4M93C

Unliganded 2 crystal structure of s25-26 fab
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (IgG1k) light chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93C01
4KTDH 2QQQA 3EO9L 3ES6A 3PF2A 3OKLA 3V52H 5AZ2L 1G0YR 1BJ8A 4TRPH 1SY6L 2L7UA 2WWMC 4KUCF 4NUJA 5FOBB 3WDIA 3S3JA 3OR6B 2J6EH 3MBEC 5GS3A 3QHTC 4CRPA 3GSOB 3MTRA 3ARYA 3HKFA 5C7XL 3OZ9L 1BD2A 1HCFX 4ZOEA 3IFLH 4MNQA 3RVXD 5I17A 2H26B 3L7EB 2VWEE 3O6KL 4KHXH 3QUZA 4PJIE 3RHWF 3P77B 5I18L 2Y07H 2R2EB 1MHHB 5ANMB 2O5YL 4JDTL 2R29H 3S35H 4PJEF 4E9LA 5GS2D 2FGZA 4M3JA 4CUCA 5CGYD 4QCIB 1H3TA 4BQ6A 1KUMA 2D03L 1FL3B 1LE9A 3UBXG 5K33A 1NCDL 4MJIA 2DQEH 2HLAB 2DM2A 3DNKA 4RAHA 1ED3B 3GGWB 3FT2A 1QSEB 1FFRA 4OZHA 4EN3C 4YXLH 3N85H 1T6VN 5E1AB 4Q58C 3EO9H 3RIAF 4ZS6D 5AZ2H 3RVTD 1NGZB 1MPAH 3QQ3A 3H9YA 3NIGF 2Z4QB 4S2SB 1SY6H 4XVJL 4JM2C 5B3NA 3MO1B 2ADGA 2CDEB 2X4NA 3FOLA 5FV2A 1KLFA 3WDHA 3QEQB 1BQHG 5GISL 1KF9B 1F42A 1P2CA 4GLRH 4P5TA 4Y4FA 5T5NF 3CFDA 5C7XH 1CFNA 2H32H 3OZ9H 1MRDL 1LNUA 4B50A 1KJ3H 4YE4L 3CDCA 2HYMA 2XYCA 4UDTA 5HHQB 3O6KH 5T1MB 1KGCE 1TVHA 2RCSL 3EJZD 5I18H 2J8UB 4KDVA 5FGSA 1XGUB 3SDXA 3T04D 1MJ8L 2O5YH 4JDTH 4K3GA 3DWTA 1BIIA 1YDPB 4FTVE 5HGDB 5EU5A 4KDTC 1KEGH 1AGCB 1KN2L 4W81A 4WENB 2D03H 1K4DA 5SX4I 2HKFL 2Z93A 3PGDB 1NCDH 3OL2A 2MHAB 3GBLA 4FMFA 1FGNH 5DMGD 3MODL 2LV4A 4PJ8D 3RGVA 3T4AA 4HWNA 4U05A 1R3KA 3PQYE 5AAMA 1IZKA 1IGJA 2E6PA 1J8HA 4UBDC 2DWEB 4C57C 1JZ7A 4XVJH 4F7CA 2CSPA 3TIDB 1RFDL 4MNGB 1XF1A 5F7NC 4UDUB 4G6FD 3RNQB 4PRIB 5GISH 1S7TA 1XIWA 3GB7B 5FYJD 5DEFB 3MFFA 4YE4H 4GG6E 1IEHA 3DURA 5IVXB 2BSRB 4MCZB 2H2SC 5D7JB 3ARBC 4MLIA 4LFHD 1F11A 4PJ7E 5GRXG 4ETQA 4RZCA 2RCSH 3SGEH 1GC1L 5FHAL 1K85A 4NFBA 3BZ4A 1D5XA 4O2FA 5FDWA 1MJ8H 3MOBL 2X4QB 1IAKB 4JHBA 5B8CB 3C60A 1KN2H 1U3HA 4JY4A 3PQYA 4HUVA 3NA9L 2HKFH 3UTZA 1CVSC 1LEKA 3EYSL 3T65A 5DEGA 2OBGA 4PRHD 4P2YA 3WN5C 4LEOA 2IBGA 8FABB 4U6TA 3WMSA 4XNMA 3MODH 4JFQB 2BHYA 2D7TL 4GO6B 1JGEA 2ZG1A 4PJGB 4OZIB 1AQDA 1H9VA 4TTGA 1ACYL 4WUUE 5E8DL 3DVFA 4EUPH 1A6ZA 5DQJB 3PWVA 1S7RB 4N9GB 3QUMA 3ZTJH 4MLSA 5F7MC 1RFDH 1X5JA 5JIIA 1T03L 3RZCB 3PNWA 5DRXA 3JTTB 4UZGA 4HMDA 1BVLA 4KTEL 2V2XB 1I3GL 2HLFD 2AXFA 1QLRB 2AKRB 2D7MA 5JW4R 1GC1H 5FHAH 5IROA 1CDHA 4X5WB 5F71A 2PUQT 3MOBH 1YYLL 3LN9A 5HPMB 2O93L 2JIXD 3V6OE 1U58A 4J3OC 3TVMA 4L3AA 1F02I 1I1FB 4RFOL 3V5KA 3QQ4B 4F80A 2DLGA 1URLA 3QULB 3TBSA 3QT2A 3NA9H 1L7TH 2X1PA 1MCWM 4CN1A 3EYSH 3R4DA 4PRPD 1HSAB 3WKML 3TO4A 5IR1B 3BN9C 3EJYC 4M7ZB 3N1GC 1WZ1L 2D7TH 1UYWL 2AABL 5DK0A 5DJAB 1JNJA 3GK8L 4CVWA 1G9MH 1A0QL 1H3XA 4N5ED 1S7VB 5E8DH 4X8JB 1S7SA 2VLJA 1QR1B 2AJZA 5ISZA 3PJSB 5TE7L 4J8RB 5EU4A 1T03H 1DQLL 1T0NA 3OR7B 1T1YA 3DXAA 1UB5A 1DQJB 4KTEH 5HI3D 2BOBB 1G9NC 1ZT1A 3MJ6A 1I3GH 4POZD 4Q9CA 1UWGL 1UCBH 3SKMB 5E5RB 4QF1A 4L1HA 4HKXB 1N6VA 4D3CL 5T5FL 2ICWB 4ZNEE 5IVNA 3FO9B 1Y6NR 1YYLH 4R2GD 3TIEB 4CGTA 2BSED 1DBML 2APBA 2YKLL 3VGAB 3BD3A 4RFOH 4FQXB 4QRQA 1ITBB 4XX1E 3G6JE 5ITFB 5D1XA 4PJAB 4O4YL 3QUYD 3QG6B 2ITDB 4F7EA 3UPRB 4O02L 1X7QB 3WKMH 1T0MB 5LXGL 4WWID 4DZ8A 4U1GB 3DX7A 1WZ1H 4EXKA 4DQOL 1Q8MA 1UYWH 2AABH 2IAMA 2ESVB 1IMHC 3TNNA 4HFWA 3GK8H 4XBGB 1A0QH 1D5BB 4UB0L 3QEUB 5F6IB 3GSWB 4CMMA 3L9RA 1CQYA 1I7UA 4MDIB 1ZLWK 1ZSDB 3AS3A 3IJHA 2DLTA 4MVBC 5TE7H 1YUHA 4ZNEA 1DQLH 5DJ6A 3FQRA 3QUML 5SWZD 2EYTB 4LAJH 3NPSB 1TTFA 2VQTA 2XN9A 2VDNL 2ZOLB 2RJMA 3D6GA 2NY6D 4D0DB 1T2QL 1LEIA 1UWGH 1CXLA 3ELAT 4Y4KB 4NO2B 4D3CH 5HHOA 5T5FH 5E8EB 4NM8L 3P9LA 5GSRB 1X9QA 1SQ2N 3N1FC 4MAYB 1DBMH 2YKLH 1C08A 2AXJA 2XICA 4RISL 3UYPA 3MJGX 4JFEB 3B9KB 1D5MB 2P5EE 3NIDE 5F9WC 4O4YH 3QIUB 4M7LH 2VXVL 1FL5B 5MHSD 3DX8B 4BK5A 1C1EL 2R56L 3GJFH 3IFPB 3OKYA 3GBNL 3QG7L 5LXGH 3LQAC 4K7PL 3L5HA 5A2LH 5C8JB 4DQOH 3ALWA 2F53E 3QDME 5KN5B 5IBLD 3I3DA 2HJKA 4AEFA 4UB0H 2H45A 5C0ND 3TJHC 2V7HA 4DOHB 2Q3ZA 5DYOB 3KAAA 4NRYB 5EBWB 2LU4A 3ZKMC 3QUMH 2HRPL 1M7XA 2FJGB 1JHLL 3W11D 1J0ZA 3L6FB 4S11A 5F3BA 4GW1B 5FKPB 4P3CL 2E27L 1REIA 4LLMA 1ZGLM 3EFDL 3AS1A 3MLTA 1EXUA 2HH0L 1LP9A 1FVEB 4PJCB 1RHHB 2CO6B 2R0ZL 1KJMA 3DUHA 5C2UB 1WQVT 4GFTB 5E8PA 1U36A 1JZ2A 4GKOA 5JW5B 4PGCB 3IDYC 3D25B 3V0VA 3MCKA 5FGCE 4RISH 2F53A 3DSNA 1A21A 2JCCB 3KVQA 1E4XI 1XGQB 4Y16A 3PWPB 3V5DA 3O3DA 2VZSA 3AB0C 2IPKA 1CG9A 4P46C 2VXVH 1YEDB 4HUMB 4IS6A 3MUZ1 1C1EH 2R56H 1XZ0A 3GBNH 3QG7H 4JCLA 4HMEA 4K7PH 2P8MA 4OM0L 2DJ4A 4R7NB 3MRBA 3HI6L 1VDGA 1AR1C 3CH1B 3MLYL 3N1MC 1M71B 4ZUUB 3O3AB 2VDQL 1FFQA 4IRJD 4JFFB 5D93B 3ARDD 1DUZB 1ZGLB 4JRXB 2OL3B 1F6AA 3X13A 4OB5L 1QOKA 1U6AL 3NCBB 1BP3B 4H0HB 5H2BB 1PGRB 4NYLA 2HRPH 1EO5A 3QCVL 2F54D 1SYVA 1GXEA 1J05B 3O11B 3TCLA 1JHLH 3STBA 5TQ2L 4P3CH 3LV3B 2E27H 5I71B 2AQ3A 4BUHA 4WFHD 3EFDH 4I18A 2HH0H 5MENA 3W39B 2R0ZH 2YZ1A 4NRZA 4GW5B 2WANA 3PWNA 1DVFA 2FSEB 4KY1L 4Q7DA 4ZUTB 2D2OA 3U30C 1VFBA 2DN7A 4PJXA 2CKBL 2Q8BL 2FRGP 4ONGL 1JK8A 3ARUA 2B20A 1OAXL 3NCCB 3C6LA 4NQUA 1J1OH 4PJDA 2DI7A 3GMPB 3VRJB 3MA7B 4OM0H 4NO3B 3HI6H 4R4ND 4NQCA 3LMJL 3VRIA 3MLYH 1WT5C 4ODVH 4X7CC 3BZDA 3FKUS 4MX7A 1UKSA 4QRTB 