4M9JA

Dna polymerase beta e295k soaked with dumpnpp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
326
structure length
307
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHAFTINKYTIRPLVTGVAGEPLPVDSEKDIFDYYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 99
structure length 307
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9jA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9jA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9jA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9jA03
3IM1A 1XSLA 3ZDBA 1BVSA 4QZ8A 3H4BA 5DECA 2LYHA 7ICMA 3GQCA 4QZAA 4DQIA 5DKWA 2NRKA 3T5JA 3AQMA 2NRXA 4YMMA 4RT2A 8ICFA 1SKRA 3ORYA 1JXLA 8ICKA 1BNOA 5J2JA 2FPLA 5CA7A 2O5AA 3M9NB 7ICIA 7ICPA 5JUMA 3QEAZ 1S9FA 3ISDA 1WCNA 5IILA 5KFTA 1RYRA 1V9PA 4M04A 4ECTA 2BCQA 1S0NA 2ZUDA 4YR2A 4J9MA 3C5FA 4F92B 1KRPA 3QZ7A 5J0UA 4F91B 2R8KA 3RJKA 1BPYA 4DL4A 2BQ3A 1ZQGA 8ICPA 9ICLA 5KFLA 4I2IA 1KSPA 3WFPA 1S10A 4ED8A 4X4PA 5J0TA 1ZJMA 3V7JA 4KLUA 5DG7A 5HRHA 4I2DA 4QZGA 4LVSA 4WC4A 2W9MA 4WC5A 1S0OA 2JZBB 4KN7A 2DRAA 4DLGA 5J2FA 3JPNA 1CUKA 5IINA 1BPXA 2BCSA 4YG2A 2A1JA 4O3NA 4RPZA 4EBDA 4KLJA 2F1JA 5KG6A 8ICOA 3ISBA 3PVXA 5KFCA 3PW2A 1NK5A 4O3RA 2C28A 4O3SA 3K75D 5KFVA 3FYHA 7ICEA 4QWDA 3RJGA 4F3OA 4M9GA 8ICWA 4IRCA 4DF4A 2ASLA 4M47A 2BPGA 5KFQA 9ICMA 3GDXA 2VA3A 4UAWA 1NK8A 3GV7B 4ATBA 2DR7A 2J6SA 4GC7A 2VA8A 1TK0A 4KLQA 3B0XA 2IA6A 4I2JA 1ZQKA 2W8KA 2V9WA 2KTQA 5HRLA 2H5XA 5L1KA 3RH4A 1L3VA 1FA0A 1ZQMA 3PNCA 4DLEA 1T7PA 4UD4A 1SKSA 1IXRA 4RWOA 4PGQA 1XSPA 3LK9A 2NRWA 7ICJA 2P6RA 4B9LA 1TFWA 4ELVA 4ECZA 2FLPA 4NLNA 2FLLA 4DS5A 5KG0A 1EXNA 9ICCA 4O3QA 4QWEA 2AGOA 1XS9D 1ZQIA 4M9HA 5HMLA 4FH3A 2XY7A 1ZQTA 4P4OA 4K4IA 1JXEA 9ICSA 4Z6EA 3BQ0A 3PMNA 5J2HA 2ZH7A 4EYIB 4KLSA 5HRFA 4XRHA 3V72A 4KMUA 4MEYA 5KFBA 4TUPA 4NXZA 5J0QA 5EWGA 4R65A 3JPSA 3SZ2A 4IRKA 2F1HA 1TFYA 3C1YA 4RQ0A 1NJWA 2KN7A 4RNMA 1U4BA 1KDHA 5HRDA 4FHYA 5DGBA 3E2EA 2BHNA 3C2KA 3Q8PB 2FMQA 1L3UA 4MEXA 5L1IA 2XGPA 1K1SA 4QZ9A 5KFJA 4F93B 3ETLA 1RZTA 5KFGA 1S0MA 3MDAA 2PFQA 4KLHA 3KHHA 5C5JA 3PW5A 1XU4A 3RAXA 5DB8A 3HP6A 2C2EA 1MQ2A 1ZQBA 3QE9Y 1XO1A 3RJJA 4J9RA 4F2SA 5HRGA 4X4QA 2FMPA 1D8LA 1X2IA 4RQ5A 4EBJA 4XQ8A 1OU5A 1BPEA 1X9MA 1ZQLA 4O5CA 4KLTA 3EWAA 1UEVA 1ZQDA 4TUQA 3PW0A 2ZHAA 2JZBA 4RUCA 4FO6A 2BDPA 1ZQSA 4DWIA 5KG1A 4WC3A 8ICBA 4FS2A 3HJ4A 3C5GA 4B9UA 4B9VA 3OUYA 1XSNA 3KHRA 2BQUA 9ICIA 5KT5A 4YR3A 3LWLA 4ED2A 3RRHA 4WC2A 1BPDA 1ZQUA 5KFYA 2HHSA 4KTQA 3BDPA 3H8JA 4J9OA 1JMSA 3JPOA 1N56A 2V4QA 5J0WA 2J6TA 4I2FA 4DL6A 3OSNA 4JV2A 1R8AA 3WFSC 1NK4A 5KFAA 3C23A 5J0YA 3MGHA 1A76A 1VJ7A 3G6YA 1NOMA 4KN4A 8ICQA 1IM4A 5BOMA 4AT9A 4TQRA 4I2GA 1RXWA 3ZDDA 4ELTA 1R89A 4DSKA 5KFWA 3GIIA 7ICHA 7ICNA 1MC8A 4YMNA 4F4WA 3N4MB 4DOCA 4Q8EA 4WC0A 4J9SA 1D9FA 4WC6A 2V4RA 3PX0A 4Q45A 3EZ5A 3JZ0A 8ICZA 5KG5A 4PHPA 3NGDA 2IMWP 5J2GA 2ZTEA 2M2TA 4R63A 1ZQFA 2HHVA 1A77A 4AT7B 4RQ1A 3HT3A 2ASJA 4C8KA 8ICJA 4KITB 5KFDA 4UQGA 2XCAA 5KFIA 5DGAA 1ZQCA 4DEZA 4UBCA 5BOLA 2OWOA 4NY8A 2HHWA 4ED1A 8ICVA 3NTUA 7ICQA 2ZJ5A 4TURA 4ECUA 3RJFA 4EZ9A 4X4NA 2BR0A 4BDPA 1S97A 7ICRA 3GIJA 1D9DA 5DLGA 1Q79A 3V6JA 5F9NA 2DPIA 9ICWA 4KLEA 3PO5A 4DS4A 3TANA 4ED0A 5KG4A 3Q8MA 2ZUCA 3PR5B 1NJYA 2PFPA 1NZPA 3UPQA 4DL7A 8ICRA 4QZBA 1NJZA 5DQGA 5CHGA 5D4BA 2UVUA 2ZH9A 1AROP 2UVRA 1UT8A 1NKCA 2IHMA 1NJXA 4RQ3A 3Q8LA 2PXIA 4DFJA 1UA0A 3WFOA 3SV3A 3ZD8A 4NM1A 2DR5A 1UEUA 2FPKA 4YVZA 5KFHA 2XC9A 4ED3A 3JPRA 1Z00B 2AQ0A 4O0IA 2XO7A 1RXVA 5J2AA 3QZ8A 4QWCA 1KFSA 4KLOA 1TFRA 4RWQA 2DFLA 3OSPA 4E0DA 2M2UA 5KT3A 5DBCA 1HJPA 3GILA 4F4YA 4FS1A 2BQRA 9ICKA 2J6UA 1YLQA 4KLFA 2VANA 2AGQA 4FHPA 5KT7A 1SL0A 4KLDA 1TK8A 4RWPA 4DQRA 4NLKA 1QSLA 2W9CA 4RPYA 1HUOA 8ICHA 5DB7A 2RFFA 3C2LA 9ICPA 4ECRA 5IIKA 4F4KA 5F9LA 9ICOA 2ZH1A 5EWEA 5HP4A 3TFRA 4MFFA 5L1JA 1JQRA 3RJIA 3H8SA 2ZTDA 5DQIA 1U48A 2W9BA 5KG2A 4J9LA 1NKBA 7ICOA 3IHQB 1UA1A 3RR7A 4C8OA 2FPMA 1QSYA 4QW9A 4IQWA 4E8FA 1UETA 5KFNA 5TZVA 3RB0A 4F4ZA 4C8LA 5DG9A 5CP2A 1NK7A 2KZMA 1MIYA 5L9XA 5CJ7A 3EW9A 2HVHA 3BQTA 4IR1A 1HUZA 3H4DA 3OHAA 1K1QA 3KHGA 4ECWA 2C22A 9ICGA 4RZRA 2ZH4A 5KT4A 3AUOA 1DOQA 4BXOA 5KFOA 4EYHB 3T5KA 2PFNA 2VA2A 3OVBA 3RB3A 4WC1A 4UAYA 1L3SA 4I28A 3H7IA 4M6WA 4RU9A 4J9NA 1U49A 3N97B 2HVIA 4O3OA 4UD5A 4Q8FA 4HYKA 1BNPA 4FBUA 4I2EA 8ICNA 4CCHA 2UVWA 8ICYA 2HHUA 4X0BA 4X4TA 3C66A 2R8HA 5KFRA 8ICUA 5KFPA 4UB2A 4GXKA 3TQ1A 3GIKA 8ICLA 2PFOA 4F4XA 4EEYA 3UQ2A 4DFMA 4JWNA 8ICTA 5DBAA 1S0VA 5IIIA 3HWTA 3M9MB 2RDIA 1BGXT 4PGYA 4JV0A 3UXPA 1KNYA 3OJSA 3BQ1A 4P2HA 3OJUA 3HW8A 3UQ0A 8ICEA 1PZNA 4J9QA 4DSIA 5KT2A 5BPCA 2ISPA 2PBEA 3RH5A 5KT6A 2WTFA 3RTVA 2FMSA 4AT7A 4EZ6A 2DVIA 4XA5A 4ED7A 4M5DA 1U45A 5KFKA 5J0PA 4DO9A 9ICQA 4LZDA 4ECXA 4E80A 4X0AA 3RB6A 2HHPA 4IQTA 5HR9A 4YR0A 2BPFA 4ATBB 4Z6CA 1KFDA 5J0XA 4JV1A 4AT9B 4MF8A 3B0YA 1XC9A 5J2KA 3FDSA 3GIMA 1B43A 3LWMA 1X9SA 5HHHA 1ZYQA 4RPXA 3JPQA 2Y1IA 4F5NA 3TI0A 4WCWA 7ICFA 4G3IA 2HHXA 3NYBA 3K4GA 4YP3A 5KFSA 4RQ7A 2AGPA 4EP7A 4WBZA 4YD1A 4RT3A 5DB6A 1ZQOA 1ZQJA 4IRDA 4EBCA 4QZCA 4FBTA 2JEGA 1Y88A 4QW8A 3MGIA 4R8UB 2IBKA 8ICCA 4AT8A 3PR4A 3TAQA 4FH5A 2DRBA 3M9OB 1D8YA 3H3AA 2MUTB 2Q66A 9ICRA 3MR3A 2BCVA 5J0OA 1Q78A 9ICHA 3GV5B 2F1IA 1KTQA 1DGSA 3UPSA 3OHBA 1ZQEA 4GXJA 3H37A 2HHTA 5KFFA 3H39A 5J29A 3TFSA 3OUYB 4KLIA 5L1LA 1BPZA 3JPTA 4M6WB 1ZQVA 4RQ4A 3TAPA 2IHNA 4B9TA 4LT6A 3WFQE 1ZQXA 3KHLA 3PMLA 2UVVA 5J2IA 8ICAA 4PGXA 3G6XA 1ZQPA 5DEDA 1Z3EB 1TAUA 2ZH6A 4JUZA 2KFNA 3UXNA 4AT8B 4ELUA 5J2EA 4C8MA 4UB1A 1T3NA 4NKTA 1TVAA 2DR9A 3MBYA 4NLGA 4I2CA 4MFCA 2M9NA 3EYZA 3LDAA 1ZQWA 5D49A 3PX6A 2HW3A 1JAJA 1R8BA 4DQSA 4P4PA 4E7XA 5F2VO 2BGWA 1QSSA 2BKEA 5HHIA 3SV4A 2Y1JA 4EBEA 2P66A 4YQWA 4F5RA 2R8GA 4QZIA 3T5LA 3T5HA 4B9SA 4BGDA 4EBKA 3EPIA 8ICGA 2HHQA 3HIYA 3PW4A 5DBBA 2B21A 2NRVA 4IQUA 3V6HA 2ZTCA 3AU6A 5J2DA 2JEJA 4PHDA 2C2RA 4ZH4A 3AU2A 3ISCA 4DSFA 1NKEA 2FLNA 3PY8A 7ICSA 5HC9A 9ICAA 1MQ3A 1B22A 3H40A 4DL5A 4RQ8A 3HPOA 4UB5A 4DSJA 4KLMA 2Q0ZX 4UB3A 2M2WA 5IIJA 3ZDEA 4X5VA 3OVSA 4YD2A 2W8LA 4XUSA 4M2YA 3MR6A 3RBEA 5CB1A 4DFKA 9ICEA 9ICFA 8ICSA 4BWMA 2KZZA 1T8EA 3SI8A 9ICVA 4S3NA 4DSEA 2XY6A 2PI4A 4DL2A 1JIHA 4XQ7A 2NRZA 5HREA 1T4GA 7ICVA 2C2DA 1S77D 2DPJA 4QZFA 3HX0A 3OVAA 4TQSA 3C18A 5HMMA 5KFUA 2NRTA 2PI5A 4FHWA 5EWFA 3Q8RB 2KFZA 4M0AA 2ATLA 5DG8A 3H8WA 3UXOA 2ISOA 5KFZA 2KZ3A 3PX4A 5J2CA 5EOZA 2XY5A 1DK2A 2M2VA 3RJEA 4YFKA 4DQQA 4GC6A 7ICLA 2A1JB 3SYZA 3ZD9A 4F50A 4O3PA 4QWAA 3RJHA 4UB4A 3MDCA 2ZUBA 4ECQA 1WCLA 1VFGA 1DK3A 9ICJA 2AU0A 1L3TA 3C21A 4C8NA 3PW7A 5HNKA 1R8CA 4WBYA 2AQ4A 3MR2A 3ZDCA 1NK9A 4TUSA 9ICUA 4M9JA 5J2BA 4UBBA 3V7LA 5CWRA 4QZHA 1S76D 2MAXA 4Z6DA 2ALZA 2GWSA 4DSLA 2ZH8A 4QZEA 3C1ZA 3V6KA 2ZH5A 9ICTA 2ZH3A 1TAQA 1RPLA 3MFHA 3GFKB 3MR5A 4B9MA 4K4GA 1SZPA 7ICKA 5IIOA 4ED6A 4GLXA 4KLLA 4IQVA 5HRIA 3AQNA 4IG8A 1CEZA 4FHXA 5J0RA 3JPPA 4DF8A 1UT5A 1LV5A 2ASDA 3HJ1A 5DB9A 1NK0A 4UAZA 4O5EA 8ICIA 1V4AA 2ZJAA 3RH6A 1KFTA 4X4RA 5HRBA 3M8RA 4YN4A 4MF2A 3G6VA 2XGQA 3RR8A 2XCPA 1TKDA 1ZQQA 4YCXA 4PPXA 4Z6FA 4Q44A 3AQKA 2ZH2A 1NK6A 4M9LA 4O5KA 4ECSA 5IIMA 3TARA 5DLFA 4KLGA 3EPGA 3RBDA 1QTMA 2W9BB 3RRGA 7ICTA 1TV9A 3THVA 1WOTA 2BE3A 1MIVA 3Q8KA 4PHEA 3PV8A 2KP7A 1SKWA 5KTQA 2BPCA 5D46A 3ZDAA 4J9KA 2W9CB 4YXJA 4R8UA 4F5PA 1C7YA 4K4HA 3Q8SB 4X4VA 1JN3A 4NKUA 4ECVA 3LQCB 1RYSA 1JX4A 2O1PA 1U9LA 4X4UA 2RDJA 5KG7A 3OV7A 1QLNA 4I2HA 4RQ6A 1XWLA 2MUTA 3C2MA 4I29A 1PX5A 3KTQA 4YXMA 3H38A 2DR8A 1Z00A 3L9DA 4DFPA 4J9PA 7ICGA 3PO4A 1ZQYA 4PHAA 4F2RA 8ICMA 4YMOA 1MIWA 2ID1A 4WC7A 5HRKA 4RNNA 2ZJ8A 1ZQHA 1ZQAA 4DL3A 1SL2A 2JEIA 9ICNA 8ICXA 5DDYA 5KFEA 3Q8QB 2R8JA 4I2BA 4NM2A 4NLZA 4PH5A 9ICXA 4FHVA 4RWNA 4BXOB 2BCRA 5KFMA 3T3FA 3RB4A 1L5UA 5KFXA 5DDMA 4DOAA 5J0SA 1ZJNA 4F5QA 3AQLA 1MSWD 3OGUA 1N48A 4X4SA 4LZGA 4F5OA 3BJYA 3MABA 1LB2B 1ZQNA 4O9MA 1U47A 2ZHBA 2BCUA 3RAQA 4P4MA 1COOA 2P6UA 1ZETA 2I9GA 4RUAA 4Q43A 7ICUA 5DQHA 2I1QA 1ZQZA 5CR0A 3BQ2A 1BPBA 2JEFA 3MFIA 2W9AA 4IR9A 2AJQA 4X4OA 4QZDA 3WFRE 4QWBA 4M9NA 1H38A 4I27A 4JK1A 3V7KA 1NO5A 3JYYA 9ICBA 2R8IA 1X9WA 4BWJA 4MFAA 3GV8B 4R64A 4GXIA 4DOBA 4ECYA 3M8SA 3QEBZ 5KG3A 1TK5A 4F8RA 4JWMA 1KEJA 4RNOA 4B9NA 4DQPA 4I2AA 4R66A 1ZQRA 1SL1A 4RQ2A 1F5AA 1KLNA
chains in the Genus database with same CATH superfamily
