4M9UA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
365
Chain Sequence
b'MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 115
structure length 365
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4m9uA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4m9uA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m9uA01
1A48A 2GPWA 4WBNF 3U55A 2NUAB 4I50F 5JQGF 1CE8A 4FFOA 3MJFA 4WD3A 4MA5A 2R7MA 2R7NA 2FPGB 2CZGA 3N6RA 4XX0B 2YW2A 3V4ZA 4O7LA 4O2BF 4YB8B 2I8CA 4O7SA 2QF7A 4EGJA 4MV1A 3K5IA 4EA7A 1KJ8A 4O4JF 1KBLA 1T36A 3R23A 5H80A 2NU8B 5JQWA 4O7WA 3VA7A 1PK8A 4O82A 5LOVF 4DLKA 1GLVA 4FE2A 3Q2OA 2Z04A 5LXTF 2GPSA 2Z02A 4GGMX 4EA9A 1EUDB 4O2AF 3KREA 3ETHA 2V59A 1B6RA 3TIIA 1KJQA 2YS6A 2R85A 2YZGA 3E5NA 5C1PA 4QSHA 1VBGA 2X0SA 3BSSA 4MV9A 3U9SA 1SCUB 5J2TF 1KJ9A 1C3OA 2ZDHA 4YAKB 2ZDGA 1JLLB 4MV3A 2VHEA 2IP4A 4IWXA 2R84A 5J2UF 3R9RA 2HJWA 4HR7A 2PN1A 3I12A 3VOTA 4XZ3B 4M98A 2HGSA 2CNVA 1GSAA 4MV6A 3G8DA 3RV4A 1EUCB 5LP6F 4I4TF 3U54A 2ZDQA 3LWBA 4O7ZA 3JZFA 4O7VA 2P0AA 2YZNA 4TV8F 3DF7A 2DIKA 3BG5A 1Z2NX 1M0TA 2GLTA 1UC8A 2R7LA 3JRXA 3WNZA 3KAKA 3WO0A 3K3PA 3VPCA 2YZMA 1IOVA 2YRXA 4O84A 2R6FA 3VMMA 2FPIB 1BXRA 2XCLA 4HNUA 5BPFA 4IWYA 1I7NA 4HNVA 1ULZA 2GQSA 4C5AA 2SCUB 2C00A 5BPHA 4IZOA 3RV3A 4HQ6A 3BFPA 1DV2A 3ORQA 4O4IF 3AX6A 2R7KA 2VPQA 4XYMB 2FB9A 3TIGA 2V58A 2W6OA 1JKJB 5IYZF 4ZI7F 3KALA 4FGRA 3TQTA 5C8YF 4IHJF 1KEEA 3N8DA 1VBHA 5HBRB 5CB4F 4M99A 2GQRA 3K5HA 4MV8A 5BMVF 2CNQA 4YJ2F 2NU7B 4O4LF 2R87A 4O83A 3QFFA 1CQIB 4FFNA 1AUXA 5HV6A 2VR1A 4XYLB 4EAAA 4YAJB 4FFPA 1Z2PX 5C1OA 5JVLA 1M0WA 1EZ1A 3MWEA 3Q1KA 4O86A 3HBLA 3TINA 2DZDA 4O7RA 1VKZA 2R82A 4HNTA 4O7YA 4NYEA 4YBZB 2CQYA 1JDEA 1DV1A 2CNUA 4L1KA 2NU6B 3HO8A 1GGOA 3JRWA 4E4TA 5KX5F 3VPBA 2R86A 4EABA 1KJIA 4FU0A 2I80A 3KAJA 5KKNB 4IIJF 1IOWA 1B6SA 2DWCA 3JZIA 4RZQA 5FNVF 3ORRA 5LA6F 4O7TA 2W6ZA 4FFRA 1Z2OX 5D8DA 2NPOA 1W93A 4TV9F 2VQDA 5DMXA 1AUVA 1OBGA 3OUZA 2W70A 4EG0A 2FP4B 5CA0F 3V4SA 2XD4A 4M9CA 5GONF 1E4EB 1E4EA 3LP8A 4YJ3F 4ME6A 2OLSA 1GSHA 4FFLA 4FFMA 4Y8VB 5I47A 5EZYF 3R5FA 1JDBB 2YZLA 1CQJB 2DLNA 4O7NA 2W6MA 5JH7F 4O81A 1OBDA 4C5BA 2NU9B 1KJJA 2QK4A 2W6NA 2FPPB 2PVPA 5JVDF 3WO1A 2W71A 1BNCA 1WR2A 3R5HA 1UC9A 3BSYA 1M6VA 1PX2A 2W6QA 2WYOA 2YL2A 4J6EA 2YS7A 5CAEB 4EGQA 4EA8A 3G8CA 3BSWA 4ZOLF 1GSOA 1KUTA 5LYJF 1DIKA 4ZHQF 1CS0A 2W6PA 2YWVA 3R5XA 2V5AA 4O4HF 2YRWA 1KC7A 4MV4A 5CA1F 3VPDA 2YYAA 1EYZA 3OUUA 4TUYF 3RFCA 2PBZA 4M9UA 3GLKA 1EHIA 3U9TA 3TW6A 5K2MA 3UFXB 1I7LA 4C5CA 4MAMA 4ZQIA 3HB9A 4MV7A 1A9XA 3SE7A 3AW8A 4I55F 3ETJA 3MWDA 3NUAA 2J9GA 4MA0A 4DIMA 1C30A 1W96A 3GIDA 2I87A 3RUPA
chains in the Genus database with same CATH superfamily
1E9VA 2MSEB 1N5JA 4X44A 4Q7MB 3KJIA 4FXPA 1DBPA 3ITEA 3E9EA 1DLJA 3F6EX 1KYWA 4LHSA 3FYUC 2Y0BA 2FFJA 3Q8SB 1JDPA 2EU8A 4HWKA 4RFSB 4ZYLA 3V4ZA 3HRIA 2NYRA 5FPKA 2PKCA 3T06B 5EGNA 3O91A 3ZQUA 2WM9B 4BRUA 2G8NA 5BURA 2UVPB 3RAQA 3INNA 1WDTA 3R3JA 1IUKA 3FM9A 2OCIA 2A9PA 3TXYA 4CMGA 3CGGA 3K32A 4WSOA 4I9HA 2H1FA 1NLMA 3S2SA 1UBUS 3WIUA 1SU4A 3WTBA 4JHLA 4D56A 3LYUA 4RD0A 1YBHA 1B0AA 4N41A 1B6RA 2O2SA 1ECLA 3BJEA 2V7EA 4TKVA 5DGHA 2R4UA 2EL7A 2EF0A 1S89A 3ADOA 3OOEA 1ZVMA 1XDBA 1E2FA 1BQEA 1I2AA 2UVDA 1V6SA 3N2GB 2H1CA 3SQMA 4RLQA 2EJ0A 1M8FA 5TGTA 4G2TA 1ZCJA 4IJKA 1KFJB 4ZMSA 3AIMA 2A8YA 2EJBA 3WI7A 1DJLA 2RHDA 4LDRA 2O8DA 3RI3A 3K3VA 1L8OA 1Q12A 1W0JA 4BPBA 1PRYA 1ISSA 3VPCA 3HOUG 1J22A 3ZY2A 3RTEA 1S3GA 4DLTA 4BMYA 4M7PA 3GIWA 2X13A 3HJCA 2Q5JA 2HZBA 4HXGA 5KG6A 3I5AA 2H7VA 4AUKA 2PDAA 2RGYA 3JATA 2FLNA 4R2WA 1ESNA 4PXYA 3GLHA 4AP9A 1UK8A 4B1FA 1FIUA 1J49A 2HUPA 2X4IA 2VQEH 4A8JC 1N2HA 4V2UA 5CHYA 4OM8A 3CCBA 2OP0A 1PZHA 1EJ6A 4PG6A 3A32A 3AJRA 4YFVA 3O9ZA 2L82A 3P5SA 5EXSA 3GLFB 2ZM5A 2VAWA 3R0XA 4H7KA 2Y6UA 4QDKA 2QD4A 5JI3E 4Q4DA 3UQZA 4DWJA 1OLXA 5AQ1A 3GFSA 2GFQA 1F8FA 2W9AA 3OM0A 4ZI7B 4R3WA 1TYEB 4OH7A 4LE1A 1LVGA 3KR0A 1SXJD 3ZH9B 4P98A 1DJNA 6YASA 1VLMA 2IWHA 1Y14B 3RRZA 5TDHA 4HDCA 4P3XA 4G01B 1DWUA 2ISQA 2ZWIA 2YJ5A 4GOJA 3O8OB 1XZDA 2PWZA 4RJ2A 4J9PA 1PYGA 1V4VA 3UANA 2H85A 3C8UA 1GSHA 4HDAA 2VUTA 1EXVA 1RRVA 2BFNA 1V3VA 5AM3A 5H70A 2EL9A 4F8YA 1JHXA 1QXSA 1KE1A 3ESRA 2QR3A 2ZJ3A 3WGKA 3I61A 2ZI6A 2IH5A 5DZSA 2ZATA 1Y9DA 4XTCS 4H1VA 1DIRA 3FTQA 3IMGA 3HPRA 2VC2B 3NTQA 4UOEA 1SVMA 3S70A 3EHDA 5B2ZA 4L72A 4RUKA 2NVOA 3TYXA 1LD3A 3GJXB 1TYCA 1QR2A 4WA8A 3TPZA 4CM4A 5IJZA 1JB1A 2Q3JA 2W9BA 4KHZA 3IEPA 2IPMA 4NYJQ 1KKLA 3RT1A 3ESDA 4PYMA 1N1EA 2VJMA 3ED1A 2JGRA 1RTKA 2NVXA 2ZI3A 4MAMA 4RUAA 3S99A 1T2DA 4KUGA 1JECA 3L93A 1JH8A 2ZETA 1BDHA 1YVDA 4D0NA 4GX5A 4LXTA 4CMJA 4BEVA 2JDID 1V7ZA 1E3IA 2C5AA 4RE5A 1Z6PA 2DR2A 2D5CA 1IBSA 1V8PA 1X15A 3I4CA 5KFGA 1CE8A 4L3OA 2V4UA 3SI8A 1J8FA 3TVTA 1PZNA 5AW8A 3TTXA 2O8EA 2FPGA 4LNHA 5F73A 1JQKA 3VH4A 2ET6A 1TC2A 2JCYA 5AVYA 4EG7A 1VL2A 3R7BA 2FPIA 1GYFA 3A37A 2AR0A 1LPBB 3EPJA 3AUXA 1SVOA 4RKYA 1ZHSA 2HT1A 3E48A 4Q4HB 3OOHA 1TVKA 1U7WA 4PSDA 4B4VA 4A93G 1Z2AA 4BO2A 3ZDZB 1Q2UA 4CL3A 3FROA 5CPFA 5KQGA 1Y9JA 3UCXA 2R68A 3ST7A 4PLPA 1I36A 