1KYOK 5B21A 2VDQH 4HGMA 4H20L 5TGBA 4WUKL 3J7HA 5BXFB 3D39E 5L2JB 4OB5H 4RGOL 2JB6A 1KJ2B 2BMKB 4MNQD 1JJUA 1S8DA 3QCVH 3IDIA 3LEVL 4IRZL 1BZ9A 2VDPL 3QUZD 5TQ2H 3PDOA 1DANT 2Z9TA 4G8EA 4P2OA 5F7WC 3CFCL 2P7TB 4UUJB 4MQXD 1AY1H 3UC0L 5HVGB 3X11A 5JO5A 4MMXC 2E9IA 2ZUWA 2A74A 4OCWL 3EUUA 1FNAA 4KY1H 2MKLC 4MJID 1OF2A 3DGGA 3OXRB 4FZ8L 5L0QB 5JPMB 2CKBH 2EIBA 3BWAB 1UXSB 1HDMA 2CLVA 5EIVA 4LIQH 3O3EB 5HJ3A 4X6BB 4ONGH 3C2AL 1MF2L 4R0LB 5F96L 3VGBA 2ZSVB 1U8OA 4Z7QF 3BQUC 4UV7L 1NLBL 3OXSA 1R3LA 4ZYKA 4AENA 1U91B 3LMJH 4RBPH 1IEBB 1NC4D 1A02N 1RZ8B 4H20H 4WUKH 1QSFE 3G04B 2X4PB 4P5TD 2APFA 4RGOH 2PW1A 3H2WA 1VGKB 2XTJD 5BJTA 4P0DA 2YN3A 4IHOB 4M43L 3LEVH 2NY2C 4IRZH 5IB1A 1I8LA 3NCYP 2AW2A 3GUTB 5EPMB 3U0TA 1BQHA 5ID0A 3UCRA 4XI5D 1HQRA 3KNBB 1MI5E 3IETB 3X12A 4XXCC 4K3JH 4ISVB 4LVOC 3CFCH 3LKNB 3UC0H 3GSRB 3ZT6A 2RB8A 5C0BE 3L3JB 3BWUC 3NAAL 5KSAA 4ZD3H 1QPXA 4HQQL 4OCWH 1JWMB 4NKDB 3G5ZB 3NOIA 4L3CA 4P4RA 1JP5A 3B5GA 1D7FA 1WC7B 4HUNB 1L6XA 2XA3A 3QWOB 3STZA 2CR6A 2NPLX 4Z6AT 2D0GA 3C2AH 3KXFE 4TUJA 3VA6A 4C83A 4WDIB 5DZNA 1MF2H 5F96H 1J8HD 4P4KA 3SDAD 3OKKA 4UV7H 1NLBH 3CFIC 5J12C 5HSFA 1U8KA 4OFIA 4A6YL 5ID1B 1ZVYA 5DDHA 3RTQB 1MIEL 3K1KC 5ETUA 4F9LC 2VZOA 1NFDB 2FIRT 2R1XA 3GMLB 1C16B 1GZQA 2FCBA 2H8PA 4JN2B 5I1DB 2WIIA 3EOAB 4YDIL 4HS3B 1VADB 3GIZL 5C0BA 3PP3K 3BE1L 5GSVA 5IF0A 4DVBA 4NQEA 3WL9B 4RNRB 5DVNA 4H1LG 4OZGB 4ZQKB 4V1DB 5DO2C 4WHDA 5C0AB 5CEXA 4XBPB 1EMTH 4DFIA 1RIVL 3HE7D 4HUKB 2PXYB 5DJ8A 3VI4E 3PABB 5D7KD 3JWNC 4G9FD 3W0WB 4JDZB 1INEL 3KXFA 3NAAH 3C60D 3GBML 3MJ7A 1U3HD 2FATL 1MRCL 4G42B 4LMQE 4PLNC 1D6EA 2DMBA 4JY5L 5JQ6H 4J3SA 1HHJA 4DKDC 4P49A 4LSQL 4G8FB 2EIZA 1G7LA 1EUTA 3MV11 3WCYA 5DHVA 1G0XA 5E9DB 3I6LE 1E4WL 2D3VA 5LKNA 1BMGA 1AHWB 2HVKA 1N0LA 3B3IB 2OZ4H 4WWKD 4A6YH 4U6HB 1QFWL 4MQ7B 1ZA6A 1MIEH 2JK5B 1YNKL 3DVNA 1WVZA 1QBBA 2EXWD 1J9CT 4HXBL 5HYJB 3JVGC 3E6FA 2AEWA 5ESQB 3UZEA 3BZFA 1I1AC 5HHVL 4YDIH 5E24E 1E28B 1CICD 3GIZH 2FIKA 4HXAL 3BE1H 3BYTA 4MA1C 4O58L 4PGBA 4P3DA 4AG4L 1ITCA 1GPOL 1A3RL 1DN2A 1QQDA 5A3IC 2X7LB 1NL0L 1T1ZA 1MFDL 4QKXB 1U8MB 5DHYB 3MCG1 2DMKA 1RIVH 3TVMD 2R8SL 4KWUA 5C6PB 1INEH 4XP6L 3ZDYF 4I1NB 3D3VA 4NC0B 3GBMH 1EPFA 5D7IE 2FATH 1MRCH 3O41B 3LKOB 3WSQL 4P23C 5C70A 4N0FB 3DX9B 4I4WB 4LVHC 3OHXA 1E4KC 4HDIA 3ZKSD 3TO4D 1A6PA 4JY5H 1PKQB 4JJ5B 5F7UA 4BKLA 4QHKI 1NGQL 3CSGA 1IT9L 4LSQH 5DJYA 2XOTA 5D1QC 2X9XA 3HR6A 2VNCA 1KTDB 1E4WH 1JGDB 2OR9L 2VLJD 2FEDC 5H94B 2Y6SC 1CGVA 1QFWH 4X9HA 4ZSOB 3VGDA 3ZKND 4Y7MA 5GGVL 3VI3E 5I1AA 4O51B 4PGZA 4YNYB 1KG0B 4OIBA 4X6CF 4LOUC 4UT6L 4IOIA 5HHVH 5CSZA 4DKAA 3RPIA 4U1LB 4HXAH 5E6ID 4O58H 2D9QB 4XPTL 1RK0A 4U1HA 5D7IA 4AG4H 3TFKD 3AAZA 1GPOH 1A3RH 4L5FL 2B39A 4HBQA 5I73C 2HFFB 1SJEB 3OKEB 2B5IB 3L3KA 2R8SH 3TBWA 4XP6H 3MREA 1VPOL 3UPCA 4ZFOA 5GS2H 4EUPB 1CXHA 3WSQH 1OQOA 3HG1B 1FL6B 4G8GB 1HHHA 1DQQA 1MELA 3UTOA 2PTVA 1TXKA 5JW4N 3ILPA 1JI2A 1NGQH 2HT4C 1IT9H 3ARQA 4MXVF 5F7EL 1OAKL 4FQIL 5HD8D 2QKIB 3EYVB 5EU6D 4GBXB 4OI9A 4EIZC 4PB0L 4EI6A 4FQHA 2X6MA 2OR9H 1NUNB 1YZZA 3QDJB 3EOYG 4ENED 2AP2A 4WU5A 2A6IA 1YPZF 5IKCB 4I77L 5BZWB 1A6TA 4OZFG 4YFDB 3PWLA 5GGVH 3EJJX 4NSKA 5D2NB 4MGXA 2MJWA 2XN9D 4MDJA 5EO0B 2Q8AH 4UT6H 1U92B 4RRPG 3RUGA 1O7VA 1XGYL 2F19L 5C6WH 2CIIA 1CQKA 3VD7A 4EI5C 3MUGB 4XPTH 3T0EB 1QRNE 5DD0L 4L5FH 2IQAB 4JO4L 5HHOD 4PD4K 1T21B 1RZ7H 4OBRA 3BMVA 3FO2A 4OKVA 5C0FA 2VLMD 1N3NB 1OY3B 1BVKB 2VIRA 4HPOH 4YPJA 1NGWA 4KRPB 1YEEH 1IAIL 1CD9B 1VPOH 2YC1A 5TF1L 3OX8A 2EYRA 3WJJC 4I3SL 2ADJB 4YHNB 5GGUB 3O9WA 3T4YA 4WGVB 4NN7C 3QUKA 4XP5L 3AM8A 4LLVA 4PJIB 2WUCL 5C2BL 4H8WL 3HNVL 5HYFA 1OAKH 4FQIH 4YFLF 3BPCA 3H7BA 4N90D 4Y4FB 3VDBA 2DLEA 1ES0A 4PBXA 4OSUL 5CSBA 4PRBB 5DFVD 5DHVH 4TYUA 3TBTB 1CE6B 2DQJL 3CVHH 2VL5A 4I77H 5E2JA 1X5HA 3ALXA 1BFOA 2R1WB 5KANG 1FJ1B 2VC2L 1DCLA 3MBEA 1QUNA 3QIBB 2RFXA 4HUUB 2Y7QA 3FZUD 5GS0D 1EHAA 4CN4A 4HIHB 3QWRA 1XGYH 1H3GA 2F19H 3TBYB 5J6HA 1UCTA 3QNXB 3D9AL 5DD0H 4JO4H 2X2YA 3PL6D 1BF2A 3L95A 3IF1B 4Y1AA 2WWKT 1HEZA 4ZTOL 4NWUL 5DC0A 1IAIH 2A6JB 4I3SH 1M6OA 3SGJC 1N6UA 4ZFOL 3NCMA 4K3HA 3U0PA 3BFOA 1X5XA 1S9WA 1W0VB 4XP5H 2WUCH 3CU1A 3DX6B 4H8WH 1UZ8B 3G5XB 3HNVH 4KK8C 2E9BA 3F12B 2JKXA 4PJBA 1EEZB 4NO5B 4L4TA 4NFDA 3S4SA 4FTVB 4C58B 4EN3A 3EO0A 3DRQB 4M8QA 2DQJH 1MWAL 2FO4B 1CXEA 3WO4B 3KPSE 2MCG1 4JM2A 5JNYA 4YHIA 3MRJB 2GHWB 2VC2H 3IYLW 1ORSA 4L8DA 3C5ZC 1UVQB 2FWOA 4YUEH 2EDWA 1X5KA 1R5IB 2NY4B 1UWXK 1UJ3C 3D9AH 2D0HA 3PQYB 5I9QC 1X3DA 2LVEA 5MEND 3GJFB 5FA4A 1PBYA 3PUCA 1BPVA 4ZAKB 1IKNC 2F54E 5AZEL 4ZTOH 3QNYB 4NKMA 3WHE0 4ZUWB 2V5SA 1EVTC 4NWUH 3OAUL 4FQPA 4PGDA 4UNTA 4P57A 1P7QB 3AS0A 1EUUA 3NZ8B 4GG6B 4KDTA 2X4TB 1ZOXA 2M8XA 1B3JA 3BP6A 4PBVC 3MRMA 4PJ7B 4FXGA 4X4ME 3C6LD 1C7SA 3SKOB 4OZHF 4F7TA 3TEUA 2YWZA 3DARA 4NQCD 5FA3B 5E94B 4ZDHB 1HNGA 2DIBA 4X6DF 1A9BB 3H9SE 3SDCA 3DHMA 4QYOA 1WFOA 1K4CA 4HLJA 4MB5A 1MWAH 1VFOA 3O3BB 2A1WL 2ZKHL 4PJ5E 3JWDL 2NR6D 3KLDA 3T0XA 3GMQA 7FABL 1ROWA 4ODWA 3VFMA 3W82A 1U58B 4DAGL 1QKZL 4MNHA 3MOAL 5I66A 1OGAD 