4M9FA

Dengue virus ns2b-ns3 protease a125c variant at ph 8.5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
233
structure length
200
Chain Sequence
GSHMLEADLELERAADVRWEEQAEISGSSPILSISIKNEEEEQTLGLEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNTGTIGCVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIANTEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS2B-NS3 protease
publication title Allosteric Inhibition of the NS2B-NS3 Protease from Dengue Virus.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 44
structure length 200
sequence length 233
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4m9fA00
4TYDA 2GVFA 4OM9A 3RC4A 1DXPA 2O8MA 4M9FA 3SV9A 1A1RA 3LKWA 2XNIA 3SU4A 4B74A 2OC7A 2OBQA 4NWLA 4B6EA 2F4LA 2K1QA 3H09A 3PV2A 2XCNA 2QV1A 3SU1A 2OK5A 5EQSA 2F9VA 3O8BA 3SU6A 4A92A 2F9UA 4K8BA 4I33A 3RC5A 5EPNA 3EYDA 3SV6A 3SYJA 4I32A 4WF8A 3U1JB 3OYPA 4B6FA 3SUDA 2IJD1 5EPYA 2FOMB 1JXPA 1DXWA 3M5NA 1W3CA 3KEEA 3L6PA 4RI0A 3OTPA 3P8OA 2A4GA 5EQQA 4B75A 3LONA 5FPSA 2XCFA 2WHXA 3SU2A 3SUFA 3U1IB 1DY9A 4R8TB 1RGQA 3P8NA 4JMYA 4A1VA 2IJOB 4KTCA 3KF2A 2OINA 4A1XA 5EQRA 2OC8A 5ETXA 3SV8A 2OC1A 2WZQA 2FP7B 3AK5A 2WV9A 4U01A 5H4IB 1N1LA 3KNXA 4A1TA 2P59A 3O8RA 1DY8A 3SU5A 4B76A 5ESBA 3SU3A 2A4QA 5IDKA 3SU0A 1WXRA 4I31A 4WH8A 3E90B 3PV5A 2OC0A 4B71A 1CU1A 3O8DA 2GGVB 3SUEA 5FPTA 5GNDA 2YOLA 3M5OA 3M5LA 1BT7A 2OBOA 2A4RA 3RC6A 2FM2A 5B6LA 3LOXA 4B73A 4WH6A 1RTLA 5GPIB 3SZEA 5FPYA 5T1VA 3SUGA 3O8CA 3SV7A 5GJ4B 4NWKA 2VBCA 1NS3A 3M5MA 3KN2A
chains in the Genus database with same CATH superfamily
1GBIA 3OEHD 2SGPE 1C5VA 4AFZA 2D26C 2GDDA 1Z6EA 2A32A 4K5ZA 4NIYA 4P02A 3LIWA 4XDEA 3VB6A 4CBNA 1Y5UT 1V2QT 5HYOA 1M9UA 1OKXA 5EW1H 1PPBH 1OWKA 1GI9B 3RXLA 3UB0A 1FUJA 2VVUA 1E0FD 3MHWU 1HAYB 4J1YA 2GX4A 1K1JA 3MOCA 2WPLS 5EIYA 6GCHF 4NSYA 4E05H 5J4SA 1SMFE 3T29A 3BTME 1G9IE 1ANBA 4ABBA 2PUQH 1NPMA 4X1RU 3BTGE 1ZMNA 4VGCC 1C5QA 4WF8A 1IQHA 1UVSH 2ZU5A 2ODQA 2M5TA 1NFWA 1C1NA 3BG4C 3WWBA 2ZGHA 3BTKE 2G8TA 5AHGH 2CN0H 3OTPA 2FLBH 3VFEA 1MD7A 2BY8X 1DUAA 4KKDA 3VXFH 1J15A 2STAE 4NIWA 1D3DB 5KECA 1SOTA 4UFDH 1QFKH 1MMJN 1O2HA 4ZUHA 3STJA 3SQEE 1SVPA 3QK1A 4NCYA 3KYGA 3SW2B 4AX9H 1KYNA 4U01A 3F1SB 1W0JD 3TJUA 3A87A 5A2MH 3MU1A 4X2VA 4ZKSU 2HNTF 1PPHE 1UVPA 5IDKA 1H8IH 1ORFA 4WH8A 1NRNH 2H2ZA 3LPRA 1HXFH 4H6TA 4B71A 1P09A 1BRCE 1GBJA 2CF9H 5F8ZA 2BXTH 1JMOH 1T8MA 1XKAC 1AUJA 1C5UA 1LQEA 1D3PB 3DSGA 2ODPA 2JKHA 5T6DA 4XRNA 8ESTE 2CF8H 5FCKA 2H5DA 1YF4A 3DT0H 3GY4A 1DWDH 5B6LA 4XD7D 1NRPH 1THSH 1CSOE 1BMMH 2F91A 3GCHB 3Q3YA 4O3TA 4X1QU 5JBAS 1LHFH 1C1MA 1SG8B 2VH0A 4U32A 1O36A 1NBME 1JRTA 1AZZA 4AFUA 1UHBB 1BHXB 1MBMA 4FOUC 1W0ZU 4K1TA 1OX1A 1SGRE 4NWKA 1O2UA 2ESTE 1W13U 3KN2A 1ZSKA 4LOYH 2BVXH 3ZZDA 4NA9H 1YGCH 3RXAA 3NRLA 3ZIAD 4D9QA 2Q6GA 2LP6A 1SGIB 1T7CA 1YPGH 4UFEH 4ZCNA 4AG2A 1OP2A 4NWLA 3SGQE 1UCYK 2GZ8A 2RA0A 2C93B 3T27A 1GI6A 1AHTH 5BRRE 1C2JA 4AYVB 1QB9A 1GBBA 5EQSA 1S5SA 1BTYA 3SNEA 1H1BA 3CENA 1V2TT 4WVPE 4CR9A 1TB6H 3CP7A 4D9RA 1ZMLA 4I32A 3E3TA 1C1SA 1C5PA 3S7HB 1O2TA 4ZKOU 3SQHE 5C5NA 1HAOH 1HIAA 2FOMB 1OWHA 2HRVA 2Z9LA 1EJAA 1MQ6A 3GCOA 1GVZA 2ALVA 1ELBA 3UQVA 2VIPA 3A7WA 2BVRH 2ZIQH 2KX4A 1GJBB 4JZDH 3RXSA 4MPXA 3DFLA 4OS5A 4R8TB 3KQDA 1HAXB 2RDEA 3RXTA 4AN7A 1AIXH 1O5CB 3IITA 5EODA 4A1XA 1OXGA 2Z3DA 2J92A 3OE7D 3QGJA 3E0PB 1TAWA 1AWFH 1GBFA 2WZQA 4BXSA 4WMDA 1NM6A 5DJ7A 1O2OA 3TH2H 4ZKRU 1SKYE 3B8JA 3HK3B 3KQ5A 1P57B 3LDXH 1KLTA 3F9GA 2VIWA 2OUAA 1SC8U 3UQOA 2GJGA 4XFQA 2BY9X 1DOJA 3RMOH 4NGAH 2Y5FA 2Y6TA 1EX3A 1JOUB 3Q3KA 5EOKA 4CHAC 1L2EA 2BLQA 2H9HA 1O2KA 4FUEA 3QWCH 3ZZ9A 2PKAB 2YOLA 1Z8IB 3IG6B 1TA2A 1OWIA 2OBOA 3PM3A 2R9PA 4MNYA 1FY3A 1GHYH 1GGDB 4THNH 2F83A 1E1QD 2QCYA 2ZHDA 1K1NA 1K21H 1KXCA 2AS9A 1EOLA 2JJ2D 3I78A 1TPAE 2ZF0H 2V3OH 1AE8H 3RXKA 2AMPA 1IQFA 5DG6A 2TIOA 2KR7A 3D65E 3E1XB 1N6XA 4CRBA 4PROA 3E6PH 1DS2E 1CA0C 2W7SA 4GCHF 3M7UA 2FOEA 2WUCA 2C3SA 2Y81A 1OWEA 5DO4H 1E1RD 1D3TB 1DLEA 3RXDA 3PMHB 3RXHA 1LHEH 3GDSA 1BIOA 1Z8RA 4GSOA 2A2XH 1EOJA 1TGCA 1SPJA 3ZVEA 1PFXC 2XBXA 3SJ9A 2Q1JA 3A86A 3BF6H 1AY6H 1C2EA 4KTSA 1DSTA 1UCYE 3P8FA 2PSXA 1SGFG 1TA6A 3ODFA 1PQ5A 4OGXA 4YLUA 1O3HA 3A84A 3AVZA 2BD2A 1FQ3A 5A0AE 3P95A 1VITH 4JZIA 4IW4E 4D7FA 4X1NU 1W3CA 2FLRH 5B6OA 1CT2E 1VITF 1W8BH 1GWAA 1WQSA 5EQQA 3HKIB 1MTVA 2XCFA 5HIZA 1GHZA 4A6LA 1D6WA 1RGQA 1XXDA 3P8GA 1LKBA 4FUIA 1KXFA 1HB0B 2ANKH 5KEDA 3VGCB 4RT0A 4TWYA 4Y8XA 1QCPA 1SGEE 1NZQH 2THFB 3SI3H 1SLVB 2SGEE 5TJXA 1G2LA 1GL0E 1GHAG 6CHAB 1D4PB 2D8WA 2J98B 4GVUA 1V2LT 3DSPA 1GDQA 4M7GA 3SU5A 1NRSH 4I86A 1GMDG 2KCYA 2OD3B 4X6NA 3SU3A 1O2IA 4BAMB 1TBRH 1HGTH 1ANDA 1TBZH 2AGEX 2VWLA 3A7XA 1A2CH 1K2I1 1S82A 4FXGH 1HUTH 1TOMH 1UVUH 2BD3A 3PLPA 4FVBA 1BMNH 3RM2H 1J17T 2BLVA 3Q76A 1GBMA 1WUNH 4GLYA 4WXIA 4XBBA 2JIZD 2XW9A 1O31A 1HAVB 1QZ8A 1MAXA 1QRWA 2FX4A 3ELAH 3UIRA 1P04A 1RTLA 3LC5A 1TALA 1BTUA 3NCLA 5EG4A 4MPVA 3F9FA 2PGBB 1LKAA 2A31A 4YO9A 3A80A 3RMMH 2HLDD 1CHOG 1G30B 1L1GA 2RCEA 2WUBA 1GVKB 4XBDA 3RXBA 1GG6B 5FL7D 2BM2A 1INCA 1H4WA 2V7QD 3LH3A 1CBWB 1V2KT 1FPHH 4RKOB 2HGTH 1A4WH 1TRMA 1O30A 2OC7A 2ZTZA 1YPJH 3FANA 6LPRA 1O5FH 4INLA 2BD5A 1EAXA 2A7HA 4U30A 2R2WU 5A09A 1BOQA 4AYYB 1GJAB 3E8LA 1C2DA 1DICA 1OPHB 4UEHH 2RA3A 1ANEA 3A7VA 4WMFA 3QX5H 5E2OA 5FBIA 1SLXB 3RLWH 4ABAA 1IQNA 5DP3A 2Y7XA 1DE7H 2BDHA 1K22H 3UOPA 3FP6E 1JXPA 3NK8A 3ESTA 1Y3UA 4Y8YA 3EGKH 4YLQH 4CRAA 4B75A 5E0JA 1MTNC 4JK6A 1GI1A 1S83A 2FESH 1EPTA 1P3EA 3STIA 4AZ2B 5FX6A 2FPZA 1G2MA 1PYTD 5ABWA 2ZKSA 2F9NA 4ISHH 5HMAA 4XBCA 1ARCA 4ISIH 2WYJA 3TNSA 3AW1A 3TK5A 1F92A 1TNHA 2OC8A 3PWCA 4BAOB 1PPEE 2OC1A 5FCRA 2BQWB 1A0HB 2KAIB 3A81A 3RXOA 5K7RA 1AFEH 2OCVB 4RT1A 2TGDA 3GDUA 1Q31A 3NZIA 4X2XA 8GCHF 1G32B 2R2MB 3WY8A 3NUMA 3SGBE 1T8LA 1ZHRA 1MKWH 5DKMA 2IPHA 5EJLA 3KHVA 2PFEA 1ESTA 2FWWA 2B7DH 4UE7H 5KGOA 3TK9A 3U98H 1ZPZA 1EPTC 1HAPH 3QLPH 4GUXA 4TWWA 4NG9H 1XUFA 2PW8H 1BITA 3SUEA 1TYNA 2BY7X 2K8IA 3SORA 1H9LB 1GJ8B 3OAAD 1Y3YA 4B73A 1XUIA 3OU0A 3ZZ4A 2EI7A 1OP8A 1SL3A 1RIWC 1YCPH 4INKA 4YOJA 1A0LA 1Y3VA 3A85A 1QJ7B 1C2HA 1E35B 1A0JA 