4M93B

Unliganded 2 crystal structure of s25-26 fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
EVQLKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-26 Fab (IgG1k) light chain
total genus 36
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93B01
3EJJX 4UIMA 4QF1B 4R4ND 4OFKA 3RZCC 1KYOJ 4MLIA 3LOWA 1FIGH 3BPNB 4E41B 1PSKH 4P2OB 2VLKB 1OVZA 4WO4D 3NIGF 1KT2B 1L4IA 4DVBA 2YPLD 3WCYA 4DGYL 1CGUA 2FBJL 5JW5A 1XGRA 1N64H 4HH9A 1SJXA 1DVFC 4G43B 5C0CB 1CFNA 1SM3L 4C56B 1CL7H 3K2UL 1NCDL 3MXVL 3AB0B 3A0OA 1YYLL 3GI9L 3HE6B 2IBZY 4JGUA 3L3GA 5CP7B 4HUUA 4GG6E 2IFFH 1KLGA 3CFBA 4UOW0 2X4RB 5EUKA 5TDPA 3WD5H 3LPFA 1O0VA 2YPLB 1J86A 4ZXBD 4GKSA 5SWQB 4EXPX 2E5EA 2QQLL 1A4JA 4HKJA 3QUZA 2VXSH 4N0RA 1TQBC 4J6RL 5FAAA 4NC1E 1ZHKB 3FOMB 2VISA 3NFPB 1A64A 4OD3H 5GS1B 1A0QH 4EXKA 1UYWL 1V5JA 4RAVA 4G9FA 3E3QC 5IK3A 1TLKA 5C0BE 1N6QL 3MZTA 3B9KA 4LCCC 1KJ2H 1U8IA 1UM6H 1IKNA 4RWYL 5HHNB 1YPZB 2H3NB 1A4KB 1KCUL 4MHHI 5EZLB 2AABL 1T4KB 1SBSH 2PKDA 1XR9A 3MNVB 2VRAA 5E9DB 1S9WA 4NHUB 4OCWL 3WHE0 1XGYL 1BJ1H 3L7EA 5HHVL 5HD8C 4C4KO 5IEKB 1TJHH 3O8XD 1FFNB 4YHOH 1RZKC 4U1HB 1S7VB 4G6AC 1WFNA 3MRQB 1AXSA 3SDCA 1JJUA 2IANA 3H42H 2WWMD 2OZ4A 4HWBH 3MV11 2NY4D 1TZHA 2H6PA 5DHVB 3WS6A 4XPBL 3WFHB 5L6YH 4ZTPL 1N8ZB 1UWEH 5HHQB 3R06B 4Y16D 3LEYH 2BVEA 3CH1A 2N4IA 4WDIA 4BQ8A 2X7LA 2Y5TA 3SDDA 3HZYA 4LARL 1S7SB 4P5KB 4OQTA 5JPNA 4F33A 4POYA 4NQVA 4M1GL 2IH3B 3AREC 3AS0A 4ZUVA 1LO5A 4I77L 1FH5H 4JDZA 4PJXF 4XNZB 3VXNB 3IXAA 3N85L 3WFBH 5ALBL 2XTJD 4RSVA 1BFTA 1QBAA 1QQDB 4OTXL 4OFIA 5D2LE 4YH6A 5IBUG 3I6LE 4PPTA 4OZ4A 2H32A 5AUMA 3UBXB 3VXUA 1UJ3C 4X9FA 1MHEA 4Z7OE 2BC4A 4O9HL 3HUJA 3ARDA 2HKHL 4JFDE 4FFYL 3QHZH 5F88B 3BWAB 4Z7NF 1C1EL 4HUMB 3ARZA 2M8XA 1AFVL 1UZ8A 3H9HA 2CGRH 1EA9C 2R0WL 4UQ3B 1CI5A 1SJEA 4EDXB 1MIMH 4KUZH 4HJJL 5IMMB 4P46B 1KPVA 4D94A 3F8UB 6FABL 3VXUD 1CXHA 1BAFL 4NDMB 5J4MA 4K3HA 3LH2H 4AM0A 4IJ3C 1KIUA 5B4MC 4LMQE 4Y1AE 2N7BA 5CHNA 5LJYH 3GUTA 1B0RB 5EZOL 5SWZA 4X7TA 3HE7A 1A6UL 3C8DA 1IEAA 3LSOB 3X11A 3B9VA 3LCYA 1ORSA 4NT6B 3O45B 1H3TA 1ZANL 4CDHA 1GYAA 4AEIH 1EBAA 3IAGC 1IFHH 3MRPA 4ONOA 1FNSH 4NPYA 4PFEA 4WIQA 4YGVB 2D7PA 3TT1L 4YHNB 1A1OB 4PJBA 4KHTL 5MP6L 1WGOA 2ED7A 3ULSA 4QHNA 2D31B 5KG9B 4OQ1A 1XIWB 5IQ9A 5DSCB 5KSAC 3MJ9L 4KMTH 4PB9L 4Q0XH 5E2VH 4PBWD 2VLJD 4MXWH 1NUNB 2HN7A 3LDBB 1YYML 3IDGA 1A02N 1IRAY 3QHFH 4PR5B 4L8BB 4AL8L 9CGTA 1GHFH 1SEBB 1JTOA 2R1WB 5IMOA 3RIFF 3W0WD 3BGFB 3H9SB 1U8OB 1CGWA 4WI4A 3MJ7A 4RFOL 1XF5B 4PRIE 1R3KB 1Z5LB 1NFDE 2HVJA 3PL6B 5BW7C 4PP1D 4Q6IA 1ZLSH 4LLUA 3SDXE 1BFOB 3DLQR 4WWKA 3E6HA 1QLEL 2GSIA 1CFSA 4P4KC 5F7FA 3EO0B 1UM4L 3JTSA 4HIHB 1QLFA 1XH3B 4CMMA 1CICA 2VDKL 3H3PH 2B0SL 1LGVA 1BWWA 2E8ZA 2PTVA 3G5XA 3W0WB 2A1WL 4K3EH 5DXWA 4MWFB 5CEYB 2Q8AL 4ZAKA 3EIFA 3BP5B 3LKPA 4PJ8D 3BWUC 1J9CT 1G7IB 3BAEH 4ZSOA 1G7HB 5JIIA 5EBMB 5JIPA 5CBAA 4MA7L 4RZCB 5GHWH 2XA3A 2EKSB 3PP3K 1X5FA 3RNQA 1J10A 3W9EA 3G6AA 2X9XA 3GMPB 4ODSH 2EEAA 1RJZA 2Y06H 3MUGA 4KI1A 4EOWH 4MA1B 3U4EB 3NGBC 1I7TA 2A2QT 3HNVH 2H1PL 5EU6A 1FZJA 3M1BB 4WUKH 4OCYL 4ZFZA 2FX9L 4MX7A 3SKOA 2GJJA 4FXLA 2Q76A 1ZHNA 15C8L 5I6XB 5IW6A 2K7PA 5I73C 4UT6L 4HWZA 3WSQL 2XY1A 5J1AB 1FNGA 4TUKL 4F37F 2XRAH 4LVEA 2H2SD 3S3SA 5FUOH 4ZXBC 1MFAH 5I30L 3O3BB 3D25A 1T21B 4PJ9D 3OKEB 4K8RD 2OYPA 5ID0B 1AC0A 2VXTL 1JGLH 2A9NL 2WUBL 2FNBA 2JTDA 3C5ZA 1V7NL 1IGJB 4X9HA 3PQYA 2HH0H 3O2VL 1XR8B 3IGAA 3TV3H 5MEPA 5JA9A 4WTXA 5M95B 1AP2B 4FQLH 2J12B 1AO7A 4U1KA 5DT1L 4AMKH 4RNRB 3P30L 4O00A 1A6WH 1Y6KR 2ZUQC 2GK0A 5EBWA 3FB6B 5D7JB 3ZDXE 3MJ9A 1U8LB 4K71B 4MYWB 2MCG1 4XXCA 4QHNB 2H2SC 1T22B 4UILH 2VKWA 1BQHA 3QIUB 3KLSA 4YDJB 1N5AA 1VEPA 2B4CL 4UOW1 3EDFA 5JQHC 2OJZL 3HC0A 3WLBA 5T5NF 1GGBL 2VABB 5GGSB 4M7ZB 3BPOB 2H2PD 3WNPA 3FO0H 3DBXB 3WNKA 1CDJA 3QP3A 4BH7A 3T2PA 3MLSH 3PL6C 4TQEH 2BCKA 3MUY1 2NCMA 2YUVA 3CDFA 4QCIA 3VI3E 2R8SL 2M26A 4P4KB 4I0PB 3VH8G 1W72A 4F2MB 3V6FA 5HY9A 5T3XH 1RHHB 3FZUC 4QF1A 1FG9C 4U1NA 2GJ6D 1BFOA 4N1CA 1JHTB 5J6GA 3TCLA 1J87A 1FE8H 1CFSB 3TYGL 1K3IA 1P7QD 1JI1A 4C57C 4JJ5A 3HPJA 4HS8L 5IG7A 4NIKB 1X5HA 4NQEE 4QYOA 2DQUL 4PJDE 4G80B 3MACH 4GRLD 3QXTA 3TBVA 1NC2D 3TVMD 4U0RC 4C56A 4UB0L 1ZT4A 3RAJH 1A22B 2EDOA 2MQ0A 1DN0B 2ERJC 5DJAA 5F96H 1MCHA 2D7TL 4M8VA 5DFWH 3MRKA 1MQ8A 1G7HA 4LKXB 3VMPA 3GJFA 5D1QC 4PS4L 1SEQH 3V0VB 4YHPB 1MFEH 5DJ2A 4M61B 5EO0B 3SEPA 3LMJH 2DYPA 1A6AA 3MYJA 2EDJA 4P3CL 4OGXH 3H7BB 4H0GA 4XCNB 4ZO9A 4LVNC 1VHPA 3OX8A 5C6TL 1KCLA 1T1ZB 2OSLB 1HH6A 4DJMA 3MR9B 1LO0H 3DX8B 3VFOB 3GMOB 4Y4FB 1ZHKA 3FOMA 1CDCA 2WM0A 3ARBA 4P4RA 2F74B 4Z78A 4F8QA 3BP6A 3V7AG 5ETUB 5EG6C 4PG9B 1NFIB 1QRNE 2Y23A 4HXAH 4Y1AA 2CDGA 3CUPA 3S9DB 5HYJD 4MXQD 5DVNA 3O4LB 3BN9C 2AEQL 2JF1A 3BH9A 5GISL 3V52H 4KVNH 3DGGB 3K3QA 3ZZ1A 4YXKL 3DVGA 3FQUB 4M6NL 5D71H 1FVEA 3JTTA 4QRUA 4X4ME 4NO3A 4H1LB 5IHUH 3JVGC 4JRXA 1AXSB 4A2MA 4K8RC 3VFWB 1VACB 1YMHA 4Y5YC 3VFRA 1AHWB 5BRZD 5HGDA 4QHUB 3O4LD 3KPOA 4TNWK 5B38A 1EXUA 4Z7VE 5C0JB 4YQXL 2MKWA 2YOCA 4FZEL 1OAKL 5C07B 2VDQH 2VQ1B 4DK3A 3O41B 1U8JA 