4MA8H

Crystal structure of mouse prion protein complexed with chlorpromazine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLQQSGTELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGSIDPSDSYTSHNEKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYFCSRSGYGYYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of prion inhibition by phenothiazine compounds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Major prion protein
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ma8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ma8H02
1VHPA 1D5BB 5AUMA 2JF1A 2YN3A 3FO1B 3QHZH 3V4UL 5IV2A 4ESKA 5A43C 2F54D 4OFYD 3G6JE 4LSVL 1NKOA 4Q74A 1N0XL 1XIWC 4HFWA 3MBXL 4XC3H 3GSQB 1S7WA 4RGOL 2W9DH 4ZXBD 2ZSWB 3V2AR 3ULVL 1CTOA 1U93B 2VQUA 3GMMA 3VH8G 4QRTA 4DQOL 2VLKA 3TC9A 3IDXL 1A2YB 3TCLA 3U0TA 3VXOA 3BP6A 4Z0BL 3PIQA 4YAQB 3WHXB 2Z31C 5FYJL 3SKJL 5E8NB 2DLHA 1WZLA 4OCYL 2WBJD 4R6UA 3NZ8B 5I1JH 1MCEA 4MAYA 3SBWA 2FHCA 1GGBH 4PRNB 4ELMA 3HFMH 4F2MA 1R3JB 2CKBB 4HX1A 1YY9D 2OS7A 2D0GA 3CFBB 5D7JB 4EXPX 5EC2B 5DMYA 5I18L 1XGUB 5CD5C 3ZDXE 4GMSL 4RMTA 2X41A 2MHAB 4ODXB 2HMID 1F8TH 3B6SA 4NQCA 1FRGH 4XHJD 1X5XA 3RBSA 3MV8E 5IBUG 2EYTB 2GJZB 4HXAH 4D0BB 4HS8L 4LCWE 1CE6A 2D7OA 3GO1L 3O6FA 2ADJB 3QWOB 4OIAA 2R0ZL 4NO3A 5GGVL 5TH2A 2XKNA 3MODH 4KMLB 1DDHA 2P24B 4ZAKC 1UFUA 4P2YA 5JQ6L 5IB3A 1ZGLB 2I9LB 3SPVB 2AJUL 1VFUA 2ZCKH 4YXHL 4QF1B 2BVQB 5E8EA 3JUYA 5DMGD 4LCCB 4LEOB 5EU6B 1Y18A 4MYWB 3WL9B 4G6AC 2MSPA 2GAZA 3DWTA 1LHZA 1BFOB 4ZS6D 2V2XB 1ONQB 3QUXD 2VLJA 5IFJA 4HWBH 5GRZA 2G5BA 2MTPA 5E00B 1X5LA 3BE1L 2Z35A 3IFLH 1HSBA 2Y72A 1V8HA 2A73A 3QQ3A 3KJ6H 3GSWB 3BIAX 2DQDH 1AHWC 1WTLA 3D18A 3G9AB 2DTMH 2H32B 3TYFB 1JZ7A 2EE2A 4M62L 4XRCA 4ETQA 3T2NH 4YHZL 2Y36H 2NY1D 5I9QC 1DBJL 3QI9B 2PYEE 1YEIH 4PD4K 3EJZC 3R1GH 3REVA 5KW9L 4JZJC 3LQAH 5IFHL 5IHLB 5FO9A 2QSTA 2DJUA 1CDGA 2YD7A 4UDTB 1N59B 3E2HB 4JQVC 1WCQA 5D1QA 4UT6H 4OAWB 3TJEH 3PL6D 4YDJB 4ZUTA 1YMMA 2P43B 3TBWB 4ZAKA 3ARBD 3F7VB 4M93C 2F58H 5CSGA 5DJZB 3EO0B 2EEBA 3GEWB 4I18A 5DJ2A 3QQ4B 2YK1L 3EOBA 1G9NC 2CJUL 5LJYH 1FGNL 2BY1A 2I07B 5CIPH 4JY4A 4LCWA 2W60A 1KJVA 4NNXB 2QHLA 2P8PB 1BQHB 4Z7UE 2NX5B 3SE9L 4L5FH 4X9FA 3BEWA 1EO5A 2VL5A 1TQCB 1S7TA 4U1KB 2ED8A 5HYSA 5IMLB 1I8KA 2I9TB 1G1YA 5GGTA 4QHKJ 4WW2C 1I7ZA 4O2CA 2P5ED 5FOBA 3PV7A 3TPKA 3SBWC 3VFNB 4NZDA 1CFTB 3DX6A 2XPGB 1NAMB 3Q5OA 1U92A 4Z9KB 2Z4QB 3AAZA 5C0GA 3FRUB 5KSVB 1I3GL 5MEPA 4JG0H 3OBAA 2ESVB 4M1DL 3TN0A 2H41A 3BGMB 1T4KB 4F37F 1MLBA 5MEQB 3TIDB 4JM4L 1JUFB 1Z9LA 1QLFB 4A6YH 3NABL 4OGXH 2GKIA 3IS1X 2YPLA 4PGBB 4G6ML 4JPKH 3ZTNH 1YDPB 2HYMA 4YH6A 3QNYB 4F37K 3OB0K 4G80A 2CD0A 4DN4L 5F6IB 2ZUVA 3JTSA 3HB3D 3L7EA 1Q9LB 3SGEI 4Y19E 4LPVA 3W5MA 3DUSA 4MB5A 5F89A 1PEWA 5BOZG 1OAUL 4K3HA 1YN6A 4UTBH 1BQSA 5JPNA 4KUZL 3STLB 1OHQA 2ICEB 1VESA 4JFEE 4LPYA 3VD3A 1HQRB 5D2LF 2J1KA 4Q2ZA 4NN6B 1BBJA 4TPRL 4X7FC 2Z92A 5F6HJ 5IJVB 1TXKA 1T1YA 5EPMB 2Z91B 3VXQA 3DXAB 4HPOL 1VGKB 3KPRE 1YEFH 2ZUQB 1KGCD 3CDGB 4GKNA 4ELMB 4YHNB 1YEHH 5DDHB 3E8UL 4HHAA 1UKTA 4RFEB 3WSQL 4I0CC 3T65A 3IVKB 1TVHB 1M7DB 3RUGB 1J8HA 1GZQA 1HEZA 4K3DH 4OM1H 2HT3C 2G75A 4PJ8B 3NN8A 5D7LB 3BZ4A 3T77B 3KS0J 2IPUG 1XR9A 3QDJE 4NKMB 1WWBX 2X40A 5J57B 2PO6C 3D39A 3OSKA 4MNGB 2KDGA 4D0BA 2LU7A 1A14L 3V52H 1T20B 4CVXB 2DTML 3P3YA 2KUTA 1T0PB 2BOBB 3G5XA 5BQ7A 3L95B 3TVMC 4GRWF 2A77H 1KFAL 3GMNA 2J8OA 5GJSH 5JMRA 2HT2C 2ZOLB 3FCTB 1AGCA 4KUCF 2BVQA 4Z78A 4CU8A 3EYQD 5HYJE 1SEQH 1N8ZB 3X13B 4GW4A 1AO7A 4KPHH 2DICA 3KNBB 3ZKNC 4C56E 5C6PB 4P57A 4KC3B 1NGPL 1T1WA 3FOMB 1OGAE 1U6AL 3X12A 4N1CA 2CLRA 4QRPA 3FL7A 3SCMA 2CRZA 3DMMB 3D2UB 1Q72H 1FFQA 4F15B 2CDEB 3R1GL 4HWEH 5C0AA 1B0GA 1L9NA 1J05B 2XRAL 4MA3B 5I8EB 2FATL 1LWRA 4DGIL 5GS0L 2I25N 4DTGL 1GZPA 5EN2A 3HR6A 3BIBX 4EN3B 1N6QL 4LIQE 5I15L 5ACZA 1MCFA 5L2KB 3RP1A 5D6CB 3HG1D 4KDWA 3BE1H 1P7HL 3ALXA 1BLNB 1LO0H 3ZTJH 3U0PA 4PG2A 2QADD 3UPAA 3FOLA 4DKFH 2IBZX 5E2UL 2R0LL 4K07A 4PGDA 1INDL 4K8RC 4UDUA 4YHLH 1E28B 2A6IA 2Y6SC 1AGBA 4LNRA 2SEBA 3VFWA 2AK4B 5E99L 3ROLA 4KK5D 1S78D 3C5ZD 4MX7A 1YEIL 1KPRA 5C0RL 3CGTA 5HI5D 4DGVL 4HFUH 1RK1B 4W6YB 4WWKC 4WV1C 1TNNA 2ZUUA 3REWA 5C0NC 1JHLH 3QB7C 5A40E 4L8SC 1UQSB 1I8MA 1JNNL 1CL7L 2DQIL 4AT6B 1MCWW 4P4RB 5GRVL 1WZKA 2ZKHH 4KI5C 3PGDB 4NQTA 2GJ6B 3WFCH 4PPTA 1NGZA 3RWEB 3QXDB 1HSBB 5TDNB 5T1LA 4PJIA 3QFJD 4G7VL 1NEZA 3QPQC 2H2PC 3CH1B 4JFYA 5D71H 3RKPA 3BW9B 4QXUH 3QAZB 4F7PA 4F7CA 2Y07L 3OKLA 3TN0B 4ERSL 3L5JA 3WN5B 2GIYA 3BXNB 5F72S 1JGUH 3GBNL 5F96L 2DQJL 1T4KA 4NO5A 3T0VA 1OCWH 3QNZB 1KXTB 2ZPKH 5FDWA 5L2JB 3WHE0 1L6XA 3I3DA 3O6FC 4HCRH 4NT6A 5E6IA 2R2HB 4NC1E 4OCLC 4YXKH 1HHHA 5KS9B 1CGUA 1N59A 1E4XL 5DJCA 2DLGA 3MLUL 2R8SL 4TTDD 1I1AA 3S88L 4JFZH 2CR3A 4U7KA 4X7SH 4FTVD 3VH8A 4CAGA 4KK6C 3CFJB 1NCNA 4D9RD 1RMFL 4ZG1A 4PGCA 1C12A 4FTVA 3T0EB 4D0CA 4O2EA 1QLRA 4KJPD 1AKJB 2DOCA 2UUDH 4TUJA 4ZYKA 4HK3N 4NYLB 4OGXL 1UXWB 4GBXB 2WWMD 2HKFL 3NPZB 1WJ3A 1KJ2A 1AP2B 4N0UA 3QZWA 2BRQA 4GT7A 3E3QE 1U91A 4PGEB 1FPTH 4C58B 4OLYH 4BKLB 2AQ2A 1P6FA 3RDTA 4R4FH 1I7ZB 4P9MH 