RA 3OAZH 2IC2A 2R0ZH 1L0XA 5TGBA 3C8KB 1MJJB 4PJXB 1KN4L 2HLFC 2YEZB 4AMKH 2Y6SD 3E8UL 3QUXC 3CXHJ 4K23H 4BH7A 4YEFA 5HI4D 4DKEH 2D3VA 1DLFL 3SDDB 4H26A 5ACZA 3JTTB 4DOHE 3A67H 3I6LD 5LGJB 1KXTB 1T5WB 3QEGL 4HS8H 5D2LF 2Y5TA 2FYYB 2HVJA 2X4NA 3OKNB 4XWOC 1T0MA 4PREB 3ULUD 3GSNH 5F9AC 4KKNA 3QB7C 4MB3A 4Z7OF 2YZ1A 4LMQI 3MO1A 3N0PB 2VXUH 3C6LA 5JHDD 1S8DB 2DKSA 3VXSE 1NBZA 3IDGA 2D03H 3KPNB 4P3WA 5EO0A 2XWJA 4I5BB 5L2JA 4GKNB 4ZPVB 1FC1A 4IIQA 3GI8L 2WBJB 3STZA 4CU8A 3JWDH 5I1DA 3UBXG 3F7QA 1JMZA 1XR9A 5I71C 4XNYL 3DPBA 4GG6E 3W0WA 3SE9H 3MRCA 2ESVE 1FNFA 2B1HH 4M61A 1I3VA 1AR1D 2CKBB 2OQJB 2ADJA 1QFOA 1RJZA 5CIPB 3ZL4H 1NDGB 1QEWB 2ICES 1U8JB 2CUMA 4U05A 4PRPB 1FVEA 2VLKE 5FO8A 4K2UL 4DN3L 2B8OT 1CFSA 2QSVA 5DQDL 4OZ4B 4U1HA 3SQOL 2BHUA 3FQWA 3SJVA 2V17H 3RAJL 3NN8A 1NGPH 5HYSA 3C6LC 4NP4H 1Q9KB 4MJ4A 4P23A 4R7NA 1FZJA 5FHBL 3IDJA 4AENB 4BFGA 5FEBA 2ZWLT 1FAKT 3LQAL 5F7HA 3MYZA 4RSVA 5IMKB 4IIQC 3QHFL 4WW2A 4X6DE 4YHLH 5JIIA 3DETD 5GZOD 1R3JA 4HWZA 5IIEA 5BVPL 4MWFA 5I75C 5KS9B 1UM5H 3G5XA 2OS7A 1A6TB 1GC1H 2YD4A 1CD8A 1WC7B 3QXDB 4Y4KD 5CJ8A 3HZKA 4P2RD 1K8IB 5DHXB 4PTTA 2GTWB 2XOTA 2OTPA 3E2HB 4JDTH 2VDKH 1A3RH 3MJ9H 1KB5A 3BZDA 4PJIE 3DMMC 2Z0BA 5E8OA 2AJXH 4P23C 4E42A 2L7UA 1TQBB 1OT2A 1NBYA 2HWZL 5D6DC 1IAOA 4JCLA 2OK0L 2XG4A 3SGDI 1R3KB 1OWWA 4ESKA 3NH7H 3BDYL 1RUPH 2CK0H 4ZG1A 1NEZB 3VRIA 5DJXA 3D69B 1T21B 4Y7MA 2VL5A 3RWIB 1JZ8A 1JGDB 2Z93A 1YNKL 2QTEA 3L3IA 3U7YH 2FR4B 3P4OB 1CE6A 1WIUA 5GRVL 4V1DE 4YQXL 4LSUL 2KKQA 3CFCH 1MEXH 3U83A 2YD2A 4JGJA 4X7TA 1RIVL 5HHXH 4OF3A 5IVNA 2BJMH 4JM4L 4M6NH 1BQHB 2CLZA 2QADB 2X5PA 3NIFF 4WNQB 4NKIH 1QSEB 4XVSH 2DLEA 1BECA 4PIRF 1U3HB 3BKCL 4HT1H 4O51A 3HZMB 1AXSA 1ZANL 4G3YL 4AEIH 3EYVA 4ODHL 3P77B 4GLRI 4S1RL 1ZEAL 2P5WB 3HFMH 5J12B 2FIKA 3ULUH 4KZEL 4MNQD 4PRNB 3G08B 4WV1B 2VISB 5I8CB 2UUDK 4KI5E 4EUPG 4Z8FL 3V4PH 4PLJD 2VERN 3HUJF 4BYHA 4TSCL 3WNLA 3PWUA 3UZEA 3ZTJG 4OD2A 1O7SA 1MCPL 2R4RL 4CKVX 1AD0B 4JKLA 1Y0LB 4X6DF 3K2UH 4PRDB 1UKSA 3ZYJA 1DFBL 4NHCH 4EIGB 5AAMA 3PXJA 1RZ8B 4WI4A 5FB8A 1DP0A 