3ZDBA 3H4BA 4QZ8A 3GQCA 1VLBA 3NVYA 5DKWA 3OPXA 2F44A 8ICFA 1JXLA 1IG6A 2O5AA 3M9NB 7ICIA 2MRLA 7ICPA 4OJLA 3QEAZ 3RFAA 2EWRA 1JI7A 1WCNA 4GIBA 4NXVA 3TADA 4K9AA 3E0FA 4ECTA 2O6KA 1S0NA 2R8KA 3QZ7A 4UD5A 2MSNA 4DL4A 4ED8A 1QH9A 5EE0A 3HRDD 4KLUA 4I2DA 2EZYA 5IINA 3JPNA 8ICIA 4WQKA 5F3XB 4NJ8A 2F1JA 5KG6A 3LVVA 3IN5A 3PVXA 4O3RA 3K75D 1PVQA 2ZIVB 4IRCA 1FFVA 4DF4A 4M47A 2VA3A 1NK8A 1TK0A 2IA6A 1ZQKA 2W8KA 2KTQA 3AQFA 2H5XA 5L1KA 4OCZA 1ZQMA 2OCEA 4RWOA 1XSPA 5ALLA 7ICJA 4B9LA 4ELVA 2YB1A 2FLPA 5AIAA 4UAUA 4O3QA 2F2AB 2AGOA 3ED5A 4FH3A 1JXEA 4Z6EA 5J2HA 5HRFA 3QU2A 4OAHA 1X40A 4NXZA 4IRKA 1TFYA 1NJWA 2KN7A 4RNMA 4FHYA 5HRDA 4B6JA 5KFJA 1S0MA 4EENA 3N28A 4Y2RA 4UB6U 3KHHA 3UPSA 1XU4A 5DB8A 4LJXA 1XO1A 5ALHA 4JB3A 4XQ8A 1X9MA 1ZQLA 1ZQDA 5KG1A 4WC3A 3NKUA 3MCRA 3HJ4A 2YX8A 5AI0A 3OUYA 3KHRA 5KT5A 4YR3A 3RRHA 4WC2A 1PUZA 5AK6A 2KSOB 2KICA 2YY6A 3KBBA 4I2FA 2V4QA 3K1RB 3WFSC 5KFAA 5J0YA 3MGHA 4CDGA 4NLBA 4XJEA 4KN4A 4AT9A 5BOMA 2OM6A 3ZDDA 2F3NA 1MC8A 4WC6A 4C4TA 5KG5A 2QARA 2HHVA 1A77A 4RQ1A 8ICJA 4KITB 5KFDA 2XCAA 5AK4A 5HR9A 2KJ8A 4ED1A 7ICQA 2LMRA 2XI9A 4EZ9A 3CK6A 4NL9A 5F9NA 4JMUA 2K8AA 3PO5A 4DS4A 5KG4A 3DDHA 3LYSA 3PZPA 3UPQA 4U7CA 4QZBA 2UVUA 5CHGA 5D4BA 2KVCA 4G9BA 3WK9A 1NKCA 4RQ3A 2PXIA 4AYBC 3SV3A 4YVZA 4ED3A 3F53A 1Z00B 4KLOA 4O0IA 2XO7A 4QWCA 4HAIA 1TFRA 4RWQA 3ICXA 2M2UA 4FS1A 4EGWA 4EEDA 3CP8A 1QSLA 4RPYA 1DXSA 8ICHA 2K8BB 4F4KA 4CF3A 9ICOA 5EWEA 3TFRA 3RJIA 5D62A 4J9LA 4C8OA 4QW9A 3WU2U 2OEHA 5KL8B 3U26A 1UETA 5KFNA 5AM2A 1NK7A 5L9XA 1RM6C 3HILA 5CJ7A 2WF6A 3H4DA 1K1QA 9ICGA 4BXOA 4C7YA 2VA2A 3OVBA 2ZH5A 2W3RA 3RF9A 2KMDA 3M6KA 4M6WA 3SMVA 1ZXIA 4HYKA 5G5HA 1L7OA 2UVWA 2LKYA 1XO0A 3C66A 2R8HA 5EE3A 3QU7A 4UB2A 1HIWA 3IP4B 4EEYA 4PGYA 5ALMA 4JV0A 5KAFU 5AK5A 3HW8A 4JLZA 2ZIXA 3IG5A 5BPCA 2ISPA 5KT6A 2WTFA 2WFAA 5JU5A 1WUDA 4XA5A 4M5DA 5J0PA 4E80A 4LZDA 4ECXA 3NVZA 2AH5A 4NV0A 2LYAA 3B0YA 1XC9A 5J2KA 3GIMA 3LWMA 3NWIA 3TI0A 7ICFA 2DKXA 1PK1A 4LEZA 4EP7A 4RQ7A 2AGPA 4WBZA 4YD1A 5DB6A 1JROA 3MGIA 2NO4A 1Z1BA 4FH5A 3M9OB 3H3AA 5L1MA 1Q78A 3MR3A 2JMGA 3GV5B 4GXJA 2KV2A 2KHVA 3H39A 3QNMA 3TAPA 4LT6A 1IV8A 1ZQPA 5DEDA 2GAFD 2FE9A 2ZH6A 3UXNA 5KNIA 4ELUA 3D2NA 4UB1A 5AM1A 4NLGA 4I2CA 2M9NA 1R8BA 4P4PA 2BGWA 1QSSA 5HHIA 2Y1JA 2P66A 5AKLA 1SIJA 4YQWA 3T5LA 4B9SA 4EBKA 4EV6A 4IL6U 3PW4A 2B21A 4IQUA 2JEJA 5J2DA 5HC9A 2FLNA 3IV6A 5B66U 5ALPA 1B22A 4RQ8A 4P0QB 4UARA 5B3PA 2Q0ZX 3ZI4A 5IIJA 5ALFA 5JTGA 2R18A 2W8LA 4M2YA 9ICEA 2KZZA 3M1YA 1AQ6A 2K89A 4K99A 4XQ7A 1T4GA 2LI6A 4QZFA 3WK5A 4CE6A 4Y2QA 4TQSA 3C18A 4I0UA 2PI5A 2E8MA 2ZG6A 3Q8RB 2KFZA 2ATLA 3R9KA 2E8PA 1DK2A 3PX4A 2DWQA 2ES6A 4PJ0U 1SV0C 3RJHA 2WHEA 2ZUBA 4ECQA 5E79U 5CHEA 3QU5A 3PW7A 1R8CA 9ICUA 5J2BA 3ERCC 1S76D 4DSLA 2ZH8A 2JXJA 1ZRMA 9ICTA 3MFHA 4UB8U 3MR5A 5IIOA 5KAIU 4FHXA 2KIWA 4K9BA 4UAZA 3RH6A 5AHXA 3D2SA 4YN4A 4MF2A 2XGQA 4Z6FA 5IIMA 5B3QA 3TARA 1QTMA 7ICTA 2VJ5A 1X6IA 3THVA 1YT3A 3IDWA 5D46A 3QYPA 4J9KA 4YXJA 4K4HA 1F44A 2GOLA 3LQCB 1RYSA 2OHFA 2W7PA 1VDVA 4WH5A 4Y2PA 5AKHA 5KG7A 1QLNA 1L7PA 3H38A 2F77X 4YXMA 1Z00A 4AYBF 4K8VA 4J9PA 3PO4A 5JTIA 8ICMA 1MIWA 1V97A 2ZJ8A 1QCKA 5D63A 4PH5A 2E8OA 5KFMA 3T3FA 1ZJNA 4LZGA 3MABA 3WK6A 4O9MA 1U47A 4P4MA 2YMMA 4Q43A 2LPEA 2I1QA 1ZQZA 5CR0A 2JEFA 4QZDA 3V7KA 2YMQA 1C20A 4BWJA 3GV8B 1TK5A 4GXIA 4E8FA 1KEJA 4RNOA 3C28A 2GO7A 4R66A 3A0BU 1KLNA 2ZXIA 4FZLA 1O03A 3T5JA 3SAGA 1PVPA 4RT2A 5AM5A 3ORYA 3S6JA 5CA7A 3BS5A 2BDUA 5IILA 5KFTA 1RYRA 5AIBA 2BCQA 2KVSA 2ZUDA 1F5SA 8ICPA 1KNYA 4DFDA 1V38A 5J0TA 1ZJMA 5DG7A 2EAMA 4LVSA 2DRAA 1S0OA 4KN7A 4DLGA 7ICMA 2BCSA 4EBDA 2A1JA 5ALUA 4O3NA 4KLJA 4NXWA 4CRXA 1S5LU 5KFCA 3PW2A 2W11A 3NRZA 2C28A 4O3SA 3BZKA 3FYHA 3AL0B 8ICWA 2LM1A 4KMOB 2J6SA 1ZRNA 4GC7A 2VA8A 3M6ZA 4I2JA 1Q3VA 5HRLA 3L3FX 3RH4A 3PNCA 3T79A 4DLEA 1SKSA 2KJ9A 3SEIA 4PGQA 3ER8C 3LK9A 2NRWA 2WF7A 2P6RA 2EZXA 1TFWA 4NLNA 4Y2TA 4OAGA 2FLLA 5CFSA 4DS5A 5KG0A 9ICCA 2HBJA 3NS1A 3SQIA 5ALIA 3BQ0A 4CF4A 2ZH7A 4KLSA 5AI4A 4XRHA 3F2CA 4KMUA 1WYGA 4MEYA 5ALDA 5EWGA 3SZ2A 4F72A 1U4BA 3BZCA 5DGBA 2BBHA 3D6JA 3E2EA 2PMZC 2FMQA 4BX9C 2WB1C 1ZD2P 2IOFA 3MDAA 4F2SA 4J9RA 5HRGA 1D8LA 4RQ5A 2F76X 1OU5A 1BPEA 4O5CA 2BBJA 1UQVA 5J8YA 2KNJA 3C5GA 1XSNA 3PHZA 3LWLA 2H3ZA 1BPDA 3DV9A 1ZQUA 2W43A 3BDPA 4KTQA 3H8JA 3JPOA 1N56A 1R8AA 5J0WA 4DL6A 3OSNA 1XNSA 1NK4A 1PK1B 1A76A 1VJ7A 1NOMA 2HDOA 1L7NA 8ICQA 3L4PA 2QB1A 1RXWA 4ELTA 5AKGA 7ICNA 4F4WA 4DOCA 2JH1A 1D9FA 4QNLA 4Y2UA 4Q45A 3EZ5A 4PHPA 2DL0A 2ZTEA 1UHUA 1ZQFA 1ED1A 1WG8A 2B0CA 3HT3A 3AQNA 2OWOA 4UBCA 2K60A 4NY8A 2YQEA 3NTUA 2ZJ5A 4TURA 2KD1A 1S97A 2YTUA 1UPHA 1Q79A 4ED0A 3PR5B 3KKAC 2FDRA 4US8A 2VKQA 4C0ZA 1LVHA 2IHMA 3Q8LA 3QX7A 4HX0A 1CI4A 4NM1A 2DR5A 2XC9A 5J8YC 2FMPA 2LBOA 1KFSA 1KQQA 3AQEA 1ZD5A 5KT3A 4F4YA 2J6UA 4KLFA 2YMLA 2AGQA 2Y9TA 4KLDA 2W9CA 3C2LA 9ICPA 4ECRA 4MKPA 1ZOLA 2AXTU 5IIKA 1JQRA 5HP4A 4MFFA 2NO5A 2ZIUB 5ALTA 5L1JA 5DQIA 1U48A 1UA1A 3TADC 4F4ZA 4C8LA 1J97A 2HVHA 3BQTA 2NYVA 1KW4A 1P7DA 2ZH4A 5KFOA 4EELA 4WC1A 4UAYA 4J9NA 1U49A 1BNPA 5ALJA 2HN1A 4X0BA 4X4TA 3WKAA 2OXOA 4GXKA 3ER9B 8ICLA 2PFOA 4JWNA 8ICTA 3FM9A 1S0VA 5IIIA 1BGXT 2PBEA 1L7MA 4EZ6A 2DVIA 2E8NA 2KK0A 3RB6A 4YR0A 4JV1A 4MF8A 3SAHA 3FDSA 1X9SA 1ZYQA 4RPXA 4F5NA 4US9A 2HHXA 3NYBA 1ZQJA 4IRDA 1HEKA 4QZCA 2DRBA 3PR4A 4FE3A 4EX7A 2DUYA 4Y2VA 1N5XA 5EE1A 5H2FU 9ICHA 2HOFA 2HHTA 3TFSA 5CFTA 4KLIA 1JALA 2B6GA 2HCFA 2KJ5A 3PMLA 3QUTA 2UVVA 8ICAA 1ECWA 4DCCA 2VIXA 2KFNA 3D2QA 2XIDA 1JUDA 3LDAA 1PVRA 1OW5A 3SV4A 4EBEA 4QZIA 3T5HA 3V6HA 3AU6A 2ZTCA 3AU2A 2G07A 1MQ3A 4DSJA 4X5VA 3OVSA 2W54A 3NVOA 1NI3A 4XUSA 3MR6A 4DFKA 1T8EA 5HR6A 4DSEA 1JIHA 2NRZA 7ICVA 3ONNA 2DPJA 1SXEA 5KFUA 4FHWA 4O6AA 5AKEA 2H3FA 3PSIA 4M0AA 3EUB2 2K4HA 5ALGA 5DG8A 3H8WA 3UXOA 2XY5A 2M2VA 1Q8KA 2A1JB 4F50A 5AI9A 4QWAA 4EEKA 1L3TA 3BS7A 1N60A 5ALXA 4WBYA 5KL1B 3MR2A 3ZDCA 3F5AA 4TUSA 4UBBA 4QZHA 3C29A 2ZH3A 1RPLA 3GFKB 4WQLA 4K4GA 3BS5B 1DGJA 1SZPA 2CPRA 4KLLA 3SR6A 4IG8A 4KX3A 3HJ1A 1NK0A 1RQNA 1V4AA 1T3QA 3QUBA 3G6VA 3RR8A 1ZQQA 1SXDA 3AQKA 4YCXA 3QU9A 3B9JA 4ECSA 3WK7A 3EPGA 1VJ5A 3RRGA 2BE3A 3PV8A 2JV3A 4USAA 4QJFB 2HBLA 4F5PA 1C7YA 2G06A 4NXTA 2O1PA 1U9LA 2AHOB 4I2HA 4RQ6A 1PX5A 1L8LA 3UMGA 2DR8A 1TE2A 7ICGA 1URJA 1ZQYA 3F2DA 2ID1A 2PMZF 2K4PA 2R8JA 9ICXA 4FHVA 4RWNA 4PL1A 3RB4A 1L5UA 5DDMA 5J0SA 1N48A 4F5OA 1S8OA 1LB2B 3KZIU 3GU3A 2RP5A 2ZHBA 3RAQA 1COOA 1ZETA 3LVWA 2KSOA 2E1FA 1OUQA 5DQHA 5AKZA 2W9AA 4IR9A 2AJQA 5HR7A 4X4OA 1N2XA 4M9NA 9ICBA 2R8IA 4CGZA 4R64A 9ICWA 5AM4A 4F8RA 4JWMA 4B9NA 2WF5A 2HHQA 1BVSA 5DECA 2YN4A 4QIWF 1FEZA 4O68A 2NRXA 4YMMA 1SKRA 8ICKA 2W3SA 1S9FA 1V9PA 4J9MA 4YR2A 3C5FA 3RJKA 9ICLA 5ALNA 2HOQA 3E58A 1BPYA 1ZQGA 4I2IA 1KSPA 1S10A 3AM9A 4X4PA 5AI6A 1A6SA 3V7JA 5HRHA 2GH1A 4QZGA 2W9MA 2JZBB 4EX6A 1BPXA 4RPZA 2M0NA 4ZOHC 3F2BA 2GLEA 4OD0A 1NK5A 1D8BA 5KFVA 4PZNA 7ICEA 3RJGA 4F3OA 4PL2A 5KFQA 3GDXA 4ATBA 3GV7B 5GTHU 3MGVA 3AMZA 1FA0A 4UD4A 3HKZC 2KE7A 1NNLA 4QWEA 4P0PB 1XS9D 1ZQIA 4CF5A 5AM3A 4P4OA 9ICSA 5J0QA 4OJ5A 3JPSA 2F1HA 3CRXA 4RQ0A 1KDHA 3Q8PB 3A0HU 1L3UA 4MEXA 1V85A 1N62A 2XICA 4F93B 1K5OA 4KLHA 3RAXA 3PW5A 1LKYA 1MQ2A 1KRPA 9ICQA 2WAQC 1X2IA 4EBJA 4KLTA 2JZBA 2BDPA 1ZQSA 4DWIA 3TACB 1GO3F 1J2MA 2FJ6A 4B9UA 1SWVA 2E3TA 4KM5A 2BQUA 9ICIA 2L5YA 2HHSA 1JMSA 1B0XA 2J6TA 4JV2A 1RYUA 5FP0A 3I28A 1IM4A 4TQRA 3N7PD 1R89A 2HBKA 4DSKA 1L8OA 3WKCA 3N4MB 3EF2A 4Q8EA 2JHDA 2V4RA 3PX0A 2ZIWA 8ICZA 3NGDA 2IMWP 1N61A 4R63A 4C8KA 4UQGA 5DGAA 4X4QA 4DEZA 2HHWA 3RJFA 2BR0A 4BDPA 5ALEA 2ZIWB 5DLGA 3V6JA 2DPIA 3QUQA 3Q8MA 2ZUCA 2PFPA 2DF4B 1NJYA 1RG6A 4DL7A 3AN1A 1NJZA 5DQGA 4NXXA 2UVRA 4DFJA 1UA0A 3ZD8A 5KFHA 3UMCA 5J2AA 3QZ8A 2DKZA 2DFLA 3OSPA 4LEWA 4X4NA 5DBCA 1HJPA 2BQRA 2VANA 3IG8A 1SL0A 4RWPA 5ALQA 4GFJA 2RLTA 4IS7A 1HUOA 5DB7A 3WKBA 2CXYA 2ZH1A 1X6JA 2ZTDA 4EEBA 1TAMA 2W9BA 5KG2A 7ICOA 2FPMA 2Y0SF 4FZNA 2EQYA 4FZMA 4WJ3B 5TZVA 3RB0A 4BUGA 5DG9A 5CP2A 2KZMA 4MHVA 4IR1A 2C22A 2H3QA 2Y0SC 4RZRA 3AUOA 1DOQA 5ALZA 4EYHB 3RB3A 1L3SA 4I28A 3H7IA 3FC4A 4FBUA 8ICNA 2KKPA 1Z4NA 5KFRA 3SD7A 8ICUA 3H0LB 4F4XA 2HMXA 5DBAA 2W7OA 2G5IB 3HWTA 4NLCA 3UXPA 3NASA 3BQ1A 3UQ0A 1Z19A 8ICEA 4J9QA 4DSIA 5KT2A 3RH5A 3RTVA 4AT7A 5KFKA 4DO9A 3SAFA 2I5HA 1DRGA 1L6NA 4IQTA 2BPFA 1UCVA 3JCFA 4ATBB 4Z6CA 4AT9B 4F71A 3N7SC 5HHHA 2Y1IA 3K4GA 2EZZA 2VJ4A 2IHOA 4RT3A 1QQ5A 4EBCA 3NRWA 4FBTA 2JEGA 2IBKA 5CFUA 8ICCA 4R8UB 2DGZA 2MUTB 2Q66A 2PKEA 2P35A 9ICRA 2BCVA 4K96A 1A0PA 2F1IA 1KTQA 1DGSA 1OXJA 1YZ7A 1ZQEA 5KFFA 3OUYB 1BPZA 1ZQ1C 3WKDA 3JPTA 4ACOA 5AKXA 4M6WB 2IHNA 3WFQE 4B9TA 1ZQXA 3KHLA 5J2IA 4PGXA 3KZXA 3G6XA 2RHFA 1TAUA 4JUZA 4AT8B 5J2EA 4C8MA 1T3NA 4NKTA 4MFCA 3EYZA 1SZHA 3PX6A 2HW3A 4E7XA 8ICGA 2YMPA 3HIYA 4P2HA 4NWIA 4PHDA 1NKEA 4ZH4A 3PY8A 5AK3A 9ICAA 3ETRA 3HPOA 2W03A 4KLMA 3H0RB 1IIPA 1LKYB 4UB3A 3ZDEA 4YD2A 2OH2A 5AM0A 3H0MB 3FAHA 8ICSA 2LM4A 4RQNA 4BWMA 3SI8A 4S3NA 2XY6A 3PSFA 4DL2A 3K1ZA 2WF9A 3HX0A 2HBMA 1GPJA 5EWFA 2KIVA 5JRTA 5EE9A 2E1EA 2ISOA 5EOZA 2Q4TA 4DQQA 4GC6A 7ICLA 1RDFA 3SYZA 3ZD9A 4O3PA 4UB4A 1WCLA 9ICJA 3C21A 4C8NA 3NUQA 1NK9A 5K4LA 4M9JA 4JLXA 4KX5A 5CWRA 2MAXA 4Z6DA 2ALZA 4QZEA 3C1ZA 2ZXHA 3V6KA 4B9MA 4IQVA 5HRIA 1CEZA 5J0RA 4DF8A 5DB9A 4O5EA 4X4RA 5HRBA 2XCPA 1TKDA 2ZH2A 4Q44A 4O5KA 4M9LA 3QXGA 5DLFA 2W9BB 3Q8KA 4PHEA 4Y2XA 2KP7A 1SKWA 2BPCA 3ZDAA 4CNQA 3Q8SB 4X4VA 3WK8A 3H8MA 1JX4A 4C7ZA 2RDJA 5CRXA 3OV7A 3C2MA 1XWLA 3KTQA 2FI1A 3L5KA 3L9DA 5A0LA 2KKVA 4PHAA 4F2RA 5ALSA 2I6XA 4WC7A 5HRKA 1ZQHA 4DL3A 5C0YA 8ICXA 5DDYA 5KFEA 4NLZA 4NM2A 3VCBA 2BCRA 3CNHA 1X9XA 5KFXA 4DOAA 1KL9A 3NVVA 3AQLA 3OGUA 