4O58L 4XPFH 3GSOB 3OJ2C 4JO1H 4JZJB 4HCRL 1PAMA 3U9PL 2DQFA 1FORH 4OQTH 1OGAD 3GMPA 2X4RA 1IGJA 1OTSC 1WCBA 3CK0L 3SE8L 2KPNA 1C1EL 3KPMA 1G1CA 4NQEB 4ZTOH 2VN4A 4C56D 4ZS6C 1T20A 3GHBL 1ZS8A 3BPNC 5CJQL 5EORL 4GOSA 3O4LD 5GS2H 4LCWB 3ARRA 4TUOB 1BAFH 2MPAH 5D4QA 1RHFA 1RK0B 2GJ6A 1T7WA 2Y4SA 4HAFA 3SE4A 1X5AA 4N0RA 2DBLH 1BZQK 3GM8A 1GGCL 2NY6B 1A3RL 3BPLB 2OMBA 4JRWA 2VYRE 4YBHA 3FQNB 1MJ8L 2CLZB 5DQJA 5KN5A 4U1SB 4OCWL 1P7KB 5ANMA 5HI4C 4BFIB 3ZKMC 3SKNA 3ALPA 3PQYE 3C5ZA 5E1AB 5BZWA 1I9IH 2A38A 4Z0XB 1T2XA 2ICWB 1FYTA 1MVUB 4WU5B 2D7QA 4KVCL 3LCYA 5EOQH 3TNMB 3VXUD 5MI0B 2X1OA 5LG1A 1B4RA 3ZL4L 5FHAH 2YOCA 4N9GB 1R5VA 4K2UH 5DR5H 2OZ4H 1FJ1B 4MXWH 4I9WE 1NL0H 2IQ9L 3ZSTA 1YPZB 1DBBH 2X7LA 4Q6IA 4IBLT 4L1HA 3B5HA 4XTRC 4XVJL 2YRZA 5IBTH 3ZE2E 1IGFH 1MI5E 3CFJA 3VFRB 2E8YA 2FGWL 2VXVL 3T4AA 1LEGB 3C8KB 4RWYH 5CP7B 3WO4C 3RNKB 3UO1H 5JXED 3PABA 5DVKA 3ILPB 1KTRL 3DYMA 1DQJB 1MCWM 5IK3B 4KHTH 3I6LE 1T1XB 2V9RA 1FCGA 4C83B 2WMPA 3AY4C 4YO0A 4YIQB 2CUMA 3M1BA 3RI5F 2ARJA 3ZDZE 2O5XL 3S5LB 4KK9D 4F33A 2QQNL 5T1KB 4OF0A 5AAWA 1FGVH 3LQAC 1OWRM 3WIFA 1ORQA 4M6NH 2V2TA 1IKFH 4QNPF 3W81A 2Y5TA 3KGRA 1IC5L 1FGVL 4PB0L 4ZFZB 1MFAH 3WHXA 2R1WA 5E08L 4GW4B 5F1NA 3GMPB 3EYSH 1NCBH 4HUKB 3ROOA 1JGVL 1FBIL 2DQUH 2Q6WA 4M03A 3TT3L 5HHOB 4P23C 3ISWA 4HUMB 4C55A 1OTUD 5BMFH 4HGWA 1GOGA 3T0EC 1FNEA 2VXTL 4LLWB 4NP4H 2FGWH 2QR0B 4JDZA 3LN4B 1TQCC 2QQKH 3IS0X 3PGCB 4EDXB 4WU7A 4XPGH 4Y19A 4YHIA 4CJ1A 3D39D 4TSAH 3QDJB 1QG3A 1HH9B 3CDYA 8FABB 5KSBF 2R4SH 5SWSE 3FHAA 1FYTE 2AK1H 2F5AH 1KC5H 1NAML 3QIWB 4XT1C 3UTTE 5EN2B 3V0WH 4Z7WE 3MR9B 4KDTA 5I0ZA 2R4RH 4NNPH 3THMH 1DVFB 1FLRH 1K85A 4WW1B 4OLYL 3VRLF 2P5WE 4ALAH 4Z7OF 4WVRA 1AJ7L 4BQ8A 4UOW0 1BD2B 5FM8A 5T1DH 2OL3H 5EOCJ 2R0WL 1NSNH 2A9NL 1T7YA 4OGYL 3N1FC 3TBSB 4CVZA 1YPZA 2P47B 4XI5C 3G5VB 2OTWB 1U95B 2C1PB 1NMBL 1FO0H 3HZMB 4I0PA 1N0XH 4I4WB 3FAXA 1F8TL 3TO4C 5GQBA 5I1IL 2IMNA 3WJLA 1NUDA 1VERA 1GHFH 2YWYA 5BCAA 1MAML 3S5LG 4HFWB 2AEQH 3KHQA 3EAKA 3U7WL 4HXBH 3RQ3A 2IQAB 5I17A 2CK0H 4A2MA 3KDMB 5ADOL 4LNVA 5DTFB 4EN3C 4Y4KC 3O9WB 3GHEL 1UB5A 4JPVL 2Q8AL 3UBXI 3H9SD 3SKJH 1FG2A 3GRWL 4PJ9D 5ILTL 3DGCR 3CSPA 2HLAB 3ZKND 4BQCA 2OK0L 2FH6A 2J88H 2YD8A 4WJ5A 1W72A 3KVQA 1ZS8B 3BN3B 4E41B 5JUEH 2IBGA 1TTUA 3B2UC 7CGTA 4G9FB 2AJVL 4RQQA 4JFHE 3VXRD 5F9DC 1NMAL 2W60B 2NYYC 2JCCB 4FQXA 1KIQB 3FB7B 5F71A 2PTUA 2MCPL 4DKEH 1NLBH 3QUYC 3KLHD 3SQOH 4GUPA 1RZFH 1CLYH 2V7HA 5CSZB 1E4XI 1C1EH 1E27A 4EN3D 3TM6A 3H7BB 2GTWB 1DSFL 3QXAA 4OZIE 2VAJA 2E6QA 4YBLC 4NIKB 3FQXA 1T0NA 2CPCA 1FVDA 5HDOA 5ESVB 4HIEB 4MLSA 4WHYG 4WUKH 2XZCL 4AY0A 2FCBA 5DK2B 3SDAD 3V6ZB 3OKLB 4P3WA 3CD4A 3QULA 2PTTB 1PG7L 1XF3A 3MLSL 4GG6A 2DM3A 2X4NB 5IEKB 3IF1A 3AU1A 5ICYB 4ELKA 2O5ZH 3MC0A 3ARDB 2BY0A 4NNPL 1CD0A 3VXRA 2OR9H 3OB8A 2WLZA 4MJID 4QCIA 4YDKL 1TMCB 4X6DF 1C08A 1PD6A 1JNHB 2R1YA 4P3DB 4F3FB 1OW0C 2EDLA 5I1AB 5ISZB 3BPOB 4M61B 1Q0YH 2J8UE 4HDIB 3IDJB 4ZPTA 1MFBL 2V9QA 2RCSL 3G9VA 5J06A 1URLA 1CXEA 3KPMB 3EOTH 5ECJE 3MO1A 5IROA 2VDNH 1KXQE 3SGDH 1JL8A 4J3OC 4Y5XA 2IQAA 3Q1SH 1UG9A 1QLRB 3GSVB 3INUL 2BSED 5T3XL 3CMGA 1IAOA 3MRIA 1AQDB 3U83A 1OPGL 4PR5A 4WFHE 3ZKXB 5BXFA 1WITA 1KENH 5C1MB 4Q58C 4AMKL 4WV1B 4K8RH 3ARTA 4WNQA 1A2YA 1ZKAA 5IBLC 1DTUA 1CTNA 1BJ1H 4P59H 3VXOB 1OAZL 2EDTA 2FX7H 3TVMD 1ZV5A 3UZEA 3RUGA 2XZQL 3TJHD 4J8RB 3MRFA 3D69A 3O6FD 1L9MA 4WU5A 3OZ9L 4IEFB 2AK4D 4GQ9H 1NCDH 4NQSB 5FUZH 3EYQC 3L3JB 5HPMA 1QBAA 5EBMB 1J86A 1FV1B 3WFHB 1LO3H 2VSCA 2BY2A 2BVYA 4X5WA 5I73B 2FLRT 2J3SA 5I71C 1G84A 1S7XB 2DD8L 4P3CH 1G6RL 2AEPL 4M1CC 1MELA 1TENA 2HTLC 4QTIL 1I1CA 5GRJH 3X14A 2DQGH 3U9UB 3ZDYE 5I1LB 3ARWA 4PTTA 1DANU 3W2DH 2X10A 3LZFH 1I3UA 2YA2A 4Z78B 4LSTH 3PABB 3QWOA 3TP4A 2NY6D 5DD0L 3QHFL 1DQJA 5IVXE 5A2FA 2DYPB 2EKJA 4NKOB 2NW3A 4DVRL 5C9JB 4G43B 2A74B 3H0TA 1ZANH 5DUBB 3RDTD 1B90A 1FQ9C 3DRQB 4U1JB 4S1SH 4OKVB 2XV6B 4CMHB 1Y18B 1AGFB 4XC1L 2DB8A 3DVNA 3WIFB 3O3AB 5EA0H 4HZLB 2Y5TB 1NBVH 1F00I 4MA3A 1DANT 1OGAB 4YHYB 1S9VB 1JE6A 3L7EB 1NLDL 4LCUB 3HS0B 4PJDF 3DX8B 1K6QH 5FYKU 2NXYC 2DDQH 4Y4FA 5HGDA 2E7LA 2ORBH 1RZGB 1PDKA 4QHNA 3QI9C 4PJGB 2Z93B 3SGKC 4XXCA 4NDMA 5JUEL 4KK5C 2VDKH 4EUPH 4HH8A 4OGZA 3V6FB 3B5GA 3IFOA 4TQEL 5IJVA 1T1XA 2JB5H 1BF2A 3KPSA 4MNQE 1MFEH 1NUGA 3AB0B 5B39A 5HI4D 4ISVA 4NN7C 5EOTA 4GAYB 4P5KA 3RWHA 3NABH 1IT9L 2OSLA 2DLEA 4LASL 1JPTL 2M2DA 1T5XB 3QXWA 2IBZY 1ZHNB 1NCCL 3NFPA 5CGYD 1FNHA 3CUPB 1YMMB 3RKDD 3O0RL 4ZMAT 2JTDA 3P9LB 1U8NA 4BH7B 5T33L 4IRZH 1CI5A 4H1LG 4LPWA 5IKCB 5IM7A 5IESH 4MQ7A 4NO5B 2VOTA 1OAUH 2EO9A 1QBLH 3CLEH 3UBXG 4CN1A 4U1NB 5KSBB 1MQ8A 4UAOB 3PNWA 2H32H 1EBAA 1NFIB 3DARA 5F7UA 3TA3B 3VA2C 1QLFA 4I2XE 1WEJH 3ARGB 1RHHA 3RZCD 1IBGL 1EO8L 3UJIL 3S96B 3ZMRA 5T5FH 3TGXA 3MOAL 5HD8C 3QXVA 4WDIA 4H1LA 2DDQL 5HGGS 5DFVC 3QDGB 5MI0C 1UCBH 3LY6A 1WC7B 4MS8C 3VCLB 4NO3B 3K7UA 1CFTA 3DX6B 5DHVB 5IG7B 3O8XC 3TNNB 1NAMA 2ZJSH 3PXJA 4M4RA 2NXZC 4PUBL 1O7VA 5FM5O 3D0VB 3TBTA 3LQMA 5FEBA 2PXYC 1NGWB 5MEOB 1BGXL 3FJTA 4URTB 4NBZB 4XWOC 2GAZB 3VW3H 2NY0C 1ZANL 4MQXC 5EFIB 4UT6L 4KVNH 5ESAB 