3SI4H 1YYY1 2WV4A 3S9BA 1KXBA 2VINA 1AFQC 4BOHA 4D76A 4NZQA 1TGTA 2FI4E 1W12U 2PHBA 4LZ1H 4DGJA 1ELFA 1SI5H 2EA3A 2GMTB 1PJPA 2W26A 3FAOA 3LGIA 5GXPA 1Q2WA 2VGCC 2M2AA 2ZFQH 4K1EA 2OQ5A 1KXEA 2ZHEH 4A92A 3BTEE 4K8BA 1QA7A 2TGTA 2L6OA 2VJ1A 4FUGA 1MU8B 3OX7U 4MDSA 1KXDA 5C20A 1O5DH 2P93A 2YMSC 1C1PA 1O3BA 1ZYOA 4Q4LA 2C8XB 1K1IA 6GCHG 7LPRA 3RXQA 2STBE 3KEEA 3L6PA 2B5TB 1YBWA 4CBOA 1ACBE 4I8JA 1DITH 1UVTH 2GZ7A 2RDLA 3KIDU 2Z3CA 3SBKA 2F3CE 4HZHA 2CK3D 3HGPA 4XSKU 3RDZA 3GCTF 1UW7A 1P2MA 4YT6H 1ZHPA 3BEUA 3P8NA 1HDTH 4NFFA 1KMHB 2GZ9A 3KF2A 2O9QA 3GDVA 4AB9A 1MH0A 1ELDE 1HYLA 1Z8JB 4R0IA 4BAQB 1O3GA 3S9CA 3T5FH 2BYAX 2AH4X 4HGCA 3PTBA 5AVDA 4FVDA 2P3TB 2ZCKP 1P2NA 2XC4A 1Y59T 3F2GA 2R0KA 5C1XA 4H6SB 1PYTC 3H5CB 2ZFTA 1NBMD 4I31A 4XE4A 1DT2A 2K0QA 4B1TA 2BY6X 1EP6A 1TGNA 4P00A 2QIQA 5FPTA 1C5OH 2IPQX 3MNSA 1QQUA 1CGJE 4JZFH 5JPMH 1V2MT 2OQUA 2GCHF 2GCTB 1GDUA 1W0YH 1C2IA 1O3LA 1EZUC 1OOKB 7ESTE 2SGFE 2UWOA 1GI4A 5C1YA 4UONA 2O8LA 4FUCA 3GISB 3O8CA 3LGYA 2HVXA 1NS3A 5J4QA 3TIUA 1O3CA 2ZQ1A 4SGAE 4JCNA 2GVFA 3ATIA 4FU9A 3SV9A 1HAIH 3N7DA 2QXIA 4Q63A 1BHXF 1FY1A 2P8OB 1SBWA 4Y10E 4AC9A 1ZZZA 5L30H 3GY5A 4U2WA 4DT4A 1T4VH 2F4LA 1ELVA 1ZR0A 1BTHH 2NU2E 1F0SA 5EXMA 1F2SE 1HJAB 1O5EH 5EJZA 1FONA 3PMAB 1K1OA 2F43B 3FVFB 1J8AA 1BTPA 2KCOA 2D2DA 1EUFA 1UHBA 1V2PT 3VEQB 3F9HA 1OWDA 1K9OE 3TPIZ 3VG8A 3QGNB 3T2NA 5CMXH 1RTKA 1XVOA 1YY3A 2AGGX 2ULLA 4ACAA 3FP8E 1A5IA 1OWJA 4JYVH 5EPYA 1ETTH 4ASUD 1KLIH 1O2JA 1V6DA 5AFZH 7GCHF 1LTOA 2SGAA 3AAVA 1FV9A 1C5RA 3TVJB 4ZH8A 4I7YH 4SGBE 3U1IB 3FN8A 1CGIE 1C2LA 3U8RH 2J4IA 9ESTA 5FAHA 4HG6A 3GCHC 3FOAA 3F0PA 3T62A 4WWYA 5FX5A 2JJ1D 1AU8A 1O3FA 2VWNA 4QT8C 5EJ1A 2HALA 3EQ0H 3MU8A 3TGJE 2FOGA 1EAUA 2XBVA 5LPFA 1LDTT 3I29A 2GV6A 2P59A 2PLXA 1IHSH 4HFPB 3UAIC 5ESBA 3Q3XA 1VCQA 3VB4A 3PB1E 3SV2H 1QR3E 3KQBA 1VZQH 2P16A 1FN6A 3G01A 1T8NA 2GGVB 4GHQA 5GNDA 4DIHH 2ZPSA 1CA8B 1ETRH 1PPZA 2ZECA 3KL6A 1BT7A 1MZAA 1D9IA 2O8WA 1SGNE 2GT8A 1QJ1B 1THRH 3SJIA 3A88A 4ZMAH 4DT7B 5LPRA 2ZCHP 2A7JA 1SQOA 2WPJS 1QIXB 2F9OA 4X6MA 4ZAEA 2OLGA 5FXLA 2BOHB 1UTQA 1A46H 2J95A 2ZU1A 8LPRA 3DSOA 3V12A 1C9PA 2TGPZ 5PTPA 1TNIA 5L2YH 1EAIA 1H8HD 1CQQA 3GCNA 3SU4A 1TRNA 3DD2H 1O3JA 1NFYA 2O8UA 2PKAA 4I8LA 4YOIA 4GCHG 1DSUA 3BTHE 3CS7A 1NU9A 3HK6B 3QN7A 3SU1A 2BD7A 2W3IA 3OY6U 1AE5A 3O8BA 1UK3A 2XOKD 5JYIA 1EZQA 2F9UA 4BANB 2FI5E 1N8OB 3L3TA 1O2QA 1GHXH 5I25A 3LGVA 5DPAA 1O5AB 4ABGA 3UR6A 1BBRK 1BTWA 1LPGB 3ZV8A 4RI0A 1P9UA 1ETSH 1YPKH 4TT3D 1KLJH 1A7SA 3TJOA 1T31A 1QA0A 1LVBA 1P2JA 2HNTC 2W7UA 1C5XB 3QDZB 4NA7A 5DK1A 1GJ7B 4DIIH 1W2KH 2G52A 1FY8E 4RKJB 3PO1C 4TY6A 1GI7B 1VITG 1OYQA 2QY0B 1XVMA 1SGYE 2HOBA 2ZP0H 2WINI 3ZV9A 1ZPCA 3N7EA 5T6FA 3GOVB 4K8YA 3MU5A 3O8RA 1WSSH 3MH6A 1QQ4A 2BDAA 4B2BA 1SQRA 2VB0A 3RXJA 2JH5D 2J38A 1UCYH 1ZRKA 2OXSA 3MNXA 1O2LA 1SFQB 4AFSA 1SR5C 3W95A 4A7IB 1G37A 1SSXA 1OS8A 1W11U 3SOSA 3T26A 4DY7B 1BMFD 3M5LA 1ZGIA 1HNEE 2Z94A 4TPYA 3RXGA 3ODDA 1E79D 2ZHFH 1QHRB 3A83A 2CJIA 1IQEA 1UMAH 1VCWA 4IMZA 4CRCA 2W3KA 2J98A 4F55A 2XC5A 4K60A 2W6ID 2QYIA 1V2UT 3ENSB 1Y5BT 1A3EH 1ELCA 5GCHF 2FO9A 2XXLA 2RFKC 2FODA 3DHKH 5FBEA 1EZXC 4ABEA 4CH2B 3EA9A 3LKWA 4HTCH 4IMQA 1T8OA 5HM9A 4BNRA 2UUYA 1ESBA 1P2QA 1GHVH 3F2HA 1TBQH 3B23B 2KM0A 1C4U2 1F0UA 1O5BB 3UREA 3VGCC 2BZAA 3GY6A 1XXFA 1TLDA 1SGDE 1O33A 1U6QA 4OS2A 1MQ5A 6CHAC 3AASA 1Z71A 1NY22 2BZ6H 3TNTA 2BVSH 1T32A 1E37B 3SV6A 1W10U 1EB1H 4YM9A 3U1JB 1GBLA 1MCVA 1BRUP 4NA8A 3EE0B 3UWIA 4RSPA 1QNJA 1UTPA 1MABB 2EEKA 3PMBB 1MU6B 4Q7YA 4TSFD 3ZVBA 4IGDA 3M3VA 2ZDMA 3EA7A 3MO6A 1LPZB 2DUCA 2XWBI 5BPEA 1BBRE 4Y0ZE 1MD8A 3ATMA 3K2UA 2VIQA 1TNLA 4A1VA 1L4DA 5C0TA 5JB8S 2KZ4A 3D49H 2G81E 1GJ4H 3JZ2B 5C1UA 1V2OT 1ZPBA 2ZGXH 3GYMA 1CVWH 2BDYA 4CH8B 5HIYA 1V2JT 1NRQH 3PROA 1TQ0B 1G3EA 1TABE 2XRCA 1CT0E 1Z1IA 5IK2D 1GG6C 3RXFA 4OS6A 2O8TA 4DURA 4UFFH 3S0NA 3QTOH 2LPRA 3T25A 3S69A 5T3HA 3PV5A 2I6SA 3SO3A 5DN6D 8GCHG 1CU1A 2XC0A 1O35A 4OS1A 1YLCA 2H5CA 1S84A 1NESE 2G5NA 1TMTH 3TH3H 1IHTH 4FUJA 3UTUH 3P17H 2ZDKA 2KAIA 1RXPA 2ODYB 2NU4E 4KGAA 2ZU2A 3ATLA 5HGGA 4IC5A 1YWUA 1OP0A 1NFUA 2AIPA 5E8EH 1GMHF 1YPLH 3MNCA 2ZFPH 4X8UH 3OSYA 1YC0A 3RC4A 1TWXB 1A1RA 2NU3E 3A8AA 2XNIA 1S81A 7KMEH 1QL8A 1O2ZA 2G00A 5EGMA 4X8VH 3UUZA 1WTGH 1C2KA 3UNRA 3PV2A 5GIBA 1O34A 2XCNA 2JDID 4ISNA 1S6LA 1S85A 3BV9B 3FP7E 1VJ9U 1XM1A 5JDUB 1ZTKA 1AVWA 1HAHH 3BTWE 4AFQA 1KDQB 5E0HA 4I8HA 3DCLA 4E7RG 1BZXE 3OYPA 4Y0YE 3F0OA 2ZFSA 4WJG2 1OHHD 1O39A 4KTUA 3P8OA 2BY5X 3RXUA 1C5MD 2BHGA 3I77A 1BRBE 4MNXA 3BTQE 1SLWB 2KCAA 5C3NA 4MQAA 1GI0A 2P95A 2SGDE 1SHYA 3R3GB 5EW2H 4XOJA 3VB5A 1FI8A 3M7TA 5EQRA 1PQ8A 2C8ZB 3HGNA 3TH4H 1GI8B 3CS0A 3U8TH 2FP7B 2WPMS 3GCTG 2KCPA 2C90B 1S0RA 1N1LA 4IS5A 1K0HA 4A1TA 2EQNA 2QXJA 1ZRBA 2SGQE 5CE1A 1C1OA 1GBTA 3F68H 2AEIH 2VU8E 4B76A 4ZHLU 1YPEH 1SQTA 2W6JD 5C5OA 2ZQ2A 3PLKA 5JBBS 2WV5A 2J5UA 4YXWD 3VPKA 4K1SA 1FDPA 1AKSB 2GMTC 4O3UA 1C5WB 2QXHA 2V6NA 1GPZA 1MKWK 3PTNA 2AMQA 1P0SH 4ISLA 4WH6A 4X2YA 1C1WH 2J34A 3SNCA 4MVNA 5GPIB 4TY7A 3SZEA 1SGQE 2FOFA 3LU9B 2CHAB 5FPYA 1C5YB 3SJ8A 1EAWA 4Z1MD 2SNVA 3LC3A 3LJJA 3SV7A 1MTWA 1K28D 5C17A 3RU4E 4OM9A 1WV7H 2GCHG 1GMCF 2P94A 2A0QB 1MTSA 1MBQA 4M9FA 4X8SH 4YTAA 2ZTXA 1O0DH 1HFDA 1QB1A 1G3CA 2AMDA 1DPOA 2WPDD 3PV4A 1DWEH 1F5RA 1NC6A 4JYUH 4YESB 4Q7ZA 5EXLA 4ASHA 3RMNH 3U8OH 1ELGA 2HVYB 3UFAA 3K6YA 2GD4B 3LGUA 2BDBA 1ZMJA 2PKSB 2TPIZ 1Z7KA 3UNQA 1GHAF 2BDGA 4JK5A 1VR1H 2F9VA 3EA8A 4AG1A 2TRMA 1COWD 1O2YA 4O97A 5JB9S 4ZKNU 3EYDA 1GVLA 1B5GH 4J2YB 5DP7A 1O5GH 1YM0A 4CREA 2JH6D 1EB2A 1YPHC 2WYGA 5A8ZA 1ANCA 1VJAU 1DWCH 1ESAA 3BTDE 2NU1E 4IN2A 2ZU4A 1FY4A 1HRTH 1C4V2 1SGCA 1TQ7B 4E7NA 5A8YA 2W5EA 3GICB 3VB3A 3OEED 3GY7A 2A5AA 2ZGJA 2G4TA 1ZJDA 2GCTC 7GCHG 3MH4A 2GDEH 4B2CA 1BCUH 1GCTC 4ABJA 3KQCA 1IQJA 3RXPA 1Y3WA 1QRZA 4ESTE 4ZHMU 1TRYA 2TBSA 2VNTA 1OYTH 3Q00A 2F9PA 1E36B 3VXEH 4BAKB 2BD9A 1UTNA 3EDXB 4NZLA 1GJCB 4GAWA 4JZEH 3W94A 3SU0A 2B8OH 2FI3E 4Q7XA 1J14A 2BX4A 2P8OC 1EFRD 2NWNA 2OC0A 1A5HA 1GHBF 1W14U 4E06H 3GY8A 1EP5A 1LVYA 3M3SA 1HJAC 1MKXK 2JETB 4Y11E 3A8DA 1GJDB 3MFJA 3SN8A 3TGKE 