4B7LA 1JPSL 3PGDA 5C70A 4PGJA 5I76A 2J8OA 4WUKL 1JF5A 2C4FU 2JLLA 4ONGH 2CIIB 3AREA 3X12B 3UO1H 4GXUM 1AKJA 2I07A 3LRSB 3VXOA 3ET9F 3TJEL 4KZDH 1I8KB 5HDQL 3H7LA 3MODH 3TPUB 1AR2A 2DKUA 1FFOA 3MRGA 3MRRB 3MJ8A 3RGVD 4MNGE 3G9VA 5I1HL 3MRJA 4LSVL 1NSNH 5E4IA 3GJFH 4MNQE 4OCSH 2X4QA 5LKNA 1FJ1B 1GC1L 3IKKA 5T3ZE 1JUFB 1BIIB 1OAUL 3BQUA 2BOBB 1MFBH 5KS9B 5AEAA 2CRIA 4UQ3A 2ZOLA 2HT3C 5F6IC 5DQDH 1JNHB 2DQUH 4Y4KC 5F1NA 3MV7E 5ISZE 5HYQA 1XT5A 2NYYD 3IJHA 4TN9A 5GGQH 3IU3B 5L7XL 4KRPC 2NY3C 3VG0H 4YDVA 1JMZA 3WFEH 1TCMA 3LZFH 4N0CD 5GZOC 1T0NB 4E9LA 3W2DL 5T33L 2XWJB 1WC7A 1I8LA 4WU5A 1X6NA 5CJQL 2VXVH 4E0RA 2R8SH 4XH2B 1G9NC 1JYNA 3EBAA 4P2QD 5C0CD 5KS9F 2J8UB 3JV5A 4LFHD 2ADFL 5FYJH 1NGYA 5I0DA 1UJ3B 4ZO7A 4OGAC 3VH8B 1OQOA 1CS6A 2VLJE 4L4TE 1NDGA 4JPVH 4NQDD 1BM3H 1G7LA 4MAYB 4JFQA 1IM3A 3BQUC 1CG9A 5EU5B 4JR9H 2R1YA 4TVSa 1FZKA 3WFCH 4WV1B 1M7IB 1JL8A 4M6ML 2QTEA 3MJ9H 2HG5A 3AY4C 1A7BA 1IGIL 2EECA 4YO0A 4M4RA 5EWIL 3K74B 1FYTA 4R3SB 3RHWF 5MP6H 1A6WL 5D1XD 5FDWB 4H8WC 3KDMA 3NA9L 3D1MC 5KBNC 5IMOB 3ZT6A 4DVBB 5IHUL 5GRWA 3F62A 3FQWB 5I2IA 5JW5B 2V7NA 4M6NH 5D71L 5BS0A 3MV9D 1ZE3C 1CQKA 3JUYA 3RL2B 3MV7B 1EZVY 5FYLH 1MVUB 4JFZH 3CX2A 4Y5YB 3RZCA 2IC2A 5EZOH 1Q94B 3U2SA 1FYTD 3UX9B 1EK3A 4PRHE 2MTPA 3EO1B 4WI5A 4X8JA 3LH2L 4RMUA 4XP5H 4FFVD 3EYOA 3M8OH 3EZ8A 1FL6A 3RZCD 4XP4L 5DVOA 2EEDA 4G8FB 3RVVC 5IUSA 3H0TA 2WIIA 3B8SA 3CMOL 1JGUL 4JN2A 1FL3A 3QBTB 2JJWA 5IVZA 2WBJC 4O51B 3V8CA 1MRFH 1NAMH 3K1DA 2YPVH 3NAAL 3HRZB 1NMAH 1U6AL 1UEYA 1PLGL 1VGEH 4PJDF 3SDAA 3TBSA 1HYSC 2VAJA 2CIIA 3HS0B 4OKVA 3C8KA 4LVHB 2HLFD 5EOCH 4HT1L 3TT3H 3VCLB 3U82B 5BXFB 1C16B 2DWDA 1J18A 3MRMA 1MELA 5ITFB 2V17H 2L4OA 5I8KL 3SHSA 1JPFB 3P73B 3QNYB 3QWOB 2E27H 5I17B 5D1ZD 3N85H 1UWGH 2X4QB 4KQ3L 4MA7H 5DD5L 3HC4H 1YDPB 4Y4KB 3VG0L 5TE7H 5L7XH 3AUVA 2IQ9L 3AAZA 2Q8AH 3QFJA 3LEYL 3WDHA 4WCYL 4QRPD 2X70B 3BH8A 2V7HB 3KPNA 3GSUB 4HG4K 1NGPL 5IHZB 3GSXA 1A7NH 4GRWB 5TDNB 4JO4H 1DCLA 2FCBA 1UM4H 5LBSH 1K8DB 2VXQH 3NA4A 4UT9L 5ID0A 4PTTB 5L2KE 3O6MH 5E5RB 3GSRB 4O2EA 3FO2A 1MIEL 4KKCD 4LDEB 5C0BA 4APQB 3UJJL 4X98B 2W60A 1OTSC 4G9FD 1XR8A 1YEEH 1JWSA 2EYTA 3KLAB 5MEPB 5HHVH 3VXSE 3E6FB 5IKCB 3FQTB 3VXPA 3MGTB 3NGBB 5C92A 1AE6H 4PGBA 3K81A 1EZVX 3WUZA 3BE1L 4HAFA 1ZLWK 1H3WM 3C09B 2EXWC 2H32B 5AUMB 4NFBA 4MQSB 4MNGB 5F89B 1JPSH 4NQTA 4YC2B 1ZLUH 3N1MC 4Q58C 2J88L 3ARDB 3QUKB 2WWKT 5F72S 1RJYB 5DURD 4KMTL 4C55A 3D48R 4HDIB 1IMHC 3LKNA 1EEQA 4Q74A 3QUXB 4XPTL 1SYSA 1SJEB 4EDXA 1WT5A 2QSQA 4NKMB 5E6IA 1KCVL 3ZE0F 1QLRA 1YEGL 3ELAT 3DMMD 4F57L 1OTTD 3SDYH 5BV7C 2OR8A 3G5YB 4QO1A 3BXNB 5E00B 1NLBH 2I9LA 2VDNL 1V7NH 5JQ6H 4DFHA 1RK1B 3QDME 4JFFA 4HZLB 3VXRA 5F7KC 3L5IA 2XOTA 2AGJH 4XNUH 2YPLE 1J5OL 4U1SB 2PW2B 4WEBL 2A6DB 5I30H 3KPRB 3VD7A 3DOSA 1GGIL 3Q3GA 4KRNA 4U1NB 4JM2B 2NX5E 4JN1H 3D85A 3PV6B 2W0PA 4MQ7A 2FBJH 3NCMA 2WK2A 2J6EH 5ANMA 3RWCA 5DA4A 2QQNL 1HDMA 5DHYA 4RQQB 4MQTB 3L6FA 3I6KB 3LQZB 4Q6YA 1J05B 3RBSA 1HHGB 1OSZA 3HA0A 1NGXA 4JRXD 1SY6A 3GMNB 1EO5A 1FL3B 3HNSH 3IRZA 4LSTH 1V3LA 1JNNL 1ZLUK 3QUYA 3NZ8A 3T77B 5E2WL 2J3SA 4U3XA 2H32H 3KPMA 3PWVA 5T3ZD 4OGXL 5BVJA 4M61A 4LGSB 1MOEA 4PJHE 5E6IC 4BSVA 3RWHA 3A6BL 1BVZA 3N50A 3P3YA 4M9OA 4OF6A 2D7TH 2EYRA 4GRLA 5CS7A 3SDXF 4BZ1H 3S37X 4UB0H 4NQCD 3MROA 1BQLH 1BFVL 1T7XA 4OQTH 4HLZH 3TM6A 4JM2C 4FA8A 1DUZB 4JKKA 1VGKA 2WIMA 4Y4FD 4NNYA 4LF3B 3NABL 3DYOA 4OZGA 5M7QA 1WZMA 5E08L 4WHYH 4NQCE 3EYVA 4K55A 1NBQA 3DUSA 3DX7A 3RVUC 3ZE1E 5D96B 1CBVL 1CCZA 3PP4L 3SE8H 4CN4A 1BZQK 2NY6D 1MFDL 4MSWA 2PO6C 4G7YL 3QUYC 5JOEA 5TF1L 1WAAF 3VW3H 4HPYL 4IDJL 2K3TA 2VDRH 3GBLA 1GAFH 1BOGB 2BNRD 3QG6B 5FYKU 1WF5A 4NQXA 4NQUA 4IOFD 2F53D 2FHCA 4JFOB 4RMQA 3FN3A 4OZGE 4POZC 3VFWA 2HYMA 2ZSWB 1TENA 2GJ6A 1RUAL 4JZOA 3V4PH 1YY8B 1UB6A 3PNWB 3LN9A 1G9MC 1E4KA 2OMBA 1P7QA 2MQ3A 1IC4H 4RAVB 2EDEA 4PRIA 4HWNA 1TMCB 4PJGF 1Z2KA 5IFJA 5ADOL 3ROOB 5IESL 2WBJB 4HLJA 1A0QL 2W9DL 1RZFH 1AGFA 1ZHNB 1GL4B 1IFHL 4X0KB 2I07B 3LRSA 1R3JB 2YUXA 3BKJL 3WL9B 3CD4A 1NJ9B 2YEZA 4HBCH 2R29H 3T3MF 2VH5L 3MJ8B 1JF1A 4FXGB 4FFWD 4ORGB 5H94A 4XMLH 3O9WD 1FVCA 3U7WH 4ZG1A 5D70H 3ALWA 4WI9A 1TQCC 3ARUA 2UWEE 3DTXB 4V2CB 2EE3A 5KSAB 2IQAB 2X4SB 3NCFB 3BZEA 2Y6SD 4OFDA 1FYTE 1SM3H 2NTFB 3BP4A 1MI5E 3UTOA 5A1AA 3BFOA 3QQ4B 4UT6H 2OTWA 2AXFB 2XIDA 2OTPA 1PQZA 1B88A 3ES6B 3UJIL 3WJLA 1N0LA 5MEQA 2DQTL 3CH1B 2NW2A 1PSKL 1FNHA 4X8XA 1IC5H 4QTIH 1SY6L 2JJUA 5BO1H 3RVXD 3BHBB 3H9ZA 4RAUB 2NX5B 4GKNB 4MNQB 4XRCA 3RNKA 3DETD 3BESR 1L0YA 3MLZL 3CVHL 2EDLA 4Z7VF 1X5KA 5E4EC 4ZUTB 4Z7UE 3SKMB 4XMKH 4LSRL 3KPPB 4DZ8B 1ZEAH 3C60B 3MLUH 3O2DA 5ALBH 2NY7L 5ESAB 2XYCA 4I3GA 1NGZB 1JZ8A 4IRJB 3QEUB 3QJFB 1RUQH 2Q7YB 3D9AH 5HJ3A 1G6RA 2YD3A 3PDOB 2FD6L 3DPBA 2DQCL 4QCIB 3Q0HA 4P2RD 3EJZD 2DQGH 3P0YL 2RFXA 2A1WH 2BVOA 1G1YA 5I8OH 4Z0XA 2LVEA 3ORJA 2XY2A 4PJEA 2DLFH 2VO5A 2BOCB 3QQ9D 1HXMB 3ULUD 4BA8A 1F3RB 2MCPH 4N0YH 4CADA 4XC1L 4GLRH 1J1OH 5TQ2H 3FN9A 1T03H 1Q0YL 5C6WH 1I8IA 3RWIB 2VLKA 2FR4B 1XF1A 3IS0X 4CVXB 5E8OA 1IGCL 2KKQA 1UACL 4P2RB 