4M9UA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
365
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 115
structure length 365
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4m9uA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4m9uA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m9uA01
4M99A 1I7NA 2R7NA 2FB9A 4O4HF 5BPHA 4J6EA 3OUZA 5JQWA 4O2BF 5C8YF 5HV6A 1DV1A 4HNUA 4FU0A 2W6PA 2QF7A 4RZQA 3MWEA 2I8CA 4EGJA 3R9RA 2WYOA 4O7YA 2VQDA 1GSOA 3U9SA 5JVLA 2R7KA 4FFRA 3LP8A 2GPWA 4O83A 1CE8A 4O4JF 4XZ3B 1Z2PX 1KJ8A 2CZGA 2R85A 3JRWA 4NYEA 1KJ9A 4EGQA 5BPFA 3HBLA 1KJIA 4YAJB 4O7RA 3KALA 2VPQA 3TINA 3R5XA 2C00A 1WR2A 5GONF 4O7TA 3MJFA 2GLTA 3HB9A 2NU7B 1UC8A 3N8DA 5J2TF 2DLNA 3GLKA 1JKJB 5C1PA 5FNVF 2NU8B 2PBZA 1E4EB 2GQRA 4IHJF 3K3PA 1AUXA 1DIKA 2I87A 1M0WA 5H80A 5CA1F 4IWXA 3R23A 1Z2OX 4O4LF 3WNZA 2PVPA 3BFPA 5CAEB 4O4IF 4DLKA 1GSAA 2XCLA 5EZYF 2W6QA 4ZQIA 4ZI7F 2V59A 1JLLB 5LOVF 5J2UF 3K5HA 1A48A 3U55A 4FFMA 1IOVA 1C3OA 5I47A 3VPDA 4O81A 3BG5A 3I12A 2DZDA 2I80A 1EHIA 1W93A 4MV7A 4EABA 4L1KA 1EUCB 2FPPB 2ZDHA 4EAAA 4FE2A 4MV6A 4YAKB 4ME6A 2NU6B 3ORQA 2YYAA 4WD3A 1CS0A 2Z04A 3VPCA 4O7VA 2GPSA 3E5NA 2QK4A 3DF7A 4Y8VB 4ZHQF 2ZDQA 2R86A 3WO0A 5LYJF 4YB8B 1VKZA 1AUVA 4MV1A 2X0SA 3UFXB 1GSHA 2YZLA 2DIKA 4O7NA 4FFOA 4O7WA 4C5AA 3JZFA 1EZ1A 1W96A 2R87A 1BXRA 2DWCA 1KEEA 2SCUB 3VMMA 4I55F 5LP6F 5BMVF 3U54A 1VBHA 5JVDF 2YRXA 2ZDGA 4XX0B 4C5CA 1EUDB 1CQIB 4C5BA 4WBNF 1DV2A 3MWDA 1KJQA 3U9TA 2P0AA 4M98A 1Z2NX 5JQGF 1A9XA 3GIDA 1GGOA 1KBLA 4FGRA 2Z02A 3V4ZA 2YRWA 1CQJB 3Q2OA 4MAMA 3KREA 1IOWA 4XYLB 3G8CA 3Q1KA 3JZIA 4M9UA 4M9CA 2CNUA 2W6OA 4MA0A 3AX6A 2VR1A 5CB4F 1JDEA 3K5IA 3RUPA 3OUUA 3JRXA 1PX2A 4TV9F 2YS6A 5D8DA 4FFNA 3G8DA 4MV3A 2OLSA 4EA7A 1B6SA 4YJ2F 3R5HA 2XD4A 4IIJF 5DMXA 2PN1A 4HR7A 2W71A 4XYMB 4MV4A 5KX5F 2CQYA 5LXTF 3WO1A 1JDBB 3TIIA 2FPGB 1GLVA 2R82A 4FFLA 4EG0A 4QSHA 4DIMA 2R84A 3TW6A 2FP4B 4MV8A 1C30A 2YZNA 1PK8A 1E4EA 4ZOLF 2NUAB 1I7LA 2J9GA 1VBGA 4O82A 4HNVA 5JH7F 2YZMA 2NPOA 2IP4A 3SE7A 2W6NA 3R5FA 1M0TA 2YS7A 4YBZB 4IWYA 4FFPA 4TV8F 2YW2A 3KAJA 3AW8A 2CNQA 2CNVA 1OBGA 3RV3A 2VHEA 4MA5A 5CA0F 4O7LA 1KC7A 2YWVA 4I4TF 2FPIB 2W6ZA 5KKNB 4E4TA 3BSSA 4YJ3F 5IYZF 3QFFA 1BNCA 3V4SA 3LWBA 3NUAA 3BSWA 4GGMX 3ETHA 3RV4A 4EA8A 4EA9A 2GQSA 4O7ZA 3VA7A 3RFCA 4O7SA 1M6VA 1UC9A 2V58A 5C1OA 2NU9B 4HNTA 1KUTA 3TIGA 1EYZA 2V5AA 4TUYF 2YL2A 2R6FA 3ETJA 2HGSA 4I50F 1SCUB 4HQ6A 3TQTA 3BSYA 3VOTA 4IZOA 3ORRA 2R7LA 1KJJA 1ULZA 3KAKA 2W6MA 5K2MA 2HJWA 1T36A 5LA6F 1B6RA 4O2AF 3VPBA 4O84A 2YZGA 4MV9A 2W70A 3N6RA 2R7MA 4O86A 1OBDA 3HO8A 5HBRB
chains in the Genus database with same CATH superfamily
4KZKA 4NH4A 3AJ8A 2PUBA 2C8VA 3W0LB 1ZMXA 1IC6A 3LT1A 5JCXA 1EJ0A 5DGDA 3HWX1 3H1BA 2HRRA 1YONA 2FW0A 1SCUA 3HUDA 4L6CA 5KFPA 1MJNA 1HYBA 1A9RA 5BPHA 1E7QA 2P9FA 3EDCA 2GBLA 3GT3A 3KSZO 3KZ1E 4M22A 5CNKA 2O8DA 1CJMA 4OYHA 1MORA 4HTAA 4OHVA 2OHOA 1NZFA 1TM2A 3BWVA 3KCNA 4ANFA 5CA1A 1P2FA 3AUUA 1QSGA 4G1BA 2HTEA 3TQ1A 3B78A 4HH3C 4DR7B 2UXBB 1HL3A 5FUQA 1J24A 4PC7A 3CT4A 4F4JA 4Y9SA 1BA2A 3Q8LA 1G59A 3ZHUA 2BFCB 2PEZA 4WK4B 5CRIA 3LX6A 2QGFA 2QXYA 4TXLA 4C6HA 1A5BB 3R9RA 1GKYA 4R98A 1L7DA 3GUVA 1GU1A 3H8VA 1U5CA 1C0PA 2X7HA 4GZ6A 4RFSA 2VWQA 5A3RA 1DG9A 3ZCPA 2Y6UA 3TCKA 4BZWA 1ML4A 4FIDA 1A8IA 2RD2A 5JVLA 2H4XA 3I2IA 2EF0A 4KLAA 4F3CA 4ZO9A 1EMDA 1IN1A 4Z5XA 2EXXA 3NHSA 2ZE8A 2HM7A 4B48A 3L8ZA 4NI5A 3UHPA 1FDWA 3DONA 5AI6A 4FFRA 5AK4A 3VU9B 1DAFA 1NY5A 1RWXA 2X5XA 3FRIA 3M4YA 1GQSA 5ULLA 1CE8A 2B7CA 4EY8A 1VL0A 4CIVA 5T41A 3CXRA 3C1UA 1KE1A 3QMVA 4EMSA 2C2EA 1JA1A 2EJUA 3NONA 3CN7A 4PS0A 3SGLA 3TLMA 3U44B 2PGIA 1MEEA 2XQJA 3KKLA 4UDOA 5T8KA 3KFLA 5GADl 2X5OA 2ZIUB 2PGAA 10MHA 1QOQB 2BMDA 2WKWA 3QYFA 1NVVQ 4HF7A 1KVSA 2YVAA 2HI0A 4HDSB 4DBZA 5BP7A 5LUAA 4CLRB 1JYSA 4E5YA 4W5HA 4ECEA 5M7EA 4ARCA 5EIBC 3R5XA 1HDZA 2QL6A 4YLGA 4JOCA 2R8ZA 1WXXA 5T5QA 5C8VA 2RJNA 4OIFA 1JKXA 2G6TA 4JJ7A 4DNFA 5E7IA 2XOEA 1HYGA 4REMA 1N6LA 2KE5A 1R12A 3TE7A 3ZDEA 4K9SA 2MSLA 2QW8A 3LAWA 2B8WA 3QVVA 4GMFA 4ZQCB 4HAIA 7MHTA 1JPJA 1QK3A 3AIMA 1ORDA 5BUCA 5ALDA 4UQLA 1K1QA 1GG9A 4J3FA 3V33A 4B3CA 1RHMA 1R2QA 1XDGA 1N8KA 2HQRA 2PSDA 2WM9B 5AHWA 4DWJA 2H2DA 2IHVA 5EESA 3SYTA 3MYRA 2GHRA 3L1VA 3ILSA 2YZ7A 3N53A 2I34A 2O14A 4NARA 2HA2A 5E1BA 3GGPA 1UFKA 2V6GA 1QC5A 5COQA 5FADA 4EBFA 1VLZA 2NO6A 2YWJA 1ILEA 1YR3A 1E0JA 1R7RA 4Y2PA 4Z0PA 3C97A 5EE9A 1HH4A 2X0JA 3BIJA 3Q7SA 1NPTO 2GN2A 3JQBC 4K6GA 4RJ2A 2V54A 4QPPA 5A9TA 5LD2C 1DIKA 4HLUA 4M21A 2C59A 4ASUA 5HZGA 2EEPA 1PI3A 2PUEA 1JG6A 4ED8A 3OTGA 3B9RA 5CB6A 5LU8A 2OCLA 3VJLA 4L50A 1RWQA 1FKAH 3EEYA 1U0HC 3H0EA 3ICCA 4G1FA 4MITA 4P54A 4P4UA 4REQB 3DTTA 5EQDA 4ARBA 5BN5A 2FFHA 4DV5B 4E5MA 3AGPA 1GILA 1I3LA 2FTKE 4F6RB 3AERB 4MVWA 4CKZA 2Q3HA 2OYRA 3Q3VA 3GV7B 3EDRA 4EIWA 4B8YA 1GGMA 4PLFA 3OCCA 3BB3A 4N0DA 4DM3A 3VYVA 1SZJG 3E1SA 4KO8A 1KDPA 4EM6A 4JASB 5F7OA 1QBGA 4NECA 5ALLA 2DFLA 4P83A 2GGSA 2PLFA 4YHHB 3GTPA 1LVGA 1WZCA 3HSYA 1H0KA 5FPHA 5J2TA 1XV5A 2XKKA 2ZRNA 4YDQA 3FDZA 3BG5A 