3MNBA 2Z9IA 1QGFA 3VB7A 3E91A 3MU4A 3TITA 1O32A 1KIGH 1YLDA 5F8TA 2G51A 3L33A 3V7TA 3Q77A 4FETA 3OY5U 1SFIA 5TCCA 3RLYH 1SQAA 4H4FA 5CHAB 3SUGA 1Z1JA 3MO9A 3BN9A 3TJNA 4BTUB 2ZDLA 3QO6A 1QY6A 1IAUA 3SGAE 2J9NA 3A7YA 4ABHA 1JIRA 1C1UH 5C2ZA 1P11E 3V3MA 2FTMA 5DP6A 9LPRA 2A5KA 2FOCA 2P3FH 1T4UH 1NO9H 2XBWA 1C2MA 2HPPH 1AWHB 1B0EA 2K1QA 1JWTA 2QA9E 3C1KA 5C0UA 1C2FA 1GBCA 1TE0A 4ZHAA 2XYAA 1HBTH 1BMLA 1THPB 3ZZ7A 3ZZAA 3BTFE 3K6ZA 2PTCE 1C1QA 2V3MA 1SB1H 3BEFB 1F0TA 2P3UB 3SHCH 1P3CA 2XWAA 3UR9A 2FOHA 4FUDA 1ZLRA 1DXWA 2AIQA 1PQAA 5DP9A 3ZYEA 3V13A 4MLFB 3LONA 4MNWA 1DFPA 2CXVA 2ZPRA 2Z6BD 1TNKA 2YMSB 1VGCB 1NRRH 1IQMA 4DG4A 1QRXA 5HM2A 1LPKB 4JMYA 1QBVH 1AB9B 2IJOB 2SNWA 1O3IA 2ALPA 3TJVA 1AVXA 1V2WT 4UD9H 2A4OA 5F53A 1GI2A 2PWXA 3A8CA 3KNXA 1FIWA 1C5SA 2WSSD 4FUHA 1DY8A 2ZWLH 4X1SU 1LO6A 3DFJA 2V3HH 4ABFA 5SGAE 2ZG0H 1J16A 2Y5HA 1FAKH 2OTVA 2PSYA 4IN1A 4H42U 2AYWA 1GL1A 2FX6A 1K1LA 1GHWH 4CRFA 1W7GH 1O2PA 2TGAA 2J2UA 3MH7A 1O2GH 3MQKC 4B2AA 1O3DA 3RC6A 1SLUB 1EJMA 1N8OC 4D8NA 3OFND 1FIZA 2ZPQA 1O2RA 4MPWA 1TPSA 2UWLA 1MTUA 2VBCA 3ZZ8A 1J9CH 1O2MA 1Z8GA 4TYDA 1X7AC 1C5TA 1E34B 3MYWA 3RXCA 2O8MA 4O03A 3RMLH 1K1MA 2Y7ZA 1BA8B 2ZZUH 5LPEA 4K3JA 3BSQA 2PP6A 5GCHG 3ZVAA 1AMHA 4B74A 4CRDA 2C4FH 1N6YA 2LNCA 4X6OA 1TGBA 3KGPA 2GT7A 1YCPM 4UDWH 1KTTB 2PTNA 4I8GA 4AORA 4ABIA 2Q6DA 2OK5A 2BQ6B 1O3OA 5GDSH 1IQKA 1UTOA 2H9EH 2GV7A 2V0BA 2FZZA 5K0HA 1GBDA 1UK2A 1RD3B 1NFXA 1O2WA 5EPNA 4JYTA 3KYFA 1BQYA 1F7ZA 1HCGA 2A5IA 1TX6A 2PV9B 5L2ZH 4Y8ZA 2AFQB 1Y5AT 2AGIX 2R3UA 3W1EA 1TMUH 3EE7A 1EKBB 3NPSA 3AW0A 1C2GA 3P92A 1BJVA 1RS0A 4FU7A 4A5TS 2IN2A 1UTMA 4NIXA 2HWLB 2VVVA 5JBCS 2PGQB 3RXEA 2FS9A 4ZROA 2BD4A 4HI3A 1FLEE 2QN5T 3TU7H 4VGCB 5E2PA 2FDAA 1GBEA 4LXBH 3SHAH 3A8BA 3KCGH 1WXRA 3ZVGA 3BG4B 3LT3A 1GGDC 1S6HA 1P01A 3SNAA 1AZ8A 2F9BH 1HJ9A 1F0RA 3RP2A 4D7GA 3ATKA 1HLTH 1CGHA 2AHME 2BTCE 2FM2A 3FO8D 1QJ6B 3NKKA 2A7CA 4TPIZ 3SJKA 1RFNA 1XUKA 3E0NB 1BBRH 3R0FA 3URCA 4Y71A 4BAHB 5GWZA 2CGAA 4ZXYH 3ZZ5A 1HV7A 3LGTA 2ANYA 2ZU3A 1B7XB 2H6MA 4Q2KA 1GMHG 1A5GH 3QZQA 2BDIA 2Q6FA 2ZNKH 1LVOA 2WPIS 1XUJA 1OSSA 1XUGA 1JBUH 2ZC9H 1TNGA 4GPGA 1EQ9A 1LHDH 3M37A 2HNTE 5ESTE 1V2ST 4GHTA 3QUMP 1DDJA 1FX0B 1GJ6A 3SU6A 1O3PB 1QURH 1B0FA 2ZO3H 4I33A 1H9IE 1QBNA 3NWUA 3SYJA 1CE5A 3RXVA 4RN6A 2ZDAH 5DP5A 3ZZ6A 3N7OA 1LCYA 1VCPA 3ZZBA 1GBKA 1DX5M 1TMBH 1P03A 1QBOA 2ANMH 1AD8H 3M5NA 1YLNA 5E0GA 2BLOA 3ZZCA 1GDNA 2EC9H 1AN1E 5CDFE 1HAVA 1W0KD 2WHXA 3PLBA 1ZHMA 1BTZA 3AAUA 1WOFA 3WWFA 1ELEE 3RU4T 1ZSLA 3JZ1B 3MTYA 1KY9A 3UNSA 1UTLM 3MWIU 1L1NA 1P05A 3CNRA 1WBGB 2RG3A 1IQLA 1KDQA 1QL9A 3PO1B 3FKSD 3M7QA 2DE8A 1BMAA 4AOQA 5T6GA 2Z3EA 3F2FA 2VH6A 2GKVE 1WAYB 1F5KU 1W7XH 1DM4B 1PPCE 1NN6A 1MAYA 2G55A 1S6FA 2QF5A 1JIMA 3QTVH 2BMGB 3BIVH 3O8DA 3RU4D 1V3XA 1HJ8A 2ZHWH 1XMNB 2B9LA 3BTTE 2ILNA 2Z9KA 3F3BA 1CT4E 2G4UA 5A0BA 2NU0E 3MMGA 1AI8H 3U69H 1Q3XA 5C94A 1UTJA 5TCAA 5T1VA 1PPGE 2WPHS 1ZTLA 1O38A 1C1TA 4BTIB 1S0QA 1CBWC 8KME2 3M5MA 4WMEA 4Z0KA 2C8WB 1IQGA 3UWJH 2OP9A 1O3NA 1BDAA 1HIAB 1ZGVA 1L1JA 1AKSA 2PR3A 3K9XB 2OBQA 2VWMA 3FZZA 4CHAB 1MZDA 3QZRA 3WW7A 1GMCG 3C27B 2H9TH 1ZSJA 2R3YA 4X8TH 5AF9H 1C5ZB 2BD8A 2ZEBA 1MUEB 1G3BA 1AQ7A 2SFAA 1HAGE 2QAAA 1GI3A 3RC5A 1TONA 1KTSB 1WDIA 2IOTA 1RJXB 4INHA 1WYKA 3OTJE 1A61H 1QB6A 3N99A 2EI6A 3URDA 4Y79A 4F4OC 3SUDA 1XKBC 1DUEA 3A82A 1WQVH 2ZGCA 3ATWA 3HKJB 1CA0B 2HLCA 3M3TA 1BJUA 1FY5A 3A89A 1TX8A 2JH0D 2A4GA 1F5LA 3P6ZB 2FMJA 4WY3A 5FPSA 2XBYA 5JBTA 3SU2A 2J97A 4AB8A 5A8XA 3D23A 1TPOA 1BB0B 3PWBA 3ZYDA 1O3EA 1V2NT 1FNIA 4KTCA 1NTPA 3RXIA 2Y5GA 3ZVCA 1Y8TA 2CHAC 1O2XA 2C8YB 1O3AA 1H9HE 4IBLH 3AK5A 2XTTB 2VVCA 3DUXH 1FAXA 4Y6DA 3PMJA 5G4BA 1SGPE 2BB4A 5F6MA 1GCDA 4FUBA 1C5NH 2A4QA 1EJNA 2UUKB 1EASA 1ID5H 5F03A 2BXUH 4BTTB 1TNJA 5FHTA 5F8XA 4CR5A 1HPGA 1ELTA 5DSFA 1EZSC 2EY4C 2PKSC 2YMSD 2GTBA 1DWBH 2ASUB 1HAZB 3PYHA 1NT1A 1DLKB 3GS9A 3MI4A 3LOXA 4F48B 1JRSA 1GHBG 4MTBA 1CHGA 2Z9GA 1AO5A 2BDCA 2YNBA 4ZXXH 3LJOA 4O9VA 5HXFA 3SZNA 2ZTYA 1IOEA 1TGSZ 1YKTA 2ZHQH 4X2WA 4Z6AH 1EXFA 1G36A 4NFEA 3SNDA 1D3QB 3P70B 2ZI2H 5I46H 1GBAA 1TPPA 1FPCH 4NSVA 3U9AH 4LZ4B 2Y82A 2J94A 1DXPA 3UOUA 1EATA 3HPTB 3NXPA 2A2QH 3DA9B 1TX7A 3MU0A 2QF3A 4K2YA 3FZDA 1UTKA 1V2RT 3H09A 2HPQH 5HKKD 2DE9A 2CV3A 2H1UA 3T28A 3RXRA 3ZVFA 1P8VC 2G5VA 3A7TA 1WCZA 1L4ZA 4KP0A 4X6PA 4KELA 2EI8A 1FMGA 1UVOA 3ZVDA 4F49A 2D1JA 4NIVA 1FN8A 1SGFA 3S9AA 1BUIA 1KSNA 2VIVA 1YCPK 3RM0H 2IJD1 3FFGA 4FUFA 1H8ED 1GBHA 4MG3A 3BEIB 1AGJA 4AGKA 1ARBA 2UUFB 1P2KA 1C4Y2 4YT7H 5EU8A 1XX9A 3F9EA 3UY9A 2JETC 3MO3A 1DY9A 2BOKA 1TFXA 1P02A 1MCTA 2OINA 1GJ5H 3BIUH 1DVAH 5ETXA 1O2VA 1YPMH 3SV8A 1GMDF 3H7OA 3ITIA 2XNDD 4MNVA 3U28C 3S7KB 4AGJA 5CHAC 1L0ZA 1RRKA 4DOQA 5DGJA 2WV9A 5LH8A 2Z7FE 2BLWA 1G3DA 3B9FH 2UWPA 1C5LH 4X1PU 1ABJH 1SHHB 2ZDVH 3EAJA 6ESTA 1HXEH 3E90B 1H8DH 1P2OA 3PRBA 4I8KA 4JZ1A 4YZUA 1QTFA 4Y76A 4DW2U 2QE7D 2VIOA 1MTNB 1SGTA 1ELAA 3M5OA 4DCDA 1C9TA 3TGIE 1P2IA 2A4RA 1O37A 4BXWA 1CHOF 2VWOA 2Y80A 1O2SA 3SNBA 2Z9JA 2A45B 5CHBA 2FXRA 1Y3XA 4K69A 5GJ4B 1GJ9B 2V35A 2FEQH 1CO7E 2A1DB 3TLOA 2LELA 1P12E 2R0LA 1UK4A 2FIRH 3K65B 1VGCC 5A0CA 1YPHE 3D62A 1FJSA 1LHCH 1XUHA 2WPKS 1TIOA 1AUTC 1AB9C 1LHGH 4ABDA 4B6EA 1EPTB 1E38B 1LVMA 4OS4A 4Q80A 2VIDA 3UPEA 1Z6JH 2UUJB 3M36A 1O3KA 2QV1A 2ZCLP 3SJOA 2QXGA 2CMYA 1KXAA 4Y7AA 2FTLE 3H7TA 4FU8A 2ZA5A 4YOGA 5IYTA 1WTHD 2FOBA 2AERH 2FYRA 1P06A 1K1PA 5AFYH 1RIWB 4MPUA 5DP8A 3E16B 2ZFRH 4OS7A 4Y7BA 4B6FA 2QGRA 3ZZ3A 1LMWB 1O3MA 1ZOMA 1ABIH 1BRAA 3MH5A 2YNAA 3GYLB 1P9SA 1QL7A 1MKXH 2QF0A 4UFGH 1AFQB 4CRGA 1FZZA 1C1VH 3SUFA 1P10A 2ANWA 1AVGH 1FXYA 2FYQA 5C67A 4DJZB 1UO6A 1TOCB 3TK6A 1YP9A 2PUXB 2I6QA 1LQDB 2L74A 2KFWA 2BX3A 3GY2A 1PPFE 1V2VT 2VGCB 1DANH 2BQ7B 2ZFFH 1UJ1A 1SOZA 5H4IB 3BG8A 1BTXA 1RTFB 1GI5A 1VKYA 1GCTB 1PQ7A 3V0XA 3LGWA 3M61U 5LGOA 4DVAU 3HATH 5EXNA 5L6NH 1D6RA 2FS8A 3A7ZA 1C1RA 3PRDA 3F6UH 2B0FA 1A3BH 1WU1A 4IC6A 4ISOA 3RUOA 3RXMA 4ACBA 2GP9B 1ZJKA 3IWMA 2QC2A 5DP4A 2ZDNA 1IQIA 3GY3A 4OGYA 3LH1A 1NU7B 2FOAA 3M35A 1ZTJA 4WXVA 1NROH 2ZGBH 4X0WU 3KQEA 2QF4A 4LK4A 1O2NA
