4M9UA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
365
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 115
structure length 365
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4m9uA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4m9uA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m9uA01
4IWYA 4O86A 2VHEA 2YYAA 1JDEA 3ETHA 1DV1A 4O81A 3R5XA 4YJ2F 3BSSA 1VKZA 4EABA 5GONF 4RZQA 1GLVA 5H80A 1KJJA 3HO8A 2WYOA 2R82A 1PK8A 2FPIB 3GLKA 4YB8B 4Y8VB 4EGJA 1SCUB 3VOTA 1W96A 2DIKA 5JQWA 4O7WA 3HBLA 1C3OA 3R5HA 2NU6B 2IP4A 1JKJB 4O7LA 2HJWA 1BXRA 2ZDHA 1Z2OX 1M0WA 2NU9B 2W6OA 5HBRB 2Z04A 2VR1A 4MV7A 3MWDA 3VMMA 1UC8A 5LP6F 4QSHA 4O4IF 3KAJA 2YS7A 4HNUA 2I87A 3E5NA 4C5BA 3JZIA 5IYZF 3KALA 5JVLA 1KJ9A 5C8YF 3KAKA 3JZFA 2XCLA 4WBNF 1KBLA 3MWEA 4EA7A 3VPBA 5HV6A 3I12A 4IIJF 4O4LF 1CQJB 2FB9A 2YWVA 4ZHQF 1AUXA 4MV8A 2NU7B 4GGMX 3GIDA 4M9UA 5I47A 5FNVF 5J2TF 4YBZB 1A48A 3V4ZA 2QF7A 3VPDA 4NYEA 1I7NA 3WO1A 2R7KA 2R84A 3TIIA 2V59A 2R7NA 2FP4B 4IZOA 2R7LA 2YZLA 4TV8F 1EZ1A 4DLKA 1KC7A 3BSYA 5EZYF 2W6NA 3ORQA 5LA6F 3TW6A 3TQTA 5D8DA 5LXTF 5CA1F 1Z2NX 4MV1A 2I80A 3R9RA 4MA5A 3U55A 2YL2A 5BPHA 2OLSA 2R6FA 1CQIB 4MV6A 4M99A 1KJIA 2W6QA 2SCUB 4M9CA 4O4HF 4IWXA 1CS0A 3K5IA 4MV3A 1ULZA 5CAEB 2R87A 4YAJB 3U54A 2R7MA 3DF7A 4O7RA 4I50F 2I8CA 4ZQIA 4YAKB 3RUPA 1EYZA 4XZ3B 4FFNA 1OBGA 2CQYA 3N6RA 2GPWA 4O2BF 3N8DA 4O7ZA 1M0TA 3V4SA 1B6RA 4O82A 3JRXA 3ETJA 1B6SA 3SE7A 3WNZA 2HGSA 2GQRA 4L1KA 4FFOA 1Z2PX 3BG5A 2Z02A 3KREA 4EA8A 1EHIA 2W6MA 2PVPA 4O7YA 5KKNB 3G8DA 2YS6A 1VBHA 3R5FA 2YRWA 5JVDF 2GLTA 4ZOLF 4FFMA 2NPOA 5LOVF 2FPPB 3G8CA 1KUTA 2X0SA 2CNVA 4EA9A 2W70A 1T36A 4DIMA 4J6EA 4FFLA 4O7NA 3RV4A 1GSAA 1WR2A 2C00A 4FGRA 3TINA 3QFFA 2FPGB 2R85A 2CZGA 4MV9A 1GSOA 2YRXA 1M6VA 3Q1KA 3JRWA 3RFCA 1DV2A 5JQGF 5LYJF 2PN1A 4I4TF 3RV3A 4O7VA 1E4EB 3VA7A 5C1OA 4HNVA 2YW2A 2YZNA 2DLNA 2CNQA 4O7SA 4XX0B 3BSWA 3OUUA 2XD4A 3U9TA 3ORRA 1I7LA 4YJ3F 3K5HA 4TUYF 1AUVA 4MAMA 2GPSA 5CB4F 4TV9F 4WD3A 3LP8A 1VBGA 2YZMA 4FFRA 3NUAA 4M98A 2NU8B 2NUAB 3VPCA 4O83A 5K2MA 4EG0A 1OBDA 4FE2A 3OUZA 4O7TA 1IOWA 5DMXA 3TIGA 1JDBB 2ZDGA 4MV4A 2ZDQA 1JLLB 4I55F 2W71A 4O4JF 4IHJF 2QK4A 3AX6A 2VPQA 2DWCA 2W6ZA 2V5AA 2PBZA 3AW8A 3BFPA 3U9SA 3Q2OA 1CE8A 4C5AA 1KJQA 1W93A 4FFPA 4XYMB 2V58A 2W6PA 3MJFA 1E4EA 5CA0F 2CNUA 4FU0A 1EUCB 4EAAA 5C1PA 1C30A 3LWBA 1BNCA 5JH7F 2J9GA 3UFXB 4O2AF 2R86A 4MA0A 2YZGA 1A9XA 5BPFA 4HNTA 5BMVF 2VQDA 1EUDB 1UC9A 4HQ6A 3WO0A 1GSHA 4XYLB 4C5CA 3K3PA 4ZI7F 2P0AA 2DZDA 1KJ8A 4ME6A 4E4TA 4EGQA 2GQSA 3R23A 1DIKA 1GGOA 4O84A 4HR7A 1PX2A 3HB9A 5J2UF 1IOVA 1KEEA 5KX5F
chains in the Genus database with same CATH superfamily
4RJ2A 2OD2A 2R92G 1CZHA 3FFBA 2QZPA 3TY8A 3JYNA 4IO0A 2EERA 1SD5A 1R7RA 4RIFA 5FD6A 4I6EA 2OGZA 1J8FA 1ABFA 1E2KA 3L9XA 4E03A 1RQNA 1D2AA 1ZCZA 5ISMA 1QO9A 3PQ8A 3KKQA 2ZUDA 1WS6A 2CVFA 1PWHA 4DA6A 4MRRA 5B4UA 1OE0A 1ZH6A 4O08A 2HT1A 4F3TA 2NU6B 3I4CA 3M6WA 3EWAA 2CCJA 1FBNA 4UULA 4MWSA 2XYHA 4N8DA 5MFZA 1XJ5A 3ZLUA 1E3SA 4K9DA 2WA1A 3RUAA 1JJFA 1IFXA 4WKNA 1GZVA 5IULC 5JS8A 1NMSA 4C06A 2HCFA 3DHYA 3PI6A 3M9LA 3JZFA 3FVVA 4F46A 4NI5A 3VKUA 3JALB 4GI7A 1ABBA 4FOSA 2OBXA 2DECA 4BQFA 2VF4X 1U7XA 1FLAA 1JI0A 2M98A 1G7SA 3DT9A 4YXFA 5DYGA 4G01B 4HL6A 4BRUA 1LGYA 3O9ZA 1OLSA 5KC9A 1YQWA 5AUPB 3PHLA 5H59A 5JG7A 1UINA 1O9GA 3UJ3X 3I23A 2DHRA 4GLOA 4G41A 4Q7LA 4YMHA 3DDOA 2WSYB 4Q1BA 4BZWA 4LRSB 4O4LA 1WPQA 4UHHA 4IS3A 4DCUA 3U7QB 5AHWA 3N59A 4AKGA 2GARA 4KR9A 1KJIA 4HRVA 1RYNA 1AHIA 5SY6A 4QDKA 1L5SA 2O2XA 2DUJA 3T5LA 3KWLA 3QTTA 1F3LA 2YHUA 3RF6A 5A4AA 2IYOA 4N9QA 2UUPA 1X1RA 4WLFA 3HYSA 4LJKA 3TO5A 2B1JA 4NV1A 4KVGA 1OAKA 4O2BF 1AUPA 2UVRA 2ACKA 2UYYA 3JARB 1U65A 1JAIA 2J0UB 2ZP1A 3GNSA 5EZ6B 4EG4A 4IDFA 4OK6A 4PC3A 3PTZA 5ED0A 2PHZA 3PTLA 1YJCA 5E2AA 3QKIA 4RDCA 3ZXIA 5G0WA 2QE6A 4L8VA 1FFCA 1Z9BA 3QPBA 1KUTA 2FK8A 2VDJA 1CHNA 1AGXA 1THTA 1RYSA 3R77A 1QGUA 3VSEA 2V4ZA 3ZLJA 1U6KA 3RF7A 2CNKA 1FFSA 2QRLA 2ZRDA 5F3WB 4P9NA 5BURA 5DFAA 4EGSA 2FEMA 4XYEA 2I0FA 2W58A 5K8UA 5EWLB 3VA7A 4OB6A 1Z36A 1NBIA 1WXHA 1YVDA 1Y37A 4V2IA 4XX0B 1I3MA 3TLCA 3GRRA 1MO6A 4R7ZA 2BMDA 4H2DA 4TUYF 1TWCA 3FB4A 1IL0A 1HQYE 3JQ9C 2PK3A 3OO0A 2X0EA 3QNWA 4C20A 4EHFA 3IAEA 5FKJA 2BDTA 1DJLA 3BTVA 5K7SA 3L7NA 1KEEB 4EGAA 3HR7A 4E09A 2Q0XA 3MGCA 3FPBA 1GPJA 2AHOA 4OUDB 2GJSA 4B5LA 1RZUA 2GGSA 2RGUA 4DWOA 3P2JA 1CIVA 3IGFA 3CEJA 4Y2YA 3U9SA 1PZNA 1BEZA 4I8XA 2GJ4A 4MW0A 1MEJA 4LFAH 5EJ2A 4GSLA 2GA9A 4HH3C 2O07A 2W6JD 2MMGA 4X1KB 4WJLA 4J0HA 4CIVA 3GOQA 3QVKA 5AKYA 5JDCC 4V02A 2QS9A 5BY2A 4X92A 4US2R 2JJ2A 3LPDA 1K6EA 4MGYR 3ZX5A 3Q3JB 3CN9A 5B1DA 1X3SA 3R40A 5E2BA 2AGPA 3PFNA 4X9XA 4LJSA 1VXOA 3CLTD 3CLRC 3ICOA 2GLXA 3O4IA 3ONFA 4J6FA 3L43A 5AT1A 4EW1A 2PWAA 5F9FA 5BWNA 4MTDA 3OX1A 1WMDA 4UE3S 4LRTB 3RR2A 5C81A 1GRVA 3T41A 1IBLB 4JUCA 1BH6A 3RC8A 5AI4A 4COKA 3CNHA 4RAQA 1PK8A 2LR0A 1WU7A 1Y7HA 4RPJA 1FP1D 3A7EA 5TPZD 1W29A 1PS9A 5BW8A 2C29D 1FMCA 2BC9A 1YDMA 1NV9A 2VP6A 4ATNA 4F4FA 4Q7MB 1OC4A 2GKOA 4JJKA 1BFKA 3HP1A 1F3OA 1JWLA 5FPHA 