5SWZB 4GH7B 1B2WL 1PZ5A 1UVQA 1RFDL 4XPHH 5LQBH 3RKPA 5D9SB 1A7OL 1QRKA 3GJFB 3VXME 2AJ3A 4JHBA 3WIIH 3V5HB 3O45A 1CFBA 5JW4M 1EVTC 5TFSL 3S36H 1QUNA 2VR9A 1S9VB 3HE6A 4KMQA 1GHFL 2NXYD 4YIQA 3FB5B 2IF7A 1OM3H 4YK4B 3RJDA 3BMWA 1DBAL 3OX8B 1UT9A 3P4OA 3DX6B 2IALB 4PB9H 4Q0XL 7CGTA 2C7UB 3QRFM 4MVBD 3VGHA 3JVGA 1MAML 4KJQC 1VFOA 4DUWA 4PJAE 4ZQKB 1EGJH 5C0CE 4YAQB 3ZKQD 4MDIA 3HE6C 4JPWH 1DE4A 4PV8B 1U3HA 4O2FA 1QFWL 3VGAC 3ROOA 2VC2H 1ZTXH 3CX5J 1CU4H 3LKQA 5GGTL 3RVWD 5DTFB 3HS0A 4OKVB 5CJXA 1A2YA 4K3DH 2E9WA 3CCHB 1K4DA 3BKCL 3HE7D 4P5KA 5KTEL 1AD9B 4HCRL 2ADGA 1ZTXL 5GRJL 1JRHI 2IFFL 3P4MB 2DTML 1YC7A 2UUDH 3QFJE 4KRPD 1MAMH 5F6IB 4KTYA 5HI5C 1KULA 2XQYK 1QQDA 3TZVB 1YDPA 4DGYH 3UTTE 3ZSSA 4C58B 5D5ME 4NN7B 3LN4B 1U2CA 5HVWA 4KROC 3BP4B 5CKGA 2OMNA 5E99H 1MIML 1F6FB 3KPNB 3OR6B 3KPOB 1R0AL 5DRWB 2CGRL 4OIIH 4MWFA 3O6LH 4NZRH 1BLNB 2CD0A 2B1HL 5D1XA 2I9TA 4I2XA 2VE6B 1AD0A 1BJ1J 3LEXB 4U6YB 1UACH 2BP3A 3T4YB 3O6FB 1UQSA 1QSEB 3FFCB 4Z8FL 5HXMA 3CIQA 4LLYA 1MFCH 3WXVH 5EC2A 4OTXH 2KZWA 3SGEI 1NL0H 3SE9L 4G8EA 4JFEA 1NGQH 3DYPA 5C08A 3NN8B 3C60A 1ND0B 1CDGA 3BGMB 3DV4A 1AO7D 1E28B 3CFCL 1XIWD 2MNUA 4M1GH 3IFNH 5IB2B 5HJ3B 1JV5A 1F4AA 3HMWL 1CLYL 3MMEA 1JIBA 2J2ZA 4AT6A 4LMQI 5T1LD 1T0PB 1CGSH 1UWEL 3VXUB 1ADQL 3D9AL 3ILQC 2XN9B 5KS9A 1UH3A 1BJMA 2BNRE 3ULVD 1Y6MR 2NNAA 4UU9B 4HWBL 4QOKB 3JWOC 3JV4B 1IC7H 3EOTL 1RZIB 4RBPK 3SDXA 2CDFA 4LQFH 3PL6D 5IROC 2DDQH 1H3PH 1HKLL 1F11B 4KUCD 4R0LB 3U9UB 4M5YL 4WU5B 2DWEB 1VCAA 4LHUB 3ZKNC 2IGFH 2R23A 4WNQB 1S7RA 5CMAB 3NCJH 3U9PH 2VJXA 2OK0L 3MRBB 4MCYB 4N5ED 4K7PX 5DWUH 3FT4A 2R2HA 2VYRE 3ULUE 1S9VA 5DDHB 3QQ9C 4LP4A 2AK1H 2BHZA 2EXYC 2FSEB 1CFQA 1IAKB 4JLRA 4CUCA 1RIHL 2HT3D 4Z7QE 4NCC2 2YD5A 4TSBH 1U41A 4GRLC 4PTUB 5E9DE 1QLFB 4NYLA 4JAMB 4XCEB 1OCWL 4MHHG 1LEKA 3QIUA 1MWAA 5I8EB 3QDGE 4ZQKA 5GGTA 4EI6B 2R29L 2F19L 4LLDB 1VESA 4N0CC 1IAIM 1VA9A 2MPAH 4Z7WB 1U3HB 2AKRA 4O2FB 3CK0L 1KTDA 3DIFA 5KG9A 1FLRH 2BMKB 1U8MB 3OHXA 3UPCA 4HCRA 5BVJB 2VABA 3JWDH 1IAOB 3LKPB 3MA9H 2NYYC 4P5TA 5DTFA 1FN4B 2FX8L 3MRIA 3IDGB 3OTTA 4X4MA 2BZDA 5FGBC 4Q97A 4UI2A 1Q9OB 2CLRB 4BM7A 1GIGL 2R1WA 4MXVF 3CX5K 2V9QA 1ZSDA 2P7TB 1G7MA 2HTKC 1RHHA 2YD1A 4JG0H 5DWUL 4OM1L 4LK4A 2D9CA 1YNKL 4Z0BL 3H9SA 3MLXL 1U3HD 4F37K 1A3RH 2I60H 1JHTA 1ZVSB 1IGTA 2XZCL 1M6OA 1KTRL 1NCAL 3RWGA 2UYLA 4JHZA 4F8TA 4L3ED 3RL1A 5KVGH 3FT2A 4AEHL 4D8PB 2GHWB 3GMMA 3I3BA 5A2KH 2XACC 3MV01 3LB6C 4BJLA 1KCSL 2BRRH 3DSNA 4NUGL 2WIIB 4HZAA 1GAFL 5BRZE 3TO4D 5IW6B 1YMMD 3C5ZC 2Z8SA 3DVFA 4U2YA 1AGDB 5DZLA 3W11C 1JGDB 4WFHE 2FWOA 5I15H 3BP5A 1KPUB 3FFCA 3HAEH 3OKEA 3C8KB 4ZTOL 1KFAH 2VR4A 2VZ1A 1I7UA 3QIUC 4EKXA 4YDLC 3LEVH 4E5XB 4X6BB 3B6SA 5DUPH 3ARRA 4CMHB 2ARJB 5E24E 5BQ7A 1VADA 1ADQA 1HSAA 5D7SH 2FGWH 4W6XB 1CGXA 2JJSC 1I7TB 4UBDD 1YNTB 1I7RB 4G9DB 3DGCR 2V5TA 5JUEH 3BH8B 1R3HB 1IGFL 4AQOA 2Q3ZA 1INDL 2C1PA 1H5BA 1X5LA 4I3SH 1MREL 1EV2E 3TN0B 2GAZB 5EC1A 5K93A 1EJOL 5CFHA 2B1HH 3QXDB 4Y2DC 4L5FL 1I1AD 5JXEA 4RMVA 1H5BC 3GSNH 5KSAA 2W60B 3QQ3A 1HYSD 3CJJA 1PY4A 2APWA 1F90L 1QFUL 3DI2B 4W4OA 3INUH 1LO3L 3RY5A 4RGMB 5IB4B 3G08A 2F9BT 3VXPB 1C7TA 2P8LB 4KHXL 1EXUB 1KJ3L 1UB5B 5IQ7L 1C8PA 1S5HB 4GT7A 4PJXE 4L3CB 1M7DA 3V6FB 3PUCA 4MJ4A 4NRZB 2OS7A 5A16B 5DQ9A 1T7WA 3JV0A 4WWKC 1WBXB 2VAAB 2AGJL 4K7PL 4K3JL 2I27N 1MWAL 5KTEH 2FB4L 1SVCP 4OFVA 4WU7A 5IMKB 4KQ4H 5C0RH 5GGVH 2A73A 3Q6FB 4YXLH 3SDYL 3TNMB 2Q6WB 4W68A 1T2QH 3I3EA 5F7YC 3TBVB 2BMKA 4XPTH 3C5SA 4U1GB 3G5VA 1HILB 3VJ6B 3UJTL 4UV7H 3MRNA 1DQDH 2WBWB 3ZT7A 1MPAH 2B1AH 4TRPL 2VDMH 3V0VA 5C0AD 5DRNB 3BUYA 5D1XC 3NZHL 5DEFA 2Z31A 3BZFA 4M62H 4YNYA 5E8NB 3ARDC 4FABL 3D85D 1YJDC 5HI5D 2IFGA 4RISH 5E8PB 5KZCB 4PRID 4PLJC 2YR3A 5GXBB 3O3EB 3TESA 3IFOB 5B39G 2Y9RT 4R4BB 4U6HA 5C0RL 5IEHB 5DLML 2YMXL 2F74A 4Z78B 1KENL 3B5HA 2DB8A 4OUOA 2E9IA 3V7AE 5J6GB 3M17B 3HTLX 1OARL 1MIEH 4OB5L 4JQXA 4UT9H 2XKSA 1NGXB 3BIAX 1B9ZA 2F53A 2HJKA 3MREA 2WMPA 4EI5D 4MJIE 3RTQA 4XP9L 3BT2H 4JO4L 2DLFL 2Z35B 4HUWA 1CXEA 3SKUD 1JGDA 1W0YT 2ZUWA 5ANME 4XXDB 1U93A 1LO3H 1R5IB 5KJRH 1RJCA 3W9DA 1H9VA 2N1KA 1U91B 4PJGB 5IVOA 3VH8A 3MRKB 2Q87A 4F9PA 1HYRC 4M1CD 4JFDA 4XVSH 1MCRA 2ADJB 4X7DC 4J4PA 4IMLB 4ZNEE 3P4OB 4U6TA 2P8PB 2FDBP 1QBMH 5BZWB 5GRUL 1U8HA 5INDB 3WKML 4G43A 2OJEB 3HHRB 5SWSE 4ZUUA 2BY0A 2E27L 1EHLL 5IR1B 4XZUB 3CH8A 5BOPA 2BSED 4GAYB 5F7MC 3GMOA 4WHDA 4Y4FA 4BQBA 3HLAB 4Y89A 4RMTA 3MLZH 4JQVC 5DD1H 4ERSH 3KDMB 2BY1A 4DW2H 1U8JB 5DHVH 3I85A 3LKRA 4DKEH 5JHDB 1E4WH 2X9YA 4PRPE 1EO8L 4HUVA 2YUWA 1DL7H 1IC5L 4OZIF 3GHBL 2E8YA 4ZD3L 4KDWA 5D1ZC 3LEVL 2I5YL 3HG1B 1XGPB 1JGUH 1J0IA 3ZTJH 1AGBB 4EQ2A 3GGWA 4GW5B 2Y1VA 2NY3B 1SJHB 2FX7H 2Q3AA 2CLZB 2QKIA 1S9YB 4ZFOB 1OWWA 2EE2A 3MRJB 4W70A 3L7EB 1B0GA 2BRQA 1T4KA 1D9KD 4FTVA 2D03L 4XMLL 4KDTC 2GJZB 1JUFA 3PNWA 4JN2B 1BREA 3LQAC 4NRZA 5A16A 3D3VD 1TZIA 1HI6B 4HKBB 4NUGH 2YWYA 32C2A 4M7KL 3E1F1 2AERT 1UENA 3D6GA 1TTFA 4HEPG 1AO7E 1KXVC 1KCRH 4TULH 3PXJA 5IESH 3RIAF 2DMCA 1JHLL 1FZMB 4LSUH 1MCFA 4IOIB 1I8LC 1UC6A 4Z0BH 1A4KA 5EZLA 