chains in the Genus database with same CATH topology
4TYDA 2GVFA 2LELA 4OM9A 3OEHD 3DSOA 3NRLA 3RC4A 1DXPA 3ZIAD 2O8MA 4M9FA 1E1RD 5FL7D 1A1RA 3LKWA 3SV9A 3N7DA 2V7QD 2XNIA 1H8HD 3SU4A 4ZCNA 4Q63A 4B74A 2OC7A 2WPDD 2OBQA 4NWLA 3F2HA 4B6EA 4DT4A 2F4LA 2K1QA 3UB0A 2KM0A 3H09A 5C0UA 3WW7A 3PV2A 5HKKD 2XCNA 2JDID 2QV1A 3SU1A 2OK5A 5EQSA 1S6LA 2M2AA 2F43B 1FX0B 2F9VA 2KCOA 3O8BA 3SU6A 2XOKD 4A92A 2F9UA 1COWD 4K8BA 4I33A 3RC5A 5EPNA 2L6OA 3EYDA 3SV6A 3SYJA 4I32A 3VG8A 4WF8A 3N99A 3DCLA 2YMSC 3U1JB 3OYPA 4B6FA 4Q4LA 3SUDA 2IJD1 3F0OA 5EPYA 2FOMB 1JXPA 1DXWA 3M5NA 1H8ED 4ASUD 1W3CA 3KEEA 3L6PA 4RI0A 1OHHD 3WWBA 3W1EA 3OTPA 1MABB 2A4GA 3P8OA 4TSFD 5EQQA 3LONA 5FPSA 4B75A 5CDFE 1W0KD 4TT3D 2XCFA 2WHXA 2YMSB 3SU2A 2CK3D 2KCAA 3SUFA 3U1IB 1DY9A 3FN8A 1RGQA 4R8TB 3WWFA 3P8NA 4JMYA 4A1VA 2IJOB 5C0TA 1KMHB 2OINA 3KF2A 3OEED 2KZ4A 4KTCA 4A1XA 3FOAA 3F0PA 3OE7D 5EQRA 2OC8A 5ETXA 3SV8A 2KFWA 2JJ1D 2XNDD 2OC1A 2WZQA 2FP7B 3N7EA 3AK5A 2KCPA 2WV9A 4U01A 5F53A 5H4IB 1SKYE 1N1LA 1W0JD 3KNXA 3FKSD 4A1TA 2P59A 3DSPA 2WSSD 5IK2D 3O8RA 1DY8A 3F2GA 3F2FA 3SU5A 2KCYA 4B76A 2W6JD 5ESBA 2A4QA 3SU3A 5IDKA 3SU0A 1WXRA 1NBMD 2J5UA 4I31A 4WH8A 3E90B 1EFRD 4YXWD 2K0QA 3PRBA 3PV5A 5DN6D 2OC0A 4B71A 2QF5A 1CU1A 3PRDA 3O8DA 2QE7D 2GGVB 3SUEA 5FPTA 5DSFA 5GNDA 2YOLA 2K8IA 3M5OA 1BMFD 2YMSD 3M5LA 1BT7A 2OBOA 2JIZD 2A4RA 2AHME 3RC6A 2FM2A 3OAAD 3FO8D 1E79D 4XD7D 3GS9A 5B6LA 3F3BA 3LOXA 4B73A 1E1QD 4WH6A 1RTLA 5GPIB 3SZEA 2JJ2D 4F55A 3OFND 5FPYA 2W6ID 1NBME 4FETA 5T1VA 4Z1MD 5CHBA 3SUGA 2KR7A 3O8CA 3SV7A 5GJ4B 5C17A 4NWKA 2VBCA 3KN2A 1NS3A 3M5MA 2HLDD 2QF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYD A;  2GVF A;  4OM9 A;  3RC4 A;  1DXP A;  2O8M A;  4M9F A;  3SV9 A;  1A1R A;  3LKW A;  2XNI A;  3SU4 A;  4B74 A;  2OC7 A;  2OBQ A;  4NWL A;  4B6E A;  2F4L A;  2K1Q A;  3H09 A;  3PV2 A;  2XCN A;  2QV1 A;  3SU1 A;  2OK5 A;  5EQS A;  2F9V A;  3O8B A;  3SU6 A;  4A92 A;  2F9U A;  4K8B A;  4I33 A;  3RC5 A;  5EPN A;  3EYD A;  3SV6 A;  3SYJ A;  4I32 A;  4WF8 A;  3U1J B;  3OYP A;  4B6F A;  3SUD A;  2IJD 1;  5EPY A;  2FOM B;  1JXP A;  1DXW A;  3M5N A;  1W3C A;  3KEE A;  3L6P A;  4RI0 A;  3OTP A;  3P8O A;  2A4G A;  5EQQ A;  4B75 A;  3LON A;  5FPS A;  2XCF A;  2WHX A;  3SU2 A;  3SUF A;  3U1I B;  1DY9 A;  4R8T B;  1RGQ A;  3P8N A;  4JMY A;  4A1V A;  2IJO B;  4KTC A;  3KF2 A;  2OIN A;  4A1X A;  5EQR A;  2OC8 A;  5ETX A;  3SV8 A;  2OC1 A;  2WZQ A;  2FP7 B;  3AK5 A;  2WV9 A;  4U01 A;  5H4I B;  1N1L A;  3KNX A;  4A1T A;  2P59 A;  3O8R A;  1DY8 A;  3SU5 A;  4B76 A;  5ESB A;  3SU3 A;  2A4Q A;  5IDK A;  3SU0 A;  1WXR A;  4I31 A;  4WH8 A;  3E90 B;  3PV5 A;  2OC0 A;  4B71 A;  1CU1 A;  3O8D A;  2GGV B;  3SUE A;  5FPT A;  5GND A;  2YOL A;  3M5O A;  3M5L A;  1BT7 A;  2OBO A;  2A4R A;  3RC6 A;  2FM2 A;  5B6L A;  3LOX A;  4B73 A;  4WH6 A;  1RTL A;  5GPI B;  3SZE A;  5FPY A;  5T1V A;  3SUG A;  3O8C A;  3SV7 A;  5GJ4 B;  4NWK A;  2VBC A;  1NS3 A;  3M5M A;  3KN2 A; 
#chains in the Genus database with same CATH topology
 1GBI A;  3OEH D;  2SGP E;  1C5V A;  4AFZ A;  2D26 C;  2GDD A;  1Z6E A;  2A32 A;  4K5Z A;  4NIY A;  4P02 A;  3LIW A;  4XDE A;  3VB6 A;  4CBN A;  1Y5U T;  1V2Q T;  5HYO A;  1M9U A;  1OKX A;  5EW1 H;  1PPB H;  1OWK A;  1GI9 B;  3RXL A;  3UB0 A;  1FUJ A;  2VVU A;  1E0F D;  3MHW U;  1HAY B;  4J1Y A;  2GX4 A;  1K1J A;  3MOC A;  2WPL S;  5EIY A;  6GCH F;  4NSY A;  4E05 H;  5J4S A;  1SMF E;  3T29 A;  3BTM E;  1G9I E;  1ANB A;  4ABB A;  2PUQ H;  1NPM A;  4X1R U;  3BTG E;  1ZMN A;  4VGC C;  1C5Q A;  4WF8 A;  1IQH A;  1UVS H;  2ZU5 A;  2ODQ A;  2M5T A;  1NFW A;  1C1N A;  3BG4 C;  3WWB A;  2ZGH A;  3BTK E;  2G8T A;  5AHG H;  2CN0 H;  3OTP A;  2FLB H;  3VFE A;  1MD7 A;  2BY8 X;  1DUA A;  4KKD A;  3VXF H;  1J15 A;  2STA E;  4NIW A;  1D3D B;  5KEC A;  1SOT A;  4UFD H;  1QFK H;  1MMJ N;  1O2H A;  4ZUH A;  3STJ A;  3SQE E;  1SVP A;  3QK1 A;  4NCY A;  3KYG A;  3SW2 B;  4AX9 H;  1KYN A;  4U01 A;  3F1S B;  1W0J D;  3TJU A;  3A87 A;  5A2M H;  3MU1 A;  4X2V A;  4ZKS U;  2HNT F;  1PPH E;  1UVP A;  5IDK A;  1H8I H;  1ORF A;  4WH8 A;  1NRN H;  2H2Z A;  3LPR A;  1HXF H;  4H6T A;  4B71 A;  1P09 A;  1BRC E;  1GBJ A;  2CF9 H;  5F8Z A;  2BXT H;  1JMO H;  1T8M A;  1XKA C;  1AUJ A;  1C5U A;  1LQE A;  1D3P B;  3DSG A;  2ODP A;  2JKH A;  5T6D A;  4XRN A;  8EST E;  2CF8 H;  5FCK A;  2H5D A;  1YF4 A;  3DT0 H;  3GY4 A;  1DWD H;  5B6L A;  4XD7 D;  1NRP H;  1THS H;  1CSO E;  1BMM H;  2F91 A;  3GCH B;  3Q3Y A;  4O3T A;  4X1Q U;  5JBA S;  1LHF H;  1C1M A;  1SG8 B;  2VH0 A;  4U32 A;  1O36 A;  1NBM E;  1JRT A;  1AZZ A;  4AFU A;  1UHB B;  1BHX B;  1MBM A;  4FOU C;  1W0Z U;  4K1T A;  1OX1 A;  1SGR E;  4NWK A;  1O2U A;  2EST E;  1W13 U;  3KN2 A;  1ZSK A;  4LOY H;  2BVX H;  3ZZD A;  4NA9 H;  1YGC H;  3RXA A;  3NRL A;  3ZIA D;  4D9Q A;  2Q6G A;  2LP6 A;  1SGI B;  1T7C A;  1YPG H;  4UFE H;  4ZCN A;  4AG2 A;  1OP2 A;  4NWL A;  3SGQ E;  1UCY K;  2GZ8 A;  2RA0 A;  2C93 B;  3T27 A;  1GI6 A;  1AHT H;  5BRR E;  1C2J A;  4AYV B;  1QB9 A;  1GBB A;  5EQS A;  1S5S A;  1BTY A;  3SNE A;  1H1B A;  3CEN A;  1V2T T;  4WVP E;  4CR9 A;  1TB6 H;  3CP7 A;  4D9R A;  1ZML A;  4I32 A;  3E3T A;  1C1S A;  1C5P A;  3S7H B;  1O2T A;  4ZKO U;  3SQH E;  5C5N A;  1HAO H;  1HIA A;  2FOM B;  1OWH A;  2HRV A;  2Z9L A;  1EJA A;  1MQ6 A;  3GCO A;  1GVZ A;  2ALV A;  1ELB A;  3UQV A;  2VIP A;  3A7W A;  2BVR H;  2ZIQ H;  2KX4 A;  1GJB B;  4JZD H;  3RXS A;  4MPX A;  3DFL A;  4OS5 A;  4R8T B;  3KQD A;  1HAX B;  2RDE A;  3RXT A;  4AN7 A;  1AIX H;  1O5C B;  3IIT A;  5EOD A;  4A1X A;  1OXG A;  2Z3D A;  2J92 A;  3OE7 D;  3QGJ A;  3E0P B;  1TAW A;  1AWF H;  1GBF A;  2WZQ A;  4BXS A;  4WMD A;  1NM6 A;  5DJ7 A;  1O2O A;  3TH2 H;  4ZKR U;  1SKY E;  3B8J A;  3HK3 B;  3KQ5 A;  1P57 B;  3LDX H;  1KLT A;  3F9G A;  2VIW A;  2OUA A;  1SC8 U;  3UQO A;  2GJG A;  4XFQ A;  2BY9 X;  1DOJ A;  3RMO H;  4NGA H;  2Y5F A;  2Y6T A;  1EX3 A;  1JOU B;  3Q3K A;  5EOK A;  4CHA C;  1L2E A;  2BLQ A;  2H9H A;  1O2K A;  4FUE A;  3QWC H;  3ZZ9 A;  2PKA B;  2YOL