1W6UA 1M2GA 3DA8A 3NYWA 4LY0A 4LJYA 2CHUA 2ETXA 1ZK0A 4RD4A 4EFDA 5JRZA 3LHDA 1TW2A 2G8LA 3RUHA 3NBXX 3HCEA 2Q21A 4XYLA 3QKIA 3FHOA 4GW3A 2B2XA 4M1SA 2VCHA 3H5NA 1MG0A 3EODA 2C61A 3W6PA 1CNFA 3F4BA 4Q03A 3K1YA 1GV1A 1CUXA 3M4ZA 4ZCTA 5ER9A 4LJ8A 2FE3A 1X0XA 5IDVA 3VO2A 4IRMA 3LUGA 5KFTA 4JI0B 4PNPA 2ZR8A 2B7BA 1N25A 2PG3A 4HWGA 1QH0A 3Q7RA 4B17A 2FZKA 4IHAA 3Q7SA 4B3IA 1EFRA 3DP7A 3RRMA 2WMNB 2P7HA 1DU4A 3H1PA 3K53A 1XAJA 5KTSA 3W04A 4DMMA 2F2TA 4DB4A 1C2TA 1QR6A 1SBIA 1QB8A 5KOHB 2EKBA 3LVQE 2X8JA 4J1SA 4K9NA 4B0PA 3EAGA 3BFPA 3HL4A 5HNEA 3INGA 2QVGA 1OPXA 4RH3A 4M1WA 1M10A 2P6PA 3B60A 4ITUA 4W4TA 4JBIA 3ZDRA 1QRAA 2GN9A 2ATIA 3SYNA 4JBHA 1AKVA 3GGOA 2JCXA 2IW1A 1DDOA 1JDZA 1O8BA 5IJ9A 3IBSA 3QVGB 2Y0EA 2A5YB 2VPTA 2WU4A 1I4LD 4S2EA 1FYEA 4BVJA 1AHNA 1N36B 1RYDA 3AEQA 1QGYA 3HA3A 5FPOA 3D31A 2Q5OA 3AR9A 2KS6A 4J6FA 1E2LA 4K1LA 3ORFA 1INLA 2XGOA 1GJRA 4D8YA 1WY5A 4CIYA 1V8BA 2GSDA 4O4LA 3LVFO 1DNPA 2HI0A 1USVA 4M1YA 3ZDCA 2HPAA 4WKGA 3HY4A 1AKRA 4QVKA 5HYVA 4NPHA 1NONA 1KO8A 3ZBPA 4FVTA 3H5IA 2JLBA 1RRGA 5DB4A 4I4IA 4M46A 2I55A 4QNNA 3PRYA 2JFOA 3GZNB 2PD3A 3T7SA 3LPDA 3SDZA 3THYA 4F8JA 1MVOA 3CIOA 3RD5A 1HDRA 3CGWA 2PRZA 1QVWA 3DE4X 1QGUA 2FG7C 4G0MA 3B3QA 2JKVA 5C5DA 4XDZA 4EF6A 2XE4A 4CLRA 1ZETA 3LHFA 1Z4IA 2IHBA 5EXEA 2FN7A 3QU9A 1H23A 1JXLA 1YQXA 3IIEA 4C89A 4L4ZA 1VG0B 5LZ9A 3R5XA 4WBSA 4ZVTA 3QYPA 2O0HA 1EYZA 2WJWA 2H7XA 3A9TA 3FUUA 3NW9A 2PPVA 2ZROA 4A0HA 5KFOA 1L4EA 1LQTA 1YFJA 1V4BA 3O2NA 1CJCA 1G6OA 1S8FA 1BS1A 3B6MA 2F4NA 3DDWA 1KAGA 4DCVA 2R6AA 3MTEA 2B36A 4FGUA 9ATCA 1Q77A 3PPYA 3CLVA 2PKRA 5BNWA 5KU7A 3PGJA 5ALPA 4B4DA 1R9NA 2CFMA 4AZTA 4D4IA 1VB3A 3NC1C 2IEIA 1GQSA 3RE1A 2VDVE 2LGJA 3DUFB 5K0LA 2PLNA 5CM9C 5A4MS 4R2IA 5JQWA 3VHXA 2DT5A 2WIJA 3DL0A 4Q7KA 4ZXFA 3FUCA 3VR1A 5LOVF 1UBFA 4GPAA 1NWHA 5B3AA 1HOTA 4D9MA 4ALKA 5BUCA 3ZU5A 1GZHB 1D2CA 4WDRA 1DKLA 3ANSA 1LBQA 2G88A 3R9KA 4FC6A 3TE7A 2DU8A 1P4AA 2PZBA 2YC2C 4FOTA 3ER9A 5ED4A 2XRFA 2QZJA 1U0FA 3BHMA 3NJ4A 4BP1A 5J43A 5JRDS 1RE0A 4MPJA 1Z6TA 1D9ZA 1KY3A 2Y1DA 1YS2X 5EMHA 3Q6MA 5LKAA 1Y8RA 5K8JB 1JLHA 2CFRA 1AO3A 1XDDA 3AB3A 5H82A 4LHXA 2OCXA 1ZKMA 4NVRA 2RG1A 3VZBA 1WCV1 1GNLA 4KYTA 2WWFA 4Y2YA 4D2IA 1P5JA 1ZJ4A 2GR9A 1NTOA 4RANA 4JI7B 2R751 3RS8A 4JP5A 3GUCA 2ZBGA 3O03A 4C4YA 1G5RA 1LRKA 5KTMA 4L7VA 2Y27A 2C9YA 3L0YA 1KEPA 4HYTA 1LZLA 4PZZA 1SQFA 4RF5A 5AUQA 5EAIA 4KX5A 3KPWA 5HKBA 1FVOA 3UUWA 4GLOA 4DV0H 1G5QA 3QTBA 4E4RA 4YAFA 2OO5C 4I1PA 2ID8A 2XGJA 2PAAA 3L7NA 5A5DA 3L41A 5A3SA 2CL0X 1FXWA 2B5VA 2OXRA 3AKYA 3LHIA 3GCWA 4RKQA 4G5OA 3P94A 4CV2A 1LBSA 3PZPA 5ILOA 1X7YB 1ZGGA 2CVOA 3SSMA 3ZHQA 2X41A 1PZEA 1Y1WA 3N5KA 2UXCH 4LHVA 1JR2A 1Z7EA 5DX0A 3ROQA 3EZGA 1PI3A 4BFZA 4L9SA 4ZI7A 3ZVMA 2QZ4A 1KRWA 2BL4A 3NAQA 3GG9A 1B1AA 4LFBH 1IJEA 2QSYA 4YJ2A 4MIYA 1T26A 5F1OA 3N44B 1E3WA 1XJ5A 5G40A 4IIHA 4OGLA 3C3XA 2QRNA 3C6ZA 3IOBA 1KP9A 4HAOA 5C32A 3K8QA 3EZ9A 2RHRA 4HSGA 1O3YA 2G83A 5EKSA 2RGVA 3IHWA 4ZVPA 4HJXA 1FRZA 2MYNA 2COGA 1YULA 1KRXA 4FMPA 3TLCA 2V55B 1GIAA 5CDYA 1YGPA 4LGMA 1DEAA 4E07A 1YR7A 4FGZA 4N6NA 2CEKA 1RWOA 1UBHS 3L0CA 3WJ7A 5IT4A 2VRCA 2L0XA 3PX3A 2FZVA 3CM0A 3GEPA 4TSKA 1F8YA 4LRYA 4RS4A 3WV4A 4ENPA 2W43A 3PWSA 1XEWX 2KWIA 1XU4A 4EB6B 4UVGA 1IY0A 1US8A 3IR6A 3L7IA 1LPMA 2JGIA 3WZ2A 3I42A 2D1SA 2UVVA 5BUQA 3KSAC 4EI2A 1YTLA 1U81A 3EQZA 5WRFA 3ZZUA 1SCIA 3OMXA 5A0VA 3IDQA 1LDMA 4F2PA 2J4FA 3SXUA 4B3HA 2F8LA 2J9GA 5I7HA 5KZMB 3RWBA 3UO8B 5JSZB 3RM3A 1WPGA 3ZWDA 2WYHA 3MTDA 3C3JA 2PL5A 3K0AB 3OLWA 3PFFA 1QTIA 4J9VA 1JL3A 5FA5A 5F2NA 1EK0A 2PGOA 1I4DD 4RAYA 2WOOA 1BDIA 3F71A 4YAUA 5DGAA 2WTUA 3GD7A 4YUYA 1E9EA 2FJPA 4P3YA 2DR3A 2P6UA 2FDXA 3OPQA 4AP5A 3SK0A 2M6LA 5D6NA 1DMSA 4WBNA 1Y5NA 3ZIAA 5BSGA 5KT2A 1PJQA 3AINA 4B6EA 2VG8A 3I6IA 4X85A 1AF7A 3ZWNA 2HU7A 1C29B 1CQXA 3RLIA 5FJIA 5BSRA 5FUBA 2ST1A 1R12A 3EPHA 2DX7A 5JNRA 5G1NA 5J4VA 1XLUA 5GM1A 2KX7A 3ZBQA 4FNMA 2HV8A 3UKJA 4WKPA 4DZZA 2C2OA 3TL3A 3SOZA 1QO9A 4G67A 1H6BA 2XYRA 3H9JA 5ABPA 2R6DA 4IYRA 4Q5IA 4B80A 5DISC 4E3ZA 3AB8A 3R7DA 3J7TA 4NS4A 4JCCA 1NC1A 4UCTA 4YP7A 1H2XA 3WLNA 1GOTA 3H99A 3RV4A 5F51A 1MENA 4OI2A 5ALLA 2FXIA 2XCAA 3NC0C 1ZU5A 3IG0A 4JI2H 3CUYA 4PPNA 1LU9A 3GDGA 1YBMA 1UDAA 3C14C 3KEGA 4CF7A 1WLYA 2EF1A 5KC9A 1EUZA 2B94A 1SH7A 2OZKA 1QHHB 4OLBA 4Q9AA 4NRDA 5KOHA 3PENA 3TLGB 1E6WA 2Z9DA 4ZRDA 2COUA 1T0BA 1T9ZA 5HPYB 5DNAA 5EA2A 3BIXA 3ORHA 3BWEA 1WBBA 3DOIA 4QU5A 2JI7A 5ERXA 2OHVA 2I34A 1LQUA 4DV1B 2FQ1A 1JHOA 4LFAH 1NNI1 4YRNA 4PINA 2GVDC 2D7CA 1JIVA 3P71T 1MXHA 4DM3A 3ZYCA 1NLUA 2C94A 3VNAA 2NQTA 5HV6A 5GMOA 1U94A 2PFSA 2J6HA 4YAJB 3U4DA 3UC9A 3U0GA 2PUVA 4XQEA 4JVSB 2WVAA 4JBLA 1YJCA 3HBLA 4KQEA 3VGJA 2HCFA 4YCLA 3PP8A 5K3BA 3S4YA 2CW8A 3SIPA 1K5GA 4MIKA 3HI4A 2YFYA 5M29A 3EVNA 3D3WB 4F1JA 2PK3A 3QH4A 5JXGA 2W57A 3AZQA 2TSYB 5GJVC 2WSBA 2H8KA 2NPOA 4WLFA 2CJYA 2GTIA 5CA0F 3MJHA 2GCGA 4LKOA 1JDUA 2X4GA 3GZNA 2WNSA 2AE2A 5EZYF 3EZ7A 2ZRPA 3T52A 1YBVA 1RYFA 1NYTA 2AHOA 1JHRA 4IEEA 3FHLA 2WVJA 4H1UA 1KKUA 3ANXA 2XR1A 3UA3A 5SICE 4CEHB 2F9FA 5DQHA 2XE8A 