4M93C

Unliganded 2 crystal structure of s25-26 fab
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
b'DILMNQTPLSLPVSLGDQASISCRSSQYIVHRNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (IgG1k) light chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m93C01
3FOLA 4XCYA 4YHMH 5DDHA 1VFUA 1QOKA 3KPMB 1RZFH 3FRUB 1MRCH 5KTEL 2P46B 4HKXB 1VESA 1A9BB 3OB8A 3D9AH 5DT1H 1CIDA 4NO2B 2WWMD 3FFDB 1IL1A 5E8NB 1IC4L 1FO0L 5H2BA 4K8RH 5K9KA 2ERJB 1KLUB 4D0DA 4BQ8A 1UA6H 3GJEA 3FN9A 1UFUA 2CSPA 3X13A 3STZA 4M4RA 4U1GC 3H0TB 5JMRA 1PW3A 4MCYA 2GTWB 3SDAC 2QADC 3UYRH 3KWWB 5HY9B 3KG5A 3EO9L 3GRWA 3P0VL 1OP5H 3KNBA 2COQA 4PR5B 1INEH 3QB7C 3D0VA 4LSVL 1D3CA 1YPZE 3GI9L 4YR6A 4ENEC 2AJSH 5IT2L 3OKYA 4I77H 4FFYH 3AB0C 4EIZC 1Z9MA 3FQNA 2Z31B 3TA3D 1XGQB 5GZNC 3Q6GL 4OCWH 4AM0B 3P9LB 2F58L 1YUHB 4G9FA 2I26N 3QIWD 4QEGA 3NFNB 2HA1A 2W60A 4G6AD 2HLFC 4U6XA 3X12A 4DZBB 5HVHB 3E6FA 3QUYA 3O6LH 3C2AL 1DQTA 2IAND 3LPGA 4G8FA 2P8LA 3EJYD 1BZQK 1GVIA 3QG6A 2I9TB 4V1DD 3RIAF 3BPCB 3LEVL 2YPKA 4HFWB 5DJXB 2FL5B 5IFJA 1F4AA 2OBGA 5JOEA 3C87A 2DS4A 3H9SD 4XCCL 5TQ0H 1I1AA 3BUTA 1HYSD 1A14L 3QEQE 4XGZB 2OL3L 4G8GB 3GSUB 2W07A 1HIMH 3R8QA 5IBLD 2XZZA 3Q1SH 4HKJB 3WNKA 1LO2L 5L7XH 1BZ9B 3DX6B 4K9EH 2FGWL 3TBWB 3LKQA 3KPOA 2RIKA 1TQCC 2NY1B 1FGVH 3BT2L 3UTZA 1RUKL 1IM9A 4JGUA 4XMKH 2VXTH 4MNGE 3T0BA 2EC9U 3RPKA 4ISVA 2K3TA 5GGQH 3VGAB 4CVXA 5AZ2L 2LU3A 1ZHKB 2Y5TA 4Q6IB 5L2KE 1EA9C 3KHOA 2DLIA 2X70B 4I18B 4MD4A 3REWA 3MRHB 4N0CD 3MRPB 4NZRH 1JV5A 2AQ2A 4Z6AT 3MLWL 2X4UB 5HDBF 1A7QL 3OKKA 4K8RC 5GGTH 4IRSD 5A2KH 3WN5A 3LS4H 2F5BL 3G6JE 5I30L 1VGEH 5C0FB 3DV6B 4FG6C 4TQEH 4WVRA 3MJ9H 1L0QA 1XGTA 1U8JA 3SJVB 3EOYG 3NZHL 1OOAA 3JWDL 3UCRA 5EU4B 4KVCH 4B50A 3KYMA 4KK5D 4RA0C 4MNQB 4Q0XL 2CUMA 3MBXL 2EH7L 3K0WA 3HC3H 3O6FB 2YA2A 2IANE 1X5JA 2HJFA 3L9RA 5F7UA 3JUZA 4LHJB 1EXUB 4RGNB 4HKZB 5HVWA 1Q8MA 3GDBA 2EC9T 4V1DE 4I0PB 1BVKB 4R97C 2XQBH 4LCWD 3N06B 3NIFF 3H9SE 1DL7L 1R24B 4PREB 4G6KL 4KY1H 3QAZB 1CD0A 3RWHA 3V6ZA 5IW1A 4RMQA 4QRTB 4WU7B 3VCLB 4WHDA 1Q9KA 1R3JB 4MA3B 2VITA 3HMWL 5EWIL 2DBLL 2IH3B 2PO6B 3HZVB 3O41B 1LE5B 1FL6B 4J8RB 4XVUD 4OLVH 1WAAF 3WKNA 3I02A 1Q38A 2B1AL 2AQ3A 3D85A 4JO3H 4EEEA 3S88H 2ICES 1G6RB 1NPUA 2E7MA 4C57C 2IAMD 1PLGL 4H8WL 4PYHA 1KJVA 1Y0LA 4JVPA 3FQTA 4NQED 5ABDE 2DQFA 4OLZL 1OLLA 5JQHC 1BD2A 4LNRB 1MCEA 4YHPA 2Q7NA 1LE9B 2Q76B 3RKDD 3ARFD 4PJ5A 5EIVA 4EI6B 3CFIC 4JREB 3HR5A 1NFDF 4LGPB 4A6YH 5I1CL 5CEZD 3SDYH 5TPWH 4K9EC 1NC4A 5A43C 5LBSH 1LK2A 1IQDA 1KLGA 3K8KA 4LLAA 3BKCL 3KLHC 3VW3H 1C12B 3T2NH 2BNRD 4MXQC 3ECBA 1WVZA 3HN3A 5DJCB 1T7WA 5EZOL 1QYGL 3MREA 4QKXB 3QDMA 4MXVF 4MD0B 3BIAX 3SGEH 4ODBD 3PP4L 2P49B 1IAIL 5HDBE 4EBQH 5GS0D 5T1DH 3FKUS 4PRPD 2FZ3B 4Y4FA 5F9JB 5MEOA 5E2WH 2WZPD 4NZTH 3QUZA 3MR9B 1KTKE 4NO0D 3UZEA 3QXWA 2VYRE 4F33A 4F15C 4FMKA 4OZIB 2H26B 2NY0B 1WEJL 1BM3L 3ROOB 4HFUL 2CQVA 1HOCA 1IGCL 1K6QL 1R5IB 4UTBL 3BW9B 1B6UA 2VDPH 1XGRA 2CMRL 3AREB 4GMSL 1L0XA 4DTGH 5B8CC 4FQCL 3D18B 1WWBX 4UDUA 5I2IB 1KB9K 5EBWB 4LEXH 4NUGL 2DMBA 5IB1B 3NIFE 4KGLA 3GM0A 4JFFB 4XC3H 2DD8L 3V5KA 1WFOA 1ZGLB 2X4NA 3B6SB 3UTTB 1DBJL 2C4XA 5MHSD 1X4XA 2BSSA 4PRHD 4XP4H 3VFPB 5IHUL 1U8NA 1AC0A 3KJ4C 1FZMB 1YMMB 2KZWA 4WWKA 4D8PB 1WAAE 1KPVB 4YUEL 2XI9A 3DX9A 5EO9B 2HFFB 4M9OA 1UWEH 1BBJA 4ZXBB 3OAYK 3BN3B 2HAZA 2YPLB 3BPLC 5ECJE 3TN0B 5CJ8A 5K33A 5DRZA 4BSJA 4OLEA 3PGDA 1OGTA 1TZGL 4K7PH 4X9HA 4NM8L 4QXUL 1T1ZA 3U79A 1FL5B 2APBA 3MLXH 1U93B 3SY0A 1GGBH 4OQTA 1NMCC 4RQQA 4ONGL 1NFDE 5K59E 3C5ZA 4U49A 3W0WE 2P5WD 2QQLL 1HHJB 4M48H 1WGOA 4NKOB 3EUUA 5A3ID 4LDOB 5DGRA 4WUUD 4XP5L 1EHNA 4HCRL 1AGEA 1KCRL 1NDMA 1TENA 4PUBL 4Z0XA 5HI3C 2BHUA 4HGWB 4MJ6B 5KAQF 3RVUD 3MCG1 5C08A 1DVFC 1HSAB 1OQOA 1I3GL 3PHSA 1KN2H 4PP1D 4DW2L 4PRPE 5IGXH 5KBNC 3LQZA 4MXVE 8FABA 4HG4J 2LFGA 3CVHH 3T8XA 4ZUVB 3B2UC 3C6SA 4Z78A 2CXGA 2XQYG 3GI8L 3DGGA 3L3KB 1BQHA 1EUTA 3DSNA 5DMIH 4O4YL 5C71A 3EHBC 4OI8A 1HINL 1UT9A 1JUFA 3VXSE 5A2IH 4WY7L 4FQXC 2LABA 3A6CH 1AGDB 3QDAA 4L8DB 4JANB 2JJUA 4MNHB 5LAXB 1KTDA 3O9WB 2VISB 1VCAA 3KYOA 4R8WH 5JUEH 4QOKB 4I2XA 3BWAB 2Z8VC 5FDWB 1BGXH 2FIKB 1KJ2H 2ZZUT 5EBGA 3CH1B 1EEQA 4TOYH 1XF3A 4LSUL 25C8H 4X5WA 2NZ9C 4PV8B 3ILPA 5EDXA 4PJDE 1FZJA 5F1KC 3I6GA 5MHSE 4G8IA 5DGQA 2HN7B 2RBLA 1KB5L 1XIWB 1EBPA 2ZWLT 4HJ0C 1JK8A 4WNQA 4LEOA 1V7MH 5TGBB 5ITBH 3QUXB 1ZTXH 1NAMA 5KSVB 3TH3T 2XRAH 1RZ8A 1JGDA 4DUWA 3IDGA 1ACZA 4NZJA 3IKCA 4OB5L 5IBTH 5MERA 1S5IL 4ZQKB 1JMZA 2JIXB 5ADOL 2V5TA 4OFVA 3LKNA 3BP5A 1ES0B 4LSQL 4G43A 4ZDHA 1NBZB 2P5WE 4PGJA 1YPZA 4FTVD 4LGRB 1S9VB 2HT4D 4XNYH 3GSRA 3HFML 2YPVL 3T1FA 2H41A 1R0AL 1MIEH 3T65B 1MOEA 2R1YA 3PIQB 3FAXA 4P2RA 1P4IH 5FGCB 3MNVA 1A5FL 2LTQC 4L8SB 2M8XA 4LARH 4U7MA 2ZUQC 4PJHF 3EYUH 1MCCA 2F54D 3QI9A 4FS0A 2QBWA 3IJSA 4ZNEE 5HHQB 1U8IA 4UT7L 1BQHG 2MCPL 5AAWA 4YDKL 5IOPB 3CDGA 1PD6A 3EYFA 2Z8WC 2EDWA 2XY1A 4OF8A 3DBXA 3IGAB 3BD4A 3PWLB 1QSEA 5IMMA 2R0WL 5ID1B 5IB2B 2NY5H 4QRPE 4XWGL 3IXAA 1YYMH 4BQ6A 1TJHH 1YNLL 3K81A 3HG1E 2OZ4A 9CGTA 5M95B 3HC4H 5I17A 1QPPA 