4M93C

Unliganded 2 crystal structure of s25-26 fab
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-26 Fab (IgG1k) light chain
total genus 49
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93C01
2VDKL 4YK4C 2XWTA 1J1XL 4JDVA 4QCIA 3F12A 3MRBA 2R9HD 1T04A 2Z8RA 1BVKB 5IB3B 3EO1A 4OZHA 3T4AA 5IBUG 1JHLH 3FO0L 3OJDB 2FH6A 4DFHA 3V6FA 4IRJD 2JJTA 2O26U 4Y0GA 3ULVF 1FCGA 1WBXB 3LEXB 1U3ZA 2XZCH 3SKOB 4HG4K 1JNNH 3OAYH 1B4JL 4NIKB 2A83A 1W2KT 4PY8I 4OAWA 2G2RA 4XCYB 5I8OL 4RBPH 3L3JA 3QEHB 1J8HE 4MNQB 1AFVL 2J8UA 2C4FU 3N1MC 1N6UA 4KJYB 1HNGA 4WTXA 1AJ7L 2XT1B 2QADD 2P5EB 1EVTC 4X5XB 1WAAA 5HDOA 4I0PD 3AB0B 2OI9C 3T0EC 4R2GC 3UMTA 5DRZB 5B3JE 4AY0A 1NL0H 3C87A 1QBLL 4JO1H 3UTZA 1UACH 5B4MC 1FDLH 3NA4A 3LH2H 3NIGF 5BZWB 5F70A 3GUTA 1C5BH 4K3HA 5FKPB 3DV6A 3UC0L 3QDMA 3V0VB 3QRGL 1MOEA 2AQ3A 3MOBH 3U4BH 5J9PB 3RVXD 5KN5B 2VXVH 3H0TA 5DMGD 3JXAA 3ARFD 4Y4HC 1M7XA 4WY7L 4W68A 3LN5B 5BMFL 4WTZG 1U8MA 2APWA 2XXCB 4PJCE 5JQHC 2XN9A 2FHCA 1NPUA 4O5LL 4MA3A 3U4EA 3V79C 4R7NB 2DMCA 2IC2A 3PF2A 3BVNB 1FO0B 4NRZB 2VDNH 1FO0L 1NKRA 1OAUL 4PFEA 5CGYD 1L7IH 1RZ8B 4F7CA 1IGIH 4MCZB 1OW0A 4LLDB 4PRPD 1WUNT 2VYRE 4ELMF 5GZOD 4YAQA 3RWDA 4FTVA 3U0PA 4PP1D 5BZWA 1HSBB 4JFDE 1I8IA 1KV3A 2FJGB 4MLSA 1F90L 4U3XA 1NDMA 2BJML 3T8XB 3W11D 2DJSA 3H9HA 1BIIA 1G9ML 1CQKA 2PW2A 1UJTA 5HHXL 2JIXA 1T89C 2EKJA 4UOW0 2ESVA 4KJQC 1CFVH 5EBWB 5JIPA 1KIRB 4WUUA 5ENWB 3X12B 1XF4A 4OCWL 4ELME 3IFPA 3CDGA 5IFJA 4PJBF 3TV3L 5HDLA 2VKWA 1LE5B 3OAUH 1OGAB 1N0XL 2BVOB 4NO2B 1Q9KA 3CVHL 3HAEH 4EKXA 3MX0A 1OTTD 1FYTD 4I3RL 1ORSB 4Z6AT 1ZHLB 3MC0A 5EBLB 1S7UA 3UJIL 2LU3A 3OGCB 4G6MH 5FYKL 5DJ6B 4Q74A 5DURB 2A9MH 4LGSB 5GIRB 1EZVY 1J0JA 4H25B 1FNSH 3H7LA 5DLML 3TO2A 1NCNA 4PJBE 1MCKA 5C0IB 3RVWD 2V5YA 4QTHA 5GGQH 3DMMB 4V1DB 3FFCB 5D7SL 4PGEA 4PRBA 4JPKL 3IKCA 4HS6A 2ZOKB 3WUZA 3REVB 3NFNA 2GFBB 5J1AB 4OBSA 5DO2D 4NM8L 2P45B 1TNMA 4Y88A 5AD0A 5FGCB 3U9PL 1DQTA 5FYLH 1QBML 2IPKA 3BH9B 3DRTB 1G0XA 2XWBA 4HXAH 3VFMA 4PJDA 2NY4B 1M6OB 5ACZB 5HI4C 3FTGA 5JA9A 3QXDA 4LKCB 5FKPA 3ARRA 2AXGB 4OIAA 3N50A 1NC4B 4YXHL 3KR3H 3E8UL 3G6AA 4L5FH 2X7LB 5H2BA 2WM0A 3VD7A 3THML 3ZYIA 5IGXH 4NFCA 1SMAA 5ICXA 3GBML 3TYGL 4A6YL 3QFJA 1RZKL 4YNYA 2J7LA 1A4KA 3W2DH 4DCQB 3NH7H 2XY2A 4FQ2H 3VFPA 2XNAA 4HFWA 4XC1H 3SDAB 3P4MA 4HCRA 1WAAF 1H3GA 1SM3L 4M43H 5F1OB 2DQEH 1C1EL 5JXAH 2A1WL 4J4PC 5IMOB 5ALBL 1AGEB 5LGJB 3RWCA 5FUZH 4WW2C 1P7QB 2BOBA 5D7KE 3CH8A 1N64H 1XIWD 1ZLUK 3H9SB 3TJHC 1ZLVK 3K1DA 1I7TB 4ZUWA 1CZ8L 3PIQA 4QRPE 3QXTA 1YY8B 2V17H 3B6SB 4HG4J 4GMTH 4FFVC 1WIPA 3JWOH 5SWQA 4XGZA 4N8VA 1A2YB 1AP2A 5IVZA 5IB5A 1F4WL 4HH8A 4Z8FL 3IXTB 4AQOA 2RFXA 2JJWA 5ISZA 5IG7A 5LQBL 1F11A 3WIFB 3DX9B 1OPGH 2NTSP 4NBXB 2ADGB 4IIQC 3ARUA 3FQTB 3H3PH 1FN4A 1YMMB 3U7YH 4RWHA 3LKNB 1YPZF 4HK0B 3TBTB 5JZ7D 3UTPE 5D1XD 4Z7UE 3C2AH 3KXFE 4QY8A 2Y4SA 1FL3A 2JELH 2MFNA 4S10A 1KEGL 5CUSH 4FA8A 2VAJA 4R7DA 2PYFA 1MCIA 3F5WB 1IEAA 3OKMB 2OL3B 5IMMB 1YEIL 4POZC 4HUKB 3RKDC 2BNUA 2LU7A 4DVBA 4M7JL 1OM3L 3AAZA 2R0KH 5FYKU 5C0RL 1FL5B 3QQNA 1NH6A 5IHLB 2NY0D 2UYLA 2GI7A 3IDNA 4EVNA 2JK5B 3RNQA 4KKCD 3TFKD 4K3JH 1G7IB 4JKWA 1MQ8A 4M3JA 5FV2A 5B8CA 5KSUA 3LEYL 5KS9B 4YO0A 1ZVSA 4RNRA 4K8RH 3IJSB 2Z4QA 5KANI 4LEXL 3KYKL 5HHOA 5DD5H 4QWWC 1RQ5A 4RGOH 4U1HA 2UVEA 2D9QB 3Q6FA 2A74B 3P0VH 3STBA 4ZOBA 1G6RB 2HVJA 4JQIH 5DGRA 3TBSA 4F7MA 3FQRB 2BNRB 1YPZE 3DX7A 4DKAA 4MZ3A 3WUWA 4WIQA 4LAQL 3RX7A 5MEND 1CLCA 5F9WB 2HJFA 2XOTA 3BO8B 4LNVA 3RVUD 3MA9L 5D7IA 1NGWB 2EYRB 3R06B 4RGMB 2R1XA 3MRHA 3D39E 1KCUH 5DDHA 3X3GL 3D9AH 1MFCL 2HFFB 4AT6B 3DARA 2NY3C 1NSNL 2J1KA 5GJSH 4P2QD 3LSOB 3H7BB 5I74B 3PHSA 4AEHL 5DQDL 4HF5H 1I9EA 2R0KL 1OTUD 2OL3A 5IMMA 4ENED 3L3DB 2XQBH 4DZBA 1J18A 4PJ5B 5EOCL 3RDTD 2IQAB 4KXZI 4G6FB 4L4TA 3W0WE 2OL3H 2ERJB 3E6HA 1VFUA 4JCMA 2EH7H 4JGUA 4YGAB 2AI0H 4WWKA 3L5JA 1U3YA 1I9IL 4GBXD 3QDMD 3DIFA 3G6JF 5IG7B 3VXMD 3SE8L 5E2WL 1FYHB 1AP2B 5IB5B 3C8KA 4BSVB 1VGEL 2I5YH 4WVRA 5FKAA 3TESA 2FSEA 5H35B 4EI5C 4KROD 2YRPA 1A1NA 3GJFH 4ZYKB 2X4QA 3TBVB 3FN9A 4L4TE 5KSAD 3O6FA 3T0AA 1OAXL 5C07D 3KPNB 4P2CG 4NDMB 2Q8AH 1AHWB 1JYWA 3EOBB 1SEQH 3QDAA 3CFEB 5SX5H 2UWEE 5L88L 2NY7L 3CFDA 4JZJA 3AS1A 3UYRH 5CCKL 5IFAL 3Q0HA 1WWBX 3DURA 2CXKA 5ICYA 5DC4B 1A6TB 5T33L 1NGXB 4UOW1 1T3FB 1BBDL 2Y5EA 1SHMA 1KJ3H 5IVXE 1HE7A 3PWLA 4X80L 1T1XB 5D70H 5E1AA 2EIZA 3UBXI 1KBGL 1ZGLB 4V1DD 1PBYA 3QWRD 4WI8A 3TBYA 2D03H 3VGDA 1S9YB 4DOHE 1SYVA 3ARTA 5DVKA 4X6BA 3T0ED 4PRIB 1WJ3A 4JO4H 4WO4B 3JV4B 3T2NH 5GS0H 1PZ5A 4WFHD 3U0WL 1ZEAL 3MV8A 4S1QL 1TVHB 1N59B 4F3FB 4EQ3A 1AXIB 3C6LC 3NIFF 3VXNA 3RTQA 1Z0MA 1Y6NR 2ZJSL 2VWEE 3BO8A 2NY3D 5FHBH 3NZ8B 2VDLH 1KCUL 1MAML 5KVDL 4Z78A 2L7UA 3IDYC 2IPUG 2CUMA 1A7OL 4C4KT 2VSCA 3I6KA 5JQ6L 3UO1H 1BVZA 3MLRH 5DQDH 1ZGLP 1DE4B 3ZSSA 5IVOA 5J56B 5IKCA 2B2XH 1KN2L 3BKML 1KCVH 1WFUA 5EUOF 4J8RA 4R0LB 4YFLI 2ZSVB 3WNPA 2D31A 1NCCL 4PJAA 3QQ9D 4U7SA 2X1PA 2BFVH 3QHFH 2RR3A 1IQDB 3P73A 1QSFE 3SN6N 2GITA 4HHAB 1L7IL 1CCZA 1K8IA 1VFBA 4L29B 5ESVB 3QDHA 1DUYB 5DJAB 