1OHQA 4ZUVB 4JGMA 3WYRA 3VRLE 3D3VB 3G5VB 1J7VR 1IL1B 2OTUA 1I8KA 3CZFA 1B4JL 3GNMH 3DI3B 2ADIA 2VN4A 5HDBF 3WFCL 4C56D 8FABA 4NQEB 4Y4KA 1V7MH 1UJ3A 1XEDA 3BUYB 4XC3L 2IMNA 2OBGA 2X1PA 4RBPH 5D5MF 1BQUA 3VA2C 3QFJB 1FLRL 4GW4B 3WDIA 4IOSD 4M7KH 4N0UE 4L4TD 4UU9A 1XF4B 5IHZA 3DROB 4TUJA 1E0OB 4IDJH 1PBYA 1DZBA 4HPYH 2VXUL 5F1OB 5TF1H 4G7YH 4X6DE 3CXDH 4P23B 1Z3GL 1DFBL 1CBVH 2GTWA 3STZB 4N68A 1HHJB 2AXGB 2YRPA 2A83B 3ILPB 5CJXC 2ICWJ 4Q9QH 1ZGLA 4UDUB 2ICWB 3KHQA 4IHOB 4NNXB 2F5AL 4KFZC 5EO9A 1T5WB 2D3VA 2R56H 2FECI 2JIXA 4PY7A 2D9QB 4MJ5A 3G04A 5GS2D 3DRTA 4NDMA 3ECBA 2HFFB 4Y0GA 5DMGD 3U2SB 4EQ3A 3AY4A 1UA6H 1P4BL 4MJIB 3VGAB 2EDXA 3D18A 2EDNA 3BN9D 4Z95L 2WZPD 5T3XE 3MBXL 2XWTA 3L3IA 5TQ0H 3ETBF 2R0KH 3S35X 3GRWH 5EZJB 3MODL 1S7TA 2PF6A 1T1YB 1XGQA 3IAQA 1CGVA 4H0HB 5KAQF 4CJ1A 4NOFA 1J11A 5DI8B 3MRIB 5GGRA 1E6OH 5D1ZB 4JJHA 2AJSL 1HIMH 4XAWL 4OIAA 1T04A 4NSKB 4QHLA 2QQNH 4YPGB 4ALAL 4PJEE 4CU8A 3OWEA 4XP9H 2CK0L 4Q7DA 3VRIA 1NL0L 3P73A 1WQVT 1MVUA 4WUUE 2FIKA 1XF5A 4JPKL 4MJ6B 2R0ZL 2P8MA 4LQ1A 5E5UB 1TJIH 1CDBA 4KI5F 1OARH 2ZUXA 3FT2B 4FTVB 4PJGE 5IT2H 4P59L 1KENH 1RUKL 4TPRH 2YMXH 4C59B 3MLPA 1J1PH 1FNEB 1QNZH 1J12A 1A1OA 5FO7B 1VPOL 2QHRH 3KYNA 5GRYA 1TQCB 2EYSA 3JV6B 1H8NA 3VFPB 3NZ8B 3T77A 3ZKSD 4ZPVA 1B3JA 5MENE 3PG2A 5E99L 1C12A 1KEML 4Z7UF 5JXEC 3E6HB 1FLTX 1MRCH 5D1QA 3NZHH 1KGCD 4OF7A 4ZS6D 4KWUA 1H15B 3S4SA 5AWNH 2V2WA 1SHMA 2X4OB 2FJGB 1A6VH 3GK8L 5DGQA 3EJZC 5IGXH 3IDNB 3HPLB 3VCLA 4PRPB 3CDYA 3IFLH 4HIXL 5CCKH 3UTSD 4N0UB 5B22A 4X6CE 4TUOA 5E2TL 3TFKD 4ZUWB 4KTEL 3OGOE 4PJ7B 5D7IE 5GGVL 3EGSA 3SGDH 3G6JA 3A67L 1H3UA 4DKFL 5EIVA 1CU4L 4P3CH 4LLUB 5KVEL 3WIFB 4DQOL 4KU1A 1S5IH 3V0WH 1SEQL 3V0AC 3WHE1 4GRWH 3O4OB 1WAAA 4MX7B 5HVHC 4R7DB 3QO0B 3G5XB 5F44A 3GSUA 3T3ME 4X5WB 1A7NL 5FYJU 1KN4L 1Q9WA 3QXAB 5HHXL 5IB3A 1Q72H 2FBOJ 5I1CH 4O58L 5TE4H 1IVLA 3R4DA 5I0ZA 4NN6C 4PJHF 1NFDB 2IAND 3CLFL 3C2AH 2V2XA 2HP4A 3ZDYF 5ADPL 1X7QB 1BJ8A 5CBAB 2GY7B 3I2CL 3KYOB 3G08B 4XBEL 5E0QA 3T2QA 4LEOA 1R5VA 3N06B 3WV0A 5KSUB 5ICYB 4Y5XC 2DQHH 4L4VD 2PO6D 4M1DH 4KAQL 4M93B 4MJ5B 5JIKA 2O61B 3RGHA 5DD6B 3ECBB 3MRLB 5CINL 4YHMH 3P9MB 5C0IA 1T03L 4J3TA 5TH2A 4JFPA 4TQEL 4JCLA 5BCAA 5DQJA 1FNLA 2C4FT 2FGWL 3L7FA 4F58H 4QRRA 4J8RB 3UCRA 3VD4A 5CD3A 1U6AH 5CIPB 2P44B 1NAML 1YEIH 3CMGA 2CKBA 4NBYB 4NCC1 5CIPH 2Z31C 1DUYA 2DQGL 5C3LD 2NY2C 4OSUH 1Q8MA 3QDAA 5DI8A 5TJWK 2JCCF 2ZP0T 3GHEH 5HI3C 5F7UA 5T1MA 2Y72A 3FJTA 4ZXBA 4G6JL 4U3HA 3DWTA 5EBLA 3RTQD 2GT9B 2KQMA 1SQ2N 5E00A 3QDGD 4LRNH 4S1RH 1IZJA 5AD0B 4WNQA 3ZE0E 1IQDB 4AMKL 5E8PA 5E2JA 3VGGA 3C08L 3PF2A 2XWBB 3KPQA 4G3YL 3IVKB 5CZVH 4MA1C 4HC1H 3DVNB 4KK6D 4TNVF 2P42B 3PHSA 4DCQB 4QNPF 1MCLA 3X3GL 4QTIL 1FGNH 2HWZH 4M43L 3SQBA 1A7RL 2GKIA 3U36A 5KW9H 5I75C 1CR9H 3NA9H 2F53B 2HJKB 3BD5A 3FQXB 3SO3C 1F4XL 2ITCA 3AC0A 3IJSA 3PWPB 2I24N 4A6YA 4OLXH 12E8H 4M6MH 1RZKH 1Q0XL 4QRPA 2B2XL 2YN3A 15C8H 1MH5B 5GS3A 4HK0B 1WFTA 2EDTA 4DTGL 5LWYL 5D7IB 3BVNB 4R96B 3DV6B 4HG4J 1JVKA 3KXFB 1OP3K 2CLRA 3DBXA 4HWUA 4QT5B 1ZLVK 3JWDL 3MTRA 5FO8B 1G7JA 2PYEA 4QKXB 5FO9A 3V95A 2F19H 4EOWL 4P4KA 1CF8H 4L3EE 1J8HA 2UVEA 1G7PB 2IH1B 3G6JB 3GSOB 4N9GA 1N5YL 5CJQH 4X9IA 4W81A 4LSQH 2G2RB 1A6AB 3HE7C 1VB9A 5F9JA 3WIFA 4HIEB 1HHIA 4HIJA 5JHDA 4O2CA 5SWSA 4PLKC 1HZHH 3DNKA 5FYLE 4X6CB 2ATKA 4LLVB 5CEZD 4NC0B 3S35L 5D7JD 4Y1AB 3QCTL 5DZOA 1UKSA 5D5MA 3S34L 1Q9WB 2NLJA 5JZ7C 1G0DA 1INEL 4POUB 2AVGA 1KPUA 1KGCE 4XNQB 1D6VL 1KIPA 2BSTB 4OBSA 1UKQA 1VFAB 1EMTH 1IAMA 3FB8A 2O26U 1GC1H 1V3KA 3FO9A 3JBG7 4OCXH 3H2WA 1K6QH 3OL2A 3JTTB 5BVPL 5DJ2B 5K59F 5EO0A 1I7ZB 2VDPL 4YWGL 5HHME 1ZLSL 2YWZA 3OKOB 4E5XA 4XTRC 3QI9A 1D5MB 3MV8B 4NUJB 5T3XD 3MRLA 1MFNA 5TGBB 3TO2A 4XCCL 1ETZB 5DO2C 2ZCLH 4UMGA 4IIQC 5DQJB 4I3RH 3NCYS 3HMWH 5HGHA 3VFUA 4ONGL 2FYYB 4U4BA 3FTGA 3OKKB 4NO0D 1NFIA 5SWQA 3V6OA 2CKBB 5JW4R 4PUBL 1NDMA 4YR6B 2V2TB 5C0JA 3MXWL 5EC1B 2MHAA 3D3VA 3HFMH 4LEXL 4XNMA 4ZUTA 1PAMA 1CN4A 1VEOA 4ZXBB 4J4PD 3STLA 5I1KH 3GMLA 1E4XL 4FFVC 2VUOA 4JFYB 2RB8A 1KIQA 4HS3B 2HJFB 4OT1H 5DJ8A 3REVA 1FVCB 2FEDD 1FVEB 4S0SD 1JZ6A 1AKJB 1Z0MA 4NO3B 3I3DA 3TH3T 3HZVA 1ZKAA 1QOKA 1DBBH 3IKCA 2FO4B 4YXKH 5I1EL 1GGUA 2BOBA 3GKWL 4O5LH 1R0AH 2OTWB 4HLZG 2VZVA 1PQZB 1X5XA 2AEQH 2ATPB 2VWEE 5IB5A 2DBLL 3MLVH 5I8CB 2NW2B 4HXAL 4QRSB 1F3JA 1KTLA 5D8JL 4A6YL 2EXYD 3QFDB 1FNFA 1J8KA 3WIHA 4LCIL 1RULH 1RZJL 2FJFB 3PWPA 5FYKL 1QSZA 2AJZA 3QPQC 4L8DB 4PP2B 2V6HA 1WSST 3DV4B 5CSZB 1CWVA 3VXSA 4LL9A 3QCVL 3QR2A 1JYVA 1E4XI 3SKMA 4U1IA 5ESAA 1KLGB 4OF8A 5C07E 1KJVB 2VZSA 5DYOA 1GZPB 3VE0A 2Q7YA 2Z0BA 5I66B 1VFUA 4KKAD 3AU1B 3R0NA 3RUGE 3TC9A 1FJ1A 4JDZB 3KJ4C 2YA1A 3GZKA 5EU5A 4YGAB 5B3JF 1G7QB 2HMIC 2ED9A 1A4JB 1ZGLP 4L1HA 5CGTA 1CIDA 1U42A 2J8UA 1NPUA 1M7IA 3NIDF 1TVHA 4GKZB 5SWZD 2RFXB 3WFBL 4UINL 2JJVA 4UIKL 1HE7A 5J3HD 3D0VB 5GS0H 4X5XA 1G7LB 4MAYA 4CVZA 4P5MB 4NHCH 1NLDL 2D0HA 2LE9A 4ZUSB 3B2VH 4QHLB 3S36L 1N6VA 4Q2ZA 3QDJA 2ZNXA 1PKQA 4YPGA 2A6IB 1HINL 5ELIA 3HI6H 4CN6A 5IJKA 1IKNC 1CVRA 3EDEA 4R8WL 1LWRA 5IBTL 