4X4SA 3BJYA 3I76A 4C4SA 2W55A 3KKAA 2P6UA 4OAIZ 4RUAA 7ICHA 3BQ2A 1BPBA 4O67A 4QWBA 3J81j 3GZFA 4Q8FA 4MFAA 3QEBZ 4ECYA 2YB4A 2EH9A 4I2AA 2BZFA 3KD3A 1SL1A 4RQ2A 5KFIA 1WWVA 1B4FA 3IM1A 1XSLA 1SB3C 2LYHA 5AI8A 4QZAA 4DQIA 2NRKA 3AQMA 1J2NA 2Y9UA 1BNOA 5J2JA 2FPLA 2A3VA 5JUMA 3ISDA 4QIWC 2H3VA 4M04A 4F92B 5J0UA 4F91B 2KHQA 2BQ3A 5KFLA 3WFPA 2W04A 3WK4A 1MA7A 1X42A 1SV4A 2JGAA 4WC4A 4WC5A 2LHTA 5J2FA 1CUKA 2WF8A 5AKYA 4YG2A 2QKQA 8ICOA 3ISBA 5CEHA 4QWDA 4M9GA 2IOFK 2ASLA 2BPGA 3HKZF 9ICMA 2DR7A 2F8LA 4UAWA 4Y2YA 1COKA 4KLQA 3B0XA 4K98A 2V9WA 1L3VA 4A8EA 4Y2SA 1T7PA 1IXRA 5GTIU 5ALVA 4P0PA 4C80A 1PK3A 3CYMA 4ECZA 2RQ5A 1EXNA 4M9HA 5HMLA 2XY7A 2IUBA 1ZQTA 4K4IA 1ZD3A 2F8KA 2JRZA 3PMNA 3QUCA 4EYIB 1CRXA 3V72A 4LEYA 3O0FA 5KFBA 4TUPA 1FO4A 4R65A 5AI5A 3C1YA 2BHNA 3C2KA 4UATA 5T14A 4OJOA 5L1IA 2XGPA 1K1SA 2H3IA 4QZ9A 2D6FC 3ETLA 1RZTA 5KFGA 1YZ6A 2PFQA 2K4EA 5G5GA 5C5JA 2C2EA 1ZQBA 3HP6A 3RJJA 2G0AA 3QE9Y 3OWGA 3EWAA 5D61A 2CN1A 1UEVA 4TUQA 3PW0A 2ZHAA 4FO6A 4RUCA 2QB0B 2XVTA 8ICBA 4FS2A 4B9VA 4ED2A 5KFYA 4J9OA 2D8CA 3C23A 1Q46A 3G6YA 4Y2JA 2RRDA 2IOHA 5KFWA 3GIIA 4YMNA 3K7DA 4WC0A 1KKXA 4J9SA 2EAPA 3JZ0A 5ALRA 2ODGA 5J2GA 2M2TA 1KN5A 4AT7B 1MN8A 2ESEA 2ASJA 1ZQCA 5BOLA 8ICVA 4ECUA 3UM9A 7ICRA 3GIJA 1D9DA 4KLEA 2HSZA 3TANA 4AP9A 2MU2A 1NZPA 1RQLA 8ICRA 1AROP 1FFUA 1UT8A 1NJXA 3WFOA 1UEUA 2FPKA 2R8GA 5AICA 3JPRA 2AQ0A 1RXVA 1Q3UA 2ZIVA 2G09A 4E0DA 3KOOA 3GILA 9ICKA 3F5EA 1YLQA 5ALWA 4FHPA 2N1RA 5KT7A 1TK8A 2HI0A 4DQRA 4NLKA 2DQNB 2RFFA 2OYYA 5F9LA 5ALYA 2Z7JA 3H8SA 4U6PA 1NKBA 3IHQB 3RR7A 1QSYA 4IQWA 4OAFA 4K97A 1X66A 1QQ6A 4N7RA 2B56A 1MIYA 1FIQA 3EW9A 1HUZA 3OHAA 4ECWA 3KHGA 4LEVA 1ZD4A 5ALOA 5KT4A 3T5KA 2PFNA 1VFGA 2HVIA 4RU9A 3N97B 4O3OA 4I2EA 4CCHA 8ICYA 3KFUF 2HHUA 5KFPA 4RQMA 3TQ1A 3GIKA 3ALRA 3UQ2A 4DFMA 4C4RA 4NL9C 3M9MB 2RDIA 1O08A 4O69A 3OJSA 3OJUA 1PZNA 4FFDA 2NV3A 2FMSA 1Z4OA 4ED7A 2K8CB 1U45A 4X0AA 2HHPA 1NZBA 4OJPA 1JRPA 1KFDA 5J0XA 4OO1J 1SV0A 1B43A 2JR5A 3JPQA 4WCWA 3VC8A 4G3IA 3CW2C 4YP3A 5KFSA 4BJQA 1ZQOA 1Y88A 4QW8A 4AT8A 2A1AA 3TAQA 1D8YA 5J0OA 2DBYA 2ZIUA 2QB0A 2B51A 3SENA 3OHBA 2CRXA 3H37A 4KB6A 5J29A 5L1LA 2LYBA 1ZQVA 4RQ4A 1Z3EB 5AKKA 2HN2A 3TKAA 2DR9A 1TVAA 3MBYA 2ZH9A 1JAJA 1ZQWA 5D49A 5F2VO 4DQSA 3HJEA 4I2GA 2BKEA 4IC9A 4F5RA 4BGDA 3EPIA 5DBBA 2NRVA 3PSTA 2C2RA 4J03A 3ISCA 4DSFA 7ICSA 1Z1VA 3H40A 4DL5A 3N7RC 2WAQF 4UB5A 2M2WA 3RBEA 2EANA 5CB1A 9ICFA 3PSPA 9ICVA 2JH7A 4ICAA 2B4VA 2PI4A 1T94A 2A19A 5HREA 3QU4A 2C2DA 1S77D 2WB1F 3OVAA 5HMMA 2NRTA 2K4IA 1N5WA 2KEYA 2G5HB 1M6YA 4UASA 2KZ3A 5KFZA 5J2CA 4NXUA 2KG5A 2EDUA 4YFKA 3RJEA 5B5EU 3MDCA 1DK3A 2AU0A 4WOYA 3DEEA 5HNKA 3M7DA 2AQ4A 2KOBA 3V7LA 2E5SA 2GWSA 2QLTA 3WKEA 2GA9D 1TAQA 1F0MA 1SGGA 3MC1A 4PZOA 7ICKA 3AEVA 4ED6A 4GLXA 4UAVA 1SWWA 4UW9A 3JPPA 1UT5A 1LV5A 5ALKA 2ASDA 2ZJAA 1KFTA 3M8RA 1KBUA 4PPXA 4O3MA 2G08A 1NK6A 2MA1A 2D3DA 4KLGA 3RBDA 3OTQA 1TV9A 1WOTA 1MIVA 2EAOA 5KTQA 4OJ6A 2W9CB 4R8UA 1JN3A 4NKUA 4ECVA 2ZIXB 4X4UA 5AKJA 3I1YA 2MUTA 4I29A 3UMBA 4DFPA 4YMOA 1N63A 4RNNA 1ZQAA 3BQ7A 2JEIA 1SL2A 2HOIA 9ICNA 4FO1A 3Q8QB 4I2BA 2FCLA 4BXOB 4F5QA 1MSWD 1ZQNA 2BCUA 4P0QA 2I9GA 7ICUA 1QQ7A 5TISU 3WFRE 3MFIA 3IRUA 1H38A 4I27A 4JK1A 1NO5A 3JYYA 5AKIA 1X9WA 4DOBA 3M8SA 5KG3A 4DQPA 2QARB 1WWUA 1ZQRA 3NVWA 1F5AA
chains in the Genus database with same CATH topology
3IM1A 1XSLA 3ZDBA 1BVSA 4QZ8A 3H4BA 5DECA 2LYHA 7ICMA 3GQCA 4QZAA 4DQIA 5DKWA 2NRKA 3T5JA 3AQMA 2NRXA 4YMMA 4RT2A 8ICFA 1SKRA 3ORYA 1JXLA 8ICKA 1BNOA 5J2JA 2FPLA 5CA7A 2O5AA 3M9NB 7ICIA 7ICPA 5JUMA 3QEAZ 1S9FA 3ISDA 1WCNA 5IILA 5KFTA 1RYRA 1V9PA 4M04A 4ECTA 2BCQA 1S0NA 2ZUDA 4YR2A 4J9MA 3C5FA 4F92B 1KRPA 3QZ7A 5J0UA 4F91B 2R8KA 3RJKA 1BPYA 4DL4A 2BQ3A 1ZQGA 8ICPA 9ICLA 5KFLA 4I2IA 1KSPA 3WFPA 1S10A 4ED8A 4X4PA 5J0TA 1ZJMA 3V7JA 4KLUA 5DG7A 5HRHA 4I2DA 4QZGA 4LVSA 4WC4A 2W9MA 4WC5A 1S0OA 2JZBB 4KN7A 2DRAA 4DLGA 5J2FA 3JPNA 1CUKA 5IINA 1BPXA 2BCSA 4YG2A 2A1JA 4O3NA 4RPZA 4EBDA 4KLJA 2F1JA 5KG6A 8ICOA 3ISBA 3PVXA 5KFCA 3PW2A 1NK5A 4O3RA 2C28A 4O3SA 3K75D 5KFVA 3FYHA 7ICEA 4QWDA 3RJGA 4F3OA 4M9GA 8ICWA 4IRCA 4DF4A 2ASLA 4M47A 2BPGA 5KFQA 9ICMA 3GDXA 2VA3A 4UAWA 1NK8A 3GV7B 4ATBA 2DR7A 2J6SA 4GC7A 2VA8A 1TK0A 4KLQA 3B0XA 2IA6A 4I2JA 1ZQKA 2W8KA 2V9WA 2KTQA 5HRLA 2H5XA 5L1KA 3RH4A 1L3VA 1FA0A 1ZQMA 3PNCA 4DLEA 1T7PA 4UD4A 1SKSA 1IXRA 4RWOA 4PGQA 1XSPA 3LK9A 2NRWA 7ICJA 2P6RA 4B9LA 1TFWA 4ELVA 4ECZA 2FLPA 4NLNA 2FLLA 4DS5A 5KG0A 1EXNA 9ICCA 4O3QA 4QWEA 2AGOA 1XS9D 1ZQIA 4M9HA 5HMLA 4FH3A 2XY7A 1ZQTA 4P4OA 4K4IA 1JXEA 9ICSA 4Z6EA 3BQ0A 3PMNA 5J2HA 2ZH7A 4EYIB 4KLSA 5HRFA 4XRHA 3V72A 4KMUA 4MEYA 5KFBA 4TUPA 4NXZA 5J0QA 5EWGA 4R65A 3JPSA 3SZ2A 4IRKA 2F1HA 1TFYA 3C1YA 4RQ0A 1NJWA 2KN7A 4RNMA 1U4BA 1KDHA 5HRDA 4FHYA 5DGBA 3E2EA 2BHNA 3C2KA 3Q8PB 2FMQA 1L3UA 4MEXA 5L1IA 2XGPA 1K1SA 4QZ9A 5KFJA 4F93B 3ETLA 1RZTA 5KFGA 1S0MA 3MDAA 2PFQA 4KLHA 3KHHA 5C5JA 3PW5A 1XU4A 3RAXA 5DB8A 3HP6A 2C2EA 1MQ2A 1ZQBA 3QE9Y 1XO1A 3RJJA 4J9RA 4F2SA 5HRGA 4X4QA 2FMPA 1D8LA 1X2IA 4RQ5A 4EBJA 4XQ8A 1OU5A 1BPEA 1X9MA 1ZQLA 4O5CA 4KLTA 3EWAA 1UEVA 1ZQDA 4TUQA 3PW0A 2ZHAA 2JZBA 4RUCA 4FO6A 2BDPA 1ZQSA 4DWIA 5KG1A 4WC3A 8ICBA 4FS2A 3HJ4A 3C5GA 4B9UA 4B9VA 3OUYA 1XSNA 3KHRA 2BQUA 9ICIA 5KT5A 4YR3A 3LWLA 4ED2A 3RRHA 4WC2A 1BPDA 1ZQUA 5KFYA 2HHSA 4KTQA 3BDPA 3H8JA 4J9OA 1JMSA 3JPOA 1N56A 2V4QA 5J0WA 2J6TA 4I2FA 4DL6A 3OSNA 4JV2A 1R8AA 3WFSC 1NK4A 5KFAA 3C23A 5J0YA 3MGHA 1A76A 1VJ7A 3G6YA 1NOMA 4KN4A 8ICQA 1IM4A 5BOMA 4AT9A 4TQRA 4I2GA 1RXWA 3ZDDA 4ELTA 1R89A 4DSKA 5KFWA 3GIIA 7ICHA 7ICNA 1MC8A 4YMNA 4F4WA 3N4MB 4DOCA 4Q8EA 4WC0A 4J9SA 1D9FA 4WC6A 2V4RA 3PX0A 4Q45A 3EZ5A 3JZ0A 8ICZA 5KG5A 4PHPA 3NGDA 2IMWP 5J2GA 2ZTEA 2M2TA 4R63A 1ZQFA 2HHVA 1A77A 4AT7B 4RQ1A 3HT3A 2ASJA 4C8KA 8ICJA 4KITB 5KFDA 4UQGA 2XCAA 5KFIA 5DGAA 1ZQCA 4DEZA 4UBCA 5BOLA 2OWOA 4NY8A 2HHWA 4ED1A 8ICVA 3NTUA 7ICQA 2ZJ5A 4TURA 4ECUA 3RJFA 4EZ9A 4X4NA 2BR0A 4BDPA 1S97A 7ICRA 3GIJA 1D9DA 5DLGA 1Q79A 3V6JA 5F9NA 2DPIA 9ICWA 4KLEA 3PO5A 4DS4A 3TANA 4ED0A 5KG4A 3Q8MA 2ZUCA 3PR5B 1NJYA 2PFPA 1NZPA 3UPQA 4DL7A 8ICRA 4QZBA 1NJZA 5DQGA 5CHGA 5D4BA 2UVUA 2ZH9A 1AROP 2UVRA 1UT8A 1NKCA 2IHMA 1NJXA 4RQ3A 3Q8LA 2PXIA 4DFJA 1UA0A 3WFOA 3SV3A 3ZD8A 4NM1A 2DR5A 1UEUA 2FPKA 4YVZA 5KFHA 2XC9A 4ED3A 3JPRA 1Z00B 2AQ0A 4O0IA 2XO7A 1RXVA 5J2AA 3QZ8A 4QWCA 1KFSA 4KLOA 1TFRA 4RWQA 2DFLA 3OSPA 4E0DA 2M2UA 5KT3A 5DBCA 1HJPA 3GILA 4F4YA 4FS1A 2BQRA 9ICKA 2J6UA 1YLQA 4KLFA 2VANA 2AGQA 4FHPA 5KT7A 1SL0A 4KLDA 1TK8A 4RWPA 4DQRA 4NLKA 1QSLA 2W9CA 4RPYA 1HUOA 8ICHA 5DB7A 2RFFA 3C2LA 9ICPA 4ECRA 5IIKA 4F4KA 5F9LA 9ICOA 2ZH1A 5EWEA 5HP4A 3TFRA 4MFFA 5L1JA 1JQRA 3RJIA 3H8SA 2ZTDA 5DQIA 1U48A 2W9BA 5KG2A 4J9LA 1NKBA 7ICOA 3IHQB 1UA1A 3RR7A 4C8OA 2FPMA 1QSYA 4QW9A 4IQWA 4E8FA 1UETA 5KFNA 5TZVA 3RB0A 4F4ZA 4C8LA 5DG9A 5CP2A 1NK7A 2KZMA 1MIYA 5L9XA 5CJ7A 3EW9A 2HVHA 3BQTA 4IR1A 1HUZA 3H4DA 3OHAA 1K1QA 3KHGA 4ECWA 2C22A 9ICGA 4RZRA 2ZH4A 5KT4A 3AUOA 1DOQA 4BXOA 5KFOA 4EYHB 3T5KA 2PFNA 2VA2A 3OVBA 3RB3A 4WC1A 4UAYA 1L3SA 4I28A 3H7IA 4M6WA 4RU9A 4J9NA 1U49A 3N97B 2HVIA 4O3OA 4UD5A 4Q8FA 4HYKA 1BNPA 4FBUA 4I2EA 8ICNA 4CCHA 2UVWA 8ICYA 2HHUA 4X0BA 4X4TA 3C66A 2R8HA 5KFRA 8ICUA 5KFPA 4UB2A 4GXKA 3TQ1A 3GIKA 8ICLA 2PFOA 4F4XA 4EEYA 3UQ2A 4DFMA 4JWNA 8ICTA 5DBAA 1S0VA 5IIIA 3HWTA 3M9MB 2RDIA 1BGXT 4PGYA 4JV0A 3UXPA 1KNYA 3OJSA 3BQ1A 4P2HA 3OJUA 3HW8A 3UQ0A 8ICEA 1PZNA 4J9QA 4DSIA 5KT2A 5BPCA 2ISPA 2PBEA 3RH5A 5KT6A 2WTFA 3RTVA 2FMSA 4AT7A 4EZ6A 2DVIA 4XA5A 4ED7A 4M5DA 1U45A 5KFKA 5J0PA 4DO9A 9ICQA 4LZDA 4ECXA 4E80A 4X0AA 3RB6A 2HHPA 4IQTA 5HR9A 4YR0A 2BPFA 4ATBB 4Z6CA 1KFDA 5J0XA 4JV1A 4AT9B 4MF8A 3B0YA 1XC9A 5J2KA 3FDSA 3GIMA 1B43A 3LWMA 1X9SA 5HHHA 1ZYQA 4RPXA 3JPQA 2Y1IA 4F5NA 3TI0A 4WCWA 7ICFA 4G3IA 2HHXA 3NYBA 3K4GA 4YP3A 5KFSA 4RQ7A 2AGPA 4EP7A 4WBZA 4YD1A 4RT3A 5DB6A 1ZQOA 1ZQJA 4IRDA 4EBCA 4QZCA 4FBTA 2JEGA 1Y88A 4QW8A 3MGIA 4R8UB 2IBKA 8ICCA 4AT8A 3PR4A 3TAQA 4FH5A 2DRBA 3M9OB 1D8YA 3H3AA 2MUTB 2Q66A 9ICRA 3MR3A 2BCVA 5J0OA 1Q78A 9ICHA 3GV5B 2F1IA 1KTQA 1DGSA 3UPSA 3OHBA 1ZQEA 4GXJA 3H37A 2HHTA 5KFFA 3H39A 5J29A 3TFSA 3OUYB 4KLIA 5L1LA 1BPZA 3JPTA 4M6WB 1ZQVA 4RQ4A 3TAPA 2IHNA 4B9TA 4LT6A 3WFQE 1ZQXA 3KHLA 3PMLA 2UVVA 5J2IA 8ICAA 4PGXA 3G6XA 1ZQPA 5DEDA 1Z3EB 1TAUA 2ZH6A 4JUZA 2KFNA 3UXNA 4AT8B 4ELUA 5J2EA 4C8MA 4UB1A 1T3NA 4NKTA 1TVAA 2DR9A 3MBYA 4NLGA 4I2CA 4MFCA 2M9NA 3EYZA 3LDAA 1ZQWA 5D49A 3PX6A 2HW3A 1JAJA 1R8BA 4DQSA 4P4PA 4E7XA 5F2VO 2BGWA 1QSSA 2BKEA 5HHIA 3SV4A 2Y1JA 4EBEA 2P66A 4YQWA 4F5RA 2R8GA 4QZIA 3T5LA 3T5HA 4B9SA 4BGDA 4EBKA 3EPIA 8ICGA 2HHQA 3HIYA 3PW4A 5DBBA 2B21A 2NRVA 4IQUA 3V6HA 2ZTCA 3AU6A 5J2DA 2JEJA 4PHDA 2C2RA 4ZH4A 3AU2A 3ISCA 4DSFA 1NKEA 2FLNA 3PY8A 7ICSA 5HC9A 9ICAA 1MQ3A 1B22A 3H40A 4DL5A 4RQ8A 3HPOA 4UB5A 4DSJA 4KLMA 2Q0ZX 4UB3A 2M2WA 5IIJA 3ZDEA 4X5VA 3OVSA 4YD2A 2W8LA 4XUSA 4M2YA 3MR6A 3RBEA 5CB1A 4DFKA 9ICEA 9ICFA 8ICSA 4BWMA 