5C07B 2DQUH 1ZVSA 3C6LB 2YWZA 4K3HA 2HVKB 3F58H 1D6VH 3TO4A 1OT1A 3FOMA 4KJWD 2ZG3A 3HAEH 2Z92A 5KZCB 2CIIA 3FB8B 3RVTC 1YDPB 1VKXB 5HHNB 32C2B 1PX4A 5JR1L 1KSRA 3TIDB 4LLWA 2OSLA 3OPZL 4X8XA 1KCUL 1Z0NA 4DVBB 1E4WH 3RWFA 4JHAL 1S9XA 4YXLL 2DKSA 3QCUL 1RUAH 1A6PA 4LVOB 3DVNA 2YD1A 3VWKD 5F89B 3FB5B 2F74A 4P2QB 3QDJA 2I27N 3UO1H 2DI8A 1CXIA 1MELA 2PTTB 3LRGA 2JCCF 3BDXA 4J3TA 2GQHA 4Q74A 5T5FH 3O3DB 5JIHA 4JY5H 3BI9X 1RD6A 2FB4L 5BJTA 1NJ9A 4P5TB 1VFBA 3A6BH 2F5AL 4L8CB 5FHAL 3DMMA 4P46A 1KC5H 5F7MC 2K1MA 3HS0A 3CXHJ 1J8HD 4PFEA 5CFHA 1YMHA 3KPSB 2J7LA 1MAMH 2BOBB 2ZUUA 2XN9B 1FJ1B 5F6IC 3K7UA 4PJHE 4Y1AB 1U95B 7FABH 3LCYA 4WFGD 4KRPC 5ENWB 3K3QA 1P1ZB 3SDXA 3HI5L 4GAGL 4J3XA 3R06A 5GRVL 2J8UF 3DROA 3QDGD 5HI4C 3W5MA 4NN7B 4HPYL 4G8EA 3BDYL 1RHHA 1UADC 1I8IA 1WBXA 5EBLA 1MEXL 4CMMB 1B4JL 3V2AR 4PD4K 5KSBE 3SE8L 3FOLB 3DVFA 3QFJB 4P57A 4XBEL 2Q86A 5MEPA 2R9HD 5ESAB 4XMLL 1J1PL 2RCSH 5IMKA 5F9WC 2NY5C 2IPTH 4MA7L 3D0LA 1JZ2A 4WW2B 4K94H 5IMOA 2FECI 1BFSA 1DSFL 3QP3A 5LCVH 5CBAA 1SBBA 4LCUA 4NQXB 4O5LL 5FOJA 1UKQA 3L3HA 3SE9H 4RFNC 3PUCA 1IZJA 4AH2A 4X9FA 3L3OA 2H2SD 5J6GA 4PLKD 1NLDH 2DJ4A 2YZ1A 5D6CB 4CW1A 1MCPH 5GXBB 4JDZA 4KVNH 3ZHDA 4XPBH 3D0VB 2JCCE 3K4DA 3WMSA 5IROA 1BVLA 1SQ2N 2SEBA 3FQNB 3K80A 1FO0A 5KVDH 2VZUA 3IS0X 4XAKE 2DICA 2NX5E 5TE6H 5HPMA 4U7SA 3KJ6H 3OKLA 1UXWA 4XNXH 1J8HE 1I75A 2OYPA 1F6FB 3NCJL 1T2QH 1K8DA 4KAQH 5E2TH 1MAKA 5AG8A 1IAKA 4KTEH 2NXYD 4EI5D 2O93L 3V6OA 3LN4A 2GSIB 1QUNA 1Q94A 3UTSB 4M7KL 1TPXC 4O2FA 3VXRD 4HPOH 2R0LH 4WFGE 4R2GD 4YHKL 5ISZD 3EO0A 4Z7OF 2ENYA 4U1SA 3JWNC 3UTPD 4N8PA 2VQTA 3QDGE 4LKCB 3OGCA 4GRLA 2CLRA 3MLTA 2Z31D 2DYPA 4GBXB 2FO1A 1G1CA 4ZFZA 3CFJB 3QHFH 2BX5A 5CJOH 4HW6A 2J8UE 3EFFB 3QA3A 3TFKC 5EU6D 1DQMH 3O3AB 1SJEB 5D1QD 5FKPB 1T5XB 1ORSB 2OR9H 5B22A 5C0AB 3CLFH 2EDRA 4RIRA 2FX8H 5I1GH 4PB9L 1PG7H 1LEIB 4NO3A 5T3ZD 3RRQA 1U3YA 1BBDL 1NFIB 3EJZC 1QTYT 5H35B 4ZYKA 5EUOE 1X5AA 1SEQL 4RGOL 4AYFA 2VQ1A 2QHLA 2R29H 2OL3A 1PQZA 1CFQA 4CVXB 4UTAH 1MI5D 4G8GD 2R4RL 2Y5TB 4UILL 4RGMC 2X05A 4DKDC 4PGEA 2N56A 4YDLC 3MV7A 2CDGB 4AL8L 1W72B 4K94C 1CIUA 3GRWH 4X6FA 1LGVA 1DBBL 3RY5A 3QUKA 4LFHD 4UI2A 5FYKU 4M03A 3PWPB 2CKBB 2J4WH 5D5ME 2ICWI 3RU8H 3HUJF 4DGIL 1XH3A 5IIEA 5C0GA 3ROLB 2VC2H 3TWCL 2H45A 1A7PL 1NCCH 2MKWA 2R4SL 5DJ6A 3D3VA 3VXSA 4L4VD 3KXFD 1MHPL 1QACA 1Y6KR 4BH8A 1X5GA 2DQDL 1BVZA 3MRCB 1OSZA 2NY2B 3L9RB 5FYJL 4JKMA 1HH9B 2WSKA 3QNYB 2QV2A 3VWJC 5ISZE 1CU4H 2QR0B 3J7HA 1UACL 3L3JB 4OD2B 3TPKA 4RFOH 4MB4A 3UTPE 2HH0H 4AJ0A 5C6TL 1CXKA 1AQKH 3RWHB 4ZODA 3ULSA 4Z7OE 3V6ZB 3CFDB 3RTQC 1P4LA 1Q9KB 4BFIB 1BIIB 5EU6E 1A1NA 4HS6B 2X4QA 3FT4A 1ZHLA 5BVPL 1AP2A 1KPUA 4MNQD 1D5IH 2EEAA 2VH5L 3P77A 1XR8B 1KJVB 3QH3A 2FWOA 2DQFB 4L3AA 5T3ZE 2HMID 1BD2B 3PWJB 1N5AB 4LLYB 4LCIH 4PJ5B 4PPTA 5GISH 5CP3H 2HJLB 3HR5B 3JVGC 4TSBL 3SE3A 3STLA 5TDNA 4L29A 3U6RA 5DUPL 1MI5E 4H1LB 1NC4B 3DUUB 4CN1A 1IQDB 4UIKH 5F3BA 3VXMB 4I5BB 3VFSA 1MRFL 1MCOH 4IRJA 5GS2H 4LOUD 3MPCA 4NQVB 3SDDB 3JXAA 3MREB 2GJJA 4NRYB 1JZ6A 2A9NH 2BDNL 1RV6X 3RHWK 3R0MA 1RULH 2CRIA 4JM2A 2RFXA 3GMNA 3QUZB 5HYJB 2EE6A 4L4VE 3MA9L 1RUQL 4P23A 3HUJE 2A77L 2QHRL 3HLAA 1IEAB 2DKMA 3QQ3A 5JMOC 2FYYA 1QFUH 4U6YA 2BNQD 2Y72A 4UUJA 5K93A 1BOYA 3MGOA 5I19H 2FATH 2QLVB 5FB8A 4NO5A 2ZCKH 5IBUB 5SWZD 3S36X 5HHVL 2AJXL 3LQAL 4JFEE 3ESVF 4XZUA 1E28A 1DQLH 2I5YL 1YNKH 4ZD3L 3AM8A 1S7RA 1B4RA 4MA8L 2WNGA 4NCC2 4XI5C 4AT6A 4XVJL 4UAOC 4PJBA 4H5SB 1RU9H 4XB8A 1DBAL 1X5HA 3OAZK 1DE4B 3QUYC 1TIUA 4PS4L 4YZFE 4RWYL 3O11A 4ZOAA 5FECB 2AXGB 2NY0D 3EOAA 1MLCA 2AW2A 1GC1L 4WWKB 4Q9QL 3GFUA 3DX9B 5MENA 4OF0A 3VFRB 4U0RC 5KOVC 1NCWL 2WIIB 3O2WL 2ZSVA 4G7VH 3U0TA 1YN7A 4GLRH 5C0BD 5DRZB 5DURD 2F8VA 3BSZH 1I1AC 3LDBC 4NBYB 4K3EL 3TCLA 3N85H 2F53A 5BZDB 2Y25A 4RQQB 4HIHB 1DQDH 1Q9OA 4JFDB 1JNNH 5ACZB 4OM1H 1QEWA 1KIPA 1T66C 1J7VR 5IW6A 4IHOA 5GRUH 1EEZB 2PYEB 2VDRL 1YECL 2WLZA 1MAJA 3FHAA 3O8XC 3QHZH 2GYSA 2HT3D 2H2PC 1YY9C 5DHVA 2Q8AL 3GM8A 4JAMA 3D39D 3CSBA 3K8MA 2O5ZH 1L7TH 3RHWF 1OD9A 4ONOA 2PXYB 1IBGL 4J4PA 5EU5B 2UV3A 2WQ8A 4X7SL 3V5DA 4ZUTA 1KTDB 4OLYL 3WS3A 5D7SL 1U91A 4HCRA 4I2XB 1ZLWH 3E3QC 1KT2A 3OKOB 5T1MA 3MNWB 1EHXA 4D2NA 4DK6A 4YC2B 5KSBA 1QA9A 1M05A 1RZKL 4IIQC 1Z5LA 5C70A 4G80B 3LKOA 3MRDA 4PJ8D 4PRDA 4Z7VA 4NHUA 2FBJH 4MQ7A 4XPGL 2QJDA 4Y4HA 2P5EA 3QO0B 4TPRL 2E9JA 1I7RA 4U3CA 5E4EB 2GIYA 2OJZH 3S4SA 5A2JH 5KS9F 4NHCH 5J7CC 3A67L 4WFFE 4EUPG 5DJYA 2BMKA 3WE6B 2VXVH 3S5LA 5KSAA 1RZ8B 3THMH 1P84K 1MSPA 3IDGB 4XT1C 1ZLSL 1P7QA 3CDFA 1LILA 4HXAH 4GFTB 1YNTA 1MUJA 3VFTA 4NQSA 4J3WA 1IAOB 3ZTJG 1GGCH 1U2CA 5I66A 3GGWA 3CXDL 4EN3C 4DKEL 4PG9B 3TBYA 1VADA 2P8PB 4OUUB 3BWUC 4MJID 3PV6A 2ED8A 1WBZB 1QSVA 4OQTH 1IQWL 3I3DA 1HZHL 4ZTPH 3DIFA 1KB5A 3VG0H 2NX5A 3LEYH 2I60H 5B4MD 3BP4A 3ZKSD 5CP7A 5LQBH 4HIEA 5I16B 2CLZB 4QHLA 1NC2D 2NCMA 4GMTL 4PRNB 4QHKI 1CICA 1RMFL 3D39E 5DA4A 1IM3A 3QXVA 1FDLL 3ZT7A 1RPQA 3VXPA 2JIXD 1I1FA 2FH6A 1MVFA 3PNWA 1WWCA 3SKOA 1Q0XH 4U1LA 1I8KA 2GAZA 1JWMB 4P2YA 2NY6C 3E1F1 4CRPA 1QSEB 5KANG 