3EQ8A 3EARA 1H2ZA 2G7ZA 1YDHA 4H6VA 1K97A 3AEQB 2E21A 4U7PB 1TO2E 1Z08A 4HDNB 4A6PA 1VZ2A 1JKJA 4CT5A 4RTSA 4GOLD 2FPPB 1S9DA 4D26A 3KWLA 5KWJA 4MV6A 1UBUS 1SC1A 1RLUA 2UYOA 4N12A 3V6MA 1IIBA 3CF4A 4P80A 5C31A 4CKEB 3GIPA 2YCHA 4M9SA 3IV6A 2ECPA 1OJ7A 3PDIB 2WPNA 4RLQA 2YYAA 2Y67A 2X0RA 4UVEA 4R69A 5ECDA 3T6KA 5LJLA 3HXQA 4Q82A 2P30A 2GBLC 3ZDQA 4XVHA 3ESZA 3HCFA 2H4YA 2P2GA 1H2HA 4H0NA 2X4IA 4JYMA 4MINA 5K7SA 3QBJA 2IBTA 3KPWA 4RLFA 4JGIA 3H5WA 1AS0A 3HVIA 3GNQA 3TSYA 1UJCA 1QU3A 3OU6A 1EWRA 3EVCA 2HT6A 4P3YA 5DWQA 4G0NA 1P2DA 1RIIA 6REQB 1N2GA 3L0CA 3SHOA 4IYJA 3PQ3A 1GYQA 4ZK2A 1PL0A 4GLFA 4X45A 4ZHQF 2BGJA 2Z8YA 4B8ZA 4JVOA 3ROTA 3WKBA 4G1EB 1KQ3A 4XUDA 5H59A 3E4DA 4PX9A 1H69A 5DGXA 2JBWA 3FTNA 4WSOA 5CNJA 5F35A 4YRNA 5EYPA 3M1AA 1RI1A 1WMEA 1PSZA 2WD9A 4AN1A 2RDJA 2G5GX 1ZJJA 3TE6A 5KFCA 3UT5B 2CW5A 4I4LA 3ANNA 5BWUA 3CW2A 3I6YA 1EXMA 1R0RE 3R41A 3QOXA 4MDYA 4P7JA 4PONA 2WYHA 1GL7A 2FPRA 3PFKA 3RM3A 1BXRA 3P2IA 5KO2A 4CLXA 2QSZA 2V4ZA 3CH6A 3ZGOA 5LQRA 3U7JA 1I4TD 2GOYA 4A3EG 2D0DA 4LSAA 3EFOB 2DY1A 1Q2UA 3K4QA 4YP0A 4DUGD 1XJ5A 3QQPA 2LUOA 1C9YA 1W5AA 4RU1A 5JISA 5T67A 1ZINA 1IVSA 3QWHA 2IYWA 1UINA 5BNTA 1NE7A 3B8HA 2MSCB 5KNBD 5THXA 4MTEA 1NMQA 2PD6A 1KEEB 1NATA 3K70B 1UMCA 3PPIA 4WBNF 3K30A 5KWSA 2L42A 3GNLA 1N3BA 4HNQA 3VHQA 4ZV4A 1DAIA 1R5JA 1NTRA 4DT1B 4IHJA 1X70A 1WUJS 3O9MA 3P2EA 4FHCA 5TRTA 3T06B 1PCXA 2J3MA 1Y9DA 1X8LA 4LDQA 3UM9A 2IS4A 2PL5A 2OAP1 1ZN2A 1TMOA 1E1LA 1EB8A 2NAPA 4LWOA 4K40A 3O38A 3FCAA 1ZICA 1TM5E 2B35A 4MAMA 1N56A 3HFGA 3T1YB 1RJEA 3GA0A 2FLVA 1ACMA 2FUCA 1EVKA 2GJ4A 4LQDA 5HIIA 1SBIA 1WBJB 2OBXA 3ZQ4A 4BMZA 2ZIAA 1JQ5A 5BSEA 1JHMA 4NZOA 4NQZA 1K86A 1R9JA 1DRWA 2B30A 4QODA 3M9MB 1PIWA 1GNTA 4X64H 2BZ1A 3AVPA 3C0KA 3EG5A 4HFRA 1UPXA 4XYBA 5ILQA 4QL3A 3RT1A 1M1NA 4MA0A 2J67A 4LHZA 4BE7B 5L7TA 1C4XA 3H16A 3U4IA 1XHEA 3CCFA 2MWMA 4M3NA 2WTFA 1EAMA 5LDGA 1LZKA 1Y89A 2OXEA 4XWAA 3V1TC 4G0MA 1I4WA 4ARUA 4CQJA 3GLFB 1ELOA 1QH1A 4RHFA 3QZUA 5BNZA 2ADMA 3STHA 4WBSA 3PYMA 3PW0A 3AY6A 4RYLA 2OKGA 5FKJA 4RFSB 5JNWA 4MO2A 3UZBA 1XK6A 1AKQA 4HWGA 4PBTA 5BWRA 4REOA 4UJ3A 4ZVMA 4DZTA 2DHDA 1BFUA 1EA5A 2BFCA 4K3UA 2GEFA 4L3WA 1E8DA 1Q6ZA 5I9MA 3SAJA 3JWIA 1XRRA 2WJ3A 3CUVA 4RSMA 1D9ZA 4HCJA 1IN5A 5JEEA 4RMGA 2H2HA 3EHDA 1QK4A 3BJZA 4E4YA 4F04A 2FVYA 1XIVA 1YR7A 4IM7A 4V24A 1LC0A 3WDLA 2OLSA 2CV1A 1IG3A 2V7QD 3AU8A 3HB0A 3J7TA 3U26A 3I2HA 4ZI7A 1DL5A 3GJSA 1W5EA 4R16A 4RCVA 4UQOA 4Y98A 4K05A 5KEIA 1AQLA 5BN4A 4OG2A 4R05A 1T5BA 1PQWA 1OLUB 3RSFA 2R1ZA 3R3JA 4NS4A 2XUDA 4A16A 4K8RB 4IRKA 1TZBA 2QRKA 2W9BB 4YRPA 4JUDX 4N82A 4PBSA 4DBVO 5JZMA 3ANSA 5JY6A 1JNXX 2Q6VA 3TLAA 1SG6A 3QYPA 1FQKA 2FPSA 2GO1A 3CGWA 5DP2A 2WM2A 3W3AD 3HJBA 2VCHA 4TV9B 3GGJA 4C78A 1S1MA 4MVJD 2J33A 1E2GA 2QV7A 4DIMA 2IY8A 4KIUA 3E9RA 1TK9A 2ZKLA 3RARA 1SCBA 4QJ4A 4DNXA 1NXQA 2VLIA 3C3YA 3VU1A 4IGAA 4M2LA 1J0BA 3GB9A 1HI9A 5FL7D 5KSWB 1D1SA 1JU3A 4E12A 4RTOA 3L6OO 5L3SA 4KGZA 4S05A 2XGQA 3OCXA 4MWDA 4OQXA 3VPSA 3K9LA 3T7TA 4BO7A 4JL5A 5GIPE 4WGFA 4PBCA 1F6BA 3ROZA 4HD8A 2IZ5A 3BA6A 2W2QA 4ZOLF 1DUSA 4EVRA 2B9EA 3W6OA 2FRXA 4JUCA 4ED6A 4EX7A 5IHPA 5HJEA 2HJGA 4LRTB 4RZXA 4GXQA 3BBPA 2V7QA 3QUCA 2QVCA 4RORA 3AKYA 3L40A 4WDQA 5MN6A 3QLVC 1WKCA 1PQ4A 2F4NA 3TAXA 1HNZB 1YA8A 3ZDRA 2RK3A 1OBFO 4ED3A 1RAIA 4KIWA 5ALVA 1N8SA 2A9QA 1Y4AE 2UYGA 3Q2KA 3QXJA 5E6RA 3M6VA 4KR7A 2RJ3A 1CF2O 2JATA 3ONDA 1JFVA 1FP1D 3W5VA 2HJ9A 1KI1A 1GPJA 2VQFB 4PYJA 3WJ7A 2XGSA 5E8RA 4QTUB 3D4BA 1SC9A 1DKOA 2EJVA 2IH2A 3PQEA 4WMLA 2A30A 5ITVA 1STOA 5IMSA 2JIBA 3HB4X 2OT3B 1UBOS 5A3VA 2CFSA 2IU4A 2BKVA 4R8RA 1TE2A 4I6JA 4KDCA 3R7FA 3V7FA 1SUAA 1B1CA 1V71A 2B1IA 4MI6A 2HFKA 3UMFA 3W77A 4K9PA 3KRTA 4ZU3A 3FX2A 2O0HA 3W06A 2CL5A 2RHOA 3LX4A 1T10A 4CN8A 2J4DA 3QVSA 3SZ3A 1I3NA 1PZHA 2G72A 3H6HA 4PLPA 1FSFA 2IIBA 1KI7A 5I7HA 1J5EB 3W1EA 4M0CA 2GD2A 2PDAA 2KB0A 3V1YA 2ZT6A 1I3KA 1TQHA 3LC2O 4J0JA 2QRMA 1GN9A 2ERXA 2EJ2A 1NVTA 3OTOB 1I2ZA 4JYPA 2Q5CA 3NBFA 3IHLA 4RUAA 4FUQA 5KOYA 3LWBA 3NUAA 1SCQA 1SC4A 2QX9A 4LBWA 4RH1A 4Q7QA 3OZWA 2AG6A 4TLEA 4JMLA 1EEXB 4M1TA 5GVSA 4Z0NA 2ZTHA 2GJ9A 2XT6A 3I0ZA 4G2TA 4JJFA 5ITZA 1ZD9A 1YDMA 2DJIA 1Z3IX 3F3YA 2QZSA 4HDKB 3LRPA 4N0MA 3WBKA 2P4EA 3PPWA 4UFZA 2DFNA 1VOTA 2PUFA 3IP8A 4MDHA 1ILWA 1KC3A 4KGVA 3UK7A 2BW0A 2GXAA 2ECQA 5IT5A 3H04A 4WLFA 3L4SO 1JH8A 4ROSA 1XRQA 5THKA 3GAZA 3JPWA 2DSTA 3JQ9A 1XCMA 3IEIA 4RM2A 3IVCA 4RBNA 1OWNA 2NQ8A 1P16A 5D86A 1RQRA 2XCUA 4JBLA 4PC3A 4XEUA 2XTAA 4EKIA 1MENA 1ZJZA 3OHAA 4Y2HA 5EP1A 5IVHA 1C8VB 3RRBA 1Y5LA 4PIPA 2WABA 4J0MA 2IOFK 2P11A 2I91A 1PEDA 4XKJA 3VVLA 3PGA1 3GZ4A 5K05A 1L3CA 3NFRA 2HRDA 2O2XA 5DBFA 3IOMA 2QUAA 4HI0E 1QS0B 3RGXA 4G3XA 2EATA 2IMWP 3JQ7A 3WSWA 1BDHA 2R751 3MRVA 2B37A 2QVLA 3I34X 2CGEA 5D5HA 1E4FT 2Q3EA 3WBJA 3KLBA 4YJDA 2Y1FA 4W7HA 4TTJA 1U2DA 3HVKA 1O7JA 4MRAA 5TJ9A 4BX3A 2WFZA 1AF4A 1ESEA 2H5JA 4JSYA 4IJVA 3RVDA 3CISA 3EPJA 5DTEA 4YUYA 4BRSA 3JXEA 3D8RA 4GC5A 1P75A 3R77A 4W9MC 3GV8B 2NO0A 2JLQA 3AFIA 3HCWA 3EXEB 1PUXA 3P9SA 5JFTA 1KP2A 5KTYA 5KYNA 1VPWA 