1OOAA 5D6DC 3VRIB 2KQNA 2L7UA 2J4WH 4LP5A 3DSFL 4R7NB 5D9SA 4CL7A 3K4ZA 4JRYA 4K94H 1T83C 4LHJB 4PLJD 5SWSD 3ROLA 5DVLA 2UUDK 4G6KH 4LKCA 5INDA 4GAFB 1JZ5A 4A2LA 1D9KB 4GG8A 4JHAH 2W65A 3SJVA 2NR6C 1ED3A 2VIRA 4P2RE 2GIYA 5F93C 1INEH 4ZPVB 4Y5YA 1HINH 1C12B 3NFSL 3L3KB 3B2VL 4I2XB 2UY7A 4LLQB 1SBSL 4JM2F 3CFDB 2RR3A 3ARGD 4NQDE 4O51A 3RFZC 5DZNA 2LQRA 1S7SA 3OB0H 3DXAD 1KJ2L 1UM6L 5LAXA 1QSEA 5DC0A 3HPLA 4OLVL 3RX5A 2BSSA 3P30H 2D31A 5TE6L 5CKAA 3O6KH 3AMLA 4KZEL 4HMCA 1HEZB 3VXTB 5ACZB 3TBWB 4Z76B 1ZV5A 5CGYC 5FHBH 3IT8D 1CF8L 3STLB 2UV3A 1J0KA 4J3WA 4PJEF 4HK3J 1CE1L 2HJFA 4FXKA 1B0WA 3E2HC 1HK6A 2AEPH 5BO1L 2WUBH 1EHXA 2A9NH 2FL5B 4N1HB 4QHKI 1JGLL 2DQTH 4Z7UB 3LS5H 4NKDB 4BH8B 1XFPA 1MJ7H 4U05A 5DRZA 1KCKA 2EO1A 2IBGA 1RZKL 5JDSB 4X5WA 4AG4L 5F6HI 3OJMB 4D3CL 2PN5A 4Q6IB 3WSQH 1HCFX 3JV4A 2IG2L 4M1CC 1WBZB 1AD0B 4Y19B 4HUXB 5EU3A 4S11A 3GI8H 5CP3A 4OCRH 4HPOH 5D93C 5IBLC 5C71A 5D70L 3GSRA 4IOIA 1R5VB 3QXUA 5F21B 4JFZL 2AJZB 3V6ZB 2IPKB 3IXTA 1F00I 2DWDB 4HC1L 5IKCA 4JQVA 5DEGB 4NM4H 5ID1A 1K8DA 4ZSOE 4U1IB 1PEZA 3BGMA 4QOKD 2Q86B 1YECL 1YEKH 2GQHA 2EZ0D 4Y19D 3BIKA 5C0BB 4HGKC 4IOFC 2ZCKH 1KEGH 5ACLA 4MNGA 2FRGP 2DTSA 3X3FL 3OBAA 3PJSB 3REWA 4PJIF 3QNZA 3GIVB 2A9ML 1EX0A 2CIKA 3QXDA 3L9RA 3NFSH 5FKPA 1A3QA 4X5XB 3A6OA 4CVZB 1IE5A 1KTDB 3DIFB 3AM8A 1A7QL 4I3RL 4FS0A 1Q38A 3BJLA 1DEEB 2PXYC 2ZSVA 2E7LA 1CTNA 3QPXL 1DVFA 3RTQC 5EIQA 1JWUA 3L1OH 1IQDA 4APQA 4WUUA 5J11C 4Z6AT 2X6MA 1INQA 4S2SA 4OBRA 3P2TA 5C1MB 4MA3B 2EICA 1X6LA 1DQTA 3WJJC 4R8WH 2NY1D 3KNBA 4NN5C 2JELL 3LZFL 5C09B 1GSMA 1BFSA 2BFVH 4XP1L 2OQJA 1JFQL 4LAQL 3L6FB 2F58L 3MQIA 2K7QA 3QHFL 3S34H 5MHSE 3CFJB 3TYFA 1BFVH 5I1CL 1QEWA 1VERA 4NYLB 4MXWL 1MFBL 1OP3H 5E2VL 1BBDL 2FH8A 1JZ4A 1HILA 4Z7WA 4Q9RL 4WW2B 2X4TA 1KV3A 4GMSH 1DEDA 5BJTB 4HS6B 4N5EC 4WWKD 2EDFA 1YN6A 4W4NA 2DLGA 1YEKL 5DEFB 1RQ5A 2VERN 4I18B 4PG2A 4PP1C 3AM8C 1M1SA 4ZO8A 1QRNB 3GSWA 2P46B 4B5EA 2AV7A 3VFNB 4HKXA 2CRMA 3MUGB 5EULV 1DVFD 3PWVB 3U4EA 3UTSB 2P5WD 4PD4K 3TN0D 4WI7A 4FXKB 4U1MA 2CO6B 3ZHLA 1KC5L 3WN5B 4OZIE 1EAPA 3U79A 4BSVB 3HMXL 3PWUB 1YN7A 2FL5A 3IDMB 3WIHH 2VMFA 1BAFH 2IG2H 2GJ6E 3BPCB 4N0FB 3KYNB 6FABH 4OLXL 4ZMAT 4X6FA 2WBJD 3BO8A 4HJJH 1KEMH 1U95A 4F3FA 4DUVA 4EN3B 2HKFL 2APVA 3GMNA 2WWKO 3SGEH 3BP7A 3D2UD 3GKWH 1AGDA 4O5LL 3LHPH 1J8HE 1H0DA 5BV7B 3PDDA 3QHZL 5ICXB 3QZWG 3FB8B 3OPZH 1I3GH 3CVHB 5ENWA 3R1GH 2XN9E 1T1XB 1GCFA 4P59H 5JPMB 1N7MH 4KVCL 1A1NA 2A38A 4F7EA 4JFOA 5CZVL 1B6DA 2KL6A 1FBIH 1PGRB 4G3YH 5GISH 2MSPA 3RIFK 4HX1A 1VSCA 4OLWL 3QG6A 3GIZH 4U1KB 2P5EB 3I50L 3HLAA 1BIHA 1NBVH 3B6SB 4PB0L 3BIKB 4U3CA 2ARJA 1T0MB 4P2YA 4X4ZA 1OF2A 3H7BA 4E41E 3VWJA 4TTDD 4YBQC 3FB6A 5D7JA 3RWDA 1FGVL 3T8XB 3T1FA 3GB7A 5AZEH 3BUTA 2AJSH 4OSUL 3WE6B 4ISVA 3KYKH 3FT3A 2CIKB 5IV2B 2ZUVA 1WWAX 4XCCH 1WFOA 4XPBH 1S7QA 5EIIB 4GW5A 4F58L 2EIEA 4PRIB 3X13B 1YEEL 3I9GL 1Y0LA 4PRAA 4JZJC 4ODHL 3LMJL 2WBJA 5DJ8B 2F15A 1NBYA 5FB8A 4YFEA 4MMZC 1S9XB 5KOVC 3MCLL 4X5LA 4HGMA 5LBSL 5EDXA 4YHOL 3GMQA 5KSUA 2VDOH 5TPWL 2FZ3B 5HHPA 4FQJL 2VLRB 4IS6A 4OLYH 1ZGLM 3BX7C 2FO1A 1UB6B 4ORGA 5H94B 5GGVY 4LRIC 4WCYH 2RHEA 2R56L 4N90D 1YEHH 4ZS6C 4B53A 5DQ9B 4HS8H 5IEHA 3S35H 2FEEI 4UV4H 3CLFH 3T0ED 2ZG1A 2EKJA 5GIRA 1YMHB 3BHBA 2A6JA 4GQ9L 5BMFL 2XXCB 3Q6FA 3QJHA 4Y5XA 4JANB 3C5JA 1R3JA 3WL9A 3GSQB 4J6RH 2XXMB 1WITA 4YPJA 4M93C 2QQLH 2QQKH 2AV1A 4L29B 4D0CA 5ACMA 3QDJD 2QSCH 3ZYZA 3RX8A 5TDOA 3QIBA 5KSBB 4DKFH 3VE0B 1PLGH 1VGEL 1XZ0B 2VLKE 2LAGB 3X12A 1NMAL 4XT1C 2CH8A 4XVTH 2YPVL 3PE9A 3RHWK 1W0WA 3EJYD 4AEEA 2OCFD 4M8QA 5CCKL 3DHMA 4ODXA 5IW3A 2AK4E 4HIXH 3MXVH 3HMXA 1FAKT 4TUJB 2MJWA 3QQ4A 4C56E 2BVOB 3WN5A 3PWNB 1N64L 4WY7L 4CMHC 1HXMA 1MHPL 4LLWA 3LS4L 3Q5TA 5DK3A 5CEZL 5D6CB 3QULA 3EOAA 3FOLB 3RGVB 4UTBL 1U92A 4FG6D 4LIQE 5DT1H 2XTLA 4DGVL 3IJSB 4NZTH 1RU9L 3MCKA 3RDTC 5C0CA 3NPZB 4Y1AD 3MBED 3DJ9A 1RIVH 1DBBL 2X4NA 1AQDA 2HH0L 3O2VH 5DO2D 3FN0H 4XP6L 2LV4A 2YBRB 1U93B 1CD9B 1DDHB 3UAJD 3DV6A 4PJDB 1I8IB 2DM2A 4DVRH 4YHYB 2AQ2A 4TSCH 4S1QL 2DLTA 3PGFL 3SPVB 4NO2B 1RHFA 1GJIA 1XCTB 3DETC 1UXWB 3V6OE 4Z5RB 4G6JH 3QEQD 3VXMA 3QRGH 2O5XH 1C08B 2P4AB 2EIZA 2DI8A 4MQXC 1T0MA 2VQ1A 3HI5H 5EO1B 1TCRB 3B4NA 1I8MA 3RRQA 1MCQA 5FFLA 3VWJB 5ESQA 1ZHLA 3S3PA 4J7RA 1IAII 4Y4HB 1DL7L 2HLAB 1HIML 5ESVA 2R9HD 3MLTB 2AP2A 1FCCA 1KXQE 1UWXH 2AK4A 4NSKA 3CCHA 2IPTH 1LEIB 1IBGL 3RWIA 5E4EB 4D9LL 1FFRA 1KB9K 3RDTB 2NLJB 2Q8BL 4RMSA 5C7XL 2NY4B 2FIKB 4P23C 4RAHA 5IMLA 3LKQB 1XGPA 4MA8H 5H37G 3SDAC 1MF2L 3PABA 1WBYB 2NR6D 2OTUB 3CFIC 1SJVA 1CGYA 3CZFB 3GO1L 4IRSD 2JKXA 4Z7NE 1QBML 5GRXG 4IRJD 5FKAA 2R1XA 2X5PA 1OSPL 3FB5A 1VDGA 1OD7A 3QEGL 4XVSL 1T66C 2CLVB 4N8VA 3D69A 1YEFH 5DQDL 5D2LF 2FJHA 3GM8A 5D7LD 1U8QB 5A2FA 5SWZE 1CK0L 2CUMA 3QIWD 4NZUL 5DJYB 3TO2B 3UZEA 4N8VG 4D0BA 1MEXL 1WIUA 4I9WD 4LGRB 2ZCHH 4KROB 3HZKB 3QSKB 1I3VA 4NQSB 5BV7H 1JRHH 3N0PB 3PWJB 4Z18A 25C8L 5HD8D 4QXGL 1FL6B 4Z7QF 5D6DA 4NKIL 1TITA 2XNAA 5L9DH 1AH1A 1NDMB 2F8XC 5EC2B 4H0IA 5FGSA 3V6ZA 4DKDC 1PZUB 1ZGLB 3QFJD 4KTEH 