3REWA 1A1MA 1A02N 4NKMA 2VLLB 5IG7B 1G7JB 4NWUL 5JUEH 5H35A 4M8VA 2OJEA 2APVA 5HHME 4M4RA 2HN7A 3BVNB 5EH1A 3DX7B 1YEFL 4NKQB 3TVMB 4JDZB 4G6AC 4PGEB 1IGTA 4PJIF 5EU3A 3ARDA 3B9EA 4ZSOB 5IJKA 5E8NB 1FGNH 3HG1B 1BEYH 3Q5OA 1FPTH 1N4XL 5TE6H 1RULL 4R26L 5EUOF 5T1KD 1R5WB 1EAPA 1T3FA 3WIHL 4QT5B 4XHQA 5DEGA 4ODSH 4MCZA 1SVCP 5C0BE 1DBML 4QF1B 3CVIH 1CICB 1DEEA 2YC1A 4PP2A 4MDJB 4WEBL 4NQEE 5A43C 4FQXD 3P9MA 1J1XL 5BZDB 3PGCA 5CBEB 4O9HH 1QKZL 3Q3GB 5D7JB 3UTSE 2E7BA 3ABZA 2JCCB 2QSTA 3KYOB 4K7PY 4NKDA 1TTGA 4B7IA 3PJSA 1MWAL 3MJGX 3ARDC 2P5ED 5CGTA 3U7WL 5IF0A 1C16B 3EZJB 4K3DL 1VGKB 2XIDA 5E8DL 4G8EA 1I9EA 3C87A 3UYRL 1JHTA 2FD6L 4NZUL 3V4VH 1MCNA 2MHAB 5EOCH 5EDXA 3MFFB 12E8L 3LRSB 5C0EA 5F21B 2GT9A 4QO1A 3UPAA 3U46B 1CTOA 1B3JA 1IKFL 3BD3A 5GGVY 1HN1A 4HS6B 4MA8H 1F2QA 1A5FH 1J0ZA 2R1XB 4RMTA 2CD0A 4PRBA 2Z31C 4XC1H 1QSZA 1U8OA 4H20L 3NFSL 3QI9A 1EVUA 3FOLA 3PL6A 4KQ4H 5A40E 4X7DC 4HDIA 4XX1E 4G7YH 4S0TD 2YPKB 4GUPA 2RFXA 4O02L 1T89A 3IFOB 5MHSE 4KRLB 3QBTB 2W65A 4LCCA 3ZDZF 4I0PC 2EDLA 4PJHE 4PYGA 1T1WB 2HKHL 1XF5A 3QAZB 1WF5A 1F4HA 1J87A 4XNZB 4LCIL 3BPCB 3HLAA 3QO0A 3IF1A 4HG4K 3KPQB 1FZMB 4ZOEA 2ZOLB 1TPXC 3KLHD 1C12A 4Z7NF 1UWEL 4P57B 4WY7H 1CD9B 3VFMA 1KENH 3GSWB 2DIBA 4JPVH 4D3CL 3CH8A 1SEBA 1FLRL 3PL6C 4KWUA 4E41A 4M5YH 1XT5A 4WTZG 1KEMH 5T1DH 2BY3A 2MPAL 4OV6F 1IEHA 2CK2A 5HHOA 4LCCC 4WO4C 4GS7C 4UU9A 4TRPH 5BS0B 4ZTPH 4AM0A 5FYKU 5E00A 1RIHL 2PYEE 1HSBA 1S9WB 2GFBA 4MCYA 5E9DD 5DUBB 5L7XL 5J1TC 1S3KH 4GRWH 3RDTA 3NPSB 2AJZA 4L3EE 3WLWC 1I1AB 2FZ3A 4J3OC 4K7PL 5T5NF 1BVKB 5IBLC 3WEXA 3PV7A 3WO3B 2VLME 5L8KB 4N0FA 1BZ9B 3GJEB 3P11L 3S37X 4C56D 1GJIA 3HMXA 4PJ7F 2ICWB 4Z77A 1QBBA 3QNYA 1OARL 1ORSB 4FQ2H 5JO5B 1KNOA 4NM4H 4P2OB 4U1IB 3DUHA 2V2TA 1JF1A 5T3XD 1RJYA 3C5JB 3H3KA 5DFVC 2YA1A 5I1HL 3VXRB 4HKJB 1I7RB 3G5YA 5GGVL 4C54A 1JE6A 5MEND 4LLQB 2OZ4H 4PLKD 3EYOB 3MJ7A 1FIEA 1GGYA 4DZ8B 3VWKA 4YH6A 4MD0B 3BP5A 3HCVA 4LVEA 3X12B 5EFIA 1YZZA 3NFNB 2AXHA 5FKPA 4S2SB 1YMMD 4OKVA 4DN4H 4F58L 1W0YT 2IADB 5BV7B 2AEIT 4XMPH 5C8JB 2BFVH 3ZHKA 