4MA8H

Crystal structure of mouse prion protein complexed with chlorpromazine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
b'QVQLQQSGTELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGSIDPSDSYTSHNEKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYFCSRSGYGYYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major prion protein
publication title Structural basis of prion inhibition by phenothiazine compounds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ma8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ma8H02
4PV8A 1JI2A 4X80L 1MPAL 2V9RA 4YHML 2Y9RT 1EGJA 3PDGA 5FYKL 2Q76A 5GGRY 4R90L 1RZGB 2XZQH 4YDJA 3UYOD 4OV6F 2DS4A 4Q74A 1ES0B 4K8RD 1WVZA 4OD3H 1AIFB 3DI2B 3HHRB 1KUMA 3O2DA 4RQQA 1F4XL 4PJAF 4Y4KA 4MMZC 3WHXB 1J11A 2YD2A 4YHOL 1XR8B 4QOKA 5TGBB 5C2UB 3P4LA 4JLRA 5E7BA 3X3GH 2IQ9L 3UCRA 5DZOA 3LN5A 5TE6H 1EJ6A 4NRYA 1I9IH 4HX1B 2A9NH 1MUJA 4L5FH 2NY5C 4DUXA 3TCLB 5LVEA 4DK6A 4UV4L 2MQCA 4HZAA 1KBGL 4QYOB 1FFOB 2DM7A 2FLBT 3HC0B 5KVFH 2DQIH 1P6FA 4KKBD 5AEAA 4FQPA 2GJZA 5EBMA 5TPWL 5C09D 3BRFA 1G9MC 2K3TA 4QHUA 4HIHA 2OBGA 1OCWH 1OT2A 3P9WB 2R2EB 2WP3T 5L0QB 1H5BA 1AR2A 4JFDA 1FDLL 4ZS7H 2EDKA 2R23B 5I74C 4P9MH 4FQ1H 5KJRL 2FATL 2FLRT 2GFBB 3RGVD 3ZYOA 1UXSB 4N5UA 4XPHH 5BMFL 2A0LC 2XWBB 2G60L 2X2YA 1QPPA 4PB0L 1ADQL 2EIZA 5F21B 1I1AD 1T6WA 3O4LE 1FL6A 2W9DL 2Z92B 4LVOB 4Q2ZB 2HFEB 4HAFA 5A2LH 3BI9X 5SX4I 2UVFA 4Z77B 1BECA 2OR7A 3GMLB 4FNLL 1T0MA 1H9VA 5FGBA 4E5XA 3NTCL 3G6AB 1U8LA 1CI5A 4PBVC 2MCG1 2IPKA 2BNQB 4NQCD 3H0TA 2Q1EA 3UTTE 4GKZB 3C87A 1F4WH 2VNCA 2RR3A 3N9GL 4LHUA 4U1NB 3IJSA 3R8BB 5EZOH 1VFBB 5I1DA 1R3HB 1FFNB 5L9DH 3OKMA 4RGNB 4OBRA 3TO4D 1ONQB 2EXWD 4V1DA 1HILB 1WWBX 1X6NA 2GTWA 4GFTB 1KEGL 