3VWJD 3IXAA 3VFTA 5D2NE 3ZYJA 5T5NG 4XP4H 3JWNC 2OTUA 3O3UN 5ENWA 4YDLB 4Z0XB 1LE5A 2HA1A 1EUTA 1NCWH 1R3IH 5I66A 3LRSA 3X12A 4PR5A 4ODTL 2ARJQ 4WWKC 2R0ZL 2ZUUA 4RWYL 5B22A 4E41E 1HOCB 5FO8B 4OJFH 3ZKMC 3S9DB 1T6VN 5DVNA 5CZXC 2C26A 1EAPA 3O41B 3BESR 3HI1A 4URTB 1HWGB 1OAZH 4AMKH 4OB5L 3I9GH 1IAIM 3QIBC 1EJOH 1YMMD 3DI3B 1I1YA 1WF5A 2YKLH 3OKLB 3WO3B 4L5FL 2PW1B 4HDIA 5ESVA 3GO1H 3FOLA 5SV3A 2V9TA 5I19L 4KGJA 3WNLA 5JXEC 4RQQA 3DUHA 2DJUA 4ZFOL 1Y6MR 2DWEB 5CINH 4EBQL 3V7MA 2OMBA 2Q7YB 1RV6X 1CDHA 5EU4B 3QCUH 3MLVH 4NN7B 3QH3B 4EUPA 4U1KB 1X5XA 3RGVA 2P43B 4NN6C 5BVPL 2NX5E 3O2DL 2BCKB 3SDYH 3MFFB 2PYEE 1W0YT 2Q87A 3EOAA 3MSPA 4NOFA 3WIIH 1GC1C 2GKIA 5FOJA 2F8OA 5J89A 1G9NC 3QR2A 5IFHH 1MAMH 4WFED 5D7JB 4OD1H 3SKNA 5DZNA 3MJ9L 4W6XB 4XTRC 1PQZA 5DQJB 5KSBF 2C1PA 2W9LA 5DJYA 2ATPB 2IPKB 3RA7L 5DUMH 2VNCA 3ZLQC 4WFFE 4XNMA 3UDWC 4ZTPH 5GISL 3GKWH 2YKLL 3TA3C 2ATKA 2I9TA 3WJLC 2FBOJ 3C2SA 3IGAB 5J12B 3UJTL 2V7NA 3C60B 4LCIL 3VFWB 2FR4A 5ACZA 4YDJA 4N90D 5ID1B 3QHFL 4NKQB 1ZLWK 5E1AB 1OP5H 1SJEB 1IC7L 1JRHH 4UUJA 3SDXA 3L5WB 4Z7VA 2PO6C 3HRPA 4P4RB 2HN7A 4FXGA 3KPLB 5AYUL 5E8NA 2Z35A 1BQLL 1MCOL 4LHJB 4OTXL 1N3NB 1TJHH 2Z8WC 5LAXB 1X5KA 3FB8A 1D6VH 2HLFC 4LNRA 5GRWA 4JY6A 5FDWA 2F5AH 4GLRH 3T1WA 1G0YR 3V0WL 4LSTL 5DQJA 2ZKHL 4OD2B 4PJXB 3REWA 1OWWA 2VC2L 5IP4A 2ATPA 5SX4H 5GS2D 2MHAA 4ODUB 5T3ZL 3HG1E 3NCJH 1IILE 1C12A 4I1NB 4X6CA 3FT2A 4H20H 4GO6B 1A7PH 4KVNL 1BWMA 2BVOA 4NO2A 5DD1L 5L2KE 3TF7C 3S37H 5HPMB 5E03A 2MTPA 1QYGL 4I48B 1RJYA 2CDFB 5IFAH 1LE9B 4OCYH 1MCFA 3BMVA 4M7ZC 1MH5A 2VXTH 3FO0H 2IQAA 3TPKA 3GSXA 4G8IB 3WSQL 1NAKL 4KJQD 4QKXB 1N6QH 1CN4A 1BFSA 1HHIA 3FN3A 4RX4A 2EEDA 2VQUA 1XZ0B 2X6MA 3VXME 4NQDA 3D9AL 3PGDB 3KPPA 5BQ7B 1U8IA 3BRGC 5AYQA 1DBMH 3L7FA 1TXKA 1R5WB 5DZLA 3LKPA 1YEEL 3TBWB 5EG6C 5SV4A 5IROA 4K8RD 4Q6YA 4Z7WB 4H0IA 3U0TA 1UWXH 1NAMB 4OFKA 3L1OL 3T2NL 1WBYB 1BOYA 4L4VA 5IBLD 2K7PA 5L2KD 3JVGA 3VXUA 3FQWA 5C0GB 2D3VA 4YHOH 2IADA 2FLBT 3HCVB 3MBEB 4KUCD 5L8JB 3OG6B 1FCCA 4MHHI 3R1GL 2DM7A 4PJGF 5DF0A 4AL8L 2EYSA 3ARFC 2OR9H 5FK9A 4LLWB 1A9EB 5CEXB 4OZIF 3GJEA 2F54D 3JWOL 3GSUA 4X4XB 4YXKL 1M71A 4Y4FB 3X3GH 4EN3B 3FT2B 1AGCA 3NAAH 4R4FL 2AABL 3HC4L 1I8LC 1KGCD 3HE7C 3IAQA 1KEMH 4N9GA 5T3XL 4GXUM 3O3DA 3BKYL 4ZAKC 1J8KA 4N1HB 3FCTA 1MREH 5CJQL 5GRUL 2CKBL 3VMNA 4JHBA 1IKFH 4C56E 5K59E 3VXOA 3MLSH 1C08A 2V5RA 3DUSA 5EO0A 2VOTA 3E3QC 2V2XB 3OXRB 2BC4B 3GMPA 4UILH 4I3GA 1NGYB 2NXYD 4G8GB 2XZAH 4M7ZB 3PWPB 1J05A 4WUUE 5JHDE 3RZCD 3PHOA 2B5IC 3GBNH 5F9WC 1UQSB 2GQHA 4GAYA 3RTQB 3S37L 3OKKB 3MCG1 2ZCHH 4UIKL 4Y2OA 5D8JH 4YBLC 2CRZA 3MUY1 5HYFA 3UTPD 4A6YA 1KCRH 3D69A 4YPJA 1OB1A 1GL4B 3S35L 3EYSH 2WUBH 4MDIA 1K6QH 5D2NB 4MXQD 1CFNA 5C0AB 5ABDE 2UZIL 3MJ9H 3DETD 5E5MB 4FFYL 2QSQA 5JR1L 3W5NA 2NR6C 3C60D 1MQKH 2G60H 1Q38A 1OARL 1A02N 3FO1A 5C70A 4K3DL 4JCLA 1RZIA 2YUZA 5KBNC 3CDFA 4KK8D 2E7MA 3ARPA 4HS8H 1EGJH 4P5TA 4HMEA 1RZIB 3PWJB 2VDOH 2FGWH 3D1MC 3QUKB 2GTWB 2CR3A 1IEAB 2W0LA 4N0UB 3W82A 3W11C 3AS0A 2V17L 3M07A 3JV5A 2CXGA 1U2HA 3D6GA 3VFNA 3RY6A 2EXWD 4WI2A 3VXSD 5HJ3B 1VACB 2OJEA 1IRAY 3EDEA 1NEZG 1A6VH 1A4JA 1WIOA 1T7VA 4KK6D 1IGYA 3I3DA 1LDPH 2CSPA 2DF3A 2J6EL 2X4OA 5EN2A 4MD0A 1PG7W 3AU1B 4MQTB 5I74C 4PTUA 1RJZB 1G7HA 4XWOD 3MRFA 1V7MH 5CUSL 1IJ9A 1WZ1H 1EEZA 4N8CL 2YD8A 2AAVA 5LCVH 2A73B 2WP3O 1S8DB 3SDCC 3GMPB 4KUZH 3DXAB 5GRZA 1C5DA 3VGEA 4HWBL 2GIYA 3N0PB 4TRPH 1YEFH 5HHVH 5B38B 3PP4H 5L2JA 2HT2C 5F7HA 5C0RH 3F6IA 5T1DH 3PL6D 3SJVD 5C0CA 3W0WA 4NP4L 1A3LL 5HGHA 2RBLA 2NMSA 3K81A 4Z0XA 5TDNB 2H2SD 4JEGB 2XWJB 4G5ZH 1DANT 5CJBA 2ADIB 4C56A 1D5BB 3FMGH 1FJ1A 1RIVH 2EEAA 5IB4A 3O4OC 1CGUA 4UIKH 5D8JL 5FF6A 3NCCB 4NWTL 3STZB 5E00B 7FABH 4P3CH 4Z95L 2C3VB 1II4E 2XTJC 3D39A 4PP2B 4TSBH 3D3VE 3MLYH 1IM9B 3QQ9C 3MCLH 5CHNA 3HNSL 5DA4A 5AG8A 3ARGC 1RJLA 4NQCA 1UB6A 1OOAA 1K3ZA 4KPHH 5KSUB 4NQEB 1B88A 1YZZA 1R3HA 4PJFF 5SWSB 3HPLB 3MO1A 3RNQB 1RZKH 4PJ9D 2Q3ZA 4XHJC 3CFKB 4GT7A 1L0XA 4HCRL 5GHWH 3G5YB 5EO1B 3VXPA 4CU6A 3ZHDA 5DUML 2VSDA 4RMUA 3GHEH 4NKIH 4QT5A 1NCUA 2W65B 3HE7A 1TNNA 4F7CB 5DMGC 1JPTL 2XACC 4IOIA 3K8KA 2E27L 2HTKD 4MJIB 5GRVK 5F1SA 2DQEL 1IT9L 3DWTA 4N90E 4NPYA 3RWJB 1AXTL 3DRQA 4LCCB 4P46C 5F21B 4RSVA 5FF6B 3PWPE 1D5ZB 4Q7DA 2R2HA 2VDNL 2O61A 2Y36H 4FTVE 3N1PC 4ODBD 4P9ML 4JKMA 1ZHLA 1TJHL 2VQTA 3GBLA 4FXKA 2P8PA 4N0RA 1B0RB 5LGHH 3BSZL 4OSUL 3TBTA 4X0KA 4ODXB 3QEUB 4EN3C 2NY6C 2BRQA 1KIRA 4WUUB 2K1MA 2NNAA 4OLVH 1G9MH 2EC9U 4ZXBC 1NUNB 3ZTNL 2GJZB 3V6OA 4IRSB 3CK0L 4R9HA 3ZE2E 3TZVB 1H0DB 2RCSH 4OCRL 3X17A 3DVIA 4S1SH 3BE1H 3ZDYE 1AD9B 1Z5LA 2YPVH 4HIHB 3Q3GB 4HV8B 5TQ0H 3K2UH 1Q94A 4GG8A 3PWPA 1OD7A 1NBQA 4Z18A 2HKFH 3UROR 4ZYKA 3N1QC 3KPLA 3S98A 3K4ZA 4NP4H 3U0TB 5HGAA 3WN5B 3Q5YA 5FKAB 2DTML 1MAJA 1J0HA 4CMMB 1R5VA 2EDXA 4YHZL 1C16A 1TZHB 4JZOB 3LKPB 4PJBB 5I71C 5BOZG 4TTDD 2E3VA 1YMME 2KDGA 2GY5A 2DLEA 1W0WA 1A4KB 5IQ9A 1ZANL 3L3KA 2XQBL 4Z0BL 3V6FB 1ONQB 4AG4H 3M45A 1J8HD 4XTRD 5EU6E 2BXZA 5DJDA 1JGVH 1ES0A 4XC3L 3FFDB 1IGFL 1BGXL 1EHLL 1DQLL 