1CGXA 4I48B 3RNKB 5SWSE 2RBLA 4QRPA 5D1QD 4RGOH 4U3HA 4IS6A 4D0CB 3MOQA 3QDJB 4X7SL 3TLRA 5JXAH 1MPAH 3SOBL 5J11C 4OUOA 1CDJA 4LQ1A 1QRNE 1NLBH 4OFYD 3RVVC 3W9DB 5C0RL 1MOEA 4XRCA 2HH0L 4S11A 2AVGA 4DKAA 4K94C 5HGHB 4TSAH 3LPFA 4YGAB 5A16A 2R0ZL 1BFOB 3V5HA 4BKLA 2HLFD 4JM2A 3QUXD 4AMKL 2ITDA 4YIQB 5F6IC 3EOYG 1D5ZB 2AQ1A 4K23L 3QIWA 1WWBX 2N4IA 1U8LB 3UTQA 3VWKC 1P7QA 3LKQB 3A67L 1GGIL 2NY2C 2JB5L 5H8DA 1FZKB 4HS8L 2J8UF 3OKOB 4NBXB 3OAYH 1FC2D 1E6JH 4C83B 4XWOD 2GAZA 5C0AB 3KHQA 1JGUH 3CGTA 2OXHA 5F7KC 3GSNL 3RWJB 4X7EC 4NGHH 4Y2DD 3O2DH 1IC1A 3ROOB 3RWGA 2HG5B 5FYKL 4IOIB 4PJXE 3ZO0A 5KVGH 3FT2A 3FN9A 2VXUL 3MCG1 1EEZB 4KRPC 3H3BC 2RB8A 2D03L 1P4IH 4PJBB 3FQRA 5F88A 1BLNA 1AO7D 1AP2A 1EK3A 3JWDL 4ODVL 4R96A 4XVUC 3SN6N 3S37H 4DEPB 3QIWC 3SEPA 5C09B 5TQ2H 1XIWB 3PXHA 1UCBH 2B1HL 1T5XA 4RMVA 4HZAA 1C7SA 5EZIL 4R0LA 1DUZA 3TO2A 2X4SB 4X98A 3ZTNH 2V5MA 3QIUB 3ZL4L 3BGMA 2W0LA 1UB6B 3HTLX 4PJ9A 3GSQB 3O4OC 4K9EH 1N3NB 4NNYA 3GO1L 2NNAB 3S96B 1KLUA 4RZCA 3VFWA 3C5ZB 3WUWB 1IARB 4ENEC 1MIEH 3C6LD 1NGPL 3MROA 4YNYB 4LLVA 3MSPA 1TQCB 2YUXA 4NP4L 4XZUB 3DX8A 4XI5C 2X44D 1OWRM 1HHGB 3D2UB 4ZNEA 4D9QE 5KG9B 2Q8AH 1BJ1J 2G60L 2I24N 1B0GB 2KBGA 4BFBD 4H0GA 2XWTB 4PB0L 5DS8A 5IB1A 4JAMA 4PRPE 4U1MA 3AS0A 1NUNB 3W0WD 3N1GC 2WMPA 1CIDA 3M1BA 5I1AB 1UM5L 3DI2B 2HT2C 4R0LC 1GZQB 1GC1L 3SGEI 2HJKA 3NPZB 5HGAB 1Q94B 4PJ9C 5T3XH 1EUTA 1J8HB 3BRDA 1IGJB 4F7EB 3K2MC 3H7LA 4NN6C 2V2WA 5D2NA 4LCUA 4OCWH 5AUMA 3SKOA 5GRVK 3JV4A 3DMMD 1FDLH 4JDTL 2VDKL 3MJ9L 4P23D 1CDUA 1NGXA 5CEXB 4Z0XA 2AJXL 4KI1A 3VE0B 25C8H 1KV3A 5KS9E 2H2PC 3ARFA 3BP6A 4ZDHA 4WU5B 2D0GA 4YDIH 2CK0L 3VJ6A 4LASH 1VHPA 1UXSB 4ONFH 5DVMA 3VXQB 4N8VA 2CRMA 3SDCB 4P3CH 3U7YL 2PO6B 1PEWA 2FX7L 1P1ZA 3RVWC 3CCHA 4TTGA 1ERNA 3FOMA 2CQVA 4WHTA 2B4CH 3CFCL 4PLNC 3FJTA 2R0LH 1N64L 2R2HA 4ZUSB 1N2RB 1QA9A 3HR5B 5GSVA 2HLAB 2LU3A 5DXWA 5HHXL 4M7ZB 2BC4B 1ZLUK 3IAGC 2BJML 3QDMA 1RHFA 4KUCD 1NC4A 4M6NL 4XP4H 5TFSL 2OBGA 1CWVA 2PF6A 4NKIL 1IGFL 4XVSL 4G43A 4KAQH 4HT1L 1I8IA 1TVBA 1JP5A 3LN4B 5DEFB 4AEIL 4OQTH 