2KZZA 1T8EA 3SI8A 9ICVA 4S3NA 4DSEA 2XY6A 2PI4A 4DL2A 1JIHA 4XQ7A 2NRZA 5HREA 1T4GA 7ICVA 2C2DA 1S77D 2DPJA 4QZFA 3HX0A 3OVAA 4TQSA 3C18A 5HMMA 5KFUA 2NRTA 2PI5A 4FHWA 5EWFA 3Q8RB 2KFZA 4M0AA 2ATLA 5DG8A 3H8WA 3UXOA 2ISOA 5KFZA 2KZ3A 3PX4A 5J2CA 5EOZA 2XY5A 1DK2A 2M2VA 3RJEA 4YFKA 4DQQA 4GC6A 7ICLA 2A1JB 3SYZA 3ZD9A 4F50A 4O3PA 4QWAA 3RJHA 4UB4A 3MDCA 2ZUBA 4ECQA 1WCLA 1VFGA 1DK3A 9ICJA 2AU0A 1L3TA 3C21A 4C8NA 3PW7A 5HNKA 1R8CA 4WBYA 2AQ4A 3MR2A 3ZDCA 1NK9A 4TUSA 9ICUA 4M9JA 5J2BA 4UBBA 3V7LA 5CWRA 4QZHA 1S76D 2MAXA 4Z6DA 2ALZA 2GWSA 4DSLA 2ZH8A 4QZEA 3C1ZA 3V6KA 2ZH5A 9ICTA 2ZH3A 1TAQA 1RPLA 3MFHA 3GFKB 3MR5A 4B9MA 4K4GA 1SZPA 7ICKA 5IIOA 4ED6A 4GLXA 4KLLA 4IQVA 5HRIA 3AQNA 4IG8A 1CEZA 4FHXA 5J0RA 3JPPA 4DF8A 1UT5A 1LV5A 2ASDA 3HJ1A 5DB9A 1NK0A 4UAZA 4O5EA 8ICIA 1V4AA 2ZJAA 3RH6A 1KFTA 4X4RA 5HRBA 3M8RA 4YN4A 4MF2A 3G6VA 2XGQA 3RR8A 2XCPA 1TKDA 1ZQQA 4YCXA 4PPXA 4Z6FA 4Q44A 3AQKA 2ZH2A 1NK6A 4M9LA 4O5KA 4ECSA 5IIMA 3TARA 5DLFA 4KLGA 3EPGA 3RBDA 1QTMA 2W9BB 3RRGA 7ICTA 1TV9A 3THVA 1WOTA 2BE3A 1MIVA 3Q8KA 4PHEA 3PV8A 2KP7A 1SKWA 5KTQA 2BPCA 5D46A 3ZDAA 4J9KA 2W9CB 4YXJA 4R8UA 4F5PA 1C7YA 4K4HA 3Q8SB 4X4VA 1JN3A 4NKUA 4ECVA 3LQCB 1RYSA 1JX4A 2O1PA 1U9LA 4X4UA 2RDJA 5KG7A 3OV7A 1QLNA 4I2HA 4RQ6A 1XWLA 2MUTA 3C2MA 4I29A 1PX5A 3KTQA 4YXMA 3H38A 2DR8A 1Z00A 3L9DA 4DFPA 4J9PA 7ICGA 3PO4A 1ZQYA 4PHAA 4F2RA 8ICMA 4YMOA 1MIWA 2ID1A 4WC7A 5HRKA 4RNNA 2ZJ8A 1ZQHA 1ZQAA 4DL3A 1SL2A 2JEIA 9ICNA 8ICXA 5DDYA 5KFEA 3Q8QB 2R8JA 4I2BA 4NM2A 4NLZA 4PH5A 9ICXA 4FHVA 4RWNA 4BXOB 2BCRA 5KFMA 3T3FA 3RB4A 1L5UA 5KFXA 5DDMA 4DOAA 5J0SA 1ZJNA 4F5QA 3AQLA 1MSWD 3OGUA 1N48A 4X4SA 4LZGA 4F5OA 3BJYA 3MABA 1LB2B 1ZQNA 4O9MA 1U47A 2ZHBA 2BCUA 3RAQA 4P4MA 1COOA 2P6UA 1ZETA 2I9GA 4RUAA 4Q43A 7ICUA 5DQHA 2I1QA 1ZQZA 5CR0A 3BQ2A 1BPBA 2JEFA 3MFIA 2W9AA 4IR9A 2AJQA 4X4OA 4QZDA 3WFRE 4QWBA 4M9NA 1H38A 4I27A 4JK1A 3V7KA 1NO5A 3JYYA 9ICBA 2R8IA 1X9WA 4BWJA 4MFAA 3GV8B 4R64A 4GXIA 4DOBA 4ECYA 3M8SA 3QEBZ 5KG3A 1TK5A 4F8RA 4JWMA 1KEJA 4RNOA 4B9NA 4DQPA 4I2AA 4R66A 1ZQRA 1SL1A 4RQ2A 1F5AA 1KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IM1 A;  1XSL A;  3ZDB A;  1BVS A;  4QZ8 A;  3H4B A;  5DEC A;  2LYH A;  7ICM A;  3GQC A;  4QZA A;  4DQI A;  5DKW A;  2NRK A;  3T5J A;  3AQM A;  2NRX A;  4YMM A;  4RT2 A;  8ICF A;  1SKR A;  3ORY A;  1JXL A;  8ICK A;  1BNO A;  5J2J A;  2FPL A;  5CA7 A;  2O5A A;  3M9N B;  7ICI A;  7ICP A;  5JUM A;  3QEA Z;  1S9F A;  3ISD A;  1WCN A;  5IIL A;  5KFT A;  1RYR A;  1V9P A;  4M04 A;  4ECT A;  2BCQ A;  1S0N A;  2ZUD A;  4YR2 A;  4J9M A;  3C5F A;  4F92 B;  1KRP A;  3QZ7 A;  5J0U A;  4F91 B;  2R8K A;  3RJK A;  1BPY A;  4DL4 A;  2BQ3 A;  1ZQG A;  8ICP A;  9ICL A;  5KFL A;  4I2I A;  1KSP A;  3WFP A;  1S10 A;  4ED8 A;  4X4P A;  5J0T A;  1ZJM A;  3V7J A;  4KLU A;  5DG7 A;  5HRH A;  4I2D A;  4QZG A;  4LVS A;  4WC4 A;  2W9M A;  4WC5 A;  1S0O A;  2JZB B;  4KN7 A;  2DRA A;  4DLG A;  5J2F A;  3JPN A;  1CUK A;  5IIN A;  1BPX A;  2BCS A;  4YG2 A;  2A1J A;  4O3N A;  4RPZ A;  4EBD A;  4KLJ A;  2F1J A;  5KG6 A;  8ICO A;  3ISB A;  3PVX A;  5KFC A;  3PW2 A;  1NK5 A;  4O3R A;  2C28 A;  4O3S A;  3K75 D;  5KFV A;  3FYH A;  7ICE A;  4QWD A;  3RJG A;  4F3O A;  4M9G A;  8ICW A;  4IRC A;  4DF4 A;  2ASL A;  4M47 A;  2BPG A;  5KFQ A;  9ICM A;  3GDX A;  2VA3 A;  4UAW A;  1NK8 A;  3GV7 B;  4ATB A;  2DR7 A;  2J6S A;  4GC7 A;  2VA8 A;  1TK0 A;  4KLQ A;  3B0X A;  2IA6 A;  4I2J A;  1ZQK A;  2W8K A;  2V9W A;  2KTQ A;  5HRL A;  2H5X A;  5L1K A;  3RH4 A;  1L3V A;  1FA0 A;  1ZQM A;  3PNC A;  4DLE A;  1T7P A;  4UD4 A;  1SKS A;  1IXR A;  4RWO A;  4PGQ A;  1XSP A;  3LK9 A;  2NRW A;  7ICJ A;  2P6R A;  4B9L A;  1TFW A;  4ELV A;  4ECZ A;  2FLP A;  4NLN A;  2FLL A;  4DS5 A;  5KG0 A;  1EXN A;  9ICC A;  4O3Q A;  4QWE A;  2AGO A;  1XS9 D;  1ZQI A;  4M9H A;  5HML A;  4FH3 A;  2XY7 A;  1ZQT A;  4P4O A;  4K4I A;  1JXE A;  9ICS A;  4Z6E A;  3BQ0 A;  3PMN A;  5J2H A;  2ZH7 A;  4EYI B;  4KLS A;  5HRF A;  4XRH A;  3V72 A;  4KMU A;  4MEY A;  5KFB A;  4TUP A;  4NXZ A;  5J0Q A;  5EWG A;  4R65 A;  3JPS A;  3SZ2 A;  4IRK A;  2F1H A;  1TFY A;  3C1Y A;  4RQ0 A;  1NJW A;  2KN7 A;  4RNM A;  1U4B A;  1KDH A;  5HRD A;  4FHY A;  5DGB A;  3E2E A;  2BHN A;  3C2K A;  3Q8P B;  2FMQ A;  1L3U A;  4MEX A;  5L1I A;  2XGP A;  1K1S A;  4QZ9 A;  5KFJ A;  4F93 B;  3ETL A;  1RZT A;  5KFG A;  1S0M A;  3MDA A;  2PFQ A;  4KLH A;  3KHH A;  5C5J A;  3PW5 A;  1XU4 A;  3RAX A;  5DB8 A;  3HP6 A;  2C2E A;  1MQ2 A;  1ZQB A;  3QE9 Y;  1XO1 A;  3RJJ A;  4J9R A;  4F2S A;  5HRG A;  4X4Q A;  2FMP A;  1D8L A;  1X2I A;  4RQ5 A;  4EBJ A;  4XQ8 A;  1OU5 A;  1BPE A;  1X9M A;  1ZQL A;  4O5C A;  4KLT A;  3EWA A;  1UEV A;  1ZQD A;  4TUQ A;  3PW0 A;  2ZHA A;  2JZB A;  4RUC A;  4FO6 A;  2BDP A;  1ZQS A;  4DWI A;  5KG1 A;  4WC3 A;  8ICB A;  4FS2 A;  3HJ4 A;  3C5G A;  4B9U A;  4B9V A;  3OUY A;  1XSN A;  3KHR A;  2BQU A;  9ICI A;  5KT5 A;  4YR3 A;  3LWL A;  4ED2 A;  3RRH A;  4WC2 A;  1BPD A;  1ZQU A;  5KFY A;  2HHS A;  4KTQ A;  3BDP A;  3H8J A;  4J9O A;  1JMS A;  3JPO A;  1N56 A;  2V4Q A;  5J0W A;  2J6T A;  4I2F A;  4DL6 A;  3OSN A;  4JV2 A;  1R8A A;  3WFS C;  1NK4 A;  5KFA A;  3C23 A;  5J0Y A;  3MGH A;  1A76 A;  1VJ7 A;  3G6Y A;  1NOM A;  4KN4 A;  8ICQ A;  1IM4 A;  5BOM A;  4AT9 A;  4TQR A;  4I2G A;  1RXW A;  3ZDD A;  4ELT A;  1R89 A;  4DSK A;  5KFW A;  3GII A;  7ICH A;  7ICN A;  1MC8 A;  4YMN A;  4F4W A;  3N4M B;  4DOC A;  4Q8E A;  4WC0 A;  4J9S A;  1D9F A;  4WC6 A;  2V4R A;  3PX0 A;  4Q45 A;  3EZ5 A;  3JZ0 A;  8ICZ A;  5KG5 A;  4PHP A;  3NGD A;  2IMW P;  5J2G A;  2ZTE A;  2M2T A;  4R63 A;  1ZQF A;  2HHV A;  1A77 A;  4AT7 B;  4RQ1 A;  3HT3 A;  2ASJ A;  4C8K A;  8ICJ A;  4KIT B;  5KFD A;  4UQG A;  2XCA A;  5KFI A;  5DGA A;  1ZQC A;  4DEZ A;  4UBC A;  5BOL A;  2OWO A;  4NY8 A;  2HHW A;  4ED1 A;  8ICV A;  3NTU A;  7ICQ A;  2ZJ5 A;  4TUR A;  4ECU A;  3RJF A;  4EZ9 A;  4X4N A;  2BR0 A;  4BDP A;  1S97 A;  7ICR A;  3GIJ A;  1D9D A;  5DLG A;  1Q79 A;  3V6J A;  5F9N A;  2DPI A;  9ICW A;  4KLE A;  3PO5 A;  4DS4 A;  3TAN A;  4ED0 A;  5KG4 A;  3Q8M A;  2ZUC A;  3PR5 B;  1NJY A;  2PFP A;  1NZP A;  3UPQ A;  4DL7 A;  8ICR A;  4QZB A;  1NJZ A;  5DQG A;  5CHG A;  5D4B A;  2UVU A;  2ZH9 A;  1ARO P;  2UVR A;  1UT8 A;  1NKC A;  2IHM A;  1NJX A;  4RQ3 A;  3Q8L A;  2PXI A;  4DFJ A;  1UA0 A;  3WFO A;  3SV3 A;  3ZD8 A;  4NM1 A;  2DR5 A;  1UEU A;  2FPK A;  4YVZ A;  5KFH A;  2XC9 A;  4ED3 A;  3JPR A;  1Z00 B;  2AQ0 A;  4O0I A;  2XO7 A;  1RXV A;  5J2A A;  3QZ8 A;  4QWC A;  1KFS A;  4KLO A;  1TFR A;  4RWQ A;  2DFL A;  3OSP A;  4E0D A;  2M2U A;  5KT3 A;  5DBC A;  1HJP A;  3GIL A;  4F4Y A;  4FS1 A;  2BQR A;  9ICK A;  2J6U A;  1YLQ A;  4KLF A;  2VAN A;  2AGQ A;  4FHP A;  5KT7 A;  1SL0 A;  4KLD A;  1TK8 A;  4RWP A;  4DQR A;  4NLK A;  1QSL A;  2W9C A;  4RPY A;  1HUO A;  8ICH A;  5DB7 A;  2RFF A;  3C2L A;  9ICP A;  4ECR A;  5IIK A;  4F4K A;  5F9L A;  9ICO A;  2ZH1 A;  5EWE A;  5HP4 A;  3TFR A;  4MFF A;  5L1J A;  1JQR A;  3RJI A;  3H8S A;  2ZTD A;  5DQI A;  1U48 A;  2W9B A;  5KG2 A;  4J9L A;  1NKB A;  7ICO A;  3IHQ B;  1UA1 A;  3RR7 A;  4C8O A;  2FPM A;  1QSY A;  4QW9 A;  4IQW A;  4E8F A;  1UET A;  5KFN A;  5TZV A;  3RB0 A;  4F4Z A;  4C8L A;  5DG9 A;  5CP2 A;  1NK7 A;  2KZM A;  1MIY A;  5L9X A;  5CJ7 A;  3EW9 A;  2HVH A;  3BQT A;  4IR1 A;  1HUZ A;  3H4D A;  3OHA A;  1K1Q A;  3KHG A;  4ECW A;  2C22 A;  9ICG A;  4RZR A;  2ZH4 A;  5KT4 A;  3AUO A;  1DOQ A;  4BXO A;  5KFO A;  4EYH B;  3T5K A;  2PFN A;  2VA2 A;  3OVB A;  3RB3 A;  4WC1 A;  4UAY A;  1L3S A;  4I28 A;  3H7I A;  4M6W A;  4RU9 A;  4J9N A;  1U49 A;  3N97 B;  2HVI A;  4O3O A;  4UD5 A;  4Q8F A;  4HYK A;  1BNP A;  4FBU A;  4I2E A;  8ICN A;  4CCH A;  2UVW A;  8ICY A;  2HHU A;  4X0B A;  4X4T A;  3C66 A;  2R8H A;  5KFR A;  8ICU A;  5KFP A;  4UB2 A;  4GXK A;  3TQ1 A;  3GIK A;  8ICL A;  2PFO A;  4F4X A;  4EEY A;  3UQ2 A;  4DFM A;  4JWN A;  8ICT A;  5DBA A;  1S0V A;  5III A;  3HWT A;  3M9M B;  2RDI A;  1BGX T;  4PGY A;  4JV0 A;  3UXP A;  1KNY A;  3OJS A;  3BQ1 A;  4P2H A;  3OJU A;  3HW8 A;  3UQ0 A;  8ICE A;  1PZN A;  4J9Q A;  4DSI A;  5KT2 A;  5BPC A;  2ISP A;  2PBE A;  3RH5 A;  5KT6 A;  2WTF A;  3RTV A;  2FMS A;  4AT7 A;  4EZ6 A;  2DVI A;  4XA5 A;  4ED7 A;  4M5D A;  1U45 A;  5KFK A;  5J0P A;  4DO9 A;  9ICQ A;  4LZD A;  4ECX A;  4E80 A;  4X0A A;  3RB6 A;  2HHP A;  4IQT A;  5HR9 A;  4YR0 A;  2BPF A;  4ATB B;  4Z6C A;  1KFD A;  5J0X A;  4JV1 A;  4AT9 B;  4MF8 A;  3B0Y A;  1XC9 A;  5J2K A;  3FDS A;  3GIM A;  1B43 A;  3LWM A;  1X9S A;  5HHH A;  1ZYQ A;  4RPX A;  3JPQ A;  2Y1I A;  4F5N A;  3TI0 A;  4WCW A;  7ICF A;  4G3I A;  2HHX A;  3NYB A;  3K4G A;  4YP3 A;  5KFS A;  4RQ7 A;  2AGP A;  4EP7 A;  4WBZ A;  4YD1 A;  4RT3 A;  5DB6 A;  1ZQO A;  1ZQJ A;  4IRD A;  4EBC A;  4QZC A;  4FBT A;  2JEG