3LEYH 3O9WD 1AR1D 1HCVA 1IAMA 1URLA 4WCYL 3VFPB 1ZOXA 1MFAH 3QQ3A 1ACYL 3GSUB 4HJGB 4RRPG 4X4XA 4AH2B 3P4NA 1YC7A 2NY1D 1S78D 1TITA 3G6AB 4PJ7B 4PY8J 3WLWC 3D3VA 5C0NC 3S35H 2X70A 3G08A 3O6KH 2ZWLT 3BOVA 4LVOC 5KW9L 5DDHB 4XP6H 1MIMH 1F90H 1J8HA 5I6XB 5KJRL 4PJDB 1XGTB 2HVKB 4J4PA 1J1PH 4JFDB 2A0LC 3ARXA 4LLYB 4DVRL 5DRNB 5E5UB 3ZDZF 1QSFD 1F4HA 1ZLWH 2R2HB 4GH7B 5EC1A 3LQZB 3MODH 5C6WH 1S5IL 2IAMA 2XWBB 3HUJA 2J12B 3VGBA 1ONQA 5FM4A 3RAJH 3DV4B 1EGJL 1MIEL 1GIGL 4LBEB 3WKNA 1Y18A 2VDRH 4N5UA 1UJ3B 4GRMB 5DMYA 3P4OB 2Q7YA 3WD5L 1CYGA 4XVUD 4U6VL 1HZHL 1NFKA 1RIHL 5EU5A 1CGSL 4I5BB 4QWWD 5T3XH 4GG8B 5K9JH 4NUJA 4L8BA 1JMXA 5C0DB 4LVNB 4XXDB 3IS1X 3AGVA 1MFDL 4F9LA 3NPZB 2QR0B 2OM5A 5BW7A 1N0LA 5GS3A 3WV0A 3LRGA 5GJTH 3FO2B 3HZYA 4YFEA 3VGFA 3ULUC 3VXRE 5A1AA 5EORH 4OZHF 4KQ3L 2HRPL 5C0FB 2PTUA 3WEXA 3I6LD 3G9AB 5GSRB 4EN3A 2EC9T 4H0HB 2R0LH 2GCYA 4OCLC 1JWMB 5HHNA 4PBXA 1WV7T 5E9DA 3B5TA 2MWCA 1YMMA 4P5TD 1HSBA 1A5FL 3CGTA 3K4DA 3S4SB 5I66B 4DVRH 1IARB 4JFHE 3T4YB 4V1DE 2NY3B 2VKXA 4PGCA 1RZKC 4BFIA 1C5CL 3T3PE 1FIGH 3U79A 3TJEL 3ZKXC 1A3RL 4QRUA 2IADB 3OB0K 1NMAH 5F3BB 2GUOA 3R8BB 1QSFB 5DUBB 2AABH 5L9DH 1Q0YH 3TO4D 1Q72H 1MJ8H 2O5YL 4YIQA 3VFVB 4NN5C 1SY6L 4ZUVB 2VQ1A 3U36B 1RK1B 2RGSA 3LQZA 3NGBB 4G43B 4QXUL 1UB5A 5C6TL 4JJ5B 1EO8L 3FAXA 3CSGA 3HUJB 3D25B 4JQXA 3OR7A 4JFFD 1JHLL 3OPZH 3CFBB 4K3JL 3IETB 2YD3A 3ORJA 3I3EA 5FYJE 5F97E 2IAMB 4XCNA 5F88B 4XPGL 3IRZA 3SDDC 2ZCLL 1MVUA 5E08L 4BELD 2Q6WA 4J1UA 1KPVB 3QDME 1WIUA 3EO0B 2GSGA 1KNOA 5BRZD 5KS9A 2VLLA 4XNUH 4Z77B 1EEYB 2X89A 1XAUA 4PIRF 4XPAL 4X7SL 2YPVL 3Q2CA 5CWSB 5B38G 3DGCR 2XWJA 2VMFA 2DQDL 4TPRH 3DXAE 4WUKH 3BKMH 5BZDB 2Q86B 4QOKE 2H26B 1P5UA 1MLBA 1K8IB 1VFBB 3H9ZA 4Y4HA 2DIBA 4JM2F 4PJFA 2XIDA 3G04A 3DURB 3QUYC 4NM8H 2XY1A 2PTTA 1AGFA 3D39D 4PJEB 2IFFH 1QFWM 4QXUH 5A16B 3GK8L 4MA1C 4KKBD 1N5AB 4KQ4H 3GJFB 3IFNL 4HS3A 2ZOLB 3LQAC 3SDDD 5C71A 3MPCA 1S8DA 5FCUH 3TWCL 4PRDB 2Q20A 1R6VA 4RMVA 5E8NB 3FAWA 3FMGL 4QTIL 2QQNH 3VH8G 3MRFB 3L9RB 4GUPB 1SJEA 3S7GA 1KN4L 3PHQB 4M48H 4FABL 2BNQA 3O6FB 1RUQL 3AU1A 3KPSA 5HDQL 2AEQL 3CDYA 1G1YA 5IV2B 4ZO9A 4Z7UF 3SGEH 1XCQA 5AUMB 3VH8A 2ZG1A 1J0KA 4KXZH 4JFDD 2BSSA 4PGDB 3CLEH 3MJGX 1YECL 3QFJD 4NRXA 5IESL 3GHBH 3IU4L 4HC1A 1R3KB 2AJVL 3VXOB 4YDLC 3LKOB 1VACA 1K9TA 4LHUA 3SQOH 4M3KB 1PG7X 4KPHL 3VFGL 2BHZA 1ZA3A 3KVQA 4U6XA 4K7PX 2YXFA 3SO3C 5DJCB 2JIXB 3MBED 4N9GB 1IEBA 1P9MC 3QZWA 1FZJB 2FYYA 1U8QB 4QRPA 2Q76A 2J5LB 4UV4L 5DMIH 1QP1A 3CMOH 1AGCB 2BVUA 5CIPH 4NQSA 4F33B 2AEPL 3ZKNC 1QVOA 3NCYS 5KVGL 3NZHH 2AV1A 1VFMA 1QFWH 3BZEA 2GEEA 5DUPL 4LHUD 5C0AA 5TF1L 1KFAL 2Y36L 1AR2A 4NQDD 1AC6A 3CFEA 4UT9H 5GZOC 4XAKE 1F13A 5D93B 3ULUD 1T1WB 2VLLB 4Z77A 1PG7H 1W72H 1WT5C 2PN5A 3GSQB 5TQ2L 5FEBA 5SWSA 3AVEA 4XNUL 4BYHA 1KJMA 3HPLA 1EPFA 3ILQC 5TJWK 4OGXH 4QHUA 4FFZL 3MV11 4GRWF 1F3DH 1PY9A 2R56L 2YD7A 5CHNB 4MA8L 2EICA 1UGNA 3VCLB 5KN5A 4U1LA 4NN6B 3OAZK 4NQCB 3FQXA 3KDMB 4ZUTA 3CJJA 3O4LB 4RNRB 3NOIA 3VFUA 2XA8L 2MPAH 1S5IH 3FCTB 3ULUF 1JVKA 2EDDA 5ELIA 2E7CA 4ZD3H 4GG6A 4ODVH 1C08B 3O6LH 2OK0L 3TO4B 1YJDH 2D4FA 3WFDL 1HHIB 4XPFL 2A0LD 2E6JA 4R90H 3SGEI 2X89D 3QFDA 3UPAA 2F74B 4F80A 4YXHH 2ICWI 4C4KO 1UM4H 3O4OB 1MJ8L 1M71B 3L3KB 1BX2B 4L3CB 3PJSB 5DJCA 1FQ9C 2P5EA 4XPBH 3BZFB 4HKZA 3SKMA 1DL7L 3EAKA 4IOFD 4EIZC 1LVEA 3LMJH 3IVKB 2DQUH 4MQ7A 4XBPA 1FBIL 3OKOB 4YDKL 4QLRA 1P9MA 4MMZC 4QRPB 3QEHA 3VCLA 3QDJE 3BSZH 1EZVX 4FFVD 4ZNCD 4HUXA 4PJGA 3GMNB 5B39B 3T2OA 4XC1L 4CU8A 4ODTH 4NZUH 4U6HA 4KKLD 5GXBB 1PKQA 5FGRA 4ODWA 3UJJH 1BHGA 2R0LL 1GGYA 3MRIB 4YBQD 5IVZB 4DGIL 2R56H 1JE6A 1HNFA 4N0FA 1T1YB 1F5WA 3O2WL 4R97C 4JVUA 3LN9A 3TZVA 4FMKA 4BFGA 2C3XA 3D85A 1YNKH 3VI4F 4M5ZH 2FBJH 4YXKH 3CMOL 1AGDB 5IW6B 2H32A 3KPRA 1S5HB 3FRPG 3RU8H 3TIDB 3IDMB 5HI3C 1S9KC 5DMKB 3BGFB 4KC3B 4DZ8A 3MJ6A 3VFNB 4QRRA 3VG9C 3S3SA 4HT1L 1N5YH 1JHTA 3T0XA 4WI5A 2QL1A 2R4SH 4RZCA 2VR9A 4P5TC 1HYSD 1OPGL 2R2EA 4LSRL 1XGTA 1EO8H 1P84J 1U41A 2H1PH 2BNRE 2J6EA 2Z8VC 1A1OA 1NUFA 3AY4C 2FB4H 5KOVC 3OKNB 2BVEA 2H26A 3BUYA 3HNTH 1MRFL 2J6EH 5D7JA 1KENH 2FECL 3B8YA 1UH4A 5MERA 4PJ7A 3NFSL 3EJJX 5ADOL 4I0PC 1FVDA 1TJGH 2AJUH 4A2LA 2VZSA 2VO5A 4PJXA 1QD0A 1YUHA 3P4NB 4RFNB 4Z5RA 1TQBB 4G9DB 4OKVA 3D69B 2X4UB 3ULSA 4XAWH 3TLRA 3S34H 5A2FA 1ES0B 3N85H 5D2NA 1UCBL 4YDIH 3U7AA 4TVPE 1A3QA 1VPOH 3VGHA 4Q9QL 4LU5H 2HTKC 5CS7A 3TN0C 3IDXL 4OLWL 2Z92B 1T2QL 4CBPA 2A9NH 2DWEA 4FXGB 2V2WB 3V4PH 3LS4L 4YX2L 1PSKL 3GMNA 1RUAL 5C7XL 4CVWA 4FQIH 5FGBA 1AQDA 4PJIB 4JPWH 3KWWB 5EO0B 3VFOB 2FATH 4ELMB 1A6WH 5DQ9A 3IVKA 1M05B 4QRSA 5CP7B 3VRJA 3EYFA 3ZL4H 2BY2A 1U42A 2FB4L 4PJ5D 1K8DA 2ZUSA 1F97A 4KGLA 4IRZH 4M48L 4W4OA 4FP8L 4DN4H 3KPTA 1XGYL 3CSYB 1F4XL 4I77L 4OT1L 5C86A 5JPMB 3IJYB 1WEJH 3ZKQD 3DX9A 1WWWX 2ESVB 3G6JE 4JG0H 5ANMB 5A3IC 2PETA 2VABB 4PJ9A 3HZYB 1NGQH 3HCVA 4L4VB 1NDGB 3JV0A 5DS8B 5C0GA 3MRGB 1ZAGA 2ZPKH 4K2UH 4MCZA 3ARBD 4OFYD 3E3QE 3MRLA 1D5ZA 3AREA 3PIQB 4PV8A 3PWNB 5J6HB 5LCVL 4XBGA 5E99L 2XZQH 4OGAD 4DK3A 1R5WA 2PKDA 5EC2A 5D2NC 