5KFNA 1CZHA 1ULUA 1AC5A 4XKJA 1YL7A 3PVCA 4A3CG 2QGNA 4YP5A 5G02A 2QUBA 5IVKA 3TI7A 1RYSA 2CT8A 3L4EA 4LJRA 5AVVA 1KZ1A 1XYGA 4YV1A 2NXNA 3UWMA 4E6EA 4BUZA 2FR8C 3NKLA 1DT5A 4PZPA 4AQ7A 1MJGM 4J9MA 1I7LA 3RTGA 1TOAA 1K6XA 3HV2A 4K9OA 2IXAA 1TXGA 3UAOA 4MA0A 3ZK7A 4QTUB 3NUQA 1ZSVA 2EBWA 4IGFA 1L4HA 5DG8A 5LYYA 1GO3E 3S6JA 5D2CA 2BQRA 4DV5H 4L5BA 5F21A 2PVSA 4AIRA 5D3MB 3S81A 1YJBA 2D0PB 3SNHA 2F67A 4G84A 3CPSA 5TMDA 1XZFA 2X1LA 2H0QA 2I8CA 5FOVA 4X20A 4CT0A 3AFGA 1UEIA 2FOLA 2H3HA 3L8EA 4LSMA 4D43A 4K6NA 2ERYA 3QELA 4BNVA 3RKRA 1NI4B 5JPDA 4RTNA 2H2AA 3P96A 3E58A 4F92B 4EFMA 3CZMA 1NWCA 2A5JA 1RKBA 2X8AA 1BSVA 2G6TA 4AJJA 2CNNA 3PXCX 4RC9A 1F8UA 1X1SA 2Q07A 3RARA 4ETIA 4Z7QB 4YC7A 4UREA 3NCTA 2EATA 4A16A 2A78A 3TE6A 1TQ8A 1K68A 4PO8A 3FYDA 2C1XA 2DETA 1TO1E 1SWWA 4MV0A 3UN1A 2WB1E 3WMRA 4IWXA 3KDPA 1EEHA 2OAEA 1WOMA 5TC4A 3NAGA 5JAPA 2R60A 3EGCA 5L51A 1MB2A 3KUXA 4G0WA 1ULSA 4MIEA 1BN7A 4Q3NA 3VNSA 4OLHA 2ACWA 4F50A 3I92A 1P1CA 3DBLA 1M33A 3ZJTA 4RM3A 4HQLA 4D6XA 1KOGA 1TO6A 4O7VA 1QONA 3QITA 4ROTA 5EJ5A 3CQZA 3HZHA 3ML1A 2FWPA 4NG4A 4OJMX 5CPBA 3PW0A 2B3TA 4TGLA 1EFUA 3GZTB 4D25A 4E11A 2VH5R 4YMSA 2UZ1B 3WL7A 2IP2A 3L84A 3HB5X 4CQMD 1T5SA 1R9MA 3O82A 2Y1LA 2X3YA 1KGDA 5LP6B 1DEOA 4LMYA 1JKMA 1D6MA 4L3WA 3K2IA 2R6JA 4Y2VA 2H5LA 4K3UA 2FSSA 2IKSA 3K9BA 4MYTA 4F4HA 1T2UA 2VT3A 1ZZGA 3M6XA 1GFZA 2FZWA 1IVYA 1EX7A 1XLTA 2Z3ZA 2TMYA 5CT4A 2VEDA 3L0OA 3N5CA 3G02A 1R18A 3E8MA 4BQNA 3QM1A 2DULA 5LMNH 5JVLA 3Q1KA 1D4ZA 3N76A 5DGBA 2YXBA 5ECGC 3GCZA 4O7YA 4H3KB 2YMLA 2FH5B 3U4MA 1WBDA 3IUBA 4P58A 4BGIA 1RABA 2YDXA 5KFPA 1B41A 3DBRA 3NONA 1QZZA 4YQWA 1T5IA 2OFFA 3SY8A 4II7A 3BIFA 2C20A 2WOJA 4LK2A 2JCVA 1JTVA 4Z0PA 3FVVA 4DR1B 3IAUA 2WILA 5DFAA 1EE2A 3IE2A 3CBGA 1OXVA 4DIDA 1NBHA 5TVGA 1SUFA 2QWXA 3CKKA 1QMPA 3F5FA 3FFBA 4G5XA 1I2ZA 4DRYA 4ED3A 3Q3GE 3ZTWA 2BRUC 5B37A 3ZZNA 5JADA 1C50A 2I65A 1VCIA 2QV0A 3DONA 5GONA 5AVUA 4YJ3B 4ZYXA 4YRBA 1K4YA 5IC6A 3NBKA 3MFYA 4LI0A 1SR8A 3KJFA 3PR1A 3BWYA 2GUGA 3N7UA 1AKUA 2CNDA 1MJNA 2WFLB 1PWYE 2JEOA 1R0RE 3LKVA 2PH7A 2ZIXB 3AJAA 3V4RA 2YFHA 3N1UA 1AV7A 1U04A 3MTAA 4MQFB 4MA5A 2ZR7A 4LE0A 1Q3HA 4MKHA 2MSLA 3T94A 1YD7A 4XYEA 3N3AC 2WKQA 4MWGA 4MPDA 3KL2A 1H2AS 3O94A 1J42A 4UAUA 1YI1A 1PR0A 4MGEA 3RB0A 5BWTA 3F97A 4BMPB 4BCBA 3TDNA 1X8JA 5DTMA 4U7TB 2C28A 1V39A 1Z88A 3GIKA 1GGJA 3TSZA 3EWAA 2QL7A 3D6UA 1UMBB 3DL4A 3LE8A 4UBJA 1I50A 3NEJA 4O2AF 4XWTA 5CX4A 5CW2A 1L9XA 2VS1A 3HXPA 1MAVA 4BZXA 5EWGA 1TI7A 2PSSA 4HQOA 2ENUA 4PYLA 3WLSA 3INYA 1XDZA 1RI5A 1KTVA 4QICA 1JP7A 4E09A 2IU6A 4B45A 5HW0A 1H8ED 3DE2X 3F2VA 2C9BA 1NVDA 4MJ7A 5J2UF 2QAJA 3HYSA 5A5VA 5SZIA 1S8NA 1WXHA 5HRAA 5JHHB 2OFXA 4WLVA 1ZO8A 5LLDA 4PYIA 3T7EA 4XQCA 4P35A 4IJWA 2Y4RA 4JDPA 1F4VA 1NP7A 3PNBA 1TLTA 1QPZA 1UWVA 2H1HA 2QTZA 4OEHA 2OESA 1VLHA 3CEPB 2KB0A 5LP1A 4ZT2A 1ZHOA 1Z06A 1YRHA 5FR2A 1DWQA 3GRUA 1AGXA 1O6FA 2Y0SE 3BKXA 3WGZA 3TIXB 1SIUA 1FTSA 4QULA 4HQ6A 5L40A 3S5UA 4Y8VA 5D01A 3IUJA 4ZU6X 1I0ZA 3DZIA 3ONFA 1U9IC 2REXB 2ZIAA 4UE2A 4BQRA 1GZUA 3V8MA 3C7KA 4MP3A 1CJKC 2ANBA 4TTQA 4ARVA 3DQQA 4UQLA 3QFSA 3UAWA 2A0KA 1G8GA 1A3GA 3EQ9A 1U3DA 3TLBA 4F4WA 4US0R 2AB0A 1TMGE 3WC4A 3HLYA 4JOQA 1PFGA 3TZQA 1P2GA 4RABA 1U9YA 2WE7A 2HQRA 4DA8A 4GZ6A 1DI0A 2ZSJA 2F1KA 1HNWB 2NZ8A 4OLAA 4B2PA 1S7CA 5K5EA 2JAXA 1QZ3A 2Z9CA 2QPAA 2CQYA 3PD7A 4IMJB 5JJBA 3W5JA 4HLDA 2JAHA 3QPWA 3THWB 2FWRA 2I3ZA 2FRDA 3U5ZB 4J9SA 2FR0A 4ZYUA 1G42A 3LKDA 1W93A 3AKZA 2PU5A 1E4GT 2YICA 1AN9A 4KHPH 2O1EA 5NULA 2Q9CA 4M76B 1IMJA 1E8NA 4PVDA 3IPRA 3HKCA 1S9HA 5D84A 3UWOA 4HDNB 4RIGA 2AGOA 1G2PA 3SYLA 5L4LA 3BQ2A 4DSUA 5K0FA 4BE7B 4W1SA 4U1RA 3OURA 4CG1A 1BRTA 1SOWA 4HPWA 4Z7NB 4OF4A 4CEHA 3BSYA 1EP2B 2A3RA 1ZOSA 3AVWA 3CX7A 4NXMB 2QNBA 3FLAA 2A86A 4WECA 4W5TA 1XEFA 2V4ZA 3DDUA 3ENZA 6LDHA 4PNZA 2UYOA 2H2GA 5DHTA 3JWIA 4N49A 1RYHA 1JR3A 1E9BA 3DV2A 3LY9A 5CA1F 3V6HA 1MAWA 3EA5A 2BTQB 4CPDA 3L79A 3LPAA 1GPJA 2ZSIA 2YTZA 3V7WA 1GA1A 1RCUA 3SR3A 4AUEA 2XZDA 4C4AA 5DN6D 4XWOA 4QG7A 4PTLA 1WF3A 5CB8A 4KMRA 2E4WA 5HF5A 3QOFA 5E9AA 1XNHA 4AKGA 4BWYA 4QIWE 4EATA 4BBZA 1YDFA 4FN5A 4PN7A 4H17A 2OZLB 3R8FA 4AX4A 3DW3X 1M8KA 2QF7A 2ZCVA 2OHOA 3TKYA 4RNNA 3D8SA 5BWUA 1TU3A 3C1TA 4L28A 5LQDA 1KJ8A 2F9MA 1FQWA 2I78A 4AZ3B 3WLKX 5LD2C 1FYXA 3CJQA 3BJYA 4JJKA 3QEMA 4MLZA 4DDUA 1U7ZA 2AFHA 3DMDA 3ZNQA 1G21E 1ZINA 2AN3A 1KVQA 4DL7A 4PIPA 1G3MA 1ABBA 4QWBA 3GJ4A 1K6MA 1XALA 4E5UA 2A35A 3K9QO 1RU3A 2OBFA 1OZAA 2XLCA 2A4KA 1NVVR 4PZEA 1JAYA 4ED2A 1SD1A 2AF4C 4XIGS 1II0A 4QWEA 2IY7A 1SUWA 3D6NB 5AW1A 5IANA 1U28C 1FFXA 3JD1A 4U6PA 4IM7A 2NVBA 4Y3UA 1V1JA 3EWNA 3HBMA 1VPDA 5KYWB 4B82A 3DEJA 4O3MA 3AOGA 4GWLA 1QGDA 2O14A 4NECA 4H3SA 1HEIA 2JFQA 4DUPA 1FP6A 3F3MA 4R1PA 3W5HA 2DIKA 4OI0A 3ZLUA 1UC8A 3QTTA 2PX5A 3WK9A 4Y9SA 3A4MA 3EVDA 1IZZA 4ZARA 1P1HA 2UXBB 1P8AA 3FCAA 3QIVA 2IY8A 4G3IA 3CSWA 4PHFA 4WH0A 2SCUB 3R7FA 2PRYA 3LOQA 3LO8A 4BFLA 1KP2A 4N6GA 3KQWA 3HOZG 1ZW1A 2WVHA 1MC8A 2FB9A 3GR6A 2OYRA 3NYQA 2ZBUA 4RJJA 1ZMBA 4B40A 2ZYDA 4UZSA 4L95C 2YXLA 3C87A 2VP3A 1F38A 