4YHYC 1NFDE 3H3PH 3F7VA 2YRZA 3CSPA 3QO0A 3V0WL 1Q9OA 3RWDA 2UYLA 5DMKA 2P5WA 3SKNA 5HYFA 3BESR 1YEHH 1NCTA 3H7BA 4CVWA 1ZA3B 3QUYC 4X7EC 1GGIL 2YR3A 2B1HH 1QFHA 2J1KA 3GBLA 2YUWA 2G75A 3F12A 1NUDA 4DN4H 3RVUD 4MYWB 1U3ZA 1HI6A 3PDOB 3B9AA 5I75C 3VI3E 1NAMA 4U0RC 5D5MB 1YMME 1IGIL 4WHYH 1XCTA 3LEVL 3MA9L 4WHCA 4JO2H 4P3CH 1IGJB 1NANI 5HHMD 5F97E 1AGEA 3IDYB 4UIKH 5DJ0B 5D6CB 1JNLH 4LHUG 1S3KH 3O3BB 3R1GH 3TZVD 4EI5B 2V5YA 4U6YB 5I71C 3M8OH 4I2XA 5F1NA 4J3SA 4G9FB 3E6HB 3FOMB 3IDXL 3V0VA 3C5ZA 1UACH 4YUEL 2FJGA 1JPGA 3TPUB 3QT2A 4EEEA 4MDJB 2CDFB 3B83A 1WFNA 4JREC 4OUOA 5GGSA 1G7LA 1VB9A 1W72H 4PRIA 1GH7A 5ERWA 5F96H 3NPSC 2VABA 3H9HA 4AMKL 3D39D 1VPOH 4ZDHA 5CEXB 4M7JH 2FEEL 3DHMA 4LPXA 3I2CL 3ZT6A 3MV8D 3WHE1 5I8KH 3BGAA 1NMCC 4PG9A 4XWOC 1QR1A 3JV6A 4NBXB 3V4PL 4U1LB 5KTEH 1KXTB 1RZJH 1I7TA 2XZZA 3PE9A 4XXCC 2BVEA 5AYQA 1R24B 3G6JB 4WFEE 1JNHB 3FFCB 3OHXA 2DIBA 4XNXL 4OZGA 1RIHH 4JFQA 4UV7L 5GGVH 1HH9A 3N0PB 3RIAF 1NL0H 4KMTH 3ETBF 1S9WA 4X9FA 2R4RL 3DYMA 3VH8B 5GGVY 3UPAA 2AW2A 1MIML 4LLUA 2YK1L 5ICYA 3S4SA 1MCEA 1E6OH 1L7TL 1BFOB 2DQCL 1IBGL 2Z9TA 1H3GA 3FHAA 4G8GD 4KJPD 2LE9A 4PIRF 4HS3B 1JHTA 3O9WB 5C0IB 3V95A 5IVXB 1IEBA 1XT5A 2HT2C 4JFDD 4GAJH 1IKNC 4WU5B 1VGKA 1YPZF 2OL3H 3TH3T 3MRJA 3VXQB 3QRGL 4O4YL 3MLRL 2DQTL 3QCTL 4L8SA 4YXHL 3QH3B 2L0DA 1P7QB 4QXWA 1DL7L 1XCQA 2L4OA 3TT3L 1EJOL 2YD5A 1TJIH 4X4MA 1ZSDB 4ZUVB 4TNWF 4F9LC 2CLRA 2JCCB 3QNXB 2P8MB 3FO0L 1I3RB 3B9VA 3F8UB 1CICB 1VGEH 1B4JH 2PCPB 1CIUA 2UY6A 4M48L 1U9KA 4JZNB 4FP8H 4PJHB 4UINH 4PR5B 4I18C 1CT8A 5ALBL 4QWWD 1TQCC 4L3AA 5E8DH 4PLKD 1J05B 2AJZB 2A1WL 1RUPL 5DRZA 5GSVA 3T8XB 2JJVA 2V17H 3O6LL 3DETD 3JWOL 2D3VA 2NTFB 4LPWA 3QEUA 4HWEL 1FRGH 4KZDH 4EJ1C 4GLRI 4JQVA 1NMAL 