5IVXA 2JIXD 3FJTA 1NMAL 4JO3H 2MKLC 2V6HA 4JM2D 3AXLA 4Q9CA 5KVGH 5A40E 3U4AA 4XWOC 3AM8C 2N7BA 2XG4A 3CFKA 4NZTH 3RVXC 3ZHLA 4B53A 1NGPH 4OZGE 4WDIB 4OF8A 3X11B 3U36A 3WFBL 3BQUC 3VI3F 1H3PL 1BREA 1QHPA 3KPRD 3ZKMD 1D5IL 2CK0L 2VDQH 2DQUL 1FAIH 1MCOH 2XN9E 5IEHA 5D1XB 3QEGL 3UYOD 3IFNH 2ENSA 4IIQA 4WO4D 3E6FA 4GRWB 3TYFB 4G80B 3WL9B 3IDGB 1INDL 4P2RB 1QRND 2VDMH 4Z8FH 1RMFL 2BSSB 1J8HB 4NCDA 2B39A 1Z0NA 4LQFH 3S5LB 2PW2B 3ULVD 3LKNA 1HYSC 3MV9E 1JGLL 4UDUA 4N5ED 3DHMA 3QQ4B 3TBYB 2QJDA 2Y25A 4G7VH 4WW1B 3OB0H 3M17B 4RISL 4L4VD 1W0WB 5E0QA 4JFED 4U4BA 4ZOEA 5JUEL 5EBGA 1B90A 1JFQL 5HHQB 3FO2A 2WWKT 3C60C 3S37X 3O2DA 2ZOLA 4HS3B 2GITB 1J88A 3PV7A 4HHAA 4MNQA 1N8ZB 1MF2L 5KSBA 2Y72A 2QSVA 3D87B 1B4RA 1CLZH 3FT3B 2XQYK 1QSEE 1OP3K 3BIKA 3U4BL 1JYXA 1IGFH 4OIIH 3CPLB 4JRXB 1AGFB 2FD6H 3MLSL 5HYJE 1OP9A 1IKFL 3NACL 5IEKA 3INUL 4K3EH 3EYVA 2W0FB 1FLRL 4WEBH 5JOFB 3WMSA 2H32H 2E8YA 4KI1A 4OD3L 2XTJD 4Y4HB 1OAQL 4PGBB 5JW3L 4WNQA 4NQXB 3MV8B 4X4MA 3ARZA 1SJHB 1ZS8B 1B3JA 3I50H 3GJEB 2ID5A 3NVQA 5C8JA 3E2HB 4NN7C 3SE3C 1FYTA 5FM5M 1KIPA 4J7RA 5KZCD 2IBBA 3E6FB 1XIWA 4S1SL 3FFDA 3RUGE 4LVNC 5D5MF 5IM7A 4X7CC 2QHRL 4KDTA 3OZ9H 4YFLF 1U8OA 1U8LA 1WZMA 5F96L 4NQSB 5E8OA 3FHQA 2H8PB 3WBDA 4WDIA 2EIZB 1RU9H 4CMMA 2BDNL 3ULUL 2OSLB 3MV8D 4U1KA 5GRJL 1JPSH 4OFIA 3RHWF 5FO9B 4ZTPL 5GISH 4G6KL 1IL1B 4UT6L 4X6DA 3SKUD 3RUGA 1I1YB 3O45B 1ZLSH 2XN9B 1RZGA 4XMLL 4OZIB 3U9UB 3FOLB 4DKFL 1SBSL 5JW4R 1S7WA 1XZ0A 5KSBB 1XGUA 4MNGB 1INEH 1P7QD 8CGTA 5JDSB 4H25A 1FZOB 4E9LA 2EDLA 4R4BA 5F3HA 4LQFL 1LO2H 3V0VA 2DAVA 1J12A 2B1HL 3Q3GA 4WHTA 1UM5H 2DQHL 3STZA 3L7EA 4LF3B 2XICA 3RRQA 4AMKL 4P4KB 3B2UC 2AK4E 4PLJD 3MFGB 3VJ6B 1FL5A 1NAKH 1KYOK 5ISZE 4JHWL 1G7JB 2ARJB 3MLUH 4F58H 4KROB 4U0RB 1P4BH 5LGKA 4KK8C 3SE4A 3MRPA 3QULB 1UXWA 4MQ7B 3PUCA 5I75B 2BHYA 5BZDA 3MUZ1 4K7FB 1N3NA 5D1QD 4LSDA 5HYJA 3MGAA 1KTDA 2GK2A 4I8DA 4U1NA 5D1ZD 5TE7H 4GRMA 5C0CB 2DLTA 3HMXL 5L7XH 1DTUA 2R1XB 3CFJB 4TTDC 4YE4H 4F7EB 3VD9A 1JK8B 4KRPB 4U2YA 5EC1B 3QDJB 4DGVL 2AJXH 1AQKL 3MV7D 4JG0L 1TQCB 5I15L 4ORGA 1CG9A 2HVKA 3TFKC 1QLEL 4BH7B 4UTBL 1MELA 1NAMH 4C55A 3QUZD 4HXBH 1A64A 2Y07H 5DXWA 3KYNA 4TPRL 4JFYB 3QJHB 1TVHA 3NAAL 1FJ1B 4LK4A 1KT2B 3KPSE 4NRYB 2WWMC 3V0WH 3UZVB 1CGWA 1G0DA 3UTSB 5D96C 1N26A 5L8KB 5F89A 1T1WA 1CBVH 5DRWB 3L7FB 4HFWB 3P30H 3P9LB 3PWUA 4G6KH 1T2XA 4LPWA 4Y5VC 4KY1H 4HK3N 3ULVL 1RIHH 4RZCB 4OTXH 3O6ML 4HWUA 2VISA 3QFJB 3NCFB 1T1XA 2N56A 5C7XH 2Q76B 1RJYB 1UG9A 4KDWA 1ZGLA 1PEWA 1EFXD 1MY7A 1MH5B 3MQIA 3MROB 3TIDA 4D3CH 1A6PA 1FGNH 3IF1B 5T1DL 4G42B 5MP6H 1R5VB 4QY8B 4YHIA 2EEBA 3KPNA 3NIGE 4TN9A 3HZKB 3RL1B 3OR6B 3P2TA 1XCQB 5AUMA 1NC4A 4JZOA 3WFZA 1LO3H 3FB7A 3FQTA 4XGZB 4NRXB 3O2DH 1PFCA 5D1ZB 1HIML 1VERA 3QJHA 1IC5H 3QXVA 1DBAH 3A6CL 2KQMA 3VWKD 3V8OA 1IGMH 1REIA 2B4CC 4K9EL 2P5ED 1Q94B 3WHE0 3QNXB 4O02L 3O8XD 3EYVB 1UADC 1EAPB 3O41A 5E6ZA 3OKEA 4MQSB 1FE8H 4WI4A 4NSKB 5HHOE 4PRDA 1E4JA 4IMLB 1KPRA 4XPHL 1HHKA 4C83B 3ARGD 3OKOA 2ZCHL 4JQIL 3LKSB 4HGKC 1G7PA 2GSIA 4G6AD 1SVZA 5FO9A 4C54A 2XNAB 3KJ6H 5HYEA 4YHML 1QA9B 4L3CA 3I75A 4APQC 4X4YB 5TFSH 5BS0D 4PJEA 1I7ZA 4GBXA 5D7LB 5DRWA 3G5VA 1QFUL 1YEKH 3UTSA 4BKLA 4PJFB 1CZ8H 4NUGL 3VGGA 1A9EA 5CEXA 1MAKA 1BGXH 2GJ6E 2YWYA 1HWHB 4M03A 1ADQA 4ZSOB 4G80A 1EEQA 2EYRA 3R06A 3I6KB 4P59L 3TBSB 2X70B 1U3JA 5F8RC 1ADQH 4ZOCA 4QRTB 3KG5A 2XRAL 4XP1L 1U2CA 4OQTH 4YHKL 2AV7B 3RZCB 5J12C 4CADA 2BNRA 4ZNEA 1AO7D 3CSPA 2WWMD 3GRWL 3CH1B 4YO0B 2VXUL 2A77H 4MDIB 2IGFL 5GGUA 1UH3A 3UTSE 2VUYA 2PO6A 4U1HB 1A6UL 1W8NA 2A74A 3QUZC 2UY6A 3TNNB 2H9GB 1CI5A 1X5HA 6CGTA 2NY5H 3AXLB 4MVBC 2KZ1B 3SCMD 3FB5B 4QOKB 4NQCE 3BE1L 4W70A 3ZDZE 1HHHB 2FX9L 4BKLB 5EO9A 4K7FA 3MRQA 4XNQA 3TJEH 4AK1A 1CK0L 1YNLH 1UM6H 2VL5A 3Q1SH 1NC2D 3KNBB 2DKMA 5BO1L 1FZKA 1Q9KB 1U8NA 3I75B 1GGCH 3PP3K 4Y4FC 4UU9A 3DV6B 4LLUA 3K4AA 3KPQB 1QSFA 1NGZA 4F33A 2F74A 2WBJA 5E9DB 1UA6H 1BBDH 4L8SC 1BLNA 4OLZH 1CLOH 1V3JA 4PG2A 2EE3A 43C9A 3BP5A 1F45A 1T7ZA 2IG2L 1QBBA 3S5LA 5F9DC 5HHNB 4KJPD 2I60H 4P46D 2MNUA 1X4YA 4ODUA 3MBEC 4HH9B 3NCJL 1I8IB 5E4IA 3O0RL 1IM3B 5K9QI 4LLWA 3VA2C 3C5SB 4JHZA 5EOQH 5L0QC 8FABB 2AP2A 1I7TA 1B0RA 3BQUA 3H9HB 4IIQB 2HH0H 4JN1L 3GHEL 4GXUN 1WITA 3DVGA 2YR3A 3AB0C 4RGMC 3C8KB 4P2RE 3MRCB 3RPIA 2DIAA 1A3RH 4UIMB 2BY0A 5MEQA 1WBYA 3L5WA 1DUZA 1UXSB 4O58H 1XGUB 2VZOA 5TDPB 4OV6F 2DLIA 3H8NA 3TNNA 4HPYH 3SEPA 4JKKA 3G04B 5GRYA 3H6JA 1BVKA 4OSUH 2C1OA 3QUXA 5HHQA 1JZ7A 1KOAA 4FRWA 5CLTA 4CL7A 3UTTB 1CFBA 2APXA 4P0DA 2NY7H 3RHWK 3UYRL 1VKXA 4NZDA 4DCQA 1NFIA 4ZAKD 4F3FA 4YHKH 3IKKA 1U8LB 3C60A 3A6BL 2VJXA 2VH5L 2AQ2A 3VXNB 3S5LG 2EIBA 4HIEA 1S3KH 3N85L 3SBWC 4ALAL 1U93A 4U1JA 3T77A 4R6UA 1N6VA 4KJWC 3VI4E 3GIVA 2QADC 1IGTB 5CWSA 5IW3A 2YD6A 1PZ5B 1BQHA 3FZUC 1XIWB 3WNKA 2XZZA 2AK4B 2R4RH 3FFCD 2EE9A 1SYVB 4BH8A 3QXDB 3ME0A 3EFDL 4R97B 4NZRL 3SO3B 4IRJB 2I24N 4L9LC 5I6XC 1OGAD 1O7VA 3EW3B 4M1CC 4NO0A 2YHGA 1EAJA 1RMFH 3QDGE 4XP5L 3EO9H 5IWLC 2G2RB 3CVIH 5IVNA 4RX4D 1UEYA 3OV6A 1S5HA 4HGWA 4Y4KD 1I9JH 