4HIIA 3EYQC 4PJFA 1EPFA 4LMQI 5C6PB 4J3VA 1LP9F 3Q3GA 3I6LE 3MQIA 4XP1L 1ETZA 3QNZB 3ARDB 3RVWD 1EDQA 4Y4FC 3AS2A 5IEKB 5KVGH 1JHTA 4F9LA 1ZVSB 1UKSA 3ZZ1A 1HQ4A 4UBDD 2IF7A 5CINL 2YSSB 2Z92B 5DHXB 2CIIB 4JPWH 4N0YL 4QWWD 4NN5B 1OAZH 4K7PY 3S4SG 5C7XL 4JHWH 4LLWB 4OGXH 5JQ6H 2OSLB 3CZFA 1U3HA 5IB3B 1KB9J 2V7HB 1AO7B 4X99B 4OD1L 1FQ9C 1SM3L 3DVNB 5DMGC 5JO5B 3ARBA 3IFNL 1A6WH 4PJ9A 1I7TB 3ULUH 1IKFH 3W2DL 3DSFL 3JWOH 1UM4L 3EW3B 1BFTA 2JJTC 2PCPA 4KK9D 2IC2A 1E6JL 2DQHH 5EPMB 4Y5XA 1UM6L 3UAJC 3QNXA 3BEWA 2FJFA 4X6DA 1KTLA 1S5HB 4HXBL 4X6CF 4F7TA 3HS0B 1A3RL 5FV1L 2Y6SD 4GG6E 5FYLL 1CDIA 3TYFB 4PP2A 1FC1A 3QXDA 4AG4H 2H32A 3WLBA 1DBML 5ANME 3WJLA 1CZ8L 4O9HH 3GNML 5ICZB 1ORQA 4UV7H 1W0VB 3O4LA 2X4PB 3RJQB 1A7NH 3LAFA 3C5ZC 3B3IB 3O0RH 4L3EE 5L8KB 3B9KC 2BXZA 5D7LD 3WD5L 2P24B 1Z9LA 4O58L 1T3FA 4L4TD 2QQNH 1I4FB 4HLZG 3LIZL 1IZKA 5I15L 2YD3A 4UB0H 4RISL 5EBLB 3P4MA 3J8F7 4NGHL 5K9JL 4P3CL 3SPVA 3KJ4B 3G5XA 5DEFB 2VDKH 2OZ4H 1WIUA 5CEZL 4PJIA 4BH7A 5DVMA 5CKAA 1GOFA 3EGSB 2J12B 1C08B 4YE4L 1DUYB 1ULVA 2EYSA 4ZAKB 3KYKH 1WV7T 4OD3H 4TNWK 5HDOA 3SQBA 5IMOB 4WTWA 5GRYA 4OV5B 4G9DB 1F90H 3TVMD 4QTIL 1ZA3B 4QXTA 1SYVB 4LIQE 3GB7A 1GAFH 2OR8A 4HK3N 2BVOB 5CZVH 2R2BB 5GS0L 4D3CH 5CZXC 4CW1B 3BQUD 1H5BB 2BVTA 4JDZB 2VLRD 4QXWA 4AQ1B 3I2CH 3HI6L 3KPPB 5J13B 4M43H 3L1OH 4IDJH 3UYPA 4ERSL 1EV2E 2VNCA 1WBYA 3GMPA 3CU7A 4N8VB 2D0FA 3ZKNC 1HWHB 3VXNA 4PJ7A 5JZ7D 1TJGL 1NL0H 4OCSL 3B9DA 4JFPA 5SX5K 1Q1JH 3OKLB 1HXMB 1UH3A 3ULUC 3EOBB 1V7NH 2QQQA 1NGPL 1ZS8B 1OP9A 1NEZB 3Q2CA 1K8DB 1UQSA 3O2DH 2BK8A 3SDCD 3VFVB 3N0PB 1FYTE 4NYLA 4ODTH 1EGJA 2GHWB 1PYWA 3WSQL 1U3JA 3PJSB 1CI5A 2X09A 5FA3B 4LLMA 1D9KD 3T2PA 1FLRH 5ERWB 1KACB 5IR1A 1QBMH 5DSCB 2VDMH 5I1AB 4HUWB 4PTUA 4OJFH 2FR4B 2RGSA 1C5BL 3MOBH 4L4TE 2C9AA 2IQAA 3GMRA 4U1JB 3LN5A 5L8LB 3S36L 4HWEH 1OPGH 3VFMA 1CLYH 1FZOA 3MRQA 1CFBA 1G7HA 3U0PB 3VA6A 1TQBC 2XWJA 3VXUB 4QYOA 3QJFA 3QI9C 4G7YH 2XACC 4GRWF 2Y36H 1JPSL 1CL7H 1CK0H 4FXKB 4ZS6C 4JPVL 1HXYA 1FAIH 5JHLL 4HDIA 3ZSTA 5CD3A 4HV8B 2J88L 3SO3B 5D1ZD 3IF1A 4NO3B 3ZYJA 1UWXH 1MREL 3RY4A 2A1WH 4D0BB 1AXTL 2JE8A 2FJGA 4AZ8A 3O2VL 1OAYL 2VLKA 4Z7UF 1TVBA 3C8KB 4TNWF 4PGEB 1UB6B 3D2UB 1CFSB 5INDB 4NQDB 3OXRA 5EC2B 1IGTA 2X41A 4H88L 3T09A 2VLRE 2G2RA 3TO4C 3FB7B 2NTSP 1LDPL 4JPKH 4X6FB 3WO4B 4FXLA 1X5IA 1VGKB 1OAXH 1DEEB 2YC1A 1U8KA 2B0SH 1CT8A 1ONQB 2DM3A 1IARB 4XAWL 4D94A 1C5DA 2HG5B 3DYPA 4XCEA 5TF1H 2WV3A 3MC0A 3O45A 1IC4H 2GK2A 4H26A 3QIBD 1FO0H 5F8RC 3Q48A 3T0EA 5DJ6B 4FZ8L 5JTWA 1VFMA 4ZFFB 4F7PA 2DOCA 1OGAB 4L1HA 4ELMB 4TUOA 2ESVA 3TYGH 2EIZA 4BZYA 1K3IA 2ITDB 2DQGL 1A02N 4WHTB 4Z0BH 5MI0B 4O2EA 3P0VH 5DD3L 5F6HI 3DMMC 4Y4KA 4P46C 2EDBA 3PWPD 4HJGB 4ODWA 3GI9H 5IHZA 5IT2H 4PG2C 5AYUL 3HPLA 4HAGA 3MRFB 4FA8A 1ZHNA 1RZJH 4OF5A 1BMGA 2AXFA 3VDBA 2ZUVA 1FFPB 2BOCA 5C09D 2AK4A 5L2JB 3BD3A 4DN4L 2LV4A 4CDHA 5HHOB 1KJ2B 1BF8A 4FABH 2K7QA 4GT7A 4KKBD 5F7EH 2F58H 1J10A 3BDBA 4PGZA 4A2MA 1UCBL 3DXAE 4GRWE 1FIGL 1I1CA 1UKTA 4ORGB 3MV8D 4YX2L 4TULL 2R2CA 3KPRE 1M1SA 4XBPB 2VLJD 3FO1A 1NBVH 1T1XA 3LRHA 1Z6JT 4M7JL 4NM4H 5TDNB 3BKYL 5LXGH 3U6RB 1KXTB 2DWEB 2JTDA 3LEVH 3O3UN 2ADGA 4KI5F 4PJXB 4K7PX 3VFSB 1V3MA 1BZ7A 5CLTA 3SHSA 1FNLA 1R3HA 4KHXL 2X2YA 2OL3H 1KG0B 3L6FA 5D9SA 3MGAA 3N9GL 2AVGA 2GUOA 3NA9L 5BXFB 1GGTA 3QQ4B 4POUB 3GMQB 2BSTA 5I6XC 4HIXL 3ME0A 5HI5C 1IGJA 1N64L 3TNNA 4APQD 3MZGB 5LGKA 4J2XA 2VDNL 4JM2B 5DEZA 2WW8A 3PQYE 4XPHL 5L0QB 4GKSA 4YBQC 3NFPA 4FZEL 4JCMA 5D96B 5BO1L 4KV5F 5F7YC 3AFLA 3RZCD 3UC0H 5I74B 3RPIA 3QQ3B 5C2BH 3B9VA 4YIQB 2AJZB 4M1CC 1A6ZA 4UUJB 5AZ2H 1A4JB 1OARL 3HNVH 2O5XH 3WLWC 1BPVA 1WLHA 4NJ9H 5JXEA 5SWSA 3FFCB 3VDAA 1AJ7L 5IROC 3TBTA 2JB6A 3U9PL 1SMOA 1XF4B 3LKPA 3MLWH 2V2WB 1BLNA 1OAKL 1X6LA 4XZUB 1E28B 2EC8A 2WQRA 4YNYA 5JOFB 5J1TC 3RUGB 1S7RB 4X98A 2AEWA 5I30H 1A2YB 4AT6B 1MJ8L 1RIVH 4JJHA 3NCYP 3DUSA 4BFEA 1PAMA 3U7YL 4YHLL 3V7AG 4M1GL 1JYVA 1NCBL 2WMPA 4L4JA 3O11B 4U2YA 4M8QB 3MBXH 2Q87A 4PJEB 5FYKD 5H37H 4ODHL 1M71A 3ARGB 4FP8H 4X4ZA 2OI9B 2BC4B 3HAEB 5I9QB 1FGNL 1RZJC 3S98A 4ZS7H 5DS8B 4HAFA 2WBJD 4GRLC 1LEGB 5DK2A 3WFCH 5E9DA 1EAPB 3U0WL 3BYTA 3NN8B 3TBSA 1F58L 1U6AL 1N26A 2F53B 3OKNA 4H25B 2A83B 4WI9A 5T3XE 4F7MA 2ADIA 2QSQA 3MRMA 1EFXB 4G6KH 2OTUA 3DRQB 1OAQL 1QEWB 2DKUA 3C09C 5I1HL 4Z9KB 1JWUB 1CFNB 3LEXB 4KI5E 4G6FD 4PJCF 3KGRA 1ZAGA 4MWFA 3DI3B 3HMWH 3PWUB 5EWIH 1QKZL 2DBLH 4CUCA 3AROA 2FHBA 2P7TB 1LQSR 1JRHH 4E41D 3GIVB 4BQBA 2APXA 4PJGB 5D2NA 2QADD 3RWGB 1PLGH 5I71B 1AGCA 5I8EA 1OP5K 1GYAA 2AK1L 5GHWL 4OLZH 4NWUL 5F88A 4JFZL 5KOMC 1QBLH 4L8BA 3IDJA 4ZUUA 3MUGA 3ZE1F 3MNZA 4LLQB 4J6RL 4LCCB 2FSEB 2ILLA 1QFHA 4ENED 2Z93B 4BSWB 1N4XL 4HJJH 2IJ0C 4KV5E 2ARWA 2DTSA 5GZND 1QSZA 2W9EH 1B6DA 1NMBL 3DTXA 1U91B 5ALBL 5AAMA 3EDEA 1LD9A 2DLFH 4DFHA 1AHWC 1KT2B 5J6HA 5D71L 1Q72L 3O4OB 1RJCA 4KK6C 1QA9B 2HLFD 5KW9H 1T22A 2OTPA 4XVTL 2IBZX 1AR1C 4NHUB 4MQ7B 2XZAH 3RGVA 2EEBA 3MUJA 3OZ9H 4W6WB 3MOAL 3GMLB 4OAWB 5L9DL 4LHUG 5CSBA 1IFHH 5DJYB 4D9RD 3S5LB 4PV9A 4EUPH 2AXJA 5DD6B 2XFXA 1BM3H 