5ADUS 3TIXB 5IYCG 4Q7KA 3SIWA 5HKBA 1ELOA 3U3OA 1KEUA 3IUBA 2QX7A 3LZCA 4OI1A 4HGQA 2DWUA 4YRDA 4TWJA 1YO6A 3UXYA 4L9AA 5EXSA 1HPLA 1L5HB 3C1OA 3V8NA 1ZESA 3IFSA 4DQUA 3TDKA 3QM1A 3P94A 3K70C 3NI2A 3C3JA 2P1RA 4HQFA 4JCCA 3F90A 3H99A 3EXHA 4CGYA 3OPQA 4OUKX 1WBDA 3EFHA 3EJWA 3E9YA 4BP9A 2WC1A 1UEJA 1PEDA 5FV4A 2X4IA 4H3SA 4C43A 2OBLA 1NIJA 2XH8A 2PZKA 1DIGA 3QBVA 4HJXA 3LVFO 2QNIA 2IPAB 4WW0A 1THZA 3SLRA 1CEYA 3WQBA 2NYUA 3VV2A 5AVSA 3PL1A 4P3KA 2BI7A 1S2IA 4B6SA 2XPCA 1RAGA 1UDBA 2A2ZA 2EXXA 3UXMA 2QUAA 1S0MA 2R8ZA 4PYOA 4NMWA 3OO1A 2OILA 3H5LA 2OZPA 1TM7E 3M7IA 4P32A 1H5UA 3FYTA 1I0ZA 1VSVA 4CM9D 3CVUA 1AU9A 4OGLA 2ZIFA 3MFQA 1G8PA 2HFKA 2HJRA 4B09A 5JAMA 4JHXA 1E5LA 1U0GA 3TFWA 3E9ZA 3G9TA 4W6QA 4D0GA 4QBHA 1BE8A 4W5HA 5AVQA 3O7MA 5HA5A 4JVOA 1J23A 5H83A 3W2HA 1A7KA 1D03A 1T4DA 3P9CA 4J0KA 4LZPA 2OYRA 4ZOLF 5IDQA 2PZAA 3QXJA 2I55A 3I34X 4MYHA 4FC6A 5AJVB 2HF2A 1NIPA 1XWFA 4OP1A 4DLTA 3VYSB 1DLJA 4UASA 1MU0A 5HE9A 5I60A 3CZQA 3RUFA 4U2BA 1JIKA 1VM6A 3AVYA 2WKQA 4ZQFA 2CNNA 4JK3A 3S24A 2PN1A 5L1KA 4B6PA 3NHLA 1GCIA 4O6VA 3A1EA 1U0FA 2UV8A 3PQFA 4RZXA 1X7XA 3R3XA 5BSWA 1U3DA 4ECRA 3WL4A 3FBWA 1T4MA 2OHXA 4J2HA 1FK8A 1OA1A 4NNJA 4HAZA 1IBKH 1JR3E 1PR2A 1H8EA 3KUKA 4Z4FA 3A14A 1O97C 1AH2A 2X6QA 1HE2A 3SZUA 1IVSA 3PA6A 4KDRA 4TQ9A 4O83A 1TRKA 2VTBB 5CDTA 4XPIA 1QUFA 1PP4A 4QULA 1GL7A 3WG9A 2UKDA 4GLLA 4FJ2A 3JRNA 5LBIA 4Q3KA 1Z18A 4LI0A 3Q40A 5FORA 2PBZA 3RAFC 1F2TA 4DLNA 5IHXA 4BX2A 3F74A 1I1HA 5I9TA 3TW0A 4WGGA 4GKAA 1JR2A 1T2DA 2FVXA 5JSUA 1ITZA 1P1RA 3QW4B 3W8RA 1GPDG 2ATVA 2ZYDA 3D1LA 5DV9A 4LXUA 2CHGA 2XGJA 4IILA 4P4TA 3MQ4A 2O0LA 3W78A 2GBLC 2FZLA 2DZDA 4EY3A 1Y5IA 1YJ5A 1E2JA 5CH3A 3CRZA 2HC9A 3QMMA 3UKJA 3GV5B 2V6BA 4QVKA 4D8WA 2X4DA 2ZRPA 2PV0A 5AUQA 3NJ4A 1CRLA 3V97A 3FPLA 2H8KA 1KY2A 5IF9A 3TRJA 2GK3A 4PVDA 4WESA 4Y6GB 4OKNA 4GP7A 2E2HA 2VSOA 3UB3A 1PL6A 1ZJ4A 1XD2A 1SKUA 1ESEA 2ZI9A 1FTSA 5EXTA 5BWMA 3PHGA 2EYUA 1SVUA 3D7MA 3GD5A 2P8SA 5FPTA 2FN7A 3R9KA 1R2QA 1ISHA 1B8NA 3KOUA 3PENA 4PXSA 5ENZA 3WWJA 1XYVA 1SZJG 3MSCA 3BH0A 4C22A 3MRTA 3WYNA 5K8VA 1W5TA 3LYUA 1JZTA 4QECA 5CFPA 3CX4A 4W9MC 1QWSA 1T13A 1Q19A 1G291 1FUKA 4OYRA 3KJNA 3URMA 2ZBFA 1FDIA 3IEKA 3THWB 1CY2A 1JEEA 2XIGA 4Q18A 5FOWA 4KREA 4BO4A 1QGYA 4LEIA 4QPCA 5C31A 3QSYA 1CZNA 3H9EO 4YP1A 1LI7A 3D4OA 4XAQA 4X6LA 1JIJA 2O1EA 1R0KA 2XSZD 5GGXA 2XMZA 5LYYA 5KU7A 4OM8A 2PH5A 4IIHA 4Q3NA 4EUNA 4GOLD 5CPBA 1YUBA 1W0KA 1R0SA 2R2GA 3GEDA 1GPKA 2J7PD 2B4KA 5KG5A 4ZCSA 4OKIA 3ED1A 2VK8A 3STXA 4QWCA 3AHHA 1TQHA 1BFDA 3TQOA 1ML3A 5HCNA 2C3OA 2FMKA 4B6EA 3FKJA 5EP4A 2FCRA 5AHOA 4IOLA 3CZCA 3LCJA 5PGMA 4B3CA 3GR6A 3DQZA 5LKAA 2YV3A 3MTAA 3O73A 3GJQA 4YMTA 2VRCA 4XJVA 5HOEA 4QDXA 3WLPA 3UKOA 1A3GA 3TM5A 2ZRKA 1XP5A 5U4XA 3BFJA 4X7BA 2XYRA 4TWRA 2DY0A 4L0DA 1HA3A 3D9QX 1MFPA 3GQBB 1GPBA 1TUGA 5AQEA 1EVEA 4GMKA 1H4VB 2F4VB 1DCFA 2G5CA 2JIRA 2VK2A 3SOZA 5I4KA 5G0SA 4F1KA 1C41A 1EK1A 4LC9A 1YMQA 3WSTA 2AK2A 3RC3A 3FCCA 5MN4A 4CODB 4DUGA 3E1GA 4MKRA 5K3AA 4LHEA 4FFLA 2KBEA 2C94A 5REQB 2FPWA 1NVKA 3OJLA 5DZSA 4FNMA 2LUOA 2XT0A 4H18A 1AXGA 3SI7A 1WNTA 4LZLA 3LUDA 1OV4A 2I71A 3OZVA 4AP6A 2GVZC 4FE3A 3DOUA 3JZDA 2IVZA 2W2KB 2O1SA 4Y9SA 4HNVA 5CG1A 3DA8A 2NW6A 1U2ZA 1Z16A 1N0UA 4Q37A 2X1MA 5I7FA 1DIBA 4L4UA 5JZVA 4XIJA 5K05A 4K0KH 3VSBA 2AF3C 1OHHD 2BELA 4EFLA 2OFOA 3T5JA 5BVHA 3LW8A 3G6KA 1QU3A 4KZKA 3T52A 3AHCA 2FHPA 4P6VF 2VPSA 4FDUA 3DAAA 3H6HA 3EXFB 2QKYA 4F06A 1PG5A 3ND8A 3PFCA 1HMYA 1VL2A 2NV0A 3MCTA 1E60A 2O7SA 3GC6A 2XTNA 1PZXA 4FKZA 3C7DB 3FCAA 1E1QA 1YQ9A 2L69A 1EVIA 3T9DA 2A14A 4QU9A 2DFLA 3LW7A 2PX4A 1HYEA 4TYQA 1VPTA 3IE2A 4OBBA 3HLTA 5G3ZA 4UDOA 4B3GA 5FTWA 1XCMA 3RB8A 2FMHA 3IVRA 4N7RA 4HEQA 3V33A 1LJ8A 3SYNA 4MJ3A 2QPAA 2R6DA 3SEFA 4JJZA 4FGUA 2QROA 4CQMA 4DV0B 4WVFA 1GPUA 2HOQA 4HWKA 3BOSA 2E21A 2UYHA 1VZ3A 3C3EA 1E2BA 2O0KA 1MX5A 1G5HA 4Y1EA 4JT2A 4RZQA 1PAUA 3S1AA 4L78A 3H9UA 4TL8A 2BHLA 3RTDA 4F96A 1CKEA 1XEWX 1O96A 4PCVA 1B1AA 3L7OA 1MGOA 4MP3A 1FFBA 1DLIA 4YJ2A 2DQSA 3KCQA 4J90A 4O2LA 2ZSAA 2QPTA 4B3TH 1J4AA 5KNDH 2ZSKA 3KQQA 4I9UA 1TAGA 1CG6A 1JLHA 2NVBA 5J40A 3QVOA 3AKYA 5MGBA 2OGWA 3H1TA 4MKXA 4YRQA 4CUKA 5L3SB 3LULA 2HWWA 4ZCLA 2D1TA 4BLRA 1MBZA 1XRMA 5CFZA 1R3UA 2Q5IA 5IBPA 3GIKA 3BQNB 2X3YA 4IIUA 1G8SA 4K9QA 1IULA 1B6TA 2FETA 2GDJA 2IVFA 1SBHA 3UV6A 2WSSA 1BMTA 2AOTA 1M54A 3VPFA 4IR1A 1INLA 4FZRA 2O8CA 1KBZA 2RI0A 3LQQA 5TT0A 5ENDA 1G5QA 1YB5A 4DTIA 1S5PA 4MR9A 1C1HA 3LCVB 2XF8A 2REOA 4HZUA 3I45A 4AS1A 3I2YX 2E1PA 5ETJA 5JANA 1G9SA 3GLFA 4EPRA 1V45E 3NWJA 3F49S 1JH9A 1DTEA 1FUUA 5K0BA 3WGIA 5U1PA 1FNMA 4JYBA 1G2IA 3VC3A 2K87A 1D6JA 3ELBA 3S81A 1DGQA 4OLFA 2W4MA 2GCIA 3JSAA 1L7MA 3WGLA 4F4WA 1B14A 4LRYA 5K3FB 4ZZ0A 4IAOA 1E3TA 4Z7OB 1O5IA 2FK3A 4JI2B 2I1VB 1PLLA 2EVWX 1F2VA 2PZFA 1ZIDA 1A7UA 1QWOA 2VNJA 3X1JA 4KR0A 4M38A 3KXDA 4A8JC 5IUNC 1BG6A 2H3HA 2ERCA 4YP3A 3QOFA 2FUG1 3RS3A 4LX0A 4AJHA 3QV1A 4I6GA 3VTAA 1C4OA 2HXSA 4YJGB 4IVQA 2CXSA 4OV6B 4Q3DA 2Q1YA 1H6BA 4EBEA 5JQGB 3QXXA 4WOBA 4FLEA 5T41A 5EJEA 5KYXA 1JFLA 4A6DA 