4GKSA 1C5CH 2X4OB 4S1QL 5DQ9B 3GK8H 1PG7H 5I1IL 1ZLUK 4KHTH 4L8DB 4JY4A 4U1JB 1JI1A 2H9GB 1MFCL 3BW9B 5T3ZD 5FUOL 1LEGA 2H1PH 1INDH 5DRNA 1UENA 2FWOB 1EEYA 3PWNA 4HG4K 3DIFB 2X70B 1J0HA 1JGVH 5T5NF 5FHAH 4PJ8A 4X6EA 4X9IA 2APVA 5JO5A 1KT2B 1SBSH 3BPOB 3GMMB 4N9GB 2NTSP 2XKUA 4ODUB 3ARQA 1L6XA 5LWYL 5C09B 1LE9B 1MNUH 3SBWA 4Z18A 25C8L 4NO3A 3UTQA 5F70A 4UQ2A 3T0AA 5E5RB 1HDMA 3D2UB 3GMOB 1IAMA 3IDMB 2WP3O 3ZT5A 4R7NB 5HTSA 3LMJH 1TFHA 4YX2L 1ZVSA 1A6PA 3RWFA 3W82A 5DHVB 5TE7L 4K7PH 1ORSA 4R26L 3BZ4B 1BM3H 1IVLA 1KJVA 2ZOLA 1AP2A 3DUSB 1MFDL 2H6PB 5BXFB 3JWDH 3OXSA 4K7PY 1UWEH 5C0BE 1I1AB 1PX3A 1DEEB 4GAYA 2X4UB 3SGEH 4ZOAA 4MCYB 4JQXC 4LMQE 1JPTL 4GG8A 3SEPA 3D39E 5IFJA 3SPVB 1RJYB 4YHZL 5MEPA 1IGML 4F33B 2WMPA 1MCPL 4OGZA 3QULA 4ELKA 1JZ2A 5E08H 5GGUB 1CN4A 3MV8E 1HYRC 2YD9A 4KKLD 3U7AA 3ULUH 1KLFA 4XVTH 3VE0B 1J18A 4LKXA 2EICA 1P6AB 5HYSA 1KIRA 2DQFB 4QHMB 4X4XB 3OXRA 4TVPD 2NW2A 4PGZA 4NQCB 4G6AD 4DZBB 1DEDA 2NY5L 4OM0H 5DJAB 5HI3D 2A77L 1F3RB 1HHKA 3X13A 3ZE1F 1OAQH 4D94A 4BZ1L 2HFFB 3BGMB 2R39A 3C9NB 5BV7B 1EMTH 3KJ4B 4YXLH 1KCVL 3O45B 1B88A 2SEBA 4NQUA 4C54A 1UJ3C 4XGZB 1AFVL 1NDMB 1G9ML 4JB9L 3QNYB 3QQ9C 1B0RB 4XHJD 4YHPA 2EC8A 4Z76A 5CSGA 1U8NA 4I0KA 5TDPB 3SN6N 2E3VA 3F58L 4GG6B 4NC1E 1TITA 4YZFF 5FV2A 3SDXE 1S7TA 2A6DB 4G8GE 2EYRB 2P1YA 3HI5L 2X4QB 3HPLA 1T1YB 3PQYA 3HZMA 1PZUB 1BQSA 1KB5A 5LBSL 5TQ2L 2FIKA 4UTBH 2Z8RA 2KUTA 1QUNA 4U1IA 5HYSG 4N8CL 1MH5B 2IQAA 1U8IB 5HHMB 1NEZA 1T1XA 5IR1A 4K2UH 2OQJA 3QAZC 5EU3A 2W91A 4E41A 1NGYB 1PKQA 4P48A 4P9HC 4ZUSB 5IMMA 1F90L 4MX7B 2H45A 3KXFE 2QR0A 4ZTOL 4OAWB 3TZVB 3TVMB 2VC2H 2Q86B 4AIZA 1A5FH 4HIJA 4L3CA 5CSZB 1V7NH 4EBQH 5EOTB 1ETZB 3P30L 1QYGL 4KKAD 2VUOA 3TEUA 3V4VH 4MJ2A 4K3EH 5LGJB 