3REQB 2XUOA 4FE4A 2F2TA 1XCPA 1IQ0A 1X7GA 4OHPA 4TYQA 3R09A 3FWHA 3Q7QA 1SHUX 3IRVA 1CIPA 2CMFA 4DCGA 2HLDD 2XCSB 5ER6A 4ISBA 3OQNA 1NONA 4EFBA 4OQEA 4JJZA 3IELA 4UHJA 1M5TA 2NZ8A 3CPHA 3P96A 5DISB 5J1SB 1K8QA 1SBTA 5KI6A 4E6EA 3EFOA 3L05A 2R8XA 3N70A 3ZD8A 4DUZH 3C6KA 3MGCA 3L2OB 3GT7A 2A5LA 1W36D 2XODA 2GCGA 3PGLA 3EISA 4XQ9A 1SU7A 2C4MA 2OMEA 3SR0A 2G17A 3TO5A 4KPGA 5HZHA 4W82A 3T1HB 3TM4A 2I29A 1H8HA 2LDXA 2D1YA 4UAUA 3SCZA 1L6RA 1PBTA 1A97A 2RSLA 1VXRA 4DLSA 3K9HA 5FBWB 2BMWA 2C2MA 3L7AA 1NYQA 4BU1A 1QFXA 2D8AA 2PMWB 1PR4A 3KXDA 3ZQKA 4Z1MD 2EQAA 3O31A 4DM7A 5JY1A 3EIFA 4ZU1X 3IQIX 4F4HA 2VEOA 2Q5JA 4KO4S 5CVUA 1QE5A 1Z38A 1P8LA 1SCKA 1ZH4A 5C5CA 5JG7A 4ED0A 3IAHA 4L9AA 5FTWA 1SQFA 1RP1A 5CCDA 1K3TA 4ZHQB 1P6XA 2G4LA 5C7YA 1ZSYA 2R8GA 3AG5A 5ALMA 5AW2A 1K2VN 1G7TA 3MXTA 3I04M 2H0RA 5EXXA 1M8PA 2W57A 1PJ2A 2X77A 1RXSA 4UM7A 4LF5H 1MN6A 3NHLA 1YHZA 3PWTA 3DYBA 4DLXA 3KWMA 1XEXB 4AY2A 5LMUB 2QD1A 3I2JA 1HNWB 3ER8A 2BL4A 1M8KA 1PVDA 2L2QA 1X1EA 4NAHA 4UVIA 2ZIEA 3K16A 1FSPA 3H20A 1B1AA 1ZUD1 4RTKA 1Q0HA 2I2AA 2XMZA 4Z9XA 4A3CG 2PNFA 3T1OA 3NOVA 1WHTA 4PLVA 3NEAA 4K9MA 1HDYA 3WWCA 2PHZA 4FDMA 1QFYA 5HF6A 2PGNA 3EPKA 3FTEA 1AXGA 2PWPA 3ACDA 2W22A 4UCFA 1Z4PX 1DEKA 2WLTA 3DHVA 3QKUA 4GLJA 3PVSA 4KYTA 5JH7A 2C00A 1KJYA 1RNLA 3EWIA 3EZFA 5D3MA 3RUFA 3CNHA 3UYLA 2HB6A 5B57C 3G0HA 1XI2A 4M6WB 3IRUA 4O7TA 3R3VA 1GWNA 1TYBE 4CQNA 4NYJR 4LTNA 4QXPA 1N4AA 5DFAA 4J9LA 4CL3A 1YAJA 4XWWA 4JBXA 4GIBA 1E8MA 3AUXA 3WGGA 2P78A 3TDNA 2IUSA 3PFGA 2DHQA 5EDWA 2GEUA 4Z49A 1G42A 2P9JA 2QAJA 1OFVA 5WRFA 1TU3A 2HSDA 1I1LA 3BXEA 3SGIA 3I4FA 2EYQA 3ODPA 4FYWA 4Q3NA 4G97A 1YFKA 2DQ4A 4KYVA 2O07A 4IQGA 2Z5GA 3PQ2A 4PAQA 1TCUA 2R6JA 1EX7A 1V45E 2HHLA 4FKBA 2AW3A 4FOLA 2GI4A 1DOZA 4QYTA 4YBZA 3EGIA 5HA5A 2GQRA 2HIMA 4PXYA 3AM1A 2NQTA 2QLFA 4QFCA 3O4IA 4AUMA 2L69A 5AMXA 4J76A 5I5TA 4OP2A 2DP4E 3DDNA 2Q9UA 3MGAA 4UZEA 2GNPA 1R64A 1U1EA 1EXWA 1ZH2A 2I3BA 2UUPA 4PZPA 3VDQA 5BUQA 1E1CA 2C3OA 3KZOA 3JAWA 2X5JO 4H31A 4JJGA 3WRVA 1E1RA 3K6SA 1P3Y1 2IU3A 1K3FA 1VCOA 2R1TA 4Q00A 5E1DA 2WUEA 1G20E 2H8KA 2G9QA 2AT1A 1S7GA 4YGXB 1Y3FE 4UNNA 3RIGA 1TECE 3H2GA 1DFIA 1RD4A 3SNOA 4RKRA 3BX1A 4BGUA 4US0R 4Z53A 2FCRA 5I7UA 1U6IA 3W5OA 4LZPA 3E2MA 2M6RA 4WZBA 1EFDN 1KH1A 5DQHA 1Q44A 5J2UF 4TT8A 1FRZA 4UBIA 5IAKA 4R9SA 4C7KA 1EFTA 4CF5A 5A62A 5JI2E 5EL0A 4AMBA 3NP7A 4LMYA 2QPTA 3W4JA 1FP2A 1W2HA 5FA6A 3F8NA 2X1HA 1G3UA 4PHFA 3N43B 1JHDA 4TLCA 2NAFA 1MX1A 1SU4A 4WX2B 1U3CA 1TWAA 4QT0A 5T14A 3RFUA 5FD5A 2D2IA 3DV0A 1FYXA 3G79A 3BICA 3I9LA 3KQMA 1JYFA 1ZUNA 4MV7A 1UPAA 4M0MA 4BNNA 2H07A 2H1CA 3TEMA 1QTIA 3ZHSA 1VJ0A 4AJ9A 5B3AA 1JU4A 2VDMB 1MV5A 2WOOA 4HYQA 4YY3B 4YRSA 4ME6A 2QTRA 3RTCA 5LLTA 3DDCA 4JI8B 1IWBB 3ORQA 1YVDA 1PJSA 2FFQA 3DO5A 2J3DA 3I39X 4KQ2A 2HA6A 4Q0MA 2HA0A 4TZ0A 3AF4A 4V0SA 1KRWA 3UJAA 1Q0TA 1IYDA 2VAWA 3EEIA 1NP3A 3HN6A 2I6FA 4OKIA 1L5NA 3RTAA 3NNDA 1GQ2A 3VSBA 4Z99A 2AWOA 4Y0AA 5C8XA 2QRZA 4GEKA 2Z4TA 1PZEA 1QX3A 3RFXA 3WIBA 2GPSA 2VP4A 2QT1A 3BTUA 2QBYA 3T1NA 4FXPA 4I4NA 4LMBA 2OECA 4LV6A 3W2IA 2I2WA 1JEJA 1L4LA 4DSUA 5I4IA 2F9MA 4HYEA 3V2HA 1ZD5A 3DZIA 3OJXA 2H6EA 2HHFB 3C0FB 2J0SA 1GFZA 1KT8A 1YDWA 1IQUA 2OGZA 2ZRDA 1L5FA 1HQKA 1Q1AA 5E6RB 4ZYZA 3WO0A 4ED1A 4XJXA 3TNLA 2IIPA 3HU2A 2G9NA 1C5KA 1WVGA 2VOEA 2R4QA 3L92A 4M83A 3VYTB 2ZJ0A 2G1AA 4B35A 2D2EA 4UHFA 3LT4A 3AK4A 4DCMA 4P3NA 2NSHA 2JFXA 1I5EA 3DE4X 4ALIA 4O7WA 1ND6A 3F8SA 1L5KA 4CCYB 5ITSA 2CJFA 1CFZA 5EHXA 2CBXA 2HMTA 3O73A 1P45A 4YYEA 1DMSA 3Q9NA 2QVYX 4Q03A 3S5UA 1LSOA 3TZHA 5BWCA 3U54A 2D2XA 3AUTA 4QGHA 1KO4A 1TAQA 1JXLA 3BXFA 4KOEC 3VC3A 4QW9A 1NASA 1VMEA 2XUIA 3FJOA 1G8PA 3ZJTA 5HNKA 4FZJA 4DV6H 5REQB 5L7WA 2PZBA 2WTNA 5K0SA 2CCKA 3OPMA 4B4UA 2BFFA 2QUZA 3CW8X 4HY3A 4QVKA 2W2KB 4X8MA 5DHUA 3T8YA 1Q11A 1CQZA 3VJRA 5FUVA 5BRJA 5IP9G 5FUBA 4RSGA 3AGQA 4ARVA 5TQ0A 5IZCA 4E1BA 4JI7B 3B1YA 2RHWA 5DLPA 4HAVA 2NTYC 2VJPA 1CZUA 1ZHFA 4UNIA 4AJ1A 2QL7A 4YJFB 3G6XA 1VE1A 1K66A 3A9RA 1W75A 1GTL1 2QMOA 2QVZX 3F4KA 3FNEA 3UXHA 5D6NA 2GHIA 5C4MA 1E5LA 2QM3A 5FWXA 4MUEA 2JC3A 3D3KA 4UC0A 5AUQA 4OOEA 5C7IO 4R68A 3AU9A 5DRYA 2X76A 1SAYA 1TQDA 4IAJA 2P9GA 4NOKA 2IH5A 3AXSA 4HWTA 2F17A 3OLZA 3G8CA 4LHVA 3Q1KA 3O2NA 1KSHA 2A1TS 2IGTA 3QXCA 4MWBA 4CE6A 1IL0A 1A69A 1Y5IA 3B2NA 2GAFA 2EFHB 3OQ1A 1PR2A 4EHFA 3D02A 4D9JA 4X0EA 1DQPA 4Y1RA 1CUZA 1FVHA 2EFDB 3B5JA 5FWDA 1AD2A 1F0NA 3WLNA 1PLKA 3ZBTA 4AMZA 1W4RA 1I33A 1WCV1 3A11A 3BK2A 3NBZC 5TGDA 4ER5A 5K4GA 4FFDA 2H9IA 3TUZC 1MJGM 1O9GA 1EE1A 3L6RA 2GESA 2FW9A 3PXUA 3UJ3X 1T25A 2QX4A 2GVZC 2UVQA 2Z9BA 1JT9A 5JNSA 2V45A 3ZWYA 3ZCRA 2GXSA 5FA8A 2OCKA 3FA2A 4BEJA 5FOTA 1NXTA 2AL7A 2XA2A 2BR0A 1VTKA 1B4DA 1VMAA 5IVDA 3A04A 2A0UA 3TLCA 4MICA 4FGZA 4AI6A 3EY9A 1OZHA 2LKDA 3DOCA 4J43A 4RV4A 4RVGA 3SEQA 3FUVA 1G21E 3SC4A 2P2CA 4Q3BA 4ASUD 3AV0B 1DDOA 1NXSA 2I4TA 3M8KA 4PTZA 5ALWA 5B2EA 4UM5A 3PJEA 2GAAA 4FB5A 3LQYA 4X60A 4JENA 3GN1A 2GK4A 4C9BA 4BY7G 3PC3A 1IM2A 4LOIA 3R5HA 1XN4A 3BIWA 5K03A 4FBUA 3VX4A 4BDTA 4MP3A 1CXZA 2O6LA 1D4FA 1BD4A 5KVVA 5CM0A 