1RJ9B 1XJCA 3PL5A 3N86A 2DETA 5C5CA 1S7CA 4OGKA 1RJFA 4M9XA 1RKBA 1W36C 4FGRA 3HY6A 4TSRA 4N6NA 4CHGA 1RNLA 1OCEA 1XRQA 2VHYA 1RYFA 4YRMA 1FYEA 4BO3A 1ZR2A 2OFFA 4QM7A 4UVDA 2C2WA 3SJUA 1OFIA 4TS9A 5DU2A 1VG9B 1NY5A 3AUFA 1NXSA 2HGZA 1T34A 4LBYA 5C1BA 3OZTA 5AHXA 5CLFA 3MTQA 4YWJA 4P7GA 2GN2A 1NFFA 3EIUA 3CPEA 4HATA 2I2FA 5IKMA 4Y2RA 2L42A 4KXMA 4ISCA 1V26A 4QQKA 2O5VA 1AHPA 3CH6A 1YKGA 5AFSA 4MI3A 4KAFA 1RD4A 4JV0A 1J5EH 5CM9C 1WW3A 4KIFA 1G6KA 5HBGA 2X1LA 3AUYA 3DMNA 4KDEA 4FN4A 3U4GA 1JSZA 4YWHA 3LC2O 3OZRA 5AJWA 1ZAKA 3ILHA 3Q10A 1U8EA 3RG2A 3LCCA 5B6JA 4EWLA 3SZOA 1V8DA 2VNSA 5H5JA 2VBIA 4H17A 4NCAA 3EF1A 1CVLA 4UNPA 3ER6A 3VGPA 4DDVA 2I2AA 3CSDA 2CNUA 1QVWA 4C4AA 2YCHA 3D8TA 1SCKA 3UFXB 3PR5B 1D2RA 4NFYA 2YZGA 5F9MA 4EB3A 4L16A 3GEHA 1ZH0A 4YJFB 3WX0A 3KZNA 3TRIA 3VDMA 4PYLA 3TSAA 3K4PA 3SYLA 1WD5A 1QR2A 5TT1A 3R74A 3ZZUA 4CGZA 3K1YA 2WU4A 3ZHCA 3L1HA 1P7VA 4AYBA 4A73A 3DKRA 3EIQA 5G1OA 1UFOA 5JNWA 1I5EA 3C7CB 4LN1A 1AMOA 1II9A 4IRXA 2ZPAA 3RT9A 4MX8A 5ALJA 3EBPA 4HGOA 4WASA 1YUNA 3L40A 5FI1B 4BKPA 2QM8A 4GI1A 3T5TA 5E2IA 2PS3A 2PY6A 4ENPA 1G63A 4AZVA 3BKWA 1Y8QA 1GQRA 4ZO9A 4F0JA 1HEIA 3UBTA 1P74A 1WX1A 4D0RA 1YJBA 5ALHA 2AG5A 5IVHA 3C3WA 4HNUA 2NSHA 1A7AA 3GOHA 3UZUA 1NLFA 2JFPA 3G0HA 4ND7A 5FO1A 3MGBA 2ZB8A 1WM1A 1P7PA 1QZTA 1MOQA 2O8VA 1AUXA 4PZDA 2FR1A 3GJ5A 2CVHA 1EVLA 3G2LA 4RO0A 2ZYHA 1AV7A 2BEUA 4Y8VA 1Q14A 3HUTA 4MW9A 5TQJA 4YALA 5B6IA 4OO3A 1HNWB 4D4LA 2YIJA 4ZEWA 2NVUA 5JY1A 1GZHB 3DW1X 3KVVA 1URPA 2NU9A 1HNXH 1N1MA 1L4BA 3A26A 3TW6A 2VHWA 4NF2A 4QEDA 2I7TA 3K5WA 2Y1LA 3X1WA 3P9YA 3G1TA 4RZ3A 2WWVD 1XVUA 1EFDN 3TRFA 2FQXA 3A2NA 1I3CA 2HWUA 3G79A 1ABEA 1V43A 4MQ5A 1GZ5A 2BEVB 3K5IA 5CAEB 1I3KA 4IH4A 2XIJA 4G2NA 3MD0A 2YNMD 1E9VA 1H2FA 3WMGA 3HMKA 4X8MA 3JD1A 1DOHA 1OX6A 2O8EB 3U17A 5KFUA 2AGQA 1VXRA 4LCEA 2ODEA 2VDMB 1C0LA 3H84A 1K3TA 4HXEB 4UBMA 2VDKB 2FNAA 2NXEA 4UCWA 4G4GA 4GPAA 1F0NA 4ODIA 4LF5H 1T94A 1VRCA 3QYPA 2V6GA 1FTQA 1G2PA 4IICA 2CLLB 1C14A 4KQ1A 1DBWA 4RZHA 1XZFA 5ADWA 4WCDA 3RR5A 4CFYA 2C9MA 3WSWA 1K0FA 3KB2A 3V2UA 1HKUA 3NBZB 5GJVC 5BN1A 3WZLA 3ZU3A 2NTYC 3QVWA 1XN1A 4LGMA 3AB7A 4DSTA 4O7VA 4MVYA 2QVGA 4BKQA 3KWJA 2C4VA 3LJKA 2WHPB 4GP9A 1ETUA 1EVZA 2SHKA 3PC8C 4E70A 3ZN2A 2A4KA 1EUQA 4OYYA 3AVWA 3K5HA 4I81A 3OQMA 4WOPA 4A5OA 3U7GA 4D3FA 1UZUA 4K6KA 4QQNA 1OIWA 1NBMD 2EF0A 4XEHA 3L8DA 5FJ8G 1KQOA 3DXZA 4DRZA 4GIBA 2FOIA 3NDBB 3HC7A 2WU3A 1ZNZA 1J21A 4IXWA 4O1IA 5KTSA 5HJ2A 2B83A 4G09A 3CH5A 3F5DA 2DY1A 3D7KA 3ZCUA 2UUAH 2G5GX 1P9WA 5GOZA 3A6FA 2HCRA 3USCS 3PF8A 3FSEA 2A1IA 5JJCA 1HX7A 1MOPA 3WL3A 4JR1A 3LC1O 2HK6A 1G2OA 1PR4A 4XYLB 1IZ7A 5IXSA 5A3VA 3OIYA 4ALMA 3OEHA 3LKVA 3VOSA 1ECPA 2OG2A 4O84A 2CXQA 2ETVA 3U3XA 4AUEA 4IBOA 4B3FX 5DSZA 4GQIA 2CE2X 4LXIA 1QZUA 1T9KA 3R7LA 1D6SA 5FQNA 5CHEA 5I3CA 2B36A 1GQQA 4LOKA 3RTGA 4LK3A 1HDIA 4G37A 5DGTA 1K89A 1VLZA 3F9IA 4WZBE 4EYGA 5KFHA 3RSLA 1BEEA 3MXTA 3DDUA 3K0CC 2VXCA 5IFKA 1NUPA 5D1OA 5IAEA 2ISQA 4DG8A 1UZAA 3D6HA 1SXPA 4MARA 3AQIA 4JLVA 1P2TA 5J59A 1XDSA 1MH9A 3DGEC 5DX8A 3G49A 1BDMA 4QQFA 3M1AA 2R8OA 3SYKA 1OKKA 5KOYA 4MVJI 1H9BA 4YDHB 5EDWA 4ZGWA 2DYKA 1ZSVA 1YE8A 4M7RA 1NXWA 3A28A 1Z6PA 1MG5A 3KAJA 5B3LA 1P8AA 3T61A 1SB9A 1P91A 3AOEC 2A5GA 3U26A 4E1AA 3VQTA 3E9NA 1M1YE 3MWEA 3KZ1E 4A3GG 4IFBA 1M7JA 3SZGA 2PPVA 1HGXA 4QFMA 1T8TA 1ZXLA 3N0VA 1FDTA 5ALPA 1L5YA 1KY4A 2E89A 3D64A 2Z5LA 2Q2NA 4E3ZA 4N7MA 3OCVA 3U7EB 1YDEA 5JO9A 1M73E 2Q1SA 2HRDA 2VTBA 3QRWA 5J63A 2IDMA 5E6UA 1SNYA 4D56A 3NOOA 4YDQA 1KTIA 4X64H 3OLCX 2PKQP 4S1OA 4ZHQA 1FYXA 2XNHA 1U6IA 3N2KA 3QH4A 5JUMA 4PLHA 2C88A 2JH9A 3NUQA 4KGXA 3IKVA 5JCZA 4MVJM 4I9HA 3AI7A 1X1TA 5CXUA 4Y67A 2XRYA 2O54A 3KC2A 2J85A 2OQIA 2HIGA 4M1EA 1YHYA 1GT91 3ON5A 1RHMA 1PNVA 2DR0A 2V7PA 5CB4A 4N7JA 3EXIB 1P7CA 3RIZA 2FSGA 1CB7A 5A0VA 1U5BB 4ZHSA 1H93A 4MMYB 4CM3A 2QN3A 1G8MA 2FPXA 3A9CA 2A92A 2QLJA 1O3YA 2QYTA 4EQ6B 1ENOA 1KAHA 5JCPA 3A1UA 5IC5A 4WNYA 4OMDA 1KFCB 3BEOA 1CWUA 3LX5A 3QOXA 1E6EA 5C5JA 3QX9A 1WW2A 3TOVA 2XA2A 1GFWA 5AQ1A 5JYDA 1LVUA 1YASA 2Z6UA 4NZZA 1E6CA 2IP2A 3ILVA 5G0VA 4E5YA 3Q5EA 2CLHB 5IP5A 4CG2A 2ATEA 4A3LG 2HBQA 5K0CA 4Z0NA 3F6BX 2Q4EA 1F5NA 3GX1A 3BMQB 3SJBA 4OB8A 3HVKA 4UVEA 2NUAB 5C32A 3K1AA 4E2WA 3RNLA 2BI8A 2HLNA 3B7WA 1T9ZA 4JHLA 2AEEA 3EXAA 5TMDA 3RQIA 3JXEA 4U7JA 3MJVA 1GSIA 3TZEA 5E6SA 2AMLA 1HDZA 3F7NA 1REQA 1EKPA 3JSXA 1F5SA 3K0HA 2FA9A 2GAFA 1KZ7B 5JAIA 1CS4C 3B52X 5FUBA 1Z28A 3SXPA 3N39C 4D8YA 2DJIA 1G4HA 3GLTA 4KB5A 4KK4A 1KI7A 3DG9A 1U3FA 3IESA 3B12A 4YMSA 4HGRA 2WFMA 4KI7A 5DCUA 3K0KA 2A59A 2XHZA 2D1SA 5BMVF 1VI6A 3PVXA 4E2FA 1TWHA 3HKBA 4P5PA 4FMBB 3W90A 1UDXA 2A9PA 2NAPA 4EGQA 1JJBA 5LMCA 4X62B 2J0QA 1XWWA 3GZNA 5DBHX 2RGEA 2HGWA 4CCWA 3NIWA 1A5BB 2XA9A 2PR7A 4IINA 2QMZA 3SFZA 5CDSA 1VCIA 1G9XA 3HADA 1TNDA 4TZ0A 1IBKB 1M2OB 1XCBA 3FHLA 1VTKA 1TZJA 1SBZA 2AU0A 1BSVA 1JEYB 1YS1X 1ZS9A 4BP8A 4QJ3A 4UNIA 2ZIGA 3W9BA 2NPFA 2BMAA 2JLCA 4A10A 5DN9A 1FIUA 1Y33E 1XSEA 1UIRA 3VVCA 3HWX1 4M22A 3WWOA 3A4NA 3OM1A 1Z26A 5K8LA 1WZEA 2K7ZA 1PUIA 5IYZB 