5AWNL 4BZ1H 1JK8A 5JORA 3H9YA 3MO1B 4WJ5B 1XR8B 4C4KT 3HZVA 3FT4B 2GK0A 1FLRL 4M6NL 4I4WA 1A6AA 5DQDH 4NKDB 3VFTB 3RX8A 5A3ID 1DBAL 3HPJA 1T80A 5E7BA 4TVPH 1I85A 4PREA 5I8KL 1BLNA 1P4IL 3OX8A 3CC5B 4G6FB 1LP9B 1Y0LB 1A8JH 4NPYA 3I02A 1K9TA 2IH3A 3LQZB 4P2OD 2DQUL 5T1DL 3TFKC 4GKSA 4BZYA 1UXWA 1ACYH 5EZOH 4LGPB 5KSAA 3KJ4C 2ITCA 3KWWB 2YSSB 3QWQB 3LEYL 2AQ3A 3TBVA 3IDMB 3ROLB 4LLYA 3V8CA 3LKQB 1VFAA 2HJFB 2WSKA 4Y4FD 3FQNA 1FDLH 1NUFA 2H1PL 1HHIB 2DM7A 2WIIB 1CVRA 2AXJA 2ERJC 2Y5EA 3BT2H 3RL2A 3V0VB 1I8MB 4N0CD 4WWKD 4PRDA 1U8NB 2H26B 3GJEB 2AGJH 1INQA 4F7MB 4Q7DA 4ZODA 4K3GA 3RTQC 4PRIE 5DJ2B 1NC4D 3GMLB 5FFLA 4EJ1C 2H6PA 2XTJB 1FL6A 2BZDA 4JN2B 3BAEH 1F5WA 4FG6C 4Q9CA 1EAPA 3MOQA 5GS0H 4JR9H 5GRWA 4IIQB 4JM2C 1MCRA 3N9GL 2F54B 4PJEB 3QSKB 3QCTH 5I0DA 2XZQH 4R0LB 1ADQH 5E94A 4OZFA 3P4OB 4NQXA 4PJ7B 4MJIE 4JFQB 1G9MC 5D8JL 5ESQA 1QLEL 3MRQB 3A6BL 2A74A 3K8LA 1MIEH 2CUHA 5K9QI 1EHXA 1BD2E 5I6XB 3HAEH 3MLPA 5T1LD 4KI1A 2EH8L 4S0TD 2GUOB 4XVJH 1F6FB 1YNLH 5I66B 3T09A 5IOPA 1A7OH 4HWEL 3SOBH 4EUPA 1CDUA 4E5XB 1HCFX 5GGVH 2ZJSL 2EXWD 5JOFA 1XGPA 2YRLA 1DBKH 3RU8L 4Z5RB 1PY4A 4K7PH 1ZLVK 2F8XC 3SJVB 1YNKL 1ZVYA 4HUXB 4XMPL 3UYPA 1UGNA 3GUTA 1U8QB 2FO4B 2EDQA 3TVMA 3B5TA 3BGAA 1R3JA 4MNQB 5CHNB 5IW6A 4HJ0C 2KH2B 5CJOL 5J1AA 4O4YL 1OGTB 1DEEB 4Y8DC 3TBWA 4APQC 1B4JH 1O0VA 1RJZA 5JO5A 4P46C 4POZD 2FLBT 2VMFA 3PWPE 3T0XA 4DKDC 2YPLD 4OGAC 1JGDA 4KQ4L 4M93B 2RFXB 4PJAE 3V95A 4L1DA 3SO5A 2ADIA 4U0QB 3DYOA 2ADJA 3IDMA 3K3QA 4TVPD 2PXYB 2WP3O 5J3HC 2AI0L 5MP6L 4V1DD 3FHQA 1DQMH 2HN7A 3WXVL 3O6ML 1NDGA 3CMOL 3VFUA 4PRPE 2FEDC 1DUZB 1E4XH 1AGBB 5I1HH 4G9FD 1I1FA 3MLVH 1JWUA 3QRGL 4U1NA 1JGLL 4XI5D 3RWJB 4RGOH 1IAMA 2EC9U 2P42B 3BWAA 1GGCH 5SX5H 1GZQB 5EIIB 3UPRA 4TNWK 1QFOA 2OQJA 3LKPB 4MJIA 5SWZD 3TO4D 1F90H 2A73B 1BVLA 1NMCC 5H94A 3WBDA 2W59A 4YBLB 1BPVA 5K9OB 3NCYS 5JNYB 4QXUL 4JANA 3WCYA 4R0LA 3O0RH 5E94B 1QEWB 4OZHF 2A9ML 3MUGB 4PJ5A 5FKPB 5D7LD 5T1LB 4FFVD 3ES6A 1YEGH 2FH8A 2JKXA 5LAXA 2CRIA 5BJTB 4ENED 2CH8A 3I75B 3ORJA 2LTQB 3U9PH 5FCSH 5IIEB 1XCQA 2ZPKL 3R4DA 2B5IC 2PW2B 4CADA 2EH7L 3DUSB 1KNOB 4EOWL 4IHOA 5GSRA 5J12C 5J6GB 2KBGA 3O9WA 4NRYA 5KVGL 2AAVA 5C0BE 5TGBB 4E41D 2GK0B 3VRIA 3VXPB 4XNQB 3OGCB 2AK1L 1LK2A 4J23A 5C0EA 3TVMB 3K8KA 1I4FA 1Z3GH 2VR4A 1WT5A 2XFXB 5DD0H 5FECB 1CG9B 5E2WL 4PJBE 4JFZL 3P9LA 3KLHC 4QRQB 2BSTA 2GSGB 4OCXH 2FX8H 1C5DA 4HIIA 3KYNB 5IHUH 5HY9A 4BFGA 3SJVE 1TJIL 3VG9C 4PJ9A 3LV3A 4LRIC 5BV7B 2NXYB 3EO1B 1P9MC 5I15H 1H5BB 3H9SA 4YDLC 4QTHB 3CXHK 3F12B 2DQJH 3RHWK 2AXFB 2C3VB 1DQLH 5CEZL 5DC0A 3CH8A 3QFDA 5BVJB 4QWWC 4KAQL 2R0LH 3DETC 5L6YL 1FFNB 3WEXB 5KOMC 4QTIH 5JW4Q 1X5JA 4XAKD 3MGTA 3A6BH 3GSOA 4JZJA 4YBQC 5DRZB 1U8KA 5GGSB 4N90E 1UJTA 2DS4A 3JV5A 4L9LB 4HH9A 5H35A 1F4AA 3C60C 5J13B 2JJSC 1NGPH 3NCYP 5EIVA 1RUQL 1RJLA 3QHFH 4YXHH 4AH2A 1TETL 5DJ0B 1MCQA 4HSQA 2F15A 4XPAL 1QYGH 5SX4H 4M7JL 5GGSY 3BZFA 1DE4B 3W39B 3EZJB 1LP9E 1OQXA 1V3MA 2MNUA 5F8RC 1T6WA 2HG5B 4YX2L 1BD2D 5ICXB 4Z76A 3HZVB 3LDBC 4WFFD 35C8L 1D5MB 4TNVF 2IAMA 1CD1A 5HHNB 4ZUSB 4JHBA 5EU6E 4JCMA 2BC4B 2DLFL 3S35H 4Y4HB 4NO0D 1S9WB 4GRLB 4OCRH 3L3GA 1FFOA 4XWGL 3ZT5A 5CBEA 2HJKA 2WP3T 1JN6A 1WBYA 4RAHA 1EHLL 1UXSA 1JYWA 3GMOA 4NSKB 4Y19D 1WAAA 1C8PA 1F11A 2ARJB 1EDQA 2C1PA 2FGZA 3G04A 2RR3A 4DFHA 4S2SB 2LU4A 2W9DL 4XZUA 3TZVC 2NQCA 2BOCA 3ARBA 3F7YB 4OJFL 2YD3A 4ZXBA 5ID1A 5BS0D 1G9NL 1KLFA 1YMMD 1RZKC 2XKSA 3WO4B 4YWGL 5D72L 1T0MB 3MREB 1A22B 2FJHB 4WGVB 4I2XA 2W0FA 3PWVB 3H42L 4S1RH 3N1MC 3RWIB 2X1WL 2CXKA 3NFSL 3Q6GL 2WUBL 4LHUG 1BVZA 3LQZA 1RUPL 1CICC 3WXWL 4RGNB 1BIIA 4LLUB 5K93A 4ZD3H 3JTTB 4HGKC 3MJ9L 4HV8B 4U05A 5DGQA 5LGJA 2GTZB 3HR5B 1H3PL 4DK3A 4TVSa 1N64L 3IJYB 3QQ9D 3MRBB 4NQUA 4FQ1H 5T3ZE 3KS0H 5JXEA 3GI8L 3NACH 4FQHB 3CIQA 5J0BA 3A6CH 4LCIL 3ZL4H 1BM3H 2HRLA 1PX3A 3PP4L 3SGEH 1A02N 1F3DH 5C7XH 2IF7A 1E4WH 5FGBA 4LEXH 2OL3L 5CFHA 1T5WA 1CXIA 2CO7B 1RZFL 3OV6A 4FNLL 3MJ7A 2VXUL 1XIWA 4G43A 4D9RE 1A1MB 2G60H 1GC1H 1NANH 4ZUVB 1DJSA 1ZLUH 2OP4H 4F57L 3HMXH 1I3GH 5DYOA 4LU5H 4NJAH 3MRPB 4RAVB 3MA9H 2D9CA 3WDJA 1O5DT 1ODAA 3DGGB 4TUOA 5A2IH 4N0FB 4M7ZC 2CR6A 3GHBH 3FN9A 3WMSA 4WTXA 4WU7B 4PBXA 4HIHB 4PJGE 1QQDA 3UJTL 1CGYA 2BP3A 3HHRB 5ACZB 3CZJA 3WUZA 5LGHH 5JA9A 3X14B 4YQXH 2EIZB 4PB9L 3S34H 4TULH 1H3PH 4QRRA 1QR1A 4S1RL 1N6VA 3MJ8B 5E8DL 4JDTH 3VXTA 4HMCA 3P77A 3QEQA 3G5ZB 5E8DH 3P0YL 4OI9A 5HDBE 1S3KL 1SBSH 4JO1L 3PWUB 1CLOL 5IVXA 3VG0H 5MENB 1AGEB 3IJSB 1S5HA 4BSJA 5IT2H 5C08A 1KTLB 2R29L 2XWTA 3A6CL 4LCIH 4C56A 2NY5L 1I75A 3WUWB 4GBXC 3GBNH 5FYLE 1TITA 4AIXA 2XA8L 1OGAA 3BPLC 4UNTA 2I5YH 4HJGB 3RWHB 3T0BA 3RTQD 2ZUWA 1XCTB 1A7BA 1TTGA 3BP5A 3ULVE 1TJGL 3RWIA 3QJFA 1X44A 2ITDB 2V5SA 1Q8MA 4YXKL 1U3HB 4AIZA 4G6KH 1FZKB 4N9OB 2J6EL 5B22A 5CIPB 1KTKE 3BKYH 5JDJA 1B6UA 3IJYA 1IARB 1P4BL 3NAAL 4K23H 3FO1A 1LP9F 3HTLX 3BPNB 1QD0A 5I30L 2O5YH 4GAGL 2FWOB 1SY6H 3DSFL 5TPWL 1SJXA 1EHAA 2E9JA 5H35B 4ZFOB 4AENB 2PNDA 5KAQF 5JHDB 1I7TA 3QEQE 3SDCA 4FXGA 5J6HB 3AC0A 2HMIC 1WIUA 3O41B 5FA3A 4L3EE 4M00A 1XGRA 4Z95H 4WI4A 2NNAA 3OKNB 4U3XA 4F8QA 