4BM7A 1OAQH 1P7KB 2R15A 5EIQA 1PG7X 5C07A 5JOPD 3NTCL 4P2OD 1MQ8A 4LBEB 3SDXF 4WUUB 5HI5D 4RAVA 2AEQL 2EDNA 5AZEH 4X0KB 3OAUH 4XZUB 2NXYB 1T20A 5T1KA 1BREA 4M1DL 5ITBL 4M1CC 5B3JE 4LLYB 1GVIA 2HFEB 2HTLC 1PAMA 3H9SA 2NY3B 3EYQD 3HFML 4Z76A 2BY1A 5C0EB 4HHAA 4HV8A 2X4UA 1CZ8L 1KC5L 5T3ZE 3L5XL 1JNHB 2UWEA 2WP3O 3WN5A 1MJJA 4JLRA 5D8JH 2E7HA 5DURD 1MUJA 4ZFGL 2A83A 5F1IA 2A1WH 2ZKHH 4OQTH 1RUAL 3HPJB 5DWUL 3JWDH 5DJCB 7FABH 4DAGH 1QKZH 5SX5H 4KKCC 3MOAH 1RZIA 3VFOA 1T89C 2KQMA 3TO2A 5FO8B 5MERA 5E7BA 5GGRA 4PREA 1FNHA 3NTCH 4AEHL 1DLHA 1JV5B 4S1SL 4W4OC 3BHBA 1EEYA 2XWBB 2ERJB 1IE5A 3ALPA 4OGAC 2AEQH 3IDJA 1OT2A 5KSUB 2GTWA 2ATPA 2RHEA 4DZBA 2XWTB 5CWSA 2VE6A 1U8NA 2IAMB 4OFPA 4M1DH 5ITBH 2I9LB 4QHMB 3S5LG 3S35X 4IDLA 3HFMH 4YDVA 1ZLUK 5LJYH 4OLUL 1QLFA 4ELKB 5IW3A 1T7VA 3J8F7 1KC5H 2YXFA 4WW2C 1A4KA 2EC9U 3REVB 4P4KD 3D85A 1E6OH 3RVVD 1KLUB 1UGNA 5F9JA 3R0MA 3O6FB 3UP1A 4WFGD 1Q9WB 3RL2B 4N0UB 2F5BL 4KI5C 5FKAA 3G6JB 1YY9D 1RJCA 4ZFGH 1X5AA 3V4PL 4Z8FL 4OV5B 2EE6A 1JPGB 3R8QA 1RUAH 3I02B 5EZLB 5DWUH 2P1YA 2YOCA 3AREC 4NQED 3U36A 1EGJA 2D31B 4Z7UA 4H25B 2G75A 2P8PB 2CKBB 3U4EB 1QHPA 1CXKA 1OQXA 4AEHH 4JFXB 5IVZB 4S1SH 3VXMD 4M3KB 4QHKJ 3EDDA 4Y5YB 5D7JC 2V17L 3H9HB 1FYHB 4KJPD 1A5FL 4L4JA 3FTGB 5ADPL 3OGOE 1FFPA 2NXZD 5DMJB 2P46B 2OTWA 4H1LA 2EDEA 1CYGA 5CD5D 5ERWA 5C09E 5GJSL 2IMNA 3QRGL 3VXRD 4ELME 5LGKA 4YC2C 3LY6A 4OLUH 4PY7A 1U3JA 4U3CA 1Y18B 1LE5A 4JAMA 2UVEA 4QEGA 1A7PH 3CFEA 1GGUA 2F5BH 2AAVA 4PRAB 4X4YB 1VEOA 4L3EA 2P5EB 3V4PH 5JDSB 4Z8FH 4DTGL 4N68A 4KXZH 1MFEH 2HG5B 3RZCC 4I0CC 3T2QA 5EN2A 5B39B 2A6KB 1KJVA 5DJ2A 3QDMB 1OTUC 4EDXB 3P9MB 4WI4A 4ELMA 1CTOA 2V17H 3Q6FB 1ZANL 3D3VD 1JPFB 4C55A 4X7FC 2BNQE 2DTSA 4IMKC 4QRRA 5C71A 3O45B 5GS1C 1CFTA 1JF6A 5T3ZL 3OKDB 5GJSH 3RNKB 5CFHA 3QRGH 3CIQA 5FK9B 2GYSA 3S9DB 4UV4H 5FO7A 1TZHA 2FZ3B 2VKXA 1DEDA 1FE8L 4M7ZC 1XAUA 2C3WA 3SE3C 3A0OA 3BIBX 2V5RA 4ZFFB 5DTFA 3RHWK 1RV6X 4KMQA 1AGEB 3AU1A 3CDGB 4DTGH 1T6WA 4LNRA 4UTBL 3QJFB 3MRNB 5ADOL 2JJUA 1GGIL 2XV6B 1FPTL 4LKCA 4WTXA 1IC5L 5HY9A 5ICZA 3B8SA 4W4NA 3KYOB 2BNQA 2QJDA 3O2DA 2YA0A 4GMTH 2IBZX 2KZWA 3B9EA 1KXTB 3K1DA 4LKXA 4HWZB 3ZYJA 4CVZB 3CZFA 5KTEL 5IJKC 3ZDZE 2GAZB 4MCYA 2J88L 3VWJC 1CL7I 1G9NL 1ZANH 1NEZG 1ZAGA 5DT1L 1WBZA 2NY5C 3AXLA 4X8XA 1U8HB 1II4E 2WMPA 4A6YB 1HH6B 5BW7A 2GSIB 3VGAC 3CFBA 3L3IB 4FQXC 3QDGE 3BP7A 2B7DT 2FYYB 3KPRD 5J9PB 3QFJD 3PV6B 2VLKD 1PZUB 1ZA3B 3ULUD 4DN3H 1BX2B 1XF4B 5TPWL 4QGTA 4WW1A 5KS9A 2DLFL 3FQUA 2AVGA 2OMBA 1IAOA 3VXNB 1FE8H 4ZO9A 3S3SA 1VESA 4U1GC 3ARFB 1M7DB 1OHQA 4QRPE 2AJVL 43C9B 1T1WA 5LAXA 1QFUL 5F6IC 3FRUB 1P6AB 1UACL 4PJ9B 2IANE 2C1PB 3NZHL 1FN4A 5ADOH 4JHZA 1FPTH 1IC5H 4WO4B 2AS5M 4NKIL 4BH8B 4RFEB 5ICYB 2N7BA 4NDMA 2C3VB 3M07A 3NPSC 3JTSA 3U46A 2PTTB 4NCDA 3DGGB 4U1MA 4OZFA 1J18A 4JRYD 3NIDF 4TNWF 3QDGA 1B6DA 2C3HA 2H9GA 4GKZA 1G7PB 1LP9F 2XWJB 5I75C 2J88H 1HI6A 1S7UA 4Y4KC 1E27B 1G9NH 4HW6A 3NGBC 5D6CA 5DT1H 1BBJB 3D39B 3OWEA 1JF1A 3KJ4B 3TWCL 2QSTA 3RWDA 3UXFA 1K8DA 1LK2A 3WUWA 5GGVY 4U7MA 3QQ9D 4MAYC 5EIIB 3MRGA 2ZG2A 5ESAA 5ILTL 5GGQL 2LTQC 3VMOA 2APTA 2FJHB 1BAFL 2W07A 4M4RA 1FSKC 1NDGA 3B9KC 3QUXA 1O5DT 1A2YA 3QIUC 4ODUB 4FXKB 1RUQL 3T0AA 2OI9B 2IANA 4XRCB 3FRPG 4NQDA 2DLFH 4WFEE 2UYLB 3P4MA 2QLVB 1CF8L 1FZJB 2EE2A 4JPIB 5M94B 3HZVA 2AJVH 1G7MB 3FONA 5EULV 5EWIL 2WWMD 3LQAL 1QFUH 4K94C 1YMMA 4U6XB 1WT5A 1UACH 3MBED 4P2RD 2ENYA 3NZHH 3QWRD 4N8PA 3DV6B 1MLBB 1EEQA 3UTTE 1OGTB 4NKIH 4Z77A 1JRHH 2OJEB 3REWA 1ZEAL 1G6RB 5IMKA 4R7DA 4WI5A 2DM4A 3DUUA 1CN4A 4Y1AD 5FF6A 3HE6A 3MGTA 3WLBB 3FQNB 2M2DA 1KCVL 4U3XA 1T0PB 3CX2A 5H35A 4NBYB 1U3ZA 2C4FU 4JHAH 1QSFB 5KVDH 1MFBH 2CXKA 1KPRA 3P4LA 3ZKXC 4A2LA 4Z0BL 2PYEE 5DUBA 3TWCH 2Q76B 5JHDE 3AS2A 5IIEB 4PJXF 5GRWA 1FORL 5ILTH 4NZRL 1BAFH 4Y4HD 3FFCD 1FQ9C 3WE6A 2DKUA 4JG1L 1KPUB 1BFSA 2NY7L 2X4RA 1MI5B 3QH3B 4EXPX 4KZEH 4PJDF 4HMCA 2OXGA 4MD0A 3V0WL 1CF8H 1CI5A 4J6RL 4OUUB 2C1OB 3BQUA 5EWIH 3GSQA 4NIKB 1KCLA 5IW6B 3UYOD 1WLHA 3L5IA 4H0IA 5D93C 1FVCA 5HPOA 2RQ8A 4FQQA 5C08E 4QOKA 5DJ0A 3MR9A 3KHQA 3MNZA 5IB5A 2WZPD 4EVNB 1NC2A 3L7FB 1PY9A 1ZEAH 5E5UB 3HRZA 1YJDC 5JHDA 1UXWB 2X70B 5F9DC 1NGYA 3GMMB 5I71C 2VABA 1IM9B 1KCVH 1FRGL 3DVGA 2C3GA 2YR3A 2HKHL 4JFHD 5J13B 3MV01 4MJ6A 4PJ8B 1OARL 2UY7A 2X9YA 4Z0BH 1VHPA 2MPAL 5DHVB 5J6GA 5DUPL 2ORBL 2X4SA 4NQVA 1VERA 3CVHB 4GKNB 5AYUL 1FORH 3T0BA 4NZRH 1YQ2A 5BQ7A 2FJFA 4DK3A 1FVDA 3QO1B 4G6FB 4JG1H 5KVFL 2NY7H 3M17B 4HGWB 2FX8L 3QO0B 1FZOA 3BZFB 5HYSG 4YGVA 5C08A 3S6CA 1R3IL 3V0WH 3SDCD 1I7TB 1OTTC 1YN7A 4J6RH 1MHEB 1QVOA 3TN0C 4Q9QL 3LKSA 3CSYB 2OR8A 3DI2B 3VFRB 3MRFA 5DVLA 35C8L 4G7VL 2G5BA 3U7WL 4F9LA 1Q1JH 3MRRB 1DP0A 4PRNB 1MCWW 1S3KL 4OD1L 3VWKA 5C07D 4HIEA 1PEZA 4LLWA 3S37L 4L8SB 4KKNA 4XVUC 3GRWA 4EZMA 4YXHL 3ABZA 3ECBB 3E1F1 4PRHB 3M1BA 1FO0A 1MJUH 1DJSA 4FXLA 5EBGA 1FRGH 2C26A 2HKHH 1GHFH 2V7NA 3CLFL 5GZOC 3PHQA 3VW3L 3TV3L 1DE4B 2MPAH 4PV8B 1NGXB 4ZFZA 1OAUL 2ORBH 1B4RA 4KKAC 1AXSA 4KMTL 2R1YA 5AYUH 1T4KA 2I07B 3V9FA 3N50A 5L0QC 5HDBE 4LQFL 