5IBUB 1VENA 3WS3B 5ESAA 3BI9X 3P0VL 1KTLB 4KJYB 5HGDB 1RZ7H 3HFML 4KKCC 5DYOB 1NDMB 1A1NA 5HGBB 5I1IH 5I76B 4L9LB 2CO6B 1BZ7B 2H41A 1NCNA 4YDLB 3IXAA 5JOFA 3V4PL 4OV5A 2ARJA 4BSVA 5F7EH 1LILA 3OF6D 1QSEE 4JY4B 5E5UB 1CF8H 3FHAA 1GOHA 4M7JH 4CADA 4TUOA 2N56A 1RK1A 1EBPA 2IANB 4OQ1A 1LO3H 4NNXA 5GGSY 2HT3C 1GZPB 2VDQH 3MRJB 1ZXQA 1GAFH 4MAYB 1GGUA 3KPMB 4PRHB 3IGAB 3DJ9A 4H8WL 3PDOB 3KDMB 3GHBH 4JZOB 5D1ZC 3L5WA 1A7OL 5ADPL 4G6JH 1HOCA 4JFZL 3MFGB 4AH2B 3IDMB 5C08B 2E8YA 2DF3A 1S7UA 4JFED 4OGYL 4GRMB 3MV8E 4H88H 5K9JH 3DTXB 4UNVA 1KTDB 1JMXA 2GJ6E 5ID0A 3T0DA 1FGNL 1OAZL 1PBYA 1BEYL 4ERSH 1FPTL 5TE6L 4XP1H 5IEKA 3E6HA 3OB0H 4XBGA 1D6EA 3K74B 4XXCA 3S4SG 1FFNB 4WFHD 3CVIL 2YA0A 1Y6NR 4JGMA 3SO3C 2A73A 5EU4B 2PTUA 1MFBH 2Q7YB 5DRXA 4E0RA 4X4XA 2OL3A 1U8KA 4ZSOE 3GMLB 2ADGB 3KYMA 3GIVA 5EZLA 3HG1E 4O9HL 5CWSB 3K4DA 5D70H 1V05A 1ADQH 1Q9WA 2JK5A 3KPLA 3DHJA 4EQ3A 5HJ3B 1Z9MA 2NW3B 3GSNB 1I8KB 2BCKB 5JQ6H 3I3DA 1HH9A 2RR3A 1N59A 1JTTA 3O9WA 1CU4H 5K33A 4WDIB 5IMOB 1QUNA 3UC0H 3MLRH 5E4EC 4G8IB 3ARTA 4YDJA 5C0IA 2DQDH 2JCCE 2UWEB 4FMKA 4MZ2A 4ZAKA 3JBG7 1TZHA 2Z31D 1J0HA 4MA8L 3X3GL 4XC1L 3LS4H 4EI5A 3IVKA 1OW0A 4HKZA 2VDNH 4KQ4L 5SWZA 3QDGA 4NO5A 4G7YL 2KZ1B 4Y5VB 3QQ4A 1TCMA 3B9VA 5FECA 2FJGB 5JW5A 2YD7A 4I0PD 4I2XB 3H6JA 3OHXA 1T0PB 4X9FA 1JYVA 3T09A 3ZSSA 4JZJB 1SJHA 1PX4A 1U0QA 3TV3L 3G6JA 3P0GB 1ZV5A 3OTTA 5DD5H 3STBA 3MLPA 1GSMA 3LKNB 4X5WA 3Q6GH 1HINH 5EIIA 1DBJH 3S5LG 5E2WL 2XQBH 4R8WH 4WY7L 4GW5B 3UJIH 4ZAKC 1MJ8H 2AK4A 5AZEH 3IDNA 3Q2CA 4EI5C 1T6WA 4JPVL 3DXAB 5C0GB 3PL6D 4KTYA 4N0CC 1DZBA 1DN2A 1NCWH 4EN3B 4PJGE 4FN0A 4M5YL 1I7TB 2HVKA 3S9DB 1KEML 4M93B 3BKYH 3X13A 4WO4D 3T4AB 3MRBA 1HHIB 2PXYA 4TRPL 4ZTPL 2O5YL 4U33A 3MPCA 1S3KL 3OKEA 5CCKL 3T0EB 1PZUB 3WLWD 2JJWA 5B21A 2LAGB 4DUXA 2HFGL 3DX6B 5IBLD 1MJ7L 3NA9H 4N0UA 1I1YA 1M4KA 2WUBH 4P4RB 2WZPD 5EN2B 1WZMA 2YMXL 1MI5A 2CDFB 4F7TB 3CFKB 1D9KA 1K2DB 1P4LB 4UAOB 2VZ1A 5ERWB 4C55A 2DQUL 4FQ2L 4DGIH 2MMXA 3RWFA 2OI9C 4N5EC 3FFDA 3FONA 4JJHA 5BS0E 4XH2B 1HZHH 1DDHA 5DFVD 3SE3A 1NL0H 4L8CA 