A;  1Y88 A;  4QW8 A;  3MGI A;  4R8U B;  2IBK A;  8ICC A;  4AT8 A;  3PR4 A;  3TAQ A;  4FH5 A;  2DRB A;  3M9O B;  1D8Y A;  3H3A A;  2MUT B;  2Q66 A;  9ICR A;  3MR3 A;  2BCV A;  5J0O A;  1Q78 A;  9ICH A;  3GV5 B;  2F1I A;  1KTQ A;  1DGS A;  3UPS A;  3OHB A;  1ZQE A;  4GXJ A;  3H37 A;  2HHT A;  5KFF A;  3H39 A;  5J29 A;  3TFS A;  3OUY B;  4KLI A;  5L1L A;  1BPZ A;  3JPT A;  4M6W B;  1ZQV A;  4RQ4 A;  3TAP A;  2IHN A;  4B9T A;  4LT6 A;  3WFQ E;  1ZQX A;  3KHL A;  3PML A;  2UVV A;  5J2I A;  8ICA A;  4PGX A;  3G6X A;  1ZQP A;  5DED A;  1Z3E B;  1TAU A;  2ZH6 A;  4JUZ A;  2KFN A;  3UXN A;  4AT8 B;  4ELU A;  5J2E A;  4C8M A;  4UB1 A;  1T3N A;  4NKT A;  1TVA A;  2DR9 A;  3MBY A;  4NLG A;  4I2C A;  4MFC A;  2M9N A;  3EYZ A;  3LDA A;  1ZQW A;  5D49 A;  3PX6 A;  2HW3 A;  1JAJ A;  1R8B A;  4DQS A;  4P4P A;  4E7X A;  5F2V O;  2BGW A;  1QSS A;  2BKE A;  5HHI A;  3SV4 A;  2Y1J A;  4EBE A;  2P66 A;  4YQW A;  4F5R A;  2R8G A;  4QZI A;  3T5L A;  3T5H A;  4B9S A;  4BGD A;  4EBK A;  3EPI A;  8ICG A;  2HHQ A;  3HIY A;  3PW4 A;  5DBB A;  2B21 A;  2NRV A;  4IQU A;  3V6H A;  2ZTC A;  3AU6 A;  5J2D A;  2JEJ A;  4PHD A;  2C2R A;  4ZH4 A;  3AU2 A;  3ISC A;  4DSF A;  1NKE A;  2FLN A;  3PY8 A;  7ICS A;  5HC9 A;  9ICA A;  1MQ3 A;  1B22 A;  3H40 A;  4DL5 A;  4RQ8 A;  3HPO A;  4UB5 A;  4DSJ A;  4KLM A;  2Q0Z X;  4UB3 A;  2M2W A;  5IIJ A;  3ZDE A;  4X5V A;  3OVS A;  4YD2 A;  2W8L A;  4XUS A;  4M2Y A;  3MR6 A;  3RBE A;  5CB1 A;  4DFK A;  9ICE A;  9ICF A;  8ICS A;  4BWM A;  2KZZ A;  1T8E A;  3SI8 A;  9ICV A;  4S3N A;  4DSE A;  2XY6 A;  2PI4 A;  4DL2 A;  1JIH A;  4XQ7 A;  2NRZ A;  5HRE A;  1T4G A;  7ICV A;  2C2D A;  1S77 D;  2DPJ A;  4QZF A;  3HX0 A;  3OVA A;  4TQS A;  3C18 A;  5HMM A;  5KFU A;  2NRT A;  2PI5 A;  4FHW A;  5EWF A;  3Q8R B;  2KFZ A;  4M0A A;  2ATL A;  5DG8 A;  3H8W A;  3UXO A;  2ISO A;  5KFZ A;  2KZ3 A;  3PX4 A;  5J2C A;  5EOZ A;  2XY5 A;  1DK2 A;  2M2V A;  3RJE A;  4YFK A;  4DQQ A;  4GC6 A;  7ICL A;  2A1J B;  3SYZ A;  3ZD9 A;  4F50 A;  4O3P A;  4QWA A;  3RJH A;  4UB4 A;  3MDC A;  2ZUB A;  4ECQ A;  1WCL A;  1VFG A;  1DK3 A;  9ICJ A;  2AU0 A;  1L3T A;  3C21 A;  4C8N A;  3PW7 A;  5HNK A;  1R8C A;  4WBY A;  2AQ4 A;  3MR2 A;  3ZDC A;  1NK9 A;  4TUS A;  9ICU A;  4M9J A;  5J2B A;  4UBB A;  3V7L A;  5CWR A;  4QZH A;  1S76 D;  2MAX A;  4Z6D A;  2ALZ A;  2GWS A;  4DSL A;  2ZH8 A;  4QZE A;  3C1Z A;  3V6K A;  2ZH5 A;  9ICT A;  2ZH3 A;  1TAQ A;  1RPL A;  3MFH A;  3GFK B;  3MR5 A;  4B9M A;  4K4G A;  1SZP A;  7ICK A;  5IIO A;  4ED6 A;  4GLX A;  4KLL A;  4IQV A;  5HRI A;  3AQN A;  4IG8 A;  1CEZ A;  4FHX A;  5J0R A;  3JPP A;  4DF8 A;  1UT5 A;  1LV5 A;  2ASD A;  3HJ1 A;  5DB9 A;  1NK0 A;  4UAZ A;  4O5E A;  8ICI A;  1V4A A;  2ZJA A;  3RH6 A;  1KFT A;  4X4R A;  5HRB A;  3M8R A;  4YN4 A;  4MF2 A;  3G6V A;  2XGQ A;  3RR8 A;  2XCP A;  1TKD A;  1ZQQ A;  4YCX A;  4PPX A;  4Z6F A;  4Q44 A;  3AQK A;  2ZH2 A;  1NK6 A;  4M9L A;  4O5K A;  4ECS A;  5IIM A;  3TAR A;  5DLF A;  4KLG A;  3EPG A;  3RBD A;  1QTM A;  2W9B B;  3RRG A;  7ICT A;  1TV9 A;  3THV A;  1WOT A;  2BE3 A;  1MIV A;  3Q8K A;  4PHE A;  3PV8 A;  2KP7 A;  1SKW A;  5KTQ A;  2BPC A;  5D46 A;  3ZDA A;  4J9K A;  2W9C B;  4YXJ A;  4R8U A;  4F5P A;  1C7Y A;  4K4H A;  3Q8S B;  4X4V A;  1JN3 A;  4NKU A;  4ECV A;  3LQC B;  1RYS A;  1JX4 A;  2O1P A;  1U9L A;  4X4U A;  2RDJ A;  5KG7 A;  3OV7 A;  1QLN A;  4I2H A;  4RQ6 A;  1XWL A;  2MUT A;  3C2M A;  4I29 A;  1PX5 A;  3KTQ A;  4YXM A;  3H38 A;  2DR8 A;  1Z00 A;  3L9D A;  4DFP A;  4J9P A;  7ICG A;  3PO4 A;  1ZQY A;  4PHA A;  4F2R A;  8ICM A;  4YMO A;  1MIW A;  2ID1 A;  4WC7 A;  5HRK A;  4RNN A;  2ZJ8 A;  1ZQH A;  1ZQA A;  4DL3 A;  1SL2 A;  2JEI A;  9ICN A;  8ICX A;  5DDY A;  5KFE A;  3Q8Q B;  2R8J A;  4I2B A;  4NM2 A;  4NLZ A;  4PH5 A;  9ICX A;  4FHV A;  4RWN A;  4BXO B;  2BCR A;  5KFM A;  3T3F A;  3RB4 A;  1L5U A;  5KFX A;  5DDM A;  4DOA A;  5J0S A;  1ZJN A;  4F5Q A;  3AQL A;  1MSW D;  3OGU A;  1N48 A;  4X4S A;  4LZG A;  4F5O A;  3BJY A;  3MAB A;  1LB2 B;  1ZQN A;  4O9M A;  1U47 A;  2ZHB A;  2BCU A;  3RAQ A;  4P4M A;  1COO A;  2P6U A;  1ZET A;  2I9G A;  4RUA A;  4Q43 A;  7ICU A;  5DQH A;  2I1Q A;  1ZQZ A;  5CR0 A;  3BQ2 A;  1BPB A;  2JEF A;  3MFI A;  2W9A A;  4IR9 A;  2AJQ A;  4X4O A;  4QZD A;  3WFR E;  4QWB A;  4M9N A;  1H38 A;  4I27 A;  4JK1 A;  3V7K A;  1NO5 A;  3JYY A;  9ICB A;  2R8I A;  1X9W A;  4BWJ A;  4MFA A;  3GV8 B;  4R64 A;  4GXI A;  4DOB A;  4ECY A;  3M8S A;  3QEB Z;  5KG3 A;  1TK5 A;  4F8R A;  4JWM A;  1KEJ A;  4RNO A;  4B9N A;  4DQP A;  4I2A A;  4R66 A;  1ZQR A;  1SL1 A;  4RQ2 A;  1F5A A;  1KLN A; 
#chains in the Genus database with same CATH topology
 3ZDB A;  3H4B A;  4QZ8 A;  3GQC A;  1VLB A;  3NVY A;  5DKW A;  3OPX A;  2F44 A;  8ICF A;  1JXL A;  1IG6 A;  2O5A A;  3M9N B;  7ICI A;  2MRL A;  7ICP A;  4OJL A;  3QEA Z;  3RFA A;  2EWR A;  1JI7 A;  1WCN A;  4GIB A;  4NXV A;  3TAD A;  4K9A A;  3E0F A;  4ECT A;  2O6K A;  1S0N A;  2R8K A;  3QZ7 A;  4UD5 A;  2MSN A;  4DL4 A;  4ED8 A;  1QH9 A;  5EE0 A;  3HRD D;  4KLU A;  4I2D A;  2EZY A;  5IIN A;  3JPN A;  8ICI A;  4WQK A;  5F3X B;  4NJ8 A;  2F1J A;  5KG6 A;  3LVV A;  3IN5 A;  3PVX A;  4O3R A;  3K75 D;  1PVQ A;  2ZIV B;  4IRC A;  1FFV A;  4DF4 A;  4M47 A;  2VA3 A;  1NK8 A;  1TK0 A;  2IA6 A;  1ZQK A;  2W8K A;  2KTQ A;  3AQF A;  2H5X A;  5L1K A;  4OCZ A;  1ZQM A;  2OCE A;  4RWO A;  1XSP A;  5ALL A;  7ICJ A;  4B9L A;  4ELV A;  2YB1 A;  2FLP A;  5AIA A;  4UAU A;  4O3Q A;  2F2A B;  2AGO A;  3ED5 A;  4FH3 A;  1JXE A;  4Z6E A;  5J2H A;  5HRF A;  3QU2 A;  4OAH A;  1X40 A;  4NXZ A;  4IRK A;  1TFY A;  1NJW A;  2KN7 A;  4RNM A;  4FHY A;  5HRD A;  4B6J A;  5KFJ A;  1S0M A;  4EEN A;  3N28 A;  4Y2R A;  4UB6 U;  3KHH A;  3UPS A;  1XU4 A;  5DB8 A;  4LJX A;  1XO1 A;  5ALH A;  4JB3 A;  4XQ8 A;  1X9M A;  1ZQL A;  1ZQD A;  5KG1 A;  4WC3 A;  3NKU A;  3MCR A;  3HJ4 A;  2YX8 A;  5AI0 A;  3OUY A;  3KHR A;  5KT5 A;  4YR3 A;  3RRH A;  4WC2 A;  1PUZ A;  5AK6 A;  2KSO B;  2KIC A;  2YY6 A;  3KBB A;  4I2F A;  2V4Q A;  3K1R B;  3WFS C;  5KFA A;  5J0Y A;  3MGH A;  4CDG A;  4NLB A;  4XJE A;  4KN4 A;  4AT9 A;  5BOM A;  2OM6 A;  3ZDD A;  2F3N A;  1MC8 A;  4WC6 A;  4C4T A;  5KG5 A;  2QAR A;  2HHV A;  1A77 A;  4RQ1 A;  8ICJ A;  4KIT B;  5KFD A;  2XCA A;  5AK4 A;  5HR9 A;  2KJ8 A;  4ED1 A;  7ICQ A;  2LMR A;  2XI9 A;  4EZ9 A;  3CK6 A;  4NL9 A;  5F9N A;  4JMU A;  2K8A A;  3PO5 A;  4DS4 A;  5KG4 A;  3DDH A;  3LYS A;  3PZP A;  3UPQ A;  4U7C A;  4QZB A;  2UVU A;  5CHG A;  5D4B A;  2KVC A;  4G9B A;  3WK9 A;  1NKC A;  4RQ3 A;  2PXI A;  4AYB C;  3SV3 A;  4YVZ A;  4ED3 A;  3F53 A;  1Z00 B;  4KLO A;  4O0I A;  2XO7 A;  4QWC A;  4HAI A;  1TFR A;  4RWQ A;  3ICX A;  2M2U A;  4FS1 A;  4EGW A;  4EED A;  3CP8 A;  1QSL A;  4RPY A;  1DXS A;  8ICH A;  2K8B B;  4F4K A;  4CF3 A;  9ICO A;  5EWE A;  3TFR A;  3RJI A;  5D62 A;  4J9L A;  4C8O A;  4QW9 A;  3WU2 U;  2OEH A;  5KL8 B;  3U26 A;  1UET A;  5KFN A;  5AM2 A;  1NK7 A;  5L9X A;  1RM6 C;  3HIL A;  5CJ7 A;  2WF6 A;  3H4D A;  1K1Q A;  9ICG A;  4BXO A;  4C7Y A;  2VA2 A;  3OVB A;  2ZH5 A;  2W3R A;  3RF9 A;  2KMD A;  3M6K A;  4M6W A;  3SMV A;  1ZXI A;  4HYK A;  5G5H A;  1L7O A;  2UVW A;  2LKY A;  1XO0 A;  3C66 A;  2R8H A;  5EE3 A;  3QU7 A;  4UB2 A;  1HIW A;  3IP4 B;  4EEY A;  4PGY A;  5ALM A;  4JV0 A;  5KAF U;  5AK5 A;  3HW8 A;  4JLZ A;  2ZIX A;  3IG5 A;  5BPC A;  2ISP A;  5KT6 A;  2WTF A;  2WFA A;  5JU5 A;  1WUD A;  4XA5 A;  4M5D A;  5J0P A;  4E80 A;  4LZD A;  4ECX A;  3NVZ A;  2AH5 A;  4NV0 A;  2LYA A;  3B0Y A;  1XC9 A;  5J2K A;  3GIM A;  3LWM A;  3NWI A;  3TI0 A;  7ICF A;  2DKX A;  1PK1 A;  4LEZ A;  4EP7 A;  4RQ7 A;  2AGP A;  4WBZ A;  4YD1 A;  5DB6 A;  1JRO A;  3MGI A;  2NO4 A;  1Z1B A;  4FH5 A;  3M9O B;  3H3A A;  5L1M A;  1Q78 A;  3MR3 A;  2JMG A;  3GV5 B;  4GXJ A;  2KV2 A;  2KHV A;  3H39 A;  3QNM A;  3TAP A;  4LT6 A;  1IV8 A;  1ZQP A;  5DED A;  2GAF D;  2FE9 A;  2ZH6 A;  3UXN A;  5KNI A;  4ELU A;  3D2N A;  4UB1 A;  5AM1 A;  4NLG A;  4I2C A;  2M9N A;  1R8B A;  4P4P A;  2BGW A;  1QSS A;  5HHI A;  2Y1J A;  2P66 A;  5AKL A;  1SIJ A;  4YQW A;  3T5L A;  4B9S A;  4EBK A;  4EV6 A;  4IL6 U;  3PW4 A;  2B21 A;  4IQU A;  2JEJ A;  5J2D A;  5HC9 A;  2FLN A;  3IV6 A;  5B66 U;  5ALP A;  1B22 A;  4RQ8 A;  4P0Q B;  4UAR A;  5B3P A;  2Q0Z X;  3ZI4 A;  5IIJ A;  5ALF A;  5JTG A;  2R18 A;  2W8L A;  4M2Y A;  9ICE A;  2KZZ A;  3M1Y A;  1AQ6 A;  2K89 A;  4K99 A;  4XQ7 A;  1T4G A;  2LI6 A;  4QZF A;  3WK5 A;  4CE6 A;  4Y2Q A;  4TQS A;  3C18 A;  4I0U A;  2PI5 A;  2E8M A;  2ZG6 A;  3Q8R B;  2KFZ A;  2ATL A;  3R9K A;  2E8P A;  1DK2 A;  3PX4 A;  2DWQ A;  2ES6 A;  4PJ0 U;  1SV0 C;  3RJH A;  2WHE A;  2ZUB A;  4ECQ A;  5E79 U;  5CHE A;  3QU5 A;  3PW7 A;  1R8C A;  9ICU A;  5J2B A;  3ERC C;  1S76 D;  4DSL A;  2ZH8 