4P5MA 3VG0L 2FX8H 5GHWL 3SPVA 3LQZB 2CDFB 4GRLB 4AMKL 5IW1A 2Z31B 1R3IH 1UENA 4LCWE 3LN5A 4R0LC 1AKJA 2ARJB 2R9HC 1Z5LB 3EIFA 3IAPA 3EDJA 4K9EH 1FFOA 3I6GB 4Q9QH 3LZFL 5DMIL 3V7MA 3MNWA 5KSVA 5JXEA 4MB4A 4HLZG 1PFCA 3EHBD 4Z5RA 35C8H 2DQDL 2FL5B 4OF3A 3P4OB 4LSRH 3U7WH 3JUYA 1HH9A 1S3KH 5EUOB 3JVGA 5CUSL 4UQ3B 3P0VL 3DO7A 1I1AA 4O2EA 4PGJA 4FQJH 3S37H 2VR5A 1SHMA 1AO7D 5IHLB 5DJZB 1MCKA 2MTPA 4YXHH 2BCKB 3WIIL 5DRWB 2EDBA 4HUXB 2WLZA 5HYQB 1VA9A 4AH2B 3KYMA 2R39A 1IGFL 5CJBA 4BQ9A 3VW3H 2G2RB 3MROA 3TV3H 3W9DB 2WINB 1OAUH 1MWAB 4KMTH 1RMFL 2WQ8A 5IG7A 1QYGL 2Z91B 1E4KA 4LQFH 1I3VA 1XR8A 3D85D 5CLTA 3VG0H 5GHWH 5L8LB 5IB2B 3BN9D 3RWHA 4AMKH 5C0IA 3ILQD 1F4HA 4YBQC 1X4XA 4HEPG 5D1QA 4B41A 4MB3A 1KLGA 5T1DL 5I1HL 3LZFH 5HGGS 5FECA 5DMIH 1SYSA 3KPPB 2ZUYA 3T09A 3GSNB 5JR1L 5I2IB 2R2BA 2O5ZL 1S9XB 2FHBA 2HN7A 2JELH 3BUYA 5DD1L 3RTQC 3VFWA 2PCPB 3P0GB 2DQDH 4R2GB 2BVQA 1FV1B 5C0DB 3IAQA 4RIRA 1NJ9A 5GS0H 3P0VH 3OX8B 2EXYD 1D5ZA 1H0DA 3F7QA 4YHLL 3D2UD 3QUYB 3VXTA 3BH8A 1WV7T 3LEXA 4JZJC 4O00A 2GIYA 4Z9KB 5I1KL 4RX4D 3WIIH 1DBKL 4XP4L 5GIRA 3S34L 3GHBL 3WLWC 4IRSA 3UTQA 3D0VB 2ILLA 4HX1A 4RDQF 1IGFH 3MRDB 3GDBA 2PXYC 2WBKA 5IHZB 1M05A 4CU6A 4U1NB 1NBYA 5E00B 4XBEL 4W6XB 5TDPB 1HKLL 1RMFH 3HS0A 3V95A 1QRNB 3HB3C 1IGTA 2EEBA 1AGFB 1QYGH 4Y5XA 1OP3K 5DRNA 3PXJA 4GKSB 5JLZA 4WHTA 3VFNB 4XPHL 3RWFB 3HUJA 3LDBB 2QV2A 2OS7A 5D7LD 4ONHB 4GRMB 2NY6B 1KB9K 3LB6C 4E42A 3DV4B 3CXDL 5I1HH 4FQ2L 4APQA 1AHWC 4L3ED 3T2OA 4Y19D 1FC1A 5JR1H 3FQXB 2O5ZH 5DD1H 5EBMB 2CK0L 4M00A 1NKRA 3HAEH 3T8XB 4NT6B 4OLWL 1CK0L 1FYTE 1E0OB 3KDMA 1OPGL 4WHYG 1X4ZA 4YHLH 3U1SL 1U8JB 3KPOA 4U2ZA 1F97A 2A73B 4EI5A 1P1ZB 3CC5A 5I1KH 2DWDA 1CD1B 4XNUL 4JDVB 3RWEB 2AV7B 1DBKH 3ZHDA 4F33B 3T0DA 2YPKA 4XP4H 1ZLVK 3S34H 4QRRD 4QO1A 1I8KA 3QXVA 4K71B 1UB6A 2Y06L 2W0FA 3IXTA 5B4MD 4POUB 3U6RB 1SMAA 4L4VE 3LS4H 4NGHH 4XBEH 3IDMB 1U95A 3G08A 3GM0A 3O0RL 3WJJA 4E41E 1EFXA 4D9RE 3OG4B 3ULUF 3VXUE 1T5XA 3KLHC 4XPHH 4L8DB 5HHPB 2FWOB 3RVUD 2BVUA 4XHQA 4NHUB 3B83A 3P40A 2GITA 5EC1B 3CXDH 4LLUA 3FCTB 3RX7A 4FQ2H 3E0GA 1WUNT 4ODHL 4P2QA 1G7IA 1MFNA 4U6YA 5L8KB 2ICEB 1T1XB 1HHIA 2NW3B 2YRZA 4FA8A 4RMRA 2CK0H 1J8KA 1W8OA 3RUGF 3PP4L 2BXZA 1CK0H 3IVKA 3VJ6A 3ZKMD 3CJJA 2B1HL 1ZHLB 5EO9A 3W2DL 2XZQH 1RJZA 1MCQA 3QXAA 3PHOB 5I1LA 1OPGH 4F37F 4QRSA 3U1SH 1KCUH 4HZLA 4XNUH 5LVEA 5I8EB 3QJHA 4J4PC 4KK5C 5CP3A 1JPST 4GW4A 4E41A 1PG7W 2RIKA 3KPSB 4K8RC 3PDDA 4LSTL 5F88A 3BP5B 2AJSL 3VXUA 3Q5TA 1S78C 2VL4A 5TDOB 2Y06H 4NBXB 2DLHA 1ZTXL 4YHPA 3VXPA 4IRJB 3O0RH 4S0TD 3FT3A 3UZQA 1GYAA 3SGJA 1NEZA 3KHOA 1QSZA 1T66D 2N7AA 1S9VB 1HKFA 3SDDD 2YD4A 3TYFA 2X1OA 2F54B 1AFVL 2V5TA 1NBQA 5DK3A 2CK2A 5DUML 3UTSD 12E8L 1K2DB 3CSBA 3CFKA 4AM0A 5GGRY 3IDUA 1INQB 3QFJE 2XA8H 3ZHKA 3C2SA 3HZYA 4KK9D 3DHJA 3DROB 1AR1D 4ODHH 5BZDB 5IHBA 5IHUL 4H5SB 4KQ3L 1R24B 3GO1L 3LKQB 4JR9H 5E4IA 4FFVD 3IJSB 3ARBB 2EKSA 2BY2A 3X3FL 3PP4H 2B1HH 1MCEA 2NY0C 2DQUL 3W2DH 3W9EB 1XGPA 1LD9A 3NIFE 1ORQB 5FB8B 3T0EC 3V6ZB 3BSZL 1ETZA 5KOMC 3TH4T 2QR0B 3OJDA 2C5DC 5FYKD 4WI3A 1FCGA 4J3TA 4PJ5B 4LSTH 1IKNA 2AJSH 5DLML 3NFNA 2C4XA 4JRYE 4KRPC 4D8PA 1I9EA 2K9UA 5DQDL 2DYPD 1G9MC 3PIQB 2DS4A 4JY6A 3QUXD 4ZO7A 3TESA 5SWQB 4WJ5A 4DVRL 1CDBA 2XQYK 2XQYG 2FECL 4XXDB 3WS3B 1OTSC 1EK3A 4NQDD 5C0CD 2R2HB 1A9EA 1XH3B 1NMAL 1AFVH 1MCBA 4PJBF 5DUMH 3G5YB 5C0GB 4JFPA 12E8H 3VFOB 4KV5F 5HI4D 3H3PL 4LLAA 4IIQA 1QZ1A 1YMMD 2AGJL 4TTDD 4HPYL 5IHUH 4KQ3H 3GO1H 4JM2F 4HJ0D 2GKIA 25C8H 2G9HB 3TLRA 3TZVC 3IB4A 2VDRL 5FOBA 1KB9J 3OR6A 3X3FH 1I7ZB 4FQLL 3VH8G 1OT1A 2NY1D 1BOGB 1QSEE 3GSOA 3HE6D 5HTSA 2X5PA 3MGOB 4YO0B 2P8LB 2H26A 3L7EA 4BZ1L 4DN4L 1FAKT 1FDLL 3P77A 4X6DB 1MEXL 4X5XB 5A16B 3FO1B 5DLMH 2R2EA 1MHHA 5ANMA 4RGNC 5ESVB 1NC4B 1QR4A 3BXNB 4DVRH 4QCIA 4P48A 2XKUA 5L2KD 2XTJB 3B6SB 1FL3A 4CDGC 5FEBA 2J8UE 1NMAH 2NZ9D 3B9DA 2HLAA 5GGTL 4YDJB 4LSDA 1FG9C 1ED3A 3BQUD 3GGWA 3H3PH 1QSEA 1CXFA 1NQBA 4DEPB 2AGJH 4HPYH 5E1AA 5FYLD 3HTLX 1JTTA 3T1WA 1NGZA 3WO4C 5IV2B 2Z4QA 3VXSE 4S2SA 5E5MB 2VDRH 4KRMB 1NC2D 4FG6C 4I3GA 1B0WA 1OSPL 1SMOA 3MO1A 1KIPA 2CDEA 3L3HB 2HT3C 3MCLL 2VKWA 4FQLH 1JCKA 2AJXH 3QEQA 4NFCA 2M1KA 2A9NL 2VXTL 3MOQA 5J06A 2NY4C 1NCNA 3IDXH 2YD7A 1K5NB 2DD8L 4KI5E 4ZODA 3QIWD 1VKXB 5HHQA 2XKSA 4UT9L 4ZAKC 5T1MA 4OGYL 4DN4H 1FDLH 1K8IB 5CP3H 5CBEB 2D7QA 1BQSA 1MEXH 2J8UA 3SDAB 32C2B 1XGUA 5LQBL 1OP5K 2IF7A 4Z7OE 3LH2L 1YDPA 2VH5L 5HGDA 1HYSC 4BSWB 1D9KC 1LDSA 4YHYC 1AGCA 2UWEF 3QPXH 1U42A 1XCQB 1L9NA 2OLDA 1YNLL 3MJ8B 3PGDA 1VCAA 2MHAA 4OLXL 5GGTH 5I1GL 4I2XE 5BOPA 3GSVB 1HILB 3ARGD 3QBTB 5C09B 1E4JA 5DS8B 3HE7B 3U0WL 5JOFB 4G9FB 4OIAA 2DWEA 4JFDE 3VWKD 1ND0B 2PYFB 3V4VL 3TIDA 1EO7A 2IADB 2O61B 2XTLA 1DLFL 4MNGA 2FBJL 4UDUA 3RNQA 4PRIA 2A9NH 2VXTH 1GOHA 5DO2D 3GB7A 5B22A 5DEFA 1A6WL 2YPLD 2DD8H 5D2LF 5IVXA 2BSRA 1IGML 4MCZA 4QNPF 3MZGB 5D7JA 4NZUL 4OGYH 5JIKA 3LD8C 3RBSA 1TJIL 4N8VB 3ARWA 4WWKB 2NCMA 5LQBH 3H7LA 2DKSA 2NXYC 3V6FB 1R5WB 3AFLA 1C12B 2X4QA 1IAKA 5CEZD 3LH2H 2WSKA 3OB0K 5B8CA 1L4IA 2Z8RA 