4JDTH 4HFUH 1RZGA 1K6QH 3T4YB 5BRZB 3KPNB 1CD1A 3KS0H 3OB0H 3CFBB 4U1MA 3CVIL 3ZTJH 1X5XA 1F3DH 4ZPTA 4I4WA 3T2OA 5BS0A 1OW0C 5GSRA 3U9UB 1FVEA 5I18L 4LSTL 3FZUC 2VLLB 5E00A 2ZG2A 1CLOL 2R56H 3CC5B 5HGDA 1KTRL 1PGRB 5J9PA 3BP4B 3PL6B 4EVNA 2OTWA 2B1HH 3H3PL 3LV3A 4GQ9L 4HIEB 5E24E 2IPKA 4PJCE 5IHUH 4ELKB 4ZUSA 4LU5H 3T77A 4HS8L 3SE3C 4YUEH 1WWAX 3ARRA 1QSFD 2NQCA 4G6JH 1MHHA 3TA3A 1WCQA 5AWNL 3OJ2C 4K8RD 5EFIA 5DHVH 3PNWB 4PBVC 4CL7A 2ADJB 4FQLL 4FFZL 1IGFH 1TZGH 4LQ1A 5L88L 4IRJC 3SKOB 3NAAH 5ACMA 4FG6D 3CFCH 3KAAA 3ZE1E 4B41A 4ONGH 1H15A 2NYYC 1G7PA 4N8CL 4WU5A 1A6AB 2QQLH 1J1OL 3ZDZF 1NUGA 3QULA 4XP5H 4HCRH 2I07A 4W4OA 1D6EB 5BW7A 2R23B 2CKNA 3H9HA 5IB4A 5B3JE 1HQ4B 4GS7B 4QRUA 3GJFA 4DW2H 4P23C 1S9WA 4JY4B 5IJVA 4C83A 3IFLH 4LSSL 4D9RE 3C5SA 3OR7A 5JW5A 5D70L 4E5XA 1U3HB 2G75A 1NKOA 1HINH 5IVXF 3L3DA 5J3HC 2DQTH 5LJYH 2NY4C 5H94A 1RZ7L 4WY7H 3WL9A 2MQCA 2DQEH 3FQUA 1CLZL 5CHNA 4NNPL 3WHE1 2APTA 3AM8C 4RRPG 2FX9H 3MGTA 1MRDH 4LPYA 1ZXQA 4QHNB 3GSQA 2M2DA 1RUMH 3QNXB 3KPQB 3WV0A 1OF2B 3BEWB 3HZMB 1DUZB 1LO5B 3TZVA 1KTLB 4GW5A 1AFVL 2JKXA 4HH8A 1MF2H 1HH6A 1KB5H 1DLHA 3EFDL 4PRAA 2BNUA 2GT9B 3EO1A 4ZOBA 3KLHD 4IRSA 5EIIB 1X7QB 4PP2B 1S7SA 1ZVHA 5D8JL 3QXDB 1U8HA 35C8H 1IGML 1FHGA 1XCTB 4MXQD 3W9DB 3WLBB 3X11A 2R8SL 1NGWB 2W92A 4Y19E 1WFNA 2MTPA 3O4LB 3QEUA 1T1WA 4YGVA 2IFFH 4OT1L 3P11H 5ADOH 3ARWA 4F8TA 3MBEC 4MDIB 5E0QA 2XA8L 4LSQH 1IJ9A 4ZOCA 5FCUL 3MRKA 4DKFH 1JN6A 1NCDL 2MQ0A 2M1KA 2YPVH 1FORL 3L5WB 4HLZH 3ZT6A 4X4XB 4OI7A 3CFEA 5JOPD 1KCVL 1S9YA 3SPVB 3ZDZE 1A5FH 4Q9RH 4MQTB 5E5MA 3SE4C 4CDGC 2VAJA 2IADA 1ZT7B 4BH7B 1WFTA 3KPRA 2EYSB 4MAYA 4UT7H 5DLMH 4DQOL 2PTUA 3TEUA 3HR6A 4YDKH 5ICXA 4GLRI 1PG7X 2VIRB 4U1KB 4G3YH 1G6RL 1HQRA 1IEBA 1V5JA 4W70A 2R0WH 5IVXE 4XWGH 1YQVH 2HWZH 5FV2A 4I3GA 5GSVA 3ELAT 1YNLH 4JCLA 3MROA 1QRNA 4Y4HC 1O7SA 3S7GA 5JHDD 4D9LH 1A7OL 1WBYB 3V0WL 1P84J 4X8JA 3RGHA 4LPWA 1DQJA 3VXNB 3WKML 3F5WB 3C08L 4CVZB 1HHKA 5KSAC 4M93C 4OZGA 4PGCB 3IFOA 1JZ4A 5AEAA 3OPZH 2PN5A 1UQSB 5FO8A 1AGBB 5CD5C 5I1DA 5EORL 1HSBA 4R4NC 1PYWB 4U1IA 1YJDL 1QQDB 4K71B 5MP6H 4BQCA 1A7BA 3NACL 2APFA 4U1NA 2H32H 2CUIA 5KVFH 4NO0A 5DUBA 1DVFD 3TM6A 5E6IB 2IQAB 3P9MA 4Q97A 1DEDA 3LN5B 2ORBL 1OM3L 5C9JB 3VFMB 1PKOA 1G1YA 2CK0L 3MRQB 3B2UD 5JOPE 1TZIA 2H6PB 4NN6B 4OZ4A 2XWJB 1B0RB 5FHAH 3VJ6A 4ONFH 1CICC 3UTOA 3JUYA 4Z18A 5B38A 4JHBA 5DXWA 5C0CB 3NCYS 4FQXD 1XZ0A 2V2TB 2R39A 4Y2DC 1T7XA 4LDEB 5GS1A 2VO5A 2DWDA 1LEKA 4K7FA 4RNRB 2MCG1 5AUMA 5F9AC 1ZEAL 1U8LA 5JORB 4Q2ZB 4LLDA 5BV7B 3JV4B 1FZKB 1IGIH 2G9HB 4RSVA 3HE6B 4HSQA 2NZ9D 2R0KL 4PRHA 3OHXA 3SGJA 1TVBB 5D7JB 5T1LA 5J06A 3HA0A 2ZOKA 4F9LC 1CGUA 3VXUD 4OBSA 1IGTB 3BDYH 5CEYB 5I1JH 3G6DL 4IJ3B 2XKUA 4DCQA 3L5XH 2HVJB 2YXFA 1H3TA 2UY7A 1LK3L 5CMAA 1J05B 4XBEH 2G5BB 1A3LL 1CT8B 4Y16B 3UTQB 1R3LB 3HTLX 4NDMA 1A6UH 1EJOL 2EDJA 2X4RB 3EDKA 4QXGH 2XKNA 4U33A 3O6ML 4MA7H 2UWEA 1S7VB 2DJSA 1A22B 3BO8B 4WUUA 3ARBC 3S35X 4F3FB 1DSFH 3P40A 4OGYH 4PJ9C 1P53A 2F9BT 5DHYA 4O5LH 4YDJA 4LVNC 3CGTA 4NQDD 4XCNB 2DBJA 4FQJL 4Y5XC 1EGJH 1CG9B 3B83A 4ZO8A 3OAUL 5GGSA 4U4BA 2OJEA 2BJML 3MXWL 5I8CA 3FQWA 1F6AB 3TNMB 2OMNA 4AENB 3HPLB 2Z4QB 1RURL 3BISA 4LHQB 1QR1A 4XXCC 5E56A 2BOCB 5KVEH 5DUML 5AZEL 1YN6B 1DQQA 3OKMB 1MY5A 4JRWA 1RY7B 4OLWH 3WJLC 4P3WA 3QFDB 1PZUB 1KELH 3OXSA 2A6DB 3SJVE 4R3SA 4F7EA 2NTFB 1JPFA 4M7KH 5GRJH 1G9EA 5HYSG 3TPUB 3CMGA 1N2RA 4JZOA 4MD5A 4HKBA 2BP3A 4I48B 4XPAL 2ADGB 5EUKA 1WUNT 4HUUA 43C9B 4C56B 3RVTD 4JO4L 3MV9A 2V2XB 1R3HB 2B4CL 3BGFC 1BOGA 4ZFGL 3M8OL 2V5SA 3IDYC 4NC0B 5HHOD 4JRYB 1KFAL 3INUH 2GFBA 4WCYH 5D7IB 4K55A 2FNBA 2VZ3A 3QZWG 4JQIL 1JJUA 2CGRH 1YY8A 3MLYL 2AEPL 3TNNB 5EU3A 3HRZB 1EZVY 3PDDA 1IVLA 3BE1L 3TBVA 4PB9H 3VI3E 3VGDA 1T03L 4GKSB 1GOGA 3W11C 2B5IB 4Z76A 4FQ2L 4E0RA 4P2CG 3RPIB 3VD4A 2CDFA 1FCCA 3RL2B 2O26U 4DEPC 2R4RH 4UILH 4X80L 1F8TL 2YMXL 4FQIH 2B2XL 3F7PC 4X7TA 3MO1A 3TBTB 1M7DB 2HFEB 1AD9A 4M1DL 4P5KA 2Y23A 5EA0L 3RL1A 2EDNA 1DBBH 3TESA 4MJ5A 5IQ7L 1NGXA 1SJVA 4LBEB 4E42B 5C0RH 2A6KA 1DFBL 4QRRB 3ZDYF 4DGIH 1GIGL 4XNZB 4LLVA 2W1NA 1G9MH 4KRPD 3TWCH 4UNTA 1Z3GL 2CRZA 3QWOA 2OX5A 2R4SH 1MHPH 3SCMA 2PETA 5HI4D 2MHAB 4OIAA 5D1XA 4M7ZC 5IVZB 3B5TA 4WO4B 3S8WA 1A1MA 4O51A 1WK0A 5IV2B 5TE4H 4ZFOL 4NQCD 3CX2A 3UJJH 3GMOA 4XNMA 4YPJA 1DCLA 2UYLB 1GGIL 4O02H 5C6TH 3RWEA 3U4EA 1OWRM 3VFNA 5F93C 4GKNB 1S7TA 1U8MB 4JG0L 3T0VA 3G5ZA 1MPAL 1D5BB 2KZ1B 1MCDA 2PW2B 1PZ5A 5DFVD 4LVHB 5IF0A 2YKLL 5D2NB 3DURA 3SKMB 5D2LF 2JK5B 2YOCA 1ZGLP 4R96A 3RX5A 3WXVH 4OGAC 2RAMA 4HQQH 4BKLB 1G7JA 3QUMA 4LPUA 4S1QL 5DWUH 3UTTE 3BUYA 2A38A 4HK3J 1CDUA 1FNGA 4TSBH 5FKAB 4LLUB 1YMME 5DUPH 5I76B 2VXUH 3QIUA 5FM5O 4PRID 1AKJA 3ULVH 5IWLA 1SY6H 2D7PA 1ZT4B 3HE7A 1MRFH 4JRXD 1XCQA 2BRRH 3LMJL 3VH8G 1O0VA 1EHLL 1P7KA 3ABZA 5CZKA 1QLRA 4ZO7A 1T22B 4FHBD 1JWSB 2W65A 3OJDA 3WUWA 2LQRA 1DJSA 4NCDA 3T0EC 1CL7I 2AEIT 4FN0A 4S1RL 2VJXA 3RGVB 4IMLB 4D0CA 4DAGL 3G5VB 3EYSL 2ICWJ 4JGMA 1RJYB 3UZVB 3QEQB 4JN1L 3JBG7 3ZDYE 1NFKA 1BREA 1ZSDB 5F96H 2X10A 2J1KA 2C3WA 5F1NA 