4G43A 2J4WL 4WU7B 3DO7A 2APBA 4UAOB 4X8JB 1I3VA 4FQPA 1E4XI 4TULH 4LCWA 2GAZA 3IKCB 4HS6B 5I8KL 5IB3A 1DQDH 1EO7A 3EUUA 4L1DA 4QCIB 4JAMB 5GS0L 3TA3B 1YYLH 5C09E 5L88H 1MHPL 4NC2B 4OZGA 4WW1A 5IB2A 4IRSA 3A6BH 4XX1E 1AJ7H 4JRXE 2ITDA 2WUCH 3SO5A 4ONGL 2P46B 4KMQA 4HV8A 2VITB 1YUHB 1FLRH 4L1HA 1TJIH 4WEBL 4ZXBA 4GAGL 4HUNB 2W0PA 1DSFH 4R96B 5C0EB 4FG6C 2IPTL 3C8HA 4WHTB 4CRPA 2AEIT 3BKJL 5C2UB 4JFZH 2XFXB 2A6DB 5MENA 4N5EC 4KVNH 2FEDD 3WIHA 1BOGB 1NLDL 1LP9B 4FFZH 1GSMA 4RGNC 1GYAA 1F4WH 2X4RA 1KJVB 4AIXA 1V8HA 1FZOA 4RFEB 5JHLH 3BUTA 5I1IL 4O58L 3LH2L 4HJ0C 3B6SA 1NDMB 1JNLH 1IC4L 2ORBH 3P73B 4AENB 3MXVH 4N0CD 4F8TA 1WT5A 2P5WE 4JAMA 3KLHD 1BECA 1KXQE 4TVPL 5TE4L 4PGJA 2H41A 2DLFH 1WFTA 3ZE2F 1BVLB 2Y9RT 3B4NA 5D9SA 3VFUB 1VHPA 4GFTB 2J2ZA 5IMOA 4GSDH 4EZMA 1YEKL 1RUKH 4WU7A 1RZ8A 1YEIH 4J3OC 5EC2B 3CXDL 1BJMA 4JDTL 4QHUB 4PV8B 1CDYA 3BWAB 1K3IA 4D3CL 1D9KB 1T22B 3RVWC 1FGVH 4LBEA 5J9PA 4LCCC 3DX6B 4P46B 1LP9A 1FC2D 3OKKA 4YUEL 4NWTH 1D5MB 4L4VE 4BH8B 4M4RA 3G08B 4NM4H 3IJSA 1MHEB 4WENB 4DWHA 3ELAT 4QRQA 2UYLB 4HUXB 1OTTC 3MA7B 5DD5L 1Q1JL 3C8DA 3S4SG 3T3MF 4LHUG 4ISVA 3MV7E 2K7QA 2RB8A 2AJZA 3WLBB 4O02H 1XCTA 4H5SB 4P23D 3HI5L 3ARDC 3P40A 3P3YA 3RIAK 5EOTA 3VFMB 2GHWB 2X44D 1CWVA 1PZUB 3W81A 4BSWB 4NKDA 4XT1C 1QA9A 5HHVL 1IVLA 4K94L 1QO3A 5FUCE 3QUXB 3BD3A 5HGHB 3SKOA 3UZQA 3QDGD 4LSUH 4PJAF 4F7PA 3RIAF 4XCYA 2LABA 4UQ3A 4PGEB 4V1DA 5LAXA 4FQLH 1A1MA 2NLJA 4V2CB 2HN7B 2XG5A 2ZUQC 4EI6A 4ZS6C 3UJTH 3VXMA 3U6RA 2JCCE 2NY4D 5FCSH 3U83A 2OTWB 5ID1A 2VDQL 1UVQA 5T3ZD 2XKNA 1ZHKA 3KJ4C 1X3DA 2V7NB 1AH1A 5FIEA 4CW1A 5ISZD 1VCAA 5EU7E 1U6AL 4O00A 1CFSB 4IDLA 1UKQA 1A7QH 3KYKH 5DC9B 1YMHA 1K4CB 4LVOB 5MEOB 4OCSL 1IC1A 1RI8A 5T1MB 1MJ7L 3CXHK 2Z91A 4OLXH 1KB9J 1UZ6F 4OV5A 2XRAH 3MRMA 4YHIB 1JNLL 2EDEA 1QPPA 1FVDB 3ARWA 5D1ZA 3VDBA 1TENA 5E8DH 2W60B 5KTEH 1EMTL 1QOKA 2X5PA 1EK3A 1LO5B 4EDXA 4MAYD 4GG6F 3BUYB 3K8LA 4UTBH 2VLJB 4KU1A 3I3BA 5IMLB 3KYMA 4FMFA 4ZXBD 3AY4A 1YN7A 5D2LB 3UBXG 1J86A 4D94A 1EFQA 1VADB 5FUOL 4F2MA 4H1LH 1DBKH 3BP6A 3PGDA 2WAHA 5C08D 1BQLH 1WZ1L 2CUHA 4HLZG 3BRFA 4OCWH 1A6AB 4H1LA 5GS1A 4KDTC 5GJSL 1FNLA 4YR6A 5A2JH 4H8WC 4M1GL 2NYYC 2RAMA 3F62A 3TZVD 4GJTB 3MV01 1UM6L 3LY6A 5EO9B 5H37H 3M1BA 4U31A 5C0BB 5C07B 3BRDA 3TYGH 4A6YH 2HYMA 1L0QA 5EIIA 2AJSL 3FB5A 4QOKA 4U6YA 2DQFA 2R15A 2HFFA 3CFDB 4JZJB 2WIMA 2VAAB 5F88A 3VXSB 4CN1A 4D9RD 4LKCA 5EWIL 2XKNB 1JGUL 2EDHA 5JOFA 1KCSH 1JPFA 1YEJH 4EI6B 4FQ1L 3CIQA 1KJ2L 1YMHB 4NQEA 1CG9B 3HI6L 3WS6C 2JK5A 4LPXA 4RMQA 3D18B 5JPMA 1EV2E 1R3LB 1MI5A 2YUWA 5HBBA 4LARL 5CJ5A 1UC6A 3DUSB 5JORB 4R4ND 1YY9C 1IEHA 1CTNA 4UOJA 4BJLA 4EUPG 4L8SA 2BC4A 1FE8L 4LLUB 3BXNB 4UNUA 2D7NA 2GJ6B 3RTQC 3SDCB 2R0WH 4NQCD 5C6PB 4CAGA 4ZAKA 1DLFL 1YEGH 5DJ6A 5HYJD 4FFYH 1XGQA 1PDKA 1IAII 2F5BH 3ECBB 2UWEA 4JO3L 4HMDA 1N2RA 1F00I 5E8EB 5E8PA 2CRMA 3JSSA 3MRHB 4LRIC 1BZ7B 4OGYH 1JMZA 1UXWB 2ARJA 3V5HA 2EDWA 1LD9A 1AO7E 3EOTH 1AY1L 1BD2B 1RD6A 2YD5A 4NO5A 5I1GH 4MDJB 5F3HB 5K59F 1CD8A 4BK5A 1HQ4A 4JLRB 2Q6WB 5BCAA 1JRHL 5MI0B 4FHBD 3SE9H 5CEZD 4OCMC 4MNGA 3RPKA 3V9FA 5KANG 4GS7C 3WIFA 2P24B 4MNQD 3F8UB 4PJEE 3DX8A 2HTLC 1MIML 4FS0A 1YNTA 4H8WL 3TH2T 4E5XA 3P4LA 5EUKB 5HJ3A 4DTGH 5BS0E 3GM8A 1T83A 4RDQF 4W4OC 4OZIA 4KROC 5LJYH 3MLZL 4G42A 4B50A 2VQ1B 1OAXH 1EA9C 4Y2DC 2OZ4H 4KV5F 5GGTA 1HZHH 4OLEA 3LD8C 4NT6B 2AERT 1NDGA 4EEEA 4EXKA 3QDMB 1RUPH 3HFML 3K80A 4TULL 5BVJB 4LIQE 1EXUB 5F7EL 4BZ1L 1JZ4A 4QHNB 3EKCA 5C08A 3ZKND 4ENEC 5HVHC 5EZIL 1FGVL 4LHUB 5B8CC 1UZ8B 5I73B 3O11A 2IANB 1FSKB 3D2UA 5DD0L 5DHXB 3TT3L 3WXWL 4NSKA 3K1KC 3CZFB 1I7RA 1I1AD 1C5DB 1OW0C 2E8ZA 4K23L 2FCBA 4G6AC 3JWDL 5HPMA 2W60A 3KPSB 5SWZD 5INCB 5GGRA 4Y2DD 4I0PB 3G6DH 3WCYA 5EULV 2R4RL 3TBVA 1CFNB 2X4TB 5E4EC 4J3WA 1SJHA 3QAZC 1MRCL 4MSWB 1U8JA 1CIUA 3QZWG 2WBJD 1U3HD 1E6JH 1ZHKB 3O0RH 4LCWB 2P4AB 4PGBA 2R0WL 5IB2B 4HUVA 4RAHA 2D7QA 4Y19D 4JJ5A 1NEUA 4G3YH 3O8XA 1N8ZA 3Q6GL 1X5IA 1MCDA 4HC1H 25C8H 3BIKB 4G8GD 4XI5D 4YH6A 2CGRL 3QI9C 1RU9L 2FD6L 3CU1A 2I9LA 3KPSD 2GUOB 5F6IC 2X41A 5LQBH 3PP3H 3QQ4A 2OQJA 3RWHB 5C0IA 1E4XH 1FG2B 2HKHL 5DJYB 2WK2A 1OGAA 2VB5A 3MRBB 1WZKA 2X7LA 5DRNA 3W39B 4CGTA 2Z31B 1N0XH 1M7IB 4A2MA 2EIEA 2D03L 3OGCA 1PX4A 2H2SC 1F6AB 1KNOB 3X3FH 1QZ1A 4JFYA 4M8QB 3QHTC 4AH2A 1AD0B 3IFLL 2FHFA 1IFHL 4PRHE 2DQIL 3U0PB 4B41A 3MREA 1EEYA 2UZYB 5EBWA 3RVTC 4CNIB 2VH5H 5AAMA 2AXGA 5T5NF 1X5FA 3REVA 1EVUA 3HNVH 1T22A 2AK1L 4JPWL 4P5MA 5DMKA 1BEYH 3P11H 4DEPB 3SQOL 3TVMC 1AGBB 2H32B 1JCKA 3U9UA 3BYTA 4LCIH 5BRZB 5EZLB 4X6CF 3PDOB 3BZEB 5HD8D 4QEGA 1CVRA 5BRZA 3BN9C 1UJ3A 4PRBB 4H88L 5EBLA 4WY7H 5TDPA 1T7WA 1T1YA 2Z8SA 1BFVH 4YWGL 4MJ6B 4DKEH 4I0CC 4HWZA 4PPTA 1PEZA 1UKTA 1SBBA 3C5SA 1SBSH 5D1QC 1IM9A 1FVEA 4KDVA 4X6CE 2P47B 1H5BC 5I8KH 4PJGB 5D70L 4FNLH 1NMBH 2X2YA 2EDTA 3WUWG 1IAOB 4CVUA 2Z93A 4JFQA 3SY0A 4HT1H 4PR5B 1HOCA 5FO8A 1HINL 2B1HH 4PGDA 4UTAL 5BVPH 5K93A 4O4YH 3RDTB 3HI6H 1BJ1J 3WFCL 1NLBH 2G9HA 4FQJH 4UU9B 4B5EA 2E9WA 1QFWI 3IDYB 1A2YA 2JJSC 1WWAX 4PTTB 3I50L 4G6JH 1L9NA 