5H8DA 1S7WB 1CICB 2VDOL 5KSBB 5FIEA 3MACH 1YNLH 2YBRB 4PRDB 4XNXL 4X9FA 3QFDB 1AKJD 2AERT 4OLXH 2D7OA 4UTAL 5I1GH 8FABA 5JXED 4JFQA 3H3BC 1RURL 1A3QA 3CGTA 2J8HA 5JW3L 3U0WH 4PJGA 2PKDA 4OZIA 1HHKB 4AT6B 3KPNB 1I1AD 1C8PA 3V4VH 5DQJA 3NACL 4Z7UF 4XC3L 1S7RA 4N9GA 5SX4H 1ZLWH 2BY3A 1RHFA 1DLFH 3RZCA 1DUYB 4KKBD 3JTTA 1C5CL 5A3ID 1HN1A 4XCYB 1A6WH 4WEUD 4G7YL 3CK0L 2V2XA 3BI9X 3QR2A 5FUOL 3AMKA 4IEFB 3SGKA 1IGMH 4CVXB 2ARWA 5DA4A 3MXWL 2ERJC 1QLRA 2AKRA 2EDKA 4NZUH 4P46B 3WNOA 4HJGB 4K2UL 5E6ZA 5JHLL 1VFAB 5DK2B 2YA2A 4S1RH 3RVWD 1U8LB 2Q7NA 4X5WA 5HPMA 2EDDA 4IMKA 3GI8L 4PJHE 5BS0E 1RUKL 5ACLA 1I1FA 2XG4A 5DEZA 3QQ4A 1IZJA 3U82B 2ZUQB 3QULA 2X9WA 5TE4L 3C9NB 2VDOH 3AROA 4XNXH 5E6IB 4OCYL 4ZNCD 1WCBB 3GNML 2P5WE 4NOBA 1HSAA 1AE6L 2BDNL 5IR1A 4UTAH 4QWWC 4G43B 2V6HA 1HINL 4U1SB 1RURH 2Y6SD 1HZHL 5DJAA 4PJAE 4I0PD 2VQ1B 4XNYL 1S7VA 4X8JA 1QR1A 5DD3H 3NACH 3BW9B 4XC3H 3PJSA 3V2AR 4J8RA 5SWSD 5E7FA 3IGAB 3OR7A 3QZWB 2D7PA 1CFQB 4M93B 5E2UL 2ESVE 4QRPB 1DQJA 1UWEL 4WV1B 4H0GA 4IRSD 2BOBA 3CK0H 5EU6B 4RA3A 5FUOH 4Y5YC 4S0SD 3MXWH 3SKMA 4BUGA 4EUPG 4NRXB 1GAFL 1EFQA 2KKQA 1EBPA 4HKXA 1CDUA 4LHUB 2ICWA 2NW2B 3ZTJG 1KTLB 5JXAL 3FO9A 4OZ4B 1IJ9A 2CDGB 1J0JA 3GI8H 3TIEA 1U8PB 1RUKH 3C09B 5EB9A 2R4RL 5JQHC 4FQXA 1KEML 5ITFA 1RAMA 5TE4H 4PJAA 4YZFE 2ITDA 1KV3A 2PO6D 4OCYH 5LG1A 3UPRA 3GNMH 3DYOA 1X7QA 1AE6H 1HOCB 2CUMA 4APQD 3I75B 3ZE1F 5F97E 1T0MA 4ZOBA 1HINH 5I76B 3RWIB 4U33A 3O6ML 1OCWL 2ESVA 2JTDA 5D1ZB 5D7LE 4HK3N 2F8XC 2E7LC 4XBGA 1D5BA 3QEUA 3GSWA 4XNYH 4MDIA 1VB9A 1ZSDA 5GXBB 4RCAA 4XTRD 4ZO6A 3MRCB 4BQ8A 5F8QC 2EYTA 2ZOLA 3AY4C 1PQZB 1UWEH 2R0WL 4TSCH 2BERA 4Z7WE 4D0DA 4U7SA 2J8OA 1CGXA 2BK8A 4Y4KA 3U9PL 1F13A 4NO2A 1H3PL 4PYGA 4HWBH 5E8EA 3UTTB 5JXAH 5GSRA 5HHMD 2AXGB 1V8HA 4TUKL 1KULA 4B7LA 3C5SB 3QI9D 1EFXD 3UJTL 4Q9RL 2ZUXA 4MAYA 2R4RH 1KEMH 3RKDC 4JREB 4I0KA 3QXUA 3B9KA 4JFEA 1D5MA 5KS9F 4I5BB 3FB5B 3T3MF 3CD4A 3QIUA 4PJCE 3F5WB 1FL5A 5DJDB 2PYEB 2YD1A 3DX8A 4P2QD 3IFPA 4RWHA 3PL6B 4HEME 2OMNA 15C8L 5GRUL 2V5YA 1N5YL 3P2TA 3O6MH 2NY2B 1CS6A 1OCWH 5C8JA 1P5UA 5KN5A 4F2MB 1CGYA 5BRZE 4WIQA 4E5XB 3MRLB 1KCRL 1EAPB 5DYOA 4WCYH 4NRYA 3IKCB 5EBWA 4EDWL 1NLDL 5GZNC 2VQUA 2FJGA 1DN0B 4Z78B 1X6LA 2R0WH 3L6FA 5J89A 3S36X 4GW1A 5FKPA 4JFFE 2NNAB 1QHOA 4JRXE 2JJTA 3U9PH 1H3PH 4PJCA 1FVEA 5INDB 1RHHA 1IARB 5D71L 3PWUB 4TUKH 3V7AE 3UJTH 4Q9RH 1NAML 2NY5L 5JW5A 3HAEB 4PGCA 4Q6IB 3D25A 4HULB 2AK1L 2JCCA 4OLZL 1XGQA 4KK8D 3PWPA 4TULH 1YEDA 3K74B 2W60B 2ZSWB 1YMHB 5FO9B 4IOFC 5FV1L 5GRUH 15C8H 2BSTB 1LWRA 3ARFC 4U1KB 1N5YH 3CLEL 1WISA 1IAMA 2KZ1B 1OM3L 4R7NA 3UPAA 1HIML 4NWTL 4KDWA 3CH1A 4ZUUA 1M71A 4PJ9C 1OW0A 2KQNA 3CDFA 1KCRH 3O3AA 1EO8H 5CIPH 4JFFA 1DUZA 1ZGLA 4WO4C 4JRXA 1E4XL 2OL3A 5DD5L 5I0ZA 3LSOB 3DETC 1NAKL 4PP2B 5H2BA 1QFHA 4ZUSB 2DQFB 4EDWH 1NLDH 3SJVE 1J05A 3O11A 1JHKL 2WAHA 1MCLA 1FG2B 3LV3A 2GFBB 4XCEB 2QHLA 2VLRD 3RL1B 1WIPA 1AI1H 5MEQB 3KJ4C 3W39A 5KAQF 2NLJB 3QDAA 5D71H 4GW5A 2FSEA 1NAMH 5E2WL 2GJ6D 3MSPA 4ZUTA 2AK1H 1J88A 2B1AL 1LO3L 2HAZA 1OGAB 4OLZH 2OI9C 3Q2CA 5AG8A 1MJ7L 2FEEI 3VA2C 3GMPA 3VRJA 3CLEH 3MA7A 1OM3H 3QNZB 1Q94B 1YYML 4NO3A 1HIMH 1MH5B 4NWTH 3WUZA 2DRUA 3LKPB 3HNTL 4QRTA 1JGLL 4K94L 4FP8L 1BWWA 1P9MC 5CGYC 5DD5H 1E4XH 5BXFA 5L2JA 4RGMB 3QYCA 4LCWB 1KJ2A 1NAKH 4JKMA 4MJ4A 2BMKA 4OCXL 3O2WL 5GRVL 4P23B 3PP3H 2QQLL 1O0VA 4KVNL 3UBXB 3WHXB 4LVHB 1AR2A 1J0YA 2HMIC 1UZ6F 3I6KB 4XWOC 5E2VH 1CVRA 4K3EL 1CGTA 5JW4Q 2DL9A 2P7TA 3FB7B 4KHTL 4ONOA 4UUJA 4MAUL 4MD5B 4ZS6C 3DYPA 1U8IB 5DURB 1UFUA 2RAMA 4U49A 2BOCB 3HI1B 1G7HB 1SYSB 1D3CA 4M62L 1GRWA 1Z0NA 1WTGT 3GJEB 2E8YA 5E2WH 2XY2A 3MPCA 3WIHL 2B1AH 3QEGH 1LO3H 3OXRA 1QTYT 1W0WB 3E2HC 5FGBC 1I4FB 3HNSL 5JPMA 2OXHA 1UQSB 3BWAA 1UXSA 4KQ4L 4F9PC 2VERN 1HXMB 3O3EA 4NM4L 3WBDA 4X6BA 3S98A 2EO1A 1H3VA 5B38B 1MJ7H 4R6UA 2K7PA 4R0LA 4PTUB 2ZSVA 3C08L 2LU7A 1YYMH 2Y25A 1U91A 4X7SL 3VGGA 3BVNB 4BK4A 2BVYA 3ZE2E 1JGLH 1IEBA 3QEQD 5CILL 2Z92B 3QISA 4K94H 1RZ8A 4FP8H 5K9OB 3G04A 2P44B 5DVKA 2X4PA 4LPTA 4ERSH 1SEQL 1VGKA 3B9VA 3U7AA 2OL3L 5TQ0L 4OCXH 4IHOA 4HK0B 3O2WH 2YUWA 3U9UB 4RMUA 4GMSL 4ZUVB 1KFAL 4K7FB 1S5IL 2QQLH 4KVNH 3GUTA 1GGCL 5DMGC 1T2JA 5EPMA 5J13C 3MV9E 2MMXA 4FS0A 5EU3B 4J3WA 3L3DB 4PJ8C 5M7QA 3IXAB 3KNBA 4P9HL 3IETA 3PDGA 4K3EH 4ISVA 1KXQE 4NQSB 1I9JL 2Z35B 3LKNA 3GSRA 4KHTH 4M02A 4MAUH 4F3FB 4Q2ZB 3L3JA 3F7VB 2Q3AA 3PGCB 3FO0L 3N06B 4PY8I 4YBHA 3SE4C 4M62H 1JWMA 2ZCKL 4OZGE 4NKDA 4D9QD 3WIHH 3G5ZA 2J6EA 2CRZA 1TZGL 3HMXL 3HNSH 1WC7A 1TZIB 4ORGB 4KQ4H 4NC2B 4XX1G 2CGRL 3QWOA 2IH1B 1JGVL 4NM4H 2MSPA 3FT4B 4HF5L 4HS8L 3VXMB 4WDIA 3O4LE 1JUFB 3RKPA 3C08H 2JB5H 1MAJA 1CLZL 1VACB 5C92A 4X7SH 3ZYZA 1QFWI 5ID1A 2ADIB 3RTQA 4Q9BA 5CILH 1NFDA 4PRID 3U83A 3GMLA 1C16A 4JN2A 3VXRB 5I1DA 3FL7A 3NA4A 3EOAA 4K07A 4YIQB 1SEQH 4HS3A 5E9DE 1VADA 4L8SC 4PIRF 2OL3H 5TQ0H 1RZKC 3QXWA 3WL9A 4RNRA 4GMSH 4H8WC 1KFAH 1S5IH 1T7WA 1CXIA 2I9TB 4OZGA 4ZQKA 4V1DA 5C0AA 3CAFA 1GGCH 2NTSP 3MRKB 1NBZB 4XBPA 4LEXL 4P9HH 1FYTB 1I9JH 3OJMB 2PXYA 3PABA 3W0WA 