1D3CA 3MSPA 1LILA 2C3VB 1DBMH 1KN2L 3CC5B 3QIWB 4XNYL 1WK0A 2Q86A 3O6FA 1IL1A 3SDAB 5KSBA 3G04B 1KLUA 4O02L 3SDCC 1NDGB 3PIQA 1CG9B 5IBUB 3FRUA 4OFYA 1A6VL 4K7FA 3MRMB 2F53E 2VDQL 3PJSA 4Q9CA 1ND0A 4KK5D 3BMVA 3CLEL 1MUJB 3QH3A 5JR1H 2EDQA 4JDVB 5I74B 1FNAA 4YO0B 1I1YA 1OGAB 2DQFA 1P9MA 4P46A 1MLBA 3SDAD 3U0TB 4XCYA 1NFDA 5F1SA 5KW9L 1FHGA 3FAXA 1RAMA 1RVFH 4AEIL 1WWCA 2VQTA 3AAZB 1RUKH 4TPRL 5HSFA 1F02I 3L3DA 4MJID 4OZFB 1MCPH 4YHYC 1BPVA 3HE7B 1S7UA 3SDDC 2QJDA 4DN3L 3SCMA 4LSPH 3C08H 2ICWA 3OB0K 4MXQC 4RA3A 4AIXA 3PGCB 4H26A 3RZCB 4XHJC 5EU6D 4IRZH 2BVUA 3UROR 3IF1A 5TH2B 1CD0A 4QXUL 4OF0A 4Z7WE 3CSBA 4MD0B 3BEWB 3VDAA 3ZYOA 2HTLC 2FX7L 4C54A 2XKNA 4Y4HC 2XWTB 3Q48A 5F1IA 4JCMA 1T2JA 4R90H 3BI9X 2A6KB 4PTUA 1R6VA 2WW8A 3LAFA 1I4FB 1A47A 3GHBH 1EEZB 4NRYA 5JNYB 1FORH 1U3ZA 5DDHA 5MI0C 2D4FA 1EO8H 4M3JA 5T1MB 3EO9L 5F7EH 4G42A 1BBJA 2ERJB 4AZ8A 1KUMA 5EBLB 4NKOA 3E0GA 4TSAL 2E7MA 1IGFH 5D1QB 1F6AB 4WFFD 3EYSH 4AENB 5EA0H 1L6ZA 1QSFE 2ICEB 4D9QD 5AD0A 4HDIA 3VGFA 2OR9L 1K85A 2A6IA 3ZL4L 2IJ0C 3FFCD 5CLWA 3HAEG 5DS8A 2ZUYA 4KAQH 4LHUA 4PYGA 4U33A 4Y4KD 1ACZA 3FB7A 3TVMC 5JO5B 4IEFB 4P5TB 1FN4A 1OQXA 4NQDA 1C7SA 3I2CH 4HXBL 1XGUB 4XBEH 4DCQA 3ABZA 3WUWA 4PLKD 4PJ8B 3EGSB 3JTSB 1HQRB 1MJUH 5AYUL 1NMCB 3O11B 3VFVA 4LRIA 4J3VA 1S7VA 3BO8B 3ARTA 1BD2E 4EN3A 4JM2A 3SKNB 5KOMC 5TDNA 1X5JA 1IEBA 3OMZA 5EB9A 5I1GL 4EI5C 5F7DB 4M03A 3TWCL 1UWXK 4G8GE 3OGCB 4U6XA 4OKDA 2R69L 4PGZA 1OP5K 2VLJA 5DLMH 4JREB 1OSZB 1MCKA 4PJ9A 1CFTA 2DLHA 3FQTA 3TBWA 4Z76A 5BZDB 1CXKA 4Z9KB 2F5BL 2B4CH 4QWWD 1A3RL 2I60L 4M5ZL 3U4BL 2X44D 5IM7B 3HCVA 3IXAB 4GS7B 2YSSB 3CVIL 3WDJA 1ZT7B 4N9GB 1DSFH 5MENB 1QVOA 4FP8L 4WUUD 2OR7A 5M94B 1GIGH 1YNLH 5FECA 1XGTB 5FV1L 4UT7L 5IVXE 1HXYB 1PEWA 4FHBD 4X6EB 3DMMB 3ULUH 5DRZB 3MA9L 5E1AA 2AJXH 5E95B 4JDVA 5B39B 1DUZA 1ERNA 4KKCC 2VZUA 1T2QL 1WLHA 2QHRL 1X9QA 4LCWB 2OL3A 1J1PL 5DJCA 2H2PC 4AK1A 1P84K 3MYZA 1K3ZA 1DBJH 2YKLL 5IWLC 5FB8B 1LO4L 3QYCA 1AY1H 1DANT 2FATL 2H26A 5GGSY 1KYOK 2YRLA 5IFHL 3EUUA 5D2NC 4Y2DB 3MOBH 4KHXH 4F7CB 5HVFB 3MV8A 1UKTA 2BDNL 1Z9LA 2XICA 3P4NA 4TUKH 4ENED 1OP5H 1ITCA 1CK0H 3D85B 2D4DA 1ETZA 3NCJL 3U9PL 5LGHH 4GAGL 1OPGH 4LOUD 2DL2A 4M6OL 4POZD 5D96C 4S1SH 4XAWH 1E4KC 4EDWH 1QBLL 3IRPX 4DKEL 2A6JB 3BDXA 4G9FE 1H3PL 1F3DJ 1HKLH 5GRVL 1I7RA 4G9DA 3HR5A 4NJAL 1GH7A 4AIZA 1R24A 4Y5XB 3C5JB 4KJYA 2MHAB 4RMRA 4O4YL 3ULSB 3UYRH 5IF0A 2R0KL 5IIEA 3QUMB 1C5BH 3I84A 1DUYB 3TIEA 4HAGA 4PJ9C 1DQLH 5L2KD 4HMEA 4AENA 1AI1H 3KPLA 4Z95H 5J1TC 3MPCA 3QAZC 4HK0A 5IVXB 1UA6L 5D7LE 4WI8A 5E03A 2VLMD 3MNWB 4QHMA 1A6ZA 5I6XC 3C6SB 3UXFA 4LHQB 1GGYA 1W72B 5DJXA 1OPGL 3K1KC 4EJ1C 4F2MA 5LGHL 1MAJA 2YZ8A 4PRHD 5E8DL 3C6LB 5IB4A 1QPPA 3VJ6A 3B9DA 4EN3C 4NKQB 1S5HA 5I19H 1KACB 3O3EA 3ZDZE 5DRXA 3DVNA 2CKNA 1N4XH 4KK9C 5L2KB 1JK8B 1HQRA 4KKBC 4HSQA 5EUOF 5C2BH 1JPGA 4OB5H 2NTFA 5I15L 1LHZA 1T6WA 5I18L 4JPIA 5IMKA 3BD3A 4HBQA 1QEWB 4WRLA 3MOAL 3CGTA 1KT2A 4YDKH 3QQNA 1FO0L 3B9AA 3R0MA 5JA8B 2O5ZL 4X9BA 4PJ7E 4ODUB 1DN0A 3MBEB 4UAOB 2DL9A 2ZUTA 1RU9H 3QDGA 1ZS8B 1RUMH 4JRYE 4NZTL 4XC3H 4ODWB 1GZPA 4OZGF 4FABH 4QGYA 2PXYA 1V7ML 4JFDB 3D39B 3RNKB 2YPKA 3F58H 4IMLA 3S3JA 1DQMH 4QT5A 2QQQA 5E6ZA 1EBPA 2VITB 3MR9A 3GM0A 1WZ1H 1TVHB 4GKZA 1ZT7A 3QPQD 3QUXC 3QEQA 3S96A 2L7JA 1CLCA 1RJZB 3U4BH 4UTAL 1N3NB 2AJUH 2CMRL 3DX9B 3OSKA 3T2NH 4KKLC 1MJ8L 1WEJH 3UTTD 3TT1H 2MQCA 3RVVD 3VGBA 3LRGA 1KPRA 2SEBA 2VSCA 5MI0B 2AK4B 3NCYP 5LGJA 1I3RB 2OL3L 4HGWB 4MGXA 3FKUS 1U95B 5HHNA 1BVLB 4R0LC 3SGKA 3T04D 1X5IA 4YR6A 1OCWH 3PHOB 2V2TA 1JGEB 3EYUH 1AQKL 2CRZA 1UH4A 5F9OH 4Y7MA 3V5DB 3UTQA 1AGEA 5BMFH 4HJGB 2FLRT 4F7MA 5IROA 3K4DA 3OKDA 3TVMB 3LKRB 4PJGA 3LIZH 1DBAH 1KIQB 5JPMA 4P5TC 4ZFOA 1QFUH 3QZWB 3NFNA 3SDDD 1MJUL 3LPWA 4LLAA 2PNDA 3L95A 3B3IB 1UJTA 1CDYA 1U8QA 5BZWA 3HG1A 1CXLA 2OJEA 1AFVH 4ZD3H 3DUUA 4ZUUB 3LKOA 3Q5YA 3QISA 3T65A 4FFYH 1ZVHA 5MEQB 5AAWA 3EOYG 5I1LB 4HV8B 3FMGH 3QA3A 4IMKA 4WFEE 3SE3C 1B90A 4PJFB 1LP9A 1IGCH 3ZL4H 4BYHA 3DX6A 1U3YA 2X7LB 2Y5TB 3SDDB 5FDYA 4NWUH 3O6FC 1P4LB 1A9BB 3MLYH 5CGMA 2C3VA 1BP3B 2RGSA 1T22A 2Y07H 4IRSA 3TPUA 1MVFA 5E6YA 4R97C 1FH5L 1NGZA 4WVRA 4L9LC 5GRUH 3MUHL 3KYKL 4LCCB 5KSVB 1A5FH 4XAKD 5I1JL 1CD1B 1IGYB 1A5FL 4QXTA 4WI2A 1BIIA 1MQKH 1K4CA 3CFCH 3QEHA 2X1XR 3I02A 1JWMB 4DAGH 2DIAA 2P48B 1RK0B 4XPGL 4YE4H 1Q1JH 1JNHA 1OAXL 3H42L 5HHOD 3FL7A 4DGIH 1I9RL 1LVEA 3I75B 3C9NB 3CVHH 3MGOB 1QYGL 5CJ5A 4HIIA 3VMNA 3VXMD 3F7YB 3K0WA 4XGZB 1TJHL 3R1GL 2GTWB 1MCDA 3OPZL 1RVFL 5C07D 4ZUSA 5IG7B 1EEYB 3LHPL 3C60C 1T7YA 3GSQA 5JHDD 4OIIL 4MQXD 1BZ7B 1CL7I 5IJKC 4WW2F 1XAUA 4WO4B 4OV6F 4UZGA 1VKXA 5TDOB 1KELH 1BZ9A 1IEAB 1WCQA 3C87A 4X80H 5F6HJ 1XIWC 3CFEA 2BVPA 4RGOH 3AFLA 2HFFA 2BHUA 2BJML 1F45A 1J0HA 3VD5A 1W8NA 4WTZA 1MI5D 2GEEA 3KJ6H 2FX8H 1I4FA 3AB0C 3QEQB 4P57A 3S96B 5DMIH 4BFBD 1ZMYA 4NP4L 1OB1B 4XNYH 1N59A 4BSWB 1DE4B 3RWJA 3WD5L 1FV1A 3D18B 1JMXA 3MLWH 4JKPH 4AT6B 2YA0A 4ZPTA 5B4MD 4PJFF 5KAQG 1FRGL 1MWAH 5LGJB 3SGDI 4NKIH 2XN9A 3GDBA 4YUEL 1ZA3B 2BNQD 2D0FA 2NZIA 3MCKB 