4N5EC 5SX5K 4QHKJ 3MODH 2EEBA 3O0RH 3P9MA 5CEYB 5C6TH 3V6BR 1MI5E 2KH2B 4DGIH 3NIGF 3GB7B 4MB4A 1CXFA 3NH7L 3WDIA 1S9VB 4LSQL 4S0SD 2X4NA 2P48B 5FYJU 5IB5A 3HAEH 5TE4L 2DKMA 3S6CA 4Z7WE 3KNBA 2A74A 3RX7A 4M7LT 4LCCA 4YDJB 4I0PC 4U31A 2Q87A 2WQRA 2A6JA 1SBBA 4PGBA 1YEEL 5FO8A 4RQQB 3EFFA 4Y4KB 4ONFL 2F54A 4RA0C 2ZP0T 3B2UD 1NGQL 4HXAL 1TZHA 4PJAE 4QOKB 3T0EA 3ZKNC 1J0JA 4LAQH 2LVEA 4J4PA 4JLRB 4L9LB 3LHPL 5AZEH 5IJVA 3OKDA 3QUXC 4ODHL 3LN5B 1NUNB 3GUTA 4NRYB 5FM8A 1MUJB 1YEIL 4Y19A 4APQA 1HYSC 4GBXC 1N2RA 4I4WA 3TIDA 3VFGH 4U0QB 3R06A 1J1PL 2DTSA 4FFYH 5FYJH 1NCAH 5J57B 5I8EA 5C3TA 4XXDA 3L95A 2GJZB 5E9DE 3QWOA 1J86A 3QFDA 4YBLC 3EZJB 4QHUB 3HPJA 1MFEH 1XF1A 2XTJD 4HIHB 3TGXA 2VLKA 5T5FL 2DKSA 2FEDD 1H5BB 1DQLH 4XT1C 4JFDB 2VR9A 3QFJE 3O3AA 2WUCL 3CDYA 3I6LD 5CEZL 4RRPG 5E5MA 3GFUA 2BY0A 1G7PA 1J87A 4XCCL 1UWXK 1DBAL 3BT2H 3OKEA 3K8KA 5J6HA 3BDXA 3BD4A 3L5XH 2GY7B 1ITBB 2EIZB 4EI6A 1XH3A 3GSVA 1T7ZA 2VDLH 3R4DA 3L3IA 1FL6B 2ICEA 2F8OA 5H37G 2YKLL 4M6OH 5BVJA 4KRLB 3CSYA 5AYUH 3FOLA 3NOIA 4JHWL 4EOWH 4S1DD 4YDLB 5E2VH 1T0MB 2FX8H 4HAGA 4E5XB 3RWEA 3HMXL 3UTPD 4ELMA 4DGYH 3PGDA 1U8LB 2GY5A 3BKML 4OFDA 1G84A 2IPKB 5KOMC 1EVTC 3PUCA 1FJ1A 1ITCA 3H0TB 4FS0A 1QLEH 3WD5L 4LHUB 3G6DL 3IJSB 4RCAA 4HJJH 4G6KL 4OT1L 5DJZA 5FDWA 5I1DB 1P5VA 4PJ9D 4B41A 1T83C 2D7TH 3BHBA 5C70A 1GSMA 1MELA 4V1DB 2Y6SC 1KCRL 5D96C 2QV2A 1JNNL 3KYAA 2GTWB 3EYOA 4ZFGL 3O3UN 1ZA6A 4LARH 2FCBA 3F7VB 4LLQB 3QO0B 2YD7A 5CBAA 1Q9OB 4PJAB 2UYLB 3RWDB 5DMKB 4I3RL 2P5WB 3SKNB 4FQCH 3ZTJG 3WS3A 3H7BB 3ARZA 2YWYA 2G75B 4IRSD 3F12B 1DFBL 2XZCH 3RJDA 1HI6B 2D2OA 4FTVA 1F11A 5AWNH 2MFNA 1QQDA 3IETB 2OK0L 1NAMB 2BK8A 2UUDK 4M1CC 3VG0H 2H26A 4LPTA 2F9BT 2X1QA 4NUJA 1XCTB 2Q8BH 1ACYL 1AGEB 