4RCVA 2XXJA 1PAUA 3JVDA 1YB6A 5DV9A 1PLKA 1Z5ZA 4JYPA 3P2KA 1HFKA 1QZTA 2O8NA 5IKEA 4ZVUA 3WJAA 5EWJB 5TF4A 5KSPA 1J9ZA 4D9GA 4EHDA 1D9XA 1E63A 4WN3A 5CIYA 3RK0A 4IRUB 2H4ZA 3IHKA 4OPMA 5KX5F 4IQ4A 1F14A 4BGEA 1SUCA 3FKIG 3WGGA 4RFLA 4YJGA 3BRWD 4W7IA 5IYBG 1WCMG 5JFOA 1AGYA 3PXBA 4N3CA 1R64A 4JLAA 4RZSA 1DPFA 3G0HA 1PYOA 2GFHA 1MTOA 2HC9A 4BX3A 1Z12A 1J33A 1AHPA 4AG5A 1QFMA 4H7IA 1J5PA 4KXWA 2XUAA 2B6NA 4M9CA 2IYEA 1P31A 3K31A 4UHBA 3I4NG 2OC4A 1O5OA 4YCCA 2C3PA 3L8DA 2DFPA 3TEFA 2KBFA 3MUNA 4JI3B 5AR1A 4AXBA 2XGSA 4WNAB 4XPZA 4JOSA 2FPOA 4YMIA 4GNRA 3L7YA 2HWXA 3NBYB 1UKVY 1SK8A 1ICEA 1BD3A 5F1KA 2GJAA 5HMMA 4ZHSA 4DHEA 4F4YA 4WXHA 1XD9A 1FX0B 1WW8A 3TUIC 1K1EA 1J0BA 4ZICA 4YJ3A 3T5AA 1DFGA 5GP1A 1W36B 1V8FA 3FAZA 3SICE 3UV7A 4MYSA 3H4TA 5EMLA 2W8ZA 2XGPA 2XMBA 2ZE5A 1VSVA 3CKYA 2E89A 3ZV5A 5JVDA 1J5EH 5CURA 3A36A 3AW8A 2WFLA 4NHOA 2ZIXA 5D3ZA 3KWJA 3EPIA 2GRUA 1LK7A 1DAKA 3QX8A 2BTOA 1M6YA 3MBIA 1KVUA 1DO0A 4HVLA 1NKVA 5TJHA 1F12A 3IHTA 4JI8B 5AOBA 1YV9A 4GMDA 2GHQA 1V35A 3EYYA 3FZYA 4EF5A 3LBFA 1UFVA 5CVVA 1K0UA 2VCEA 1Z6GA 3VKUA 1ISPA 2GEVA 2O7SA 1MQ9A 3PTZA 3A6LA 3GMTA 2ZULA 2UVUA 5J1TB 2BH2A 2HU2A 4OY3A 2B34A 2VYCA 2PNJA 3ROTA 5AI0A 4DMRA 2CMFA 4WXMA 3OTGA 4AURA 3VU0A 4R1TA 4YXWA 4N40A 5IUJC 1CVIA 4FXOA 1M6VB 3QXGA 1XZAA 1A2KC 1RXWA 2PKWA 1FRNA 1YBFA 4EY7A 4EGFA 5DXFA 3K9FC 1Q74A 2R5FA 4L8YA 4KVFA 1E2EA 4JI1H 3WGTA 4GYKA 4TXLA 2IA5A 2WA1A 1SZJG 2XH8A 5E6SA 5F9NA 4L74A 4RDIA 3H5OA 3KXKA 5BV7A 4J4TA 4MRAA 2HRZA 4C21A 4XH9B 4ZT6A 3GAZA 4MVJI 4OREX 4KZPA 3KB8A 1N1MA 3GJQA 1ZD4A 1GZ6A 2WAAA 1EMDA 4G97A 2WYVA 1PL8A 1NLZA 1N2ZA 3GEGA 1LTKA 3KG2A 4DR5B 4YI3A 4JB2A 3ETLA 3F1LA 4IY1A 3I28A 4AYWA 3G1TA 2C2RA 1HE1C 1XB2A 2V7BA 4AS2A 1M9NA 4KBFA 1AKWA 2BFMA 4Q0YA 2C84A 3WYFA 3DC2A 3OEHA 3DE3X 3L18A 4JNKA 5ENDA 3QVSA 4BTVA 4P3OA 3AL0C 1CUGA 3UGTA 1M1YB 3QVWA 4DUZB 3IC5A 3H86A 1A9TA 1T1EA 3TX6A 2VO1A 2AH5A 3WL5A 4HVAA 2DFDA 5ALVA 1NMYA 4DNQA 4FTWA 4IHJF 2XIJA 3C41J 3LXUX 5FV4A 5DHUA 3S2ZA 3MXTA 1N78A 4ZTZB 1LTHR 5H1YA 1QDUA 1WW3A 5H0IA 3OSNA 5TNXA 2A9JA 2QM3A 4JVOA 1UBOS 3IJEB 2R3SA 5E7IA 5AM4A 2BPOA 3GLIE 3TLMA 4NCXA 1W2WB 3N2NA 3OPYB 1U1DA 2ZYHA 2W2PA 2PUCA 2OV3A 2UAGA 3H2KA 4PR3A 3MJCA 4R16A 3Q8XB 1GGFA 1FPQA 4RU9A 1P5HA 1BFUA 4DCOA 4KPYA 5BQ5A 3LXRA 3OSUA 4B9AA 3IBFA 4OUDB 3O1HB 2HJSA 2GCEA 3EIXA 2VHJA 5LIRA 3THWA 1Z18A 4C1BA 5A02A 3CLSC 4EPVA 1U0SY 2D13A 4FEAA 2DF8A 1FTQA 1EXMA 3KTOA 3PIIA 3HTXA 4X8MA 2BBOA 4FB5A 1LW6E 3KV3O 3AU8A 4NE7A 3R9WA 1PG2A 4QUGA 5C46F 1OWTA 3KQYA 4R8SA 1V2GA 3LUCA 2OLKA 4UUBA 3WVNA 5CLQA 2XT9A 1TMKA 1I2LA 1KO4A 3C8DA 3SKYA 2GN0A 5M04A 1Z5NA 5ECYA 5G3ZA 4GM0A 4OBBA 1C9MA 3N41B 2VQFH 1IPHA 4NOKA 4OKNA 4TT3A 1PJ4A 3HKEB 4GVPA 2HK7A 3LCJA 2W6QA 1V3TA 5HGXA 3QBVA 2OTCA 4L4UA 4LYGA 3BB4A 3JAWA 3HXTA 1JDNA 4DRXB 3HVHA 1NRIA 2N47A 5AFSA 4YECA 3JQGB 3H1GA 5EIHA 1ZNZA 2Y1CA 3RYHB 2IF2A 5IK2D 2BSQA 2OECA 1UZLA 5A3JA 3S27A 2HY7A 3OZDA 3QKTA 1Z2EA 3TMYA 4D5GA 3D2LA 5KYNA 4KVZA 5KSZA 4OA5A 4LV5B 2G5GX 3MINB 4M8SA 3AG6A 4LF6H 4AJOA 3KP1A 5DHRA 1IVNA 3K6JA 3T3DA 4W1RA 3TAUA 1PQPA 5IPFA 4MS1A 3I5UA 1R0WA 4DV3B 4TUYB 1BKSB 2HRCA 2CZGA 3WLEA 5J2TA 2VDWA 1FYVA 4PICA 2OZLA 3TR6A 4YRSA 1VGQA 1L7AA 4G1MB 1CB7A 1LY1A 5EUQB 4O1IA 4HL6A 5EJ6A 5KS2A 2W9CA 3EPLA 3WK6A 4CXMA 4C4OA 3K9NA 1WUYA 2E2WA 4QL3A 4Y1GA 3DPUA 2GPSA 3EAQA 1W5TA 3CUKA 3ZOZA 4TS4A 1XTSA 2KPOA 2AN4A 3RB6A 2JGJA 5EIXA 1VL6A 4YT5A 3OZSA 1FQJA 2A0UA 4CFYA 1S96A 1LGYA 3TLXA 3WB9A 3QOXA 5JT1A 3IJ5A 4D99A 2ZIUB 1AZSC 1U0LA 2RHOA 4CLDA 5IBCA 1X94A 5LJIA 3D3NA 4D4HA 1A9XB 4RA6B 1QZUA 1Z2CA 1D1PA 4ESHA 5FHQA 2JJYA 3OT4A 5KYWA 4JT4A 4A15A 3I9FA 3ROEA 4E5SA 5B7NA 3T3OA 4AQYH 3OQ6A 2XUIA 3TZ6A 2W37A 4KV9A 4A0FA 5BW8A 3F3YA 3QJYA 2AG0A 3RQSA 1D0VA 3VH3A 4G4GA 3IDFA 4KGZA 3ELYA 2YZNA 2N0SA 2H6EA 2R5NA 5DIZA 3C3EA 3HM9A 1KAOA 1VCHA 2NSYA 2B69A 4Q66C 4EMBA 3FWKA 4Z9FA 2V6GA 2DPJA 4PPQA 2A5GA 1ZA2A 1L8QA 4WQMA 2IHKA 1N6NA 3M1IA 2ZYVX 3PCTA 4UVHA 3WGHA 3KJHA 2DHDA 2AR9A 2RGNA 4KQ6A 4QDOA 4KIGA 2ATLA 2PHZA 3FUXA 2PXXA 1IYEA 2FPPA 4H6VA 1TQDA 2PUTA 2Y2UA 2P4SA 1CERA 5GJCA 2WJJA 1SUBA 2X1VA 3PC2A 5DGXA 2PJUA 3JD3A 2IIPA 4P93A 4L85A 2A5DA 3V1KA 4JJZA 4DTCA 3PNPA 4ZDJA 3OO1A 1ZQ9A 4L16A 1G5TA 4YK7A 1ODJA 2P5SA 1YR8A 3NVMB 1FSFA 2AJTA 4K6MA 1EK5A 1H2WA 1XRQA 2J3LA 3Q5EA 3ILHA 1WDWB 4TWIA 1O0SA 2FV8A 3NRBA 5C8YB 1VGRA 3AUFA 3ZCUA 5L1JA 3A1EA 3L92A 3IL2A 6REQB 3J80A 1CRWG 3V2GA 4K9DA 2FZGA 2H4YA 1N0VC 4YCAA 3NHMA 2G9RA 5LA6F 1RWXA 1VXOA 1NN5A 2EP7A 4DT1B 1N2EA 4RFSA 3V9AA 1CF4A 4UBKA 3DWGA 1XTKA 3WFJA 3L43A 1T1RA 2LCFA 5F5XA 2UVPA 5C80A 3KQKA 4ND1A 4DMGA 2XMPA 3WP1B 4FP9A 1R0KA 4NFYA 2OT3B 1LLCA 4J75A 4D9IA 1GZSA 2OBXA 4KXFB 1JDSA 3DEIA 4CF3A 2B7LA 2RFLA 3ND6A 4BATA 2EG9A 4L5AA 2OZVA 2IXTA 5CAEB 4ZANA 1KYXA 3B2QA 1GSOA 1NOJA 1M0EA 2G25A 3KUDA 4A8PA 5EVCA 5AP9A 4P4NA 3UMFA 3RIGA 3N0VA 1BAPA 1FCJA 1CTQA 1M34B 3U9TA 8LDHA 4D0GA 4NCJA 3BGWA 4BBPA 4LH7A 3N2GA 1UADA 3LM8A 3A14A 4EYIB 3E1SA 3PUXA 4IQ8A 4BNIA 1QQAA 2C3YA 3ZHBA 1WRVA 2H5JA 3AUUA 1E1NA 4P32A 3QBTA 