3OZ9L 2A77H 3RPIA 1FCGA 1MI5B 5T1DL 1S7TB 5HYEA 1JPTL 4M6AA 1WZ1L 4UDUA 3U6RB 3Q1SL 5FGCB 1AGEB 2GI7A 4ZFOL 1HQ4A 3TBTB 1D5XB 2PTUA 2DM4A 5LGKA 3MJ7B 2OK0H 1OM3L 1YEDB 1YEFL 3HNTL 2DIBA 3AS1A 3ARGA 3JZ7A 3QEGH 4JRYB 5CJ8A 2DI7A 3QUZC 3NFNB 4M5YH 2BFVL 3UTZA 4JY4A 3WS6C 3RA7H 1S7RB 3SY0A 4S0TD 3IDJA 1C08A 1EJOH 2NY5L 2X89A 2O5ZH 3DO3A 3IDIB 43CAA 4YDKL 3LKOB 4I3SL 4MAYD 5FO7A 3H9YA 3WS3A 1U8PA 3EAKA 3GSNB 5JDSA 3LEXA 4U6YA 3QA3B 4UQ2A 3B83A 2DQEL 1FO0B 3OXRA 3P0VH 1WBZA 3MLTA 3TA3B 4GG6B 1QD0A 3MRQA 1N4XL 3S4SB 3QPXH 2DAVA 3L5JA 2HT2D 2IANB 4LCYB 1C16A 1TDQA 3AS2A 1DN2A 4G8IA 4PRPA 3HCVB 3WXWH 4OQTL 4LCCA 5KSVA 4UNTA 1T6VN 3EDDA 1F4HA 1CXFA 5FYJD 2FD6H 1S9WB 5IB2A 5K9JL 2R2EB 4KXZH 3AS3A 1NGQL 1JGVH 1S7WB 4RIRB 4LLMA 4RCAA 1BQHG 2YUZA 4Y5VB 2CQVA 3HN3A 4NBZB 5L8KB 3VFMB 1N0XH 3OF6A 1U8KB 1LO5B 1G7MB 4UDTB 3NOIA 3FFCE 3GJEA 3NPSC 5DHXB 2ARWA 3S88H 4LVNB 4CKVX 1C5CL 5F3BB 3QNZB 4PV9B 5FUCE 4JFXB 4OV5A 4NRXB 1JNNH 1FG2B 3IJYA 4OCLC 1RIVL 3HAEB 1YQ2A 5FM4A 1M4KA 2P5EE 4JY5L 4BKLA 5JTWA 1X5AA 3FRPA 5F9WB 5KVGL 3RL1B 1OW0C 4JGJA 4XGZA 4HUXA 5EU3B 3P9LB 2H26B 4UTBH 1BD2B 4LDLB 1MLCA 3U9UA 4OD1L 1T20B 3LS4H 2EYTB 3KLAA 5E94B 1ITBB 1T0NA 1RZ8B 3IDNA 3VD9A 1C5DA 3MGTA 3U7AA 2QADB 3Q1SH 3QIWA 4ODVL 2FWOB 3OKNA 4BUGA 4NGHL 3D2UA 3RWEA 3W82A 1AP2A 2O61A 3C2SA 3V7MA 1AO7B 3DO7A 2ILLA 4NQCB 1WWWX 2X9WA 3F7VB 2BSRA 4OM0L 3S97C 2X42A 4JKPL 4K23H 4HH8A 4K3DL 5CZXC 2VH5H 1QPXA 1WIPA 1P4IH 2VC2L 2MPAL 5CD3B 2E6QA 1YY9C 3BSZL 5D7KD 5EUOB 5IF0B 4V1DD 3ULVL 1LE9B 3W5NA 3RWFA 2DN7A 3GIVA 2WSKA 1FAIL 4JFPB 4RRPA 5TE6H 4UT7H 3A6CL 5ADOH 3HC0B 3WLBB 4NJ9L 4HS6A 4IRJC 2Z91B 1DEEA 1EFXD 3L5XL 3ESUF 3PV7A 2ORBL 4MB3A 1FPTL 4DN4L 1NC4A 3CVIH 1O5DT 4M5ZH 4L3EB 4LEOB 1JTPA 1YEHL 3NCBB 4LPTA 5ICYA 4LIQH 4RGND 4L8CA 4JE4B 4OLYL 4XPHL 5C8JB 1OTSD 4FQJH 5CD5D 4G8GB 4TTGA 4KJWD 3T09A 3O9WA 3MC0A 1IC1A 3PWUA 1EFXB 5DD3H 1YY9D 4RFNC 4TVPH 5F8QC 1FSKC 3LQAL 2EDBA 3HPJB 5DGRA 5J06A 2BXZA 3BPCA 1IC7L 1NCCL 3EOTH 4L1DA 4OZFH 1I3UA 5JW4N 1OAXH 1EEZA 1V05A 3TBYA 3DSFH 5IB1B 3MBEA 2QHLA 3H0TB 1P2CB 2AV1B 4EEEA 4PYHA 3WUWG 3HI6L 5IW1A 1NQBA 4I5BA 2HN7B 2PW1A 4WU7B 2QLVB 5AZEL 2IQ9H 1A7PH 4JVWA 3HB3D 3NABH 3BVNA 1NLDH 4R96A 2Q6WA 4HXBH 3ZO0A 1D6EB 4CVWA 1G7JB 2XA8H 5FM5M 4J2XA 4HKXB 3ARBD 4NNYB 1HSAB 4XMKL 3DECA 3UTSA 3O2DH 4WJ5B 3UTPD 3KPRD 1IT9L 3QULB 2AJYL 3VFVB 1FSKB 1SYVB 4O2CB 2JB6B 5HGAB 4LPVA 3SKNA 3NAAH 5T1KD 1MRFL 4JFFE 3O0RH 2GAZA 1IEBB 2VISB 3GSOA 1AQDB 4OI8A 3U0WH 1HOCB 3LDBC 1JF6A 4U6XB 3T0WA 3E8UH 5F9JB 3ZKXC 3BKYL 3ZT5A 1JZ3A 2B8OT 5DUBA 4XNQA 5FXCH 3SQOH 5B3JE 5HGBB 3VI4E 3OJDB 5EZIH 3RUGF 3C60D 3KLDA 2PR4H 2OP4H 2Q76B 1UADC 5DK2B 5C0GB 2EDWA 4N8CL 2GJ6B 3RTQB 5DJZB 1C5DB 2Y7QB 4XCFH 3X17A 3KLHD 3G5ZB 3TFKC 1AQKH 5T1KB 1JWSB 1KC5H 5CAYB 3OKOA 3EYUL 4DN3H 5DC9B 2PYEB 2EIZB 1NUFA 1MCSA 5GRJH 1CDIA 2P49B 2R4SH 3G6DH 1WBXA 2VAAA 3NTCL 4MDJA 2CSPA 1MNUH 2WP3O 5B38B 1WICA 4U31A 5JQ6L 1N2RA 3K7UA 2OL3H 2G5BB 5ESVB 2IPUG 5CBEA 4YEFA 3ME0A 4NN5B 1NAMB 4XAKE 1BQSA 1YEGH 2CUIA 1I9JL 3B9KB 3WLWD 3DARA 1OWRM 1U8IB 1TZHB 1RJYA 3FTGB 2VL4A 2NW3A 4BZ2H 4K2UH 3C8HA 2OL3B 3CLEH 3LRHA 2VWEC 1N8ZA 5IMLB 1QFPA 4YHZH 4PRHA 1WZLA 2Z93A 1CLOL 3FQNB 4MD4B 3VI3F 4GBXB 2NY0B 3DTXA 5GSVA 3ZHDA 3H3KA 1K4CB 4XP1H 5TFSH 4DKAA 4KY1H 4LBEA 3BE1H 3D69B 4JFFB 1WT5C 3V6BR 1A7OH 4PJCF 4XNMB 5ITBH 4YHLL 2VLKD 3MA7B 5J1SC 3CDCA 1TZGL 4NBXB 5IFAH 2VXVL 4Y16A 5EPMB 2CDEB 1AGCB 1D9KC 4QTHA 4XHJD 4XBGA 1G84A 3GBNH 1EFXA 1JRHL 3VD3A 3PP4H 3SJVD 2ESVA 4NNPH 1KB5L 4QRSA 3WFEL 1AKJD 3HZYB 3LQZA 4ZFFB 1WISA 4U1JB 1K8IA 4F33B 4R26L 5E08H 4NZUH 4KGJA 1TNMA 3KPPA 4L8SB 1YEJL 5E8DH 4NFCA 5E70A 5IW1B 5JOFA 2DQCH 4ELMA 2CXKA 4NO0A 4JJ5B 4GUPA 1ZLVH 4JO3L 1X4XA 5C9JB 1UWGL 1A6ZB 5E7BA 1J1XL 4NZDA 1DQLL 3AU1A 2XZAH 3Q6GL 4LSQL 4H25A 2Q8BH 4LSRH 2BC4B 3RPKA 1G7QA 4PJEB 2JK5B 5KZCD 3O4OC 2IPTL 5H35A 4NJAH 3RVWC 2HG5B 3HNSL 5FOJA 3KJ4B 1LO2H 3EHBD 2NZ9D 4G6AD 5LG1A 1LMKA 2N7AA 1L7TH 4YHNA 1ZA3A 5I8CA 4HUVB 1LD9B 5LWYH 1KTLB 2NXYB 4P2RA 4WO4C 1RZGA 4FZEH 5TF0A 2FJFA 4JQIH 1YC8A 3ALPA 2J8HA 2IEPA 4L8BA 1F4XH 1AIFA 1DQQB 1ZT1A 3UTPE 5IFHH 5DJAB 1PDKA 5MEOB 1J5OH 3HZMB 1FZOA 4NOBA 2C3GA 5C0EB 4LCUB 2NY5C 1YQVL 3X3GH 1NLBL 5FYLL 8CGTA 1GOHA 1JN6A 4AYFA 2ZSWA 5D4QA 5F9DC 1KF9B 4DFIA 1T1ZA 2OSLA 3THMH 1HH9B 5FCUL 2AJXL 2HT4D 3PXHA 3L3GB 5CP7A 3N1GC 5AZ2H 3RDTD 1BBJB 1LDPL 2XN9D 4NFDA 3P0GB 2W9DH 5IVZB 3ROLB 1I8MB 1T5XB 1YNLL 4KJPD 4U1LB 4V1DE 4LCYA 2UWEA 3FO1B 1PG7H 3VFRB 1AHWA 4HKZB 2W1NA 4DK6A 1W8OA 3WBDA 2A0LD 3QCUL 5GJSH 1NFDF 3TZVC 2X4PA 4ESKA 2BSSB 4OFPA 5GS1A 1U36A 1X4ZA 2QSVA 3K80A 4NM8L 4NQDB 5GGRB 4MD4A 1YEIL 5IK3B 3DGGA 4U49A 2X41A 4J1UA 4RZCA 3HR6A 1KLUB 2R69H 2DJSA 4RGNE 5F3HA 2P5WE 3UJJH 2D7NA 2X09A 4XWOD 2E9JA 1R3IH 2CO7B 3DROA 4K9EL 5EOCJ 5EU7E 1FFOB 4BKLB 1MFDH 3QH3B 1KB5A 2CDEA 4E42A 3OKMB 3SE8L 1A1MB 1A6TA 1QACA 2BY2A 1BD2D 5I76B 3ZKXB 5KS9E 3JV6A 1G9NL 1P5UA 5DD5H 3VFPA 4BQ6A 4ONHA 1X44A 3RNQB 4PY7B 4XPAH 5I1DA 3IJHB 5JOFB 4Z7VA 1G9MH 3D25B 5I8KH 4QRRD 1I85C 5L8LB 2OR9H 