1DQJA 3D3VA 4Z7VB 3C6SA 2KZWA 5CJQH 3ARBB 1BF8A 2JTDA 3VMNA 4WI8A 1A6PA 1ZT1A 4NC0B 2OZ4L 3CVHA 2M26A 2P48B 2MKWA 2YK1H 3TT3L 3HI1A 1S7WA 4AEHL 1K4DB 4LRIC 1F3DH 5IGXH 5EZOH 3L3KA 1JZ6A 2P42B 2DM7A 3BMWA 4JO2H 3L5HA 3MODL 1C1EH 3BPLC 5LVEA 4XMPL 2BFVL 2E9BA 3MUZ1 4PTUB 3VXRE 3WFBH 4U6XB 2BSTA 3D0LA 4RGOL 3AUVA 3CFJB 5C9JA 5JXAL 1MPAL 3QFDB 3FRUA 3VFPA 4ZXBA 3RVVD 2RJMA 3WIFA 1NLBL 4CNIA 1OQOA 1U8IA 5B38A 3QEHA 5FM8A 2G9HA 2WK2A 4MQTB 3MGTA 4K3GA 1TLKA 1G7IB 3HE6A 1PSKH 3OR7B 3QWOA 3G5VA 2UYLA 5E5RB 5JHDB 5KVDL 4OZFH 3V0WL 3VWKD 4OUUA 4XGZA 2H1PH 3DHMA 2NY2D 1FN4B 3QDJE 4PV9B 1E6JL 3BT2H 2VMFA 2G2RA 4AT6B 4WHYH 2AABH 4F2MA 2J8OA 3UTTD 5IESH 3MLZH 4M6ML 4QKXB 4NGHL 4LLAA 4K71C 1AGCB 3MR9A 4JFHD 4LLMB 5KVGL 4L4TD 2FLBT 4KRPD 2H3NA 2Z4QB 1KYOJ 3LOWA 4L4VA 4ZXBC 2IG2H 1H3WM 1I7UB 3MRGA 2R8SH 2ZSWB 3UTPE 3H7BA 4LVNB 3TBTB 3O6LH 5IW1A 2F15A 5H94B 5IVZB 3NZHH 2V9TA 2ZUQB 5F9WC 2R15A 2B2XL 4G9FD 3QIWD 3S37L 4QRRD 3WFCH 3KLAB 3ZKXB 4AG4H 4CMHC 1HKLH 4JVWA 4J3UA 5DJCA 4OLVH 1CE1H 3ZTNL 5IB5A 3LHPL 2AJSH 3IFNH 1CGSH 5DMGC 1CD1A 3SDXA 2BNQA 4K9EL 4LU5H 3QRGH 4ENED 1AD9B 4LHJB 1MIEL 2BOBB 3IETA 3UP1A 4HUVB 4XI5D 4Z0BH 2ZCHL 1PFCA 2CDGA 5C09E 4B50A 5AD0B 2QQLH 3P9LB 5EU7E 4NBYB 4KDTC 3OXRA 4MSWB 4Y4KB 5DO2C 3TYGL 4UILH 4CU6A 1YUHA 2A6IA 1MVFA 4GKOA 2LU7A 2DQIH 1MRDH 3D39A 2A2QT 4QHNB 4UB0H 5MP6H 1SM3H 4JB9H 3S4SB 2C3VA 5J13C 2XFXA 2A6JB 2BXYA 5EC1B 5GISH 4NNPH 2HT2D 3L3JB 1JPSL 5HYQB 1XH3A 3WJLC 3EOAB 1ONQB 2Z35B 2EEBA 1P2CA 3QG6A 4PJ9D 1JK8B 2I27N 3ZKND 5T3XL 4JN2A 1K9TA 4OCWL 2IPKA 4L8SA 1FDLL 1QVOB 5JORA 5GGSB 4O2FB 5IB2A 3BHBA 3D0VB 3PWPD 4ZUUA 1LEIB 5CP3A 4WWKA 3TIEA 2X4UA 1CFTA 1MQKH 2W92A 2HFEB 3VFTA 2DOCA 1AFVL 5I0DA 3GM8A 2G5BA 4YDIL 1IAIH 4BSJA 1A3LH 4UT7H 4U7MA 3OWEA 1J8HE 4KKLC 4LASL 2ILLA 1AIFB 2E3VA 1NFDA 3EO0B 3KS0H 3HMXH 4UQ3B 4WW2F 2KH2B 4P3CL 4LDEB 1Y18A 3RVWD 4K7FA 3VRLE 1NANI 3VWJB 5L6YH 4I8DA 3FT4A 2B4CL 4NFCA 2EYSA 4L3CB 3CSYA 5IMMB 2R0LL 5FV1L 2P8LA 3KPPB 4TNVF 4K94H 4OZIB 4LPVA 3WYRA 2BNUA 1B6UA 2E9JA 1JRHI 1OL0A 4PGDA 4Y4HD 3N1FC 