A;  2JXJ A;  1ZRM A;  9ICT A;  3MFH A;  4UB8 U;  3MR5 A;  5IIO A;  5KAI U;  4FHX A;  2KIW A;  4K9B A;  4UAZ A;  3RH6 A;  5AHX A;  3D2S A;  4YN4 A;  4MF2 A;  2XGQ A;  4Z6F A;  5IIM A;  5B3Q A;  3TAR A;  1QTM A;  7ICT A;  2VJ5 A;  1X6I A;  3THV A;  1YT3 A;  3IDW A;  5D46 A;  3QYP A;  4J9K A;  4YXJ A;  4K4H A;  1F44 A;  2GOL A;  3LQC B;  1RYS A;  2OHF A;  2W7P A;  1VDV A;  4WH5 A;  4Y2P A;  5AKH A;  5KG7 A;  1QLN A;  1L7P A;  3H38 A;  2F77 X;  4YXM A;  1Z00 A;  4AYB F;  4K8V A;  4J9P A;  3PO4 A;  5JTI A;  8ICM A;  1MIW A;  1V97 A;  2ZJ8 A;  1QCK A;  5D63 A;  4PH5 A;  2E8O A;  5KFM A;  3T3F A;  1ZJN A;  4LZG A;  3MAB A;  3WK6 A;  4O9M A;  1U47 A;  4P4M A;  2YMM A;  4Q43 A;  2LPE A;  2I1Q A;  1ZQZ A;  5CR0 A;  2JEF A;  4QZD A;  3V7K A;  2YMQ A;  1C20 A;  4BWJ A;  3GV8 B;  1TK5 A;  4GXI A;  4E8F A;  1KEJ A;  4RNO A;  3C28 A;  2GO7 A;  4R66 A;  3A0B U;  1KLN A;  2ZXI A;  4FZL A;  1O03 A;  3T5J A;  3SAG A;  1PVP A;  4RT2 A;  5AM5 A;  3ORY A;  3S6J A;  5CA7 A;  3BS5 A;  2BDU A;  5IIL A;  5KFT A;  1RYR A;  5AIB A;  2BCQ A;  2KVS A;  2ZUD A;  1F5S A;  8ICP A;  1KNY A;  4DFD A;  1V38 A;  5J0T A;  1ZJM A;  5DG7 A;  2EAM A;  4LVS A;  2DRA A;  1S0O A;  4KN7 A;  4DLG A;  7ICM A;  2BCS A;  4EBD A;  2A1J A;  5ALU A;  4O3N A;  4KLJ A;  4NXW A;  4CRX A;  1S5L U;  5KFC A;  3PW2 A;  2W11 A;  3NRZ A;  2C28 A;  4O3S A;  3BZK A;  3FYH A;  3AL0 B;  8ICW A;  2LM1 A;  4KMO B;  2J6S A;  1ZRN A;  4GC7 A;  2VA8 A;  3M6Z A;  4I2J A;  1Q3V A;  5HRL A;  3L3F X;  3RH4 A;  3PNC A;  3T79 A;  4DLE A;  1SKS A;  2KJ9 A;  3SEI A;  4PGQ A;  3ER8 C;  3LK9 A;  2NRW A;  2WF7 A;  2P6R A;  2EZX A;  1TFW A;  4NLN A;  4Y2T A;  4OAG A;  2FLL A;  5CFS A;  4DS5 A;  5KG0 A;  9ICC A;  2HBJ A;  3NS1 A;  3SQI A;  5ALI A;  3BQ0 A;  4CF4 A;  2ZH7 A;  4KLS A;  5AI4 A;  4XRH A;  3F2C A;  4KMU A;  1WYG A;  4MEY A;  5ALD A;  5EWG A;  3SZ2 A;  4F72 A;  1U4B A;  3BZC A;  5DGB A;  2BBH A;  3D6J A;  3E2E A;  2PMZ C;  2FMQ A;  4BX9 C;  2WB1 C;  1ZD2 P;  2IOF A;  3MDA A;  4F2S A;  4J9R A;  5HRG A;  1D8L A;  4RQ5 A;  2F76 X;  1OU5 A;  1BPE A;  4O5C A;  2BBJ A;  1UQV A;  5J8Y A;  2KNJ A;  3C5G A;  1XSN A;  3PHZ A;  3LWL A;  2H3Z A;  1BPD A;  3DV9 A;  1ZQU A;  2W43 A;  3BDP A;  4KTQ A;  3H8J A;  3JPO A;  1N56 A;  1R8A A;  5J0W A;  4DL6 A;  3OSN A;  1XNS A;  1NK4 A;  1PK1 B;  1A76 A;  1VJ7 A;  1NOM A;  2HDO A;  1L7N A;  8ICQ A;  3L4P A;  2QB1 A;  1RXW A;  4ELT A;  5AKG A;  7ICN A;  4F4W A;  4DOC A;  2JH1 A;  1D9F A;  4QNL A;  4Y2U A;  4Q45 A;  3EZ5 A;  4PHP A;  2DL0 A;  2ZTE A;  1UHU A;  1ZQF A;  1ED1 A;  1WG8 A;  2B0C A;  3HT3 A;  3AQN A;  2OWO A;  4UBC A;  2K60 A;  4NY8 A;  2YQE A;  3NTU A;  2ZJ5 A;  4TUR A;  2KD1 A;  1S97 A;  2YTU A;  1UPH A;  1Q79 A;  4ED0 A;  3PR5 B;  3KKA C;  2FDR A;  4US8 A;  2VKQ A;  4C0Z A;  1LVH A;  2IHM A;  3Q8L A;  3QX7 A;  4HX0 A;  1CI4 A;  4NM1 A;  2DR5 A;  2XC9 A;  5J8Y C;  2FMP A;  2LBO A;  1KFS A;  1KQQ A;  3AQE A;  1ZD5 A;  5KT3 A;  4F4Y A;  2J6U A;  4KLF A;  2YML A;  2AGQ A;  2Y9T A;  4KLD A;  2W9C A;  3C2L A;  9ICP A;  4ECR A;  4MKP A;  1ZOL A;  2AXT U;  5IIK A;  1JQR A;  5HP4 A;  4MFF A;  2NO5 A;  2ZIU B;  5ALT A;  5L1J A;  5DQI A;  1U48 A;  1UA1 A;  3TAD C;  4F4Z A;  4C8L A;  1J97 A;  2HVH A;  3BQT A;  2NYV A;  1KW4 A;  1P7D A;  2ZH4 A;  5KFO A;  4EEL A;  4WC1 A;  4UAY A;  4J9N A;  1U49 A;  1BNP A;  5ALJ A;  2HN1 A;  4X0B A;  4X4T A;  3WKA A;  2OXO A;  4GXK A;  3ER9 B;  8ICL A;  2PFO A;  4JWN A;  8ICT A;  3FM9 A;  1S0V A;  5III A;  1BGX T;  2PBE A;  1L7M A;  4EZ6 A;  2DVI A;  2E8N A;  2KK0 A;  3RB6 A;  4YR0 A;  4JV1 A;  4MF8 A;  3SAH A;  3FDS A;  1X9S A;  1ZYQ A;  4RPX A;  4F5N A;  4US9 A;  2HHX A;  3NYB A;  1ZQJ A;  4IRD A;  1HEK A;  4QZC A;  2DRB A;  3PR4 A;  4FE3 A;  4EX7 A;  2DUY A;  4Y2V A;  1N5X A;  5EE1 A;  5H2F U;  9ICH A;  2HOF A;  2HHT A;  3TFS A;  5CFT A;  4KLI A;  1JAL A;  2B6G A;  2HCF A;  2KJ5 A;  3PML A;  3QUT A;  2UVV A;  8ICA A;  1ECW A;  4DCC A;  2VIX A;  2KFN A;  3D2Q A;  2XID A;  1JUD A;  3LDA A;  1PVR A;  1OW5 A;  3SV4 A;  4EBE A;  4QZI A;  3T5H A;  3V6H A;  3AU6 A;  2ZTC A;  3AU2 A;  2G07 A;  1MQ3 A;  4DSJ A;  4X5V A;  3OVS A;  2W54 A;  3NVO A;  1NI3 A;  4XUS A;  3MR6 A;  4DFK A;  1T8E A;  5HR6 A;  4DSE A;  1JIH A;  2NRZ A;  7ICV A;  3ONN A;  2DPJ A;  1SXE A;  5KFU A;  4FHW A;  4O6A A;  5AKE A;  2H3F A;  3PSI A;  4M0A A;  3EUB 2;  2K4H A;  5ALG A;  5DG8 A;  3H8W A;  3UXO A;  2XY5 A;  2M2V A;  1Q8K A;  2A1J B;  4F50 A;  5AI9 A;  4QWA A;  4EEK A;  1L3T A;  3BS7 A;  1N60 A;  5ALX A;  4WBY A;  5KL1 B;  3MR2 A;  3ZDC A;  3F5A A;  4TUS A;  4UBB A;  4QZH A;  3C29 A;  2ZH3 A;  1RPL A;  3GFK B;  4WQL A;  4K4G A;  3BS5 B;  1DGJ A;  1SZP A;  2CPR A;  4KLL A;  3SR6 A;  4IG8 A;  4KX3 A;  3HJ1 A;  1NK0 A;  1RQN A;  1V4A A;  1T3Q A;  3QUB A;  3G6V A;  3RR8 A;  1ZQQ A;  1SXD A;  3AQK A;  4YCX A;  3QU9 A;  3B9J A;  4ECS A;  3WK7 A;  3EPG A;  1VJ5 A;  3RRG A;  2BE3 A;  3PV8 A;  2JV3 A;  4USA A;  4QJF B;  2HBL A;  4F5P A;  1C7Y A;  2G06 A;  4NXT A;  2O1P A;  1U9L A;  2AHO B;  4I2H A;  4RQ6 A;  1PX5 A;  1L8L A;  3UMG A;  2DR8 A;  1TE2 A;  7ICG A;  1URJ A;  1ZQY A;  3F2D A;  2ID1 A;  2PMZ F;  2K4P A;  2R8J A;  9ICX A;  4FHV A;  4RWN A;  4PL1 A;  3RB4 A;  1L5U A;  5DDM A;  5J0S A;  1N48 A;  4F5O A;  1S8O A;  1LB2 B;  3KZI U;  3GU3 A;  2RP5 A;  2ZHB A;  3RAQ A;  1COO A;  1ZET A;  3LVW A;  2KSO A;  2E1F A;  1OUQ A;  5DQH A;  5AKZ A;  2W9A A;  4IR9 A;  2AJQ A;  5HR7 A;  4X4O A;  1N2X A;  4M9N A;  9ICB A;  2R8I A;  4CGZ A;  4R64 A;  9ICW A;  5AM4 A;  4F8R A;  4JWM A;  4B9N A;  2WF5 A;  2HHQ A;  1BVS A;  5DEC A;  2YN4 A;  4QIW F;  1FEZ A;  4O68 A;  2NRX A;  4YMM A;  1SKR A;  8ICK A;  2W3S A;  1S9F A;  1V9P A;  4J9M A;  4YR2 A;  3C5F A;  3RJK A;  9ICL A;  5ALN A;  2HOQ A;  3E58 A;  1BPY A;  1ZQG A;  4I2I A;  1KSP A;  1S10 A;  3AM9 A;  4X4P A;  5AI6 A;  1A6S A;  3V7J A;  5HRH A;  2GH1 A;  4QZG A;  2W9M A;  2JZB B;  4EX6 A;  1BPX A;  4RPZ A;  2M0N A;  4ZOH C;  3F2B A;  2GLE A;  4OD0 A;  1NK5 A;  1D8B A;  5KFV A;  4PZN A;  7ICE A;  3RJG A;  4F3O A;  4PL2 A;  5KFQ A;  3GDX A;  4ATB A;  3GV7 B;  5GTH U;  3MGV A;  3AMZ A;  1FA0 A;  4UD4 A;  3HKZ C;  2KE7 A;  1NNL A;  4QWE A;  4P0P B;  1XS9 D;  1ZQI A;  4CF5 A;  5AM3 A;  4P4O A;  9ICS A;  5J0Q A;  4OJ5 A;  3JPS A;  2F1H A;  3CRX A;  4RQ0 A;  1KDH A;  3Q8P B;  3A0H U;  1L3U A;  4MEX A;  1V85 A;  1N62 A;  2XIC A;  4F93 B;  1K5O A;  4KLH A;  3RAX A;  3PW5 A;  1LKY A;  1MQ2 A;  1KRP A;  9ICQ A;  2WAQ C;  1X2I A;  4EBJ A;  4KLT A;  2JZB A;  2BDP A;  1ZQS A;  4DWI A;  3TAC B;  1GO3 F;  1J2M A;  2FJ6 A;  4B9U A;  1SWV A;  2E3T A;  4KM5 A;  2BQU A;  9ICI A;  2L5Y A;  2HHS A;  1JMS A;  1B0X A;  2J6T A;  4JV2 A;  1RYU A;  5FP0 A;  3I28 A;  1IM4 A;  4TQR A;  3N7P D;  1R89 A;  2HBK A;  4DSK A;  1L8O A;  3WKC A;  3N4M B;  3EF2 A;  4Q8E A;  2JHD A;  2V4R A;  3PX0 A;  2ZIW A;  8ICZ A;  3NGD A;  2IMW P;  1N61 A;  4R63 A;  4C8K A;  4UQG A;  5DGA A;  4X4Q A;  4DEZ A;  2HHW A;  3RJF A;  2BR0 A;  4BDP A;  5ALE A;  2ZIW B;  5DLG A;  3V6J A;  2DPI A;  3QUQ A;  3Q8M A;  2ZUC A;  2PFP A;  2DF4 B;  1NJY A;  1RG6 A;  4DL7 A;  3AN1 A;  1NJZ A;  5DQG A;  4NXX A;  2UVR A;  4DFJ A;  1UA0 A;  3ZD8 A;  5KFH A;  3UMC A;  5J2A A;  3QZ8 A;  2DKZ A;  2DFL A;  3OSP A;  4LEW A;  4X4N A;  5DBC A;  1HJP A;  2BQR A;  2VAN A;  3IG8 A;  1SL0 A;  4RWP A;  5ALQ A;  4GFJ A;  2RLT A;  4IS7 A;  1HUO A;  5DB7 A;  3WKB A;  2CXY A;  2ZH1 A;  1X6J A;  2ZTD A;  4EEB A;  1TAM A;  2W9B A;  5KG2 A;  7ICO A;  2FPM A;  2Y0S F;  4FZN A;  2EQY A;  4FZM A;  4WJ3 B;  5TZV A;  3RB0 A;  4BUG A;  5DG9 A;  5CP2 A;  2KZM A;  4MHV A;  4IR1 A;  2C22 A;  2H3Q A;  2Y0S C;  4RZR A;  3AUO A;  1DOQ A;  5ALZ A;  4EYH B;  3RB3 A;  1L3S A;  4I28 A;  3H7I A;  3FC4 A;  4FBU A;  8ICN A;  2KKP A;  1Z4N A;  5KFR A;  3SD7 A;  8ICU A;  3H0L B;  4F4X A;  2HMX A;  5DBA A;  2W7O A;  2G5I B;  3HWT A;  4NLC A;  3UXP A;  3NAS A;  3BQ1 A;  3UQ0 A;  1Z19 A;  8ICE A;  4J9Q A;  4DSI A;  5KT2 A;  3RH5 A;  3RTV A;  4AT7 A;  5KFK A;  4DO9 A;  3SAF A;  2I5H A;  1DRG A;  1L6N A;  4IQT A;  2BPF A;  1UCV A;  3JCF A;  4ATB B;  4Z6C A;  4AT9 B;  4F71 A;  3N7S C;  5HHH A;  2Y1I A;  3K4G A;  2EZZ A;  2VJ4 A;  2IHO A;  4RT3 A;  1QQ5 A;  4EBC A;  3NRW A;  4FBT A;  2JEG A;  2IBK A;  5CFU A;  8ICC A;  4R8U B;  2DGZ A;  2MUT B;  2Q66 A;  2PKE A;  2P35 A;  9ICR A;  2BCV A;  4K96 A;  1A0P A;  2F1I A;  1KTQ A;  1DGS A;  1OXJ A;  1YZ7 A;  1ZQE A;  5KFF A;  3OUY B;  1BPZ A;  1ZQ1 C;  3WKD A;  3JPT A;  4ACO A;  5AKX A;  4M6W B;  2IHN A;  3WFQ E;  4B9T A;  1ZQX A;  3KHL A;  5J2I A;  4PGX A;  3KZX A;  3G6X A;  2RHF A;  1TAU A;  4JUZ A;  4AT8 B;  5J2E A;  4C8M A;  1T3N A;  4NKT A;  4MFC A;  3EYZ A;  1SZH A;  3PX6 A;  2HW3 A;  4E7X A;  8ICG A;  2YMP A;  3HIY A;  4P2H A;  4NWI A;  4PHD