1R4NA 4O7WA 5IMBA 5IDXA 2CLOB 2H7XA 1CYDA 4B3MH 4JI1B 3GU3A 1MAHA 1EM8A 3M6AA 2OGUA 5B3KA 4AF6A 5IAGA 4RPLA 1N2EA 4YQWA 1RCUA 3GMIA 4ZJYA 1XF1A 4C7KA 5CX1A 4QFBA 5DX0A 4FR0A 5KWJA 2GSDA 2H2DA 4PYIA 3T7JA 1PJQA 3UJDA 2AVNA 3EC2A 3PFBA 4HH4A 5ALTA 4LF8B 2AWOA 4MEJA 4F5DA 3ZOKA 3JQBC 2Y4RA 3GCDA 3PCRB 1KDOA 4R51A 1VG8A 1PDOA 1SKQA 4CM1A 2DU8A 3DFMA 3NHWA 1G6Q1 2PWPA 4Q48A 2JA6A 4KBFA 1KHTA 3F4LA 4RV4A 4RLFA 4MWOA 3PGKA 4QSMA 5FUWA 2IDJA 3TZLA 1CDOA 2QAIA 2WU1A 5CLIA 3STWA 3L7MA 3P9QA 2P5TB 3OC0A 2D74A 3DHEA 4AO7A 1K0UA 4RLHA 3NASA 4TLDA 1A4IA 4FSHA 1E2HA 2Z3WA 3IDAA 4TRMA 2DT5A 2ZBPA 4O4HF 2TYSB 4JSTA 3IEIA 2HJ9A 5E9QA 5AW0A 3NHAA 4N3CA 5E7MA 4PFJA 4IIGA 3AWDA 1Z8NA 2PVCA 4EVIA 3SG0A 2GZDA 3CQZA 3W5HA 1RZRA 3Q7RA 4EPTA 4BP1A 2RGBA 2DLDA 1OBCA 2GILA 2PGJA 2WAYA 3OJFA 3QVXA 4WLVA 2FLPA 1X7WB 4ZMRA 2QSZA 4A1FA 1JHZA 3CU5A 3AEKA 5TGTA 3LVRE 3H5TA 4ZOEA 1FLNA 4FQ8A 2XCRB 3Q5DA 1FDUA 1YRAA 3LS2A 1OTXA 3HJUA 4ZKEA 3M3HA 1GKLA 3INTA 2QPOA 4ABTA 2HF8A 5H3LA 4DR3H 4AROA 4HDSB 3I5MA 4R69A 4J9VA 3A6EA 3ANNA 4CIAA 3LNTA 2W4IA 5KINB 2QMHA 2ZR9A 1X8LA 2OMEA 1I4LD 4Z7QB 2PIAA 1S0OA 1DJNA 3KWFA 1F9EA 4Y0NA 2I3GA 4GOJA 1P31A 2QEQA 1A9XB 2JDID 5KNDD 4PLVA 4HJRA 1QBGA 1PGPA 2A57A 1P2UA 3BQ9A 3QU2A 3PE4A 1T0BA 1YDWA 3M6MD 4C7OB 2VPPA 2YX1A 5HCIA 2WHQA 1PYGA 2GR9A 5KG3A 4D82A 5CVEA 3U62A 3UUEA 1XXHA 1JQ3A 4IXDA 2KS6A 3EFOB 3NHRA 1GDDA 1MX9A 2H9YA 4OHUA 2W9AA 4I99A 4Z1OA 5ALGA 2O7RA 4NAUA 4WY8A 3I32A 5JXHA 4C1NA 2M6SA 3N9IA 3K6RA 1EFVB 5LD2B 1XHLA 2BGWA 4QOHA 3E3OA 1GGKA 4DMMA 3GLIA 3DL4A 2YVKA 3DO5A 3AVPA 2UXDH 1ZO8A 3UWMA 2G3YA 1NF2A 421PA 1HFJA 4Q8EA 4TMXA 1EESA 1RJWA 1YZ3A 3F4BA 2X0IA 3D81A 2LBPA 5HTOA 4HS4A 3H2YA 5FUVA 1W4AA 3DOIA 4COOA 4FI3C 1F51E 2X4LA 3ZKWB 5THKA 3IPAA 4K0KB 3UTDA 2RHOA 2PL9A 2FWMX 3GUUA 4AMVA 4PWYA 3CF4G 5J4LA 4HK4A 2XYQA 3G7UA 4U7CA 1KKLA 1GZ3A 3R2JA 1DPGA 4YJGA 1NVMB 4DIDA 1FUEA 3NKFA 4XSGA 1MH1A 1PK9A 3MOIA 1B8PA 3KHSA 3NEPX 4KR7A 2Y0CA 3PNOA 4AY6A 1PUXA 1BXRA 4L5YA 5AW1A 3RFXA 3IUEA 4ZICA 3PDCA 1N1GA 5ICSA 3VC2A 4FW8A 3UJ7A 3CV3A 1UJCA 2ATLA 3PQDA 1QFYA 4DCOA 3NAQA 3AINA 3OJ0A 3UW1A 3GCXA 4MYRA 3I58A 4HXYA 3BXZA 1TJ4A 4ZFNA 1CYEA 5CVVA 1EIWA 2NTNA 3BXFA 1PNQA 3DFIA 3GTOA 3KKNA 5IK2A 4PYRA 2Q8NA 1ZRHA 1UK7A 3W2EA 4UNNA 3KQHA 3RAPR 5EJ6A 1CUZA 1SVIA 3ZCTA 2IV7A 1N4AA 2COKA 2VA2A 4HF7A 4J29A 3L7JA 3S5UA 1CVRA 4C88A 5JDIA 4D02A 4N39A 3GI1A 3RRZA 1QV6A 3ZIUA 4RTRA 2HBZA 2ZRLA 1JKMA 3HJCA 2IEBA 3RSFA 2Z5GA 4M4SA 3PWZA 3SWWA 5I4BA 5JC8A 3IV7A 2R4UA 4AKHA 1AKYA 1QV7A 3M2PA 4B3TB 5BN4A 4X3CA 3IODA 2PKYX 3CRQA 4R41A 1W73A 3VSAA 3FIJA 2HIMA 3L6EA 5B3JA 3T5MA 2FXVA 2EQBA 2PL5A 1CQJA 4JBXA 1PU2A 1BWQA 3KV1A 4PZLA 4BP3A 3D54D 4YCJA 2IITA 3AUKA 4JKYA 1NMYA 1U2PA 3M4XA 4HDQB 3ENNA 5KNCD 3TM4A 2C8LA 1S9HA 2B69A 3G2JA 5AKIA 4Y2HA 4KJZA 1QMPA 3TOCA 4NZMA 3HCOA 3RB6A 2CDNA 4H16A 3V6JA 3HG7A 4GDMA 1Z4IA 4C21A 4GYWA 1HE5A 1N2CA 3I73A 4P38A 1NYQA 4DYDA 1NR5A 3LX6A 1KKMA 2G17A 3B6IA 3A6DA 3T1OA 3CKMA 5I45A 4RS4A 3S55A 1D2HA 2D2EA 3SMVA 3TH5A 1WABA 1YZUA 1WPXA 4R2HA 4JYCA 5GY7A 4CDGA 2XZPA 1W76A 4RA9B 2R8JA 4E2ZA 2ZT7A 4I7HA 1NOKA 5GV8A 2A7QA 5FNZA 5KVSA 2AX3A 5FPKA 1AY0A 1O6BA 4INJA 2C22A 3SAJA 3VHXA 3U9TA 4MKGA 4B2LA 1AS0A 5CPFA 2A0YA 4WEOA 3BWCA 2EQAA 4JJFA 1K8QA 1ZOSA 3IX7A 4RK6A 5ERXA 2X4GA 1H1DA 2W2LA 2ROQA 2IYVA 3IL2A 3NCHA 3JQGA 1OBDA 1BD4A 4CUJA 1WU8A 2PD6A 5CRIA 3O8CA 2X7XA 5DM0A 2V5AA 4D0NA 3GJ4A 2E4YA 1G7RA 3IOMA 4LSGA 1Q21A 2QJTA 4PZ7A 4CMFA 5GJCA 3NBUA 3RRMA 1J8QA 3U5ZB 1YQQA 1FFXB 3DO6A 4LH6A 2YOFA 2D4HA 2H00A 2GOYA 4F3RA 2KYRA 3MJRA 1LTQA 1IPEA 2A1TR 4UFZA 1DC6A 3ND9A 3GIPA 4C04A 3N44B 3V7WA 1SBCA 1M2HA 5B37A 4FNAA 3ENWA 3DKKA 2Q4OA 1IY9A 4M55A 2AA3A 3E7FA 2I4OA 2FSVC 3OWOA 3FOCA 5CBPA 5KQSA 4NCXA 2H7YA 4OD0A 1FJGH 4TKZA 3AF0A 3IQIX 3RROA 3L8YA 4YCAA 4M54A 1ZLYA 2G4LA 4OHWA 4EYSA 3F5QA 3FGPA 2N1MA 2IUUA 2X8JB 4IYJA 4BE7B 1ZOLA 2DLCX 1HL7A 5CNMA 3TZ6A 1KFEB 3GAZA 3AOGA 3ML1A 3O3NB 4CM8A 2ZDHA 3QE3A 5JNVA 2RDIA 4KIJA 1Z2OX 4ND2A 1V3QE 5I6DA 4UCUA 4OQZA 4JWTA 2PNFA 1YR1A 5L3ZA 3HEMA 1NRIA 3GJ3A 4FHZA 2AZ4A 2X5RA 4BGIA 1ZU5A 3TWOA 4GI5A 5D6OA 1RADA 4QDTA 3I37X 2ZIAA 2BHNA 3HQ4O 1XNHA 1I6KA 1O57A 4QYIA 4JIGA 5HQJA 4QJ5A 2O2GA 4I1UA 4MHSA 5G40A 4IRKA 2GAIA 1OZGA 4C89A 1U3WA 1GLGA 3BWMA 4PGAA 5EJ8A 3ZU5A 4A23A 3GH1A 5J2TF 5TEWA 3JQ8B 4Q1DA 4L6IA 3UAOA 1GARA 3JCZA 4JBHA 2WVJA 1EZ1A 4OXNA 3KJHA 2JGEA 1KP9A 4AKEA 3GTGA 1G21E 1DVRA 3OESA 2GZAA 2D8MA 2A33A 2ZE7A 4NYIR 3CE6A 5H82A 4DMKA 2IE8A 1A76A 1U2SA 2O20A 4YP6A 4JBGA 5SY4A 4R6XA 4H6WA 4EG6A 5U9CA 1SBYA 4HWPA 3JVUA 4YS6A 1QHXA 2XUQA 2MTBA 4UCFA 2YJGA 4LF9H 3RSQA 3G9QA 3N6RA 3UXHA 1NVXQ 4X61A 2ZBRA 2ECKA 2D2VA 4KN8A 1R8YA 4KVFA 1KDYA 4NU0A 5BV7A 5AM0A 1P33A 4NXNB 2NGRA 2BJHA 1YC5A 2FOXA 4JT4A 1KL7A 1OGJA 1XK7A 3M6UA 1N7HA 2HIVA 3RLFA 3FVRA 3UMVA 4BNUA 4EPWA 1RQRA 1UM8A 2JIMA 3AZOA 3OEEA 4F21A 4ENRA 3R0ZA 4MUMA 1DAHA 1T0PA 1TM4E 5CJ2A 4K9KA 4KFTA 1EX1A 4NJEB 4MLZA 2GT1A 1CDZA 1IDOA 3LUCA 3HU5A 5KFTA 1OLUB 1HNXB 4M0PA 4TRJA 1O9BA 4TRNA 2IIVA 3F1LA 4WPGA 4GEKA 1Y9ZA 