1ROWA 1HNFA 4HWBH 4OIIH 5I74B 4ZUWB 4L8SC 4PV8A 2EECA 5D7IF 5T1LD 3H9SA 3DSNA 1CD0A 2ZSVA 4U3XA 4XCFH 1TZIA 4L8DB 2CPCA 2VN4A 4QTIL 2YPLE 1J12A 4PJBF 1YNTA 1NAKH 1OHQA 4GRWB 1F3RB 1Z9OA 4XPTH 1E4KA 5KOMC 2NMSA 1WWCA 3IU3A 3KJ6L 4I0KA 3FAXA 3O3AB 2MNUA 5DJ2B 3S5LB 1KN2L 5I1IL 3SGJC 3WIIL 4QRUA 2R56H 2VSCA 4H0HB 4JHBA 2JELH 2E9IA 5EIVA 3TBSA 1JTOA 1FVCB 4GFTB 1CF8L 4U6HA 4EI6B 3QQNA 4M7JL 3UPRB 1JL8A 2J4WH 1AXTL 1G7MB 5ICZB 5KJRL 3KJ4C 1QG3A 3LEVL 3QDMD 2HT3D 1LO3L 3R06A 2NQCA 1NC4D 3GHEH 4ONHA 2VDQL 5T33L 4CVXA 1GAFL 5T1KB 4U1NA 2YZ8A 4IJ3B 3I75B 3WE6A 1ZMYA 4P5TA 5D1ZD 4HUUB 4M00A 4G6JL 3OKMB 3Q0HA 3GJFH 3PHOA 2BSRB 3GGWA 3EOBB 4MVBC 4KFZC 2H8PA 3LZFL 4H88L 4FQXB 5TJWK 1YEGH 3ZE2F 1VADB 2IANE 1OF2B 3EYUH 1KXQE 4KC3B 2HP4A 3BEWA 1ZGLM 1AGDA 4PJEB 4ERSL 1MCDA 5C1MB 5HYSG 1E27B 3RKDC 4XP1L 1PQZA 1WISA 3KXFA 4LARH 4PRHE 2ZCKH 5MI0C 1J0KA 2ZNWA 4NOBA 2OTWA 4JDVB 3EYQC 2XQYG 2DWDB 5DSCB 4KPHH 5C08E 3LS5H 5HYIA 5ANMA 3I6KB 4GRLC 4XPAH 4QHLB 3HZVA 4BA8A 2K9UA 3AFLA 1MIMH 4P5TC 5FO7A 1LHZA 1AGFA 1JZ2A 3TEUA 2O5XH 5D70L 3RBSA 1ADQL 1GIGH 1U91B 5GSRB 1MFEH 2FWOB 3V52H 3WO4B 4UNUA 1GCFA 1ZLVH 4CMMB 4QXTB 4KV5E 3STLA 5J6GA 2CIIB 2NTFA 4ODWB 3Q5YA 5JQ6L 2ERJC 5C0JB 4LBEA 3R8QA 1W8NA 2FECL 3GBLA 5HVHC 2HFFB 1E6OH 1G6VK 4DFHA 5JLZA 1CU4L 3DO3A 1IFHH 4M3JA 1U95B 4IMKA 3MLRL 4YAQB 3IB4A 3O3UN 5C7XL 4M1GH 5E1HB 3VG9C 2DQDL 1NFIB 1IZKA 3RX5A 1U8MB 3EO1A 4Q6IB 1MUJA 3IRPX 3JWOC 2ZUUA 4NM8H 3LS4L 1R3HB 3WXVH 1F58H 2APFA 4UTBH 5DC0A 3X14A 4APQA 1J11A 3PGDB 2IMMA 5C0DB 4RAVA 3ZYIA 4CVUA 3LMJL 2JE8A 5DJ6B 1DTUA 3ULVC 1FP5A 4NZJA 3FQTA 1Z0MA 5D71H 5L0QB 4A6YH 3DRTB 3D5OF 4HIEB 1Z3GL 2PETA 35C8L 3ZZ1A 1IQDB 4OZGF 2IH1A 5DD5L 4Y5YB 3GKWL 4OCMC 3TNMA 1I9IH 2YD6A 1G7PA 4IMKC 2PW1B 1DBJL 4ZYKB 4UINL 4HCRH 2XQBL 5E9DB 4FZEH 4ZAKD 3OKLA 1UFUA 4R8WL 5BVJB 3UJIL 1MRFL 4C58B 4H25B 1MJ8L 1FSKC 1HHKA 5AZEL 4FA8A 4I2XE 4EI5D 1HEZA 3SGKA 4U1SB 4N0CD 1OGAD 2HKFH 1KG0A 3FB6B 2AJYL 1NCWL 3FN3A 5CD3A 4APQC 4C56B 4PG9B 3RPIB 4OCLC 4HBCH 1ZT7B 1FJ1B 3BKYL 1YEJH 3GB7A 5EA0L 3V5DA 3OKKA 