A;  1NKE A;  4ZH4 A;  3PY8 A;  5AK3 A;  9ICA A;  3ETR A;  3HPO A;  2W03 A;  4KLM A;  3H0R B;  1IIP A;  1LKY B;  4UB3 A;  3ZDE A;  4YD2 A;  2OH2 A;  5AM0 A;  3H0M B;  3FAH A;  8ICS A;  2LM4 A;  4RQN A;  4BWM A;  3SI8 A;  4S3N A;  2XY6 A;  3PSF A;  4DL2 A;  3K1Z A;  2WF9 A;  3HX0 A;  2HBM A;  1GPJ A;  5EWF A;  2KIV A;  5JRT A;  5EE9 A;  2E1E A;  2ISO A;  5EOZ A;  2Q4T A;  4DQQ A;  4GC6 A;  7ICL A;  1RDF A;  3SYZ A;  3ZD9 A;  4O3P A;  4UB4 A;  1WCL A;  9ICJ A;  3C21 A;  4C8N A;  3NUQ A;  1NK9 A;  5K4L A;  4M9J A;  4JLX A;  4KX5 A;  5CWR A;  2MAX A;  4Z6D A;  2ALZ A;  4QZE A;  3C1Z A;  2ZXH A;  3V6K A;  4B9M A;  4IQV A;  5HRI A;  1CEZ A;  5J0R A;  4DF8 A;  5DB9 A;  4O5E A;  4X4R A;  5HRB A;  2XCP A;  1TKD A;  2ZH2 A;  4Q44 A;  4O5K A;  4M9L A;  3QXG A;  5DLF A;  2W9B B;  3Q8K A;  4PHE A;  4Y2X A;  2KP7 A;  1SKW A;  2BPC A;  3ZDA A;  4CNQ A;  3Q8S B;  4X4V A;  3WK8 A;  3H8M A;  1JX4 A;  4C7Z A;  2RDJ A;  5CRX A;  3OV7 A;  3C2M A;  1XWL A;  3KTQ A;  2FI1 A;  3L5K A;  3L9D A;  5A0L A;  2KKV A;  4PHA A;  4F2R A;  5ALS A;  2I6X A;  4WC7 A;  5HRK A;  1ZQH A;  4DL3 A;  5C0Y A;  8ICX A;  5DDY A;  5KFE A;  4NLZ A;  4NM2 A;  3VCB A;  2BCR A;  3CNH A;  1X9X A;  5KFX A;  4DOA A;  1KL9 A;  3NVV A;  3AQL A;  3OGU A;  4X4S A;  3BJY A;  3I76 A;  4C4S A;  2W55 A;  3KKA A;  2P6U A;  4OAI Z;  4RUA A;  7ICH A;  3BQ2 A;  1BPB A;  4O67 A;  4QWB A;  3J81 j;  3GZF A;  4Q8F A;  4MFA A;  3QEB Z;  4ECY A;  2YB4 A;  2EH9 A;  4I2A A;  2BZF A;  3KD3 A;  1SL1 A;  4RQ2 A;  5KFI A;  1WWV A;  1B4F A;  3IM1 A;  1XSL A;  1SB3 C;  2LYH A;  5AI8 A;  4QZA A;  4DQI A;  2NRK A;  3AQM A;  1J2N A;  2Y9U A;  1BNO A;  5J2J A;  2FPL A;  2A3V A;  5JUM A;  3ISD A;  4QIW C;  2H3V A;  4M04 A;  4F92 B;  5J0U A;  4F91 B;  2KHQ A;  2BQ3 A;  5KFL A;  3WFP A;  2W04 A;  3WK4 A;  1MA7 A;  1X42 A;  1SV4 A;  2JGA A;  4WC4 A;  4WC5 A;  2LHT A;  5J2F A;  1CUK A;  2WF8 A;  5AKY A;  4YG2 A;  2QKQ A;  8ICO A;  3ISB A;  5CEH A;  4QWD A;  4M9G A;  2IOF K;  2ASL A;  2BPG A;  3HKZ F;  9ICM A;  2DR7 A;  2F8L A;  4UAW A;  4Y2Y A;  1COK A;  4KLQ A;  3B0X A;  4K98 A;  2V9W A;  1L3V A;  4A8E A;  4Y2S A;  1T7P A;  1IXR A;  5GTI U;  5ALV A;  4P0P A;  4C80 A;  1PK3 A;  3CYM A;  4ECZ A;  2RQ5 A;  1EXN A;  4M9H A;  5HML A;  2XY7 A;  2IUB A;  1ZQT A;  4K4I A;  1ZD3 A;  2F8K A;  2JRZ A;  3PMN A;  3QUC A;  4EYI B;  1CRX A;  3V72 A;  4LEY A;  3O0F A;  5KFB A;  4TUP A;  1FO4 A;  4R65 A;  5AI5 A;  3C1Y A;  2BHN A;  3C2K A;  4UAT A;  5T14 A;  4OJO A;  5L1I A;  2XGP A;  1K1S A;  2H3I A;  4QZ9 A;  2D6F C;  3ETL A;  1RZT A;  5KFG A;  1YZ6 A;  2PFQ A;  2K4E A;  5G5G A;  5C5J A;  2C2E A;  1ZQB A;  3HP6 A;  3RJJ A;  2G0A A;  3QE9 Y;  3OWG A;  3EWA A;  5D61 A;  2CN1 A;  1UEV A;  4TUQ A;  3PW0 A;  2ZHA A;  4FO6 A;  4RUC A;  2QB0 B;  2XVT A;  8ICB A;  4FS2 A;  4B9V A;  4ED2 A;  5KFY A;  4J9O A;  2D8C A;  3C23 A;  1Q46 A;  3G6Y A;  4Y2J A;  2RRD A;  2IOH A;  5KFW A;  3GII A;  4YMN A;  3K7D A;  4WC0 A;  1KKX A;  4J9S A;  2EAP A;  3JZ0 A;  5ALR A;  2ODG A;  5J2G A;  2M2T A;  1KN5 A;  4AT7 B;  1MN8 A;  2ESE A;  2ASJ A;  1ZQC A;  5BOL A;  8ICV A;  4ECU A;  3UM9 A;  7ICR A;  3GIJ A;  1D9D A;  4KLE A;  2HSZ A;  3TAN A;  4AP9 A;  2MU2 A;  1NZP A;  1RQL A;  8ICR A;  1ARO P;  1FFU A;  1UT8 A;  1NJX A;  3WFO A;  1UEU A;  2FPK A;  2R8G A;  5AIC A;  3JPR A;  2AQ0 A;  1RXV A;  1Q3U A;  2ZIV A;  2G09 A;  4E0D A;  3KOO A;  3GIL A;  9ICK A;  3F5E A;  1YLQ A;  5ALW A;  4FHP A;  2N1R A;  5KT7 A;  1TK8 A;  2HI0 A;  4DQR A;  4NLK A;  2DQN B;  2RFF A;  2OYY A;  5F9L A;  5ALY A;  2Z7J A;  3H8S A;  4U6P A;  1NKB A;  3IHQ B;  3RR7 A;  1QSY A;  4IQW A;  4OAF A;  4K97 A;  1X66 A;  1QQ6 A;  4N7R A;  2B56 A;  1MIY A;  1FIQ A;  3EW9 A;  1HUZ A;  3OHA A;  4ECW A;  3KHG A;  4LEV A;  1ZD4 A;  5ALO A;  5KT4 A;  3T5K A;  2PFN A;  1VFG A;  2HVI A;  4RU9 A;  3N97 B;  4O3O A;  4I2E A;  4CCH A;  8ICY A;  3KFU F;  2HHU A;  5KFP A;  4RQM A;  3TQ1 A;  3GIK A;  3ALR A;  3UQ2 A;  4DFM A;  4C4R A;  4NL9 C;  3M9M B;  2RDI A;  1O08 A;  4O69 A;  3OJS A;  3OJU A;  1PZN A;  4FFD A;  2NV3 A;  2FMS A;  1Z4O A;  4ED7 A;  2K8C B;  1U45 A;  4X0A A;  2HHP A;  1NZB A;  4OJP A;  1JRP A;  1KFD A;  5J0X A;  4OO1 J;  1SV0 A;  1B43 A;  2JR5 A;  3JPQ A;  4WCW A;  3VC8 A;  4G3I A;  3CW2 C;  4YP3 A;  5KFS A;  4BJQ A;  1ZQO A;  1Y88 A;  4QW8 A;  4AT8 A;  2A1A A;  3TAQ A;  1D8Y A;  5J0O A;  2DBY A;  2ZIU A;  2QB0 A;  2B51 A;  3SEN A;  3OHB A;  2CRX A;  3H37 A;  4KB6 A;  5J29 A;  5L1L A;  2LYB A;  1ZQV A;  4RQ4 A;  1Z3E B;  5AKK A;  2HN2 A;  3TKA A;  2DR9 A;  1TVA A;  3MBY A;  2ZH9 A;  1JAJ A;  1ZQW A;  5D49 A;  5F2V O;  4DQS A;  3HJE A;  4I2G A;  2BKE A;  4IC9 A;  4F5R A;  4BGD A;  3EPI A;  5DBB A;  2NRV A;  3PST A;  2C2R A;  4J03 A;  3ISC A;  4DSF A;  7ICS A;  1Z1V A;  3H40 A;  4DL5 A;  3N7R C;  2WAQ F;  4UB5 A;  2M2W A;  3RBE A;  2EAN A;  5CB1 A;  9ICF A;  3PSP A;  9ICV A;  2JH7 A;  4ICA A;  2B4V A;  2PI4 A;  1T94 A;  2A19 A;  5HRE A;  3QU4 A;  2C2D A;  1S77 D;  2WB1 F;  3OVA A;  5HMM A;  2NRT A;  2K4I A;  1N5W A;  2KEY A;  2G5H B;  1M6Y A;  4UAS A;  2KZ3 A;  5KFZ A;  5J2C A;  4NXU A;  2KG5 A;  2EDU A;  4YFK A;  3RJE A;  5B5E U;  3MDC A;  1DK3 A;  2AU0 A;  4WOY A;  3DEE A;  5HNK A;  3M7D A;  2AQ4 A;  2KOB A;  3V7L A;  2E5S A;  2GWS A;  2QLT A;  3WKE A;  2GA9 D;  1TAQ A;  1F0M A;  1SGG A;  3MC1 A;  4PZO A;  7ICK A;  3AEV A;  4ED6 A;  4GLX A;  4UAV A;  1SWW A;  4UW9 A;  3JPP A;  1UT5 A;  1LV5 A;  5ALK A;  2ASD A;  2ZJA A;  1KFT A;  3M8R A;  1KBU A;  4PPX A;  4O3M A;  2G08 A;  1NK6 A;  2MA1 A;  2D3D A;  4KLG A;  3RBD A;  3OTQ A;  1TV9 A;  1WOT A;  1MIV A;  2EAO A;  5KTQ A;  4OJ6 A;  2W9C B;  4R8U A;  1JN3 A;  4NKU A;  4ECV A;  2ZIX B;  4X4U A;  5AKJ A;  3I1Y A;  2MUT A;  4I29 A;  3UMB A;  4DFP A;  4YMO A;  1N63 A;  4RNN A;  1ZQA A;  3BQ7 A;  2JEI A;  1SL2 A;  2HOI A;  9ICN A;  4FO1 A;  3Q8Q B;  4I2B A;  2FCL A;  4BXO B;  4F5Q A;  1MSW D;  1ZQN A;  2BCU A;  4P0Q A;  2I9G A;  7ICU A;  1QQ7 A;  5TIS U;  3WFR E;  3MFI A;  3IRU A;  1H38 A;  4I27 A;  4JK1 A;  1NO5 A;  3JYY A;  5AKI A;  1X9W A;  4DOB A;  3M8S A;  5KG3 A;  4DQP A;  2QAR B;  1WWU A;  1ZQR A;  3NVW A;  1F5A A; 
#chains in the Genus database with same CATH homology
 3IM1 A;  1XSL A;  3ZDB A;  1BVS A;  4QZ8 A;  3H4B A;  5DEC A;  2LYH A;  7ICM A;  3GQC A;  4QZA A;  4DQI A;  5DKW A;  2NRK A;  3T5J A;  3AQM A;  2NRX A;  4YMM A;  4RT2 A;  8ICF A;  1SKR A;  3ORY A;  1JXL A;  8ICK A;  1BNO A;  5J2J A;  2FPL A;  5CA7 A;  2O5A A;  3M9N B;  7ICI A;  7ICP A;  5JUM A;  3QEA Z;  1S9F A;  3ISD A;  1WCN A;  5IIL A;  5KFT A;  1RYR A;  1V9P A;  4M04 A;  4ECT A;  2BCQ A;  1S0N A;  2ZUD A;  4YR2 A;  4J9M A;  3C5F A;  4F92 B;  1KRP A;  3QZ7 A;  5J0U A;  4F91 B;  2R8K A;  3RJK A;  1BPY A;  4DL4 A;  2BQ3 A;  1ZQG A;  8ICP A;  9ICL A;  5KFL A;  4I2I A;  1KSP A;  3WFP A;  1S10 A;  4ED8 A;  4X4P A;  5J0T A;  1ZJM A;  3V7J A;  4KLU A;  5DG7 A;  5HRH A;  4I2D A;  4QZG A;  4LVS A;  4WC4 A;  2W9M A;  4WC5 A;  1S0O A;  2JZB B;  4KN7 A;  2DRA A;  4DLG A;  5J2F A;  3JPN A;  1CUK A;  5IIN A;  1BPX A;  2BCS A;  4YG2 A;  2A1J A;  4O3N A;  4RPZ A;  4EBD A;  4KLJ A;  2F1J A;  5KG6 A;  8ICO A;  3ISB A;  3PVX A;  5KFC A;  3PW2 A;  1NK5 A;  4O3R A;  2C28 A;  4O3S A;  3K75 D;  5KFV A;  3FYH A;  7ICE A;  4QWD A;  3RJG A;  4F3O A;  4M9G A;  8ICW A;  4IRC A;  4DF4 A;  2ASL A;  4M47 A;  2BPG A;  5KFQ A;  9ICM A;  3GDX A;  2VA3 A;  4UAW A;  1NK8 A;  3GV7 B;  4ATB A;  2DR7 A;  2J6S A;  4GC7 A;  2VA8 A;  1TK0 A;  4KLQ A;  3B0X A;  2IA6 A;  4I2J A;  1ZQK A;  2W8K A;  2V9W A;  2KTQ A;  5HRL A;  2H5X A;  5L1K A;  3RH4 A;  1L3V A;  1FA0 A;  1ZQM A;  3PNC A;  4DLE A;  1T7P A;  4UD4 A;  1SKS A;  1IXR A;  4RWO A;  4PGQ A;  1XSP A;  3LK9 A;  2NRW A;  7ICJ A;  2P6R A;  4B9L A;  1TFW A;  4ELV A;  4ECZ A;  2FLP A;  4NLN A;  2FLL A;  4DS5 A;  5KG0 A;  1EXN A;  9ICC A;  4O3Q A;  4QWE A;  2AGO A;  1XS9 D;  1ZQI A;  4M9H A;  5HML A;  4FH3 A;  2XY7 A;  1ZQT A;  4P4O A;  4K4I A;  1JXE A;  9ICS A;  4Z6E A;  3BQ0 A;  3PMN A;  5J2H A;  2ZH7 A;  4EYI B;  4KLS A;  5HRF A;  4XRH A;  3V72 A;  4KMU A;  4MEY A;  5KFB A;  4TUP A;  4NXZ A;  5J0Q A;  5EWG A;  4R65 A;  3JPS A;  3SZ2 A;  4IRK A;  2F1H A;  1TFY A;  3C1Y A;  4RQ0 A;  1NJW A;  2KN7 A;  4RNM A;  1U4B A;  1KDH A;  5HRD A;  4FHY A;  5DGB A;  3E2E A;  2BHN A;  3C2K A;  3Q8P B;  2FMQ A;  1L3U A;  4MEX A;  5L1I A;  2XGP A;  1K1S A;  4QZ9 A;  5KFJ A;  4F93 B;  3ETL A;  1RZT A;  5KFG A;  1S0M A;  3MDA A;  2PFQ A;  4KLH A;  3KHH A;  5C5J A;  3PW5 A;  1XU4 A;  3RAX A;  5DB8 A;  3HP6 A;  2C2E A;  1MQ2 A;  1ZQB A;  3QE9 Y;  1XO1 A;  3RJJ A;  4J9R A;  4F2S A;  5HRG A;  4X4Q A;  2FMP A;  1D8L A;  1X2I A;  4RQ5 A;  4EBJ A;  4XQ8 A;  1OU5 A;  1BPE A;  1X9M A;  1ZQL A;  4O5C A;  4KLT A;  3EWA A;  1UEV A;  1ZQD