1OTUC 3QIBA 3RKDC 4E41D 3ZTNH 3B8SA 3ULVE 5L8KB 5M7QA 3TCXA 3RVXD 4I2XB 2X5PA 5F1NB 4F7EA 3AUVA 3QIUD 3GMNA 2EDEA 4H20H 1K9TA 4FFVD 1J0IA 3V0VB 1MF2H 4Z95L 5DRWA 3QG7H 3C5ZB 4WI6A 2FJGB 2J4WL 1C7TA 3NABL 4OZIE 4TTDC 1JPGB 3KGRA 1BVLB 5MP6H 3GIVA 3CZJA 5GGSB 1G7LB 4PRIB 3DVGA 4QHNA 5ADPL 5ERWB 1KV3A 1AE6L 3CX2A 3H9HB 3K46A 4ZDHB 1EHXA 4Y5YC 1NCCH 5T1DH 1IGYA 4AM0A 2BVTA 5HDBE 1CLOL 4FZEL 5EN2A 3U7WH 3SHSA 3ARGD 2VXUH 3BYYA 1HEZA 5HVWA 4I1NB 1UM6L 1QR1B 3JV6B 1BFSA 2YA2A 1IAII 2F54D 1I7TB 1JF6A 5L6YL 5DURD 3T0ED 4RDQF 3ZKXC 4X7TA 1GOHA 4J4PD 3EOTL 4OZGB 4QRRA 4JFQB 2AXJA 5C0AA 2NY4C 1Y6NR 3VXSD 1HH9B 3BDBA 1LO4H 4YXKL 4HXBL 4NKMA 5BO1H 4Y19D 1S9WB 4AJ0A 5HVGB 4APQD 2GSGA 3EUUA 4NGHL 3QXTA 2WWMD 1MHCA 1RULL 4R4FH 5ICYB 4HCRA 4JRYA 4HG4J 3S4SB 4NWUH 2FHFA 1B90A 5IFHH 2JJSC 2XTJE 4TULH 4KJWD 4FMKA 5IWLA 4Q9RL 4JPKL 2VLKD 3I6LE 1JHTB 1RIUH 1IEBB 4TUKH 3ARPA 4X7FC 5IMOA 5DYOA 1OARH 1VGKB 3HRZA 4PJIE 3W11C 3MRJB 4OLZH 5I8CA 4ZAKA 1F4YH 4KQ4L 4L8SB 3PL6A 2R4SL 2DWEA 1YPZE 1JHLH 4ETYA 1XCQB 1S9YA 4LEXL 1X5KA 3BAEH 3MJ9H 5D9SA 5J13B 3CVHL 2CLRB 4XNQA 4LPUA 2K1MA 5AZ2L 2XZAL 2ZPKH 4WNQA 2APBA 1S8DA 3ZKMC 3VFSA 5JW4Q 1WQVT 5B39G 1CT8B 4LOUD 4NZJA 4KROD 1VCAA 3EAKA 5GRVK 4ENEC 1UVQB 5DRZB 5GSVB 4JZJC 4IOSD 1CVRA 3OWEA 3GSWA 3T4AA 5CKAA 3B5TA 4XBPA 3QEUB 1RZJC 1CD0A 2EYTA 1N0LA 2R2CA 3V5KB 2AJYL 4GKSB 4XCFH 3C8HA 2FX9L 1XGYH 4JY4B 1RHFA 4QHLA 5ICZA 5E2WH 2VLJA 5DD0H 3F7RA 5I1LA 5JNYA 1LEGB 2DLIA 5DRNB 3DX8A 4X6FA 1P7HL 1EEYB 3PWNB 3FCTA 4ISVA 4XP6H 5J1AA 4X6CE 4GW1A 1B6UA 3RQ3A 1J88A 1RI8A 4PJ8B 4X6EB 5FYLE 3IKCA 5JO5B 4FTVD 3G04A 5HI4C 5A16A 4XC1H 1A3LL 1ZLSH 4UT9L 4NO3B 3UTQB 4HK0A 1KJ2A 4UQ2B 4I8DA 1BOYA 1HDMB 3AMLA 2ESVA 5KANG 2HMID 1P53A 1UFUA 3QIBD 