1NJ9B 2DN7A 5EBMA 1WAAE 2VDOH 4LSTH 4OAWA 4PY7A 3C8DA 4LF3A 3L3DB 3RVUC 3NA9L 2V2XA 3DXAE 4H1LA 2XYCA 2WUBL 3JTSB 1U36A 3KG5A 3GSXA 1INQB 5IVXB 1RIUH 3C5SA 5JIPA 4KUZL 5FYJH 4NUJB 1B0RA 3NA4A 4U0RB 4N5ED 4DGIL 4NN5C 2NY7H 5I9QC 1I4FB 4LLUB 1UQSA 4HV8B 2IBGA 5HI3C 1JYXA 1PX3A 1YMMB 1HZHL 4KTEH 1CL7H 4DCQB 1FRGH 5EOQL 3HAEA 1NL0L 2VLRA 4DJMA 4PJDB 2DWEB 1T1ZA 4X99B 4CW1B 3SCMC 5D1QB 4YDVB 4ZD3H 5E8EB 1ACZA 4ZUTB 2YK1L 1YPZB 1D5MB 3MRKA 3LEYH 4QGYA 3PABB 5CP7A 5IGXL 4P2QD 3VGEA 2DD8L 2OM5A 1KFAH 1IGYA 4JO2L 5CBAB 3VFNB 1MI5D 1C1EL 2HJLA 2XXCB 1MAMH 3QUXB 4Z7VE 7FABH 1EFQA 2XNAB 4WJ5A 4MQXD 4P0DA 1AE6H 5EIQA 2PYFB 3HPLA 1U8QB 2VWEC 1G9NH 1UXWA 3OXSA 4MJ6B 3IAQA 5HHPA 1FV1A 3ESUF 3IXTA 2UWEF 1WCBB 4QRQB 1KT2B 1E28A 1FL5B 3QPQC 4Y2DB 3L9RB 1KGCD 1FFPA 4DKFH 4CL7A 4X6CA 1ULVA 5B22A 2BK8A 2IAMC 3BN9C 2DQFB 4PJFF 2V7NB 4V1DD 1OSPH 1QO3A 3KR3H 1QLRA 4WWID 4DGYH 5FOBB 4XXDA 3LKRB 1DVFC 2H1PL 5M7QA 1J05A 2A9NH 2MQ0A 1AO7B 1H3GA 4FOMA 1X7QB 3BT2L 3GMOA 2AABL 3ESVF 1N0LA 3ULUE 2OL3H 2A6DB 4RMSA 5IESL 3MLZL 4RGMC 1D6VL 4HC1A 5ESVB 1CI5A 5I0ZA 3ARQA 5T5FH 3FQNB 3ARZA 2VDPL 5JHDE 4ZXBD 1KC5H 3MUY1 5KOVC 3BESR 3BYTA 2IG2L 4EXKA 3MLVH 4NRXB 3BW9A 5DFWH 2R8SL 3KHOA 3QQ3B 1OP9A 5EULV 2OX5A 3U36A 3O6LL 2YWYA 4LSPH 1NMAH 3MRHA 4GMSH 4QLRA 2QSCH 2YR3A 3AROA 2B0SH 4KI5D 3C6LB 2YD3A 3HNTH 2P8MA 4M6OL 5K9OA 3WFCL 2YN5A 1MFDL 3O4LB 2R23A 4ZQKA 4JM2F 1LO5A 2X4PA 4AG4L 4FXLA 1HKLL 1P7HL 5CILH 1I8LC 4G80A 1CG9A 4IIQB 5IV2B 1FH5L 5DMGD 2AJSL 5DI8A 3IFNL 4X5XA 1CGSL 4OCXL 4PRAA 5HTSA 4LU5L 2QKIB 2XZCH 3QRGL 5TH2B 5I75B 3NGBC 3T2PA 3BH8A 3PQYA 1VFMA 4L4VD 4Z0BL 5DD3H 2AXFB 1RJZB 5DJ8B 4IRZH 5DZOA 1HDMA 2QQLL 2DI9A 3GSRA 4YK4C 3HMWH 1CFSB 3QEUA 4HPYH 1H8NA 4LLYB 1K5NA 3HS0A 2DQIL 1AXIB 3RUGA 2DRUA 4Y5XA 3MV9D 3TBYA 3DMMB 4UB0L 5AEAA 4P23B 5MP6L 1KYOK 1SM3L 4H5SB 4JB9L 1A6VH 2NTSP 4ZPTB 2XA8H 1SVZA 2CLRA 5DRZA 4NNPL 4UIMA 3FTGA 3U4EB 1J0JA 4LVHC 4XVJH 5ISZA 2BNQD 4ELKB 1M7XA 2FHBA 2DQGH 2IQAA 4P2RE 4UTAH 4D9RD 3ET9F 3UTZB 2BVOA 1M7IB 2GJZB 4F37K 4XVTL 4RMQA 1ZGLB 1C5BH 1CN4A 4UOW0 