2UUDK 3SDYH 2P7TB 5KJRH 2L7UA 3W39A 2LFGA 4DJMA 1YYLL 3F6IA 1HK6A 4LSUH 1EFQA 4Y5YB 3AUVA 4X7TB 5DJ8A 3F7RA 1S9YB 5F1KC 3P0VL 5DT1H 1A6UL 3H8NA 1TZGL 2HFGH 5CGMA 4U6XA 4B50A 4PTTB 3UJJL 4O2EB 2V7HB 3JTSB 3FZUD 1QA9A 5FECA 1H3XA 3SDDC 1J10A 2VL5B 4U1KA 1ZVSA 2IPTL 2YUVA 5DK0B 3OXRA 3VI3F 4U2YA 4LKCB 5ID0B 3SY0B 1JMZA 1IC7H 3QFJA 4W81A 3U36B 3EO9H 5F8QC 3UC0L 3L1OL 4HUVB 1A0QH 4DZBB 3ARFC 2V2WA 2YD6A 3S4SB 4GG8A 2CQVA 4N8VA 3DXAA 1CDYA 2FL5A 3CCHA 4ORZC 4NRYB 3QCUH 5JHLH 3QWRA 4XP4L 4Y0GA 3TFKD 4JFEA 1HHGB 1JI1A 2PW1A 5E5MA 4OCRL 5J12B 4HJGA 4I13B 4JHAL 4FHBD 5BRZA 5DD1H 4Y5VB 4GW5A 1ZXQA 5F3BA 2VISB 4NKDA 3VFTA 5ITFA 3FO9B 3WIHH 5L88H 2HFGL 4XCCL 3RWCA 3ME0A 4JHWL 4KGLA 4F9PA 4QLRA 4X4XA 4I1NB 2OL3B 4PJ5E 3FONB 3F5WA 4QNPE 3KYOA 4LSUL 2X4TB 4M3JA 4GKSB 5GGTH 4TSCL 2XZCH 3HE6C 5F1IB 3KDMA 5E7FA 4LPXA 3RVTD 4X5WB 1FL6B 4JN2A 2XG5A 4XCYB 4JN1H 3DVIA 3IKKA 5KN5B 2KZWA 3MGOB 1R24A 1DSFH 3R0MA 4FZ8H 1INEL 4J4PC 1EXUB 1DDHB 3IDXH 4N68A 4RIRB 5E2WH 2P44B 5IB3B 1ZGLA 4L3CB 5ITBH 3WKML 5KS9F 2GHWB 1I7UA 3MRHA 1W0YT 2Z31B 2W0KA 4GRLA 4TSBL 3QIUB 1Z5LA 4WO4C 5DYOB 5CBEB 3IDNB 2EDKA 1XH3A 1JYXA 3L3OA 5HSFA 4Z7WB 2R9HC 1IQDB 1U8JB 3SCMD 5I18H 1KIPA 1IQWH 5HGBA 1RJYA 1YNTA 3BZFB 4Y16C 3F7PC 4KUZH 2F8OA 5L2KE 3FAWA 4KXZH 3W11C 3BVNA 5HVHB 4FQCH 2IPKA 5DJDA 1FVCB 5K59E 3TYFA 3F7VA 5DJZA 1JPSH 5DRXA 4UINH 1H3TA 2C1OB 2XWBB 3GHEH 4JPVH 5IW6B 5D6CA 4A6YA 4PRAA 4HIXH 3C2AH 5TDPA 4BK4A 5JIIA 3TBYA 4OLWL 2UZYB 4XCEA 2OBGA 2JELH 3HC4L 4DN3H 4HUVA 4HUUA 1WBYB 1V05A 5GISL 3KPPA 5ICYA 3PQYB 5IB2B 2RFXA 2BNRD 3C9NB 4HC1H 3NPSC 4KWUA 1L7IL 5J1SC 4YUEH 1MUJB 3MLTA 1P4BH 3NAAH 43C9A 1AHWB 2CDEA 1X4XA 5BRZB 1FPTL 5D96C 1T03L 3F58L 1NMAH 4O2FA 3S7GA 3KLDA 4LARL 1MHPH 1UQSA 1RUAL 2B7DT 3CC5A 4ZFOL 3FQWA 3GKWL 5J1AB 1OAKH 2EXYC 3BO8A 3CMOH 4P4RA 1OGTA 5F7EL 3VU2A 5FGCB 5CKGA 1GGIL 2ORBL 2XQYG 1H3GA 2ZSWA 3RGVD 2ADGB 4L4VB 4RQQB 2DF3A 5CWSB 3IDGB 3A6OA 2HVJA 1U8OA 3OPZH 1I7TB 1JTTA 3IYLW 1KLUB 1QOKA 2X44D 2P5WB 1IAIL 2FATH 1A9EB 4WWID 4XMPH 5HHPB 4JANB 3BPOC 4CNIB 2EIZA 3C60B 2F19H 1CBVL 2XYCA 4LCYA 4M6OL 3IKCB 5IWLA 4AL8L 1EV2E 4LLQB 3DO7B 5T3XE 1C5BL 3NCEB 4KKBD 1DN0A 2BNQB 5AD0B 1T5WB 4JO3L 4FQ2L 1K2DA 1ZHBA 1J0IA 1A6ZB 2JIXD 3MJ9H 5C07E 1I1YA 3REWB 5CMAB 2EYSA 5E2UH 2EEAA 5IFAH 4M62H 4W4OA 2HFFA 2CKNA 4KTEL 3LKNB 4RMSA 3BP4A 4L29A 1IC5H 1H0DA 3E6HA 4B53A 4WW2B 1RIUL 1TZIA 3VRIB 1MRCH 1YECL 1L0QA 1LO0L 1I7RA 5C0CE 3Q1SL 3VJ6B 4O5LL 3W82A 5FO7B 1ZT4B 3MYJB 4KK6D 2EDXA 1IFHL 3OG6B 1MJUL 1JGVH 1FBIH 4MWFA 4Z77A 4PRAB 4XBGA 5JPNB 4F7EA 3MUZ1 4BSWA 2ICEA 3V5KB 4JFOB 2DQIH 3MXWL 2P45B 4JHWH 3JWDL 1MNUH 2E6PA 1CGSL 3KYNA 1M7IB 4I3SL 2Q7YA 3LQAL 15C8H 2X5PA 5AYQA 1YEJH 4OZHA 3ZTJG 4P59L 3UTOA 3EOAA 1KACB 5DURB 2DAVA 2H1PH 2C4XA 4LCWD 2YSSA 4XB8A 1GH7A 4YZFF 5FKAA 3GUTB 1EERB 2VISA 1H8SA 2VRAA 2DYPD 1LK2B 2VDOH 4K8RL 4U3HA 4M48H 1PYWA 2BRRL 4LAJH 5IQ9B 4LSPH 1GXEA 1XGTA 1MAJA 2DLTA 1Q9KA 3RBGA 5C0BB 1KBGH 5F6IC 4XGZA 3EIFA 3C6LC 4TYUA 2D3VA 3VWJD 2BHZA 5JDSA 3RL1A 1ETZB 1GGYA 1JZ4A 1N2RB 1I8IA 1KFAH 3CLFL 5DD3H 4NOFA 1X4YA 2ICCA 1LO3L 1VPOL 4XVTL 5FYLL 3VXUB 2QQQA 2VXSL 4M1GH 4H8WC 3ULVC 4ZDHA 3SE3A 3S37X 3KWWA 2AJUH 2ZCKL 2F5BL 4PJEA 2ZG1A 3QULB 5C07A 4PGEA 1BGXH 2X4NA 5IEKA 1P53A 3SO3B 5JHDA 5JW5A 2OJEA 3BN9D 2IPUK 1GIGH 3T0WA 4I9WD 1AR1D 3BYYA 2VLKE 1H15A 5LGKA 1J1XL 1H3UA 3V52L 4XP1H 1UM6H 1F4YL 4JM2B 1SY6A 2X2YA 3EDEA 2NYYD 5AEAA 5SWQA 1PKQA 5KSBA 1EEYB 3G6JB 2HVKB 3DSFH 4UTAL 4HS6A 1QSVA 3S3JA 4R4FL 1FC2D 1GGBL 3GMQA 4IIQA 4YXLH 5L9DH 4NN7B 3FB5A 3SGDI 1CICD 5HYIA 4XCEB 4KTEH 3S6CA 5CEZE 3IFPB 3QP3A 4LRNL 3RY6C 4GQPH 4LOUC 5B39G 4ZFGH 3VE0B 3VD4A 2D0FA 4TPRH 1WZ1L 1JV5B 1E6OL 1MCBA 1SQ2N 4M6OH 4X7SL 1JPTH 2NZ9C 1R24B 1KEML 5HHME 3CFCH 5D7SL 4MDIB 5C0IB 5IQ7H 3C87A 1N26A 4LLMB 3QYCA 4HZAA 2XFXA 1H3VA 1C5CL 1BOGA 3FMGH 4N8CL 5ID1B 3C6SA 5JOFB 5GRYA 5GIRB 2GCYA 3VWJA 3GNML 5F3HA 2F53E 4U31A 1RFDH 1TLKA 3HCVB 3I6KA 5BZDB 2RGSA 2APVA 4ODVL 3QBTB 5A2LH 5C0BA 3CDFA 3QIWD 1WBZA 3UP1A 3BRFA 4JY4B 5JDSB 3UDWA 3MFGB 3MACL 3HPLB 4FZEH 4R4BB 4KJQD 2X6MA 5GS1C 2DQEL 1IAKA 4RGMB 5FUOH 3PE9A 4KRMB 4RRPG 4MZ3A 1BBDL 3K74B 5HYSB 5IMLA 4YHKL 5DEFA 1G9NH 1DL7H 2H2SD 4I77H 4OT1L 1KCVH 3DROB 1DVFA 4NZTH 3LD8C 2F74A 2PYEA 1JHTB 4L8SB 4Z7UB 5DMJB 2Q76B 4I3RH 5FF6B 4X6DA 5DVLA 5IMOA 3FT3A 3ARFD 1VFBA 2VN7A 1U3YA 2DI7A 1A7OL 5B21A 5HI5C 1BD2A 3QDME 1HWHB 2AJ3B 3DIFB 1A1MA 1U91B 1HCVA 2YKLL 3ETBF 1TZIB 4UQ3A 4ODXA 5FO7A 1G7MA 1ZEAH 2ZKHL 2A9MH 3ZKMD 2DLFH 4MWFB 4GW1B 1UH2A 5HHOE 3GM0A 4Y2OA 1I8LA 3FQRA 1ZA3B 5T3ZD 1CQKA 4MNGE 4O4YH 4AYFA 1OAXL 4ZSOB 2XA3A 1HH9A 1QR1B 2D31A 2APWA 3ES6B 4G6AD 1OAXH 4PG9B 3OB0H 3PWJB 4I8DA 3IU3A 3EOAB 3O6KH 2ED7A 1F6AB 3D25B 5I2IB 4PJXB 3I02B 3OKOB 1XF4A 3VFPA 3BH9B 3V4VL 5DJXB 2WANA 3C9NA 2P5WA 5HHPA 3EJYD 2W91A 3X3FL 1U8HA 4G9DB 1NFKA 4PY7A 3X3GH 1R5WA 3SDAC 5SV4A 4E0RB 3D5OF 1CF8L 5D5MB 3UTPD 1L4IA 3CFDB 4G7VH 2VDLH 3QUMA 3EOBB 2YUZA 1VEPA 4ONFL 3FQWB 3AREB 3B2UD 3M8OH 4ODUB 1LDSA 3BJLA 3D39B 2V17H 2YUWA 1MRDH 2NY1B 2FB4H 2V6HA 2G2RB 1KELL 3DRTB 1FZMB 