1Z83A 3SEQA 4DYDA 3MJFA 1Y4UA 1KYZA 3CZRA 4V1CB 4AM8A 1CR4A 1JXMA 1AN7A 5DG9A 3WZMA 1ONOA 4ZALA 2G9QA 2PUFA 1LC0A 5JZSA 5CVJA 1B8VA 2I4MA 5AM1A 2MU1A 5BVHB 2FK3A 1VE9A 2QXYA 5DBGA 2VUGA 3LNCA 3LFUA 4EA7A 2QP9X 4WCFB 3D5QA 1ADBA 1ZH6A 1VCMA 1QDLB 4HH4A 4C4PA 1EM6A 5DEOA 4TV9B 2J5BA 1NJ5A 2Y0DA 1VSTA 4FEGA 3B3AA 5JR3A 1T8RA 1PL7A 1GRQA 3MOSA 3U1VA 1GUFA 2HRDA 2ZSHA 3DXXA 4BO8A 1V2HE 2J5QA 1WNFA 2C2WA 2D06A 4REQB 4RVSA 1YKFA 2VI5A 4X84A 4BLVA 2BFAA 3I4FA 2IJGX 2WJHA 4GLXA 1OXMA 2XZPA 3GLFA 3D2CA 4XWAA 1YOBA 4EBFA 4NU0A 2FW9A 2G3YA 1YA4A 1FU7A 3NTXA 3H05A 3TW0A 5TE9A 1D2NA 3HGMA 4DKJA 1CY0A 2QKYA 4GI5A 4AJHA 1KXJA 3CVXA 4UE3S 2OA0A 4BWSC 3DQPA 3C4JA 1W8DA 1NVAA 4QATA 2GM4A 4LF4B 4Q3EA 1XQWA 2HSGA 1C4KA 3O31A 1QCCA 4BN4A 5HE8A 4DV6B 3CX3A 2VPSA 2QTLA 4D9KA 1M3SA 2HHHB 3AJ9A 4QE3A 3BX1A 2HG8A 1F2TB 3O8OA 3PFHA 3ZTYA 4NG5A 4Y6PA 4KFSA 2ZJ8A 1H9AA 1NBEA 1XAHA 1MTZA 1ZVVA 3EA4A 4N5DA 1B3BA 4Z9YA 1UPCA 4P34A 1UANA 1HYQA 5JISA 2P9HA 3S55A 1TJ5A 4ER7A 2QRUA 1DBWA 3TZLA 2B8NA 3A2KA 1C7FA 4S24A 3LUDA 3U3RA 3U4QB 2QM8A 1UZMA 4ZKEA 5B3LA 1YVEI 1EVKA 3ZDDA 4GXTA 4HNHA 2G67A 3WV5A 4KUHA 4R1LA 4GVLA 3F6PA 2XA9A 4MZDA 4G9GA 4D41A 1Y1PA 1XC7A 2GDZA 3RJTA 5HJ7A 5BSEA 2J9ZB 1ZN9A 1IH8A 1HMYA 3JQAD 3CT6A 5B2EA 1E1CB 2P79A 3HJAA 1BHO1 1NGSA 2UZ3A 2EFDB 4MCJA 4K1XA 4OYYA 1QJ4A 4V03A 1LNZA 4L4XA 4RELA 1ZD3A 1OJ7A 4P81A 3TCXB 3RJ9A 3ZI7A 3TBHA 3EVGA 1W4LA 1FPMA 3RFXA 1WMDA 3TKAA 4M0PA 3MOIA 5FOXA 3CRQA 1FVFA 4YAEA 1H8HD 1LV7A 2HMUA 1EGHA 4CW7A 2R25B 3OQPA 3KRTA 3V80A 1RHMA 1SK9A 4C4ZA 4G63A 3MS7A 4Q4HA 1NQWA 3HDGA 1I3NA 1T34A 4K8OA 5HIKA 5D3KA 4DSNA 1DPGA 4B6JA 1GITA 2XBLA 4JC4A 2GN8A 4ZA2A 3QV2A 3AI1A 1BVYF 5ITWA 3V7NA 3ED5A 2ZXFA 4XWYA 2AKYA 4O0LA 1VXRA 3RYHA 4QUEA 4AAYA 3DHYA 3PQ5A 2JIBA 1QCDA 1I6WA 1LLUA 3QNWA 1OXKB 3NH9A 1L7DA 4MS4B 3FD8A 1YA8A 3QTLA 4BCDA 5BR1A 2AA3A 1SKQA 4DCUA 4IR1A 4I55F 1N33H 3HMQA 4MS3B 4DIMA 4RWZA 3VR6A 2GTHA 1W96A 3GIDA 2IELA 5IN5A 1JAZA 4B4WA 2OGSA 2RH5A 1TM5E 1T0UA 1RI2A 1EKXA 4OHFA 3SEFA 1AO0A 3GHHA 1EWRA 5KDLA 1NG1A 5DM70 3CISA 3TZCA 3KOXA 1ZEJA 1LVHA 3Q7IA 3RNLA 3H11B 2YW2A 5L7YA 2HMAA 4Q7LA 5LB2A 3NAMA 4MX8A 1TEZA 1I7DA 3MLAA 1ZXBA 1AG9A 5EIEA 4DY6A 4AKHA 1PR5A 2EZTA 3PNYA 4MV1A 3G2MA 3AY0A 4J0DA 4EIWA 1JT2A 1R2QA 4ZZ1A 5HOEA 1U65A 1KZGB 2JIRA 3REQB 3EQ2A 2J0VA 4D92A 1ABEA 3USES 1E2GA 4RO0A 4KMMA 3FWHA 3EW7A 1CY6A 1P1IA 1XEWY 4AWBA 1VIAA 4MAFA 3F6RA 3E2MA 1OOEA 3WMEA 1ST2A 4EY4A 3VSDA 1G3IA 2DWOA 3PJDA 1S03G 1VKNA 2IXDA 1R9JA 3QVGA 4X3CA 3IV9A 4HX9A 1UIMA 1U8ZA 1WXWA 3SN6A 1WL8A 3WIBA 3HLKA 1JWLA 1N2XA 4RA6A 5C81A 4BQFA 3DDCA 3F9IA 3EDRA 4MDFA 2ZQYA 4HWRA 1GG2A 3WGNA 4XZ3B 4FGJA 2D62A 2W6JA 4EELA 1HT3A 3A4YA 3PVSA 4WFIA 4ICIA 4OI4A 5F9MA 4W82A 5I4BA 3VTZA 1QLJA 4QC2A 2UUCB 2EJ2A 2P3SA 4BY9E 3CZCA 5CGZA 3MMSA 5FUMA 3T5DA 2BDTA 5CFPA 3OJWA 4X9XA 5IAKA 4G4IA 1CR0A 1FRFS 2Q0SA 4JBXA 3LOUA 4JIMA 5LZ8A 5CEJA 1IQUA 4US2R 4GZ3A 4W9MC 1HY3A 3LZ6A 2DAPA 4GQIA 1M7GA 2ZRKA 3AILA 1AZLA 1JWAB 5A9TA 4IDNA 4JOCA 4XFJA 3W1GA 1QF6A 4YRRA 3OCZA 2QLNA 5C8ZA 1MLDA 1FDUA 1BXGB 2WZCA 1T9KA 4IV0A 2XIQA 2V98A 1QVZA 1L5VA 4JLUA 3BYZA 4MKGA 3H4DA 1BQ3A 2G1KA 1RLJA 3BTOA 4A0GA 5FRDA 3GIMA 5EKUA 4B2IA 4JKIA 2FUG6 4PSKA 2F64A 4PWYA 5L9AA 1Z74A 3MWEB 4KAAA 5BQFA 2HB6A 1TEVA 1BRMA 4Z7JA 3TGLA 4CGYA 4E33A 3IR5A 3U7FB 5AVOA 1UJBA 1X86B 2V8BA 3TLEA 3VDQA 5C8YA 2BUBA 1FP4B 4TQRA 1QHSA 4CG3A 3JRWA 1X87A 3K6KA 5BMVB 3PX7A 1KKMA 6REQA 3D8BA 3MWJA 3V34A 1KY2A 3AV0B 1Q1NA 1BEUB 1B23P 4KLZA 4DQNA 4LVUA 3GP3A 1N48A 2P62A 1WM1A 2QDXA 4DT1A 2Q5IA 4YN3A 1IXZA 2VBFA 2XUQA 5J63A 1P72A 3MXOA 3DUFA 5JD5A 2JA7G 4KR7A 4I5IA 5LNK6 3OJFA 2JVIA 5CVDA 2QAGB 2CJXA 5JD3A 4FZVA 4MQMA 4EYSA 2DABA 3ZZTA 1ZPDA 2C95A 3O9VA 5HGJA 3D7KA 1DCMA 1EDBA 4UVIA 4QXPA 5DWQA 3NYRA 2GN1A 1NFFA 3QFRA 4LDQA 1S0OA 2CDBA 2BEVB 4G8BA 2YYAA 3DW1X 2KYRA 4R0NA 3DFUA 3PLNA 1M34A 3P9QA 2RHTA 1ISRA 1T6BY 4BB9A 4Q82A 3GLGE 1UFKA 4EHAA 1ENPA 4MV7A 1NRWA 1NZJA 1SQ5A 1AQ6A 5A04A 3DFZA 5HF9A 1NA5A 3OJEA 1POXA 1N0IA 4YBRA 1MEOA 3IKVA 5JARA 3LT0A 4MVYA 1E0DA 5KCMA 4X7MA 2V7UA 5J5CA 1MB0A 1JG1A 4J9UE 4W5QA 4J9QA 2GARA 4QDXA 4ID9A 2C5GA 3VOBA 2DBZA 2NZJA 3V55A 5FWDA 3CE9A 2WNHA 3NV9A 4RTQA 3IPCA 3K72B 5AXCA 4UM9B 4OVKA 1QQBA 3PGLA 1FX1A 4AICA 1JHMA 1O7JA 4PC6A 1FF9A 1EVYA 5KSWB 2EJ3A 5HTKA 3AW9A 5FADA 4D8WA 4DV2B 4QXMA 1IHPA 3L4KA 3W9YA 3ZNNA 3O47A 1DIHA 1J1ZA 5B7GA 3TZBA 3S7TA 4Q4CA 3IDSA 1FBNA 1DGQA 2ZXEA 3KCNA 1CDZA 3H4MA 4I46A 3WDLA 3E4CA 2MSCB 5AW9A 1TAQA 4QXOA 5B55A 1IJBA 4P9NA 3VAZA 3DVLA 4ZVVA 4REQA 2RK3A 4YGYA 4PAOA 2CUZA 1NXVA 1X7YA 2G6BA 2H65A 2WHEA 3STVA 4BFUA 2O5VA 3T3PB 4KWTA 3PZBA 2C7VA 2FF7A 4BX2A 1W88B 4YO8A 3NV7A 2Q9BA 3N2YA 3PXXA 4BWFB 3PFNA 3BHIA 1ATZA 3WX0A 1QYIA 3VFDA 4QDJA 2JGKA 1CUAA 1KAMA 3A25A 4P31A 3VDNB 1I2CA 4L22A 1E4YA 2CXQA 1SFOA 1J1UA 1CUWA 2XB2A 1BCRB 5M3BA 4CMAA 4A36A 4D4LA 3PEEA 1G60A 5JO9A 4TQ9A 1GPLA 1TQ2A 1A2BA 5FR9A 3GOQA 2HM7A 2EG5A 1FFEA 2Z56A 1SBNE 4NMHA 4M54A 4ZOAA 3CEAA 4EB6A 4P6VF 3UHPA 1EB8A 1XTQA 2PMCA 1Q7GA 4IXMA 2HT6A 1COWD 4N5LA 3H5VA 