1YC8A 3IXTA 5E95B 5GGVL 4PLJC 5GGRY 1QKZL 2CO6B 4LDLB 3MV8E 4L9DA 1XR9A 3IXAB 3VFTB 4ELMA 4G7YL 2NY5C 1F4YH 5DJDB 1I85A 2I9LB 5FUZL 3VG0H 1CL7L 3TNMB 3PXHA 2KH2B 3F7RA 3RWFB 4J8RB 1EJOL 3O45A 2Y6SD 3WFEH 1ZA6B 5EA0H 1A21A 4J6RH 3H9SA 3KWWA 4KI5E 4ZFOA 1BJ8A 1NEZA 2BK8A 2J8UB 3S96B 3KDMA 1QLFA 3MACH 4KFZC 4OI7A 4MHHG 1FFQA 4LIQH 1F6LL 3VFWA 2FR4B 5TE7L 4BQBA 3ZE0F 4Y4KB 5SWZE 1CGXA 2AV7A 3CCHA 1Y18B 4LLYA 4JFFB 5I30H 5CMAA 1HEZA 1BAFH 4DGVH 1MHCB 2ZCKH 4IRJA 5D5ME 5DI8A 5E9DD 1PQZB 4O9HH 4NO0B 3SGKA 1PGRB 2PO6B 5I17B 3SKNB 4EIGB 1ZVSB 4JFHD 2X4UA 4HIIB 1VPOL 4OZFA 3WFHB 5TQ0L 5I16B 3W5MA 1KPVA 2MJWA 5JUEH 1LMKA 1RZJL 1ZTXL 4HXAL 3ARSA 5IF0A 5JZ7C 5GZND 1HXMA 4BUGA 3N9GH 1ZT1A 1YY9D 1RFDL 3GGWB 1D3CA 1I1FA 3MOAL 5CIPB 1S78C 3WLWD 1JWUA 4APQB 1YJDL 4F57L 1MCPL 1S9XA 1EDQA 3H9YA 1UWEH 1W0VA 4RAVB 2CO7B 4NNXB 4GW1A 3SKJH 3O9WC 1D5XA 4C83A 5C9KA 4EQ2A 3BIAX 5ACMA 3QO1B 1RUPL 3HFMH 4KZEH 2ZSWA 4PJHE 2APVA 4BQ6A 5KG9B 3VH8B 4L3ED 4IRSD 3C5JB 2A73A 5HHMD 2EH8L 4H1LG 3UTOA 2FLRT 3LAFA 4XVTL 4A6YB 1OGTB 4R0LC 3BAEL 5GIRA 1HHJA 4ZFGH 5CFHA 3MZGB 5H35A 4Z7NF 5CSZA 4N0FB 5I9QC 3OKEB 4JR9H 4HLJA 4FQQA 2XN9D 3MRIA 1CGSH 4K9EH 1VGKA 2FX8L 5ANMA 3QCVH 4JO2H 4AG4L 5BV7B 5BV7L 2C1PB 1FZMA 5B39A 3ETBF 2G75B 3P9WB 5E24E 3ARFB 4P48A 2FHBA 1LO0L 1EERB 2YPLE 4HIJB 3KPMA 2VLRD 3E1F1 2CIKA 3L6FB 4RFOL 2UWEF 1L6ZA 3A67L 4UNVA 4JY4A 3E6HB 2VISB 1OAYL 5E8EA 4FQCH 4M6NH 4PJ5A 3MV7A 3T2QA 4GRLD 2E7HA 3H7BA 4QHNA 1XGQB 4XWGL 5CJXA 4XXDA 3ZYOA 4LP5A 4NHCL 5CP7A 4FTVB 3EJYD 4L3AA 3VI3E 4GAJH 5DT1H 5JOPE 5KSVA 3BJ91 1BX2A 5DVLA 2FX9H 1QNZL 2MSPA 3MLXH 2WMPA 2WWKO 5DK2B 4LCUB 1TCRB 2EDFA 1A22B 2RCSL 4OCRH 2EDYA 4MJIE 4XMKL 2XXMB 1K85A 5GGTL 4PJIE 5HYQB 1C5CH 4N0UE 3BQUD 4NUGH 2V2WA 4WW2A 1AE6H 4NNPH 1S3KL 4IOIB 3SDXE 3QJFA 3DUUA 3VGAC 1ZHBB 2FWOB 1DN0B 5IJKC 4CUCA 4G8EB 3VFRB 3JTSA 1ZGLM 4OQTL 4Y7MA 5EUKA 2PNDA 5HD8C 2WV3A 4GRWH 1YNTB 4LKXA 5EU3B 3ULSB 5FYLL 4LPUA 4ZPVA 3TO4C 3BPLC 3L5HA 1AXSB 4EOWH 2XI9A 2VZ1A 4DW2H 1WWCA 1CXIA 1OWRM 3M1BB 5C0BA 5KZCB 4M61B 4JG1H 4LCUA 4E0RA 5J57B 2D7OA 4MA7L 1T03L 5KAQF 3F6LA 5IROC 1CK0H 2WLYA 3PQYA 1LEGB 3VRJB 3GSNH 3MA9H 4WO4A 1W72A 2CUIA 3PL6B 3SJVB 5DMJB 4PV9A 3F5WA 1S7UB 4NGHH 4X6EA 3L3HA 4HK0A 3OJMB 4JY4B 2BNUB 5BV7C 2JCCF 4QXTA 3VDAA 3ROLA 3PWPD 1O5DT 1XGPA 2E7LA 4TUKH 3CU7A 4R7DB 5DJ0B 4X7FC 3MXWH 3O9WA 5F9JB 1CICC 1FZMB 2M2DA 3VMOA 1X6LA 4NO0D 4XMPH 4PJAE 4DUVA 5EOCH 3VXTB 1FPTL 1GGTA 5CZKA 1V3KA 4LFHG 5DD6B 2B20A 5DLMH 2J8UF 2D7MA 4P4KA 2ED9A 3VW3L 1JIBA 1MI5E 4ONHA 1F02I 2KBGA 1KFAH 1KCLA 5JIIA 3HHRB 4GMSH 4OZFG 1OSPH 4XPAH 2HJLB 3IU3B 4UT6H 2WANA 5FECB 3OJ2C 1IL1A 4X6DB 5FB8A 2DICA 3QEUA 2IFGA 2QQLH 4WI7A 4U2ZA 1YNKL 3GDBA 3NCYP 2IH1B 1MLBB 4DZBB 3P11L 4PRAA 3RWGA 3N1GC 4X7TB 1UACL 3SKJL 3GK8H 2ZZUT 4XCCH 4NQTA 3CLEL 3MR9B 3LSOA 2WQRA 1M7DA 3WFBH 2G5BB 2ZNXA 1LK3L 3ARED 4Y16C 5CJ8A 2WW8A 5CEZH 4L8DA 4OF0A 1VADA 3X13A 1KEML 3GEWB 3AMKA 1VGKB 2DQTL 5F1IB 4Y1AB 1VDGA 1R3JA 1U8PB 1IGJA 3FN0L 2EYTA 4PD4J 2NR6D 2Q1EA 4OV5B 3ZE0E 1B9ZA 4U3HA 2L4OA 1G7QB 2X4PA 2R1YA 1FH5L 2FH8A 4F58L 4HW6A 4JVWA 5KVFL 3OGOE 4PLOB 5IHUH 1OTSC 1CD9B 3CPLA 3MOBL 9CGTA 1JK8A 4QRRD 1E28B 2YA2A 3QDJA 4LSQL 4HKBB 2OTWA 4NBZB 4X5WB 3T0DA 3C6LD 4HDIB 32C2B 5DK2A 2PW1A 1VEOA 2F19L 2DBLL 1G7MA 2ADIA 5EU6A 4C56B 4W81A 2YN3A 1CLZL 3TO2B 2BNQD 3HMXA 4GKNB 3BHBB 4TSAL 2AJYH 5TDNA 3FFCA 2R39A 1ORSA 2Q8BH 1CXEA 2PYFB 1ND0B 4ZFFB 4IOFC 4XNMB 1YYLL 1HI6B 1I3RA 1NCCH 1XF4B 4M62H 1YDPB 1OAQH 4ODHL 5JW4N 2PTVA 1T6WA 4OD3H 2AGJH 3RKDD 3VXUD 1EEZB 3FOMB 3V4UH 5EDXA 1QLEH 3PWVA 4ZUTB 1T0MA 2CK0H 2YXMA 5D72L 1BIHA 3H3BC 4DK6A 4JFQB 3PE9A 3SY0B 3HC3L 3OF6A 3QI9D 3QA3B 1LO2L 3IFPB 3UPCA 1HDMB 3MJ7B 3VWKB 1Q0XH 1S7TA 5C0FA 4TSBL 4JPVL 2XA8H 4PJ8D 3ARDB 1NCWL 5GGQL 1P7KA 1FVEB 4RFOH 4YDKH 3PHQA 1KF9B 1D5MA 3NABH 5D1QA 1KG0A 2DQDH 4U0RC 1F2XK 1NAMA 3EBAA 4HAGA 4XHJD 3BW9B 4ZFOB 4RRPA 3B9KD 5JHDD 2Z4QB 4KK9D 5I1AA 1KELH 1UM4L 2ZUVA 2R1WA 3RGVD 4EI5D 1MLCA 3RWFA 2Z35B 5IBUB 1CICD 4MXWL 2DDQL 4FTVD 1OGAE 3GNMH 4P4RA 1XR9B 3P4MB 5EUOE 4GBXC 3DTXA 2HLAB 2JJSA 2YPKA 3UBXB 4Q6IB 5F7FA 1U8QA 1KLGA 1BBJB 4PJ8B 5FCUL 3TN0B 2LAAA 1FNAA 1PX3A 4UT7H 3RDTC 3PGCA 4YBLB 1KGCE 4AENA 1U95B 3QIWA 1GOHA 2K3TA 4S2SB 5K9OB 4GXVL 4FN0A 2BZDA 3GSNA 4YNYB 5I16A 1Y6KR 3UTZB 5JDJA 4JFPA 4DKEL 3BPOC 5CKAA 1LE9A 1BOGA 2B8OT 1MRCH 2BY3A 2HFEA 3LRSB 3UTTD 5IQ7H 2MHAB 4WJ5A 3PL6C 3DSFH 2F54A 5DWUH 4U7KA 3MLWH 3REWB 2YSSB 3GMQA 1PW3A 3QCVL 1NMCB 2NX5A 4EUPH 1J11A 5F72S 3TM6A 1ED3A 5TF1H 3ZDXE 4OD1L 2JJVA 3QEQE 4PJBA 1AQDB 4UV7H 3BDYH 4W4NA 1CXKA 1YY8A 1ZMYA 4TSAH 4CVZB 4P9HH 3MRDA 4JFEB 5FGBC 4QOKD 3L3OB 1OAYH 3VMPA 2VDOL 1KCRL 5F7MC 1CU4H 4OM0H 5DQ9B 3DNKA 3CLFL 4WHYH 1CIDA 4FFWD 1AGEA 5JA8B 4HJJL 4OGZA 1KJ2B 3FT3A 1Z5LB 1XF1A 2R8SL 2DI9A 2W9DL 5FA3B 1DVFD 4XVSH 3E2HC 2VRAA 5BRZE 5HXMA 1U0QA 1MPAH 4NQED 2NTFB 4ZS6D 5ETUA 2O5XH 4WTZA 2Z92A 3T0WA 4PBWD 5D1ZC 4LL9A 5E6ID 1Q9WB 1BWWA 1JF1A 6FABL 3BP4A 1FSKC 5K9JL 1UJ3C 2HT3D 4JM4L 1A7QL 4HH9A 2ZUXA 2HMIC 4JDVB 