2NZIA 4MHHI 2AERT 4MCZA 2X4QB 2A1WL 3EHBC 5KVMC 4QHLB 4L9DA 4RISL 4HBCH 5B8CC 2J4WH 4XP5L 2H8PB 4IRJD 5GRUH 1PSKL 4OBSA 5E1AA 3ARSA 4PJCF 5FK9B 1D9KC 2XWJB 2LABA 3SQOL 5EOQL 4R4ND 2PTTA 3NCMA 4X8JB 3RVWD 5FIEA 3TT1H 4ETQB 1KG0A 4MXQD 4IOSD 3NA4A 4WGWB 3LEYH 4PJ5D 1GGUA 5BOPA 4LKCA 1ZTXH 4PRPB 4AEHH 2AJ3A 2FD6L 1C16A 2XN9D 3UPCA 3BEVA 4QRPB 4HG4J 1FJ1A 1KPUB 3LEVL 5F9JA 1ZHBB 2X9YA 4OLEA 5HYJB 2BVEA 5E1HB 4DGIH 4DOHE 1EJOH 3H7LA 4HIHA 3PWNA 5ILTH 1NFDE 1T83A 4JQXC 1WISA 4JPIB 1LD9A 3ZKQD 4HDIA 5CS7A 1NBYB 2XRAH 4BUHA 2DKUA 4MNHB 5TE4H 1J0YA 1GCFA 3RA7L 1A6TB 4JB9H 2M8XA 3C09C 4FRWA 4JRYA 4RRPA 2ICWJ 5DWUL 5EWIH 1HHKA 5I8CB 2BSRA 3ABZA 2MQ3A 1YC7A 1X3DA 1OARH 3D9AL 4PBVC 1MHEA 1Q0YL 5HYSG 3OXRB 3LRHA 2WK2A 4QOKE 4R8WL 1KCRH 3D25A 5I2IA 1F58L 3HMWH 5DR5L 5TFSL 1AO7E 2NW2A 4EI6A 4Q9RH 2YD2A 1EA9C 5JZ7C 4GKZA 1RIHH 2HT3D 3HCVA 3I6KB 5BZDA 3GJFA 2NY0D 3CX2A 1CFBA 2IJ0C 2NY4D 4O2CB 2IALA 4KKBC 3MNZB 2VDQL 4R3SA 4TTGA 1KGCE 3ULVF 2Q8AH 3SKMB 5KOVC 5KS9E 1FL3A 2R4RL 3QIBA 3WFZA 5KSVA 2AK4E 3FONA 5BRZD 2ESVA 1CYGA 3CFKB 1AFVH 3U7YL 1HSAA 4YHIB 2R4SL 3QZWB 4JFED 4ONHB 4KU1A 2DWDA 1WV7T 3JVGC 2FIKB 2E7BA 4G3YH 3P9MA 2FYYA 3VG0L 1NC4B 3U79A 4KK9C 3FB5B 1LK3L 4UMGA 4HEPG 1J1OL 5K59F 1A5FL 3ULUH 2BXZA 4TRPL 3RX7A 3BSZL 1ORSB 4LMQI 5DTFA 2VAAA 2QQKL 4MA7H 4PLNC 3ULUL 2BNRA 3HMXA 3TBYB 2R0KH 3UBXA 1YEDA 5GZOD 4HX1B 5DHYA 4P23D 4M02A 4LCCA 1CFQB 5ACMA 1ND0B 4RGND 5I1EH 2VIRA 4L3EA 5GRVK 3WN5C 5I1IH 3VXMD 1K5NA 3FTGA 4IHOB 5GSRB 1S5HB 5DZNA 3OWEA 1CIUA 1J12A 2WIMA 3TO2A 5AYUL 5IMMB 5JQHC 4KKAC 3ZDZF 1JRHL 3O6FB 2VLJE 3S36L 1SM3L 4GG6F 4G6MH 1A7PH 1NAMH 1AIFB 4WTZA 4L4VE 1KB5B 3QDHA 4KUCD 3BP5B 1PKQE 1FNGB 4YR6A 5IEHB 1PZ5B 4EEEA 4WHCA 4QF1A 1T22A 1QP1A 3BIKB 1DCLA 3KPSB 3CSYA 5CZKA 2H45A 3LH2H 4PGDB 4EDWH 3OJDA 3BPCA 5KSAD 4RNRA 1R6VA 1KB5H 2GTWA 4JDVA 4NKQB 2ATPA 4FQIH 3FQTA 4FFWD 9CGTA 4GRLD 3FRPG 3UCRA 1L7TL 5LCVH 3I6LD 3MRNB 4MQTB 1LO4H 4K7PX 5C6WH 1BOGB 1PQZB 5D1QB 4FMFA 4NM4H 4KK8C 3ECBA 2GCYB 1AO7B 4X6DB 3VWJB 1VFBB 4A2LA 5EUKA 1QNZH 4IRJA 3KYOB 5EUOA 2VWEC 4BQ6A 1HXYA 1RI8A 1FFNA 3WEXA 3STBA 5D7IA 3GO1H 4I2XB 3FB7A 1NJ9A 3HNTH 2X4QA 4G8FB 1TZGH 1K2DB 2A0LC 1BFTA 4JB9L 4X0KB 3MUGA 5DD5H 3AS1A 2FIKA 3GZKA 5CKAA 3RIFK 4X4MA 1GL4B 3RWDB 2LQRA 1EZVY 5A2KH 2VC2L 5LGJB 1T0NB 3PDDA 1KLUA 3NIFF 2JCCF 3PV6B 2FX8L 4FQLH 1I7RB 2VERN 2D4FA 1ZT4A 4Z95L 4G5ZH 4Z77B 2EIEA 1JHTA 3C5ZB 4Z7UA 5F9JB 1EFXD 3A0OA 4MD5A 4JVWA 5IMOB 4UBDC 2K7QA 3BQUC 2AQ1A 1G7PA 3UTZA 3ARVA 5ID0A 2A1WH 4Y4HA 1DBBL 3DXAD 2GT9B 1NCTA 2M26A 4Y2DD 1S9WA 1X4ZA 2VZSA 5KW9H 1A6ZA 3IB4A 5T3ZH 1S7QA 5DI8A 3U2SA 1UZ6F 4JRYB 4P99A 4Y16D 2V7NA 4NUGH 1NGZB 5DJDB 8FABA 1Z0NA 5IMMA 5JW3L 2R2BA 5DQ9A 4LPUA 2DN7A 4KROD 4RZCA 4MJ6A 4M43L 5LQBL 1TJGH 4IMKC 3K8MA 3ZHLA 3P9WB 4R26H 3NZHH 3BUYB 3B9VA 5D2NB 3WJJA 1I9JL 4KROB 4HWBL 3TA3C 4ODUA 3MREA 1YY8B 3BIKA 3MRJA 3KPPB 2DBJA 1QBLL 5DFTA 2VNCA 2LV4A 2XN9E 1NKRA 1GPOL 4QT5B 1M7IA 1J0ZA 2W65A 4Z6AT 2ATKA 3P77B 2YA1A 5C0JA 5EU6D 1OTTC 4X99B 2QHRH 4JDVB 4OZIF 5F9AC 1FYHB 3BFOA 3AMLA 4GRWE 3ILQD 3OJMB 5DJXA 2CUIA 3UTTD 1QSEE 3QI9D 4FQ2H 1KT2A 3HZMA 1HI6B 3FO0H 5I1LA 1UWGL 4XXDB 3CDCA 4JGMA 5C2BH 1ADQA 1FIEA 3FO0L 5DEGA 4U3CA 5IQ9A 4ZO6A 4HHAB 3HNVH 4LPTA 4MB4A 3VH8B 5FDYA 1KCVL 3KPRA 5IR1A 1J1OH 3QHZL 1BF8A 1G6RA 1Q9LA 3MBXH 3PDGA 4LSRL 5F9WC 1JIBA 2VDNL 2FHBA 2BMKB 5EZLB 2VXQH 3RNQB 4ACPA 4K7PY 3MUJA 2MHAA 4MNGA 1Y0LA 4OFKA 3MA9L 1HINL 4ZQKB 5DC4B 4IMKA 1J0HA 2R8SH 2HLAA 4AG4H 1ZLWH 3MYZA 4M6MH 2MCG1 1YC8A 4IRZL 1V7NL 2HLFD 3SDDD 3QIWA 4HF5H 3MGOA 1G7QA 3IETA 3HC0B 1NBVL 2CIKB 2GJJA 5HGDB 1NBZA 3LS5L 2HJKB 3UBXB 4JM4H 2HA1A 4NM8L 25C8H 5I1DA 1SJEB 4KRNA 4S1SL 1RUML 3C08L 4MAUH 3MJGX 2AP2A 4ZYKB 3S3SA 3BP7B 4YUEL 5EA0L 1JGUL 2JCCA 4QHMA 1RAMA 4LAQL 4LEOA 4KZEH 2PUQT 5JMOC 5C0ND 1CXHA 1UEMA 3F6LA 3QCUL 5JHLL 1FO0B 2C3WA 1X6NA 1NSNL 1EX0A 4OV5B 4LVNB 5IW1B 2BNUB 1FC1A 4RX4A 4WRLA 3U7WH 1MHHB 1T3FB 3KPNA 3B2VL 2OJZH 4R2GB 1Q9WA 1MWAA 2D9QB 32C2A 1AXIB 1BREA 1M6OB 1NFDB 4P2OB 3VXNB 2QKIA 1MY7A 4JFOA 1CICA 3IFPA 3P30H 1UM5H 2DJSA 5K9JL 4NZRL 1RPQA 5I17B 2WLYA 5DS8A 5KANG 5BZWB 5A16B 5E8OB 1G9MH 4M5YL 4WY7H 4ODBD 4PGJA 1FGNH 2ATKB 1RZJL 4Q0XH 4QCIB 4DFIA 5FAAA 3SDXF 3PGFH 3CX5K 3VXSA 3U4BL 5D96B 3GGWB 3ECBB 2BCKA 4NHCL 2EIBA 2WBWB 3EFDL 1JNJA 3MUY1 3LIZH 1CFNB 5LXGH 1AH1A 4TSBH 3MRCA 4PJAA 5CP3A 1GZPB 1J7VR 1WAAE 5SWZE 2R1XB 5IG7A 4G5ZL 1YPZE 3R06A 3S98A 4Y5VA 1PLGH 5FHBL 1NANI 1Y6MR 1W0WB 4BSVB 1JTOA 4X0KA 4JM2F 4LLWA 2H32A 3T2QA 3K4AA 3QIBB 3WFDL 5TF1H 2ADFH 2R56H 3GBLA 4MZ2A 3MFFA 3CXDL 2ID5A 3CFKA 3I2CH 1F3DJ 1YY9C 4F58L 2E27L 5IVZA 4XPAH 3OR6B 5L8KB 1N4XL 2CLVA 2JJVA 2BVTA 5T3XH 3PWPA 3DYPA 4N0YH 6FABL 2B1AH 2CIKA 4DCQB 2C3HA 4JO4H 5H37G 5BS0A 4QO1A 1AD0A 3MRKA 5C3LD 4RMWA 4OFPA 2HAZA 4XNYH 5JW4M 2F54E 5E56A 3BDXA 3QA3B 3VXSE 2V7NB 4X6DE 3PGFL 3LN4A 4JY6B 3TBSA 4G8GE 4IM8A 4HIJA 5CMAA 3KXFB 3MRLB 3QCVH 4UAOC 1S7VB 1EAJA 1ORQB 2V2TB 1F4HA 1HHHB 5KS9A 3QUZB 1I4FB 5D2LA 2VDML 3U9UA 2ZUXA 3UAJC 2B2XH 5JNYA 3JVGA 2RCSH 3MR9A 5E2TL 4OI8A 2Z9TA 4LRIA 3TLRA 3MYJA 