5AVKA 5IM4A 2BSAA 2IS2A 1AQLA 2XUKA 4W5WA 4H0CA 2CXNA 1HK7A 2F1OA 4QJ3A 4HB3A 3GUUA 1XFDA 2QRJA 5K0SA 4HVCA 2PT9A 4EBCA 3CWZA 3KQLA 1U8FO 3CCCA 3I6ZA 3QKUA 3TTSA 2I3BA 5JSZA 3I23A 3A4TA 3ADPA 2V3VA 3C16C 2J3KA 1XLTC 5D8DA 2DJ5A 3KJXA 2JFWA 3K0AA 1W75A 3FPHA 3NS7A 1W48A 2PV7A 4AWAA 4LV6A 4F3NA 1BH2A 5E6RB 3IDOA 4TLDA 1KQGA 1QK3A 1EKVA 2PUHA 3BE4A 1U1IA 3Q0EA 4O5OA 4NV0A 1ZVQA 3S8EA 1OWNA 5AHOA 5T64A 1BWRA 4A27A 2Z1MA 3LZCA 4UBIA 4EDFA 4AY4A 3QVUA 1MX3A 2G09A 3TB4A 5EJMA 3HDTA 3U9LA 1IZ0A 3JQPA 1HDOA 5IABA 1RRKA 4YUXA 4BLTA 1E2DA 2IZ5A 3NIBA 2EKPA 2W9XA 4GP9A 1XDNA 1IZ7A 3KS9A 4LZLA 3HBFA 5TQ0B 1DBSA 4MS4A 3SBEA 4YTEA 3LHKA 2FOXA 2OBNA 2DFTA 1IZYA 3CR7A 1PFQA 3UTCA 1U0GA 3WRWA 4HH0A 1PG0A 3ZX4A 2Z30A 1FA9A 2G77B 3N6RA 1NW4A 4H1HA 1DTEA 4KH1A 3TNLA 4PQEA 1XZJA 4AJ4A 4DZTA 4DVJA 5I01A 2PQ2A 4GR9A 4LRWA 3VTFA 3I9JA 1QHHA 4QECA 2VIIA 5ALWA 1F1JA 4FQ8A 2CLCX 2VRWA 1O8CA 4KCGA 3TLGA 1Q57A 1XMQH 4NQRA 3R74A 3TEJA 2O5EA 3FZQA 1GLVA 2PX3A 4U7PB 4ECZA 3M70A 1UJ4A 3T7RA 1CS0B 5CFQA 1XDWA 2GJ4A 4DCJA 4N65A 4BVAA 1UDCA 4R4JA 3C48A 2R97A 2AGVA 1HBJA 3RVBA 2FPLA 1YR9A 4B6SA 4YAJA 4E70A 5FXMA 1OWMA 1IBKB 2NZXA 3D6FA 1IPEA 5DT9A 3PXDA 1NT4A 1A5SB 4S2UA 3BF7A 3M4XA 4XZ3A 4B81A 2V1XA 1GQYA 1QF7A 4JLSA 4NMMA 3HDQA 4KO8A 1FFSA 2O0JA 1I0LA 2WTMA 3BXOA 2CLMB 3D3WA 1ANKA 2I29A 1NBMA 4FDMA 2BQ3A 1J2JA 4FB4A 4DCPA 3UK6A 1BXZA 3BGDA 2N9UA 2Z1NA 5EHZA 4KQWA 3IMKA 3SYTA 4EEYA 3CF0A 2J46A 5C37A 2RH4A 1N4DA 1LRJA 1Y6JA 1C3VA 3PL5A 3LECA 5FI0B 2G76A 2DGDA 2GB4A 3RBVA 3RV3A 2B83A 2WLSA 3GAAA 2PRKA 1QHFA 1PS9A 1XDSA 4RQTA 1UMCB 2JAOA 1UINA 5J1SB 5HZHA 3DUWA 3H0GG 1KP3A 4K46A 3F78A 5I8ZA 4E5YA 1F3LA 4BB6A 2ODEA 1JZQA 2ZRBA 1QRSA 2VJLA 3SZLA 1L4BA 3E23A 4RH0A 3RQIA 3AF6A 3BKWA 3DO8A 4GRDA 4NULA 4DR4B 3HDVA 4HH3C 5G0TA 3MWEA 1YR1A 4X1KB 3KCQA 4FE7A 4LY9A 3FN4A 2QI9C 2HK8A 4L8GA 2B4TO 5FT9A 1T5BA 3KJEA 1U3TA 1I1HA 1RHRA 2O7VA 5E2BA 2G1AA 4TQUS 4QSMA 1XA0A 3F8SA 1FP4A 1PWZA 3ROGA 3JVVA 5BMVA 4ZAXA 3DVQX 2DHQA 5FTWA 2OWOA 1Z0AA 3G85A 3ZGLA 4BXXG 4CC6A 2VHQA 4BYMA 2CXTA 3NB0A 4LY3A 3HSYA 3L8GA 3FDJA 5D3MA 4P3KA 4CEJB 4FYMA 4M89A 4AXXA 1NE7A 3RVQA 4QQKA 1W85B 5DOZA 4FFLA 5MN6A 3OQJA 3DPIA 3H5RA 3C45A 2J3JA 5C9ZA 3VI4B 4BLRA 1ST3A 3PHGA 1NI4A 4LS3A 3WIOA 1KU6A 3UJCA 4LHWA 2RKBA 1EU1A 4RJKA 1NDHA 4HLCA 4CM9D 5BNIA 1O94D 3M3DA 3WYDA 4TYMA 5ADWA 2CV0A 2P2LA 3LC2O 2VTKA 5T41A 4Q6WA 5IKMA 2FRDC 3ZGYA 1CZKA 3FYCA 3FTEA 3GX1A 2I2AA 4YP9A 1PCXA 5BR7A 1O5IA 3Q2IA 3I9V1 3L1VA 2YJNA 3ZK8A 4DSTA 2AS0A 1UKAA 3GLKA 3TW6A 4MI3A 4Q3CA 2RK6A 3WB2A 3ZEAA 3ZZ0A 1Q0TA 3SE7A 1KMHB 1AK1A 2GX6A 2RGCA 2GZSA 2AKEA 1SOMA 2VSXA 2YV3A 3K0FB 4KV7A 4BBSG 3I2IA 3AERB 1QTQA 1PFVA 5ANRB 4I36A 3FTPA 3VPAA 1NZDA 1AGPA 1LS1A 1Q44A 1RWKA 1N92A 1JEEA 1QP4A 5F9LA 4MB0A 3IGFA 5KNDA 2X5XA 5AJYA 5LN1A 4YASA 1GAJA 2ZI5A 1GTVA 1YRLA 2QT9A 2UZ1A 3IO3A 1F2VA 3GUYA 3UCFA 5JC1A 3UW3A 1P19A 3V8EA 4BFTA 3GILA 4CRWB 3KJGA 5LP6A 3Q2OA 2HGWA 1T9AA 2ZBDA 4J4BA 2ZOSA 1AK9A 1EG7A 3TIIA 4HX5A 4RLFA 1VJ5A 2O3JA 2I2CA 4L78A 4JSYA 4IHQA 1B7GO 4F3KA 2FP3A 1T94A 3BSFA 2WV9A 1R1DA 3HBAA 2QJFA 3SYRA 2I4NA 3LLCA 4Z2YA 1SGWA 3BJRA 1RC1A 2H31A 4H1WA 4BC0A 5E0OA 4W5RA 1J8MF 1C0PA 2C7BA 2PO5A 2YWGA 1ZISA 1VA5A 2HJWA 4U02A 3SEZA 4YRGA 1BA2A 2BAGA 4X93A 4O8ZA 2EBUA 3MRSA 2BISA 3LQ4A 1N5DA 2ZT6A 3X43A 3V32A 5IHPA 5KIAA 1SUIA 2VDQB 1KSJA 3G49A 4NV3A 5AVZA 4RAOA 1YZHA 4DUYH 4I66A 2UVQA 5KWSA 4IQGA 4QREA 4BNLA 4PZLA 3UA4A 1PL6A 3EDYA 3IP7A 1MG5A 4E5KA 3SZ3A 4IWYA 3V1NA 4QJ5A 1SCAA 2HEIA 3HMKA 2OBYA 1KMIY 5EE5B 3KVRA 5AYVA 3G2IA 2MSNA 1M5UA 4B09A 1GLNA 2DTXA 3LYLA 4DV7B 3N70A 5EKXA 2Y1GA 1P3JA 3KT8A 2Q1YA 3IAAA 1VFPA 4G41A 4GLFA 3NQ41 1XVUA 1PVOA 1T9HA 4HYQA 3QXHA 3I9MA 4NV1A 4OGGA 5ELMA 4TMKA 3I62A 2B61A 4P5PA 1EDOA 1VIVA 3DLPX 3AR5A 2ZJOA 4RESA 1LQ2A 3JQDA 4JB0A 3DDZX 4RD2A 3H9GA 1VZ2A 4NK4A 4LF7H 3PCXA 4EG6A 1UBTS 4DL5A 4RMJA 3VR5D 1X7XB 3T8YA 2QVCA 2I22A 4J7CA 4YBZB 4IIFA 3AY3A 2QIPA 2CNUA 5CCXA 2PEZA 1HM5A 1Z8DA 1XMOB 2OQVA 1BX0A 4JV5B 4AZ0B 2G9NA 3HJTA 4DSZA 4MQFA 2VPZA 2YVKA 2HMSA 1IN5A 2PFGA 3RVPA 2ALZA 3VPHA 3A28A 3CZ9A 2PR7A 4QEKA 4TTJA 4ARCA 1PJLA 5A2GA 2QVXX 1PGQA 1TJ3A 4NPCA 2HADA 3MFIA 4F3RA 3I83A 2W58A 2DB3A 3FE2A 3QPVA 2XOKA 4QXQA 5CRIA 3KOUA 1HE5A 2QZSA 3CFYA 1UMBA 1Z62A 2XMQA 2P8SA 1HKUA 1SZPA 2PQ0A 3RJ5A 2WU1A 3II6X 4X5OA 1ZJ6A 2YMQA 1VMKA 3BK1A 3CYFA 1J9EA 1HQDA 1OXBB 3L0PA 5DNWA 3S2YA 3CT4A 3SG0A 3RSLA 4R5MA 2DQYA 5KOYA 4WBXC 4WE3A 4UE6A 2ARKA 1KI7A 3FWPA 2PGLA 2WAOA 2JGLA 1LPPA 1QNFA 3U80A 3IE0A 1NX9A 4FUQA 5F77A 3DMRA 1TU0A 4NYMR 2EEZA 2GJSA 3BDVA 5K8UA 2C42A 4ZOLB 4MUMA 2BFOA 3DXFA 3FPLA 1GG8A 4BX8A 3HA7A 3NORA 4G8CA 4DQKA 3QF4B 1XCLA 1ZSNA 3CKMA 2CK3D 1W30A 4ZT7A 5K8VA 4S1OA 4J9KA 2V6MA 4RPJA 4PE5B 1FYFA 5DI3B 3N75A 1NF2A 2VK2A 4I1OA 1RQ7A 3L0ZA 1JSZA 3TNJA 3RWMB 4RNDB 1TAGA 2NO5A 3HGQA 1RIIA 5LXTF 2BUAA 3FMIA 2WAYA 5JNUA 4IJVA 3UMRA 5C1PA 2G40A 3ZX5A 2QXUA 3C97A 2LIPA 4ZZIA 1U3FA 1P16A 3OZUA 1PNVA 4YYZA 3CJRA 3R44A 1NM5A 2RGDA 3IMEA 3ZBUA 3DGEC 1B42A 4NCIA 3FB4A 4E31A 1WVMA 1HG0A 5B1EA 1SVWA 