2VYNA 1GUZA 3K8OE 1H5NA 3FVQA 1ES9A 4LQLA 3ZI4A 1SKYB 2XHZA 2V5VA 3B3GA 4B84A 4IEFB 4XASA 4GSYA 1L7AA 1M83A 5LXTF 1TADA 5KVQA 3WO1A 1EDOA 1E9VA 1U1DA 2XWQA 3QVUA 4IIFA 4QTZA 4XGKA 2A1IA 1ZWKA 2RB5A 1R9GA 4YFVA 1DB3A 3AESB 4XWOA 3TMKA 1U8YA 1ML3A 2BFEA 3O1IC 2VYVD 4HH1A 3S4YA 3PN1A 1MH1A 3PFIA 3TTSA 1E6KA 5BQOA 2B8JA 1VCMA 4OYRA 2FP4B 3UWPA 1Y3CE 3WL8A 1LQ2A 3GARA 1W49A 4LOAA 6YASA 2IF0A 5K3AA 2VJOA 3AF0A 3TD9A 4B85A 3BGWA 2I65A 4NXNH 2VI5A 5AKYA 1P2VA 1L9KA 2C61A 3JQPA 4C1NA 4BBZA 2CMDA 2G06A 5EZYA 5I9TA 1R0WA 3N7TA 2X4LA 3RC3A 1R00A 4JR2A 1P33A 3CJQA 3S1SA 2XY4A 4BNDA 5MFPA 1EFUA 1KMIY 1TD1A 4WVFA 3V9AA 2JDIA 1E1CB 3COYA 4E3ZA 4OLAA 3JD4A 3U1VA 4DE5A 2NPIA 1RWWA 2YYYA 4S0XA 2PE5A 2MR5A 1ONBA 2RHLA 2CXPA 2VDRB 2EWMA 3HKCA 3HGTA 3EIUA 1P7ZA 1UMDB 4C3ZA 1KKUA 2P7HA 2VPWA 4ZOAA 5KWEA 5JH7F 3D2AA 2FN3A 3A1EA 4C2BA 3IO5A 2IHYA 3PEYA 1OC2A 4NZMA 1BQ4A 3BSFA 2VYND 4K81B 5G1PA 3DPSA 2O2EA 5JYCA 4PG6A 4GLOA 3F46A 5BWXA 1FFHA 5F76A 1CZOA 4OHKA 4WACA 1A77A 1JSLA 3LUJA 4L5BA 1V9SA 1G291 1P4AA 2YHSA 3OCUA 5DM60 2EQBA 3PNQA 2H3HA 2Q0XA 2I71A 3BXPA 4XDYA 3D8UA 3JQ6A 1RP7A 3GQBB 5FDFA 4NF2A 5JNRA 2QM8A 5K2OA 4CV1A 1VE9A 2X5RA 2I33A 5IABA 5C52B 4NE2A 1REQA 2OYSA 4M6WA 4O4JB 3UUFA 3T38A 2I7CA 3FDSA 3WJ1A 3NM4A 3Q2IA 2IVFA 4CR7A 2HGZA 2JRCA 3VU8A 2WF5A 4PO1A 1UKYA 4BKRA 4L2IB 3GFFA 5AW5A 2QSYA 1U1FA 1SQ5A 2VSYA 3O3OB 5EZ6B 3ZU3A 4LH6A 2G9UA 4K7JA 2UDPA 1HT3A 1M1YE 3IQHX 3JARA 3OQPA 2Y2UA 3CUYA 1UBGA 1Z28A 4J0EA 4KI7A 4B7UA 5FPKA 1X7WA 3ONVA 3PCXA 5JXIA 5GOTA 4V2UA 4HGNA 2CFRA 4YJ3F 4NBKA 2BFWA 2F8MA 4WXEA 2JDID 4NCBA 3VH4A 1DLIA 3K05A 3DC7A 2XEDA 1KSGA 2ZRQA 4R2IA 1ETUA 4DYVA 4ZTZB 5DCLA 1C0IA 1I5RA 1U98A 3FFWA 4BX0A 1PFVA 4JMPA 4F4UA 1CDDA 2XE7A 3HB5X 1X7DA 2CB9A 4HSGA 1XDZA 4KPUA 4N3NA 4FOPA 3UCXA 3M7IA 1JMKC 1SXJE 3FWPA 5BSMA 2O3UA 4CFSA 1NVFA 3RFCA 2BI8A 2JJ1D 2OFOA 3SOZA 1M6YA 3WZLA 2W9XA 3FDFA 4HQ0A 5FOWA 2FKNA 3AM4A 3ELBA 2JA7G 4F9GA 3AB7A 4F6RA 2O8BB 2PFSA 3GNSA 2BUCA 3CUEF 3NTXA 2VRCA 4FDLA 3W34A 4P0QB 4N8EA 2YCBA 4QLBA 1E61A 3A1VA 1OC4A 5GGYA 4ADSG 4YMTA 2O03A 3WMGA 4I50F 2WFLA 3K94A 2XWSA 5D1PA 3AWIA 4NDNE 3UMGA 1E7WA 1I1MA 1Q77A 2P3QA 3OHBA 5H3HA 2PKQP 2FJPA 4MEJA 3EGWA 1Z6QA 2E2HA 2OL4A 2CV0A 4MRRA 1LB1B 1BCSB 4DLRA 2WQZA 2WE8A 1XHLA 1NW8A 1JI3A 1KOJA 2B5OA 2FUKA 2ZJ2A 4QQNA 4TTAA 5EJ2A 3OD1A 1WLYA 3DTVB 3WMFA 3N86A 3L7BA 1R9TA 3JQFC 3KHKA 4QDZA 4JIMA 5F4BA 5J2UB 1TO6A 2B3TA 3ABIA 3NC4A 3PIDA 4TYYA 3Q3HA 1TAEA 1BH6A 1M73E 2Y0BA 1UKBA 1IYZA 3VPBA 2P1RA 3U0VA 1W5BA 3PDWA 2BMJA 5AW4A 3BE5A 1AKEA 1Z6GA 4U8GA 3PC6A 1WMBA 1UK7A 1P6UA 2JCSA 4HNGA 1JIHA 8ATCA 1WPXA 3JQGB 3ZVRA 4M8NE 4QC2A 5HKKD 5J58A 3GR6A 2GYUA 2JJ1A 2P2YA 4CLRA 4G5XA 4EI8A 3K0KA 1ZY2A 3E18A 2JLRA 4XQ0A 3FMGA 1VPEA 2PT9A 4X94A 2UUBB 4E0BA 4C21A 2OBMA 3UXEA 3RK4A 2BGKA 1L3IA 4GXTA 5IW8A 4JV1A 1BXZA 4P3KA 4Q4JA 4KQCA 4HGYA 2R92A 1U0GA 3USZA 5FJIA 2PAAA 3F6RA 4CDRA 1AF7A 2QAGC 3OH8A 5JYDA 2HRZA 3PZBA 2X3FA 3CZ9A 5DHAA 2E5FA 4E11A 1XC7A 3BE4A 4JSRA 4C4PA 4Y2QA 5KFTA 2VCEA 1HDCA 4BP8A 3RS3A 3M82A 4FU0A 2E7ZA 3HZOA 1O1YA 2NU6A 2FN9A 3GEPA 5BORA 4NXMB 1NYRA 1KH2A 4I1RA 4C43A 4IMPA 3DAGA 3BFVA 1KWGA 3DD1A 3AUAA 3WICA 2FWRA 3T52A 4B3SB 3OZRA 4O7YA 1ISMA 2IFTA 2JBHA 1E6CA 3HJRA 3PX7A 1QTRA 2JEGA 1QAMA 2PS3A 5EJAA 1JB1A 2R7KA 1QG0A 1PDOA 1UDAA 2H7YA 4U00A 2YV3A 3R0ZA 3RWBA 3V8EA 2F43A 3UB3A 2FE3A 3FKJA 3MTIA 4AECA 3HYCA 1Q1ZA 2HGWA 1ZGBA 2RBGA 3G2NA 4XZ3B 1Z4KA 3IAM1 3JX9A 4PZDA 5JS7A 5JJIA 4F9EA 1GKLA 1F5SA 3LPMA 1FTSA 1PS8A 3I52A 4J7UA 5DTQA 5KZMB 3BQ0A 3X1YA 2A58A 2IHJA 1XTPA 2G9RA 4EF5A 1KTVA 2CXUA 1Z5UA 4Q37A 3PTAA 5KG2A 2HIAA 2ID9A 1GAEO 1XNHA 4BEBA 1ZVVA 3MS2A 1RLIA 1BG6A 4MWSA 3TINA 1JN0A 4X84A 3IB6A 3G82C 5EY5B 1PW7A 1TTHA 1VKJA 3AP3A 4PAGA 4J1NA 5D5PA 3F49S 3GJ7A 4C6TB 3WMXA 4CM6A 1P81A 1GEEA 2HPHA 2VPTA 4BVAA 3D8HA 1TTQB 3DPUA 8GPBA 5IYDG 4PN7A 1UXKA 1WF6A 4JLJA 5FP0A 4ARSA 3GGDA 4M0JA 5AUNB 4UHDA 2AZMA 1YE3A 1YWGO 3Q87B 2VJMA 1DT3A 1TUGA 2GB4A 2NP6A 2XQIA 3D6JA 4G63A 5H16A 2XYQA 3FUUA 4JP3A 5EKDA 4B3HA 2JKZA 5EMJA 4DTCA 5HDBB 4DW8A 1POXA 1RRMA 2YV2A 2VWHA 1EJBA 4RMHA 3AIKA 5EE1A 4NJMB 1VLJA 1XPOA 2ZWVA 1BIFA 1OH5A 5A4MS 5CB4A 4YJHB 1OYYA 1TJ4A 2NVUA 3R3YA 5DBOA 4KV7A 5DYTA 3K0FA 2BFMA 5FOXA 1J9GA 3EPRA 1DBSA 3G1TA 1IQPA 3U0GA 1MAWA 4FLFA 1C4WA 4I8IA 3I9V1 1EG2A 3JQ8B 3N2LA 1QBKC 2AXEA 3OU2A 4UUBA 2ONJA 2W0SA 5GPBA 2H17A 4B9AA 3DO6A 4GOKA 5LM3A 3FYUA 1Z2OX 4M46A 1JV2B 3E3AA 4R1MA 1QIEA 5AI0A 3V7UA 4EO9A 5LXTA 3UUEA 3CX7A 3EK2A 2GZ1A 3MT8A 3BFPA 3W8NA 4RPCA 3HJCA 4CV2A 1DBQA 4DDWA 4C7OB 4O4IF 3X44A 2FX5A 2PMKA 3TAUA 1JRLA 5EZYF 2QSUA 3UG7A 2Z08A 3T1HH 4RIEA 4BLSA 2JAUA 1ZJ5A 2VZ0A 2H7CA 3AVQA 1G20B 3KPUA 1JEYA 1PW5A 4K6MA 4W5JA 1FNBA 4KN5A 4F86A 1J1UA 5I8WA 1KERA 1U2RA 5C4GB 3RABA 1D1PA 5I5WA 3CPJB 5DGCA 1TK2A 3ELUA 1LRJA 4C6SA 1OXKB 3MAGA 3PWSA 4JU8A 1ORRA 1Q14A 4CCSA 2AR7A 2RHHA 2FR1A 5A5GA 4F91B 2ZATA 4HX9A 1N0UA 4F21A 5IZCC 3VPDA 2P4QA 3FPBA 2DCUA 1V5GA 1U8UA 3ILVA 4Q21A 3NHJA 2X58A 4X1YA 5AH0A 1OT3A 5TXGA 1JR4A 3Q85A 3KHSA 4LVUA 1RW4A 