2FBJH 4LCWD 4YC2B 1QFPA 4N68A 2H32A 1CGYA 4KVNH 2MOVA 3H3PH 2AKRB 1XR8B 4X0KB 2ATPA 4PTTB 4PRIA 4JG1H 4KKLD 4UT7L 4O58H 2XTJC 3GMPA 5F7YC 4AL8L 3I84A 2QQNH 2OTUB 1JPST 3OBAA 1NBYB 1IAOB 3WNPA 1JN6B 3UROR 2W0FA 5L6YL 2MQCA 1IRAY 5EU6D 3VRIB 1YN6A 3RL1B 5I1JH 1JZ5A 1P84J 4YHZL 3QT2A 4K94L 4HWBL 2BSSA 3WV0A 4NCC1 4I18A 2X4QA 4JFOA 1V5JA 5JTWA 3F7YB 4X6BB 3RX8A 4X6EB 5J4MA 1U2HA 1MCLA 3RZWA 2P47B 3HB3C 5DK0A 5EBWA 3BXNA 1C08A 4RAUB 4KK6C 5D7LA 4MDIB 4GKZB 1NAKL 2AEPH 2CKNA 1EZVX 5FDYA 3L3GA 5E2UH 1N6VA 4OZIE 2N1KA 1GOFA 4MNQE 5CMAA 2VQUA 5F7WC 4FQ1H 2R56L 5E5MA 2CR6A 3EYVB 1J18A 2JELL 1T04A 3T3ME 1ZVYA 2Z92A 2XZZA 5J06A 4OD1H 3PV6A 3BWAA 2FIKB 2ICCA 1LO0H 4JFEB 2EKSB 2J4WL 1FNGA 2Q86A 4GRWE 4J1UA 1CT8A 5E1AA 1GVIA 2YWZA 3IJSB 3GHEL 4XNMB 3H9SD 3L1OH 1HXMB 3OB0K 4HJ0C 1P7KB 4X8JA 3BP4A 2HJFA 1NMBL 4LSVH 1YEEL 3RTQA 3VG0H 2APWA 4ZODA 4M48H 3SHSA 4N1CA 2AQ3A 1LO2H 3CPLB 4MVBD 3K7UA 2ZKHH 1JV5B 3CNKA 4OZHA 2ATKA 1TCRA 3QQ9C 3REWB 4KVCH 1YY8B 1D5BB 4RX4D 1P5UA 1YEGL 1WZ1H 4DUWA 4JFDA 3QWRA 3QHZH 1BGXH 2OJEB 4M43H 4CGTA 4POZD 4X6FB 1JGVL 3RKDD 3LKPB 2HN7B 2AK1L 5EZJB 1EHXA 4TOYH 1GGCH 2ZCKL 3CZFB 2JJTA 3EYQD 3O8XB 4FMFA 5EU3B 5TE7L 2R1YB 2P8PA 4G9DA 4KPHL 1S7RA 5KVEL 4GRLD 4G6MH 5F1SA 2O26U 3CDCA 4XPAL 5E6IA 4ZS7H 5J8OA 2LABA 2VLJA 3RHWK 1ES0B 2AGJH 3TYFA 3Q1SH 1UZ6E 2XQYK 4OZFB 4P5TD 4MCZB 5D2LA 1RUMH 2XZQH 4PJEE 1XGUB 4M02A 4PP2B 3DVNA 1QBMH 1GIGL 5SV4A 4NQXA 2BVQA 1MFEL 4GXUM 3V52L 2Z31B 2XICA 1G7LA 3D25B 2X7LB 3WL9A 1KLFA 5IR1A 2P5EE 2Y06H 1LWRA 1O5DT 1JZ7A 5C07A 1ZA3A 1G1CA 1W72H 2R2BA 2YRPA 1E6OL 3KXFD 5JR1H 1BFVH 3TT1H 4D94A 4LEXH 5JHLH 2DYPA 3GMRA 1IFHL 4QNPF 4I0PB 1H3PH 4NKDB 1ACYH 4YHNB 2JJTC 4X7CC 3ARGA 2VDMH 4X80H 3FB8B 4MA7H 1FLTX 1QPPA 3BP7A 3T8XA 3QUZA 2VR4A 3VFVB 4Q2ZB 3WUZA 1H15A 5F7FA 4LKCA 2IQ9L 3WXVL 1F58L 1JPFA 4UTBL 2I60H 1DBBH 3GKZA 5I2IA 4N8VG 4QOKA 4BQ9A 3EYFB 4ZUVB 5LCVL 3ULVD 4KDWA 3ES6B 1JYWA 4YFEA 5DUPL 1ZWIA 4GRWF 3JVGC 5D71L 4A6YL 5D93B 3PL6B 4HDIB 1RURH 1TZGH 2R29H 1HI6A 4P4KA 2XT1B 5A2JH 3HC0A 4R7DB 1VACB 3HE7C 2XXMB