3FRPA 3X14A 5CJQH 1ZHBB 3TFKD 1FFOA 1RZGB 2VABA 4Y4KC 1WIOA 4I3SH 1CD1B 5FA4B 5JW3L 2PW1A 3VFOA 4XC1L 1G9MC 2AJXH 4MNGB 3IDXL 3MOQA 3D69A 1FPTH 4I4WB 3OAZH 4JLRB 4X6BB 4LRNH 4NSKB 4MYWB 1CVSC 4ETYA 4MA8H 4EDWL 3EJZD 2MNUA 5J9PB 4EVNB 4EOWL 5T1KA 1P7HL 4PS4H 2H8PA 3P73B 3S3SA 4HKXA 4KROC 2J3SA 4HUNB 2W9LA 2GTZB 3V4UH 4NO2A 4JGJA 4J7RA 3FFDA 5BRZD 5I73B 2EDDA 5DVLA 1NCWH 5E8NA 2P43B 5HGGS 5EFIB 2PUQT 4U6HB 2NW2B 3F8UB 43CAB 3RA7L 1KLUA 2CIKA 4YWGL 1W8NA 2VB5A 3QIWB 3SOBL 3H0TA 3TV3L 2J5LB 3P30H 6FABH 4JRXE 1G7PB 4NCC1 4A2LA 3KWWA 5HY9A 2IANB 1D5MB 3B5GA 4OFIA 3CMOH 3RX7A 3VXRA 4PR5A 4V1DB 5IB4B 5DVKA 4N0FB 4PGBB 3BP7B 4QRUB 4UT9H 2FIRT 4WI6A 3H9SB 3VWJD 5BMFL 2Z31A 1XGQA 3ULVC 2Q8AH 1KLFA 3VGBA 5CWSB 3B8SA 3IDMB 5FGCE 4AM0A 3P9LA 1FFQA 1YUHA 4F57L 3IRZA 5JW5B 1IBGH 3NFNA 1J86A 5JXEC 3RTQD 2FJHB 3H42L 1QLFB 1T89A 4FXGA 4DZBA 5DJ8B 1UJ3B 3WL9B 3B9EA 4D9QD 3DOSA 3FRPG 2WP3O 4X7SH 3RDTC 2WP3T 4Z7WF 5D7SH 2QQKL 1YEDB 1JF5A 4YHOL 2I9TA 1LVEA 2ZPKL 1BECA 3BPCA 3MGTB 4HFWA 5DJXA 2FL5A 4YFEA 1A9EB 1F4XH 5TDOB 3ZL4L 3CSYB 4X9IA 1HILB 4XGZA 4G8GA 3GSUA 4XPGH 1F97A 3V6BR 1S7XB 4HKJA 1F4YL 1G7IB 5IKCB 3S34H 3DX6A 4PRAB 3TBWA 2C3VA 1W72L 3EO1B 5DO2C 4F9PA 4IRSB 2D7TL 5D93B 1I3RB 3BEVB 4N5ED 4XNUH 3VU2A 3U46B 2D7QA 1BQLL 3X11B 1FSKC 1EO8L 1ZLSH 4X4MA 2CKBL 1MJ7H 1S78C 2ITCA 1QHOA 4GXUN 4Y2OA 3C8HA 5FOBB 2N7BA 2R1XB 4G42A 3TT3L 4DKEH 2EE3A 2P4AB 2HT2C 1ZHKA 4Q6IA 4OZHF 3QYCA 4AQOA 4O2CB 2BHYA 4P2QE 1HZHH 2X70A 3NCBB 4I18A 4BZ2L 3MRHA 1Y6MR 3MRPA 3CLEL 2GJ6E 5GQBA 5DMYA 2X4UA 1J0ZA 4LCWB 4WW1B 1Q0YH 3VXQB 4KJPC 1FE8L 4PJAF 5I8OH 4OLUL 2IADB 5SWQA 5C0FA 3DV6A 3DV4B 3QCVL 5GGUB 3SJVA 3GJFH 4P59H 5E2UL 5EU4A 2X9XA 3BZDA 4RZCA 1KIUA 2GKIA 3U2SB 1NGQH 4GQPH 4MNQA 3QPQC 1FBIH 5DD5L 2L7UA 4U6VL 4D9QE 3O6FA 4OKVB 1PY9A 4XI5D 4HF5L 5CILL 4ZTOH 2IAMB 3KR3H 1IT9L 5F72S 3KPSE 3M1BB 4NQEB 1EXUA 1YEFL 1KJ3L 2IPUG 2VDOH 2XN9E 3QRGL 4HKZA 3QUYD 4XTRC 4Y1AE 4I0PA 1BVKA 3ARFB 3NCEB 1FNSH 1SJHB 4LPXA 3STBA 4BJLA 2JELH 1R24A 2YUXA 2VN4A 4PREA 5DD1L 3LB6D 3Q5OA 5I1IL 3P3YA 1DQJB 1JRHI 4P49A 4JKPL 3VCLA 4N0UE 4U1HB 1NFDB 1I1AD 4MA3A 3VXTB 4HUVB 2BVQB 2BNRB 3O41A 2IH3A 2PO6A 2XICA 1FL6A 3HZVA 4J8RA 4N0YH 1LE5A 5KJRH 5DJZB 1Y18B 2ATKB 5LWYH 5C7XH 1U92A 4KK8C 1G6RA 1FH5H 4IMKC 5JDSA 2Y07H 5I1DB 1WFUA 1HSBB 1T66D 2NY3C 1K8IB 5C0NC 4LNRA 1AHWB 1PKQA 1R6VA 2HYMA 2Q76A 3GHBL 4PRPB 3IFNH 1IM9D 1T04B 3O8XD 4EI6A 4M62L 4QTHB 2H2PD 2I25N 4K23L 5T33L 4OSUL 5GS2D 5FYKL 1C12A 2BNQA 2YRPA 4XPTL 2BZDA 2XQYK 5DZOA 4IBLT 3W9EB 2EIEA 5DJCA 5B38B 3WCYA 1MFEH 5SWZA 2ZCLL 4MD0A 3TA3C 5FYLH 2AV7A 4CN6A 3PWNB 1ZLWK 4WFED 5GS1B 2W9DH 4MJ2A 3P4OA 1U8LB 2EXYC 2FZ3A 4KJYB 2FEDC 1CZ8H 3GNMH 4UNVA 3MR9A 4G6AC 2PF6A 4R90L 3VD3A 4G9FE 2Q3AA 4OZIA 3WIHA 3OHXB 2NXZC 5KN5B 1HHGB 1OY3B 2XTLA 1YC8A 2BFVH 3ROOA 3ARUA 4OM0H 5BW7C 1R5IA 2ZOKB 5IESH 3BW9A 1S8DB 5I15H 4GAJL 4L5FH 2VDQL 3AREA 4RISH 1RAMA 3D18A 5AG9A 5I2IA 4JZJB 5HYIA 4GSDL 1KCSL 5CEZH 2AEQL 3GHEL 4JFFA 2P5WB 1DN2A 3LQMA 2AGJL 1IGYB 4YE4H 3B6SA 3UTTA 4EN3D 5DK0B 4R0LB 1I9EA 1J88A 4CMHB 1FZMA 1YMMA 5DMJB 4BELD 2AJUL 4D8PA 3D85D 1KPVA 3O81A 5DHYB 3UJIL 5C0DB 3UBXB 5EO9A 1QLEH 1KJMB 2HFFA 5ITFB 4ZXBA 3P0YH 2YPLA 5JPMB 4OFKA 3UX9B 3AS1A 3ZE2F 3PABB 5FUZL 1QP1A 3CXHK 1A4KB 5KANI 1FL5A 1T80A 2VSCA 2X89A 3WHXB 1U93A 3TZVC 3P2TA 5HSFA 4GXVL 4AEEA 1OTSD 1HHJA 1I9JH 2AP2A 5GGRB 4PB0L 4NKOA 4M5YL 2XOTA 4P4KB 4DGYL 1FNAA 4OCSH 3T04D 2DF3A 4LQFH 4KTDH 3GSNL 4HGWA 4MJ6A 3GSOB 1XGYH 5CUSL 2NY6D 5E99H 3HG1B 3EYQD 2E9IA 3QDMD 1HSAA 1OTUC 3F6LA 3WSQH 4DVRH 12E8L 4HBCH 4ZUVA 2R1WB 4R3SB 2VZOA 3L3KA 3NH7L 3MRRB 4Y4FD 2X4TB 1MFAL 2C5DC 1MCLA 2X1PA 5CSGA 1C5BH 5EUKB 3LVEA 4EUPB 4YHML 3WFEH 1AGDA 2XTJC 1RZFL 4JKKA 1MRCL 3S36H 4JANA 4BZ1H 4ZSOA 5LAXA 5IP4A 5T3XH 3O9WA 5KS9A 1KBGL 4QOKA 3BWAA 5FDWA 2FIKA 4X5XA 3CH1A 3GZKA 4K8RL 4MAYC 3IU3B 1JPSH 3IDNB 5DMGD 4O00A 5F1IA 5DF0A 4FTVB 4MJIA 1OHQA 2FD6H 2HN7A 5F7DB 1QFWM 4GW1B 4HWBA 1Z2KA 2P42B 3MUZ1 3EIFA 2MQ3A 4LAQL 1JNHB 2DQJH 1AXTH 2E7BA 3UAJD 1NCUA 4OFYA 4E0RB 5KSVA 3O2VH 4P2OC 1OAYH 1MCHA 3BPNC 2CDFB 3U30C 1INEL 1NC2A 4KJQC 4C56D 3F6IA 3TO2A 2EO9A 2AJSL 2F54B 1BD2E 4I77L 3RVXD 1RIUL 3PGFH 4K3JL 4ZQKA 4H0GA 2UVFA 1TETL 4PJ5E 1JPTH 1R3IH 1I85A 1T2JA 2JIXA 4OCWL 4P5KB 3ARPA 1ES0A 4GUPB 4PJHB 1NBZA 3ZE2E 1MFNA 2KDGA 2WUBH 3VXME 1S9VA 1GH7A 4XAWH 1WJ3A 3C5ZD 5I8KH 3O6LL 4RFEB 3T65A 3B9KD 3PIQA 5A16B 5J12C 1EHAA 3A6OA 1RZIB 4L8SA 1S7QB 4OI9A 1FRGH 5CEXB 3IB4A 4NPYB 5TQ0L 1RIHL 4P4RB 3R8BB 1HIML 4AEFA 4TSCH 4JVWA 5IOPA 3Q1SL 3GMOB 1FNEB 5L7XL 4ODSL 4K9EL 3MRNA 1EEYB 5JW4M 5GS3A 3V5HB 5IB2A 3VWKB 5SX4H 3G5ZB 1QVOB 3SBWA 3NPSB 5EO1B 5C07A 3HRPA 3RNQB 4WJ5A 3FN3A 5IF0B 3C6LA 4OKDA 2HVKA 4QF1B 1MHCB 5GGQL 1UCBH 4JZNB 3PXHA 3LRSA 2VUYA 4R96B 4H20H 4NRXB 4TULH 2JCCB 5CZXD 3FB8A 3VI4F 4ZFOA 1VKXA 1YDPA 3T0AA 5HHNA 32C2A 5FUOH 2H3NB 3TIDA 5B39G 4NZRL 2HKFH 3ULUF 3BJLA 4DVBA 5ID0B 2RR3A 4KI5C 3ZKND 3C2SA 5GRZA 5GGTL 1J8HB 3OX8B 5IMLB 3OMZA 2XZCL 5F89A 1A1OB 3FB5A 4X6CA 3ULUD 4TQEL 2PTTA 1YPZF 3WIIH 