5FOVA 1IBRA 1XF1A 2BEJA 2OMKA 4S2UA 1SCNE 1U4OA 3K9QO 4AQYH 1FK8A 4GBGA 2ZDHA 5FL3A 5FNVA 5AQ1A 1YKGA 1XAGA 1XMSA 2I7XA 2Q5OA 1KEVA 1D7AA 5IKXA 1ZWLA 2HUPA 3IG0A 5JSQA 1E59A 4TQRA 2XUAA 1I36A 2UYCA 1X7YB 5KYKA 2F1KA 5JHGB 1WZ2A 2YN2A 5LQMA 3LX8A 5FTMA 3ZQJA 2G25A 4COOA 3K1JA 3I0MA 1TUIA 3QFRA 4QGBA 5JASA 1LS6A 2GYWA 1V35A 2E5LB 2Q2NA 2VPYA 1J2JA 1XHFA 1PR1A 2XYGA 3OE7D 4FX2A 5K3FB 3E22B 4KIGA 4UAJA 2WJYA 2XRFA 4H7FA 4YRJA 4MDEA 2G6BA 2J9RA 4G5GA 3SS7X 4HGRA 3AF3A 1KQFA 3WRWA 1ISGA 2OBLA 2QN1A 2A9KA 3TLGA 4DMCA 3K53A 4RDIA 4RVOA 2FMAA 2VHUA 1MAAA 1LC3A 1WQ1R 2YVLA 4MVJE 2XCRB 5TQ2A 3DF7A 4XYEA 4C05A 4EFDA 1H8ED 2X42A 1M1UA 3OICA 5KFBA 3B1FA 4LN1A 2BGRA 4RLSA 1U7WA 5KDLA 4AQDA 3E48A 2OBNA 4QXRA 5IX8A 2GHTA 1QO0D 3Q41A 1DX6A 4LBZA 1MO2A 4F50A 3HDVA 3WB1A 1JAYA 4ZT6A 1X1BA 3AR2A 3U17A 1U0OC 1LI7A 3ZZUA 1FP7A 1Q15A 3P4XA 5I9LA 2C0CA 3E82A 2C54A 1EVYA 1K4YA 2EFCB 2HRBA 1G4HA 2QTCA 4J29A 4DPKA 1C3LA 3WWYA 4IHQA 1QFJA 1KP9A 3FRHA 4HX5A 3H9EO 5E1MA 5E9QA 3ZCVA 3U4QB 1YCHA 4L8WB 3WDSA 1T91A 2XNKA 4M4SA 3RB8A 2OXRA 5DCUA 4X7PA 5CH3A 4BVLA 2QX7A 1CNEA 1SIOA 3LDUA 3WV5A 3HVJA 2C3PA 1A9XB 2P90A 5F3DA 3DQQA 5J9FA 1YZYA 1DZIA 1U2ZA 3BD8A 1F0PA 3HN2A 1CQIB 3IODA 4IJWA 2O2YA 3UO8B 4C5BA 2ATLA 3WNVA 1N34B 4WRRA 4YO7A 4EWLA 3R6WA 3BH6A 1X7XB 5J47A 1M74A 4IIYA 4YCDA 5HKBA 5K0FA 4AT1A 5E4JA 4EBBA 5I7WA 1JMVA 3IBSA 5IAOA 1SVLA 3EVBA 1NBHA 2JGFA 5FOSA 5ADWA 3Q0EA 2FG6C 4JK3A 4GPZA 2IOQA 4FGRA 1E2UA 2C77A 4KJZA 3QEOA 3N2NA 4A7PA 2I7TA 1U0FA 1M33A 3JWGA 4PYLA 4I46A 3ER6A 3VYWA 5LD2B 2FWPA 1JE1A 1Z26A 2YIJA 3E1GA 2YRWA 1S7CA 3FETA 3TQHA 1X9NA 4GBJA 1Q50A 1H8EA 4ZI5A 4JCCA 3V4FA 5IDVA 5ICCA 3KREA 3L8HA 3K3VA 1UP7A 3ZJVA 1MR3F 2QTBA 3O8OB 4LJLA 5EG5A 2GRJA 4LXUA 2I66A 4BRUA 4C0JA 2V9WA 1UQTA 3G85A 4E2WA 2AJLI 3IUBA 2FSUA 3RQSA 3ADOA 4NHOA 3VHXA 3K15A 1FU4A 1FYEA 2P5SA 3CNQS 4MS4A 1Y4ZA 2O2IA 4RA9A 1LA2A 3NO4A 3DVRX 3KJXA 4OI2A 4FWTA 2E6KA 1A9ZA 1U3UA 3L6UA 2H0AA 1E58A 3NVMB 3PFWO 4FHFA 5ED4A 3QG5A 5D7BA 4B46A 4Y1GA 1U2SA 1O89A 2C7VA 3E03A 3FXAA 3H3JA 4YP3A 1B8PA 2IZ6A 5DGTA 1A8UA 2G9ZA 4JT4A 4D0RA 3X1XA 5FQOA 3NH6A 3ZHOA 1DCKA 1GRRA 3WNCA 1CLUA 3S1LA 3BULA 1N2BA 3L4BA 4DLUA 4NMMA 2R8YA 4QXOA 1PX2A 3KJFA 4UEQA 2EWVA 2ZYIA 2PQ2A 3Q11A 5DEOA 4BATA 3LO8A 2HCJB 5FOQA 3TB4A 1ZHOA 2ZWAA 1GV1A 3LUCA 4QOJA 3ELDA 3AINA 4BE4A 1CEXA 3QEMB 1VAJA 1ESDA 1FXSA 3F5SA 4J9PA 2JA5G 1EUZA 3QKSB 4GECA 4R1LA 5E38A 4KVGA 3PDIA 2X3UA 4KYUA 3VR4H 3KQKA 1Q7EA 1GR1A 3D8BA 1J8YF 2PFGA 3AUYA 4YJ2F 3DLAA 3EIEA 5DMXA 5C3UA 4ISCA 2Q5LA 4LA4A 4P93A 1USVA 1CJVC 5B64A 1OXUA 3TZEA 1GPLA 4N3BA 2ASEA 5HP4A 5LWHA 5TGTA 4N8DA 3EVFA 4GS5A 4QFMA 2YWBA 3OSPA 3C3MA 1AKVA 5BQPA 2JD0A 3DEFA 3N0TA 4X00A 2R8EA 2W00A 1E69A 5KTRA 1NR7A 3FDXA 2Z58A 3ZZTA 3PVZA 1MXHA 1VBKA 1W0KA 3HVUA 5I7RA 1TZMA 2R1TB 4TL8A 3TSOA 3ZWNA 5IDQA 1NRXA 3BB4A 4C22A 4QWAA 2VJCA 3IP5A 1I3QA 3DE7X 4B17A 1T3TA 3ZTWA 3PT9A 1GL9B 1EFKA 3SBEA 2BKEA 2X7JA 3ZWOA 2IDZA 4NBRA 3NIFB 4FJ0A 1N2CA 3GT0A 1KAOA 4JI8H 2BGNA 2XWJI 4H3KB 4X1IB 3U2QA 1GJRA 4MVJI 1WXGA 2R2AA 3G13A 3LPNA 4NIMA 1A0IA 1HETA 1CPYA 1BWRA 2BFOA 3NAMA 3QVXA 2B83A 2QG4A 2XX3A 3IESA 3M9LA 3MTQA 3R40A 3R7NA 1JW9B 1USKA 3KZMA 3UW1A 5FT9A 1FW8A 4NSNA 4OA5A 4BNUA 1TKRA 1B43A 5CDYA 1HDOA 1EK2A 2WFAA 4DL5A 1LEHA 2CXHA 5DOVA 2FK2A 1Y80A 2RC6A 3VRHA 4EB3A 5JUWA 1JXOA 2JIPA 2NVWA 3OT5A 1OAAA 1R0BA 2ZYVX 5AVRA 3RRFA 3AFOA 3VNSA 1ZDMA 5J5AA 2OO7A 5A7GA 5ALXA 3W90A 1TEHA 2KQUA 3RSOA 1VCIA 2X0KA 4I66A 1HFEL 3ANMA 3STYA 3CRMA 3VC2A 1FQJA 2HMWA 2CMKA 3IIIA 4FP9A 2ZJTA 4BNLA 2RI0A 5CGQB 1HUQA 1JUDA 5ABPA 4O82A 3GNTA 4PC1A 4TTRA 2P5TB 4ZVPA 1NMEA 2NPOA 3TQCA 5KTKA 2P2SA 3QSGA 4RXMA 4QASA 4TLAA 2AGQA 3MM4A 4BX8A 5AW1A 3P4UA 2UVWA 3DZKA 2LD4A 1QGUB 3KKOA 1LVUA 1XMQH 3DWIA 3G9ZA 2CVHA 2V7VA 3FUWA 2HHHH 1PHPA 4ZYYA 1RKBA 2HF2A 2WP8J 1AQIA 4NV1A 1L8XA 3O8LA 3RAEC 1CZKA 4TKMA 2J6SA 4MP8A 1TI7A 2JA7A 1VJDA 1NUHA 4JB3A 2YU9A 4EATA 1ICEA 2C7BA 3DV2A 2Y8EA 3TSCA 1CR4A 1NN0A 1U9IC 3NAGA 3UTDA 3F47A 3W05A 1RBZA 4X1KB 3R9KA 4M87A 5C1BA 4RJTA 5KQPA 1XNRH 3P45A 4IUYA 3QW2A 5F3WB 3TW7A 3VKUA 2JZNA 3QEMA 4BY9E 2C7QA 3HCBA 3H4TA 5BSFA 3HHEA 1G98A 3QHPA 3RF2A 1FPQA 3ZZMA 4EI9A 5BSGA 3TJMA 1YC2A 1TA8A 1NP7A 2XQGA 1LQTA 2A9JA 4MVJH 2NTEA 4OGGA 4BN0A 4D4JA 1AMNA 3GV5B 5IC4A 4R01A 4YAKA 3BGIA 4NJOA 5KKAA 4JBYA 1KQGA 3HOXG 3GPCA 3D8SA 3FCOA 1QWSA 1W44A 2PYZA 3HZHA 1SUSA 3GJTA 2QIOA 5B58C 4BLWA 5IM4F 4WZAE 4B82A 3EMVA 5IS2A 1AXRA 1KZGB 1DTWB 2OHJA 4NCXA 3O8DA 2OAGA 4QJBA 1ADFA 1E20A 5DASA 4FGKA 1GT91 3N05A 1BN7A 3OZCA 4KPYA 4IIJB 3VVCA 4BBJA 4Y2TA 2IQ5A 1R0CA 4CW7A 3IBTA 2RKBA 2WVAA 2VQFH 5D3MB 5AI5A 1Z62A 1XQYA 2R6CA 5LDDC 4JXUA 1J25A 1J99A 1NBOA 5LQJA 1RMQA 1VG0B 2CBGA 2OCPA 4BN5A 2R8JA 3DCIA 3QE2A 1BWQA 3RBZA 2QMQA 2V58A 1VPLA 5AJTA 1DTEA 4O5AA 5CLHA 1P1IA 4N41A 4LJYA 1VS0A 2FPPA 5EMNA 1KDTA 2FEXA 5AJXA 3C1TA 4QREA 3V2UA 4D81A 4ESEA 5EKTA 4EYQA 3U7QA 1IH8A 2AGVA 1P5HA 2JGNA 4A6XA 4L6IA 4QVIA 1EA7A 4APMA 2EIXA 4GYKA 1G8KA 1HEYA 1Z35A 2RGBA 3QUAA 3GJ4A 1Q91A 3RWMB 3ETCA 4PAMA 4C6RA 5I7VA 