1A97A 5I5XA 4R1OA 4FYVA 5EIBD 2X8BA 1XRLA 5E95A 3VGPA 4LBYA 3T41A 2BMAA 5HFNA 4CMCA 1IBMB 1Y8AA 2EJTA 4R83A 4M36A 1HTWA 4L2IB 4E5NA 1KBOA 2QRGA 4ECRA 2XTNA 4A23A 5DF1A 4EENA 4DDKA 4NCBA 3H13A 2EBHX 2UVWA 2HHJA 5EOYA 4UC0A 5TY0A 1W0KD 2NO0A 4D74A 1T1IA 1FSGA 3MWMA 3QU5A 3L8YA 5I9LA 3N6XA 1K1QA 2B8JA 1VYTA 5DYNA 4HDNA 2J9YB 3WK8A 2EGGA 4DL3A 1JFFB 1JXOA 2G0TA 4HATA 3A3YA 2JLVA 4BNUA 4JEHA 2PD6A 1UEJA 3K6SB 3I8SA 3FMFA 1AZTA 3DHWC 2R00A 3MCAA 3BOSA 2HA2A 2YYYA 1BYIA 1U5AA 2WSSA 4A4DA 4R8LA 2WZQA 2BMWA 2QVYX 3NHFA 3OEEA 3BCSA 3O4IA 2PJZA 4OFXA 2PLRA 1O58A 2BTQA 3D3KA 1E9AA 2NO9A 4YLEA 3ZXYA 4V0RA 3URKA 4BMOB 4MHOA 5UKDA 4QBHA 4B7ZA 1NVGA 4GIBA 1N6IA 4JWKA 4YPFA 4F38A 2A3NA 3HO8A 1YOVB 3DCNA 1W47A 3L6UA 1RJFA 1N2OA 3DE6X 4IH1A 4FU0A 1C9EA 4URXR 3JZIA 1XN1A 2VUMG 1RLUA 2RAPA 3IEXA 3OKPA 5GIOE 1T3NA 2D3WA 2BLLA 1W87A 4ZV7A 1MVNA 1XPUA 4HLUA 3BZUA 1OGIA 2QYSA 2E48A 2WE6A 5JUMA 3LP8A 1USWA 4A9AA 1W85A 4DREA 3O83A 1IIBA 4RTKA 4KX3A 1R8JA 3SC6A 1HDGO 4B3GA 3BRQA 4AZ3A 2ZYWX 3PXEA 1P44A 3N2LA 3BIJA 5JD4A 1JA1A 1KEEB 1YFZA 4CODB 5ERGB 3SKVA 2GRAA 3DMHA 2YS7A 1ORVA 2C88A 5DO9A 5F1PA 1ENYA 4H7DA 3ONNA 3RVOA 1K8QA 1TCUA 5HNKA 5JOQA 1AUPA 1P3Y1 3JQBA 1PJBA 3MHPA 4GAEA 2FU5C 1NJ6A 3HUTA 3DZJA 4E4YA 4HFJA 1CY4A 2H1LA 2R6R1 4RZIA 1DXYA 1EIWA 4XEHA 4NNPA 1M5TA 5C3MA 4MUIA 1RP7A 1ZNXA 3BD6A 4AO6A 1HZZA 5CXSA 3WKDA 4H3HB 2QW0X 2E0IA 1N34B 1P2SA 3L06A 3EMBA 4D3YA 4O7LA 2HHAA 2ZS9A 1D3AA 1GA6A 4IGEA 2R6HA 3OZBA 4U7FA 5IYCG 3LPLA 2SCUA 3VYTB 5E38A 3D8NA 4K87A 5JQGB 4DDVA 1JKIA 3Q2KA 1I4EB 3A8TA 1EGVB 5JZMA 4U6SA 3L7JA 1TKRA 3KHSA 4KNYA 3PHBE 4IOJA 2Z6VA 5TEVA 3ORSA 2ODTX 2YS6A 1ISFA 1V6CA 3R3SA 3LPMA 3K70B 4ZFNA 4WZBB 4GSLA 5IAJA 3KE8A 2FZEA 4H3VA 2MR6A 3A1CA 2H59A 1AN0A 5DOVA 2QG4A 1KHTA 2FUCA 4BTLA 1J0CA 2OV4A 1PDOA 1XXHE 2VDLB 5REQB 4DMCA 4DZRA 5HKKA 3OIWA 4KQMA 1EG2A 3MTQA 1SHKA 5EWJA 4H59A 1WZIA 1B43A 3O4JA 1J0EA 3JWGA 3BK7A 4YAWA 2HJGA 3VNUA 1ORRA 2F3TA 1WDMA 3ABSB 2OMKA 2YQ5A 3K1TA 1K89A 1JKFA 1RHKA 3W7VA 3WISA 3VO9A 4WL0A 3L8HA 2VOEA 4KO4S 3OHBA 4X65H 4UZEA 4X7BA 2P6NA 3JXEA 3EUWA 2KQUA 3DS8A 4OP2A 4IAOA 4MIOA 2R6FA 2IEBA 2WNIA 1WE2A 1E2MA 1G20B 1MB3A 1R0SA 2Q1XA 2DQ4A 3OAAD 1U8XX 1DINA 2WKRA 3U26A 3K35A 3NHSA 1DV2A 2CVQA 5FYQA 3ORQA 2B9EA 4U2GA 1ABFA 5T57A 2K7FA 4FHZA 2ORWA 3AZOA 4RTMA 5CXUA 4WNAA 3KSMA 2O6HA 3AUTA 3NI2A 4WXEA 1VKRA 4E13A 4DWWA 3OJOA 4UM8B 4RX1A 3EF3A 3UAXA 5KHOC 4MPTA 2VP0A 2NU7B 1PK9A 1N6LA 2Z95A 5FR1A 3LGAA 1FX0A 3NBZB 4PO1A 2QD3A 4DAEA 3GN2A 1LX6A 1MAAA 1H0RA 3EUEA 1JLKA 3M4JA 3VUFA 1YUMA 2DRIA 4XOIA 1SXIA 2JLXA 1W581 1X7XA 2RHMA 3OHAA 3EG9B 4C4RA 1K3TA 3KB6A 1GPH1 4FN4A 2M6KA 4B46A 1J5XA 2V8OA 5L7TA 3WGLA 4PZ9A 2PQMA 4PBCA 3HE3A 4EYEA 1XQ6A 4WJLA 3JQFA 2WVGA 4PBSA 2FMXA 4LGCA 4JXXA 1TZJA 1YK1A 1FYDA 3EHEA 1TKCA 5AJXA 1Q17A 4C7VA 2BR0A 1RHQA 5JSFA 1C8KA 5LU8A 3FF4A 1T5TA 3UG7A 2PCJA 4QHSA 3D02A 2FK8A 4G5YA 4EB8A 2W71A 1A50B 2C98A 2KE5A 4MUBA 1M6VA 4L6CA 3HCCA 5L8VA 2V96A 2CNWD 5BQPA 3ZHYA 4QVIA 3QPDA 3T1VA 4NS1A 4TKUB 4RPHA 3GARA 3K05A 3UGQA 2EERA 4ZEVA 3CUUA 3D4PA 2D2IA 4GMFA 2OORA 4KWEA 3CG4A 4MWTA 4P22A 2VPPA 3NHUA 2NV0A 2PBLA 1LJUA 2ZCUA 4YEDA 1I6KA 2PT7A 3QLVA 1B93A 2QGZA 3TW4A 1GXSB 2OGTA 2CLFB 3HNRA 3NUAA 4IXTA 3H20A 3NVDA 3CVJA 3FX2A 2Z2IA 1A48A 1GPMA 4URHA 5AJHA 5FIUA 4B0OA 2IUSA 4QPDA 1FNSA 4P83A 3U7IA 1F9EA 5JS8A 1J25A 2VATA 4A5SA 5IJXA 4CCWA 3DAFA 2O2IA 2Y1OA 2ZJTA 3QF4A 5K3DA 3CUSA 3GJ8A 1GUZA 4WLUA 3WWOA 3I2JA 5ELXA 4FNOA 3SHWA 5YASA 1NFQA 1G8HA 2VJDA 3WOVA 1L5HB 2Z6UA 4PCUA 4YMLA 3OIVA 4IUYA 4Q1BA 4UMFA 5L95A 2I2DA 1GM5A 1PK8A 3R5SA 2VSOA 1M1YA 4FNAA 4R2HA 2MINB 3OTIA 3WMXA 2WQ7A 5I5WA 3KE9A 2C1EA 3ETHA 1QYRA 1S9DA 2QU7A 3FJYA 2CXXA 4M7EA 1QO0A 1NJ2A 3LDHA 3W5IA 1RBMA 3I04A 1Y1LA 4JWTA 2QP4A 5KU1A 3BQ9A 4B48A 2IEAA 4XRGA 3AI3A 2C2HA 2X1MA 1A7AA 4MTLA 1OBCA 3DYBA 5AD1A 3R3VA 3PUVA 5IVDA 1P33A 3SBOA 2AZTA 2ABWA 4Q18A 4RY2A 4UAGA 3OPYA 1VJGA 4JROA 3QQ5A 1W6RA 3VR4D 3ENWA 1ZD8A 3EFOB 2C9ZA 3RR5A 4YCDA 1Z35A 1YAJA 2YC4C 3KHKA 3O4FA 1UPFA 3GO4A 2UYCA 3SR0A 4E15A 4OUDA 1QFSA 3HYLA 3HDHA 5EZ5A 4TV8F 3VSCA 3RRBA 3OZRA 3HR8A 3MCVA 3OE4A 3OLXA 4LJ6A 1JEOA 4OHZA 3LNTA 3DTNA 4L5JA 3WLMA 5JZBA 2VPYA 3WNBA 1XLVA 2IMWP 4MMXB 1YRWA 1RSZA 1GKLA 2ZT7A 1NIPA 3HCNA 3RK4A 1SCQA 1UC5B 2WD8A 3IQHX 1QE5A 5GADl 1JFFA 4N03A 2WT9A 1GPWB 3LT5A 2EXXA 3STWA 5AVWA 1FDTA 3K6SA 1UAAA 3GT7A 3HKEA 3R5KA 4WA7A 4YCJA 2ZJ0A 1AT1A 1P8JA 4DRXA 2QTHA 2VR1A 4BLQA 2QUJA 5ALJA 4AY6A 3JQGA 3QQMA 3REFA 1NDQA 2RGUA 3JRNA 1YS7A 1Z68A 3DFFA 3IJPA 3M6AA 4M0FA 4XA8A 4O86A 4OSOA 3B9RA 1MOSA 1W46A 4KC0A 2LDBA 1PTKA 2D2VA 2HSJA 3W8NA 2WFZA 5K99A 5TMPA 3SBDA 4X94A 1KZ7B 3MINA 1MA3A 3IAEA 2QD1A 2WKSA 4JL6A 3ENKA 121PA 3DLTA 7REQB 1E59A 2BMVA 2E1PA 3RTBA 5J5AA 2UZ0A 1L1EA 4TUYA 1A0IA 1H0KA 3GJXC 1FUIA 2YWRA 3RROA 4WOKA 1GPKA 3EC7A 5L3RA 2VT2A 3E1GA 5JEEA 4D26A 1BN6A 5THKA 4HS4A 3F90A 4GM4A 2VWPA 4GM1A 4M7OA 2BMFA 1KVRA 3EDOA 1KYTA 1WXIA 1O1YA 1ZRMA 4JOBA 5DM0A 1QS0B 5B3JA 2ODNA 2C3MA 3MUEA 4R2LA 2RE8A 3JY6A 3KXLA 4OK6A 1JQBA 4NFHA 