5EZOL 4MMXC 5ISZE 4FMKA 3QUMB 5C0JB 5DJYA 2JJTC 1KIRB 1H5BA 3H9SB 5AZ2H 3MRGB 4XMLL 4QRSB 3IGAA 3H9HA 1AQKH 3N85H 1ZEAL 5D1ZA 4I3SH 4OUUB 4I3GA 4OCYH 3TV3L 3QFDB 4L4TD 3BGMA 1U3HD 1R3HB 1Q1JL 3RVXD 4N0UE 3E6FB 1T89A 3ZDXF 5GS2D 2O5ZL 5T33H 1TDQA 5FYKD 4OIIL 2Z93A 3RRQA 1HYSD 2VUYA 1F3JA 1J8HB 3N1PC 3TJHC 4Y5YA 2OTUA 1SBSL 3PJSB 4HK3J 4J4PD 4XPFL 4PJ8A 1HIMH 3LKOA 2HT4C 1UZ8B 4JZNB 3VD9A 2GITA 3HG1B 2DJ4A 5F7YC 4EIGB 5DI8B 3CVIH 5BS0E 3AXLB 2HP4A 1UB5B 4FQJH 2ADGA 4KJYA 3QEHA 1CGXA 1MPAL 3SJVA 1KN2H 4L4VA 2FO4A 4C57C 5D70L 4BKLA 5INDB 3K81A 2XIDA 3T4YA 2GEEA 4OD1L 4N5ED 5IB5B 3UJTH 4UV7L 2YN5A 1MAMH 1BEYH 5MHSE 2C9AA 4NBXB 3VGAB 2GUOA 4QKXB 2CDFA 1B2WL 2AV7A 3WE6A 5AZEL 1IAIH 4HG4K 3IJHA 4PUBH 3G6JF 4PJCA 1SJVA 4WFGE 2P5EE 5E03A 3TJEL 1C16B 2EDNA 1VADB 2NY4C 3VRJA 1B0RB 3KPLB 2Q3ZA 3NFNB 3L5HA 3I3BA 5ANME 3S4SG 4CU6A 1S7QB 5EU7C 3NTCH 3O2DA 4JPKL 1LO5A 4XNMB 4NJ9L 3WJJC 4YHOH 4XNXH 4ZSOA 1JMXA 4YFLF 1KYOK 4HS6B 3SGJA 3DUHA 3EYOA 1GGTA 4PJXE 2GYSA 1U8LA 5E8OA 5JOPD 4JCLA 4QHNB 1IILE 4IOIA 3V5DA 5DHVA 3MXVL 1RD6A 4H8WL 4R7DB 3GKWH 2B2XL 3KNBA 4XB7A 1IE5A 4PLOB 4WTWA 4X6EB 5E9DD 3BP6B 3HZKB 4PJFA 4KI5E 1N5AA 4LASH 2Y25A 1WBXA 1IEAB 4F15C 1CLZL 3N06B 4Y4HC 5CP3H 4BZ2L 4FXKB 5IHZB 4CRPA 1UZ6E 3ZYIA 3GSNB 1PZUB 4RSVA 2ARWA 4H20H 2IALB 4TOYL 1T1ZB 4WIQA 4LSQL 4XZUB 1NFDF 4UU9A 1OL0A 4PTUA 3CVHH 4K9EC 1BVKB 3L1OH 1MRFH 1TJHH 3EO0A 1NCAH 3GIVB 1T7VA 2O93L 1NEZG 4OQTA 3QQ4A 2Z8RA 5JOPE 2ENYA 5KVDH 1P7QD 1G7IA 1AC0A 4U6TA 5C6TL 4NKIH 4P3DA 2N56A 5IMKA 2NY6C 4K94L 4M8QB 3OAZK 4NC1C 1A1OA 1BQHA 1TZHB 1FYTD 4YHZH 3T2NL 3HKFA 3QT2A 4ZDHB 3DI3B 3KPQA 4K7FA 4XPGL 5FYJD 4IRSB 4LBEA 3U6RA 1CICB 1D6EB 3RPIB 4OZ4A 5HGHA 5FB8B 1NL0L 4L8DB 4FQHA 4OF5A 4PJ9B 4OJFH 4ZPVB 1NCWL 3QWRD 4ODTH 4CGTA 1BQUA 2HWZL 1H9VA 1ZT1A 4DK6A 4D94A 4LVHB 4KY1L 4IDLA 2VWEE 1A0QL 4R7NA 2FB4L 1S9KC 4YGVA 2X1PA 5D6DA 2ZSVB 3O3AA 1K5NB 2YUXA 2AKRA 4YDKH 3O4LA 1KJMB 5D2NE 2JLLA 5D2NC 3F65A 1MCPL 1BX2A 1LQSR 3PL6C 1KIRA 1KB5L 2GFBB 1PQZA 3LEXB 1MRDL 1P84K 4PJGA 4F7CB 1KB5A 3ZO0A 4EI5A 1ZA6A 5B3NA 4NPYB 2Y1VA 2QEJA 4MA8H 2P8LB 5DVMA 1TIUA 1UH3A 4X4YA 3WN5A 1GVIA 4NYLA 3NIDF 4DGVH 2PN5A 2YEZA 1OAYL 3UTTB 2FD6H 4UDTA 2X4PA 4R90H 1F6AA 2G2RA 3DRTA 3IT8D 4D9QE 4CVZB 1VGEH 3RKDC 1AGFA 2CRMA 4ODTL 2OJZL 2AGJL 3SEPA 1MCKA 3KLAA 4JLRB 2GSIB 3MV11 2VKWA 3O11B 4Y2DC 5GSVA 2X4SB 4U1MA 1LO2H 3MV7B 4N8PA 3O41A 4J3TA 4JKWA 5FA3B 2HKHL 1EMTH 3AREC 4XPBH 15C8L 3UROR 3CFCL 1OM3L 3GFUA 4E0RA 1TJIH 1OLLA 1FNFA 4Y4FB 2VLRE 3L7FB 1HXMA 3L3KB 2AJYL 4MQ7B 2HKFH 3MBEB 4U49A 3P0YH 1HEZB 3V6OE 4DUXA 2P49B 4ZO8A 1RZ8A 3EYFA 5DFVD 2WINA 1OSZA 5E6ID 3VFSB 4UBDD 3VFNA 5J9PB 1IGTA 1KCSL 1MLCB 5D1XC 1A6WL 4DVBA 1YEGL 2IBBA 2NY5C 3GBMH 5EOTB 4JO2L 4WDIB 2BOBA 5ESQB 2P48B 1JRHI 5BV7H 4WFHD 3OKKB 1NH6A 2W0FB 1HHKB 2ILLA 1KEGH 4LIQH 4U1HA 5HHQB 2NX5D 2Q7YB 1S7SB 2VDQH 43CAB 3VRJB 5IVNA 3Q6FB 4LHUA 2EKSB 2AABH 4P48A 4AQOA 3SE8H 1SBBA 5FA4B 3A67H 2AABL 4HLJA 4MCYB 2IH1B 3G04B 3DBXA 5JHDE 4UV7H 4TULL 3WFBL 1IEBA 5HDQH 4HUWB 1JNHA 1XGTB 5C92A 4D9QD 1CGTA 3L3HB 5IQ7L 1FSKC 3OJVC 2EDJA 3I84A 3T2PA 3T4AB 4JRXB 3ARZA 3RZCA 1AD9B 3U4EA 2W0PA 1RIVH 4C59B 2AJVH 4PJFF 3AFLA 5FV1L 3MRJB 1WF5A 4UZGA 1OAKL 2IMMA 2WNGA 2E7LC 5HJ3B 5EB9A 3QCTL 3DGGA 1FIGL 3MRGA 4KJPC 5B3JF 3WIHL 5L88L 2ADIB 4NN5C 4G6JH 5J11C 2OP4L 3UYOD 3IDYC 1BJ8A 1OAQL 1IAKB 4XTRD 4APQB 1XIWD 4PLKC 1C08B 2FECL 5BXFB 4UT9H 4P4KA 5MP6H 1I3VA 3CPLB 2EDEA 5GS1B 4I48B 4XX1G 1JNNH 1M05B 4RBPK 1Q94A 2CRYA 2GK2A 4I77L 3ZE0F 4RCAA 2CDFB 5DEFB 1ES0A 3TZVD 3WLWD 3C8HA 6CGTA 1NC2B 2R1WB 3PP3H 5DLMH 3V7AE 1OLZA 3HI6H 2OI9B 4HULB 4M6ML 3MNWA 2E9BA 3G5ZA 1ORSA 1JPST 1RUPH 1RUKL 1P5VA 3C8KA 5FV2A 3J8F7 5SWQB 1YEJL 2D2OA 3G5XB 2X42A 1QZ1A 5KBNC 1MFNA 3TBTB 5H94B 1FZOB 3IDIB 3QUYB 1FL5B 3ZE1F 4Z7QF 5CUSH 1QQDB 5HBBA 3BDYL 4YO0B 5GPRA 1N6QH 4EBQH 4ZNCD 1AXSA 1JK8B 4G9FE 4NNYA 2A6JB 3DSNA 2C3GA 3MRQA 3NCFB 3BD5A 1YECH 5DRZA 1AO7D 1JPFA 1BM3L 1ZHLA 3SDAA 3VFOA 4LLVB 2MFNA 4PJHE 4QRUA 5C3TA 1PEZA 5GS0D 3D3VA 1EHLH 4KTDL 2Q1EA 4LEXL 4YHPB 5CLWA 1QTYT 1TPXB 1CFSB 1FP5A 1P7QB 4X6EA 1V3JA 3UTPE 3E0GA 1D5IL 3GSQA 1CDBA 4LSTL 4QHUA 3TT1L 2XWTB 3EDDA 3HUJE 1RU9L 4U1IA 1JHKL 4RNRB 1HNGA 4JFDB 4JJ5B 3GSWA 3T1FB 4OZGB 1FDLL 1T7ZA 4U6HB 3DX7A 2BCKB 4TSAL 3X3FH 5I30H 2ZUTA 3R8BB 1YNTB 1J8HD 2BC4A 3PHSA 3LAFA 1FFPA 2DKMA 4JFFB 1EUUA 1CE1L 1CK0H 2IAMD 1YY8A 1KELH 2BSSA 3C60D 1R3IL 5EU7E 1MJ8H 4KRPD 1SEBA 4Y5XC 5DS8B 1YJDH 4OSUH 1UB6A 3FFDA 5DJAB 4QGYA 5E08H 1JGDB 1FNGA 3BDYH 2X89D 2FX7L 1JFQH 1OF2A 3RGVB 2ZOKB 3EDJA 4CNIA 1ZT7A 2ADFL 1CGWA 2UV3A 1GOHA 1IGML 5E9DB 2VUOA 1SYSB 5CJQH 4XBEL 4KPHL 1DQDH 1U8QA 1T89C 4OZ4B 5HGHB 3V7AG 4MXWL 4OF6A 4RMRA 3NA9L 1FORL 4XPTH 2APXA 1T1ZA 3MNWB 3QDMD 3P11H 1KCKA 1U6AH 4K3JL 5B8CB 3RIFF 5D7JC 1CXFA 3ZE2F 5C09B 3QG7H 5CJ5A 2BHUA 4ZSOE 4RWYL 1BAFL 2LAAA 2YXFA 3N0PB 4NN5B 4QXWA 1EEZB 1QFWI 3MLWH 4K94C 4NM8H 4ONHA 5EU5A 5LGHL 4NNYB 4WY7L 5CSBA 4OCXL 5DQ9B 2JE8A 1ITCA 1MEXL 1WAAF 4X6CE 1BZ7B 4PP1D 2EKSA 4NCC2 7FABH 4NJ9H 4F7EB 1MFDL 3I75A 4QYOA 4IRSA 4LBEB 3D18B 3D0LB 