A;  1Z8I B;  3IG6 B;  1TA2 A;  1OWI A;  2OBO A;  3PM3 A;  2R9P A;  4MNY A;  1FY3 A;  1GHY H;  1GGD B;  4THN H;  2F83 A;  1E1Q D;  2QCY A;  2ZHD A;  1K1N A;  1K21 H;  1KXC A;  2AS9 A;  1EOL A;  2JJ2 D;  3I78 A;  1TPA E;  2ZF0 H;  2V3O H;  1AE8 H;  3RXK A;  2AMP A;  1IQF A;  5DG6 A;  2TIO A;  2KR7 A;  3D65 E;  3E1X B;  1N6X A;  4CRB A;  4PRO A;  3E6P H;  1DS2 E;  1CA0 C;  2W7S A;  4GCH F;  3M7U A;  2FOE A;  2WUC A;  2C3S A;  2Y81 A;  1OWE A;  5DO4 H;  1E1R D;  1D3T B;  1DLE A;  3RXD A;  3PMH B;  3RXH A;  1LHE H;  3GDS A;  1BIO A;  1Z8R A;  4GSO A;  2A2X H;  1EOJ A;  1TGC A;  1SPJ A;  3ZVE A;  1PFX C;  2XBX A;  3SJ9 A;  2Q1J A;  3A86 A;  3BF6 H;  1AY6 H;  1C2E A;  4KTS A;  1DST A;  1UCY E;  3P8F A;  2PSX A;  1SGF G;  1TA6 A;  3ODF A;  1PQ5 A;  4OGX A;  4YLU A;  1O3H A;  3A84 A;  3AVZ A;  2BD2 A;  1FQ3 A;  5A0A E;  3P95 A;  1VIT H;  4JZI A;  4IW4 E;  4D7F A;  4X1N U;  1W3C A;  2FLR H;  5B6O A;  1CT2 E;  1VIT F;  1W8B H;  1GWA A;  1WQS A;  5EQQ A;  3HKI B;  1MTV A;  2XCF A;  5HIZ A;  1GHZ A;  4A6L A;  1D6W A;  1RGQ A;  1XXD A;  3P8G A;  1LKB A;  4FUI A;  1KXF A;  1HB0 B;  2ANK H;  5KED A;  3VGC B;  4RT0 A;  4TWY A;  4Y8X A;  1QCP A;  1SGE E;  1NZQ H;  2THF B;  3SI3 H;  1SLV B;  2SGE E;  5TJX A;  1G2L A;  1GL0 E;  1GHA G;  6CHA B;  1D4P B;  2D8W A;  2J98 B;  4GVU A;  1V2L T;  3DSP A;  1GDQ A;  4M7G A;  3SU5 A;  1NRS H;  4I86 A;  1GMD G;  2KCY A;  2OD3 B;  4X6N A;  3SU3 A;  1O2I A;  4BAM B;  1TBR H;  1HGT H;  1AND A;  1TBZ H;  2AGE X;  2VWL A;  3A7X A;  1A2C H;  1K2I 1;  1S82 A;  4FXG H;  1HUT H;  1TOM H;  1UVU H;  2BD3 A;  3PLP A;  4FVB A;  1BMN H;  3RM2 H;  1J17 T;  2BLV A;  3Q76 A;  1GBM A;  1WUN H;  4GLY A;  4WXI A;  4XBB A;  2JIZ D;  2XW9 A;  1O31 A;  1HAV B;  1QZ8 A;  1MAX A;  1QRW A;  2FX4 A;  3ELA H;  3UIR A;  1P04 A;  1RTL A;  3LC5 A;  1TAL A;  1BTU A;  3NCL A;  5EG4 A;  4MPV A;  3F9F A;  2PGB B;  1LKA A;  2A31 A;  4YO9 A;  3A80 A;  3RMM H;  2HLD D;  1CHO G;  1G30 B;  1L1G A;  2RCE A;  2WUB A;  1GVK B;  4XBD A;  3RXB A;  1GG6 B;  5FL7 D;  2BM2 A;  1INC A;  1H4W A;  2V7Q D;  3LH3 A;  1CBW B;  1V2K T;  1FPH H;  4RKO B;  2HGT H;  1A4W H;  1TRM A;  1O30 A;  2OC7 A;  2ZTZ A;  1YPJ H;  3FAN A;  6LPR A;  1O5F H;  4INL A;  2BD5 A;  1EAX A;  2A7H A;  4U30 A;  2R2W U;  5A09 A;  1BOQ A;  4AYY B;  1GJA B;  3E8L A;  1C2D A;  1DIC A;  1OPH B;  4UEH H;  2RA3 A;  1ANE A;  3A7V A;  4WMF A;  3QX5 H;  5E2O A;  5FBI A;  1SLX B;  3RLW H;  4ABA A;  1IQN A;  5DP3 A;  2Y7X A;  1DE7 H;  2BDH A;  1K22 H;  3UOP A;  3FP6 E;  1JXP A;  3NK8 A;  3EST A;  1Y3U A;  4Y8Y A;  3EGK H;  4YLQ H;  4CRA A;  4B75 A;  5E0J A;  1MTN C;  4JK6 A;  1GI1 A;  1S83 A;  2FES H;  1EPT A;  1P3E A;  3STI A;  4AZ2 B;  5FX6 A;  2FPZ A;  1G2M A;  1PYT D;  5ABW A;  2ZKS A;  2F9N A;  4ISH H;  5HMA A;  4XBC A;  1ARC A;  4ISI H;  2WYJ A;  3TNS A;  3AW1 A;  3TK5 A;  1F92 A;  1TNH A;  2OC8 A;  3PWC A;  4BAO B;  1PPE E;  2OC1 A;  5FCR A;  2BQW B;  1A0H B;  2KAI B;  3A81 A;  3RXO A;  5K7R A;  1AFE H;  2OCV B;  4RT1 A;  2TGD A;  3GDU A;  1Q31 A;  3NZI A;  4X2X A;  8GCH F;  1G32 B;  2R2M B;  3WY8 A;  3NUM A;  3SGB E;  1T8L A;  1ZHR A;  1MKW H;  5DKM A;  2IPH A;  5EJL A;  3KHV A;  2PFE A;  1EST A;  2FWW A;  2B7D H;  4UE7 H;  5KGO A;  3TK9 A;  3U98 H;  1ZPZ A;  1EPT C;  1HAP H;  3QLP H;  4GUX A;  4TWW A;  4NG9 H;  1XUF A;  2PW8 H;  1BIT A;  3SUE A;  1TYN A;  2BY7 X;  2K8I A;  3SOR A;  1H9L B;  1GJ8 B;  3OAA D;  1Y3Y A;  4B73 A;  1XUI A;  3OU0 A;  3ZZ4 A;  2EI7 A;  1OP8 A;  1SL3 A;  1RIW C;  1YCP H;  4INK A;  4YOJ A;  1A0L A;  1Y3V A;  3A85 A;  1QJ7 B;  1C2H A;  1E35 B;  1A0J A;  3SI4 H;  1YYY 1;  2WV4 A;  3S9B A;  1KXB A;  2VIN A;  1AFQ C;  4BOH A;  4D76 A;  4NZQ A;  1TGT A;  2FI4 E;  1W12 U;  2PHB A;  4LZ1 H;  4DGJ A;  1ELF A;  1SI5 H;  2EA3 A;  2GMT B;  1PJP A;  2W26 A;  3FAO A;  3LGI A;  5GXP A;  1Q2W A;  2VGC C;  2M2A A;  2ZFQ H;  4K1E A;  2OQ5 A;  1KXE A;  2ZHE H;  4A92 A;  3BTE E;  4K8B A;  1QA7 A;  2TGT A;  2L6O A;  2VJ1 A;  4FUG A;  1MU8 B;  3OX7 U;  4MDS A;  1KXD A;  5C20 A;  1O5D H;  2P93 A;  2YMS C;  1C1P A;  1O3B A;  1ZYO A;  4Q4L A;  2C8X B;  1K1I A;  6GCH G;  7LPR A;  3RXQ A;  2STB E;  3KEE A;  3L6P A;  2B5T B;  1YBW A;  4CBO A;  1ACB E;  4I8J A;  1DIT H;  1UVT H;  2GZ7 A;  2RDL A;  3KID U;  2Z3C A;  3SBK A;  2F3C E;  4HZH A;  2CK3 D;  3HGP A;  4XSK U;  3RDZ A;  3GCT F;  1UW7 A;  1P2M A;  4YT6 H;  1ZHP A;  3BEU A;  3P8N A;  1HDT H;  4NFF A;  1KMH B;  2GZ9 A;  3KF2 A;  2O9Q A;  3GDV A;  4AB9 A;  1MH0 A;  1ELD E;  1HYL A;  1Z8J B;  4R0I A;  4BAQ B;  1O3G A;  3S9C A;  3T5F H;  2BYA X;  2AH4 X;  4HGC A;  3PTB A;  5AVD A;  4FVD A;  2P3T B;  2ZCK P;  1P2N A;  2XC4 A;  1Y59 T;  3F2G A;  2R0K A;  5C1X A;  4H6S B;  1PYT C;  3H5C B;  2ZFT A;  1NBM D;  4I31 A;  4XE4 A;  1DT2 A;  2K0Q A;  4B1T A;  2BY6 X;  1EP6 A;  1TGN A;  4P00 A;  2QIQ A;  5FPT A;  1C5O H;  2IPQ X;  3MNS A;  1QQU A;  1CGJ E;  4JZF H;  5JPM H;  1V2M T;  2OQU A;  2GCH F;  2GCT B;  1GDU A;  1W0Y H;  1C2I A;  1O3L A;  1EZU C;  1OOK B;  7EST E;  2SGF E;  2UWO A;  1GI4 A;  5C1Y A;  4UON A;  2O8L A;  4FUC A;  3GIS B;  3O8C A;  3LGY A;  2HVX A;  1NS3 A;  5J4Q A;  3TIU A;  1O3C A;  2ZQ1 A;  4SGA E;  4JCN A;  2GVF A;  3ATI A;  4FU9 A;  3SV9 A;  1HAI H;  3N7D A;  2QXI A;  4Q63 A;  1BHX F;  1FY1 A;  2P8O B;  1SBW A;  4Y10 E;  4AC9 A;  1ZZZ A;  5L30 H;  3GY5 A;  4U2W A;  4DT4 A;  1T4V H;  2F4L A;  1ELV A;  1ZR0 A;  1BTH H;  2NU2 E;  1F0S A;  5EXM A;  1F2S E;  1HJA B;  1O5E H;  5EJZ A;  1FON A;  3PMA B;  1K1O A;  2F43 B;  3FVF B;  1J8A A;  1BTP A;  2KCO A;  2D2D A;  1EUF A;  1UHB A;  1V2P T;  3VEQ B;  3F9H A;  1OWD A;  1K9O E;  3TPI Z;  3VG8 A;  3QGN B;  3T2N A;  5CMX H;  1RTK A;  1XVO A;  1YY3 A;  2AGG X;  2ULL A;  4ACA A;  3FP8 E;  1A5I A;  1OWJ A;  4JYV H;  5EPY A;  1ETT H;  4ASU D;  1KLI H;  1O2J A;  1V6D A;  5AFZ H;  7GCH F;  1LTO A;  2SGA A;  3AAV A;  1FV9 A;  1C5R A;  3TVJ B;  4ZH8 A;  4I7Y H;  4SGB E;  3U1I B;  3FN8 A;  1CGI E;  1C2L A;  3U8R H;  2J4I A;  9EST A;  5FAH