3CUEF 5AKJA 2P65A 3NH9A 4PFSA 2F1IA 2CHEA 3IBGA 3GV8B 2F6RA 4LTDA 3M70A 1NSTA 1V96A 3E9CA 4BFTA 4N01A 1PSWA 4Q4AA 1IQ0A 4N3AA 1VKOA 4Y9RA 1KERA 3TSOA 1YS4A 3G0OA 3HXMA 4LJLA 3NOXA 5COQA 1JI3A 3U61B 1NC3A 3QUCA 2HDKA 1F4VA 1PR3A 3TSZA 4AX4A 2WPDD 3OVMA 3SCZA 1EZZA 4L3VA 4PX9A 4IGIA 1MTZA 4LF5B 2Y99A 2WUEA 3GYBA 2C04A 4LVOA 4Z9AA 2JVJA 3CXRA 3T1HH 1Q0TA 1I14A 3IAXA 2KHZA 2QAJA 1R4MA 2JJ1D 2WT4A 3NIBA 2H7VA 1DC5A 4PIMA 5D1PA 3KUCA 3V1UA 2FN8A 2UZ1B 4BU1A 5I7WA 1KF0A 4OJQA 1XQYA 3WGZA 1E0KA 4M1SA 2I33A 1EKFA 3DVAA 4PO8A 1KRWA 1QO0A 3TUZC 2GZSA 1U6JA 1KSHA 1K8RA 2HA4A 3K3PA 2CBGA 2GQSA 1QMGA 2JA6G 1II8A 2FJ0A 5I48A 2RBGA 3IE1A 3OZ7A 4C87A 4ZQCB 2Y0BA 3BK7A 3ZXSA 4B6OA 1SGWA 4BKUA 4GE0A 2H4HA 3SIXA 3G3EA 3DTVD 3EVNA 1ISSA 1IHDA 3IEXA 3MD9A 4BNTA 4LZWA 3JYHA 5ICCA 4XUCA 4GMGA 2WRZA 4HUQB 3LUBA 1GCGA 1JDJA 5C5EA 3DZCA 1ZQ9A 1G42A 5EQDA 2UUAB 1DQYA 5EZYA 1VL8A 4PE5B 4HT3B 2WR8A 4LQCA 4O4IF 1AZWA 3PXGA 4ENSA 3SICE 2PJUA 4OP2A 1DADA 3VGJA 1OGIA 3PNYA 3BGVA 5F52A 3TD6A 3HCDA 3T7SA 3RB0A 3C6QA 3TNLA 2H0QA 3NO4A 4FR2A 2B1IA 4KRGA 3HY3A 1ZL2A 3PFGA 1OA0A 1OGYA 2HHCA 3ZIAA 4FCVA 3TL2A 1X6VA 1KZ4A 2FPIA 2ZSDA 4B4DA 3V1LA 3MNFA 2AFHE 5K3BA 1SCUA 3VPDA 4B3IA 3IJPA 1OJ7A 2F7SA 1RDFA 4CLDA 3RC9A 4K3VA 2VEOA 2P62A 4F5WA 3W2IA 4DIEA 2C2BA 1OAAA 3GPIA 4GPTA 1QF6A 4PONA 3ZDYB 3QE0A 4WJKB 5LN1A 1PYOA 3B1FA 2VH1A 2QA5A 1V8ZA 3FYHA 2FAXA 3LHSA 3F6SA 4NNOA 4O4JB 3FOBA 2PX6A 1RI3A 4G0UA 2FUG6 1DDIA 2Z3VA 3VSDA 1Z3IX 2EFGA 1ZISA 4OLAA 1P5HA 1KAGA 4LZJA 4HRAA 1SXJB 4Z3KA 2ZCUA 5JECA 4KQJA 2H59A 1RQ7A 2BCJQ 4O7ZA 4HBZA 3D6VA 4RXTA 1E8DA 1NDHA 2VDWB 3KTFA 1MVLA 2DUWA 2W4QA 4BNKA 3GTKA 1LFDB 1YB6A 5L3QA 1XZ8A 3SF8B 2LCQA 2H8GA 5KKNB 3G6XA 3VH2A 4L50A 4NMLA 1YB4A 5TR9A 3IQXA 4KFRA 2CFCA 2OFPA 4G5FA 4F6RB 2VYQA 1P2GA 4X64B 1P75A 3TLJA 1MT3A 4YUAA 4TUYB 2H0AA 1K8ZB 3TINA 5CNIA 2V9CA 1W85A 2NTVA 2FCAA 4BB6A 1ZMRA 5KYUB 1L4KA 5AH0A 2JIBA 1B42A 3D0QA 3WOHA 4CKCB 2WA2A 3EVGA 3MGKA 1X2BA 2V4UA 2I8AA 2IS4A 5K4GA 5C8ZA 4MEAA 5FBVB 1Z83A 1O95D 2DTEA 4E4RA 4OXYA 3EFBA 1V51A 3TYXA 4S0XA 3UVEA 4KWIA 2DUMA 3AI2A 4IMJB 3RIYA 3BB3A 1IONA 5AVYA 3RAXA 4OXKA 2ZR0A 5BYKA 4PO1A 4G0MA 3FTEA 3JPYA 1KQ3A 3JD3A 3ZTYA 2XKJE 3G1WA 3QI2A 3OPXA 2VH5R 3FNIA 4WCFA 5CA0F 1U98A 2VTVA 2RB5A 1W35A 4LBZA 3H6GA 4HZIA 2F3PA 1Y3IA 5JH7F 3REFA 4CIXA 4O2AF 1Z62A 1CP3A 5K5EA 4XJXA 1VCOA 1X38A 3R3VA 1ZIOA 3JWIA 1VMDA 2QI9F 3MELA 2DXIA 5A9TA 3K96A 4ZV7A 4D44A 4R5HA 2VVTA 3F7MA 4B3SB 3NONA 1ZVKA 1S4QA 4XDZA 5FL3A 4MRVA 4ZU3A 1ACLA 2UDPA 1PGNA 5ADHA 4CCYB 3ONWA 5JNSA 4O81A 2BGIA 4IZ6A 2C3MA 3H7AA 2KB0A 5L4LA 3TRKA 2R3SA 2WYOA 2WIBA 1U2RA 4MUIA 1UL1X 1IN6A 3WLAA 1ZD1A 1IYDA 1N2XA 1Y89A 3I01A 1LSUA 3LGXA 2XUJA 2ARKA 2J3JA 1ZP6A 1E3IA 4TVIA 2DFVA 1R66A 3CH7A 4I1IA 4QNRA 4H7DA 2RAPA 2FH5B 3CKYA 4MUGA 2Q6VA 4DL2A 121PA 4TSFD 4Y9TA 3VU1A 4MGHA 4F7DA 4E88A 4LXTA 3C7KA 1RAHA 2XTAA 4MWTA 3TJRA 1T0HB 3L01A 1H2WA 4CF4A 1SOMA 3OIUA 1E8NA 1WUYA 4X65B 1T9GR 2I76A 4L51A 3FLAA 3IBCA 4AWAA 1HFWA 2WIDA 4MPRA 2H4JA 1N33H 3NBQA 4EA7A 2JRCA 4JT9A 4UUBA 1DZ3A 3SHTA 1JHQA 1T3NA 4B0OA 2FFHA 2QX9A 1JX6A 3OAAA 5BXQC 4LWOA 1CBUA 5C7OO 5DNYB 2YFKA 2CYBA 5BV8A 1Z25A 5IVPA 3V6HA 2ZK7A 4CKZA 2NU6A 1ZNQO 3ZQUA 5F64A 5F9LA 2WB1A 4BO2A 4GYKA 4DQ0A 1JEQB 5FA6A 3R0VA 4OGFA 2PGIA 2DKNA 1C7FA 3D3KA 1ID8A 5C37A 2XUHA 5GWXA 3PD0A 5THXA 1R0WA 4E12A 2OZVA 3I52A 4C4OA 2G0AA 3N7AA 1JA0A 3EVTA 5BWWA 2XUAA 1UXOA 2QP9X 3JALA 3GJSA 1RR6A 2WV7A 4E51A 2IU3A 1HE3A 4IL5A 3W06A 3ANSA 5HILA 2P6NA 3I6MA 4TWAA 4ZOLB 2PEYA 1CUXA 4OSPA 4XGIA 3U48A 2DQYA 2Q2VA 1R4AA 3MHTA 2C2ZA 4LPSA 1RP1A 1W4CA 2GQRA 3HACA 3BN3A 1MAVA 3A3NA 1T4CB 4IJUA 4PEVA 5J9FA 1H65A 2VZ8A 4JC0A 1V7QA 2HF7A 4N5DA 4BPBA 1GL9B 3N0RA 1AQYA 1GG2A 1M5TA 2GCPA 3U7QA 2VK1A 1U9YA 2DPHA 2KQUA 5KOJB 1O94A 4X6UA 5KNCH 2G70A 5FUMA 4BO9A 3LUFA 1Q84A 5EKXA 2JIPA 2DUNA 4GKKH 3ZUGA 1DAFA 1I80A 3NEJA 4XRGA 4V0SA 5MF6A 1KE2A 5B64A 1SIOA 4EY4A 4JQZA 3L0IB 3CIOA 3JARA 2I6SA 2Y3IA 2J0UA 1DKNA 3WKBA 3TGWA 3O5AA 1DRKA 3A70A 4YT8A 2FSIA 3WKAA 2JK1A 4RKRA 4BMPB 1N0HA 2FPRA 3GDEA 3HBMA 2XOXA 2DFPA 5EZSA 1OASA 3DBHB 4B3DA 3CPHA 3UYKA 4IJ5A 3MRSA 2HYIC 3THYB 1KFBB 1T2UA 4P7FA 4M7EA 4AJKA 2CK3A 1QIFA 3OHMA 3FYUB 2CVQA 2VTEA 3N87A 2IYNA 3CX8A 2TMDA 4P58A 5ALZA 3QZ7A 5E38A 2OAGA 5AKGA 4DR3B 3V4LA 5EWLA 1MC4A 2Q2WA 3GB8B 4FU0A 4LHSA 1YZNA 2QLFA 4NEQA 2AI2A 3ACCA 4M1YA 3ZDDA 3M3PA 4XX0A 3WRVA 5HS6A 3HCCA 3GNTA 1UQUA 3B8EA 3A9VA 1AS2A 1D1TA 1SHKA 4PICA 1E2LA 5BWLA 4HR7A 4EG1A 1N3BA 1KEEA 3BAFA 4BN5A 1KZ6A 3TKAA 4CM6A 4D9MA 2C99A 4OUDA 3B13B 2AS0A 1USWA 4PYJA 1M6YA 3V48A 1U11A 1BN7A 2X8WA 4V0OA 3EDYA 4G5QA 3ETGA 5KAMA 2OCXA 1MCZA 2B94A 1L2ZA 5IYBG 3E0QA 3T1YH 3IOCA 4X1KA 3AWIA 1L7XA 3WFZA 3L6RA 2ORVA 4G89A 1NJGA 5HF9A 4MWGA 1ZIPA 3PR3A 2GPNA 2ZBVA 3BTUA 1WVMA 3DP9A 2PSEA 3U6KA 5F33A 1FX0B 4C6HA 1GZ4A 1E61A 3O94A 4BE4A 1XA3A 3K9FC 3UN1A 3AL0C 3RKSA 1G18A 4ZVKA 5LQRA 4GBJA 4OQXA 3RC7A 4RKWA 2QYZA 2BVNA 3OSZA 1W0JA 4CMCA 1SHZA 3KSBC 5EQFA 2B8TA 2IIPA 2QLBA 4UEWA 3F8TA 1M8GA 4AIIA 1MX1A 3MA0A 4RZ2A 