4KVCL 3O3DA 1HKLL 3T3ME 4RBPH 5D7LA 3D25B 3WUWB 2IMMA 1FIEA 1YEJH 4ONHB 4P5TA 1N64H 3RAJL 5C0JA 1EUUA 4D0CB 3QDGB 4L8CA 1YEGH 1UWGH 5DJ0B 3RNKB 3OKDB 5FF6B 4P2RD 5C08E 1JF1B 2XQBL 2I24N 2J8UB 3CJJA 4YHYB 2D7MA 4KY1L 1HCFX 5HTSA 3KPSA 1YEHH 4LK4A 2BOBA 1OARH 2VABB 3QI9D 1FJ1A 5E2VH 3KPLB 1U95A 4ZS6D 3VMNA 3F7VB 3U9PH 2DI9A 5FXCH 1OAKH 5ENWA 3TVMA 3SKNB 5FAAA 3S88L 1P1ZA 4JO3L 5F6HJ 4AIXA 2Q7YB 3C9NA 2NW3B 4IRZH 3LS5H 3MLPA 4I2XE 2L0DA 1MJ8H 1PG7W 3MLUH 4W81A 1T1YA 3MLRH 4X6EB 1M4KA 2AI0L 3HPJB 3LY6A 1Z9OA 3U7WH 3U7YH 2OQJB 4M1GH 3QFJA 4KPHH 1RJZB 5ESAA 4OCRL 5E94B 5LBSL 4NQUA 3O6KH 3TO4D 2YRLA 5JIPA 1NUDA 2HRLA 5C0EB 5DJ2B 3T0DA 4WW2A 3T2NL 2YK1H 3QUMH 2CIKB 4I9WE 3VI4E 1JZ8A 4NQXA 3SDCA 1J0HA 3I50L 3ULUE 4GH7B 4EI5B 2NXYB 4EBQL 2PYFB 2OP4H 4JB9H 5I1HH 1D9KA 2APVA 5D6CA 5L2KD 3LD8B 3GBLA 3VXRB 1G7LB 4NZTL 1QKZH 4R2GB 3G6JF 5ISZB 2Q3ZA 3NMEA 2J2ZA 4HH9B 4POZC 1RVFH 4M6NH 4Y88A 3MACH 2AK1H 5GHWH 3TJHC 4NWUH 4P2RE 2B7DT 4CGTA 2VDPL 3DMMD 4P46D 4J6RH 5EU6B 4Z5RB 4KRNA 2AQ1A 4FXGB 5A40E 5D1QB 4LEXL 2GSIA 1NMBH 3UTSA 5ALBH 4XC3L 2V9RA 4ZUWB 1OAUH 3RIFK 4K3DL 3SDXF 4X7DC 3BH8A 5FK9B 4LKCA 4I3RH 1LMKA 2AXHA 3LN9A 3BIBX 4XP4L 2ZNWA 4QNPF 1QSEE 4PY7A 3U1SH 1MI5B 4GBXA 1H8SA 3CFJA 3SCMC 1E6OL 4Z77A 1UWEL 1ND0A 3EFFA 5D1XC 2KH2B 4Z7UA 2EH8H 1X6NA 2C3VB 3O3AA 1SJEA 5CBEA 5L9DH 3U48A 3IT8D 1JE6A 3MLXL 5FKPA 1T5XA 1ORSA 4HS3B 1GGBL 5C0AA 4XCFL 5IEHA 1F5WA 1VB9A 1LEIA 4M48L 2ITCB 1NFIA 2C1PB 2LU4A 5H35A 4G42B 5HI5D 4MJ4A 5J11B 1AO7E 1J8KA 3WIFB 4L4VB 1JHLH 3KXFB 1WITA 4Z95H 1S7UB 3HUJB 4MLSA 5I18H 5IGXL 3OKEA 4YBQD 2CDGA 3QDJE 4Y5YA 4XVSH 3CVHL 2FX7H 2VR5A 3EDDA 4X7FC 1R5VB 1CLOH 1W72A 4UZGA 4PTTA 3H3PH 1RUPH 3ARVA 5DMIL 4M1CD 3PWPA 3DX8B 3WLWD 5SWQB 1QFOA 4JFEB 2CKBA 5I1KL 1C5CL 5B3NA 4QHUB 4B7IA 2XPGB 3QIUC 5AWNH 3ROLA 4RZCB 4R8WL 1P2CB 4WI5A 4YLQT 3HE7C 1KJ2L 2GSGB 4L9LA 3REVB 4TOYL 3MRCA 3BZFB 4DFIA 2X1XR 2P47B 1HH9A 4N8CH 4WUKH 5IQ9A 1WZ1L 1WCBA 3QNYA 2XYCA 3QXTA 1J1OH 2QR0A 3L3JA 3QJHB 4OD2A 1F6LL 1Q9LB 4XX1E 2VLJA 3BPOB 4YBLC 1JGUL 1K9TA 1KXVC 1QFWL 2IH1B 5ITBL 3WJJC 5BOPA 1MCSA 3SDXE 3UDWA 2MKLC 3CFDA 2YUWA 1V8HA 2Z9TA 4GRLD 5JLZB 3RIFF 5EOCL 4BFIA 1BIIA 5F7LB 4QNPE 1PSKH 2J6EL 4XP6H 4HS6A 2DYPD 3TLRA 3VRIB 1KGCE 2IMNA 1U92B 3V4PL 5JDSB 1XR8A 5IG7A 1BWWA 3PWJA 4YK4B 3B4NA 4APQA 1N5AA 1PKQB 4LLYA 3NFSL 4XNYL 4NNPH 2HJLA 4M00A 1MIEL 5K59F 3DECA 4I0CC 4H1LA 3RZCA 3DUUA 2GCYB 4XHQA 3VXMA 3FL7A 4I5BA 3AGVA 5IHBA 5INCB 4NQVA 2BNQB 3EYUL 3SDDA 3VGFA 1CGTA 3W0WD 1UJTA 1HDMA 3MV7D 4NRYA 1HKFA 5SWZB 1W2KT 4WV1B 2AV7B 3CCHB 2E6JA 2F8OA 3MRIB 2UZIH 2ERJC 3LKSB 3DX7B 3P4OB 1OSPL 3RZWA 3M17A 5HYJA 3IAPA 4KK6D 2EDLA 1YYML 4QT5A 1FN4A 1TJHL 1J5OH 3EYVB 4M61B 1AE6H 2JJVA 1IEAA 4ZPVB 3HC4L 2XA8H 3D3VD 2DQUL 3VXSD 1W0WB 3W5NA 3O3BB 3F58L 3V6OE 1LHZA 1ZLVH 3R0NA 1KPRB 3MA7A 2MWCA 1FORH 4RMSA 5C0BB 5DURB 2Z31C 2OCFD 4PJDF 4KMLB 4MS8C 4FQQB 1E4WL 5HBBA 3IDIB 3OB0K 1RUAL 4FRWA 3DO3A 4H5SA 4OZFB 1T89C 3OV6A 4NKIL 4LNVA 5HVHC 2BERA 1DE4A 4YXHH 3UO1L 4CU7A 4JG1H 3JZ7A 2V9QA 2X42A 3IAQA 5FECA 2AXGA 4DQOH 4E41A 4UOJA 2DDQH 3FZUD 2PTVA 3CFKB 2E3VA 2VUOA 2H9GB 3VFRA 1G6RH 4J3UA 2WIIA 3VDCA 1I8LC 3D39B 3K2UH 1TCRB 1BF2A 5BZDA 2G60L 4H1LG 4HIHA 1A7OH 4K2UH 4JFDA 5ACZA 3V0WH 4QHMB 4BFBD 3MV7E 4F9PC 3MV11 3WKMH 2X1WL 4IRJD 1MAML 2NY1C 1EEZA 2PYEA 4NKMA 1J11A 5IVOA 3VXOB 2A73B 3LH2L 4Y5VB 3CUPB 3CDCA 7FABL 2NYYD 3RY6A 4PJ8B 4GXUM 5EORH 5HGAB 3MCLH 2YUZA 1F4WH 3VGAC 1XT5A 1MQKH 4MMZC 3OGOE 2PXYA 3MRJB 4Q6IC 5DR5H 4EJ1C 5IUSA 3D3VE 4I18C 4XH2B 1EERB 5EU5A 4LHUB 3G5YA 1NGZB 2ORBH 2X7LA 5CKGA 3WIHH 3GKWH 2CK0H 4ZSOB 4P4KD 5KS9B 1NMAH 3VG9B 4QRPD 3GSNA 2RCSL 3OKOA 2FO4B 1U58B 3MNWA 1JP5A 2AABL 2IPTL 4HK0B 4X5XB 2W0FB 4KZEL 3KPTA 4JJ5B 5IBUG 5J3HD 5C9KA 3HG1D 4G80A 2RQ8A 4PJBF 3U4AA 5LCVL 4RX4D 5F1IB 1M7IA 4MJIB 4M3JA 4IDLA 3QO0A 4TVPL 5SV4A 4GW4B 2EKSB 1ZEAH 3O6FC 1XF2B 2ZCHL 5DQ9B 5GJTH 1JMXA 5F21B 1V05A 3LPWA 4X5LA 1T6VN 3GK8H 4RGNC 2AJVH 3IXTA 3WE6A 4FNLH 4XPBL 4I0PC 5EU7E 1F02I 1NC2B 3VE0B 3BZ4B 3TO2B 5I0DA 2JB5L 3C60B 3KYNA 5MEND 1KF9B 3QAZC 1OT2A 5KVDL 3V6FA 2ZKHH 5ANMB 1IAOA 5E8PB 5TE6L 1T5WA 1T4KB 3N1GC 3KJ6L 4PG9A 1RK1B 4QRQB 4XNXL 1VHPA 1QFPA 2P8PA 2LE9A 2PO6C 4OUUA 1T2QL 4IS6A 3QEGH 2EO1A 1WBZA 3T2QA 4KAQL 2A9MH 1AY1H 2DQIL 2VL5B 1EJOH 3O6MH 2YEZA 3MBED 5F9OL 5I16A 4HPOL 2FRGP 1VERA 3CSPA 1VSCA 2CLZA 4NBZB 4PRNA 4JREC 1CR9L 5IB5A 1LP9B 1W0YT 2WWKO 2VZTA 4HWZA 2A74B 1CDGA 4UIMB 1N0LA 1INDH 3QHFL 2WINB 3L3IB 5CJOL 1GL4B 2DL9A 2BJMH 2A2QT 4LSDA 1GZQB 3MXWH 1MVUB 1JWMA 1DQML 2AV1B 3MRNB 4U0QB 1QNZL 3V0VB 3MJ8B 1RURH 5J89A 5KSBF 2OR9L 5HGBB 3CLFL 1YJDC 2YHGA 5DUMH 2OM5A 2FX8L 1SYSB 5I1GL 3QNZA 4N5UA 3ARDA 3QHTC 4Z7VF 5IEKA 4WJ5B 3S3PA 4Y8AA 2PKDA 2YN3A 2YSSA 1HEZB 3LRSB 2R29L 4PJBE 4ZFOB 2NY0C 4N0RA 4WGWB 4Y4HD 5DA0B 3G08B 1AGFB 4HHAB 2P5ED 2ZJSH 2DN7A 4WI3A 4HWBH 4LF3B 5IB3A 1W8OA 2V7HA 1AO7A 2YD4A 4X99A 3AREC 1PVHA 5GZOC 5MENE 5I75B 5JO5A 4X6CB 1OCWH 5KSAD 1UZ8B 1PEWA 2B4CH 1KIRB 2J4WL 1I7TA 2J8HA 2UVEA 1EVTC 4MGXA 1P7QD 4OF3A 