4JDZA 3FO0H 2J4WL 3O4LA 3OQ3B 2ZCKH 4G42A 1GGYA 1TMCB 3HMXH 5DQ9B 1OAZL 4D0CB 1S9YB 2CGRH 4GRLC 1PG7L 4B7IA 1JGVH 1PYWB 4G8FA 3N9GH 4HF5H 4TNWK 3PV7A 4L4VB 4JHWL 2HLFC 5E9DA 2HA1A 3BKML 1AHWA 3QCTL 4YBLB 3B3IA 3A67L 1CLZH 4E41B 3GKZA 2JJSC 1Q9OB 3MLUL 4U6HA 2AJYL 2VMFA 4MQ7A 2D4FA 2EYSB 2JK5A 5F7FA 2BNUB 1JHTB 1H8NA 4Z95L 5HYJA 3H3KA 5HGBB 3GMNB 4LDLB 5ESQA 3C6SB 4AL8H 1E28A 2H41A 4G9DB 2Z0BA 5K93A 2IBBA 4XHJC 4BFIB 2F5AL 3KPMB 4ZSOE 3FHQA 4HCRL 3T77B 2X7LA 1OSZB 1U8MA 4G3YL 1U93B 5DHYA 4LEXH 1PW3A 1S7QB 4DKEL 1WBYB 1MOEA 3IAGC 1CWVA 4JPVL 4LCYB 2J4WH 2MQCA 4KI1A 3O41A 3LKOA 5EO1B 5JZ7D 3HUJF 4N0FA 2BNRE 3DX9A 3P73B 1ZXQA 4I4WA 4WTWA 3OG6B 2J6EL 1OAZH 3CCHB 2LAGB 1PKQA 1GH7A 4JJ5A 4X6EB 1PG7H 2MWCA 3C5ZB 4POZC 2P42B 4I9WE 1JZ6A 1KTDA 1UJ3B 3BKMH 1JGDA 3QCTH 2CLZB 3A67H 5H94A 3MLUH 4ZSOA 4R2GC 1MCJA 4ZXBD 1R6VA 4Z95H 1MLCB 4O51A 3EYOB 4YNYA 3UJJL 1KG0A 3KPRB 3S35L 3QFJB 3NCEB 2VLKB 3QUYC 3RQ3A 4U1LA 3VGFA 2F5AH 4HCRH 8CGTA 3VFPB 4J4PA 2DQEL 1SJEA 2HFFA 3NPZB 3OKEA 4G3YH 1QSVA 2XACC 4C56D 5EOCJ 4PB9L 1T2XA 4DKEH 2K3TA 4LCIL 2OSLB 4ORZC 4JPVH 3ET9F 3T0EE 4JZNB 4EUPA 2W65B 1MPAL 3JWDC 3HG1A 1FL6A 4G8GA 3RWJB 1RUMH 3LDBC 3UTPD 2NY6C 4JRYB 4PTTB 5FUCC 2QKIA 3EYVA 3SY0B 4ODXB 4GBXA 5IM7B 5CZVL 1KJ3L 4HG4K 3QDJA 4BSVB 4JN1L 4Y8AA 5IKCA 5BZWA 1FAIL 5D2NA 3A6CH 3UJJH 4OI7A 5EO0A 1U92A 3P0YH 4M6AA 2B4CL 4WI9A 4U1JB 1KEGL 3MUGA 1G7JB 1MY7A 1F2QA 3T0EA 4Y4KD 2IQAA 3ETBF 3BIAX 1UWXH 1T21A 5HGAB 4HH9B 4QHNB 4OF8A 2WBWB 2HTKD 1RUPL 1FGNL 4UIKH 4EEEA 1N3NA 4PB9H 4K71C 1BVKA 5IBLC 3F62A 1V3KA 4MAYD 5DJXB 4LCIH 5KBNC 5ICXB 3WS6C 2Q1EA 2BVOB 4P2RB 1W72L 4JFED 3B9KD 5BVJB 2ADJA 1FFNB 4YHNA 5GGUA 5A2FA 1P4BL 2QQKL 4LRIC 5IK3B 4X4XB 3VE0B 1TQBB 2COQA 1KIPB 4PJIA 1L7IL 1GOGA 5FHBL 3BKYH 3W11C 5MEOB 4HIIB 1CR9L 1QPPA 3ULSB 1AGDB 4RGNE 5FM5O 5DA0B 5CZVH 3LEYL 1AJ7L 4KJWD 4PRBA 3WFCL 4DUWA 3C8KB 5F21B 4LPYA 3TBTA 1CE6A 4JN1H 3ZMRA 3BGFC 1FAIH 3ZDXE 3FB6B 3MMEB 3IJYB 2R1WA 4R4FL 1FJ1A 2FLRT 3QIBA 4Y4HB 4XAKE 3FFCB 3PWJB 4HUUA 1R5VB 4HIHA 1MVUB 3MV7D 2B4CH 3TBYA 3KLSA 3QNXA 4EQ3A 5T3XE 4LGSB 3VXSB 4R90L 1JN6B 3IF1A 1NUGA 1RUPH 1Y6KR 5F7DB 4M61B 1CFVL 4WW2B 3BAEH 4K8RL 3ULVD 5CEZH 3EO1B 4TVPE 1CLYL 5JPNB 2A6JA 3LPGA 4IRJC 1W72H 2XG5A 4Y5VB 5LWYL 1P4BH 2QQKH 1UEYA 2XXMB 2FB4L 1W0VA 5FHBH 1L7IH 3OTTA 1OP9A 3DX6A 3AREB 1CR9H 1UZ8A 3G5XA 3NIGE 4PG9B 4GG8B 3F12A 3D0LB 1V5JA 1EEZA 4NO5A 4BFBD 2YUXA 3CX5J 3LEYH 4FTVA 3TH2T 1AJ7H 2VZVA 3FQWB 3WFCH 3DRQA 1NCWL 1W2KT 1Z3GL 2AK4D 2C7UB 3P4NB 4LHJB 2FO4A 3MLWH 4KZDL 1ERNA 4GRWH 5J1SC 3SBWC 4IJ3B 4FFWD 3MRJA 4R4FH 5K59F 3MV8E 4I2XB 1UVQA 5J11B 2CMRH 3PGFL 1R5IA 4N0RA 3QHZL 3ME0A 1KIRB 3Q0HA 2A9MH 4LSUL 4YC2B 1Q0YL 5MI0B 2EH7L 1L7TL 4JFDB 3GJFA 5KW9L 4R90H 4R4BB 2X05A 3QXDB 4ZAKA 1RZGB 4ZOAA 1CFVH 3VFUB 3QNYA 4R4NC 1F3JB 4ONFL 4ZUWA 4K8RH 1KT2B 1CLYH 5IQ7L 1P7QA 2VLRE 1DFBH 4NBZB 1G9ML 5FOJA 3NZ8A 5DD6B 4GG6A 5LWYH 2X4TA 3AC0A 2JJWA 4QT5B 2FB4H 4PJ7A 2L7JA 1ZLUH 3QUZC 3SKOA 3BO8B 1ODAA 3ARVA 2ID5A 4O5LL 4NPYB 5FA3A 5E94A 3BT2L 4ZDHA 1CDJA 1NSNL 1A9BA 4RDQG 4OI8A 4LGRB 4JVWA 3W5NA 1NCWH 1N59B 3H8NA 1UCBL 3SQOL 1Z3GH 4YR6B 1N5AB 3O3BA 1P6FA 2FX9L 4KZDH 5AYQA 1P5VA 1MREL 1JPTL 4XNZC 5K9QG 4PY8J 4HG4J 5GS1B 1O7SA 4KJQD 2CR3A 3MZTA 1P7KA 2DQHL 3PGFH 3G6AB 5I1JL 3QHZH 4HKZB 3VDCA 3LRHA 3VD9A 1WK0A 4LSUH 4GOSA 1Q0YH 2OR7A 2EH7H 2J8UF 3SCMB 4LBEA 4WUUA 5KW9H 2N4IA 1F90L 4QHLB 2F15A 5HGHB 2EECA 4OKDA 4ONFH 4X0KA 1WTLA 2IJ0C 4XZUA 2BP3A 2V5MA 1F3DJ 5IQ7H 4NQTA 1UJTA 4LLYA 2HFEA 2L0DA 5CIPB 4P5TC 2XTJC 5I1EL 1J12A 5C0EA 3RDTB 3MXVH 1AO7B 2DIJA 2R9HD 2Y72A 1R0AL 1JNHA 1RU9L 4JQXA 3NCJL 4O5LH 4MA7L 3V6OA 4PJHB 4DEPC 5BS0B 4X6FB 2UZIL 3BT2H 1NSNH 4YJZL 4QXTB 3MJ9L 1FNEB 2YZ8A 3SQOH 4OLEA 2I60L 3VWJB 2FX9H 3WJLC 2UZXB 1MREH 5T3XL 1JPTH 3E3QC 2P5WB 3HPJA 5D9SB 1NAMB 1JTOA 2Q86B 2LQRA 5DJCA 5IVXF 4JO3H 2DQHH 5FO8A 4OFYD 5CJ8A 4LLQB 2W1NA 4N0UE 5I1JH 3KYNB 1X5LA 1QA9B 1T3FB 3GI9L 4TVPL 1EHLL 4MA8L 1JV5A 4M7LL 1LO0L 1G7QB 2XWBA 3SDAC 1F90H 1BWMA 1FNSL 5KSUA 3HMWL 3DPBA 1EVUA 2Y9RT 3TBVB 2BXYA 3OSKA 4UOW1 2KPNA 2XWTA 3TT1H 4JFYB 2VDLL 3VD3A 2I9LA 4LIQE 3X3GL 3NBNA 4QHMA 5I1EH 2NX5E 4ELKA 2Q6WB 4F37K 3D2UB 4YBQD 2VXQL 2KDGA 1R0AH 3REVA 1RU9H 1KLUA 3NCJH 3O6FA 4MA7H 4PJGF 2CD0A 4OZIF 2UZIH 4Y2DD 1X4YA 3HE7C 1P84K 1Q9WA 2NTFB 3RL2A 4N0UA 3MJ9H 2GQHA 5T33L 1R3HB 3G6JA 3NCFB 1UKTA 5I75B 3C60C 2I60H 3F65A 2YMXL 1BFTA 1U3HC 4OV5A 1JPGA 4AZ8A 3NGBB 1R3JB 5T3XH 3RAJL 2CRIA 3I02A 4RQQB 5EZLA 2ZZUT 1I9IL 1ONQB 1PZ5B 2D31A 3CVIH 3SDYL 1B88A 2R2CA 4V1DD 3DMMD 4H25A 3EW3B 3P30H 4M9PA 2P8PA 3TH3T 2CKBA 2LTQB 5J1AB 3U4EA 1FSKB 3GI9H 5D7LB 4TVPH 1EHLH 2DKMA 4MA8H 1OB1B 2EICA 2ZCHL 2DB8A 4JFXA 2VJXA 5IVZA 2PXYD 4Y5YA 1LO0H 3W0WD 2ZUTA 3H9HA 3VXOB 1LILA 1BFVL 3I85A 3FTGA 4Y19B 1FNSH 4L8BB 4WWKC 3HMWH 3VGEA 3BJLA 4R97C 2EXWC 2VDLH 4OF6A 1H5BB 1V3LA 2Y5TB 4ZOCA 2YK1L 3X3GH 4Z7WB 4MS8C 1CICC 1QACA 4JO1L 3EFFB 1S7XB 5IB4B 1UM6H 3QCUL 1Y18A 2VXQH 4KPHH 3DOSA 2W38A 1KCSL 1L0YA 4HFUL 3GSUB 4G5ZL 4OF5A 1NUFA 2EDXA 1YY8B 