2GSGB 1H0DA 4G9DA 3BP4B 3NTCL 4OKVB 3TA3D 1ZHNB 1I1AB 4JFFE 3CFCL 4LCWE 1TVBA 1J1OL 1TPXB 4Y5YC 5JW5B 1FP5A 1JGDA 1EH9A 3SE8H 1DDHA 1A9BA 1X4XA 1PSKH 4PYGA 1BQUA 3GM0A 4Y16B 3AS2A 1HN1A 2IAMC 3IETA 1F58L 4Q58C 3GNML 5DJAA 3PV6B 1C7SA 3AMLA 4M9OA 1VFAA 3UC0H 3VG9B 4HZAA 3SGDI 4NUJB 4R3SB 2ARWA 4Y19B 3QNZB 1HILA 1UCBH 4I5BA 5ALCH 1Q9LA 2A6JA 1QSEA 3QEQB 4LMQI 2R2CA 3FT4A 3VXQB 3SGDH 4OLYH 4Z7NE 5T1KD 3GSNL 4OFVA 3U7WH 3V52L 4XNYH 3TCLA 3ESUF 3LEVL 5I9QB 3I84A 4QRUB 3LPFA 4M1DL 5ADPH 5IK3A 3TT3H 4XCFL 3WXWH 1ERNA 1FL6B 1NANI 4DUXA 4HFUL 3SBWA 3HG1A 3NBNA 3S36L 4HKJB 1T0PB 1UZ6E 1UWGH 2OXHA 3WIHL 3VU2A 1EIBA 2DWDA 4GQPH 4QTIH 2O93L 1TVDA 3C5ZA 3O6FD 1WQVT 2GYSA 3V8CA 3TP4A 1ZLUH 1YQVL 3KLHC 4HUUA 2X09A 1ETZA 1KXTB 3DIFB 5F1KC 5IHUL 2R2BB 1S9WB 3L5IA 5CZXD 1JWSA 4LPYA 2VE6A 3V5DA 1A7BA 2V2TA 5E2TL 3EZJB 2OTUB 5EUOB 5HHMB 5E8PB 3S97C 5AG9A 5IB4B 2UWEB 3AM8A 5JIHA 2JTDA 4FG6D 2CIIA 4X8XA 2VZ3A 3V2AR 3I9GL 1MHHB 3BFOA 4KHTL 2NX5D 2OLDA 5DJZA 2HT4C 4O2EB 4P23B 4ZMAT 4P4KC 1JYVA 2VWEC 1SY6A 4YDVB 2HJKB 3ARGB 1FNHA 2WINA 4JRYA 1V3MA 3RIFK 3MBXL 4ONFL 1FFPB 4G8FA 2P5EE 4GG6B 3PXJA 5IB1B 4MD0B 3T4AB 3H9SD 1AHWA 2W92A 3BISA 5L8LB 3QNYB 5LVEA 2CPCA 1RJZA 4XVUC 2QSCL 1I9RH 1NUGA 2W07A 2IANE 4F15B 3OAYK 1A4JB 3OWEA 4P2OD 3VXTA 2L0DA 2X4QB 1O7SA 2C7UB 1J1OH 2WLZA 1EUUA 4UINL 5BS0A 4JM2A 5C6TH 4FQHB 1BZ9A 2NW3A 2CJUL 4M6ML 4LSTH 3IDJB 1RUQH 5ESQA 1BD2E 4PLKC 2IF7A 2P8PB 1DR9A 1S9YA 3CAFA 3KPOB 2DLGA 4HWBH 1OCWH 3HAEG 1ACYH 2VN7A 3U2SB 1EX0A 4ETQA 4O2CB 2YA0A 5TH2A 2P44B 3P9LA 1CICB 1F3JB 4LSVH 4OM0L 2YK1L 3LKOA 1RULH 4LQ1A 4PP1C 4Y5VB 1KULA 1NGQL 1DQQA 3BEWA 3GB7B 2GK0B 5D7IE 5F7EH 1MREL 1L7TH 5CJQH 5E6YA 4ERSH 1G7LB 4DOHB 4F9PA 2E9IA 1T2JA 3IDMA 3OXSA 3VXPB 1CD1A 1NMBL 3DVNB 2HLFD 1YEEH 1BFTA 2NXZC 1I1CA 1FFNA 3L9RA 4GUPA 5CGMA 4NWUH 3OJDA 2PCPB 5JXED 3ARQA 1CDBA 1V3LA 5AD0B 2XQYG 1CLYH 3B9KA 5JHDA 1RJLB 1PY4A 1A14L 1HH9A 2YWZA 4JKPL 1JZ5A 2PO6D 4F37K 5I18L 1X4ZA 1KTLA 3HG1D 4TYUA 2DN7A 3PGFH 2C3VA 4O2CA 2CLRA 3PQYE 3SDXB 1KTDB 3U46B 1RHHA 4S1DC 5F1NA 1MIEH 5J6GA 1KIUA 3QG7H 4OBRA 5T5FH 1CU4L 5C0BE 2HT3C 1IAIH 4OLWH 3EFFA 4PRIE 3H42H 2MOVA 2FDBP 1WK0A 3T0EE 4LVHC 2R0ZH 3GI8L 4TSCL 4NNPL 4ZD3L 5TGBA 2D31B 5EOTB 1YEDA 4U05A 4P5KB 4OLUH 2CDGB 5ERWA 4Y89A 5F9OH 2ENYA 1E27B 4LVHB 1R5IA 2OP4H 1BAFL 4WGWB 5D7IB 4DKDC 4BUHA 4CU7A 5JOEA 1M4KA 3EOAB 4WFFD 3FKUS 4XCNB 4XZUB 1G7HB 1LK3H 5J8OA 5ID0B 3KYOA 2W91A 2DOCA 4ODSH 3O4LA 3BN9D 4GXVH 4LGRB 3OHXA 5C07E 2HRLA 4KZDH 1PKOA 3DYOA 4UTAH 2J8HA 1NKOA 2NCMA 4PG2C 4ORGB 2V5SA 2WIIB 5IVXF 2LE9A 3QCUL 2GK0A 4M6OL 3KLAB 3GSQA 4U6YB 1OQOA 3BI9X 3OPZL 3IDNB 4LHQB 3HNSH 1R24A 4Y5VA 1T80A 5BQ7A 2Q8AL 4I9WE 4GMTL 5B8CB 4Q0XL 2XTLA 3BIBX 3TBWA 4LSUL 1E6JL 4U1NB 5I75C 2CMRL 4UQ2A 1GGBL 4RFNC 4F8QA 2H3NA 2MCG1 4HBQA 1TTUA 2P5WB 3QWOB 2NY0C 4S1QH 1NUDA 1ZLVH 4CVXA 3ZMRA 4MCYA 3WE6B 4D0BA 4RFEA 4KUZL 5ITBH 2BSTB 1HXYA 3ARBB 1NBYA 3KYMB 2VXVL 1FPTH 3LPWA 2LFGA 3WSQH 3GMRA 5HVHB 4KRNA 3WIIL 3EZ8A 3RGVC 4Z7WF 4M8VA 3STLB 1U8KB 1C12B 3HS0B 2GCYB 1GC1H 1NCTA 4P49A 4P3CL 3RWEA 4MNHB 3BT2L 5C0AE 4MXVF 5KW9H 1B2WH 2IAND 5T1LD 1OSZB 3CD4A 1CQYA 4M9PA 3X3FL 5JW4M 2XPGA 3U1SL 3GMMB 3AROA 4EXPX 2ED7A 2QBWA 5HGBA 2BOBB 1YPZA 1NGYA 4M7KH 3H9SE 2ORBL 4WWKB 5EOCJ 2GFBA 3MODL 4UUJB 1UFUA 1U91A 3QO0A 4PJEF 1MY5A 2L7JA 1CDCA 2GT9A 3CVHB 1KB5B 2IQ9H 2AKRA 1W0VB 4RAVA 4XCEA 1R3IL 4O2FA 1MSPA 4RGNE 4ZOAA 2EXWC 3LN5A 4FOMA 4PLNC 4IS6B 1P4IL 4UB0L 1A7PL 1I1FB 2EDRA 2AJVH 3QUZB 3C09C 3LB6D 2ATKB 2I9TB 4C59B 4JY5H 5E2VL 4P57A 3RU8L 5DRXB 5F7UA 4ISVB 1AR1C 2ZKHH 1XT5A 2YA1A 4JB9H 4ZODA 3BD4A 4OZHE 3NFPA 2A6IA 4NFDA 1W8OA 4O9HL 4P2RA 5GSVA 4AEHH 2C4XA 1U6AH 4HIEB 5CSZB 4GRLA 3QUYB 5EFIB 1MFEL 3T1FA 2DS4A 3HG1B 3MGTA 3WS3B 4HQQL 1JV5A 5D93C 3OL2A 1VB9A 1OTSD 1C1EH 2DYPD 3SPVA 1IZJA 1VSCA 2R69H 1TETH 5KVEH 5IQ9B 1TQCC 3VXUB 4PJGE 2BMKA 3KYAA 4OCYL 4MVBD 5CZVL 5KG9A 1NLBL 3F7YA 4JFZL 3O3BA 3TN0D 5FHBL 1T20B 1GVIA 3BKCL 4XVJH 4QRPD 4QXGL 3JWDC 1A7NL 1QFOA 4RQQB 1D5XB 4CKVX 3ALXA 3DROA 3D25A 5T1KB 1P2CA 2F53E 4HGWB 4N8CH 1Q0YL 3OJVC 2WSKA 1C16B 1TZHA 4TQEL 5HYSB 2EDJA 1JHKH 2CRIA 3SHSA 4KKAD 4NJAL 5LKNA 1KJVA 4AEIL 1RUKL 3JUYA 2VLJD 3NIDE 4CMHC 4LLVB 4Z7UA 2W1NA 5HHPB 1YEFL 1EHLH 1FN4B 3PGCB 3HE7D 3PNWA 3MRNA 4R4FH 2YMXL 4X0KB 3LIZH 1UEMA 1OTUC 1QACA 4YC2B 4MXVE 4P9MH 1A6UH 3QUZA 4LPVA 4L8CA 4MAYC 5J0BA 5SWZB 3L3DA 3MGOA 4Z7VF 1DVFA 5DRZA 4FZEL 4X4ME 3RKPA 3CVHA 3MV9A 5IJVA 2AKRB 4LEOB 3I6GB 5C3TA 3MLTB 4PJXE 3CFCH 1DUYA 2QLVB 3QRFM 4JZNA 5JIKA 4KUCF 1DUZB 1UXSA 3UJIH 1HYRC 1R0AL 3W0WD 2DM3A 2EIDA 3QUMB 3UAJC 3DYPA 3GBNL 4MLIA 4AEEA 1JTPA 3ARDA 5L2KA 2RQ8A 1X9QA 3P4OA 2AK1H 4D9QD 1DE4A 5I1LA 4K71B 5I0ZA 3DVGB 1SVCP 3SDAA 5I1DB 4DGYL 1F3DJ 1G6RA 2HVJB 3JBG7 4F7MB 1QQDA 4U1IB 1CXLA 2AJSH 2HG5A 4LLAA 5IVXB 3STLA 5FYKD 2D7PA 4TRPL 4XBGB 5FYJU 5T33H 5GRXG 3CZFA 3BH8B 3H0TB 4IDJL 4BZYA 4HPYL 4UDTB 4XP4L 5LG1A 1IGTA 3SDDB 4J2XA 4IHOB 4HKXB 1YEJL 3UTTE 3WJLA 7CGTA 4ZSOA 3CUPA 5DEFA 4WGVB 5A43C 2CQVA 3RQ3A 2LTQB 1OVZA 1WZLA 