3T54A 1J0CA 3PYLA 5C8DA 1XQXA 2WU3A 2QQ0A 3LT0A 1GGVA 4J91A 4YVFA 3OOSA 4ILEA 4ZZ1A 5JBNA 4B3MH 1VL5A 1KZ9A 3BJIC 2EX4A 4GPBA 2XVAA 4TMZA 1VLMA 1SIBE 1DHTA 2JBAA 4A1OA 1U5BA 3DR3A 3ZU5A 4YQWA 3H4VA 3BAAA 3ORRA 3JQAA 4HEA1 3T4UA 5CURA 1QOZA 4GPD1 2H4FA 4P3XA 1WIWA 3FZNA 4ERXA 1P1RA 4Q7KA 1X1SA 2A6PA 4LQ4A 4RYDA 5DQGA 2OXTA 1U6KA 4BL5A 2JLAA 2ZT8A 5TMBA 4W9RA 3SYLA 2C94A 1L7QA 2V9PA 3RGGA 4R83A 2YUIA 3JVEA 3K2QA 3AFHA 1ISHA 4REQA 2H2AA 3K2BA 2I1LA 3DZBA 3PD7A 1JLKA 4QWBA 5FPOA 1A8SA 1IY1A 4MVJF 2IYYA 1KHTA 2ZR0A 3R6GA 2WYWA 5T64A 1RTKA 4BVKA 2HIVA 1NSTA 1RMTA 4PGAA 2YZGA 4A0GA 1MAHA 3IP3A 1OIXA 1BMFD 4LMAA 4DMFA 4PY2A 2JZCA 2OYCA 3WXMA 5KNDD 1XL0A 1U1GA 1Y4DE 4IQ8A 4Q3DA 3T5TA 3LLVA 3U4QA 3FKIA 1NLUA 1QC5B 4QELA 3LUKA 1XMXA 5DNWA 4B34A 1LBTA 5EJEA 2PK3A 1LJLA 1KE2A 5A4KA 1N8NA 1EFRA 2INGX 1GCOA 2HSJA 2QN9A 1UBSB 3SYKA 2QDXA 4I9FA 3ZHBA 3KETA 1BYIA 1T34A 3VO9A 4MR8B 5JSZB 1LK5A 4IZIA 4CL8A 2VP2A 4F9TA 4NZZA 5LMZA 3KAQA 1B14A 1BS2A 5DISC 2VTKA 1GQRA 3IPAA 1SKBA 3Q3JB 2Y4RA 4OMUA 2JAHA 4BLPA 1M2KA 1NLYA 1FRQA 3LQFA 1U8EA 3NHUA 1SVMA 3MJVA 3D6MA 3V8BA 4RL4A 3UEOA 1JKFA 5FUYA 4CUKA 3FI9A 3PW7A 3ZK9A 4CNBA 3TLBA 1Y7HA 2QYSA 3DBHB 1FVIA 2PV7A 2Q0HA 1FJGH 1UOOA 3H84A 4RZQA 2EJ3A 4YT4A 4M37A 3PE4A 3W04A 3NCHA 1WULS 3U4DA 4DLLA 1S9FA 2V0GA 1H1DA 2C0QA 1XJWA 3QVJA 5LL6P 4O3QA 4DVJA 3EASA 4EKGA 9ATCA 3TXAA 2CF5A 1JVBA 2Q3MA 1RXWA 3EIHA 2WWXA 1GSOA 2IHUA 4Q9KA 2ARKA 1NNUA 4R54A 4NNOA 3WK4A 4F5DA 5CMLA 4AWBA 3EDMA 5A6SB 1MVLA 2WMYA 3AF5A 3AV3A 3D3QA 4NPHA 5KIAA 4G1CA 3MPUA 5EJ4A 4O83A 1QTQA 1R5OA 1PL8A 2Z95A 2ZU6A 3K35A 3KTAA 3K9GA 4LS3A 4EB0A 2CZGA 4K3VA 4DDKA 4IXDA 4KRXA 4ENWA 3AI7A 5GGXA 5KNDA 1O95C 4G37A 5K1ZA 5TMDA 3IHWA 4RD3A 4EPVA 1V9LA 4OM8A 1T6BY 4UCXA 1MTZA 4L02A 4X8HA 1CP2A 5AOCA 1M1YA 4ZYTA 1S3GA 3OD5A 5ENVA 3TY9A 1QFMA 3MILA 1HC7A 5F21A 4C7OA 1XPRA 4HJRA 3E22A 1KEPA 2E4UA 3HV2A 4ECAA 1ZM3A 3TNJA 3WBBA 5A6VA 2ICAA 1QQBA 2PJDA 4KXLA 4OD0A 3KKNA 1RJ9B 3B5IA 1XTRA 2H4WA 2Y1GA 2YMQA 1XF9A 1R0XA 4NE9A 4E51A 3O83A 4PQFA 1UC8A 4CF4A 2WTMA 5JCOA 2AMFA 1Q21A 3JCZA 5LJIA 3NBYC 2CFOA 3AFGA 4EA7A 3I9FA 3TQSA 3RUEA 3GIQA 1GITA 5DN6D 1GG5A 4BVEA 2JK1A 1D6MA 3N2EA 2J9YB 4HPWA 4IDCA 2YOHA 4XRGA 4ZMBA 1XYGA 1UODA 1JXQA 3H1FA 4LJRA 2TYSB 2XHEA 5EJ5A 3GH3A 1L5HB 2PS0A 3L5OA 4OSPA 4X92A 1NNEA 4HUJA 4B31A 1NI3A 4DR1B 1WDTA 3KV1A 3NEJA 3PRJA 5AK3A 3TW0A 3L0BA 4YMUA 3KB2A 5DNCA 3DVQX 5HQTA 3DFUA 1CRZA 1EXNA 1OH7A 4JEHA 2ZBGA 3NHRA 3NV9A 3SE0A 2ODAA 5LLSA 4L22A 4LWPA 2WUWE 1AUXA 3GA7A 3LH5A 3QNWA 5DP1A 3T9FA 4R8UB 1M0WA 5CA1F 1HLPA 2I6XA 3FNHA 3PXBA 3NIBA 3QKWA 3QYAA 4Z7NB 1KF0A 4HEQA 4BQRA 5BYKA 4AO8A 3PGVA 3R4CA 3CUKA 3OOWA 4FPXA 2Y6VA 1PNTA 4KXVA 4TV9A 1NQUA 4G0OA 4P84A 1TQ2A 1S0OA 3GG9A 5CYPA 3TNFA 4TYNA 1X39A 2I2FA 2QUBA 1PQPA 1Z83A 3SJ7A 2VRNA 1RXIA 3ABOB 4E5PA 4YJGA 4XCVA 5K0LA 1WO8A 2G5PA 2NXNA 1HGXA 2GBCA 2J3QA 2Q62A 1XZPA 1E2QA 1T2UA 2QZZA 2ZSIA 3BIOA 3P2MA 5SZJA 5UKDA 4DSZA 5LXTB 2W6QA 1NJFA 5DTRA 1R8QA 2DBRA 5I9IA 5CLLA 3LSYA 3FPKA 1N92A 1NPYA 1U31A 2W48A 3U3XA 2A1UA 1ZITA 3ZD9A 4A03A 3TRHA 4R1SA 4G3IA 2ANCA 1KYXA 3KZNA 2C9ZA 2X8JA 2P75A 4QWEA 3R6LA 3H11A 3HL0A 1AN7A 1LW7A 1U3WA 1ZM4A 2OD2A 2QTVB 2CE7A 2WEKA 3EVZA 3QTBA 1I01A 2YTZA 4J0GA 3MSXA 3PQ5A 5BOVA 5C9ZA 2I4LA 4CKBB 1DC4A 3V34A 1DQRA 1OQAA 1TQ6A 2PRIA 2AR9A 1D2NA 1R8YA 4GUAA 4P98A 4X6LA 4EB6A 2QMEA 1C9JA 2UUBH 3JWPA 4MUFA 5E6SB 5HNEA 1Z75A 4UU7A 2ORED 1EUCB 4J75A 1ZIDA 1U11A 3Q6NA 1T94A 1TMYA 3PXEA 3FMIA 3SQLA 2Y27A 4FNGA 5TVGA 4HQLA 3VBCA 2Q3CA 3QEJA 3B3FA 2IX9A 4P0PB 2HKIA 1T5HX 4XD7A 1N1GA 1E7MA 4UAVA 3ZK8A 2Z6AA 4AJ2A 2H5LA 2O5RA 3H5AA 1RHJA 2V9CA 1QYVA 4ENRA 3L07A 4UTVA 2HPAA 1GGKA 2ENUA 3KHUA 1MJFA 3L7DA 3O7WA 3O8NA 1MOQA 3GVIA 4LECA 2IYEA 1GRNA 2FR8C 4TS3A 3IXLA 1WSWA 4LSMA 3GLIA 4JT8A 1T4MA 1BKDR 2OKCA 2FK3A 5A6SA 4LBVA 4AK9A 2FSGA 5B1IA 1JQLB 1YR9A 4QQRA 4UTZA 1QZXA 1M7HA 5FTNA 4D8WA 1OLUA 3FYSA 1X1AA 4MEAA 4EEKA 5HKKA 2ID4A 4EI7A 1N36B 4BIIA 1V8BA 5C1DA 4KO3S 3KSUA 4BQPA 1HT0A 2AGPA 4YXWA 2A86A 3NDIA 3DT6A 2GRUA 4F46A 4O63O 2OG2A 4PGFA 4GKKH 2XB4A 4PPGA 3RAPR 1QM5A 3MHPA 3D2LA 4QGAA 4Q9IA 3GJZA 2RGVA 3DLIA 4JJEA 5LZ8A 3BDVA 4YGYA 3QPBA 4IRCA 1BKSB 3WIDA 1TEVA 4UBOA 2F8TA 3B60A 1MFZA 1DIRA 1AV7A 3O2QB 1EE2A 3G3EA 3V8NA 2V1UA 4KX3A 2JZOA 3H8SA 4BCDA 4M1MA 3ICQB 1FEZA 2IP1A 3P9IA 1A88A 1AA6A 1KEEA 3NUQA 1WP9A 4RXTA 5F5NA 1ORHA 3CUUA 5EVCA 4UTOA 4GR4A 2PX0A 1WY7A 4ZVUA 4TM8A 1GPWB 1KORA 3A9SA 4EHBA 1RFGE 2W2TA 3TWOA 3S99A 3H65A 1XZGA 4ARZA 2QE6A 5KFKA 4G23A 4JGGA 3KXYT 4MGZR 4OP3A 3SX2A 1HT2E 3RVKA 4B45A 3I8XA 4L7QA 5J4KA 2OG1A 1XXHE 2Q99A 4Z7JA 2HZ7A 4MYRA 3I3OA 1HA3A 3A05A 1YD7A 3ECAA 3LGXA 4PFSA 5JW6A 5KTSA 3SXUA 1BXRB 4GAEA 3S7TA 5LKAA 3AVUA 2Q6TA 3DAOA 1TQ8A 2XE4A 1YHYA 3GEMA 4B6PA 3LIPA 3RB3A 4F2WA 2MINB 2XUPA 3GJ8A 1AHNA 4R31A 3A9VA 2I2CA 1ZS9A 3NB0A 3PPVA 4BZPA 3X2EA 2VNIA 1BEEA 2BBTA 4DS3A 5K4AA 1HG0A 1MA3A 1YV9A 2V6FA 2X4DA 3PDCA 1U7HA 5EJFA 3CVXA 5G2OA 4E7PA 5KCZA 4NCJA 1UK6A 3LA6A 4BKMA 3Q8KA 4YLYA 1CQJB 3Q2OA 1I6UA 1SXIA 2ZYWX 4V3BA 