4CMMA 1NCAL 3SDYL 5KJRL 2E9WA 2MKWA 3AB0C 4XVUC 2Q7NA 4UT9L 3SKNB 4OZHB 4TNWF 2WQ8A 4E41A 1RULL 3TIDA 5I1CH 1A7NL 1A5FH 3R0NA 4WFEE 4PY7B 4M9PA 3SCMB 2ZCHL 2FX9L 4GRLC 5KANI 1D5XB 5DRWB 3PIQB 3KPOB 4U6HA 2NR6C 1KB9J 2XQBL 1R5VB 3LS4L 5DUPH 1OB1A 1IT9H 3LPFA 3VRLE 2QL1A 4OLVL 1NAKL 2Z8SA 2DMBA 3WYRA 3BKYL 1AKJA 1INEH 3MLRL 5EORH 2J5LB 2EZ0D 3FT4A 1CU4H 3OAYK 4EN3A 2G9HA 4GRMA 2NX5E 2GSGA 2EO1A 3MLRH 3LB6C 4IDJL 3PL6A 1YZZA 5F1IA 7FABL 3FRPA 1S5IH 5D2NA 3ZHKA 5GJTH 4FQXD 2UWEE 5TE4L 3B8YA 1KCUH 1KJ3H 4N90D 3KPTA 3SE9H 3TO4A 2E7HA 2DQCH 2X4PB 3GKZA 3GMRA 1S78C 4WEUD 1U8MB 4NQED 3OJDB 2KKQA 25C8L 4L3CA 1W0VB 2FSEB 4Y5VC 1DP0A 1S7RB 2ICES 3FQTB 1NGYB 2NXZB 4OB5L 5CEXB 4FOMA 4TQEH 1KPRB 4OT1H 5MENE 2WIIA 3CNKA 4HKJB 3RL2B 3V0VA 1PYWB 2CMRH 1K4CB 3SE3C 4V1DA 3VGBA 1RIHL 1C5DB 1QSZA 2NLJA 4HJ0D 4Y5XB 5ACLA 1CU4L 4JZNA 4YFDB 2YWZA 4KDTC 4NC2B 4B0MM 1NJ9B 4XCNA 2VLJD 2WAHA 4LKXB 4LLDA 2DQGL 5CZXD 2ITCB 1EBPA 3QEGL 3VGHA 3H3KA 4XNZB 4NRZB 5FYJU 1UA6H 3RVTC 1WWWX 1FZJB 3M45A 1YDPA 4PRID 5HXMA 5TF0A 2J8HA 3QNYA 1MIMH 1JGEA 3HE7A 4JKPL 4NC0B 4GQ9L 4X98B 5FUZL 1S7SA 4UB0H 1TVDA 2V17L 3OKEB 1HDMB 1X5YA 4MNQD 4WO4B 4MHHG 1AY1L 2G5BB 5E00A 5C0AB 3V7MA 3OZ9H 2C5DC 3KXFA 4U6VH 1T22B 3OMZA 3P4NA 4MGXA 4NQSA 4Y16B 4U1JA 4LSDA 4YE4H 1U58B 2MQCA 1FV1A 2EDWA 3WFHA 3QPQD 4QRRE 4EQ2A 2PYFA 1PSKH 1JWMA 1LEGA 4PS4H 1FE8H 2ZWLT 2UY7A 1HN1A 4NRXB 4S1QL 3KYKL 5F7WC 5LBSL 2P8MA 4LLQA 3DO7A 3MZGB 2CDGA 4HXAL 1H3WM 4ETYA 5E5RB 3VWKB 1F2XK 4AMKH 2X4OA 3B9AA 2WBJA 4PJAB 4JVUA 2R0ZH 1M7DA 3RPKA 1OSPH 4WHTB 3UJJH 4NO0B 3SGJC 2QSCL 1ERNA 4H0IA 4IJ3B 2CK2A 1ACZA 3BZEA 2KQMA 4NN6C 2V2WB 4RFNC 1FAKT 1H0DB 3E6HB 4NQDA 4CVXA 5IB4A 4HWBA 3EO9L 2ZCLL 5ICXA 5FYJH 1NGYA 5F7NC 5I74B 1M05A 1IGYA 1WWCA 1INDH 1X5ZA 3DX9A 1RVFH 4KKNA 5BS0B 1DN0B 4RBPH 2VITA 3T04D 5E8NA 1MQKL 2EH8H 4J1UA 3MLZL 4O02H 4JFPB 3B9EA 5HI3D 1G7HA 3LN9A 2F53A 4HWNA 5E8PB 4LVOC 5I75C 3MXWH 2DLIA 4F58H 5MEND 1YEFL 3MJ9A 4CVUA 3T08A 2P46B 1K4DB 4LLDB 3SKOA 4JY6A 1G7JA 5E2JA 1S7TB 1F45A 1X5GA 5FM5M 3S97C 1F4XL 2YBRA 3TA3A 4Z18A 4M8VA 3DX7B 4MB3A 1X7QA 5KZCD 5J8OA 2UWEF 2WBKA 4S1DC 1I7UB 3MRHB 4LQFH 4Y5YC 5EOCH 1CE6B 5LVEA 3NCJH 4WUUB 2BRRH 5HHVL 3FT2A 3EOYG 2OSLB 1MCJA 2GW5A 4G42A 5H2BA 1GSMA 4PJXF 4Z0BH 3O2DL 2VE6B 1ZHNA 3BPCB 1YN7A 4A6YL 4NUJB 1BIIB 3FKUS 4LLUA 1XIWB 3FT3B 4YHOL 3MCKA 3SDDB 3UC0H 3VXUA 5BW7A 5GZNC 5HGBB 4OB5H 1JTPA 3G5YB 4U6YA 5E6YA 3ARDA 5MEOA 1UC6A 3L5IA 4G9DA 3O6KL 4NHCH 4YGVB 3REVB 3RDTC 3BQUA 4J12A 1KULA 4L8BA 3O4LB 3D3VE 4TVPL 4XNZC 5EUOB 2UWEB 3ARFB 4HPOH 1WEJL 4LF3B 2JJTA 4GG6E 3O11A 1I9RL 1KLGA 3QXTA 3ULVH 1E4KA 3NN8B 2NXZD 1EO7A 3UTSB 3ILQC 1N2RA 4XNUH 1QKZH 1XCQB 4FQCL 5CINH 4X6CB 1UA6L 3MNVB 5I1EL 2GJ6D 5T1MB 1N5YH 1CVSC 4C83A 1RMFH 4GBXD 1W2KT 3LOWA 3MRIB 5F97E 4M1DH 1BMGA 1MCOL 3IFNH 4NWUL 4QRSA 5TGBA 2RAMA 1D3CA 2YS4A 1JWSA 4LLYB 3C08H 4MAUL 1FAIL 4ZO7A 4ZS7H 1RZKL 2X4SA 4U1MB 5BVJA 4EVNB 3H3BC 3K2UH 1NCUA 4WWKB 4HC1L 3FB8A 5GJTL 3RVWC 3PDOA 1QVOA 1RZKH 3BZ4B 3T77A 1Z5LB 3E6FA 3UEZA 3LPWA 1LNUB 4ZAKB 3VE0A 4LKXA 4NO2B 1A4JB 1KPVB 5HYJA 5HY9B 4GUPB 3I6GB 4IJ3C 1A4KA 4LIQL 1KIPB 3KPSD 2C4FU 1JPSL 3FFCB 1WZ1H 4QHMB 3HMXL 5C0AD 1U8OB 1GGIH 4PD4J 5AZ2L 5KSAB 5FYJE 1F4WL 1V7MH 2OMNA 4HIEA 5HHOD 4P5MA 1TNMA 5MEQA 4HUWA 4LRNH 3V6ZA 5GS3A 3DVGA 1P7KA 5C0AE 5E4EC 5F7LB 4BH8B 5AUMB 1PX4A 2C1OA 2UYLA 2OLDA 4X80H 1PGRB 2EXYD 1JZ6A 4QYOB 1P84J 1CDIA 1PG7X 5HVFB 3HPLA 1LE5A 2IEPA 3MRKB 2W07A 2UZIH 1B2WH 4JFDE 4Z7WF 2Z4QA 2JJSA 4K7PL 1T21A 4L8CA 2NW2B 4EI6B 5HJ3A 5CIPA 4XAKE 5GISH 5GGUB 4QOKD 1D9KB 4L29B 5DUBA 5FOJA 5IJKA 2VDRL 4L8BB 4LNRB 2J4WL 4XP5H 4YPJA 1II4E 4M48L 4QRTB 1A7QH 3LVEA 4HIJB 2Y36L 3V8OA 1G6RB 3CVIL 3B8SA 4MA8L 4Z76B 4I0PB 3NBNA 3RWFA 1B3JA 3GSVA 1A6VL 4PV8A 4NCC1 4PG2C 1N7ML 5IF0B 4P2CG 3RJDA 1CFNA 3BO8B 3R8QA 5D93B 1EH9A 5JW4R 4OFIA 3MOBH 3P11L 2DD8H 4P3CL 4OF7A 3V5DB 1OD9A 1I9RH 1E4KC 2VKXA 4JY5L 1UXSB 3C5SB 1UWXK 2AVGA 1XGUA 3TO4B 3MFFB 2AK4A 3QIBC 1WFUA 5E70A 4Z7QE 4AEHL 5DSCB 3ARDC 3TPUA 2PYEB 2UVFA 2ESVE 4JO3H 3CFEB 2H2PD 5BW7C 3S35L 3MV8B 2FJFA 4GW5B 3HB3C 3HUJB 3O9WC 2X9WA 3L5WA 4NO2A 3QUXC 1FLTX 1JYVA 2WINB 1AC6A 3OQ3B 2E3VA 3EFDH 4PIRF 5JOEA 3TNMA 3FTGB 2Y06H 4GG8B 4GAJL 3IDIA 5JLZB 2Q20A 3U7AA 2RJMA 5DGRA 3BEWB 4ONGH 3EYVA 2C7UB 3U1SL 2J6EA 5M94B 5IFJB 4JKMA 3TN0D 4PRHB 3P4MA 4JKLA 4K94H 1YA5A 1A6UH 2NY3B 1HQ4B 3EOTL 1XMWA 1DEDA 2XWBA 1NDGB 1IFHH 4OFVA 3HUJF 5IBUB 1JGEB 3HE7B 4WHTA 3X17A 4GSDL 4R96A 5AYUH 2VR5A 4JQXA 4L4TB 1JNLH 2IH1A 2PW2A 1XF4B 4AZ8A 2VLLA 1T21B 1N0LA 1BQHG 4ZUUA 4PJCB 4QRPD 1UEYA 3M1BB 2APFA 2OTWA 3MRPA 4RAVA 4KRPC 3FN0H 2Y23A 5FKAB 2J5LC 2YKLH 2OX5A 5HYQA 1NGWA 1VENA 4FN0A 3T0ED 1ND0A 3Q0HA 3VFVB 4V1DE 4OD3L 2I60L 4EDWL 4LHQB 3WS3A 3RZCB 1A14H 1IGJB 4FQQB 5DJ6B 1HNFA 5BO1L 3UYRL 4KV5E 4PJIF 4J1UB 4G6JL 2EH7H 3BHBA 4FZEL 4LK4A 3I50L 1CXKA 2CKBA 4M7KL 3RL1B 1WFOA 1SVCP 1JF5A 1RSFA 4N0UB 1F42A 2WBJC 2CMRL 1A6WH 1GAFH 4APQA 3PHOB 5ALBL 5D2LE 1MF2L 2PO6B 3E8UH 3JWDC 4Y1AD 1FE8L 4DCQA 4Y19B 2YBRB 1HYSC 3ET9F 4HKXA 4GXUM 3MQIA 4OGAD 4NQDB 2R0KL 4LLMA 