5A2QW 4RYLA 1NT4A 3PXUA 2V7QD 4UTOA 4AMZA 2CDAA 1P2FA 1TYDE 2IFTA 1PL7A 3SQDA 1NP3A 5LQDA 1GQFA 3JSNA 1BKSB 1XMQH 3EGIA 1G66A 2B8WA 1SQ5A 1AKQA 3ZWKA 5ADVA 3BUSA 3R7SA 2HHLA 2F8SA 2FFJA 2O3TA 1YL5A 2EX1A 2OCDA 4UCXA 2E5LH 4IQ4A 2INGX 2ZROA 2QQFA 5AOVA 4LFCH 2BV3A 5DG7A 3BSFA 1YS7A 1X9IA 3UWSA 1X19A 1U7PA 2EFHB 4JI8H 1L5HA 2ASJA 3JZMA 3HN6A 3L4SO 2QD5A 4OX9H 4I5GA 3OM9A 3C97A 2CF5A 4G5XA 4DR1H 1DTSA 3TW4A 4KH1A 1GCOA 6REQB 5BUCA 1MP0A 3GTPA 4BUCA 4F84A 4YR0A 1T5HX 1WOYA 2ZSHA 3DMTA 2QL6A 4QG7A 1BS2A 2W42A 5ALXA 2VYVA 2B4TO 1VBHA 2ONYA 2R5NA 3K71B 2I91A 3FZNA 3R75A 3AV0B 4FHGA 3VXKA 4KGZA 1DSSG 4JLJA 3F6PA 4S05A 4E94A 4QRIA 4JVMA 5HWSA 3PFWO 2VN8A 1I4DD 5J1SB 2ILVA 3RTXA 1GO2A 3JRWA 2XUDA 2QGNA 4LBVA 3SX2A 2PUFA 4DY6A 2BM1A 3NYRA 5AK3A 4EYQA 4JJIA 1QQBA 5CR9A 2HJGA 3E3MA 3C14C 2A1HA 1XCGB 1O03A 3M5CA 4MUFA 4WACA 4JELA 3FPCA 1BMFD 4PLTA 1CXZA 2WVHA 4V2UA 4J94A 4ND6A 3EOBI 2NG1A 2VJLA 2V7XA 2ZIXB 1V37A 3Q88A 4Y3UA 1K4MA 3EAFA 2HMTA 2W6JA 2ZJFA 4RH0A 3E8MA 4YIKA 3HTXA 4NYIQ 2CV2A 1B0PA 1ZINA 4J9PA 1RJDA 1YI8A 4LFAB 5F1KA 4DV2H 3ANXA 3PEWA 3E2PA 3TR5A 5CDFE 2EWMA 4FN5A 5AOBA 5KFIA 4JUBA 4W5OA 2H1VA 1CUJA 3M4NA 4MIOA 1E6LA 4NEGA 1P6QA 2JGJA 1Q83A 4FS2A 4YXWA 4Q44A 2PBFA 1FXWA 2R11A 2HNAA 3VO8A 2RC5A 1QTNA 3AP2A 2VA3A 3B9PA 2VOEA 1X1EA 3FCOA 1T5SA 2ZTLA 1XPRA 1SA0B 3D3EA 3FHJA 4G0VA 4R1MA 5M3BA 5KZMB 4XGRA 2QZJA 4HC4A 1JH8A 3RRYA 2OLKA 5KVCA 4RB3C 4M36A 3O0DA 1Q57A 2P6RA 2FMTA 1QPZA 3DVRX 4C0KA 3HUUA 2O3JA 4L3OA 3TR0A 3N28A 4K05A 1XAJA 4AWBA 3BMNB 2A67A 2RARA 4Y2QA 1G98A 1ZHQA 3DXYA 4IS2A 4EKGA 1LSOA 4FYMA 1MJFA 4Q8FA 4F8EA 1YS6A 4ZVQA 3SDSA 3OMLA 2QL9A 2OPHA 4U8HA 3IKMB 2P6PA 3KTAB 3ZLVA 3D3QA 3IALA 2RG7A 3BD6A 4L74A 2PWBA 4H27A 4ZVOA 3V6KA 4MP8A 1LU9A 2OKGA 3GTLA 1EPUA 5KCZA 1G0OA 1FJGB 5JS2A 1T2EA 5AW9A 2Q5QA 3U5TA 3QQMA 4BVHA 4CKYA 3OE4A 4QOIA 4CTNA 8OHMA 1IZZA 5LKRA 4IKOA 3ZCSA 1B6GA 2VHTA 3OFJA 2CL5A 5A5VA 2GS9A 5FWNA 3H86A 1TUBB 2FDXA 2Q46A 2EZTA 3AF5A 4BUJA 1E92A 1RJPA 4GI2A 2QTRA 5ICFA 1XVVA 2JAHA 5KSYA 3CNEA 4QO7A 2YXLA 3ICWA 2I34A 2PDAA 1L4FA 3NDPA 4KZPA 3T1NA 3CW8X 1O5OA 1ZFNA 4XUEA 3V4RA 1PK7A 3THWA 1OBGA 3TF5A 4PLCA 5C5IA 2AXEA 1W75A 3T4EA 1YB7A 1MC5A 1XTUA 3OQOA 3IOBA 3KTOA 4WUTA 1YOVB 3S70A 3BG5A 3OX2A 3C3PA 4ISBA 1ONNA 3P9PA 2PRZA 4BQRA 3QY0A 1DS6A 1RRMA 1UK8A 5ENVA 2W57A 2QMQA 4QPPA 4DR2H 4M1OA 4ANFA 1S03G 3OBIA 1SB8A 1YCHA 3LOQA 4HUQA 3SSNA 3TS1A 5JUWA 2GVNA 4CR6A 3NV7A 3P9IA 1OTYA 2R62A 5FD8A 3VKWA 3HCWA 4TYYA 5HKLA 2BQUA 1WSDA 1IAQA 3P45A 4WI1A 3M6XA 3CISA 4UUAA 3A04A 2COJA 2FJPA 4ESOA 5L8VA 4ZTBA 3H9BA 1Q77A 3NKLA 1JIXA 1P8LA 1G8GA 3OOJA 1E1MA 2HZBA 3AXSA 3ORHA 2AIRA 3EIWA 4LF9B 3IN5A 3GQBA 5DNVA 1MB4A 4L7QA 2Z2IA 2XNDD 2GEVA 1ZCFA 3M4JA 3ZLBA 3RYTC 2FW7A 1KWKA 5CK4A 3DCNA 1WPRA 1ZVJA 4WK0B 1T8WA 4H3VA 5DH9A 2NU8B 4XLZA 4CU5A 3VAYA 1QYWA 4AW9A 3HUDA 1I2KA 2W11A 1WB5A 5LBTA 1LZKA 1P0QA 4MV4A 3R3YA 4G0PA 4P83A 1EIZA 3U2QA 3GVXA 1FQOA 1FPMA 2VPQA 4OATA 5REQA 2CGEA 4LRWA 2M1ZA 5HFAA 3AERB 1VHWA 1TA8A 1H2YA 1RAEA 1IH8A 1MC1A 4BXOB 3PPIA 3CVJA 3WLNA 1AM4D 3VC7A 3TDNA 1PZHA 1R0YA 4ZTUB 2W2KA 4MQBA 1FOEB 4YI5A 1JA1A 1RBQA 3FFXA 5IXJA 2B0JA 2V9ZA 3A1VA 1GSHA 4F9EA 4BBSG 4AXXA 1LJLA 3QTLA 2ZTMA 4D26A 4BB5A 3NT5A 1H3FA 3OT5A 5DPMA 4YDRA 4PQRA 1SXJA 3PW2A 3AR2A 3B6ZA 4URXR 3EXFA 3BSSA 3SXUB 5CD1A 2VF7A 3P0RA 4CEJB 4GR4A 2VDPB 3RU7A 4Q15A 1N7IA 1PV2A 2ASDA 3SF8A 5HNEA 4BNZA 1JNXX 2JFFA 4ENUA 3KJFA 3IIEA 2NO6A 1GYPA 3T1HB 2JFWA 4DF3A 3HOYG 5SYMA 2H85A 1R6UA 1C8VB 4LWZA 1RHUA 3GYGA 1EK5A 3WLRA 3KJQA 3Q3EA 1DHTA 2JLSA 3AFNA 3GHYA 2W43A 4HAWA 1P1HA 3EUAA 1CEQA 1OPRA 1B7GO 1W88B 1TMOA 1TJ3A 3T9BA 3IDSA 4IRDA 1H8HD 3F78A 4REOA 1J07A 2FEWB 3BFKA 4LJ8A 4NBNA 4OHXA 2IE0A 1F4LA 3IO3A 1ZJWA 3T5CA 3AF6A 5LZ8A 3ZOZA 1SUAA 3B3FA 1GM5A 1YRWA 3RFTA 4IDBA 2GYYA 4YUZA 1RYDA 2DKOA 4FW9A 3K9NA 2CJXA 2IEZA 5JBQA 1XROA 4BKMA 4DUZH 4JJ6A 4RZIA 1JKFA 3O2NA 221PA 3DW3X 2XOEA 4UUNA 3DTYA 5L3SA 4K81B 2A9VA 2Q8QA 2ZUSA 3DV9A 5IWAH 2Y76A 4XQ9A 2JEGA 2YWRA 4OPMA 2IYLD 2BFDB 1GGHA 1N4DA 3PXCX 4CM7A 3V2IA 3A3KA 3GJRA 3BJYA 1J2TA 1JR3D 1L7BA 1EKVA 3H20A 4FHDA 3PVSA 2EFYA 5FBLB 3IP5A 4KXYA 4B2IA 2LP4Y 4UNSA 3H2HA 2VWQA 3DKIA 1LW7A 2XMCA 1B8OA 1JEDA 3D0KA 3IB6A 2ZE8A 1QH1B 2BWJA 3GGGA 5BWBA 2ZYUX 1YK1A 2J67A 4LTMA 2AC7A 3E03A 3NIFB 1A0IA 2QSJA 4MA4A 3GT4A 1C8BA 4XIIA 4E14A 1HL3A 4CF7A 1QORA 2QRZA 2G09A 4W9NC 2Z0MA 3RRXA 5CP8A 3B9BA 3OE1A 4CI0B 2ZUBA 4Z49A 1RM5A 4H6VA 1OU4A 5K3FA 3CH4B 1DP4A 4URHA 2YJ3A 1OHHA 3TLZA 1Q7EA 3BH7A 2R00C 1PFVA 4B7XA 5FDFA 3QOWA 4RK5A 4WLUA 3KQWA 4C0WA 1TGYA 4KUHA 2VNAA 5KFKA 3MILA 4B6QA 2IUYA 2GD0A 1EM6A 2FEKA 4JR0A 4NEHB 3BJZA 5JYCA 2XIQA 3RS0A 1QVZA 4HEHA 3H6KA 4C2AA 2W7TA 1VBGA 1PJAA 5AVXA 2ZJ4A 5LP1A 2CXUA 3E9MA 3ZJUA 1OPXA 1C9DB 5JQGA 2JFQA 3I2HA 2H54A 1XEFA 1ZN8A 4ZPXA 3X1YA 1RJ9A 2X76A 5KFYA 4WBNB 4C9BA 4ZEOA 1Y1SA 3V1KA 1XLVA 3D3JA 2OE2A 3QYJA 3U3JA 5FJIA 4QDUA 3DR5A 1S2OA 2Q3JA 2R8GA 4NESA 1A71A 4IDOA 1SCQA 2VUHB 4OCZA 4R3WA 4R0MA 2WTUA 4ETSA 1W1IA 1JJ7A 3PGJA 1V25A 1GPWB 4XX1A 4UE6A 4PDBA 