2WINB 4OAWB 4XWOC 4OCSL 4MD5A 4B7IA 2CJUL 4NQVB 5H2BB 2VN7A 4M7JH 2FH6A 1F58H 4ZFZB 3WN5C 1FORL 1MHHA 3HG1E 3REWB 1T1YA 1XGQB 4KDVA 5F7HA 4ETQB 2BY3A 3ZTJG 5C9KA 2I25N 4EBQL 1FL5B 4J4PC 5FK9B 1EFQA 1ZAGA 1EVUA 4ZFGL 1MHEB 4CU7A 4KV5F 1T21A 1NANI 1MCWW 5DD0H 1OLZA 5B3NA 2D7MA 2GK2A 4WV1A 1JWUB 3TIDA 2BVYA 3F12B 4H88L 2FR4A 4F9LC 3O6FD 1ES0A 1T80A 1GOGA 4KTDL 4X6CF 1FBIL 5IMMA 4M9PA 2AQ1A 5JHLL 1Q9KB 5JO5A 3HZMA 4GMTL 1YUHA 4XVUD 3WFDH 4QY8B 4P3DB 1DLFH 1IAKA 4JLRB 2VDNH 1LQSR 4LCUA 4U2ZA 3S7GA 4GMTH 1FYHB 1LEKB 4M7LH 4X83A 3V52L 4FFWC 4RFEB 1U8LA 2IALA 1PFCA 5CUSH 3OJ2C 2B20A 1AJ7H 5T3ZH 3BPLB 1ORSB 2DQIH 4JFEE 3P9MA 5C0IB 1P1ZA 3MXWH 1GPOL 2Z92B 4LU5H 5F7DA 5HHMB 5MEND 5BJTA 3KPMB 4DZBA 5LCVL 4RGNC 3HMXH 4QYOB 4PJ5B 4JR9L 3UTTA 3QIUD 1L7TL 1IM9A 2YC1B 1BM3L 3BPOC 4JZJA 2ZCLL 3U7YL 5E6ID 1AE6L 1ZA6B 2ADFH 1D5XA 3U1SL 1INQB 2R4RH 1F58L 4JKLA 2Y06L 5HY9B 3F5WB 1X5YA 4LOUC 1ONQA 3VFGH 1SEBA 1QSFA 1W72L 3T08A 5BVPH 4OCXL 2HA1A 5FYKE 3KS0H 1BBDH 5ALCL 5A2IH 1NGPH 5HBBA 4UIMB 4JY6A 4U1MB 1K5NA 4ODBD 1G9NH 1R3KA 1Z5LA 2HVJB 3PL6A 3QXAA 2F5AH 1UZ6E 4DUXA 2EDYA 4G6MH 1M71B 2HJLB 2PXYB 5ALCH 4EVNA 4LKXA 4ZNEA 3HRZA 5K9QI 1HZHL 4TTDC 4YBQD 1FE8L 1KB5H 1I1FA 5DJZA 3RP1A 1CICD 1PX3A 3MYJB 2XKUA 5IWLA 4XCNA 4ZAKB 3VFGL 4G6FD 3BP7B 2ENSA 4JFEB 1RY7B 2XPGB 1YY8A 3TO4C 4D9RD 1H0DB 2DYPD 4K07A 5DUMH 4KZDL 2YSSA 3TT3L 3D0LA 4MD5B 4Y5VA 1T1XA 4GLRI 4FG6C 5FUZH 4RDQG 3WHXA 5KVFH 4RX4A 2YXFA 4BZYA 3NBNA 3RWDB 5HYIA 3KGRA 4PG9A 1NAKL 4QHUA 2YK1L 4X6DF 1MHHB 5C0DA 3UMTA 3IJYB 4UILL 3CSYA 1FL5A 4K2UL 4H1LG 1AJ7L 3ARFD 5T3ZL 3WNNA 2P1YA 4XP5L 1PY9A 4FXGA 4PJHA 2OLDA 3KPLB 1WVZA 3TH2T 1NBZB 2UZIH 4XMPH 1YECH 1FNSL 5DVKA 1DP0A 4LBEB 1A7RH 3UDWC 4KV5E 2CR6A 1XR9B 3BDBA 3MNVA 1RZ8A 4AJ0A 5FCUH 4X7SH 3FN0L 4XP6H 4CJ0A 3THML 2R23B 3LN5A 1VACA 4V2BA 2R4SL 3G6DL 2VLRA 4GXVL 3T65B 4X7SL 4QY8A 3I6LD 2BVQB 3TNNB 3T3PF 2WAHA 1KSRA 3QDJE 1S9XA 1NC2A 1ZWIB 3QT2A 5CEZH 4F80A 4PREB 2PR4L 4LVOB 1BOYA 1CFQB 4I13B 2MFNA 5EWIH 5EORL 3SDCB 4XVUC 4U1SA 3TNMA 3SO5A 5C0AB 3T1FB 2XRAL 1FC1A 4YHIA 5I9QB 3KWWB 4ISVB 3FT3B 1UXSA 2I5YH 1NAKH 4NC1C 1SYSB 3LS5L 1NGWA 3NH7L 4OCYH 3AGVA 5ISZD 5D7IA 3I6KA 1E4WL 1LO2L 3MGAA 1LE5B 2YC1A 3S5LA 43C9B 5LXGL 1P5VA 2IBZX 2Z8VC 1MY7A 3D39A 3SDCD 2X2YA 4H25B 3ARFA 3CSGA 1JWMA 2CJUH 4HZLA 1F2QA 2XG4A 1PYWB 5IHBA 3QO1B 3TA3C 4Z77A 4L29A 2PW2A 1G9ML 4LPYA 5H35B 1NGYB 2JE8A 3QIBB 4X4YB 3PWPE 1T3FA 4YJZL 4I77H 3MX0A 3OXSA 3PWLB 3UZVB 4FQXB 2BOCA 3MACL 1HHIB 1UCBL 4HIJB 4UV4L 2R1YB 3V79C 4GW1A 1KIRB 3HUJB 4MS8D 5F88A 3BWAA 4KK5C 3MREB 5GZND 4K8RH 2YXMA 1YJDH 4GO6B 5KJRL 5TE4L 3PWNA 4JANA 1P6AB 3KPRE 1IILE 2CPCA 1VKXB 1OAUH 5D2LA 1CIUA 3MJGX 4H5SB 4LSSL 3T0EE 4NNPL 1VFAA 4U7SA 2UZXB 2LTQC 3ILQD 2AJ3B 1R3IL 1W72H 5EFIB 1A14H 1O7SA 4LSVH 5CHNB 4DEPB 1TZGH 2X1WL 3QZWA 3WO3B 2AK4D 4L8DA 1B0RA 4M00A 1KNOA 1ZT4B 3QNXA 1S3KH 5HDQH 3MV7A 3U1SH 5IBTH 3TJEH 4MJ2A 3O8XA 3S8WA 2APTA 1FV1B 1KJVA 2E6JA 4YHPA 4IDLA 4MNQD 1VEMA 4HV8A 4LF3A 1TCRA 3SPVA 5LCVH 4OZGB 4HFWB 4PJBB 1CLOH 2JB6A 5HGAA 3HRPA 3RGVA 1NCWH 1NBVL 5A43C 4BQCA 1L6XA 1U92B 1KJ2B 5GQBA 2BVTA 4C4KT 2GFBA 5J8OA 4KHTH 4FQLL 5J11B 5ESQB 2ESVD 3BP6B 3UTQB 1MY5A 1QNZL 2E7BA 4HJGA 3REVB 4CRPA 3HUJE 5IOPA 3UTZB 3TZVA 3QDJB 2PTTB 3TF7C 4OJFL 2D0GA 5IT2L 5HDOA 2Y7QA 4N90E 2WWMC 1YPZA 2H3NA 2YEZB 3ARED 3EYQD 4GJTB 4KVNL 4OI7A 5H8DA 3QWOA 3W5MA 5C0AE 4KTDH 2LFGA 1VFMA 4JZOB 5A2LH 1DR9A 4MDJB 1TTGA 3DVGB 4N8CH 4ODVH 5EU4A 4OLEA 2ATPA 5IB5B 4YK4C 3DUUB 3ZMRA 4ALAH 4OF5A 5D8JH 2LVCA 2GSIB 3I75A 5DD0L 5IEKA 5C08E 4ZFGH 3O3DA 3SJVB 4LGPB 5KANG 4EBQH 3GSNL 3HNVL 4IJ3B 2XNAB 1V3MA 2H9GA 4W6YB 1VENA 3GSXB 1UXSB 4PGEB 2XTJC 4GRMB 5B8CA 5JOPD 1NJ9A 5C6TH 2HKHH 5DHVA 5KN5A 4P99A 5HYSG 3G6JE 3HZKA 4PTTA 3TH4T 1D5ZA 1RUPL 1R5WA 4ODSL 1BZ9B 1TETH 5E2UH 1X4YA 3FZUD 4M3KB 3P9WB 1JV5B 2W07A 1CLZH 3ZE2E 2NY3D 3W9EB 1FDLH 4FQXC 4Q9RH 2IH3A 5D7SL 1XF4A 5IVNA 5K9JH 4XPAL 1G6RL 2FHBA 5FHAL 3L3OA 4Y16B 5EPMA 2AXFA 4QOKA 3MV9B 3PWLA 4K3EL 4FQXA 2EIBA 4XBGB 1A7PL 4PJCE 2B0SH 4Q9QL 3PDOA 4XCYB 2NXZB 3STZA 2CDFB 3AMKA 3IETA 4GBXC 3KR3L 3O8XC 5MHSD 5D1QD 1K8IB 4U0RB 3GBNL 4IHOA 4OZFA 5GRZA 4ELMF 1ZVYA 2V5YA 2XZZA 2VXUH 2DD8H 4PJIE 2LAAA 2NY4C 5T5FL 4YWGH 1QFOA 3DRTB 2HRPH 2K1MA 3QHTC 2ESVE 2I9LB 2PYFB 3V5KB 1LP9F 3BZDA 3BRFA 4LKCB 3QEUA 3QJFA 4PRDB 1XGYH 5E8OB 1BVKA 1GGBH 5C0FB 1EUTA 3L3IB 5CEXA 3IGAB 1JE6A 1TFHA 1UVQB 2XKNB 4LIQL 3HNTH 4Y4FC 3ZTNH 1U8HB 3IS1X 2VOTA 1B4JH 4TVPD 1JP5A 4OZHA 1FFPB 1YNKH 4OGAD 4RWHA 4Y16C 5JNYA 5F70A 1NMBL 3LSOA 3X11B 1N59B 4KK6C 3WO4C 2XFXB 3O81A 1RJLB 2J5LC 3H3BC 2A77L 3L5WA 2H8PA 4FNLH 2GK0B 4NJ9H 5EBWB 1UGNA 5I16B 1E6JH 1T04B 1IM9B 4J3OC 3FQRA 2E9BA 1FP5A 4KJPC 1N5YH 4F9PC 4JZJB 1FRGH 1LDPH 1IGMH 3VI4F 5DFVD 1RZGB 3MLWL 4PRBB 3L9RB 3BSZH 1V3JA 3QUYB 2IPUK 3NTCH 2GTZB 3TV3L 2VLRE 2W9LA 3FB7B 2WP3T 1ONQB 1I1AC 1HQ4B 4G8GA 3TBTA 3CNKA 1QR1A 2E7HA 1QSFB 5FA4B 3TCXA 1M6OB 3RWGB 4DTGH 4HFUH 3VXUE 4HPOL 3IB4A 1HDMB 5BS0B 3VFMA 2O93L 4NGHH 3RL2A 3BKYH 2L0DA 4AG4H 1Y18B 3FHQA 2GC