4OLZL 3MRJA 2Z31A 1Q1JH 4UNTA 4X5XA 4OUUA 5JW4Q 2DMBA 3C6SB 4X6BB 3QWQB 5IGXL 2XV6B 3JV4A 1F2QA 4HWEL 1MJJB 1X5LA 4F9PC 4KTEH 5HYSA 5L2JB 3T65A 2C3GA 4P2QB 1YEGL 4P2OA 1MLCB 3UJJL 5EU4A 3QP3A 4ZQKB 3FO9A 1N6QL 1EFXA 1DVFC 5BJTA 5E2JA 3BW9A 4FQCL 3GRWH 3W0WB 2EE6A 4PJFE 1NJ9B 5H8DA 1FVCA 3MLRL 4RMTA 2YC1B 1PD6A 5EPMA 1HSAB 4XX1G 2P24A 5AEAA 3V4UL 1QPXA 2BSED 2DL2A 3DXAA 3QXWA 5D7JD 1DJSA 5T3XD 4WFEE 1I9JL 3HRZA 4U1GB 3ZO0A 3VWKA 2FSEB 1ZT4A 3L3GB 1FIEA 3LDBB 5CCKH 3JTTA 3QDJD 1JV5B 4GRLC 2OJEB 5CINL 4HIHA 4JGMA 2CDEA 5GPRA 5EZOL 1S7XA 2VN4A 2XWTB 1Z6JT 1A1NB 5FYKH 4POYA 3OR6A 4PJHA 4OF5A 5IIEB 2ZCKL 4XBPB 1AKJA 4YUEH 2GTWA 1JPGA 4QF1B 2VLKA 2MCPH 2J4WH 1GZQB 3OAUL 3Q48A 5CZVH 1RHHB 3OKNA 4H20L 2GJ6A 3SDCA 1LK2B 5J6GB 5ESAB 3MUHL 1IAIL 3RI5K 1U9KA 3WXVH 1LP9F 1KTLB 1MVFA 1GGUA 2Q3AA 4NPYB 1JF5A 3RWJA 5C9JA 4FQXD 3JV6B 4RISH 5E5RB 4PG9A 4ZNEE 4IRSC 1E4KC 1CFTB 4MYWB 1RURL 2W9EH 1KN2H 3ISWA 3RNKB 1KXVC 1I8KA 1F4YL 4WI9A 1GH7A 1QR1B 2A1WH 3QHZL 1OQXA 4QRRE 4MX7A 2EZ0D 1T7YA 2EYTB 1MWAL 4KH2A 4MS8C 3MO1B 4PYHA 1CFQA 3QIBB 5GGRB 1IGIL 1UH2A 3BP7A 1OAUH 4FQLL 1HKLL 3C6LB 3ULUE 1LDSA 3BGAA 4FQJL 1GOFA 1HSAA 3HKFA 4IEFB 5IOPB 1OB1B 2VLRA 1ZLSL 5FYJL 4D0DB 2ZOKA 2FZ3A 3QUYD 3EYOA 3WDJA 1F3JA 4MCYB 5GZNC 3SDYL 2GY7B 4OGAC 1IC4H 3C5ZC 4HWEH 4GKZB 3FZUD 3TIEB 1OP5K 4N1EA 2KZWA 4P2OB 4JZJC 3IB4A 2LVCA 4N0YH 3U2SA 2OL3L 5FO7B 4HBCL 4D0BB 3DLQR 1FFOB 3WHXA 1DSFL 2OXGA 3VFSB 4UMGA 3U48A 4XPTL 4PRPA 4UQ2B 5IIEA 4R2GD 2IH3B 4PJAB 1T66D 5BXFB 5FXCH 3CVHH 1WTLA 1G7JA 4U6XB 4RIRB 4X9GA 3LKRA 4LSPL 1A7OH 1KC5L 4UAOC 4Z7QF 5ISZB 1IC7H 5IBLC 5A2KH 2ADGA 2AJ3B 1BFOB 2FJGA 5SWQB 3RVVD 3BGMB 1OP3H 1KCVL 3ZKSD 2EO9A 3ALPA 1DEDA 3L1OH 1UA6L 1UYWH 2EYSB 4HULB 5T1LB 5IJKA 5IB1A 3IFLH 15C8L 2WBJC 3HR5A 2AXHA 4NHUA 5CILL 1H3PH 1CTOA 3NIFE 4MWFB 3GI9L 1KJMB 1NFDB 1U3HA 3FQUA 1IMHC 1U8HB 1VA9A 3IJHB 4XXCA 2E9JA 5H94A 4G5ZL 4V2BA 4N0YL 1KTKE 4M7KL 1I1AC 4MJ5B 5C0JB 2DI8A 4WCYH 2JCCA 3R8QA 4Z9KB 4MQXD 2EXYC 5ALCL 3QT2A 4PRPE 4YR6B 4RWYH 3QUML 1GGIH 4TUOB 2V2TB 3MRKA 4FQIL 1DFBH 3L5XH 3AREC 5HGDA 4QXGH 3ARFA 3CSBA 4AQ1B 3RJQB 5DEGA 3EFFB 2B7DT 4CN6A 3TIEA 3ESVF 1QHOA 5HTSA 2VUOA 25C8L 1CGYA 1K4DA 1LO4H 4RCAA 3CZJA 1SQ2N 4W6WB 4L4TD 1GAFH 1XF3A 4PB0L 3QPQD 4LASL 4ZO6A 3MYJA 1YYML 5DC0A 1PVHA 1JHKL 1WFOA 4OCSH 3NIDF 1M6OA 5DHVA 2FZ3B 4OD2A 4YPGB 3WUWB 1MNUL 5MEOA 3PGFL 1D6VL 15C8H 5E8DL 3MLXL 4JDZA 3BWAA 1B0GB 1KENL 5HI3D 5EB9A 2B0SL 3RIFF 1FFNB 3L3JB 5CJXC 1LWRA 4ETYA 2VLJE 5C07A 1DQML 4DKFH 2OCFD 1T5WA 2KUTA 3EYQC 4MJ4A 1P2CB 2D4DA 2OS7A 2YPLB 3BPNB 1BVLA 1V05A 4P2QE 3D0LA 5GS1C 5E99H 1CE1H 1QEWB 1FAIL 3FB8B 5JQ6H 3OF6D 1OCWL 4YHYC 3RJDA 2W59A 1OLLA 4WV1B 3V6OE 4LEOA 1I8MB 3NN8B 3IGAA 3EDJA 5DUBA 2AI0L 1J87A 4KKLC 5D2LE 4YXLH 4GW5A 4YZFE 1JGDB 2YOCA 2DYPA 1Z9MA 1I1AA 2V5TA 4LRIA 2VZTA 2JCCB 4HX1B 4CDHA 3GKWL 3ILPA 1DLHB 4H88H 3KHQA 1I3GH 1KBGH 2NW2B 5I8EB 5CMAB 1LEIA 3OQ3B 2O5ZL 2Z31D 2HJFB 1TQBC 4MQXC 2P8LB 4Z7UB 5HHPA 3VXRD 3FRUB 2YPLD 4ZUUB 4XB7A 5GSRA 4M7JH 5FM5O 3ULUH 1T0NB 3WL9A 2VDRL 1UKSA 3MFFA 4M6MH 2JB6B 1INDH 2KKQA 5F6IB 4OCNC 1SEBA 2CK2A 3K3QA 1IKNA 5D1XA 2PXYB 2I27N 5JO5B 4EBQH 5DYOA 3K74B 1D9KA 1EFXB 2YD4A 3NN8A 4Z76A 1MVUB 1KJ3L 1MFNA 5I1GL 4P2OC 2GAZB 3BKJH 4M02A 4YBHA 1DQJA 3OKDB 1NJ9A 1IGML 4F7PB 5MEPA 4Z7WA 3OR7B 1GXEA 4XHQA 1KUMA 2W0KA 1SEQL 3BPLB 5T3ZH 4R2GB 4U49A 3AAZB 3QDGA 4LLMA 3OAZH 4YZFF 2VE6B 3SOBH 3VRLF 5CIPA 1TLKA 3KPPB 4LGPB 3S6CA 1F3RB 4OLYL 1CE6B 2Y07L 4KRPC 2BY1A 4KHTH 35C8H 2W9EL 1XH3B 3HZVA 4PRHA 3BYYA 2I25N 1G1CA 4IHOA 5F9OL 5K9KB 1QRNA 2WQ8A 1LEKB 1ZE3C 1QTYT 1RUAH 4I2XA 4QHMB 3BH8A 1S7VA 4AM0B 1HQRA 1TFHA 1GOGA 5E56A 1G9MC 3DHJA 1ITCA 1ETZB 3ROOA 5D7SH 2BRRL 4AM0A 1QSVA 1QQDB 4U1IA 5D6CA 3CSYA 1DQMH 2IG2H 3L95A 1ZS8A 1YQVH 3MNWA 3CXHJ 5J13B 4GOSA 3PG2A 3R4DA 2CKBH 3C08L 5E9DE 4IRZL 4IMKA 4HD9A 3BH9A 4P59H 2CKBA 1P4LA 4TUOA 3RY5A 4AIZB 2HH0L 1Q8MA 2F53B 1CBVL 4OAWB 1MCLA 5TE6H 4R0LA 3VD4A 2VIRA 4Z76B 1CGTA 4K23H 1ZXQA 1OAZL 4O51A 1WBXA 2NXZD 3LEXA 1MCRA 1PLGL 4TUJB 1SYSB 3OKDA 5C9JB 4Y8DC 4YHLL 5I76A 2NZ9D 4HXBL 2GTZA 4NN5B 1EO5A 4U1SA 1LILA 3MRLB 4AL8H 5DFTA 1AD0A 2NY5L 2DQHH 1KPUA 2IPUK 1LP9E 2HFTA 3GBMH 3V4PL 2NXYC 4HS8L 3IU4H 1NC4D 2QV2A 3L95B 3KYOB 3THMH 3JVGC 4GRWE 3MNVB 4OZHB 4ODSL 3DPBA 1NSNH 4NZTL 3RTQD 4Z78B 1D6EB 5T3XE 5HDBF 1J10A 4KI5C 1HQRB 1MWAH 3NCMA 3K46A 3T77B 2NNAB 4ZTOH 1V7NL 3D48R 3MRNB 5K9KA 1MWAA 3GO1L 4BQ8A 1N64L 4OZGB 4DAGL 4PRPB 2HMID 1K2DB 3QG6B 1N4XL 2A6KB 1A7NH 2R23A 4KQ4L 4H26B 2DRUA 3VRIB 4KTDH 4R26H 5E2UH 4LCYA 2GTZB 5CEYB 2OTPA 4HKBA 2CD0A 2XZAL 4YK4B 4K8RL 2M26A 4X5WA 2BCKA 4LU5L 4FQXB 3WKMH 4DJMA 4XP1H 3TEUA 4F7TA 1OF2B 4YLQT 1F8TH 3QH3A 4EUPB 4YC2C 1FYTE 4YHYB 1AGBA 4XAWL 5I19H 4QT5B 3SPVB 3LS4H 4YX2H 4F7TB 2CKBB 1VESA 1C7TA 4JPIB 2HP4A 5D71L 4KVCL 1U8MB 5ICYB 4QHLA 1HH9B 1QR4A 4AJ0A 3TJHD 3HMXH 3T3ME 2PCPA 4JFOA 5AZEL 3J7HA 1Z9SA 1OL0A 5HDBE 4MX7B 1AI1H 1MHPH 2BFVL 3C2AL 2F54B 1EXUA 3BZ4A 4LSRH 4PRHD 2HFEB 1G6VK 2DM4A 4OFDA 5CD5D 1M7DB 4K3EL 2BJMH 1NA