3QLTA 3U4QB 1PJ3A 2NX2A 3N2YA 1TO2E 3GLGB 1G3RA 4WZZA 2EBFX 3DDZX 1ENYA 4RMNA 3DEJA 2WDPA 2VUTA 2PQ0A 1V6SA 3IXQA 5EJ5A 2QV7A 4I50B 4B43A 4LDNA 1WCXA 4QGBA 3ZG6A 5CB0A 1JDTA 1PD1A 4ZV4A 3VR6D 4EZBA 1NW6A 5F1YA 1XTBA 4BU0A 4WN3A 3ROEA 4K7JA 5CH5A 3C24A 3FNQA 4BJHB 4E5UA 1N8TA 5COAA 3UFXA 3HVRA 2CKDA 1IK6A 1KPIA 3GGPA 5KFXA 1VB5A 4BNJA 4YJFA 1K06A 2GZHA 4MQMA 4TSKA 2RGGA 4QUBA 2V9PA 2LIVA 4PZZA 5LP6F 1EEXB 3UO8B 4QSHA 2R1UA 3COWA 1K2VN 1GKYA 5DE3A 4HO1X 4LHYA 4C3OB 2A9QA 1WCIB 2I9PA 2DWQA 4GHWA 1TMGE 2P27A 4AJ1A 4PZEA 1SBQA 2AW5A 3C74A 5B1EA 3PJRA 4KIWA 2DF8A 4EX7A 4N5NA 1OXSC 1E58A 9ATCA 4MUAA 3LT5A 3A1WA 2E5WA 1EP2B 5KYYB 1XPUA 2O06A 4RF2A 3ABZA 4RH1A 3RVQA 4Q47A 3TVYA 2VJMB 5KKAA 4TV8F 3DBHA 2NQTA 2EG9A 1RWWA 5ARDA 1XL1A 4N3BA 4UFOA 2VO1A 1SKMA 3D2BA 4U7DA 2X77A 2HMVA 4C3VA 1GVHA 4Q03A 5TS3A 1JKXA 5D87A 1QHEA 3Q8XB 1RKQA 3CXUA 1UKEA 1QRSA 3GFRA 1IBSA 5NLLA 3Q7SA 4TTVA 4U39A 3H11B 4K87A 1XQVA 2XCQA 3IAFA 3CZ4A 4EY8A 2FEPA 1T5LA 4IUBS 3DTTA 5CT5A 3EG9B 2YHIB 2XUIA 3KPUA 3NGMA 1N33B 1MW9X 4X0EA 4JI4H 3N8DA 4MR7B 2G9VA 1C5KA 4MRNA 5JISA 1PJ4A 2I5PO 2WM9B 5EINA 3C8DA 1GAEO 3NW9A 4HH0A 1N32H 2PNJA 4R2JA 1NBWB 4AX8A 3DOOA 3K8YA 5IM4F 3A9TA 3OP1A 5HGJA 2ZI7A 1UPFA 2HDWA 4X7RA 2GFHA 1A2OA 5ALKA 2AYXA 1I50A 2ODQA 2G8NA 2BEVA 1WR2A 3BMCB 5CAEA 5K4AA 4BASA 3WV4A 1HTWA 4RKFA 3D02A 2F55A 1L8LA 1O9HA 5HKKA 1CZKA 3KTMA 3ZDQA 1AN0A 3ADOA 4RSGA 3SQOA 5JJ5A 4DBLC 4BWGA 2O8EA 3R8CA 3UJBA 3L4BA 1Z39A 4WOKA 4WQMA 2N75A 3DEZA 3OKAA 3W34A 4QDZA 4I8IA 1J5EB 2YZKA 1YD7A 5JNLA 2FWPA 1M67A 5KYTA 1X1QA 1R0ZA 2QUBA 3HM9A 2C20A 4CETA 3ZJVA 2GJAA 4ONEA 5DMXA 1Y0BA 3HB7A 5CYFA 3NT4A 1RRKA 4U6PA 2Y0DA 5J23A 4GQAA 4J0DA 4JL5A 1QTQA 3LPAA 2WNIA 3AH8A 4D2IA 4JBWA 3KJXA 1IN1A 1GG8A 1NI4B 4DANA 2CXHA 2X19A 3P9NA 1JJIA 3EPLA 3VKVA 2WHPA 3GMTA 3FX2A 3HCNA 2ZBDA 4ECZA 4GKKB 3F97A 1U1EA 2EFDB 3I8SA 1EUDB 2NYVA 4ZT6A 4DR5H 3L0CA 3R23A 2V03A 2V5VA 3JQDA 4C0JA 3H83A 4CF6A 1N5LA 5J2UF 4N18A 3SQMA 5K8JB 4ARUA 1YBVA 2LDBA 1W5AA 1SKYB 4EABA 1AZLA 4Y30A 3TOXA 3VKGA 1K27A 3DPUA 1RLIA 2BGRA 2H1SA 4TTJA 3JD4A 4W5NA 3QJ5A 4BAUA 2WKRA 3QVVA 2UAGA 4OIFA 2WWXA 2HCTA 4FILA 2Q5EA 1U28C 2Y8EA 8ATCA 2YFHA 3EE6A 3BL8A 1RBYA 1QQ6A 3KB8A 2PM8A 2SKDA 4TT3A 4B33A 2P3LA 4XYLA 3ULKA 1DQNA 2VPXA 3B9RA 5T6MA 2QE7D 1IU9A 1O7JA 4ZDKA 4FIDA 1GPYA 5JC1A 4EYOA 3A6HA 3PDUA 3O8QB 3GCWA 3ZE0B 3CF2A 4KWCA 3MCVA 5B2FA 4INZA 5HV6A 3SQXA 1R64A 2EX0A 4YUWA 4GGMX 3HDVA 3FMIA 2OD7A 2OC4A 4YTEA 1DEXA 3K1TA 3L07A 5A3QA 1Z6AA 5FBHA 5AK6A 1N6NA 4GM0A 2O2EA 4CEHB 4O4HB 3U7RA 5TPWB 3AU9A 3AJRA 1C1XB 2NSDA 4KGVA 1HORA 1U8YA 2CB0A 2ZWVA 2PX2A 4P4SB 1KH2A 3K92A 2XKKA 3T1YB 2VEDA 3ONDA 1UPCA 1O0SA 3NYQA 4LWPA 2WD9A 1WB6A 5BNWA 5KFCA 1J8MF 4JBYA 4OP3A 2AOUB 5FPYA 3LSTA 4DEXA 1C7ZA 1ZHHA 1CNFA 2AWNA 1MOSA 2YJ5A 1I33A 4TT8A 3PNKA 4FONA 4GZ5A 7YASA 5KCMA 1YS9A 1D7AA 3G0DA 1V48A 3RGGA 3PNSA 4YACA 3PDWA 2Z9DA 2WJJA 3Q3IA 1Q7CA 3FHCB 3TNDA 4J1NA 2P7HA 1CK4A 3MWYW 4RVHA 4PG8A 3A3OA 2KI5A 5B58T 4ITVA 5K2OA 4BNMA 1GPMA 3NHFA 3R3ZA 2AYZA 2ZSUA 4NQZA 1N5DA 3VNVA 1QXSA 2CV1A 3WQHA 4HQNA 3PF9A 5AOCA 4H15A 4A1OA 3ZIDA 2RGYA 4CQJA 3L8CA 3HL4A 1SOAA 3MRVA 4O25A 4XFDA 1TTTA 1DKPA 1ZH2A 2NADA 4S35A 2X0FA 5BQOA 3NPAA 3A06A 1DEHA 4R3UC 5DWVA 3NDRA 4E21A 1YQDA 3PV0A 3F8NA 3SZLA 1JHUA 4Q9IA 2E5LB 2MYUA 1Q1BA 3B20A 4LFCB 4FYHA 1RU3A 2D0IA 3FKIA 5JMWA 2IZZA 2GN6A 1BJKA 2VHVA 1D8AA 3Q3CA 4I1OA 5IPFA 3ROKA 3ER8A 4UHBA 4OX9B 3AHDA 3SS7X 3UG6A 3EXIA 2VJKA 5BXYA 5KFGA 2IUFA 4D9NA 3QWIA 4DR1B 3T7AA 2FSHA 5AUNB 1U5BA 2GF0A 4XB2A 3LBNA 5EOYA 3ESQA 4IW3B 4PAQA 2D7DA 4N0EA 4CDRA 1CIPA 4EQ6A 1J22A 2VPIA 1XDZA 5DHUA 1T2FA 3GG9A 2WIKA 5BORA 4JDPA 3WYBA 2A86A 4ZO6A 3EGCA 2OVBA 1VA4A 4XYMB 2HK9A 4OL9A 5KQGA 3BIJA 4C4ZA 2ADMA 3DWIA 4J0QA 3CB2A 4DSAA 2XCIA 1VJCA 3IR5A 2B4QA 4WZAE 2ID4A 4RCYA 2GH1A 3RBZA 2HO5A 4NR0A 3BMQA 2H9AA 4E5DA 2NUAA 4PTLA 4I19A 1QYIA 4D6PA 3K20A 1ORHA 4L22A 1YOVA 1KC3A 3HO8A 1SWVA 4BVFA 4RFSB 3PHHA 5KPDA 5T67A 2IOFA 2JVKA 4PCUA 4BGEA 3L0DA 1A69A 4JLSA 3NRCA 1Y6QA 1VCNA 1DQPA 3HJBA 3GLKA 1K7YA 4RK1A 1DKQA 3UTCA 1ZMOA 2C96A 4Z3DA 4O2BB 2NP6A 1ZEMA 4DV2B 2BRUA 2GF9A 1EFRD 3HRKA 1RFGE 1KK2A 3G5AA 4II2A 5TQVA 1VA5A 2B7BA 4CLXA 5DKFA 4J1TC 1C9KA 5FLKA 1ESMA 2OO5C 3V34A 1LA2A 5E4TA 4XUDA 2R6JA 1Y5LA 3UGKA 2OHIA 4DLYA 2ZUTA 3S44A 2XQVA 3O4FA 4CIWA 1M2OA 2ZB3A 3V00A 1Y80A 4B87A 1KDVA 3AYZB 1JEYA 1FJ2A 3I04M 1VI2A 4UOQA 1MW8X 2I8LA 2WYHA 1M2WA 4M9UA 5EP2A 3SKYA 4RY8A 1Z5ZA 1QPBA 4QGHA 1QG4A 1RVV1 3F71A 3HJAA 5IYZA 3PNMA 3RKUA 1SK8A 5CM2Z 1NLZA 1YS2X 2BD0A 4P86A 1Y7IA 1NVGA 5EUQB 3EEYA 3OZXA 1M1ZA 1UWVA 2FE4A 1VGQA 2OUKA 3U19A 5E9WA 3O90A 2OV3A 2IZ5A 4MKZA 1JLSA 2WTBA 3ISVA 1BQ4A 2NZ2A 2LRHA 4MV3A 3EBLA 3DTVB 1U02A 1MJGM 2OHVA 1ZWKA 4NKRA 2F1JA 2F00A 3GW8A 1M2EA 5KJ1A 2RH5A 3KFXA 3C45A 2VCYA 1C0EA 1FUIA 1ULUA 3MGAA 4X93A 3LQ2A 3R5SA 1VPDA 2ANBA 1WSWA 3K8QA 5FBQB 3AUJB 3QEJA 1OLXB 3QFHA 3VUFA 3OT1B 2PPLA 5F7ZA 2QUZA 1E2IA 3IP9A 3IPYA 3R1IA 2HDOA 1IG0A 3L7KA 4I1SA 3M4YA 5CW2A 5LMNH 1NP7A 1JHRA 1MENA 4TTPA 5F7JA 3WLKX 2XCSB 