4HC1H 3GHEH 12E8L 1NGPL 1ZVSB 1QFWL 4R8WL 2JF1A 5EOCJ 1IC5L 4U6VH 2VDMH 4S1SH 5IHBA 2ADFH 1WZ1H 3GJFK 1HXMA 1ORSB 1KJVB 4LP4A 3SE3A 1AHWC 1AP2B 2N7AA 2ZOLB 4EN3D 1NCDH 5JOFA 5KSAD 1YPZB 4GAYB 1BLNA 3VDBA 3OAUH 1I9JH 1G7MA 4GG8B 4HW6A 5IFJB 1VHPA 4PJ7F 3ORJA 4M1GH 5MEPB 5I1HL 5D1ZC 3UO1H 4U33A 1RVFH 2O5ZL 3QULB 4ELKB 3O8XA 2XQYK 1AQKL 2IPTH 3BYTA 5C92A 5I30H 1VACA 2YC1A 4LKXB 3LQZA 5HYSB 1KIRB 1H3VA 3OXRB 3GSUA 2NW2B 4FXLA 3V6OC 2O5YL 4MJIE 4YHNA 2EDBA 4HFWA 4D2NA 4IMKC 1OOAA 1B4RA 3GMPA 1HHKB 3X13B 4X5XB 3CFEA 3MBEA 3VXSE 3ZE1E 2BSTA 2SEBB 2N1KA 2V2XA 3DURA 1XGTA 4JO3H 2W1NA 1NAKL 4YHPB 4Z76B 3UJJL 1U8NB 5DLML 1KXVC 1A02N 5B4MD 1LO2H 5C3LD 5HHXH 3DV6A 4Q0XH 4OGXL 1S7TB 4JRYD 4NZDA 5GISL 3HPLB 4YZFE 5DJ2A 3PQYB 2AJVH 1KB5B 4WCYH 1FLRL 2FIKB 5I1CL 4KPHL 3BJ91 4U1IB 5M95B 2OXGA 2CMRH 2IQAB 5HI5C 3QSKB 1G7JA 1EZVX 1NEZB 1T1XB 5IR1B 1KB9J 2OQJB 5EU3B 4ZFFA 4E41B 1PKQB 5IMMB 3AROA 1GGCH 3J8F7 4KK6C 4HLZG 3MLVH 4KY1H 4AIZB 3HCVA 4HIJB 4L3CB 3WJJA 1JE6A 4JGMA 2XZQL 3QIUB 3MYJA 2E7MA 3TBSA 2AJXH 3BQUA 4K8RH 1J12A 2ATPA 4OD3L 4I5BA 1RJLA 1TJHH 1EFQA 4F57H 3FQNA 2O61B 3ZDXF 3P9MB 2B7DT 1ODAA 3X11A 5IHZA 4M5YH 5IB2A 1DQDH 1HIMH 3ULUC 3X3GL 1T20A 1X5YA 2X4NB 5IB5B 3NZHH 3VRJA 1QSFE 5CLTA 5TE6L 1I9IL 3V6FA 2A9NL 3ZYJA 1G1YA 4L5FL 3KNBB 2A74B 4PJ7A 2ADGA 1CLYH 3B5HA 2OR9H 2A6JB 4PGBB 3U79A 1YZZA 5FO8B 5E03A 2CRIA 2CD0A 3MLSH 5KVFL 2DQIL 4X7SH 4BZ2H 4R0LA 5E6YA 1YN6B 2V5TA 4X4YA 3ULVC 2F54B 3LS4H 3NCBB 3NFPA 3RNKA 2Y07H 3T0EB 2UVEA 1ZE3C 1K2DB 1OCWL 3OKDB 2VLJD 3R0NA 3BFOA 3GUTB 5CJXA 4UQ3A 1EFXA 3NA9H 4ZS7L 4E42A 5KN5A 4P0DA 4Y19B 4APQB 4P9ML 4FQ1L 3AFLA 1N2RB 3W0WA 4I4WB 3CK0H 3TIDB 5DHVH 2X6MA 3ARBC 4JQIH 3I50H 3R06B 4LK4A 1GVIA 1WITA 4XPHL 5B38A 3BUYA 