3VDMA 4OBWA 2L17A 1NFRA 1VSVA 4IVRA 3M1IA 4U2GA 4XYLB 5BW4A 4TN5A 1G0OA 4BJ3A 4U7WA 4ZMSA 4FZ3A 3JZIA 2R9VA 2X8WA 1LZLA 2ZRKA 5DT2A 4RPHA 3E5RA 4TKLA 2ABWA 2QAIA 3DHNA 3GLQA 3SS9X 1N3LA 4OXIA 5I60A 3UMCA 3L18A 4AZVA 1AS3A 4LY0A 1CY0A 4BBRG 4P2GA 2WHYA 3GMTA 3LBAA 5JZVA 5DX8A 4YMVA 2DJ5A 3EFHA 3IUYA 4E14A 521PA 1VLLA 4NPCA 4C4TA 3SMVA 2D4AA 3U7QB 1RM4A 1E32A 2CD9A 3LOQA 5LWQA 3F73A 3H2SA 1WV0A 4UM9D 2BELA 5EIWA 2WE6A 1IAVA 2DE0X 4G1MB 6GPBA 4YPFA 1H4SA 3IP6A 4V1CI 1PZFA 1X6VA 3P27A 3PT5A 1SHTX 5C80A 1Z0DA 5AWFC 3U7FB 3RUPA 2HJVA 3H9GA 5B1EA 1S0NA 3AI2A 2J0UB 2C20A 4A8JA 3QJGA 4C06A 3RVBA 3MOSA 1BHO1 5D3KA 4CU2A 4FFNA 4PZYA 4EHDA 5JXGA 2C28A 1I4EB 1VE3A 3O90A 4DCOA 2CT8A 5DI9A 3GIIA 4R84A 1LY1A 1XVAA 3IUSA 1REQB 4O4JA 2UZ4A 3FWKA 1T1IA 1JQDA 2F3UA 2GKSA 3JWEA 4MVYA 1SXPA 1UAAA 4ES6A 1K1SA 3WL4A 3FBGA 3DL7A 2XD4A 4ZDJA 4MTDA 1XCGB 2C83A 2G0AA 3UNXA 5A5VA 1IBMB 4CM4B 1M66A 4I5DA 5LYJB 3UOWA 5BWOA 2QN6A 5HQ3B 2XVMA 4ITRC 2A4MA 1QF9A 4URHA 1LTKA 2UVPB 3ABSB 3E9CA 1YULA 4EB6B 4QOSA 4EW3A 4ZYUA 3F5MA 4H18A 2Y1LA 4AS3A 2DPHA 1ZR2A 4LHWA 2G0TA 3S27A 2WNSA 4MWOA 2GM5A 1N2HA 3WYCA 3THOA 3WDMA 1L8OA 1M6EX 4LDRA 5A71A 4P81A 3W2GA 4CKXA 5FX2A 2EQ5A 3AEXA 4B09A 4R71A 3IVGA 4PZAA 3DTFA 1UXHA 4S1WA 1E89A 1T2CA 1X19A 2IXDA 3R8FA 4IG4A 1BRTA 1MEOA 1V25A 2DH6A 3ROFA 1QDUA 1Q1EA 4WKNA 1LDBA 3VNAA 1SUBA 2AYXA 3KEGA 3QLJA 4MW6A 2AXNA 3ABRB 5ERXA 1R10A 3GIMA 1L8LA 2FW6A 1R0LA 5I7AA 1VE7A 2Q1WA 3MWFA 4AROA 2YZNA 3T35A 2OZEA 4TLDA 1OCEA 3FFBA 3A6HA 3OM8A 4K6KA 1WDKA 2ANBA 1LSSA 1XN1A 1NVVR 1PFGA 4NVRA 5EHGA 4DV3B 1RZRD 1Q12A 1E1KA 4TRRA 4CU5A 2DULA 1NXPA 3FNIA 1XRLA 4YEDA 3LULA 2EGUA 1K4KA 4GOJA 4GXNA 4QPNA 1V1JA 3QVLA 3WTBA 3DZHA 3UKOA 2H1LA 1F60A 5A5FA 2OV1A 4R8UA 4BNKA 3QVKA 4S1TA 4RHXA 1TM1E 3RS0A 3UJCA 4BFTA 4DV2H 3MTDA 4XQEA 3NAZA 3WGOA 1UNNC 2XGGA 1N7JA 1H42A 3DUFA 4IDAA 4PWQA 4ETSA 4JJ6A 5GM2A 4DBLC 2Z5FA 1D0SA 5EJ6A 1T3HA 1OA1A 1V1MA 3SE7A 3DL0A 3MMZA 4TWIA 4GKJH 1W47A 4EJFA 2PIAA 1X94A 3GX1A 4HATA 2IYQA 4W5TA 2BDUA 5TF0A 2WWTA 4M49A 4UBKA 4V2IA 4A0RA 3QRWA 5I5EA 4Z4QA 1JFLA 4PO9A 2OP1A 4MO9A 1MFPA 1GTVA 4TMVA 4RX1A 2I67A 1RXYA 1ZA1A 2EFYA 5CIQA 4D4GA 4WPGA 2ZTMA 3C3WA 1K98A 3ZCXA 5I5XA 1KZ6A 2PJZA 1NXVA 4JLKA 4L5YA 4E5SA 1O87A 1V7CA 3DBVO 5KFOA 2V9ZA 5TEWA 2WT4A 5CH8A 2PSEA 1ESZA 4B2IA 1D7OA 2VHJA 2VT6A 3MMSA 4DQLA 4EQ5A 1CY7A 1G3MA 2OXFA 1MO6A 2IV3A 1X9GA 4FTWA 2HG8A 2CFIA 3D6NB 1RZRA 1ISJA 1KIMA 2BKXA 2IYVA 3THYA 1M8FA 2P6OA 4B4WA 4PQGA 4ZOBA 5CU7A 2VH1A 4ZCQA 4A91A 4B3DA 1Z7EA 3HJUA 3T5JA 1HFWA 1QHXA 3SIXA 2OPBA 3DKKA 3KPJA 4OA8A 4B44A 5ADVA 1KMMA 1YB5A 2WWGA 1TVCA 1I2CA 3W5UA 1WE2A 1Q0UA 2AOUB 4H4CA 4LCBA 5E9AA 3VHLB 4CT0A 2W4QA 4B71A 1RWKA 3QFFA 3W1BA 1BNCA 2XVXA 4KTVE 1V2GA 1HV8A 2EBHX 3HQ4O 3NVAA 1DXQA 1ORWA 3BSWA 3GJRA 3I5UA 2Y0SE 1LRKA 3A7EA 3CZMA 4NENA 4LZNA 3FTDA 4RUCA 1M76A 3NCTA 4FJ2A 4MQ4A 3VR5H 3IQFA 3RV4A 2F3TA 2XAAA 5J40A 5K5EA 4DV6B 1XKQA 1GCIA 1I24A 1LWOA 3SLRA 4ITVA 1C3XA 3WNDA 2JL1A 3S68A 4B6JA 1QNFA 4R7ZA 2QENA 2XCQA 2ZQYA 5LB2A 1UKAA 6NULA 2JAXA 5KU7A 2WNHA 2MMGA 4OY3A 1USWA 1XJQA 4ECYA 2W2OA 1F5NA 4MQFA 5A2GA 1QKIA 1SXJB 4CMIA 3FYTA 4QHTA 5BNIA 2BGWA 1RHKA 1KDZA 2AU0A 3WK7A 1XQVA 5IKOA 4BGVA 5D1NA 3PSHA 5F12A 4Y1RB 4X7BA 5JBQA 4ENQA 2VUGA 2C2HA 5ALYA 1ZN9A 1QCZA 3RYFB 2QORA 4RGYA 2Q4TA 4FBMA 4FN5A 4HTFA 5DYYA 4G9EA 4N5DA 3O8CA 2O2GA 4O29A 2SKEA 3KKEA 4MR8A 1JFRA 1U8AA 2R8RA 3WLHA 4C4OA 2B3DA 4HQ6A 3BSYA 2R79A 4IL5A 5A04A 4B0OA 4IZOA 2QN3A 2ZT5A 4KAJA 1NUQA 3A70A 4WOJA 4ZPJA 4EYGA 3OFVA 1G8YA 2BKUA 2H2WA 1MNAA 4M1SA 2P2ZA 4QU8A 4M76B 4LMRA 2FUEA 3KWFA 5HCNA 1Y1SA 4N5LA 3V8QA 4A2QA 4MGYR 3E23A 4LDAA 4OP1A 3EZNA 2JRLA 1JPVA 3V1UA 2F4VB 2CXSA 3QE9Y 2XC9A 2PMZE 3EYYA 3IDOA 2AWNA 5ARDA 5IG2A 5CEJA 1ATIA 4N48A 3UHJA 1OX4B 2HNAA 5CT5A 3EPPA 4A3FG 4Y9UA 2AFHE 3W8DA 2GDJA 2WK1A 2CNOA 3E3MA 2ZRMA 3MINA 4FMCF 1DKQA 5HF9A 4K1XA 3HUFA 3OCYA 1YFZA 4GG1A 4EG6A 2QX6A 1I9GA 3ETEA 4UEJA 4I3HA 4UTXA 3W79A 1EM6A 4IMRA 3R3ZA 4LZLA 1UMBA 2ODWA 3BF8A 2CYAA 4YRBA 3Q5GA 3UWMA 3B2EA 4DY6A 1A7KA 2APJA 2GBIA 1SBHA 2H85A 3D0OA 5CT4A 5EE3A 5C81A 2W70A 3BEOA 1TMKA 2I1WA 3ZLVA 4ECTA 1JJAA 5JCPA 2A88A 4CT4B 3IOBA 1TJPB 3AHHA 3T3GA 2MIIA 3RTDA 1Z36A 1ZYUA 4QOIA 2ETVA 4HDMA 3ZXYA 4ZZ3A 1W59A 1YT5A 3PNBA 3ZTYA 1I7NA 2ZRJA 3D7RA 1C9DB 4GEGA 5LR6A 3PEWA 4Y0VA 4IDEA 1W0KD 5FLEX 4RSRA 5TSDA 3VR2A 3MGKA 4QLOA 4WJLA 1OPRA 2DWQA 3ZY6A 2K87A 5JS8A 4ALMA 2QBYB 5C7LO 4G4SO 2VXCA 3U9LA 5IYZA 2VPXA 3BMOB 1BQ3A 3TIVA 2BFFB 4MRSA 4A15A 3FMAA 1DQNA 1KR2A 2JH3A 3KQWA 5EHNA 5BW8A 4EEYA 1J2EA 4EBCA 2AK3A 1V41E 2WY2D 3O2SB 2Z0MA 3L4BC 5K0NA 2WIGA 2NVYA 3NHBA 2JGDB 2AGOA 3S5JA 1ODCA 1CVLA 3LHSA 4KWIA 4XYMA 4ZP1A 2JA5A 5EOYA 5I3CA 2B98A 1T8YA 3EXIB 3PLAE 4WI1A 1ZC3A 2BHNA 2O8CB 3F6CA 2EL9A 4AJJA 4HWKA 4EFKA 1OROA 3GA5A 1D1TA 5EFOA 4UNRA 2IH4A 2RHCA 2C3UA 2B63A 4OO3A 4QVGA 3VV2A 1GQFA 1SOMA 2GLUA 1NVDA 1YS1X 1MQAA 1QHEA 2VG8A 3PL1A 3DOOA 3N39C 1Z07A 4LYAA 3TMYA 5JCJD 3RCBA 4IJ5A 3D6TB 2IEYA 2ID8A 3JYPA 3GEBA 5FPSA 2OFWA 2BTOA 4NBWA 1M34E 3GFBA 