A;  4HG6 A;  3GCH C;  3FOA A;  3F0P A;  3T62 A;  4WWY A;  5FX5 A;  2JJ1 D;  1AU8 A;  1O3F A;  2VWN A;  4QT8 C;  5EJ1 A;  2HAL A;  3EQ0 H;  3MU8 A;  3TGJ E;  2FOG A;  1EAU A;  2XBV A;  5LPF A;  1LDT T;  3I29 A;  2GV6 A;  2P59 A;  2PLX A;  1IHS H;  4HFP B;  3UAI C;  5ESB A;  3Q3X A;  1VCQ A;  3VB4 A;  3PB1 E;  3SV2 H;  1QR3 E;  3KQB A;  1VZQ H;  2P16 A;  1FN6 A;  3G01 A;  1T8N A;  2GGV B;  4GHQ A;  5GND A;  4DIH H;  2ZPS A;  1CA8 B;  1ETR H;  1PPZ A;  2ZEC A;  3KL6 A;  1BT7 A;  1MZA A;  1D9I A;  2O8W A;  1SGN E;  2GT8 A;  1QJ1 B;  1THR H;  3SJI A;  3A88 A;  4ZMA H;  4DT7 B;  5LPR A;  2ZCH P;  2A7J A;  1SQO A;  2WPJ S;  1QIX B;  2F9O A;  4X6M A;  4ZAE A;  2OLG A;  5FXL A;  2BOH B;  1UTQ A;  1A46 H;  2J95 A;  2ZU1 A;  8LPR A;  3DSO A;  3V12 A;  1C9P A;  2TGP Z;  5PTP A;  1TNI A;  5L2Y H;  1EAI A;  1H8H D;  1CQQ A;  3GCN A;  3SU4 A;  1TRN A;  3DD2 H;  1O3J A;  1NFY A;  2O8U A;  2PKA A;  4I8L A;  4YOI A;  4GCH G;  1DSU A;  3BTH E;  3CS7 A;  1NU9 A;  3HK6 B;  3QN7 A;  3SU1 A;  2BD7 A;  2W3I A;  3OY6 U;  1AE5 A;  3O8B A;  1UK3 A;  2XOK D;  5JYI A;  1EZQ A;  2F9U A;  4BAN B;  2FI5 E;  1N8O B;  3L3T A;  1O2Q A;  1GHX H;  5I25 A;  3LGV A;  5DPA A;  1O5A B;  4ABG A;  3UR6 A;  1BBR K;  1BTW A;  1LPG B;  3ZV8 A;  4RI0 A;  1P9U A;  1ETS H;  1YPK H;  4TT3 D;  1KLJ H;  1A7S A;  3TJO A;  1T31 A;  1QA0 A;  1LVB A;  1P2J A;  2HNT C;  2W7U A;  1C5X B;  3QDZ B;  4NA7 A;  5DK1 A;  1GJ7 B;  4DII H;  1W2K H;  2G52 A;  1FY8 E;  4RKJ B;  3PO1 C;  4TY6 A;  1GI7 B;  1VIT G;  1OYQ A;  2QY0 B;  1XVM A;  1SGY E;  2HOB A;  2ZP0 H;  2WIN I;  3ZV9 A;  1ZPC A;  3N7E A;  5T6F A;  3GOV B;  4K8Y A;  3MU5 A;  3O8R A;  1WSS H;  3MH6 A;  1QQ4 A;  2BDA A;  4B2B A;  1SQR A;  2VB0 A;  3RXJ A;  2JH5 D;  2J38 A;  1UCY H;  1ZRK A;  2OXS A;  3MNX A;  1O2L A;  1SFQ B;  4AFS A;  1SR5 C;  3W95 A;  4A7I B;  1G37 A;  1SSX A;  1OS8 A;  1W11 U;  3SOS A;  3T26 A;  4DY7 B;  1BMF D;  3M5L A;  1ZGI A;  1HNE E;  2Z94 A;  4TPY A;  3RXG A;  3ODD A;  1E79 D;  2ZHF H;  1QHR B;  3A83 A;  2CJI A;  1IQE A;  1UMA H;  1VCW A;  4IMZ A;  4CRC A;  2W3K A;  2J98 A;  4F55 A;  2XC5 A;  4K60 A;  2W6I D;  2QYI A;  1V2U T;  3ENS B;  1Y5B T;  1A3E H;  1ELC A;  5GCH F;  2FO9 A;  2XXL A;  2RFK C;  2FOD A;  3DHK H;  5FBE A;  1EZX C;  4ABE A;  4CH2 B;  3EA9 A;  3LKW A;  4HTC H;  4IMQ A;  1T8O A;  5HM9 A;  4BNR A;  2UUY A;  1ESB A;  1P2Q A;  1GHV H;  3F2H A;  1TBQ H;  3B23 B;  2KM0 A;  1C4U 2;  1F0U A;  1O5B B;  3URE A;  3VGC C;  2BZA A;  3GY6 A;  1XXF A;  1TLD A;  1SGD E;  1O33 A;  1U6Q A;  4OS2 A;  1MQ5 A;  6CHA C;  3AAS A;  1Z71 A;  1NY2 2;  2BZ6 H;  3TNT A;  2BVS H;  1T32 A;  1E37 B;  3SV6 A;  1W10 U;  1EB1 H;  4YM9 A;  3U1J B;  1GBL A;  1MCV A;  1BRU P;  4NA8 A;  3EE0 B;  3UWI A;  4RSP A;  1QNJ A;  1UTP A;  1MAB B;  2EEK A;  3PMB B;  1MU6 B;  4Q7Y A;  4TSF D;  3ZVB A;  4IGD A;  3M3V A;  2ZDM A;  3EA7 A;  3MO6 A;  1LPZ B;  2DUC A;  2XWB I;  5BPE A;  1BBR E;  4Y0Z E;  1MD8 A;  3ATM A;  3K2U A;  2VIQ A;  1TNL A;  4A1V A;  1L4D A;  5C0T A;  5JB8 S;  2KZ4 A;  3D49 H;  2G81 E;  1GJ4 H;  3JZ2 B;  5C1U A;  1V2O T;  1ZPB A;  2ZGX H;  3GYM A;  1CVW H;  2BDY A;  4CH8 B;  5HIY A;  1V2J T;  1NRQ H;  3PRO A;  1TQ0 B;  1G3E A;  1TAB E;  2XRC A;  1CT0 E;  1Z1I A;  5IK2 D;  1GG6 C;  3RXF A;  4OS6 A;  2O8T A;  4DUR A;  4UFF H;  3S0N A;  3QTO H;  2LPR A;  3T25 A;  3S69 A;  5T3H A;  3PV5 A;  2I6S A;  3SO3 A;  5DN6 D;  8GCH G;  1CU1 A;  2XC0 A;  1O35 A;  4OS1 A;  1YLC A;  2H5C A;  1S84 A;  1NES E;  2G5N A;  1TMT H;  3TH3 H;  1IHT H;  4FUJ A;  3UTU H;  3P17 H;  2ZDK A;  2KAI A;  1RXP A;  2ODY B;  2NU4 E;  4KGA A;  2ZU2 A;  3ATL A;  5HGG A;  4IC5 A;  1YWU A;  1OP0 A;  1NFU A;  2AIP A;  5E8E H;  1GMH F;  1YPL H;  3MNC A;  2ZFP H;  4X8U H;  3OSY A;  1YC0 A;  3RC4 A;  1TWX B;  1A1R A;  2NU3 E;  3A8A A;  2XNI A;  1S81 A;  7KME H;  1QL8 A;  1O2Z A;  2G00 A;  5EGM A;  4X8V H;  3UUZ A;  1WTG H;  1C2K A;  3UNR A;  3PV2 A;  5GIB A;  1O34 A;  2XCN A;  2JDI D;  4ISN A;  1S6L A;  1S85 A;  3BV9 B;  3FP7 E;  1VJ9 U;  1XM1 A;  5JDU B;  1ZTK A;  1AVW A;  1HAH H;  3BTW E;  4AFQ A;  1KDQ B;  5E0H A;  4I8H A;  3DCL A;  4E7R G;  1BZX E;  3OYP A;  4Y0Y E;  3F0O A;  2ZFS A;  4WJG 2;  1OHH D;  1O39 A;  4KTU A;  3P8O A;  2BY5 X;  3RXU A;  1C5M D;  2BHG A;  3I77 A;  1BRB E;  4MNX A;  3BTQ E;  1SLW B;  2KCA A;  5C3N A;  4MQA A;  1GI0 A;  2P95 A;  2SGD E;  1SHY A;  3R3G B;  5EW2 H;  4XOJ A;  3VB5 A;  1FI8 A;  3M7T A;  5EQR A;  1PQ8 A;  2C8Z B;  3HGN A;  3TH4 H;  1GI8 B;  3CS0 A;  3U8T H;  2FP7 B;  2WPM S;  3GCT G;  2KCP A;  2C90 B;  1S0R A;  1N1L A;  4IS5 A;  1K0H A;  4A1T A;  2EQN A;  2QXJ A;  1ZRB A;  2SGQ E;  5CE1 A;  1C1O A;  1GBT A;  3F68 H;  2AEI H;  2VU8 E;  4B76 A;  4ZHL U;  1YPE H;  1SQT A;  2W6J D;  5C5O A;  2ZQ2 A;  3PLK A;  5JBB S;  2WV5 A;  2J5U A;  4YXW D;  3VPK A;  4K1S A;  1FDP A;  1AKS B;  2GMT C;  4O3U A;  1C5W B;  2QXH A;  2V6N A;  1GPZ A;  1MKW K;  3PTN A;  2AMQ A;  1P0S H;  4ISL A;  4WH6 A;  4X2Y A;  1C1W H;  2J34 A;  3SNC A;  4MVN A;  5GPI B;  4TY7 A;  3SZE A;  1SGQ E;  2FOF A;  3LU9 B;  2CHA B;  5FPY A;  1C5Y B;  3SJ8 A;  1EAW A;  4Z1M D;  2SNV A;  3LC3 A;  3LJJ A;  3SV7 A;  1MTW A;  1K28 D;  5C17 A;  3RU4 E;  4OM9 A;  1WV7 H;  2GCH G;  1GMC F;  2P94 A;  2A0Q B;  1MTS A;  1MBQ A;  4M9F A;  4X8S H;  4YTA A;  2ZTX A;  1O0D H;  1HFD A;  1QB1 A;  1G3C A;  2AMD A;  1DPO A;  2WPD D;  3PV4 A;  1DWE H;  1F5R A;  1NC6 A;  4JYU H;  4YES B;  4Q7Z A;  5EXL A;  4ASH A;  3RMN H;  3U8O H;  1ELG A;  2HVY B;  3UFA A;  3K6Y A;  2GD4 B;  3LGU A;  2BDB A;  1ZMJ A;  2PKS B;  2TPI Z;  1Z7K A;  3UNQ A;  1GHA F;  2BDG A;  4JK5 A;  1VR1 H;  2F9V A;  3EA8 A;  4AG1 A;  2TRM A;  1COW D;  1O2Y A;  4O97 A;  5JB9 S;  4ZKN U;  3EYD A;  1GVL A;  1B5G H;  4J2Y B;  5DP7 A;  1O5G H;  1YM0 A;  4CRE A;  2JH6 D;  1EB2 A;  1YPH C;  2WYG A;  5A8Z A;  1ANC A;  1VJA U;  1DWC H;  1ESA A;  3BTD E;  2NU1 E;  4IN2 A;  2ZU4 A;  1FY4 A;  1HRT H;  1C4V 2;  1SGC A;  1TQ7 B;  4E7N A;  5A8Y A;  2W5E A;  3GIC B;  3VB3 A;  