2GW5A 2VN7A 3TVMC 2WV3A 3R06B 3EYUL 3Q6GL 5LBSL 5T33H 5HYJD 4PRAA 4X4YA 2P5EA 5JDSA 5F7YC 3WNPA 2YMXH 4MXQD 4KGJA 3RAJH 3ZKXB 2EDRA 2HG5A 4ALAL 5CGTA 2EDOA 5EH1A 4JCMA 2GSGB 1ULVA 3TO4C 1I9IH 3SDYH 3MLSH 4NN6B 5B39A 2A6KA 1P4LB 3QDMA 4EDXA 3P9MA 5BRZB 3S4SG 2O26U 2ZCHH 4HUWB 3FQTB 1CDGA 5I8OL 3K46A 4BFEA 3RP1A 3Q6FA 1BFVH 2AV1B 3T2PA 1JPFA 1J1OL 4HJJH 1CLCA 4FHBD 3ZKNC 3O45A 4RMSA 4LSSL 3LPWA 4KGLA 3WNMA 3OKDA 4PJAF 1DDHB 3RNKA 2YK1H 5KG9B 2ZUQC 4ODVL 2IGFL 5ENWB 4YHZL 3TA3D 3KLHD 1LO2L 5FK9A 4JO1H 2B2XL 2WBJD 5E6IC 3RI5K 2DBLH 1DQTA 4X7TB 3QCUH 3PE9A 1N8ZB 1VGEH 3TFKC 2FZ3A 4WTZA 3S97C 1KCSH 1BZ7B 4BA8A 4HFUH 4G5ZH 3O6LL 3AUVA 4ZFFA 4OF0A 1PSKL 3EYUH 2W9EL 3Q6GH 5LBSH 4NNYB 1G0DA 1AGEA 3CDGA 1AY1L 4JANB 3QJFA 2Z8SA 3MRNA 5INCB 4ALAH 3VCLB 3KYOA 1FIGL 3LRSB 2VOTA 4G80B 4M93C 3SDDB 2WW8A 4J4PD 4KK5D 4WV1C 5HD8C 3UTSB 1HQ4B 4YZFF 4CVZA 4HWZA 4N0YL 3MLXL 2GAZA 4LIQL 4PJFB 1NFIB 4U4BA 5T1LB 5I8OH 4K9EC 3O4OC 3G6DL 4KTYA 1JTPA 3RWGB 4ENEC 2CQVA 1AD9B 1U8HA 5FM8A 4MJ5B 2OZ4A 4A6YA 3ORJA 4LSSH 3TN0B 4PPTA 1HH6A 3C09C 2GSIA 3SJVB 3HG1D 3L3IA 4G8GD 3QA3B 4C56E 1A8JH 2FYYA 2GJZB 2IGFH 4YHZH 5DZLA 5J9PA 4LCUB 3O3UN 1LO2H 2OK0L 2H3NB 3PV6A 4X7DC 1ZA3A 2B2XH 4GBXD 4TUOB 2DICA 1BX2A 1CT8B 1XF4A 4TQEL 2XKNB 5KJRL 1BD2D 2NYYD 1WZKA 5D5MB 4FABL 4GAYB 1CL7L 3VXNA 4W68A 3QDJD 1QP1A 3O6LH 3TF7C 4DK6A 2BRQA 3ARFA 1M7DA 5JIPA 43C9A 1PSKH 5D1ZC 2W9EH 3T2NH 1IC7H 2O5XL 3FRUA 2DYPB 5AUMB 4PJ9A 4K3JL 4OT1L 4M4PA 4PFEA 2C1PA 1RJLB 3SE8L 3BDBA 4C4KT 4WO4A 4XP9H 3RPKA 4BH8A 4RFEA 3DBXB 4LLDB 4ZD3L 4M6NL 5ICYA 3G5VB 2C3VA 1FIGH 1E6JL 5C0CB 3A6OA 1YEKL 3VRLF 5DSCB 3BEWB 2PTTA 4P3WA 3AMLA 4J1UB 1G7PA 4PJCF 2OQJB 4N0YH 3MLXH 4WVRA 2R4SL 2XWJA 2YUZA 1E27A 3I9GL 4R9HA 5DFVC 3NN8B 2P49B 3G6DH 1BBJA 3M8OL 3D39A 3JBG7 4Y0GA 1JYXA 2GY7B 3ULVF 3RZWA 1FLRH 1SBBA 5EIIA 1EA9C 2JCCF 2F74B 2OTUB 4QHUB 5JTWA 4JREC 1Q9LB 2FJHA 3FZUC 5GS0C 2OK0H 2VN4A 3DVIA 4ODUA 4FXKA 3C5JB 4Y4FD 4TQEH 4XRCA 2GJJA 4WU7B 5KJRH 1NANI 2UYLA 4FABH 1CL7H 3PL6C 1ADQL 1FZJA 4KROD 4JPIA 5C9KA 2GK2A 1G1YA 1RPQA 1G7MA 3LN4B 3BPOC 1EMTL 4U6XA 2YUVA 4LASL 1X5IA 2O5XH 5D72H 1W0YT 3QIBD 4OT1H 3SE8H 3DV6A 1P9MA 1MLBA 4X98B 1OGTA 5L2KB 2OJEA 3EZ8A 4M6NH 2VISB 1E6JH 1YEKH 1G6RA 2QADD 2DTML 1UKQA 4LCCB 1K3ZA 3WLBA 3FQNA 2YN5A 2ED7A 1CGWA 3C8DA 5JQ6L 2WWKO 4B53A 4AK1A 2R4SH 2FLBT 4DCQB 3I9GH 4IMLB 1C5DB 3RGVD 3ARPA 1QSFA 3M8OH 4XP1L 4YHML 4GJTB 3LRGA 2Q76A 4JQIL 1G9EA 4Q6IC 3DTXB 4DUVA 2OZ4L 5IIEA 5DC4B 3BPNB 1KGCD 3L3OB 4MHHI 5HXMA 4ZPTB 1KPUA 3MV9B 4MA3B 4Z7QE 5FGBA 1MI5A 3QH3A 1XIWD 4AYFA 1U3YA 4FTVD 4GQPH 4OTXL 3DSFL 3QIWB 1ADQH 4OUUA 4JZJB 2C1OA 2DI8A 2J1KA 1QFOA 2F8VA 4LASH 5IW6A 5FYJE 3GIVB 1RIUH 4EIGB 3OF6A 5ACMA 4EVNA 1UH2A 3DUSB 1AIFA 3L7FA 3O4LB 2AK4E 3PQYD 5CP7B 2ATKB 3C6LC 2DTMH 1UXWA 4Z7VF 1FZKB 2X70A 3ZSSA 4ZAKD 3GMMA 3QRFM 3Q5YA 1IM9A 5AD0B 3ARGB 5KANI 5FFLA 4O2CB 4PJ8A 2IEPA 2YD5A 5FM5M 4XP1H 4RMWA 2VRAA 4YHMH 4JQIH 3EGSB 3CVHA 4EQ2A 4AEEA 3SE4A 4PRHE 4GKNA 3Q1SL 2NR6C 5EG6C 1G1CA 1AC6A 3QO1A 3M17A 4HGWA 4OCMC 5F1NB 5TH2B 4A2MA 3QO0A 2YPLB 3OKMB 2ITCB 4OTXH 3DSFH 5HI5C 5I8CB 4G8IB 2DQCH 1I7TA 1T22B 1MHEA 1KYOJ 5EFIB 3CSYA 5I6XB 1MY5A 3VFRA 1CLOL 5E0QA 4OCRL 1XF5B 3MRRA 2Y1VA 4PRNA 5J4MA 5E99L 1W72B 2YSSB 4RGMC 3NFSL 2EEDA 3ARZA 4L8SA 3ZT7A 3TPKA 3G9VA 4NQXB 2IBZY 4N8VG 4S10A 4YGAB 3KPQB 3ECBA 4ZTPL 4PRHA 1G6RL 2HRLA 5FUZL 1BIHA 1QBAA 2IQ9L 5JORB 5EUOE 2XNAB 4L9LB 3LPFA 1DE4A 4PP1D 4PV8A 4U0RB 1NGXA 1A1OB 3WXWL 4F7MB 2NY3D 4CL7A 4PRPE 4GRWB 4Z0XB 4Q74A 3Q1SH 3VFSB 5ISZD 2I07A 3HZMB 1CIUA 4UQ2B 3DXAD 3LQZA 2CDFA 2Q8AL 5C0JB 4KK6D 4GRLA 4DUXA 2Z31A 3FFDB 4OLYL 1XR9B 2ARJA 1Z5LA 3I6GA 1KIQB 1NFDF 1RZ7L 2BNRB 3O8XB 1IM3B 1CLOH 1TJGL 2JJSA 4OCRH 3MUY1 2D0FA 2FL5A 1ACZA 3P4OA 1KENH 4HPOL 5E99H 5EUOA 2HVJB 1YEEL 1ZT7B 3NFSH 4UQ3A 5D1XD 5EUKB 4OZGF 2CRMA 5GQBA 1A7OL 5DJZA 3S5LB 2BCKA 4ZTPH 4BZYA 4PLJD 1G6RH 5DRWA 5FUZH 3RVVC 4HUXA 3ZDYE 2IQ9H 1F4AA 5HYQA 2YD8A 4AH2A 2XZZA 4FN0A 3TNMB 2IAMD 2G2RA 4J23A 3CMOL 4I0PB 3W9DA 2WINA 2PTUA 3WXWH 1WCQA 1MWAA 1MCOH 3OMZA 5EOTB 1I8IB 3SKJL 3CVHL 2V2TB 3VFGL 5SWSB 2V2WB 4BQBA 2Z91A 1FZMB 1EZVX 5LCVL 2EO9A 1PDKA 5IB2A 3O6FD 2NY0B 1FGVL 2H6PB 2MCPL 5FYJL 4OLYH 1MIML 4KJPC 4MQSB 5EZJB 3WUWG 3KPPA 5DGRA 3GSNA 5I2IA 4TSAL 3UYRL 4HS6B 3QZWG 1S9XA 4BZ2H 4Z7NE 1TJGH 4MHHG 2QQNL 5SWZE 2PCPA 5CD5C 1ZHBB 1FV1A 5C0DA 4XPGH 5CS7A 5FUCE 4HC1A 4NCC2 1A1MB 4DGYH 1QFPA 2P24B 3S88L 3RWCB 3QUYA 1A7OH 4LHUG 2PO6B 3BMWA 5C1MB 1RZKL 4KJYB 1B6UA 2GUOB 3D0VA 3GZKA 4R3SB 3MRDA 5E8NB 2VXSL 5A2IH 5IHZA 4LARL 5F9AC 4YDKL 4UNVA 4OFKA 1XF3B 5IOPB 4OFDA 2FR4B 3CMOH 4U1NA 5E00A 3IFNL 4PV9B 1V05A 1QLEL 5TDPA 3VMPA 3QEHB 4WFFD 4MXVE 5MHSE 3SKJH 4OQTA 1Q72L 2BC4B 4M8VA 1QRNA 3H6JA 3VFGH 1AGFA 3TZVB 4GKSA 3VFNA 5LCVH 3KYKH 3RWFA 4YUEL 4ONHA 4GRMA 1FGVH 2MCPH 5FYJH 4LL9A 1MIMH 5CBAB 3DV4A 5BV7L 3KWWB 2OJZL 1JWUB 1EV2E 5CGMA 2P5ED 4LAQL 4YBLC 4TSAH 3UYRH 3FQXA 1A22B 5KAQG 2QQNH 5EBMA 1HCVA 3HA0A 1GGTA 3QI9B 5D4QA 3T8XA 4NT6A 1ZWIB 3GMOB 4R8WH 2DQIL 3O2VL 