5LKNA 4DQOH 2DIAA 3BVNB 4D9LL 3P73B 1ES0B 2BVPB 2YPKB 5CCKH 5TDNA 1QRNE 1T2JA 5TJWK 4HD9A 3KLAB 3FFCE 3CH1A 3MLVL 1MJJB 3QRGH 4X6FB 1VFAB 2D0HA 1LDPH 1BECA 4CW1B 3A67L 4P2RD 3MGAA 4QY8A 1UVQB 3RJQB 2FR4B 2BNQA 4FP8L 1H15B 1C5CH 1YN7B 3BH8B 3GB7A 3FMGL 1RK0A 1IL1B 1FZOA 3PF2A 4JFPA 3MCKB 3KYAA 1RUMH 4AEIH 3P4LA 4P4KC 3WLBA 1YJDC 3G6AA 2XZZA 1BZ9B 5FDWB 4M1CD 4XVUD 1FIGH 3QDGD 5D7IE 3LB6D 1T6VN 3IDGA 4QWWD 3P4MB 5BV7L 1G7LA 1MCNA 3VJ6A 4R3SB 1X7QB 3O4OB 1HQ4A 3TWCL 3W9EA 1AGCB 3MX0A 4QRUB 1EHNA 3RNKA 3BW9A 4IRJC 1QA9B 2B4CC 12E8H 2NPLX 4YWGH 4I0PD 4ZOBA 4ZXBC 1ZVSB 1XGRB 4X6CA 1N3NB 1KEMH 3BX7C 3MV9E 2B4CL 3QUXB 5AD0A 4L9LC 4P2QE 3ARPA 4HFUL 4ZPVA 2MOVA 4TUJB 1YMME 1Z9MA 5DK3A 2G5RA 1KT2B 4H26A 5DF0A 4MJ2A 4HXBL 4NQCD 5B4MD 1KYOJ 1R5IB 4ZNEE 4HZLA 5BVPH 4FTVE 4OAWA 3W0WE 1KUMA 4CBPA 3AS3A 1G0YR 2QHRL 4TNVK 3RDTB 4KQ4H 3BUTA 4YDVB 3ARGC 2VAAB 1YQ2A 3B9DA 5E5UB 5EZLA 2I07A 5GRUL 4Y1AB 3UZQA 4FS0A 2FBJH 4X4XB 3OTTA 4UIMB 3U0PB 1BFVH 2A77L 1J1PL 2EYSB 3NZ8A 4WI2A 1RZIB 3UYRH 5D1XA 5BRZE 5TE7L 4HGMA 2EE9A 3VD7A 1ZWIA 4H0HB 1MAKA 3JTTA 1GC1L 4F57H 4HMEA 2VLKD 2QADB 3DECA 3UDWC 4B5EA 1EIBA 1N7MH 2VDMH 1HHIA 3VFMB 4U0RC 3TH4T 2AV7B 3WE6B 3L5XL 1HHGA 5E5MB 3IXTA 4ZAKD 1PY9A 5I1CL 3L5WB 3H6JA 3DV4B 2AV1B 4GXVH 4PYGA 4AEFA 4YR6B 1CS6A 1FNEB 3C2SA 3AREA 5M95B 3BP7A 2VLMD 3BOVA 3EW3B 4HKJA 4Z7NF 5EO9A 1TETH 2CO6B 3GDBA 2OXGA 4YBQD 1E4JA 4IRSC 2J8UB 3LD8B 1SY6L 4KRLB 4ODSL 1T1WB 1C7TA 1MEXH 1XGYH 4FFZH 4GS7B 2F5AL 2ATPB 4K55A 4NGHH 4UV4H 5LWYL 4NZUL 4PJ9C 4U1IB 1ZT1B 1KTDA 1RJYB 1P2CB 2X4UB 4UV4L 5LWYH 3QCVL 4M61A 3DVGB 4PP2B 4LVHC 4KI5D 3MV01 4EI5C 1WT5C 2VABB 1DLHB 5C07B 1PZ5A 5KVDL 2RBLA 1LO4L 4PB0H 1FCCA 2NZ9D 5D7IB 3IDUA 4PG9A 4BFBD 1TPXC 1VFMA 3MJ8A 4JREB 4OCSH 2EDRA 4JFXB 4KVCH 4E5XA 1J1PH 4U1HB 3OKEA 3B2VH 3P0VH 5EH1A 4MJ5A 2LAGB 3ARGD 3MROB 5ETUA 1NGQH 2DQTH 3TNNA 4XAWL 3BGFC 4Z7VE 5L6YH 4NQVA 3I9GH 4XP9L 2FRGP 5D6DC 2PCPA 3CK0H 3UMTA 4NOBA 1MY5A 4QOKA 4NM4L 1HE7A 1LD9B 1YUHA 4YAQA 2ZOKA 4YFEA 4NFBA 2DIBA 1YEHL 1YEEH 3HS0A 4ZFFA 3CFEA 4UILL 3MV8A 3HNTL 4YDVA 3T65B 4DOHB 1EVTC 5C0CD 1L7IH 4YPGA 5EC2A 3K2UL 5E2VL 4G8FA 4YX2H 5ELIA 4R0LC 4QRRB 1S3KH 2JB6A 5CP7A 1Y6KR 5GGRA 5HHOA 2Q6WB 3DNKA 3UZVB 4H1LH 1J0JA 4JO2H 5HPMB 1RUAH 3BKML 1MI5A 1JP5A 4JAMA 1MFBH 4Y4FC 1PKOA 1UJ3A 4OQTL 4XP6H 3EO1A 5ABDE 3VFMA 4XNXL 3MBEC 3EHBD 4Y1AE 1OF2B 2XNAB 1LE9A 4MAYD 1MUJA 3MLTB 1A1NB 3NMEA 5HYJD 4V2BA 5CEYA 1XEDA 4QXTB 2D7NA 3BD4A 3OR7A 2D03H 5GZND 1U3ZA 5ICZB 4LCYB 1VA9A 4KTDH 1A7NH 3OPZL 2EC8A 3L5XH 3IF1B 3O81A 3MGTB 1BQLH 1I1RA 5K9OA 1OP3H 5B8CA 4BA8A 3D2UA 4D0DA 4HT1L 3AROA 5C0GB 5T5NG 2WW8A 5TDOB 3LS5H 4UT7H 4DUWA 2NXYD 4PRPD 2NTSP 3QXAB 4P46B 4DGYH 2B8OT 2YD4A 4ZOCA 1MI5D 3KHOA 1RIVL 3WXWH 1Z6JT 3FN3A 4CL7A 3CZFB 1HKFA 1UM4H 2ZG3A 3G5VA 4ODVH 1WC7A 3MCLH 3V0AC 4UUJB 5E2VH 3RUGF 3IKCA 4GH7B 4KMQA 1I1AD 5EO1A 1MHEB 3VI4F 3AU1B 1OARL 3D9AH 4IMLA 3S8WA 1JPFB 1ZHLB 2ICWA 4ELMF 4MDJB 3D85A 1Q0XL 2JK5B 1DUYB 4NUJA 4RWHA 4N8VG 4JLRA 1K6QL 3IFOB 1OP5H 4WCYL 3MCG1 5TFSH 4JE4B 5F7DB 1X5IA 4HKXB 3S36X 3SN6N 3CVHA 1EK3A 3S9DB 4NHUB 3UXFA 1OAQH 4HIXL 3LRSA 1FG2B 3GJFB 5DEZA 4YHYC 1K8IB 3BKCH 3DI2B 4S2SA 1T66D 3HPJB 1P4LB 1DBKL 3MBED 3LN5B 3N85L 3MBEA 5KTEH 5HHVH 4U6XB 3BD3A 1UJ3C 4XNYL 4FQQA 4KROC 4ZD3L 4TSCH 2N7AA 3LSOA 1S5IL 4W70A 4OUOA 3BZEB 3L3JA 2EDFA 3QAZC 1HINH 5C0DB 3RZCC 1LVEA 3NH7H 5EUOE 1I8LC 3VMOA 1NDMA 4FQPA 4PLJD 5I16A 5DFWH 1A4KB 5FYKE 1B9ZA 3D85D 4X6BB 3BJ91 3QXDA 1XF5A 1M1SA 1MHHA 1A1NA 4KKAD 1XFPA 3MRNA 3VA6A 3WD5L 3QUML 2VXTH 4G7YL 4OZFH 2MKLC 5I1DB 4WTZG 2PW1B 1FHGA 1KCRL 2RHEA 3OAUL 4XHQA 5F7HA 1OW0A 3H7BA 1R3HA 5DD6B 3RX5A 2A2QT 3BXNA 3T0DA 4MLIA 4YE4L 1S7WB 5HYEA 4U2ZA 1DVFC 3EFFB 3QNZA 4OLUH 4PRPA 5T3XD 2K3TA 1GC1C 1JZ2A 2DM2A 1RURL 1MLBB 1I8IB 4KMTH 2BY3A 2A6DA 3I9GL 3F5WB 5FUCE 4J2XA 3V0WL 5J3HD 3MSPA 4WUUE 2VLRB 1LO5B 5C0FB 4JPIA 2IAMB 3E1F1 3QJHB 3T3ME 4PP2A 4RMVA 3HG1A 4MCZB 5CEZD 4WHYH 3K4ZA 1D5BA 2B0SL 4YK4C 3TO2B 1I85C 4UIKL 1H5BC 1T04A 1WGOA 1QBBA 2EZ0C 2IC2A 1P1ZA 4RA3A 4DW2H 3QDJD 1E27B 2R69H 5DD5L 3S3PA 2IPTH 1DBAH 1QSFD 5SX4I 1UYWL 3FQUB 4OD3H 3RWFB 3DPBA 2AJYH 4K23L 4D0CB 1JZ3A 3QZWG 3ESUF 2R69L 1U8PA 4K71B 1LE5B 4PY8J 4UNUA 3T8XB 3ILPA 4GG6B 4WEBL 4I5BA 2BOCB 3QEQB 4ZXBB 5TQ2L 1DQDL 1VGKA 4Y4KB 4RISH 2Q86A 2NY0B 5J13C 1U9KA 4S1QH 4GLRH 2HVKA 3B9KB 5CJXC 1KOAA 4XNQA 3VDCA 3JV4B 2IANE 4ENEC 3RGVC 2E5EA 4PTUB 4MSWA 1KG0B 3MMEB 4X4ZA 1DR9A 2WZPD 3GRWH 4FXLA 3HUJA 1FL5A 1RZJH 4LFHD 4YDIH 3G08B 5GGQL 1SYVA 3P30L 1HSAB 3QJFB 4HGWB 1OTSD 3HE6A 3W0WA 4OM0L 3QEGH 4X99A 5J1TC 3MRLA 5C09A 4OF3A 4ISVB 4K8RD 3ARGA 4IDJH 1YPZF 1HH6A 2A6KA 2V5TA 5F21B 4PJBB 4F9PC 3IU4L 5DURD 4Q9QH 4PJGF 1AD0B 3ELAT 4XXDA 5CD5D 4KI5F 1EO8H 3EKCA 2CSPA 3QEUA 2FSEA 2XKNB 3VG9B 3RWJA 4WUUA 3SDXE 2ZP0T 3STZB 4YHKH 5HGAA 3GJFK 3QO1B 3RTQB 2EDDA 2HJLA 2Q8BL 4L9LA 4LAQH 3JBG7 1IM3B 3LS4H 5DUPL 3WL9A 4JFFE 4KHXH 3U0WL 3ZLQC 4M4PA 2BFVH 4D8PB 5HHMD 1H8OA 4MMZC 3EJZD 1WQVT 4BFEA 4H88L 1G9ML 3O3DA 4OKVA 3ARED 4APQD 4OM1L 1IJ9A 1NQBA 4WI8A 4ZUWB 3IAQA 3C5JA 5ESVA 3ZSSA