3OEE D;  3GY7 A;  2A5A A;  2ZGJ A;  2G4T A;  1ZJD A;  2GCT C;  7GCH G;  3MH4 A;  2GDE H;  4B2C A;  1BCU H;  1GCT C;  4ABJ A;  3KQC A;  1IQJ A;  3RXP A;  1Y3W A;  1QRZ A;  4EST E;  4ZHM U;  1TRY A;  2TBS A;  2VNT A;  1OYT H;  3Q00 A;  2F9P A;  1E36 B;  3VXE H;  4BAK B;  2BD9 A;  1UTN A;  3EDX B;  4NZL A;  1GJC B;  4GAW A;  4JZE H;  3W94 A;  3SU0 A;  2B8O H;  2FI3 E;  4Q7X A;  1J14 A;  2BX4 A;  2P8O C;  1EFR D;  2NWN A;  2OC0 A;  1A5H A;  1GHB F;  1W14 U;  4E06 H;  3GY8 A;  1EP5 A;  1LVY A;  3M3S A;  1HJA C;  1MKX K;  2JET B;  4Y11 E;  3A8D A;  1GJD B;  3MFJ A;  3SN8 A;  3TGK E;  3MNB A;  2Z9I A;  1QGF A;  3VB7 A;  3E91 A;  3MU4 A;  3TIT A;  1O32 A;  1KIG H;  1YLD A;  5F8T A;  2G51 A;  3L33 A;  3V7T A;  3Q77 A;  4FET A;  3OY5 U;  1SFI A;  5TCC A;  3RLY H;  1SQA A;  4H4F A;  5CHA B;  3SUG A;  1Z1J A;  3MO9 A;  3BN9 A;  3TJN A;  4BTU B;  2ZDL A;  3QO6 A;  1QY6 A;  1IAU A;  3SGA E;  2J9N A;  3A7Y A;  4ABH A;  1JIR A;  1C1U H;  5C2Z A;  1P11 E;  3V3M A;  2FTM A;  5DP6 A;  9LPR A;  2A5K A;  2FOC A;  2P3F H;  1T4U H;  1NO9 H;  2XBW A;  1C2M A;  2HPP H;  1AWH B;  1B0E A;  2K1Q A;  1JWT A;  2QA9 E;  3C1K A;  5C0U A;  1C2F A;  1GBC A;  1TE0 A;  4ZHA A;  2XYA A;  1HBT H;  1BML A;  1THP B;  3ZZ7 A;  3ZZA A;  3BTF E;  3K6Z A;  2PTC E;  1C1Q A;  2V3M A;  1SB1 H;  3BEF B;  1F0T A;  2P3U B;  3SHC H;  1P3C A;  2XWA A;  3UR9 A;  2FOH A;  4FUD A;  1ZLR A;  1DXW A;  2AIQ A;  1PQA A;  5DP9 A;  3ZYE A;  3V13 A;  4MLF B;  3LON A;  4MNW A;  1DFP A;  2CXV A;  2ZPR A;  2Z6B D;  1TNK A;  2YMS B;  1VGC B;  1NRR H;  1IQM A;  4DG4 A;  1QRX A;  5HM2 A;  1LPK B;  4JMY A;  1QBV H;  1AB9 B;  2IJO B;  2SNW A;  1O3I A;  2ALP A;  3TJV A;  1AVX A;  1V2W T;  4UD9 H;  2A4O A;  5F53 A;  1GI2 A;  2PWX A;  3A8C A;  3KNX A;  1FIW A;  1C5S A;  2WSS D;  4FUH A;  1DY8 A;  2ZWL H;  4X1S U;  1LO6 A;  3DFJ A;  2V3H H;  4ABF A;  5SGA E;  2ZG0 H;  1J16 A;  2Y5H A;  1FAK H;  2OTV A;  2PSY A;  4IN1 A;  4H42 U;  2AYW A;  1GL1 A;  2FX6 A;  1K1L A;  1GHW H;  4CRF A;  1W7G H;  1O2P A;  2TGA A;  2J2U A;  3MH7 A;  1O2G H;  3MQK C;  4B2A A;  1O3D A;  3RC6 A;  1SLU B;  1EJM A;  1N8O C;  4D8N A;  3OFN D;  1FIZ A;  2ZPQ A;  1O2R A;  4MPW A;  1TPS A;  2UWL A;  1MTU A;  2VBC A;  3ZZ8 A;  1J9C H;  1O2M A;  1Z8G A;  4TYD A;  1X7A C;  1C5T A;  1E34 B;  3MYW A;  3RXC A;  2O8M A;  4O03 A;  3RML H;  1K1M A;  2Y7Z A;  1BA8 B;  2ZZU H;  5LPE A;  4K3J A;  3BSQ A;  2PP6 A;  5GCH G;  3ZVA A;  1AMH A;  4B74 A;  4CRD A;  2C4F H;  1N6Y A;  2LNC A;  4X6O A;  1TGB A;  3KGP A;  2GT7 A;  1YCP M;  4UDW H;  1KTT B;  2PTN A;  4I8G A;  4AOR A;  4ABI A;  2Q6D A;  2OK5 A;  2BQ6 B;  1O3O A;  5GDS H;  1IQK A;  1UTO A;  2H9E H;  2GV7 A;  2V0B A;  2FZZ A;  5K0H A;  1GBD A;  1UK2 A;  1RD3 B;  1NFX A;  1O2W A;  5EPN A;  4JYT A;  3KYF A;  1BQY A;  1F7Z A;  1HCG A;  2A5I A;  1TX6 A;  2PV9 B;  5L2Z H;  4Y8Z A;  2AFQ B;  1Y5A T;  2AGI X;  2R3U A;  3W1E A;  1TMU H;  3EE7 A;  1EKB B;  3NPS A;  3AW0 A;  1C2G A;  3P92 A;  1BJV A;  1RS0 A;  4FU7 A;  4A5T S;  2IN2 A;  1UTM A;  4NIX A;  2HWL B;  2VVV A;  5JBC S;  2PGQ B;  3RXE A;  2FS9 A;  4ZRO A;  2BD4 A;  4HI3 A;  1FLE E;  2QN5 T;  3TU7 H;  4VGC B;  5E2P A;  2FDA A;  1GBE A;  4LXB H;  3SHA H;  3A8B A;  3KCG H;  1WXR A;  3ZVG A;  3BG4 B;  3LT3 A;  1GGD C;  1S6H A;  1P01 A;  3SNA A;  1AZ8 A;  2F9B H;  1HJ9 A;  1F0R A;  3RP2 A;  4D7G A;  3ATK A;  1HLT H;  1CGH A;  2AHM E;  2BTC E;  2FM2 A;  3FO8 D;  1QJ6 B;  3NKK A;  2A7C A;  4TPI Z;  3SJK A;  1RFN A;  1XUK A;  3E0N B;  1BBR H;  3R0F A;  3URC A;  4Y71 A;  4BAH B;  5GWZ A;  2CGA A;  4ZXY H;  3ZZ5 A;  1HV7 A;  3LGT A;  2ANY A;  2ZU3 A;  1B7X B;  2H6M A;  4Q2K A;  1GMH G;  1A5G H;  3QZQ A;  2BDI A;  2Q6F A;  2ZNK H;  1LVO A;  2WPI S;  1XUJ A;  1OSS A;  1XUG A;  1JBU H;  2ZC9 H;  1TNG A;  4GPG A;  1EQ9 A;  1LHD H;  3M37 A;  2HNT E;  5EST E;  1V2S T;  4GHT A;  3QUM P;  1DDJ A;  1FX0 B;  1GJ6 A;  3SU6 A;  1O3P B;  1QUR H;  1B0F A;  2ZO3 H;  4I33 A;  1H9I E;  1QBN A;  3NWU A;  3SYJ A;  1CE5 A;  3RXV A;  4RN6 A;  2ZDA H;  5DP5 A;  3ZZ6 A;  3N7O A;  1LCY A;  1VCP A;  3ZZB A;  1GBK A;  1DX5 M;  1TMB H;  1P03 A;  1QBO A;  2ANM H;  1AD8 H;  3M5N A;  1YLN A;  5E0G A;  2BLO A;  3ZZC A;  1GDN A;  2EC9 H;  1AN1 E;  5CDF E;  1HAV A;  1W0K D;  2WHX A;  3PLB A;  1ZHM A;  1BTZ A;  3AAU A;  1WOF A;  3WWF A;  1ELE E;  3RU4 T;  1ZSL A;  3JZ1 B;  3MTY A;  1KY9 A;  3UNS A;  1UTL M;  3MWI U;  1L1N A;  1P05 A;  3CNR A;  1WBG B;  2RG3 A;  1IQL A;  1KDQ A;  1QL9 A;  3PO1 B;  3FKS D;  3M7Q A;  2DE8 A;  1BMA A;  4AOQ A;  5T6G A;  2Z3E A;  3F2F A;  2VH6 A;  2GKV E;  1WAY B;  1F5K U;  1W7X H;  1DM4 B;  1PPC E;  1NN6 A;  1MAY A;  2G55 A;  1S6F A;  2QF5 A;  1JIM A;  3QTV H;  2BMG B;  3BIV H;  3O8D A;  3RU4 D;  1V3X A;  1HJ8 A;  2ZHW H;  1XMN B;  2B9L A;  3BTT E;  2ILN A;  2Z9K A;  3F3B A;  1CT4 E;  2G4U A;  5A0B A;  2NU0 E;  3MMG A;  1AI8 H;  3U69 H;  1Q3X A;  5C94 A;  1UTJ A;  5TCA A;  5T1V A;  1PPG E;  2WPH S;  1ZTL A;  1O38 A;  1C1T A;  4BTI B;  1S0Q A;  1CBW C;  8KME 2;  3M5M A;  4WME A;  4Z0K A;  2C8W B;  1IQG A;  3UWJ H;  2OP9 A;  1O3N A;  1BDA A;  1HIA B;  1ZGV A;  1L1J A;  1AKS A;  2PR3 A;  3K9X B;  2OBQ A;  2VWM A;  3FZZ A;  4CHA B;  1MZD A;  3QZR A;  3WW7 A;  1GMC G;  3C27 B;  2H9T H;  1ZSJ A;  2R3Y A;  4X8T H;  5AF9 H;  1C5Z B;  2BD8 A;  2ZEB A;  1MUE B;  1G3B A;  1AQ7 A;  2SFA A;  1HAG E;  2QAA A;  1GI3 A;  3RC5 A;  1TON A;  1KTS B;  1WDI A;  2IOT A;  1RJX B;  4INH A;  1WYK A;  3OTJ E;  1A61 H;  1QB6 A;  3N99 A;  2EI6 A;  3URD A;  4Y79 A;  4F4O C;  3SUD A;  1XKB C;  1DUE A;  3A82 A;  1WQV H;  2ZGC A;  3ATW A;  3HKJ B;  1CA0 B;  2HLC A;  3M3T A;  1BJU A;  1FY5 A;  3A89 A;  1TX8 A;  2JH0 D;  2A4G A;  1F5L A;  3P6Z B;  2FMJ A;  4WY3 A;  5FPS A;  2XBY A;  5JBT A;  3SU2 A;  2J97 A;  4AB8 A;  5A8X A;  3D23 A;  1TPO A;  1BB0 B;  3PWB A;  3ZYD A;  1O3E A;  1V2N T;  1FNI A;  4KTC A;  1NTP A;  3RXI A;  2Y5G A;  3ZVC A;  1Y8T A;  2CHA C;  1O2X A;  2C8Y B;  1O3A A;  1H9H E;  4IBL H;  3AK5 A;  2XTT B;  2VVC A;  