2Q1XA 3TNYA 2ZJ5A 1M1NB 3PQ4A 4QBTA 1P4JA 1YCDA 4HMPA 2ODPA 4OSEA 4LXXA 2BIFA 1ZRSA 3WDLA 2ZCJA 2G9QA 5C35A 1W5SA 1OR8A 3CUWA 2QD2A 2I62A 1P4AA 4H4DA 2IU4A 3RABA 1W8IA 1IMJA 1ET0A 1WXXA 3ZBUA 2J6IA 2BM8A 1OAOC 1IRXA 1X7WA 1VE6A 1I7LA 4HWTA 2IYFA 3BAAA 3L6DA 3DMYA 1OT5A 1RZ3A 1PYDA 3VOBA 5HPYB 4LV5B 2VYCA 3CE9A 3DE7X 4RAOA 1SBNE 2C77A 3REQB 5L51A 4YQYA 4HB2A 2PUTA 4P08A 1WKVA 1LBQA 2QMOA 3FPAA 3Q0TA 3V1TC 4RW0A 1VBNA 3B89A 5DVZA 3FDSA 3OX4A 4K1LA 3IXMA 4HDSA 4PZYA 1FFEA 9GPBA 3DE4X 3B6JA 5AO9A 4L8LA 1KXJA 3R9XB 1FP4B 1KS2A 1D1PA 1W94A 1MFZA 5JHHB 3RSSA 5C18A 4B4VA 4P4LA 2GUWA 5IG2A 2CVOA 5FP0A 3SY8A 5JS7A 4QWDA 1A9XA 1AQIA 1J42A 2DWOA 3LL7A 2GBPA 1KI6B 1X87A 4C5CA 1PWYE 1GL3A 4LOHA 4X8OA 5KWSA 1OREA 4OMUA 1T1GA 2I7XA 4C7OA 1S7GA 4FK8A 3MWFA 4DR7H 1KC1A 2FMXA 2MYPA 2CHFA 1QF7A 3LUHA 3LQ1A 3EFOA 3VDRA 5BSVA 3AM1A 5FUXA 2P77A 1XVAA 3D4IA 1OWTA 2JJQA 4QW9A 2J9FB 1LW6E 1T8PA 5EI5A 4B3MB 3W79A 5KQPA 5DOVA 3T5DA 1EFVA 4P7BA 1UFQA 4TKLA 3GJXB 1QOZA 4JC8A 1Z45A 2HGXA 5BT9A 3W6NA 2EBHX 5FI0B 2ZRGA 4A0RA 3RGXA 4JKIA 2PGOA 2ABJA 1B1CA 4DKXA 5F5XA 3RWMB 3AIOA 4B8YA 2EDCA 3VR6H 4EEZA 3WHLA 2XQGA 5IF3A 1KI4A 1ZLXA 5J2TB 3H5NA 4DNFA 4Q9DA 3IDFA 4R0VA 1G1MA 2DGDA 4YIHA 1G3IA 3ZKWA 1TA0A 3FI9A 1T8RA 1YAJA 4EDHA 2GMWA 3R7DA 3CVWA 5FR1A 3A37A 4YPFA 4YAFA 4JI3H 4KMRA 2GRJA 2R751 1C0PA 2BFWA 2PX8A 5A5EA 2BTOA 4I3FA 4GPZA 4MO9A 4KQ9A 3QUAA 3V4ZA 2I1QA 3NHZA 4R1LA 5BWVA 3JR3A 4NPAA 3TLGB 4C4TA 4B31A 1VZ2A 1J49A 2EGUA 4RWEA 3MW8A 4EPYA 1P4GA 2BCGY 1V2HE 3DS8A 1K5GA 1CETA 2Q2QA 4KKXB 4RORA 4F5ZA 5GINE 3P96A 4IUCS 1WHTB 3UJPA 4AG6A 3MCAA 1FFHA 1SR8A 2Y6VA 5L40A 1GKKA 1ODSA 4RK0A 2RDJA 4AJLA 2HB6A 3D8HA 4F8JA 1DCMA 2PE5A 3KV3O 3ZKAA 4WDRA 3T4XA 1NXQA 3G88A 4LJ9A 1JWAB 2YXEA 3GIMA 4DA0A 2YYZA 5LFAA 3FCXA 1JT2A 2O2DA 1L7PA 1L4LA 3V8RA 3L8EA 2P9GA 1LBSA 3HBFA 5AVOA 1R18A 1XEXB 1TF7A 3LTEA 4PSDA 2ORED 5KQMA 3I9MA 1AD2A 3J80A 1X15A 3EPPA 3TTXA 1XTSA 2OBFA 5C7YA 4F12A 3HM2A 3A3YA 5JPCA 3OPYI 1RYYA 4Z54A 5JS1A 4TM5A 5EHIA 3WISA 3UAGA 3E27A 3BDAA 3HT5A 4QUKA 1EWVA 1Z37A 1Y8RB 3O2SB 3IEPA 1PS8A 4MCIA 4KSBA 3V8BA 4DUZB 2K2QB 2PAFA 1AS3A 4JEHA 1XDGA 4U2DA 3W9SA 1ST3A 2QJFA 3O92A 4D41A 1XRLA 5IWAB 1B8UA 2IGTA 1LS1A 5F2OA 1JNYA 1CY1A 5D1HA 3PUIA 1FYVA 2HSDA 3EODA 2HMSA 3OIFA 3OH8A 2UVQA 3G23A 4ED2A 4FIZA 1VBMA 4URUR 2X40A 4TVBA 1SY7A 4AYXA 4RPHA 5BSEA 2PZMA 3T3DA 2I2DA 4LZOA 4DV1H 3B6MA 3TTVA 4MH0R 4TGLA 1EBFA 3LXMA 2WTAA 2C7RA 5HP4A 4ERNA 4DNQA 4LSXA 1VI5A 4FE2A 2YHAA 3JVEA 1Y42X 2ZUVA 4ZU6X 5TE9A 4BQPA 4I55F 4XGKA 5I01A 3JS5A 5AI9A 1CSEE 3AW8A 3WB0A 5EIAA 4IXTA 4Z9BA 4B3JA 1E59A 5KSPA 3R6LA 4W1QA 4KSYA 4CIDA 3ZVKA 4TYWA 4DSZA 2BUBA 3F6RA 1A3CA 2UXDB 4RA9A 2VLIA 5MHTA 4ZALA 4L5BA 1NUAA 2YWXA 4FMCF 4W5WA 2DR3A 1N3YA 2XCUA 1GTZA 1BXGB 2ZWPA 2C0CA 1K68A 1UK6A 1JUDA 1R4ZA 2LWIA 4D3ZA 2CFMA 4NJOA 3KKOA 1NVDA 2KW5A 1NYLA 1XVTA 3A1NA 5ALIA 4V38A 3I5AA 1XMJA 2IZ1A 1QDUA 1S1CA 5K3EA 1G5IA 3G8AA 2C4HA 1ZGCA 5KT6A 2HA3A 3TXXA 1C7JA 1WXQA 4J43A 4XRRA 2CNDA 3URKA 2OV2A 4O1MA 4O4IB 3ME5A 5AMXA 4CNBA 2ZBEA 3E15A 1R6AA 1FFXA 2OMKA 5DO9A 3HCEA 4YP7A 2J9XB 5ALEA 1SEVA 3O4JA 4GLBA 3LPLA 3IH5A 3KG2A 3CLUC 4CC5A 4LOJA 1S2DA 1CZOA 1D2MA 1BZYA 2NACA 4C5BA 2G0NA 1UODA 4N9WA 1BEUB 1TLLA 3UJ8A 1HFKA 1V5GA 5EESA 2YDXA 3WJAA 2P2GA 1NKVA 4BZQA 2IW3A 1M34E 3ZY4A 4A9AA 5F2EA 4PHGA 2EV9A 1E1RD 1WQ3A 3GELA 4F6CA 3ZHBA 4AL4A 4ZVTA 1KEKA 1SZDA 3I30X 4O8CA 2X8JA 2ZJ2A 4KITB 3W2TA 3DONA 4YA6A 3OPVA 1PR0A 2JIDA 3LT2A 4UBJA 1F17A 3F3SA 4OJYA 3TZHA 4QXRA 4J16A 2PFGA 4YO8A 1SG6A 1PGQA 1K98A 4G26A 3HO1A 2MWMA 3M0EA 3FAKA 1XQWA 4I8DA 5FOQA 3IELA 1AO0A 3I9OA 3GN1A 4KIUA 1DZIA 1WETA 1FXUA 2JI9A 4LF4H 2F8MA 4P1ZA 2ZM6H 3IQHX 2Z2YA 3SKXA 4FBMA 1GIAA 3GWGA 3DF7A 4D9JA 4DRFA 1YNOA 4BLTA 4UQPA 3QBDA 2QTVB 4H7JA 4RYDA 4JUZA 2OA0A 1I2CA 1G20E 3JQ8A 4HVCA 1JIUA 1G64A 3EVEA 1FDRA 1LTHR 5TC4A 3TKLA 4S1PA 3U44B 1DC4A 1Z2PX 2OORC 2ORIA 1P7WA 5HW0A 3CONA 1LK7A 1D2CA 3LQFA 2EAUA 1R5OA 4W6ZA 2JA7A 2C5GA 4I3HA 2BM9A 5DBIA 8ABPA 3RS7A 4MS1B 1KZ9A 5K0FA 2Q21A 3EDRA 5EIXA 1B73A 4O7NA 2FQ1A 1WAMA 1G8FA 4LJ5A 3M6LA 4BFWA 3EZGA 1J5XA 4K9PA 2PMWB 3S68A 3QFFA 1Z7BA 3Q7EA 4DDKA 5F98A 5TPZA 4QOGA 1PJSA 2M2IA 5H16A 4NHEA 1L6IA 2FSUA 3LC0A 2Q3CA 2ORWA 2A9KA 4TX1A 4M0KA 4R4JA 2WNSA 2ICAA 2OM2A 3X2FA 3BD9A 2C9DA 1CDDA 1P4RA 4KV7A 2AD5A 3O8QA 1HV8A 4YCLA 5BSFA 3QWFA 1Z6ZA 1M6EX 2DAAA 3SBEA 2C4UA 4JI4B 3PKJA 2YWHA 3COSA 4LDZA 3TRHA 1W5FA 2AMYA 3VPCA 4NJEA 4KUEA 2I4RA 5JH7B 3H18A 1N32B 1RW4A 4EENA 4O2AB 4JASB 1OLUA 2HX1A 1NM5A 2I29A 3ORFA 1BGVA 3W5VA 2H1WA 2OVFA 3Q6IA 1P18A 1M83A 3C5EA 1RIIA 1K1SA 5DF1A 3GT3A 5G41A 3RSZA 3L8HA 4TKMA 1Z7YA 4HMOA 4IG9A 1BJRE 1I32A 5EJGA 1GOTA 4EJ2A 2QVXX 3ERCA 5JNTA 1WHSB 4NAVA 3FYSA 2YQ4A 5EWFA 3I83A 1MO4A 4R84A 1L3CA 4EFEA 1A8QA 1N6HA 1SFRA 2FN4A 5F7OA 4M37A 3LYLA 4D3XA 5AKHA 1Y98A 2O7VA 3BTSA 2F48A 3L7CA 1HT1E 4DL9A 2QN2A 3SBDA 3QLEA 1JAXA 2YY5A 4UCTA 1W9MA 2HHFB 1XA4A 3S0JA 4AFNA 2WWYA 2JS7A 4L6CA 5FTKA 2HK8A 4LYJA 1RRPA 4CM9A 3TLAA 3A4YA 1JFFB 4D80A 4RABA 1FW6A 4Y18A 4P0TA