1H2EA 3UMRA 5KVSA 3KOYA 3E05A 1X8JA 1YGYA 5ALPA 3F7TA 1SVSA 2XBUA 3MG9A 3NX4A 4XCXA 1XQWA 2WAYA 2D8MA 5BRAA 4UCUA 3OEEA 5ALHA 4U5XA 3LZ6A 1GNQA 4GI2A 1N9GB 1OXTA 1JAZA 4KODA 5F78A 4R0MA 3MBIA 5DHSA 4OATA 2E55A 2A1TR 2XIJA 3IO3A 1KOLA 1YJCA 2IHTA 4JLAA 3UMYA 2Q5HA 4UUPA 1NVKA 1E62A 5EJGA 5EPOA 4B87A 1KTIA 3JD3A 3N8DA 3DZ8A 4J9UE 5FULA 2HVRA 1KI6A 2Q46A 4R51A 4I9UA 5B30A 3TRDA 2YNMC 5KSYA 1TGYA 3V3KA 4X85A 2VCYA 2OM2A 3UFBA 4QYWA 2BFAA 3ROGA 3KHLA 2Q45A 2BM1A 1B3BA 2ZYRA 2UAGA 1Y8RB 3B1WA 3IB3A 3MFHA 1U04A 2O3RA 4N5HX 3V4VB 4EG7A 1S4QA 1OJLA 4LYDA 1QGYA 3OI7A 3UIEA 1EFAA 1Q16A 2NU8B 4MTCA 3ADCA 3IDAA 3PO3G 2CDRA 3DDZX 4QDJA 2Q2TA 1WABA 4WK0B 3BIXA 3DE6X 2W6JD 4X90A 1SZCA 4L5JA 1IQRA 1YMUA 4K6OA 1KZHA 3CVZA 3I2YX 4LVCA 5H02A 4DGSA 3FF4A 3M6AA 5JTTA 4R8LA 3TLKA 4RK1A 4M0LA 3FKQA 2ZB8A 3N0WA 4Z9FA 1QH9A 3NLLA 4MUKA 1YACA 4GKVA 1EINA 1H1TA 3DMTC 1VIDA 3WK5A 3CF2A 3UAGA 3PK0A 4RF5A 2NVUB 4DNQA 2PM8A 4Q8EA 2R6DA 3K1AB 2XB9A 5CAEB 1BDJA 3R0VA 3TN7A 4EPXA 2H1VA 4HYYA 1CKNA 3SNHA 2AZDA 2P68A 3WLKX 4TSFD 3GK3A 1WQ3A 1EVIA 4PSVA 4HUQB 5FLYA 4JI0H 4OGFA 1SHLA 1JGTA 4RF3A 4F7WA 1N2CE 2FHPA 1U7PA 5HQ3A 5DX1A 4U0KA 3K6SB 5EMMA 2VA8A 3AT1A 1JIUA 1L7PA 3PR3A 1NNI1 2QW1A 4IJ6A 1QIKA 4LX0A 4QE3A 3OURA 4D3YA 5K9ZA 5EFZA 5TJHA 3U62A 3WP0A 1GZ7A 4KTTE 1TKCA 2HWWA 3F78A 1HFKA 1OI7A 1T3GA 1Z0KA 2VUSA 3ASZA 4IIXA 4URYR 4EUFA 1YS9A 3IAEA 1ID8A 1XT6A 2A9VA 5IJ9A 3WHLA 4O81A 2HPVA 1ZK3A 4ZTBA 3BJYA 1J23A 2KLBA 5K3BA 2YR0A 1E0AA 3SPXA 3M33A 3PQDA 1Z4LA 1YA4A 1W93A 2Z6VA 1EX1A 2BR5A 3JQAD 4P5DA 3R76A 4LRWA 3CO5A 3G2OA 2L0XA 2BFBA 4KMOA 4YAGA 4DWVA 1N77A 5KNLA 2HOQA 4AYBE 3KYIB 3MUNA 5KYUB 2REOA 1N5LA 4OJMX 4PHTA 3CLUD 2Q7DA 2Y0EA 4QUJA 4XM2A 2FQXA 5EIAA 3VUFA 4FEGA 4H08A 5ISMA 4LOJA 4UNSA 2RCNA 5JATA 1O5TA 1FB5A 2DUNA 1OLXB 2VJLA 2XR1A 1CS0A 3R0QA 4NESA 4Z7QB 1H0SA 3D2CA 2C2RA 3WLLA 4DIBA 4MKGA 5KT7A 2FZKA 4O7VA 1W85B 4J0CA 1Q83A 1FF9A 3RJZA 1BMFA 1D2GA 5EMLA 5HE8A 4EYOA 4H6WA 3U40A 5AW8A 1EWYA 3BGSA 4O1MA 4DC0A 4J3NA 4BV2A 1MGOA 1RRKA 4ED2A 3FWYA 4LGYA 2Z8ZA 3KQSA 4J9NA 5P8WA 1RABA 1JDVA 2BJVA 3Q8QB 3ZGZA 4RNCA 1Y8QA 3FDJA 4QZVA 2TMYA 3KR2A 3MJTA 2XNHA 1KYQA 4O8CA 2M05A 2BQRA 2GN9A 3LCUA 4XIJA 3E9ZA 4FT2A 4KDRA 1QIGA 4UFNA 3A9CA 5FOUA 1R18A 3UFXB 3H3VH 5G0WA 2IRWA 1GSHA 1H2XA 3HDQA 3ZWMA 1CDEA 4TVSA 2X9GA 4A0SA 1KAMA 1AQ6A 3OKFA 4FDAA 4ENPA 4YAUA 1VP3A 4IOJA 1ZCZA 4UMEA 3D3JA 3JZFA 3UKJA 2HO4A 3RB4A 2P2NA 2F1RA 1NUTA 1E9RA 2GPJA 2J3LA 3HCOA 4GRAA 1JZQA 1NR1A 3IGFA 3JV7A 4LFBH 1HYHA 1PFKA 1YR6A 3QELA 4FBLA 4PRLA 3VNNA 4OOFA 3S2GA 2F7SA 3JALA 3M9XA 1Q19A 2EV9A 2FMIA 4KMMA 4HT3B 2PH1A 2E2WA 1VG8A 1YCFA 4KXFB 3NTUA 4HZIA 4AKTA 3HZZA 5JVDF 3HXTA 2WYUA 4L4UA 4RZ2A 2XIGA 1KR5A 2BTQA 2MOKA 3KELA 4Y9DA 2HL6A 1GZHB 1L5YA 1QG4A 1C9NA 3C7DB 4QATA 5DTJA 4BBPA 1S2OA 1QANA 3LE8A 2B36A 3OX4A 1NL3A 3NKLA 5LU9A 4JI3H 3UHAA 2Q6LA 1JEDA 4LJKA 3FHLA 3GPDG 4DCUA 1KJQA 1GKUB 2Q0QA 1V95A 2XWBF 2QMYA 5DYIA 5ARBA 3CUSA 5L95A 1KBOA 3JVIA 4Z1OA 2P9ZA 3VZBA 4OL0A 4GICA 4ZAXA 5FPTA 3SOPA 4Q7JB 1ZGCA 3TX6A 1PUIA 3HFRA 1A9XA 1A2KC 1OBCA 1ECFA 2WHQA 4W63A 1ZOIA 3AVTA 1KZ7B 2R6HA 3KJHA 4YCMA 4YR0A 2AVNA 2WUFA 3CB2A 4OXXA 3RUAA 1CNFA 1NLMA 5L3VA 2ZZMA 4JSTA 1KMHA 4OIMA 1QMGA 5G0SA 4LDNA 3ON5A 1QGOA 3DE2X 1TFUA 4KN8A 2B4YA 1X8KA 2CBZA 3JQ7B 5F64A 3ZKWA 1DGQA 3GAAA 1U2EA 3BE6A 1W88B 3A4YA 3ANTA 1H2WA 1DKRA 2REQA 3I09A 3JPYA 2ZR9A 4HLDA 1G7RA 4JI5H 4RVHA 2V55B 4NJEB 4HAWA 4AF7A 1CVRA 4GI3A 5LMCA 4LZAA 1DZ3A 2X40A 2HK9A 1M8JA 3LF1A 4KQ9A 5FBHA 4E88A 5D51S 1NJGA 1GN8A 4YIKA 1RYNA 1VGVA 3KC2A 1Y42X 1EP9A 4JBHA 1XRNA 1DWPA 1DSSG 1O6BA 2NU9A 3EZ2A 3FPJA 1E60A 1UEJA 3IV7A 2FLPA 3IN5A 4HDAA 4OL9A 2O2CA 1K6MA 1YI0A 4KB5A 4ZT5A 4EGFA 3U81A 4RIGA 7YASA 3OTWA 2EJWA 4HAXA 4QPDA 1SVWA 4LISA 4F11A 2WJWA 1XZJA 2E9SA 4CEJA 4RVCA 4ETMA 4OAOA 2WKRA 1QPBA 4KXNA 3JRXA 3W6ZA 3I37X 3W9YA 2FRDC 5H68A 4TV9F 4LJSA 3A26A 3EJWA 4QOHA 3X1JA 3I04A 4JY7A 3WFZA 2CE2X 4NZPA 1Q7TA 3EC2A 2PZKA 3L1IA 2W83A 5L53A 4PO8A 2JIOA 2PH7A 3U1TA 3GLIE 3TW8A 3OT1A 4YMIA 5HIAA 5J4LA 2PLNA 1D2AA 3B6IA 4R2JA 5AI4A 5GM1A 5JSYA 4D8XA 4UCVA 1R74A 4J0DA 4KE9A 3WLQA 1UDBA 2I78A 2PGJA 2AZTA 4OMDA 3OCZA 4IIJF 5IZ4A 3C4VA 2P6RA 2I5PO 3KTFA 1GNLA 1QH8B 2PWAA 3L6DA 1RYHA 1V11B 2EWWA 3C5CA 1QVRA 5J1TB 1GZVA 5HOEA 5KQLA 2GEJA 3FCYA 5MFZA 2C1XA 2E1RA 2XIQA 1R3DA 3P2OA 3WLOA 1BS9A 1W5FA 3D8TA 3A58B 4V1CB 3VAYA 3JZMA 3SEFA 1JEEA 4JEUA 1XZHA 1RVV1 1X2EA 3NHAA 3S81A 5B58T 2CKZB 4GNRA 1ZUWA 1QB7A 1CR2A 4UEWA 4FMCB 5ARCA 4F85A 2VH5R 1AK1A 2L82A 1W8DA 5BQFA 1CCWA 1MQ8B 2I76A 4QSHA 2EYUA 3HVRA 2XYVA 4N4AA 1EJ2A 1X3LA 1T0JB 2BF7A 2AKAB 1JHOA 1MX3A 4XIIA 4YAEA 2R84A 1MABA 1KYIA 3TW6A 2C2KA 3IUEA 3RJTA 5A4FS 1Y6FA 2AKEA 3E4CA 5AJWA 1SUPA 2UUOA 2YHIA 3EAFA 5CFLA 4BXOA 4EGCB 4INZA 2CZQA 4IICA 3WLSA 1K88A 1V8PA 4WGGA 5CIWA 4GFDA 3PWZA 3IVMA 3P4YA 3GPBA 3COJA 4Y6SA 1KO7A 3ICVA 1YJXA 4UXJA 4BMDA 2V7GA 1DWUA 3EMBA 3O3CA 3VNRA 2ZM6H 3B3JA 1V5EA 3JQ8A 4HDQB 5FPPA 5ALFA 3LCVB 1M3SA 3I6MA 3QWAA 4OREX 3LLSA 4C4RA 3OC0A 2J09A 4PYQA 4RU9A 1PTKA 4OGL