3DUX H;  1FAX A;  4Y6D A;  3PMJ A;  5G4B A;  1SGP E;  2BB4 A;  5F6M A;  1GCD A;  4FUB A;  1C5N H;  2A4Q A;  1EJN A;  2UUK B;  1EAS A;  1ID5 H;  5F03 A;  2BXU H;  4BTT B;  1TNJ A;  5FHT A;  5F8X A;  4CR5 A;  1HPG A;  1ELT A;  5DSF A;  1EZS C;  2EY4 C;  2PKS C;  2YMS D;  2GTB A;  1DWB H;  2ASU B;  1HAZ B;  3PYH A;  1NT1 A;  1DLK B;  3GS9 A;  3MI4 A;  3LOX A;  4F48 B;  1JRS A;  1GHB G;  4MTB A;  1CHG A;  2Z9G A;  1AO5 A;  2BDC A;  2YNB A;  4ZXX H;  3LJO A;  4O9V A;  5HXF A;  3SZN A;  2ZTY A;  1IOE A;  1TGS Z;  1YKT A;  2ZHQ H;  4X2W A;  4Z6A H;  1EXF A;  1G36 A;  4NFE A;  3SND A;  1D3Q B;  3P70 B;  2ZI2 H;  5I46 H;  1GBA A;  1TPP A;  1FPC H;  4NSV A;  3U9A H;  4LZ4 B;  2Y82 A;  2J94 A;  1DXP A;  3UOU A;  1EAT A;  3HPT B;  3NXP A;  2A2Q H;  3DA9 B;  1TX7 A;  3MU0 A;  2QF3 A;  4K2Y A;  3FZD A;  1UTK A;  1V2R T;  3H09 A;  2HPQ H;  5HKK D;  2DE9 A;  2CV3 A;  2H1U A;  3T28 A;  3RXR A;  3ZVF A;  1P8V C;  2G5V A;  3A7T A;  1WCZ A;  1L4Z A;  4KP0 A;  4X6P A;  4KEL A;  2EI8 A;  1FMG A;  1UVO A;  3ZVD A;  4F49 A;  2D1J A;  4NIV A;  1FN8 A;  1SGF A;  3S9A A;  1BUI A;  1KSN A;  2VIV A;  1YCP K;  3RM0 H;  2IJD 1;  3FFG A;  4FUF A;  1H8E D;  1GBH A;  4MG3 A;  3BEI B;  1AGJ A;  4AGK A;  1ARB A;  2UUF B;  1P2K A;  1C4Y 2;  4YT7 H;  5EU8 A;  1XX9 A;  3F9E A;  3UY9 A;  2JET C;  3MO3 A;  1DY9 A;  2BOK A;  1TFX A;  1P02 A;  1MCT A;  2OIN A;  1GJ5 H;  3BIU H;  1DVA H;  5ETX A;  1O2V A;  1YPM H;  3SV8 A;  1GMD F;  3H7O A;  3ITI A;  2XND D;  4MNV A;  3U28 C;  3S7K B;  4AGJ A;  5CHA C;  1L0Z A;  1RRK A;  4DOQ A;  5DGJ A;  2WV9 A;  5LH8 A;  2Z7F E;  2BLW A;  1G3D A;  3B9F H;  2UWP A;  1C5L H;  4X1P U;  1ABJ H;  1SHH B;  2ZDV H;  3EAJ A;  6EST A;  1HXE H;  3E90 B;  1H8D H;  1P2O A;  3PRB A;  4I8K A;  4JZ1 A;  4YZU A;  1QTF A;  4Y76 A;  4DW2 U;  2QE7 D;  2VIO A;  1MTN B;  1SGT A;  1ELA A;  3M5O A;  4DCD A;  1C9T A;  3TGI E;  1P2I A;  2A4R A;  1O37 A;  4BXW A;  1CHO F;  2VWO A;  2Y80 A;  1O2S A;  3SNB A;  2Z9J A;  2A45 B;  5CHB A;  2FXR A;  1Y3X A;  4K69 A;  5GJ4 B;  1GJ9 B;  2V35 A;  2FEQ H;  1CO7 E;  2A1D B;  3TLO A;  2LEL A;  1P12 E;  2R0L A;  1UK4 A;  2FIR H;  3K65 B;  1VGC C;  5A0C A;  1YPH E;  3D62 A;  1FJS A;  1LHC H;  1XUH A;  2WPK S;  1TIO A;  1AUT C;  1AB9 C;  1LHG H;  4ABD A;  4B6E A;  1EPT B;  1E38 B;  1LVM A;  4OS4 A;  4Q80 A;  2VID A;  3UPE A;  1Z6J H;  2UUJ B;  3M36 A;  1O3K A;  2QV1 A;  2ZCL P;  3SJO A;  2QXG A;  2CMY A;  1KXA A;  4Y7A A;  2FTL E;  3H7T A;  4FU8 A;  2ZA5 A;  4YOG A;  5IYT A;  1WTH D;  2FOB A;  2AER H;  2FYR A;  1P06 A;  1K1P A;  5AFY H;  1RIW B;  4MPU A;  5DP8 A;  3E16 B;  2ZFR H;  4OS7 A;  4Y7B A;  4B6F A;  2QGR A;  3ZZ3 A;  1LMW B;  1O3M A;  1ZOM A;  1ABI H;  1BRA A;  3MH5 A;  2YNA A;  3GYL B;  1P9S A;  1QL7 A;  1MKX H;  2QF0 A;  4UFG H;  1AFQ B;  4CRG A;  1FZZ A;  1C1V H;  3SUF A;  1P10 A;  2ANW A;  1AVG H;  1FXY A;  2FYQ A;  5C67 A;  4DJZ B;  1UO6 A;  1TOC B;  3TK6 A;  1YP9 A;  2PUX B;  2I6Q A;  1LQD B;  2L74 A;  2KFW A;  2BX3 A;  3GY2 A;  1PPF E;  1V2V T;  2VGC B;  1DAN H;  2BQ7 B;  2ZFF H;  1UJ1 A;  1SOZ A;  5H4I B;  3BG8 A;  1BTX A;  1RTF B;  1GI5 A;  1VKY A;  1GCT B;  1PQ7 A;  3V0X A;  3LGW A;  3M61 U;  5LGO A;  4DVA U;  3HAT H;  5EXN A;  5L6N H;  1D6R A;  2FS8 A;  3A7Z A;  1C1R A;  3PRD A;  3F6U H;  2B0F A;  1A3B H;  1WU1 A;  4IC6 A;  4ISO A;  3RUO A;  3RXM A;  4ACB A;  2GP9 B;  1ZJK A;  3IWM A;  2QC2 A;  5DP4 A;  2ZDN A;  1IQI A;  3GY3 A;  4OGY A;  3LH1 A;  1NU7 B;  2FOA A;  3M35 A;  1ZTJ A;  4WXV A;  1NRO H;  2ZGB H;  4X0W U;  3KQE A;  2QF4 A;  4LK4 A;  1O2N A; 
#chains in the Genus database with same CATH homology
 4TYD A;  2GVF A;  2LEL A;  4OM9 A;  3OEH D;  3DSO A;  3NRL A;  3RC4 A;  1DXP A;  3ZIA D;  2O8M A;  4M9F A;  1E1R D;  5FL7 D;  1A1R A;  3LKW A;  3SV9 A;  3N7D A;  2V7Q D;  2XNI A;  1H8H D;  3SU4 A;  4ZCN A;  4Q63 A;  4B74 A;  2OC7 A;  2WPD D;  2OBQ A;  4NWL A;  3F2H A;  4B6E A;  4DT4 A;  2F4L A;  2K1Q A;  3UB0 A;  2KM0 A;  3H09 A;  5C0U A;  3WW7 A;  3PV2 A;  5HKK D;  2XCN A;  2JDI D;  2QV1 A;  3SU1 A;  2OK5 A;  5EQS A;  1S6L A;  2M2A A;  2F43 B;  1FX0 B;  2F9V A;  2KCO A;  3O8B A;  3SU6 A;  2XOK D;  4A92 A;  2F9U A;  1COW D;  4K8B A;  4I33 A;  3RC5 A;  5EPN A;  2L6O A;  3EYD A;  3SV6 A;  3SYJ A;  4I32 A;  3VG8 A;  4WF8 A;  3N99 A;  3DCL A;  2YMS C;  3U1J B;  3OYP A;  4B6F A;  4Q4L A;  3SUD A;  2IJD 1;  3F0O A;  5EPY A;  2FOM B;  1JXP A;  1DXW A;  3M5N A;  1H8E D;  4ASU D;  1W3C A;  3KEE A;  3L6P A;  4RI0 A;  1OHH D;  3WWB A;  3W1E A;  3OTP A;  1MAB B;  2A4G A;  3P8O A;  4TSF D;  5EQQ A;  3LON A;  5FPS A;  4B75 A;  5CDF E;  1W0K D;  4TT3 D;  2XCF A;  2WHX A;  2YMS B;  3SU2 A;  2CK3 D;  2KCA A;  3SUF A;  3U1I B;  1DY9 A;  3FN8 A;  1RGQ A;  4R8T B;  3WWF A;  3P8N A;  4JMY A;  4A1V A;  2IJO B;  5C0T A;  1KMH B;  2OIN A;  3KF2 A;  3OEE D;  2KZ4 A;  4KTC A;  4A1X A;  3FOA A;  3F0P A;  3OE7 D;  5EQR A;  2OC8 A;  5ETX A;  3SV8 A;  2KFW A;  2JJ1 D;  2XND D;  2OC1 A;  2WZQ A;  2FP7 B;  3N7E A;  3AK5 A;  2KCP A;  2WV9 A;  4U01 A;  5F53 A;  5H4I B;  1SKY E;  1N1L A;  1W0J D;  3KNX A;  3FKS D;  4A1T A;  2P59 A;  3DSP A;  2WSS D;  5IK2 D;  3O8R A;  1DY8 A;  3F2G A;  3F2F A;  3SU5 A;  2KCY A;  4B76 A;  2W6J D;  5ESB A;  2A4Q A;  3SU3 A;  5IDK A;  3SU0 A;  1WXR A;  1NBM D;  2J5U A;  4I31 A;  4WH8 A;  3E90 B;  1EFR D;  4YXW D;  2K0Q A;  3PRB A;  3PV5 A;  5DN6 D;  2OC0 A;  4B71 A;  2QF5 A;  1CU1 A;  3PRD A;  3O8D A;  2QE7 D;  2GGV B;  3SUE A;  5FPT A;  5DSF A;  5GND A;  2YOL A;  2K8I A;  3M5O A;  1BMF D;  2YMS D;  3M5L A;  1BT7 A;  2OBO A;  2JIZ D;  2A4R A;  2AHM E;  3RC6 A;  2FM2 A;  3OAA D;  3FO8 D;  1E79 D;  4XD7 D;  3GS9 A;  5B6L A;  3F3B A;  3LOX A;  4B73 A;  1E1Q D;  4WH6 A;  1RTL A;  5GPI B;  3SZE A;  2JJ2 D;  4F55 A;  3OFN D;  5FPY A;  2W6I D;  1NBM E;  4FET A;  5T1V A;  4Z1M D;  5CHB A;  3SUG A;  2KR7 A;  3O8C A;  3SV7 A;  5GJ4 B;  5C17 A;  4NWK A;  2VBC A;  3KN2 A;  1NS3 A;  3M5M A;  2HLD D;  2QF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...