3M8OH 2D7OA 5D6DA 5CD5D 3T1WA 2Z0BA 4UDTB 2F53E 2FHFA 2VC2L 5D7LB 1NCCL 5EPMA 4R4ND 2DQCH 5JXAH 1NSNL 2ADFH 5C0JB 4L4TB 2AEPH 2OLDA 4X0KB 2DTMH 1P4BL 4YPGB 5FIEA 4Q7DA 1S5HA 4G6ML 2VXSL 1N6VA 3DPBA 1E4XI 3FB6A 3NGBB 4C54A 4Z8FH 2RJMA 2NX5D 3BE1H 1I9RL 4XAKD 1CU4L 3BKMH 4AMKH 4HLJA 4RFOL 4ZXBC 1A64A 5GGTA 3WFBL 4PJGE 1MH5B 3TN0C 3TYFA 1L0YA 5IFHH 4AEIH 1E27B 2C3HA 4PBWD 3DGCR 1F8TH 5ICZA 4YQXL 1EMTH 1W0VA 2P48B 2YBRB 2YMXH 2X4PA 2X4SB 5CS7A 1EO7A 3B3IA 3ZHLA 4Y2DD 4PJFF 1DTUA 2P24A 2Y7QB 3TVMB 5ILTH 5EBMB 4DGVH 3C9NB 5IQ7H 2JJWA 1I4FA 3FCTB 4XBGB 1B3JA 3JSSA 2E9BA 1T7YA 5CIPB 1DFBH 1RK0B 1MJUL 1T1YB 3WDIA 1GIGH 1H0DA 4MQSB 1CXLA 3FAWA 5DC0A 3EYOB 4LCIL 3BQUB 1J87A 5GISL 5DEFA 4HT1L 1IC5H 2VLRB 5JHDA 5CAYB 2GI7A 2EYRB 4Z7VE 4R7NB 1OB1B 3BH9B 4UIKL 5E03A 4CNIA 3EGSA 2P5EE 1C08A 1DUYA 5EUOF 3MRBB 4ZAKA 5E8OB 4ODXB 4OV5A 3O9WC 1UH4A 2C7UA 4G9DA 3OJMB 5FM5M 5GGSY 1GGIH 1ZA3A 2A9NL 3SDCB 1SYVA 2YD8A 3DYOA 3ZT5A 2BVOA 2DLGA 1RULL 2R2BA 1D9KB 3ARBD 1CDBA 1A8JH 4PJ9D 1H5BA 2D03H 3Q6FB 4JKWA 4JN2A 4JR9H 4YHZH 3KPPA 1NUNB 5D5MF 3CAFA 4X6DF 1XIWC 3EJJX 2YKLH 3L95B 4N8VA 5B4MC 1JNLH 3QUXC 1QFUL 5TFSH 4Q9BA 5DRNB 3MYJB 2B4CC 1HXMA 3EOBA 5FEBA 1ZS8A 1NEZA 4OCXH 2XZQL 3VFVA 3QO1B 4OUOA 1I85C 2YD6A 5HJ3B 1DQLL 1YNKL 3PJSA 5FA3A 2P8MB 3NABH 5ERWA 4GRWB 4CU6A 3FHQA 5D1ZB 5DSCA 3LMJH 5I1AA 4HUWA 1RU9L 4NC1E 5BV7L 5D4QA 4XX1G 2FR4A 1UG9A 3BH8B 5TQ2H 4XNQB 4U1JA 4XP9L 4PJFE 4PY7B 5HDQL 3U0PA 4L8SC 1XR9B 1G7MB 4S1RH 3IJHB 2FLBT 3VXUA 4Z77B 1ND0B 5DQDH 4GAYB 4QGTA 4Z7UB 4PJIF 5EB9A 2W38A 5CBEB 3BPNB 4FXKA 4B5EA 3TCXA 3N85L 5H8DA 3BKJH 4JDVB 4QWWC 2WAHA 4HV8A 5IEHB 3K2MC 1JNNL 4TRPH 2EDTA 5DQJB 4YJZL 2YS4A 4MA1B 3QIBB 5TE7L 4D0BA 5GRUL 2XIDA 4UV4H 1I7UA 3WNOA 3SBWC 1QO3B 4XC1H 4JFQB 5HDLA 3IDXH 2WANA 1X5FA 3C8KA 3TF7C 1P9MA 1VDGA 3QHZL 1UB6A 3D2UA 1CFSA 5INDA 4NQDA 1QG3A 4YDVA 3OKEB 1JFQH 4YXKH 5EC2A 4KK9C 2X9YA 3C6LC 5LGJB 4Y5YB 4J12A 3P4LA 3FB7A 2D7NA 4XHJC 1U8PB 2O5ZL 1MHEA 4PTTB 4EOWH 4PJ7F 1VGKA 1NLBH 1DEEA 2UZXB 1ONQA 1FP5A 4M7LT 1ADQL 1HHIB 4X6DE 2NMSA 2HG5A 5C09B 4LVOC 3BX7C 2EE2A 1EH9A 1IAMA 4OF7A 4ZFFA 1VACB 1OGAA 4ELMA 1NEZG 4L9LB 2CXKA 2CR6A 2CO6B 1T0NB 3VGHA 3MV8B 5IQ9B 3IFPB 1WCBB 1GJIA 2FBJL 3O4LE 2ITDA 4P5TC 2VLJB 4WHTA 3FO2B 4J3OC 1HN1A 2AERT 2OJZL 5EZIH 5HYSB 4NHCL 3BRGC 4TUKL 4HJGA 4JFED 3MRFA 1MWAB 2JJSA 2VXVL 4WEMB 3THML 1B88A 3GBNL 4YZFF 1CE6B 1FFPA 4F80A 5L2JA 3K4ZA 1N0XH 5HHOA 1CF8L 1KJ2A 5JIIA 4F7CB 4W6YB 5F1OB 1VEMA 4P9ML 1KEGH 3CIQA 2Y06L 1TJIL 3NPZB 3TJEL 1ACYL 4IM8A 4CVWA 4PJIE 5IG7B 4ORGA 1AD0B 2IGFH 3BGMB 2ZSWB 3QZWB 4APQB 4OQTL 1KNOB 4ZTPL 4XBPA 2QQKH 4HX1B 5JPNB 1H3PL 1KIQB 3LEYL 2I60L 4NN7C 1FC2D 3RZCB 5LQBL 2DWEA 4PJXA 4OGAD 4NFCA 3OR6B 2VLKD 3QXUA 2J6EA 1GPOL 1KG0A 3QCTH 1HDMB 5BXFA 3QQ4A 2D9CA 1MNUL 3GMQA 2YD5A 3I9GL 1A6VL 4WW2C 1W72H 1Q0XL 2D7TH 3I3BA 3E2HB 1LNUA 4PJ7E 2WK2A 3LSOB 5E8DH 3S97C 3S35H 3HZKB 1EO8H 1LO3H 2DM7A 1I9IL 3ZLQC 3M17B 2CKBH 3MXVH 4QT5B 1FN4B 3IETB 1BEYL 4MHHG 4OIIL 4KDWA 4NNYB 2ICWB 3DYMA 4XXDB 3TT3H 3T0ED 4M6MH 2NY7L 4YIQA 2AJZA 5KVGL 1A4JA 4F58H 5LVEA 2CK2A 1LO0H 4G5ZH 1VFAB 3MA7B 1F42A 2ESVD 4OTXH 2YD2A 2HFGL 3FFCA 4BZ2H 2WBJB 3SN6N 3CLEH 5F7FA 1XF4A 4JPWL 5DFTA 4NQCA 2V2WA 1OAZL 5JOFA 4JHWL 4OGXL 5JQ6L 4YO0B 1FE8H 4YH6A 3RUGA 4JFXB 4Y4KD 1CCZA 1TDQA 4OLUH 1A2YA 4BSVA 5F70A 3QCVH 5E2UH 4G6FB 1YYLH 1N5YH 1A6WL 2AK4D 4UQ2B 5H37G 1IKFL 3T4AB 4M8QA 4U1GB 5DD5H 4PJEA 3JWOL 4E41B 3AY4A 4WFFD 3ARGA 2W0KA 3SDAB 2DQHL 2FH8A 2QADB 5BCAA 2BC4A 4PJCB 3HAEA 5ALCL 4WGVB 3RWIB 3UPAA 4NP4H 5DS8A 1T21B 3HNSL 1LEGA 3QRGH 1EAPA 4OBRA 3NN8A 1I7ZB 3WFDH 4RCAA 4GBXC 5D2LA 4KROD 4H25A 2A83A 5KSUB 2VLKE 3AB0B 1EVUA 2VERN 1EFXA 3DRQA 2GITA 4JO1L 3GBML 3MLZH 4H1LH 4S2SB 1JWUA 3NBNA 3FT3A 1CFNA 3LEXA 4UQ3B 4AG4L 2JLLA 2MMXA 4O9HL 3PWUA 4NKMB 1BP3B 2P7TA 1E4JA 3ZYIA 3GIVA 4YGAB 4PJGA 5DD0H 1KULA 4NRZB 2FHCA 3RWGA 2NPLX 2IBGA 2HRPH 4MDJA 4OCYL 3KLAB 1BQSA 3ULVF 3QG7H 4LLQA 4LCCA 2FSEA 3T0EE 1DDHB 2Z93A 2DM2A 4BSWA 4Z7QF 5FM8A 2XV6B 1KN4L 5CCKL 3N1MC 5TDPB 2VDKL 3G5YB 2ZNXA 2OZ4L 2IALB 1B0GB 4K23H 2ESVE 2X7LB 4KKLC 5T33H 3ULVD 2CDEB 2Q6WA 1YQ2A 4OSUH 3WN5C 4XPTH 3GSNB 3VRLE 1HNGA 4GOSA 4MXWL 5DC9B 1N7MH 4YHIB 3IJYB 5JXED 4Y7MA 3KYKL 3BIKB 5SWSD 4OD3L 1D5XB 1N3NA 3FQRA 4HEME 5K9OA 2ZCLH 3I6LD 1TQCB 5EOQH 3RDTD 1F90L 1M7IB 2NLJA 1J9CT 2E7CA 2AK4E 1MCRA 1GAFL 3IVKB 4AIZB 5CZVL 3V7AE 3AUVA 4L9DA 2E8ZA 2NY2C 4R90H 1ZANL 3GMLA 1TITA 4OAWA 4D3CL 1QRKA 4KQ4H 3IXTB 1SMAA 1VPOH 4LHUD 1MJJB 3ARYA 3V8OA 5DD6A 3L1OL 3MUHL 4MLIA 3QBTB 2Z91B 4WEBL 3WHE0 2IG2L 3QSKB 3KYNB 1QSFB 3T4YA 5BRZA 3K1KC 3KPNA 3V6FB 3UDWC 1NL0L 2VDQH 1T5WB 5DO2D 3CFBA 1Q1JL 3EKCA 3VD7A 5E9DD 5L8JB 4GRMB 1V7NL 3HHRB 2F15A 4IS6B 3U9UA 3GUTB 3ZDXF 3O2DL 3VRJA 1S78D 4QY8B 2VLLA 3HC0B 4Y89A 4GG6F 3CC5A 3L7EB 4J1UA 3DUHA 3PL6A 2YEZB 1FLRL 2AGJH 4U3XA 3S6CA 2EXWD 3HMXL 1NGYA 1NCAL 3PE9A 2VDML 3KHQA 4CADA 5D7KE 4OJFL 4ELKA 3B8YA 2QSCH 1TVDA 3MOBL 2AJUH 5IB5B 3UJIH 3C60D 4HWZB 4HWEL 1OPGL 1ZT1B 4CJ0A 1CLYL 3U7AA 4R97B 1JGVL 2ADJA 4KJPD 