A;  4TUQ A;  3PW0 A;  2ZHA A;  2JZB A;  4RUC A;  4FO6 A;  2BDP A;  1ZQS A;  4DWI A;  5KG1 A;  4WC3 A;  8ICB A;  4FS2 A;  3HJ4 A;  3C5G A;  4B9U A;  4B9V A;  3OUY A;  1XSN A;  3KHR A;  2BQU A;  9ICI A;  5KT5 A;  4YR3 A;  3LWL A;  4ED2 A;  3RRH A;  4WC2 A;  1BPD A;  1ZQU A;  5KFY A;  2HHS A;  4KTQ A;  3BDP A;  3H8J A;  4J9O A;  1JMS A;  3JPO A;  1N56 A;  2V4Q A;  5J0W A;  2J6T A;  4I2F A;  4DL6 A;  3OSN A;  4JV2 A;  1R8A A;  3WFS C;  1NK4 A;  5KFA A;  3C23 A;  5J0Y A;  3MGH A;  1A76 A;  1VJ7 A;  3G6Y A;  1NOM A;  4KN4 A;  8ICQ A;  1IM4 A;  5BOM A;  4AT9 A;  4TQR A;  4I2G A;  1RXW A;  3ZDD A;  4ELT A;  1R89 A;  4DSK A;  5KFW A;  3GII A;  7ICH A;  7ICN A;  1MC8 A;  4YMN A;  4F4W A;  3N4M B;  4DOC A;  4Q8E A;  4WC0 A;  4J9S A;  1D9F A;  4WC6 A;  2V4R A;  3PX0 A;  4Q45 A;  3EZ5 A;  3JZ0 A;  8ICZ A;  5KG5 A;  4PHP A;  3NGD A;  2IMW P;  5J2G A;  2ZTE A;  2M2T A;  4R63 A;  1ZQF A;  2HHV A;  1A77 A;  4AT7 B;  4RQ1 A;  3HT3 A;  2ASJ A;  4C8K A;  8ICJ A;  4KIT B;  5KFD A;  4UQG A;  2XCA A;  5KFI A;  5DGA A;  1ZQC A;  4DEZ A;  4UBC A;  5BOL A;  2OWO A;  4NY8 A;  2HHW A;  4ED1 A;  8ICV A;  3NTU A;  7ICQ A;  2ZJ5 A;  4TUR A;  4ECU A;  3RJF A;  4EZ9 A;  4X4N A;  2BR0 A;  4BDP A;  1S97 A;  7ICR A;  3GIJ A;  1D9D A;  5DLG A;  1Q79 A;  3V6J A;  5F9N A;  2DPI A;  9ICW A;  4KLE A;  3PO5 A;  4DS4 A;  3TAN A;  4ED0 A;  5KG4 A;  3Q8M A;  2ZUC A;  3PR5 B;  1NJY A;  2PFP A;  1NZP A;  3UPQ A;  4DL7 A;  8ICR A;  4QZB A;  1NJZ A;  5DQG A;  5CHG A;  5D4B A;  2UVU A;  2ZH9 A;  1ARO P;  2UVR A;  1UT8 A;  1NKC A;  2IHM A;  1NJX A;  4RQ3 A;  3Q8L A;  2PXI A;  4DFJ A;  1UA0 A;  3WFO A;  3SV3 A;  3ZD8 A;  4NM1 A;  2DR5 A;  1UEU A;  2FPK A;  4YVZ A;  5KFH A;  2XC9 A;  4ED3 A;  3JPR A;  1Z00 B;  2AQ0 A;  4O0I A;  2XO7 A;  1RXV A;  5J2A A;  3QZ8 A;  4QWC A;  1KFS A;  4KLO A;  1TFR A;  4RWQ A;  2DFL A;  3OSP A;  4E0D A;  2M2U A;  5KT3 A;  5DBC A;  1HJP A;  3GIL A;  4F4Y A;  4FS1 A;  2BQR A;  9ICK A;  2J6U A;  1YLQ A;  4KLF A;  2VAN A;  2AGQ A;  4FHP A;  5KT7 A;  1SL0 A;  4KLD A;  1TK8 A;  4RWP A;  4DQR A;  4NLK A;  1QSL A;  2W9C A;  4RPY A;  1HUO A;  8ICH A;  5DB7 A;  2RFF A;  3C2L A;  9ICP A;  4ECR A;  5IIK A;  4F4K A;  5F9L A;  9ICO A;  2ZH1 A;  5EWE A;  5HP4 A;  3TFR A;  4MFF A;  5L1J A;  1JQR A;  3RJI A;  3H8S A;  2ZTD A;  5DQI A;  1U48 A;  2W9B A;  5KG2 A;  4J9L A;  1NKB A;  7ICO A;  3IHQ B;  1UA1 A;  3RR7 A;  4C8O A;  2FPM A;  1QSY A;  4QW9 A;  4IQW A;  4E8F A;  1UET A;  5KFN A;  5TZV A;  3RB0 A;  4F4Z A;  4C8L A;  5DG9 A;  5CP2 A;  1NK7 A;  2KZM A;  1MIY A;  5L9X A;  5CJ7 A;  3EW9 A;  2HVH A;  3BQT A;  4IR1 A;  1HUZ A;  3H4D A;  3OHA A;  1K1Q A;  3KHG A;  4ECW A;  2C22 A;  9ICG A;  4RZR A;  2ZH4 A;  5KT4 A;  3AUO A;  1DOQ A;  4BXO A;  5KFO A;  4EYH B;  3T5K A;  2PFN A;  2VA2 A;  3OVB A;  3RB3 A;  4WC1 A;  4UAY A;  1L3S A;  4I28 A;  3H7I A;  4M6W A;  4RU9 A;  4J9N A;  1U49 A;  3N97 B;  2HVI A;  4O3O A;  4UD5 A;  4Q8F A;  4HYK A;  1BNP A;  4FBU A;  4I2E A;  8ICN A;  4CCH A;  2UVW A;  8ICY A;  2HHU A;  4X0B A;  4X4T A;  3C66 A;  2R8H A;  5KFR A;  8ICU A;  5KFP A;  4UB2 A;  4GXK A;  3TQ1 A;  3GIK A;  8ICL A;  2PFO A;  4F4X A;  4EEY A;  3UQ2 A;  4DFM A;  4JWN A;  8ICT A;  5DBA A;  1S0V A;  5III A;  3HWT A;  3M9M B;  2RDI A;  1BGX T;  4PGY A;  4JV0 A;  3UXP A;  1KNY A;  3OJS A;  3BQ1 A;  4P2H A;  3OJU A;  3HW8 A;  3UQ0 A;  8ICE A;  1PZN A;  4J9Q A;  4DSI A;  5KT2 A;  5BPC A;  2ISP A;  2PBE A;  3RH5 A;  5KT6 A;  2WTF A;  3RTV A;  2FMS A;  4AT7 A;  4EZ6 A;  2DVI A;  4XA5 A;  4ED7 A;  4M5D A;  1U45 A;  5KFK A;  5J0P A;  4DO9 A;  9ICQ A;  4LZD A;  4ECX A;  4E80 A;  4X0A A;  3RB6 A;  2HHP A;  4IQT A;  5HR9 A;  4YR0 A;  2BPF A;  4ATB B;  4Z6C A;  1KFD A;  5J0X A;  4JV1 A;  4AT9 B;  4MF8 A;  3B0Y A;  1XC9 A;  5J2K A;  3FDS A;  3GIM A;  1B43 A;  3LWM A;  1X9S A;  5HHH A;  1ZYQ A;  4RPX A;  3JPQ A;  2Y1I A;  4F5N A;  3TI0 A;  4WCW A;  7ICF A;  4G3I A;  2HHX A;  3NYB A;  3K4G A;  4YP3 A;  5KFS A;  4RQ7 A;  2AGP A;  4EP7 A;  4WBZ A;  4YD1 A;  4RT3 A;  5DB6 A;  1ZQO A;  1ZQJ A;  4IRD A;  4EBC A;  4QZC A;  4FBT A;  2JEG A;  1Y88 A;  4QW8 A;  3MGI A;  4R8U B;  2IBK A;  8ICC A;  4AT8 A;  3PR4 A;  3TAQ A;  4FH5 A;  2DRB A;  3M9O B;  1D8Y A;  3H3A A;  2MUT B;  2Q66 A;  9ICR A;  3MR3 A;  2BCV A;  5J0O A;  1Q78 A;  9ICH A;  3GV5 B;  2F1I A;  1KTQ A;  1DGS A;  3UPS A;  3OHB A;  1ZQE A;  4GXJ A;  3H37 A;  2HHT A;  5KFF A;  3H39 A;  5J29 A;  3TFS A;  3OUY B;  4KLI A;  5L1L A;  1BPZ A;  3JPT A;  4M6W B;  1ZQV A;  4RQ4 A;  3TAP A;  2IHN A;  4B9T A;  4LT6 A;  3WFQ E;  1ZQX A;  3KHL A;  3PML A;  2UVV A;  5J2I A;  8ICA A;  4PGX A;  3G6X A;  1ZQP A;  5DED A;  1Z3E B;  1TAU A;  2ZH6 A;  4JUZ A;  2KFN A;  3UXN A;  4AT8 B;  4ELU A;  5J2E A;  4C8M A;  4UB1 A;  1T3N A;  4NKT A;  1TVA A;  2DR9 A;  3MBY A;  4NLG A;  4I2C A;  4MFC A;  2M9N A;  3EYZ A;  3LDA A;  1ZQW A;  5D49 A;  3PX6 A;  2HW3 A;  1JAJ A;  1R8B A;  4DQS A;  4P4P A;  4E7X A;  5F2V O;  2BGW A;  1QSS A;  2BKE A;  5HHI A;  3SV4 A;  2Y1J A;  4EBE A;  2P66 A;  4YQW A;  4F5R A;  2R8G A;  4QZI A;  3T5L A;  3T5H A;  4B9S A;  4BGD A;  4EBK A;  3EPI A;  8ICG A;  2HHQ A;  3HIY A;  3PW4 A;  5DBB A;  2B21 A;  2NRV A;  4IQU A;  3V6H A;  2ZTC A;  3AU6 A;  5J2D A;  2JEJ A;  4PHD A;  2C2R A;  4ZH4 A;  3AU2 A;  3ISC A;  4DSF A;  1NKE A;  2FLN A;  3PY8 A;  7ICS A;  5HC9 A;  9ICA A;  1MQ3 A;  1B22 A;  3H40 A;  4DL5 A;  4RQ8 A;  3HPO A;  4UB5 A;  4DSJ A;  4KLM A;  2Q0Z X;  4UB3 A;  2M2W A;  5IIJ A;  3ZDE A;  4X5V A;  3OVS A;  4YD2 A;  2W8L A;  4XUS A;  4M2Y A;  3MR6 A;  3RBE A;  5CB1 A;  4DFK A;  9ICE A;  9ICF A;  8ICS A;  4BWM A;  2KZZ A;  1T8E A;  3SI8 A;  9ICV A;  4S3N A;  4DSE A;  2XY6 A;  2PI4 A;  4DL2 A;  1JIH A;  4XQ7 A;  2NRZ A;  5HRE A;  1T4G A;  7ICV A;  2C2D A;  1S77 D;  2DPJ A;  4QZF A;  3HX0 A;  3OVA A;  4TQS A;  3C18 A;  5HMM A;  5KFU A;  2NRT A;  2PI5 A;  4FHW A;  5EWF A;  3Q8R B;  2KFZ A;  4M0A A;  2ATL A;  5DG8 A;  3H8W A;  3UXO A;  2ISO A;  5KFZ A;  2KZ3 A;  3PX4 A;  5J2C A;  5EOZ A;  2XY5 A;  1DK2 A;  2M2V A;  3RJE A;  4YFK A;  4DQQ A;  4GC6 A;  7ICL A;  2A1J B;  3SYZ A;  3ZD9 A;  4F50 A;  4O3P A;  4QWA A;  3RJH A;  4UB4 A;  3MDC A;  2ZUB A;  4ECQ A;  1WCL A;  1VFG A;  1DK3 A;  9ICJ A;  2AU0 A;  1L3T A;  3C21 A;  4C8N A;  3PW7 A;  5HNK A;  1R8C A;  4WBY A;  2AQ4 A;  3MR2 A;  3ZDC A;  1NK9 A;  4TUS A;  9ICU A;  4M9J A;  5J2B A;  4UBB A;  3V7L A;  5CWR A;  4QZH A;  1S76 D;  2MAX A;  4Z6D A;  2ALZ A;  2GWS A;  4DSL A;  2ZH8 A;  4QZE A;  3C1Z A;  3V6K A;  2ZH5 A;  9ICT A;  2ZH3 A;  1TAQ A;  1RPL A;  3MFH A;  3GFK B;  3MR5 A;  4B9M A;  4K4G A;  1SZP A;  7ICK A;  5IIO A;  4ED6 A;  4GLX A;  4KLL A;  4IQV A;  5HRI A;  3AQN A;  4IG8 A;  1CEZ A;  4FHX A;  5J0R A;  3JPP A;  4DF8 A;  1UT5 A;  1LV5 A;  2ASD A;  3HJ1 A;  5DB9 A;  1NK0 A;  4UAZ A;  4O5E A;  8ICI A;  1V4A A;  2ZJA A;  3RH6 A;  1KFT A;  4X4R A;  5HRB A;  3M8R A;  4YN4 A;  4MF2 A;  3G6V A;  2XGQ A;  3RR8 A;  2XCP A;  1TKD A;  1ZQQ A;  4YCX A;  4PPX A;  4Z6F A;  4Q44 A;  3AQK A;  2ZH2 A;  1NK6 A;  4M9L A;  4O5K A;  4ECS A;  5IIM A;  3TAR A;  5DLF A;  4KLG A;  3EPG A;  3RBD A;  1QTM A;  2W9B B;  3RRG A;  7ICT A;  1TV9 A;  3THV A;  1WOT A;  2BE3 A;  1MIV A;  3Q8K A;  4PHE A;  3PV8 A;  2KP7 A;  1SKW A;  5KTQ A;  2BPC A;  5D46 A;  3ZDA A;  4J9K A;  2W9C B;  4YXJ A;  4R8U A;  4F5P A;  1C7Y A;  4K4H A;  3Q8S B;  4X4V A;  1JN3 A;  4NKU A;  4ECV A;  3LQC B;  1RYS A;  1JX4 A;  2O1P A;  1U9L A;  4X4U A;  2RDJ A;  5KG7 A;  3OV7 A;  1QLN A;  4I2H A;  4RQ6 A;  1XWL A;  2MUT A;  3C2M A;  4I29 A;  1PX5 A;  3KTQ A;  4YXM A;  3H38 A;  2DR8 A;  1Z00 A;  3L9D A;  4DFP A;  4J9P A;  7ICG A;  3PO4 A;  1ZQY A;  4PHA A;  4F2R A;  8ICM A;  4YMO A;  1MIW A;  2ID1 A;  4WC7 A;  5HRK A;  4RNN A;  2ZJ8 A;  1ZQH A;  1ZQA A;  4DL3 A;  1SL2 A;  2JEI A;  9ICN A;  8ICX A;  5DDY A;  5KFE A;  3Q8Q B;  2R8J A;  4I2B A;  4NM2 A;  4NLZ A;  4PH5 A;  9ICX A;  4FHV A;  4RWN A;  4BXO B;  2BCR A;  5KFM A;  3T3F A;  3RB4 A;  1L5U A;  5KFX A;  5DDM A;  4DOA A;  5J0S A;  1ZJN A;  4F5Q A;  3AQL A;  1MSW D;  3OGU A;  1N48 A;  4X4S A;  4LZG A;  4F5O A;  3BJY A;  3MAB A;  1LB2 B;  1ZQN A;  4O9M A;  1U47 A;  2ZHB A;  2BCU A;  3RAQ A;  4P4M A;  1COO A;  2P6U A;  1ZET A;  2I9G A;  4RUA A;  4Q43 A;  7ICU A;  5DQH A;  2I1Q A;  1ZQZ A;  5CR0 A;  3BQ2 A;  1BPB A;  2JEF A;  3MFI A;  2W9A A;  4IR9 A;  2AJQ A;  4X4O A;  4QZD A;  3WFR E;  4QWB A;  4M9N A;  1H38 A;  4I27 A;  4JK1 A;  3V7K A;  1NO5 A;  3JYY A;  9ICB A;  2R8I A;  1X9W A;  4BWJ A;  4MFA A;  3GV8 B;  4R64 A;  4GXI A;  4DOB A;  4ECY A;  3M8S A;  3QEB Z;  5KG3 A;  1TK5 A;  4F8R A;  4JWM A;  1KEJ A;  4RNO A;  4B9N A;  4DQP A;  4I2A A;  4R66 A;  1ZQR A;  1SL1 A;  4RQ2 A;  1F5A A;  1KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...