3LDBB 3NIDF 4RSVA 3G08A 1FGNH 3FT2A 4AH2A 5I8EB 4XXDB 3KS0H 2FO1A 1N6VA 3QWOB 1S9XA 1XGUA 3QFDB 3GBNH 3IDUA 1KJMA 1J1XH 2VLKB 3D0LA 4AY0A 2ESVD 4WI8A 3WDJA 2X09A 3UDWC 9CGTA 3O3AB 5GZNC 1YY8A 1LGVA 5CZXC 4FZ8H 5E5MB 2H2SC 1G7PB 5DC9B 1OAZH 3OKEB 4WI4A 4Y16A 5J6HB 2ZZUT 3CSBA 3QA3A 5IMKA 4WY7H 3ZE2E 2YXFA 3WO3B 1XH3B 3GSVB 3VRIA 4CDGC 4KZEH 1F4WL 1MQKH 3SDDA 1BF2A 3L3IB 3SKMA 2AXHA 5EZOL 2R1YA 5DT1H 2ICEB 1YA5A 4NFBA 5L9DL 3ARWA 5BV7H 5BVJB 3CSYB 3FOLB 1A7RH 2NZ9C 4L8BA 4DEPB 3VXMD 3RA7H 3H3PL 4KROB 4AG4H 3IKKA 4WTWA 3EYSH 4RMSA 4HF5H 5DWUH 3RWEB 3PGDB 4ZTPH 1OP5K 1LEIA 1NGZA 1YEHL 3VMNA 1KTRL 5EBWA 3TLRA 3GMQA 3M07A 1FJ1B 3DTXA 4H88H 3TBVA 2B1HL 5AG9A 1TJGH 5FDWB 3DWTA 3GSNA 5DJZB 4DN4L 3RVTC 3IRPX 2V2TA 3BHBB 3HZYA 2R0WH 3UXFA 3EYOB 1ZA6B 5F7KC 4HUMB 1XMWA 4TUOA 2NY6D 3S3PA 4X99A 4JO2L 5CBAB 2NXYC 4P3CL 2HFGH 3T3MF 4KAQH 4KRNA 4UIKL 3WS3B 2HJKA 1JNLL 1S3KL 3UZVB 3WNMA 2F74A 3R1GL 1TTFA 5E1HB 2VLRA 4HH9A 3M8OL 1G0DA 5E2JA 2M2DA 4FTVB 1QQDB 2BFVH 3WIFA 4OF5A 5GS3A 4PS4H 5DD3H 3EYVA 1UACL 1C08A 1QLRA 1U41A 1Y6KR 2NLJA 2H26B 3GSRA 3V9FA 4NUJB 2D0GA 2C1OA 4QRPA 5J56B 5EO9A 2DQJH 4FA8A 4XP4H 3QIBB 1W72L 3W81A 2DJSA 4KH2A 1B0WA 2ICCA 2VAJA 4Z7UF 4W6WB 5F96L 1VPOL 5IG7A 5JR1H 1EGJH 1V3JA 1CLZH 4M7JL 2Z31A 1WLHA 3HB3C 5IF0A 3BXNA 4MAUH 4F7EB 1F8TH 1OL0A 3GMNB 3RY6A 5I8KL 5KSAB 1QSEE 3MUHL 4IOFC 1G7IA 5DRWB 4D9QD 1Z9SA 3O2DH 5LKNA 4J12A 1LD9A 1DE4A 1NGXA 1GGUA 4CU8A 3FAWA 3RL1A 5KTEL 1RZJL 3GIVB 3LPGA 4LAJH 4OLYH 4P2OD 1WBXA 1QSVA 3DVGB 4QHNB 4BH8A 1RIHL 4U05A 1JTTA 1I3UA 5GGVL 3CZFA 1IGYB 3MLUH 4AM0B 1NL0L 3TA3A 4KMTL 1A4JA 5EN2B 2VXVH 3SGKA 3G5VA 1QSZA 1HEZB 1LK2B 2V9QA 4DUVA 1E6OL 2VYRE 2W9EH 3HS0A 1DUYA 3UMTA 4NIKB 4X7TB 3S8WA 3IAPA 4QRRB 2EC9T 