3MMEB 1DP0A 3ULVE 3SDDC 2J8OA 5GRXG 4L3ED 2CRMA 3GJFK 4N1CA 2GK0B 1CL7L 2EDHA 4Z7QE 1A6AA 4X83A 5JA8B 4M5YH 5SWSE 3QPQD 5IVXB 5EC1B 2Z35B 4S1DD 1CD9B 1SBSL 1D6EA 2H1PH 1ODAA 2R23A 3P9WB 3QUZC 2A1WL 5CUSH 4WHCA 4XTRD 1T6WA 4P5MA 4JY4A 1TTFA 3JVGA 2W59A 1KEMH 3EBAA 3UPRB 3PDGA 3OL2A 3NTCL 1HHHB 4JPKL 3S5LG 1JGEB 1N59B 4EQ2A 4DZ8A 1OAXL 3KS0J 3H7BB 1NAMH 2B0SL 5FO9B 2FCBA 3BHBB 1XGPB 2OK0L 1KBGH 4PYGA 1F3DJ 3S37L 5CLWA 3IKKA 5E9DE 2O61A 4NT6A 4KK8D 1C1EL 2FDBP 5TF1L 1IEHA 3BP6B 2NY3D 4QHNA 5C0ND 3K4AA 1H9VA 5DMKB 3RBGA 3KPQA 1OF2A 1CFTB 3HZMA 5BS0D 1DUZA 1LO5A 3GSWB 3SGEI 3TYGL 4WWKC 3ZDXE 3FB6B 4F15B 5CGYC 3UMTA 4OLXH 4FQ1H 4LAQH 2GT9A 3AVEA 4OZHA 4Z0BL 5EIIA 5D2NE 1X7QA 4R4FH 5F3HB 3W9DA 1XCTA 2EKJA 2A6JA 3D5OF 1FYTD 1NGWA 4OIBA 1FCGA 1RZJL 1RIUH 2BCKB 5EOTA 3KLDA 4K3JH 5DEGB 1TETH 4UOW1 4UINH 5B8CB 4S1SL 4R26H 4PJAA 1BFVL 4MDIA 2R69L 5TH2B 4P3DB 4FABL 5F7EL 2QSTA 4OV6F 2EXYD 1CDYA 1JF6A 2FEDD 1NBYA 4MQXC 5BZWB 3L5WA 4X4XA 3RY6C 4LSRH 1H0DB 4HUMB 1MIMH 2NXZD 4ACPA 1NBVL 1UB5A 3FTGB 5JHDB 4NM4L 5LXGL 4EDXB 5EZJB 2PXYC 1H8NA 1ZT7A 1I8MA 1U0QA 4CNIB 3F7QA 3BPLB 5EZLA 1CLCA 1BAFH 4NWTH 1MLBB 1RIHH 3ZO0A 4P9HH 4JO2H 1UXSA 1B2WL 1NMCB 5ESVA 2C7UB 3ILQC 5GJSH 3MODL 2VIRA 4U1KA 5BQ7B 4ODSH 4YC2C 4BFGA 1JIBA 3BXNB 2HKHH 3O3EA 3AU1B 2QKIA 5J1AB 5GGVH 3WNLA 5CP3A 3O8XA 2R2EB 4A6YB 3WO3B 1EIBA 5JNYB 4JN2B 1DVFB 3FMGL 1UVQB 5DRWB 3DWTA 3GSVB 5E4EC 3UC0L 1DLFL 5BS0E 1JHKH 4XRCA 2QSVA 5C2BL 1JYNA 2GJZB 1NUFA 3F5WA 4NZDA 5AYQA 4CVZA 3R4DA 3HNVL 4PGCA 3TZVD 4TYUA 2O5XL 1U8QB 4NJ9L 1ZOXA 1AGBA 3OG6B 4FQXB 4I0KA 5CJXA 1SVZA 2XZCH 2YZ8A 3WEXB 1QQDA 3SKJH 2KQNA 4N90D 4WENB 5ICYA 2IBZY 5E4IA 1RIVL 2ED7A 2DLEA 4ALAL 4IIQA 2E9WA 1OTUD 2ZUYA 1MFBL 1M7XA 5E6IA 1FG2B 1HKLH 1G9NL 2XWTB 4U7KA 5C9JA 1XF1A 5DRXA 5HHPA 3CZJA 2H6PA 3RAJH 4WDIA 3GSXB 4FP8L 4EXKA 3WXWL 1JPGB 1B0RA 4EZMA 5HD8C 3MJ7A 1YEEL 4ZS7L 1UM5L 1N8ZA 1KENH 4NNXA 5C0CA 3WFCL 5FYLD 2V2TA 2XTJD 1FV1A 3DVGB 1A6TB 4OFPA 3B2VH 3AMLA 4RNRA 2VDLH 5IHLB 1BJ1H 3DXAD 4BK5A 5JORA 4Q2ZA 1SEBB 2D31B 5HGHB 3JV4A 1FZKA 2G9HA 3KPRD 4EN3A 3HE6A 5EN2B 4MAYD 1MY7A 2N7AA 1I7UB 1IE5A 5FHBL 2V6HA 3HNTH 1JRHL 3DJ9A 1KYOJ 2ICEA 3ARDC 5D7JA 1F11A 4YDVB 1OD7A 5CEYA 1M6OB 3IU4L 2LTQB 2AI0H 1QBLL 1MHEB 2HVJA 4P2OD 4P9HC 5LGHH 2BSRB 4KJQD 5FGBA 4MXWH 1QRND 2ZUQB 1J05A 4NN5C 1TFHA 2G5BA 5KTEH 4Y16A 3UTQA 2YD9A 1R3LA 4OZGF 2HP4A 4OCRH 2HLAB 4HJJL 4ETQB 2X4RA 3T0XA 4U31A 2W9EL 4HEPG 1S7VA 3BO8A 2DLFL 3PQYD 4F3FA 4TTDC 2XT1B 3F7YB 3I6KA 5KW9L 5D6DC 3RFZC 4XCNA 1BHGA 4N90E 3CVHB 3I50H 1P5VA 3MJGX 4N68A 5F97E 1CG9A 4LDLB 4BUHA 1U8OB 2XZAL 3EO9H 3OZ9L 3ARQA 4KU1A 3IRPX 1T83A 4RAVB 5BVJB 1EO5A 5IK3B 2EZ0C 4LSVH 1F6AA 3TNMA 1ADQA 3L5JA 1IFHL 4AENA 2Z4QA 3I75B 4K07A 1ZKAA 5CJ5A 3ZKXC 4JDTL 5I1LB 1YN6A 3BFOA 3Q6GH 4GKZA 1NAKL 5FYLE 2CH8A 2XTJE 1MCKA 3OKMA 4LCWE 2WBWB 1F3JB 2VWEC 3QFDA 2CD0A 5C0IB 3QISA 2A6DA 3L3GB 3QXAB 1OP3H 5DYOA 3C2AH 4C58B 3U36B 2NTFA 4HUXB 2HTLC 2X4OB 1TZHB 4QO1A 3TPUA 2HJKB 2JJTA 2R56L 1DBKL 2K7PA 1NBQA 4K3DH 1WC7B 4I48A 2B1HL 5GIRB 1L6XA 1WIPA 43C9A 1G7QA 5T3XD 3H2WA 4C56A 4XCCH 4NQEE 2V2XA 4LU5L 1A14H 1DN0B 5EO0B 3SQOL 1INQB 3ZKQD 3HZYB 3DETC 4KXZH 5SV3A 5T1LD 4G6JL 3A0OA 4JRYA 5IFAL 1E6OH 4L1DA 4I8DA 1QRNE 4KI5D 1LO2H 4OFDA 5CEZE 5D7IA 2FGWH 4ZAKC 1IGFL 3QWRA 3OF6D 3NAAL 4TNVK 3MRGB 2UWEF 1LNUB 4OCMC 1ITCA 3BT2H 3CFCL 3HRZA 5F6IB 1RUKH 1RJLA 4OGZA 4XCFH 4RBPK 2M26A 5ELIA 2BNRE 4OZGE 3B9KA 1FVDB 3MUY1 4KRPB 2CLVB 4KKCC 1JYXA 3WS6A 3RL2A 3E8UL 1H5BC 5J13C 3WDHA 2ARJB 3FO9B 3BESR 5C92A 4LPTA 1M7DA 2HFEA 5DI8B 1L9MA 4NQCB 3IFLL 1IKNA 1D5ZB 1A7QH 1I1YB 1T0MB 3DRTB 2V5RA 3FT2A 2F5BH 5F9WB 4LBEA 2DQTL 4E42A 4BSVB 4QRRA 5I1KH 1C5CH 5E95B 2DQEL 3NZHH 4DOHB 3JWDH 3ZE0F 5IW3A 1HYRC 3V6OC 3BZEA 2E8YA 4RMUA 4JE4B 4Q0XH 1O5DT 2FX9L 2EH7H 1MRDL 4RFNB 2MHAA 4PRBA 5IVZA 2C1OB 4WO4A 1RUML 5HHMD 1BX2B 5MEQA 1WZ1H 5IV2A 1K4CB 1HWGB 3N50A 1MF2L 2Y5EA 4PRHE 5D2LB 3KVQA 3X3GL 1JGUH 2UYLA 1QFWH 3L7FA 1DL7H 1OQXA 5B39B 3BN9C 4GKNA 2GITB 1U8MA 4PRIB 3VFUB 3FT3B 3G9AB 35C8L 4KZDL 4JRXB 3MV9D 5EOCH 4JM4L 3JV6B 2J6EH 4JFHD 1D5BA 2VE6B 2PW2A 2IFFL 5DTFB 1LDSA 2B1AH 3SO3C 3P11L 3V4PH 3SDAD 4PGDA 5HPOA 3SKMA 2V7NB 2JK5A 4M6OL 4H8WH 1UYWL 4XMPL 3S96B 4BKLA 1TPXB 3QEHB 4MDJB 4DKFL 5J4MA 1CQYA 4CVUA 2UWEE 3EZ8A 3NFSH 4WUUE 1P9MC 4BK4A 4TNVF 5I1CH 4POZD 3QQNA 5FKAA 4LLUA 1FFNB 5I76A 1MFDL 1C16A 3CNKA 4Q9RL 3E6HB 3TJHD 2Q6WB 3WO4C 3BKCH 4WI8A 1ZT4A 3JV5A 1ERNA 3UPCA 5B3JF 5J56B 5EZOH 4NC2B 1QYGH 2C3XA 1N3NB 5K9OB 3FQRB 5ADPL 1JWSA 1RQ5A 3AAZB 5DLML 4TSAL 1OL0A 3PP4H 3QDHA 1IAIH 2NLJB 4G3YL 4IMLA 4YEEA 4IOSD 2XWBA 1OSPH 3JTSB 3G5VA 1RJYA 3QEQA 3RWJB 1YQVL 2HWZL 4LKXB 4NUJB 5I0ZA 1ZSDA 3ZE0E 3ARTA 1AXSB 2VKXA 3C8DA 2E5EA 3ES6B 4D9LL 4KWUA 4RGMB 5HHME 2EYTB 1WEJH 5MI0C 4YDLB 3SCMD 1ZHBA 5ETUB 1IGCH 5D1XD 3BVNA 4L3CB 4UTBH 5FA4A 1MFCL 2JJSC 2CMRH 3JWDC 1GZPB 4GMSH 3MFGB 5E8EB 4MNGA 4FQCH 5ACLA 4HZAA 4JLRA 4X6BA 4NSKA 4NUGH 3VRJB 3MV9E 4JFHE 5F7HA 2DD8H 5HXMA 4J1UB 4JQVA 5EU7C 5MP6L 5L2KA 4NKIH 1DBJH 1BFOB 5DVNA