1RMYA 1WHSB 1DLIA 2UYGA 2ZUBA 1KAEA 3ZVRA 1W2GA 3PW2A 3RFUA 3A4LA 4HWPA 3H3XA 4RPCA 1MB4A 1R8QA 1Y3FE 1NXOA 2PZEA 4FR5A 3WYCA 2PBZA 1MX9A 1QORA 4RIFA 1RXCA 5FFNA 1XL1A 3VO1A 4HTAA 1Q7BA 1SQSA 1JHUA 2QQ0A 1DJMA 2GN6A 1T2VA 1A9XA 1OH6A 2GNOA 2A84A 4RPIA 2VRBA 5DNUA 5FTLA 5EEGA 3B3GA 5EJ7A 1NATA 2JAPA 4F45A 4ZVRA 4U2KA 1A77A 2HFKA 1G8FA 4OXRA 5K03A 5CBPB 3WS7A 4CC5A 3N42B 1T2AA 1D0IA 2ZG6A 1VG9B 1LI7A 1VDMA 2XUOA 1K7XB 3CXRA 4IVPA 5KHAA 4BMVA 1AOXA 4CV3A 1TM1E 4DABA 1C7IA 4D4GA 1OKKA 1Y3HA 2G28A 3WFZA 1TUBB 3NLLA 2PXAA 2ZTHA 3I6QA 1O97C 2L19A 3N58A 4FIDA 1LVUA 4K0RA 4L0DA 3ITDA 1G98A 2QMQA 5M2QA 4UW9A 3KQOA 3KEMA 4L6IA 4LFCB 4GKKB 4IV8A 1JIKA 1Z0JA 1ZIPA 4KDFA 3P2EA 2XWSA 4JASB 4CIBA 1CUDA 3NWJA 4A0SA 2FDCA 3OEWA 1K86A 3ZWKA 1N8SA 4DR3H 1MU0A 2I6FA 2VHZA 1L4MA 3KTMA 4MV3A 1EJBA 4B3MB 1NSTA 4R0VA 1MHTA 3I2YX 2Z5FA 4LDZA 1RRPA 4G0PA 2P1DA 5HKLA 5BWLA 4O1HA 1XNRH 3RSFA 1CRPA 4G5GA 4Q7JB 4I4TF 1CZNA 3EF0A 1PW7A 2CFTA 2OHHA 5KNBD 3JAMA 1SCNE 4OMFG 4NSNA 5JNWA 1MA0A 4KDCA 4RK7A 1QV6A 5DNEA 3KQUA 2O6LA 3ZWCA 1EGAA 1QQ7A 1SHUX 2B25A 4RVHA 1MT0A 1JIXA 4KKVA 1OH8A 4J07A 5CG2A 1V45E 4HKTA 3DLIA 4Y9RA 2WAXA 3QVVA 1FS6A 4CR6A 2TS1A 3CF6R 3LL4A 3L4BA 3FOEC 4XYMB 2B0CA 1NNLA 2PYIA 4YT4A 1AF4A 3LH5A 2GJ9A 2HV9A 2VBIA 1G7CA 1M67A 1HGXA 5AOCA 2RKWA 3L4SO 4MEAA 1IIRA 3GJSA 2V7PA 3K0KA 5CAEA 3ESXA 1XNGA 5D1NA 3H9QA 2NT3A 4ZYTA 1YE3A 1E3LA 4KB5A 1LSOA 2UUBH 2LW7A 3P4YA 4KR0A 3RFFA 1U6IA 2E9SA 2H2WA 3CH7A 4AN4A 4V0QA 5GINE 4BZPA 4O7RA 3KPUA 2OVBA 3OZEA 4DCMA 4DHWA 3AV3A 2PUWA 3L6DA 4R9RA 5DP1A 4CKEB 5SZHB 3UT5B 4PDBA 1BDJA 1BEZA 2HIGA 5A4AA 3LXXA 5JCJD 3AHJA 4IZIA 3JASB 4U9HS 2GCOB 2FEKA 1I7QB 3NWEA 4TLCA 2ECOA 2O2JA 3K8OE 4V1CA 1GAQA 2VQDA 5FYDA 4LVNA 5FPYA 3E3NA 5EJ4A 2R11A 3DM5A 4KGXA 1Z82A 2NIPA 3E18A 5BVHA 5CD9A 3H18A 4RU1A 4B83A 5DNVA 2VP5A 4G5SA 5K7SA 4CIDA 4WCFA 5EE9A 1FJ2A 2QK4A 4ED7A 2HHCA 3UATA 1H4TA 2VK4A 3K0BA 1CJMA 3HCRA 4GP6A 2C4HA 4TV9A 1S2DA 2FETA 3L0DA 3NEPX 5LUAA 5HKAA 2XCOA 4XR4A 5C8VA 3UZUA 2O3RA 3AM3A 4YVFA 4F2WA 1QHEA 3IMFA 3IRUA 3AIIA 4F4UA 3CX6A 2VQ3A 4P1ZA 4MGIR 2VJNA 2C35B 4QPNA 1XZQA 5HF6A 3JW8A 1A9SA 4HAXA 1USGA 1G59A 3S1SA 1C9DB 4XJTA 2H1WA 5CB4B 5TV2A 1EFLA 4E2ZA 3AF4A 4KTTE 4DDHA 2Q3EA 3TQFA 3QW2A 2G71A 3O92A 4KRYA 4Q3KA 3F8TA 5FLKA 4EGCB 1UP4A 1EVJA 2IP1A 2FMHA 1NV8A 1PSZA 2MDTA 1NPDA 2JGFA 4WPGA 4XWWA 4C7JA 3VDXA 1L4KA 4X8LA 4Z49A 1F2TA 3PJEA 3P0RA 2BLNA 4A3JG 5JECA 2DR0A 1PR4A 1V9SA 4UASA 3HFSA 3A2MA 3FNQA 2UYHA 4JU8A 1RYMA 2C4KA 4D6YA 2JGEA 1TM7E 2QENA 4HGZA 4OKIA 2RH8A 3L02A 3GJ3A 3T12A 5AM0A 3ROFA 1IY8A 3OE7D 1QH1B 2E4XA 3PKZA 3I8XA 4BFWA 4ERXA 1Q7EA 3ICCA 3BMQB 3A1WA 3MCWA 3W2HA 1E6MA 4AMZA 1TTTA 4CEIB 3U4QA 1TEHA 1ORDA 4N48A 2X7JA 3KKEA 1H22A 4I2VA 4QOJA 3JZAA 2RHGB 1JYFA 1U2TA 2XD9A 3HCWA 4EY6A 2XGQA 1IB0A 3GDEA 3CZ4A 4II3A 3CSUA 4G24A 2EEPA 2ZVDA 1QNLA 4WOBA 4CKWB 1FTWA 4EZIA 3A58B 4WFJA 3RU2A 3QEOA 3GBVA 1C3JA 2DWQA 4OP1A 1K7EB 2VYVD 1E1CA 3L6OO 3FCOA 4R2KA 3R1IA 1M2NA 3NWOA 2OLEA 4BLPA 2XQIA 4O08A 2HSWA 3HXMA 2WABA 1KZ9A 5AK3A 1FS5A 3PE6A 5ARCA 3T3EA 3BWDD 5A4JA 4XIJA 3VR5H 4F46A 2JJ8A 3W3AA 4R8UB 4EO9A 3MA0A 2DLDA 3EZ2A 3TDKA 2ZVQX 3R7SA 2F8MA 3KZXA 4BOYA 4FKBA 1ZLXA 3GTLA 3M1YA 2JLWA 2XF2A 5JDIA 1JKJB 4J3JA 1I30A 1QPBA 1JMVA 1U1GA 3TJRA 4YJHB 1YL6A 4Z3DA 2FCAA 3RKSA 4R8MA 1R8YA 2VJKA 1Q83A 5F76A 1P0PA 4Q3DA 3GGSA 4YNBA 2E4UA 3DYIA 4GC6A 2WEKA 4TTPA 1Z47A 1K88A 4JYZA 3VU3A 4UPEA 5FUYA 2C5HA 4S04A 1JB9A 1RC8A 2OILA 5FOUA 1MD9A 2W2OA 4BQEA 1QAOA 4F3TA 1X9IA 4Z7OB 3E1KA 3ENVA 3EC2A 4MS3A 3FNRA 4E3WA 3GA7A 2O54A 4CETA 3IESA 5HQTA 1HA3A 2OCLA 5TPZA 1G2WA 2B2CA 7REQA 1FLAA 2V7XA 1CKNB 1WQ3A 1ND6A 1XHEA 4D3XA 3JV7A 2G04A 2H57A 3VI3B 2IVFA 3H11A 2XCUA 3D8RA 2A9FA 4KXUA 4GX0A 3G0DA 2O2GA 1M54A 1RW4A 4K9KA 5FPSA 4QGBA 4FOOA 3EIWA 4QBKA 5LDHA 5IULC 2GHTA 5ALIA 5K8LA 4UEWA 2A6PA 2VP6A 1E2HA 1QS0A 1GTL1 3R0QA 1KYYA 2HREA 3W9BA 1GTSA 3RYIB 3PIDA 5IXSA 3REQA 1M7HA 4QEZA 1SELA 3N87A 1JSLA 4ZOEA 2YMPA 3OICA 1GTG1 3ICWA 4PZ7A 3HT5A 1DC7A 2VK8A 3WYEA 2O2HA 4R6XA 3E15A 2VAVA 1XI2A 3WHKA 2OV2A 4R1MA 3CLRC 2OHXA 5IKPA 2DJIA 4AMUA 5EUBA 4X61A 2CKDA 1IM2A 3QKWA 3TXXA 3F6CA 5CFZA 1HXHA 2YVAA 4QBTA 4PHTA 1B73A 2I54A 5CLIA 3BEDA 2H92A 2P90A 2FK1A 4H4EA 3C6KA 4RKWA 3KKQA 2JBHA 4PAMA 4J0KA 5ILGA 1ODKA 4ALIA 1YF3A 3PGKA 3U7RA 1JFRA 3KKMA 1W4CA 2XDAA 4KXYA 4PNEA 5KNCD 2D2FA 3AGPA 2R7MA 3H1BA 4GC9A 5CBPA 4LJ7A 3V8PA 1FVIA 1KY4A 2ZJ2A 5KEIA 4CLHA 3DMPA 2Y05A 1HNZB 4PRYA 2X9NA 1OXTA 4US1R 1FOEB 1NIJA 1TIBA 2MHCA 4E5VA 3I9KA 4PBRA 4HMPA 1TUBA 5TJ9A 3WSWA 1J06A 4KXMA 3JZDA 2O3UA 4O82A 4G2NA 4AULA 3N53A 3VPXA 3BXFA 1U6KA 3TRHA 3UKDA 2ZBQA 5FOWA 3QHAA 1R9TA 1BXGA 2HDWA 2HAEA 4AYBA 1GHTA 5KFVA 4XUGB 2ZWMA 1H3NA 1D0SA 4EITA 1VPTA 1YS1X 4C2AA 1YJ5A 2OQIA 1GQOA 1FY2A 5IJWA 2ZWPA 3G13A 5EZQA 3UC5A 4EYKA 3A6DA 3GC6A 3W1WA 1PJ2A 2R62A 3BE5A 1ZGJA 4Z9XA 3TH5A 4LF8H 3D1JA 1LPNA 2R8IA 1RWQA 3WAGA 3ADBA 3BQMB 3AESB 1SRQA 4ZGGA 3HHPA 3UK7A 3RODA 1KVTA 1BMTA 1C7QA 1XA3A 2H0AA 3BE6A 3L6RA 2R7AA 3I30X 2WP0A 2GZAA 5KG1A 4BV2A 1CRZA