2X10A 1EX0A 2F53D 3QDMD 4P5KB 5DI8B 4RGNB 3S88H 1U8JA 4Y16D 3SEPA 1Z2KA 2A73A 4MJ2A 1GIGL 1P1ZA 1CD1A 4JDVA 3RWEA 5M95B 1RZKH 2AV7A 4F33A 3TM6A 4YHOL 3ROLB 4F15B 3K8MA 5I1IL 2VXSH 1OVZA 3E6HB 4LARH 4YDKH 3HCVB 1I3RB 5F3HB 3U6RA 2A2QT 5F93C 3IFNH 2M26A 3IDMA 1QLEH 3WS6A 4C54A 1Q72H 3STLB 4BQCA 3HC4H 3SHSA 4X80L 4LRIA 2HFGL 4PJEB 2ZWLT 4L8CB 5HHPA 1CFSB 1OAQL 4NHUA 2JJVA 1IL1B 3DRTB 5EC1A 5BV7H 3FCTA 2OJZH 3IS1X 3KJ6H 2A0LD 3OKOB 4LAQH 2A6DB 2P4AB 4K7PY 4KUZH 1A47A 3CSPA 2ICEA 1T1XA 2NW3A 4LP4A 3GSNL 1XMWA 1DVFD 4XMKL 5F7LB 1A6AB 2DQIH 3O2VH 1ZHLA 3EDFA 5GZND 5HHNB 3UEZA 3PHOA 4WFHE 3ULUC 4HC1L 4OQ1A 1LHZA 1GIGH 1D9KB 4YHYB 3BEVB 3X14B 5BMFL 5I8EA 2CJUL 4PR5B 3KPSA 4YHOH 3HAEG 4OIIL 2HT2D 2IH3B 3BP5A 5I1IH 3F7YB 3D48R 1Z9LA 1AXIB 3MV8B 5TDOA 5D8JL 3MRQB 5JUEL 5DVOA 4MXWL 2C3XA 4IRJA 4JZOB 4PJIF 5IBTH 2FECI 2EZ0C 4Z18A 4XVSL 1Q38A 3MYJB 4OQTL 1S9VA 3MBXH 4FRWA 4X80H 4XCNB 2HFGH 5CEYB 2YXMA 1AP2B 2F54A 4NZJA 2ZG3A 2W59A 1K2DA 1ZT4B 1EAJA 1TDQA 1INQA 5J3HD 5IFJA 2VLRB 3DIFB 2I25N 2CLRB 2GK0B 3DROA 5BZDA 1RJYB 4H5SA 3UX9B 1R24A 3LKQA 1B0GB 1AC0A 4MNQE 2HWZL 3IJSA 3GSNH 3ARBA 3BH9B 4WO4D 1A7BA 4X4MA 1OLZA 3LD8B 4XMKH 2I26N 3AM8C 2GJ6B 4B0MM 2DJUA 4P9ML 4PD4J 3W9EA 4HC1H 4BJLA 5IMOB 4L9DA 1ORQA 5FB8A 1I8MB 3V6ZA 5BMFH 2QR0A 1DEEB 3D39D 2CJUH 4N0CD 5IUSA 2YEZB 4OIIH 3LKRB 4PJ5A 3OB8A 4MJIE 1E6OL 4L29B 4K55A 4HH8A 1B2WL 5F1OB 3WIFB 3V5HB 3MRHB 3PIQA 4M7JL 3ROOB 5JUEH 2AI0L 1OP5H 4MXWH 4CW1B 4OZHE 4WNQB 5SWQA 4ZG1A 3B2UD 5IMMB 4XXDA 4XVSH 3WS3A 3ZDXF 1TQBC 2ZUUA 5J1TC 2R2HA 4X6DE 1H15B 3KGRA 3KPLB 1XH3A 3I50L 4JKKA 4X9GA 1KSRA 4NHCH 3BGAA 3G5YA 4JPKH 5C0GA 5A2KH 1H8SA 4HKBB 3U4BH 2BVEA 7CGTA 2XTJE 4NJAL 4X83A 5CMAB 2HWZH 2G9HA 4C59B 5KSAD 4UINL 1I7ZA 4Y4HC 1YEFH 3SDXE 1BOGA 4P9MH 1AD0B 3K8KA 5CD3B 3JSSA 3LHPL 3MRPB 2HMID 4XWOD 3ESVF 3MGOA 4YAQB 4YO0A 1QSFD 1FLTX 2P8LA 5IJVB 1LO5B 2OCFD 3E3QE 4X6DA 4X5XA 3QPQD 4XVTL 3EOBB 3FO1A 5A16A 1B2WH 2XFXB 1QEWB 1A7PL 4GG6F 4XB8A 4M7JH 3MYZA 5ESVA 2AI0H 1JZ4A 1NC4A 3BXNA 4PJ7F 5B38G 4Y5VC 1MI5D 4QLRA 1N2RB 3OB0H 1IGYB 3L5JA 3B6SA 1F8TL 1MFEL 1J8HE 4NZTL 5C0BD 3I50H 5SV4A 2K7QA 3S36L 4YDJA 4UAOB 3U2SB 4UIMB 1TENA 1DANU 2FHCA 3BPLB 4NJAH 1J87A 2J2ZA 2PETA 2CUIA 2NX5B 5D6DC 1JL8A 5IV2A 4QTHB 3KXFD 5E5MA 3OF6D 4IJ3C 4UINH 3WJLA 5IEHB 3L3HA 4JFZL 5IBUB 1UH4A 1XCTB 1U8QB 4PLKD 5J11C 3EOTL 2LABA 2X09A 3RA7L 1JMZA 1IM9D 3LHPH 5D7KE 4G9FE 1K5NA 5MI0C 3SDCC 1VKXA 4UV4L 5HYSB 1RD6A 5KZCD 1K8IA 5CBEA 1WEJL 3SDAA 32C2A 4XVTH 4Y2OA 1AXTL 5DVMA 3ISWA 2D9CA 4TOYL 5HVWA 4BSWA 1MRDH 1F8TH 3MJ8A 1XCQA 4H26B 4NZTH 5CJ5A 1NCCL 3QAZC 1D6VL 2XT1B 3S36H 4L1DA 2GCYB 5D96B 3GSVA 1HILA 4GMTL 5C09A 1OWRM 5DS8A 3FHAA 3HE7A 1LO4L 4MWFB 4I48B 4NCC1 3NH7L 5JOFA 4G9FA 4NNXB 1A7RL 5KSBE 1JWSB 1WITA 1ND0A 1Z6JT 5MEPB 3V79C 2PYFA 4JFZH 2BVTA 3I6LD 4URTB 2ICCA 2VO5A 3HR5B 2IADA 2O61A 2CH8A 3EOTH 3RA7H 4CBPA 4JKPL 3OGCB 4CADB 4IM8A 4HT1L 3K81A 3SCMC 3HZKB 4DN3L 2EE3A 4X7EC 1S5HB 1WEJH 1GZPB 4N8VA 1AXTH 2AJUL 4WWKA 3EHBC 3VFVA 3V6FA 1R5WA 5ACZB 2R0LL 1C12A 1I7RB 4V2BA 4TOYH 1IEAB 2DDQL 1KB5B 2G5RA 1S7WA 3RDTC 1F2XK 4GRLD 1CICA 2Z31D 5KSBA 5CJXC 2YBRA 4PRDA 1NCCH 4D0BB 2D4DA 3QFDA 5A2JH 2VLJE 4NO0B 3F7PC 1A7NL 1D6VH 5ISZE 4FNLL 3BGMB 3BRGC 3G6JF 3DXAE 3IRZA 3D18B 1LO4H 3NH7H 1A7RH 4FOMA 1HHKA 2XI9A 3KPNA 4AT6A 2ZCLL 1BOYA 4KC3B 3UAJD 4LU5L 3S96B 1F4YL 1BQUA 3BIKB 4XHJD 1DUYA 4JKPH 4XCYA 2QL1A 2EDHA 4HT1H 3SO5A 3ILQC 4F7PB 4CVXA 1F5WA 3BD5A 1DBBL 4P46A 3JV0A 4HJGA 1ACYH 1KTKE 4RAUB 1VFAA 2X4OB 5DK2A 2AJUH 1WAAE 3CXHK 5EA0L 1U8LA 5F1SA 3VXQB 1GOFA 5CKAA 4ZXBB 2R0LH 4GXVL 4I13B 5EBLB 1B0RB 2DDQH 1SJHB 5EU6E 4AIZB 2EXYC 5FXCH 1OD9A 3C9NA 4XGZB 5DFTA 1HXYB 5E6IA 1WCBA 1A7NH 4GS7C 4S1DD 5EDXA 1JRHL 1A1NB 4FNLH 4G43A 4U1SA 4C56B 2XN9E 5CZXD 3WEXB 3V8OA 2YPVL 5E4EC 2VQ1A 2ZCLH 4JFOB 4JHAL 5KVDL 1MFBL 1T7ZA 4BYHA 4LU5H 3BW9A 5HHOE 1F4YH 3O9WD 3IGAA 1WAAA 3QZWA 1CFQA 2VLME 4PGEA 4QRPA 5HYIA 3ZL4L 4WV1A 3I84A 5HDLA 4UU9B 2H2PD 5EU6A 1KIUA 2JF1A 4KZEL 2BVPB 1DBBH 4WRLA 4DFHA 4NRXA 1CBVL 4LHUA 2NW2A 1KTLA 4OZ4A 5EA0H 2CDGA 1QRND 4GXVH 1H5BC 1U8PA 3LS5L 3K7UA 2DQGL 4N90E 3HC0B 2VXUL 1RIHL 3RIFF 3WV0A 4CMHB 1MCFA 4WFFE 4U3HA 1HOCA 1VFMA 3I75A 4R96B 1FHGA 4QRUB 5I76A 3M45A 3RWIA 1EBAA 3V8CA 3EDKA 5JW4M 4G6AC 2DJSA 2YPVH 4OAWA 5D1ZA 5B4MC 4J12A 3WNNA 4XNQB 4YQXL 4GUPB 3WFHB 1KTRL 4P99A 4F57L 4F8QA 3VGHA 3MRCA 3MLZL 1LP9E 2GTZB 2IALB 4MSWB 2WNGA 4O02H 4NN6C 1LDPL 1T7YA 4XMLL 1PQZA 1JZ5A 3ZL4H 5IB3B 3RVUC 2PW2B 3E2HB 3RY4A 1NEUA 4L4TD 1CTNA 2QBWA 4EN3D 6FABL 1CBVH 5GGSY 3UTTA 4X99B 4D94A 4WEBL 2AXGA 4OD3L 3UJIL 2ICWI 3C5SA 3LS5H 1J5OL 3IS0X 4JM2D 3TPUB 4MQTB 3MX0A 2DQGH 2VDNH 3GM8A 1Q1JL 1RK1B 2VXUH 1RIHH 3FB5A 4I5BA 3MV7B 1T2QH 2GT9B 3BN3B 3F5WA 4OD2A 1MFAL 5DJDA 1AIFB 2PYEA 1IVLA 1QO3B 5K9KB 3PL6A 4NM8H 1BLNB 4GSDL 1BJMA 1MJUL 4HKJB 4P9HC 5BW7C 3Q3GB 4F2MA 3MFGB 1GHFL 4E5XA 4JKLA 3MRLA 4YQXH 2R23B 1CCZA 4XXCA 1EAPA 1JPSL 4HD9A 5CINL 4F57H 1T66C 5IP4A 1YN6B 3MLZH 4YLQT 3LQMA 5E8OB 5MENE 4LVEA 2BSSB 2ZOKB 3SKUD