5C0AB 4XP5H 3PABA 4KKCD 5EU5A 1EFXD 4NKMB 4GAJL 3WFCH 2OL3L 5A43C 4JFEE 2HTLD 1YECH 5DQJA 2GSGB 3KPTA 3T3PE 1MHCB 4NM8H 1MVFA 1IGTA 4JRYB 3FB7A 1A7OH 2EO9A 4CL7A 1TJIL 1J10A 1V7MH 2NY3D 5C6WH 4WEBH 1JHKL 2VL5A 2DTMH 1CQKA 5I8OH 5E5UB 5LGKA 2NYYC 1VGEL 2YD6A 3B9KD 1B4JL 3GRWA 5IMOB 1SM3H 5DYOB 3HRZB 3QEHA 5I8CB 4FP8L 4ZAKB 4D0CA 4UINL 5E8DL 3PL6B 2DWEB 5F1OB 5FO7A 1JZ8A 4OV5A 3VU2A 1S9YB 3ES6A 5DUPH 4BA8A 2V17L 5D9SB 2EH8H 1X9QA 3EOBA 3Q6FA 3BP5A 1KG0A 4ONOA 4XNQB 2ZUQB 1U93A 3VXME 3BGFB 1FRGL 4KZDL 5C08A 4WNQB 3S5LG 1S8DB 3VFSB 4BFEA 1D5MB 1M7DA 1C5CL 3GK8L 1CGTA 1PG7L 3IXAA 4KHTL 1A8JH 3EHBC 3VXNA 3CCHA 3P4NA 5LG1A 5T3ZH 3TESA 3P4MA 2H1PL 3GM8A 3MPCA 1INDL 2EDQA 1S78D 3GSWB 3T4AB 4DKEH 1W0WA 1JGVL 2CO7B 2EKJA 2PXYD 2ICWI 4H0HB 4M8QA 4XBPB 3MV9E 5FHAL 3VGEA 2EYTB 2HA1A 1SBSL 4JFOA 4LFHD 4LHJB 4KXZH 2EH7H 1MNUL 5D7JC 4QHLB 5ICZB 2FECI 1OQOA 2VLJB 5JNYB 5I1LB 4L1HA 4DW2H 1FFPB 3E3QE 4YC2B 3LMJL 2RIKA 3DX8B 4X6FB 3TNMA 3E0GA 3FCTB 4ISVB 4ERSH 5F3HA 5J1AB 3CVIH 3DVNA 5IB3A 1FLTX 1RQ5A 4IRJA 4K7PL 4GW1B 5JXAH 4YE4H 4U6TA 1BM3L 2VLRD 3IKCB 4PYHA 5E2TH 3JWDL 3IU3A 4YFLI 4KVCH 5A16B 3G04B 1UWEL 4ZOEA 3LEXA 4PLNC 4XNYH 4HK0B 1KJ2B 4GRWB 4LVOC 2ESVB 4S0TD 5FK9A 4QRPD 1JF5A 2BZDA 4P2QA 1A0QH 3V7AG 1CE1H 4F7PA 5DUBA 3OX8A 2AEPH 2AJSH 1FN4B 5E08L 5GGSY 4LVHC 2UZYB 3FQTA 3ULUL 4XVTL 1WT5A 1BBDH 1HXMB 1DBMH 2YRPA 2Z31D 4TVPH 3KYKH 4XI5D 3SCMD 5JOFB 1KGCE 4WW2A 3RZCD 4OM0L 2W59A 4RGNC 3RUGF 2Z8VC 1G7MB 1OAQL 5HHVH 3PXHA 4UI2A 4Y5VA 1QO3B 3S97C 1EMTL 4YXLL 3TC9A 3O41A 3VXMB 1C12A 4OLWH 4H5SA 1AGFA 3O8XB 1T7VA 1YY9C 4HK3N 2AK4E 1UKTA 1PY9A 5EZIH 4PGJA 1VACB 2YC1B 3LQZB 5IVZA 3KPQA 3SY0A 2EXYD 4B50A 3TA3D 5C0ND 4YHNB 2CXGA 4HFWB 2FO4A 3QIWD 4TVSa 3UJIH 3EDDA 3GMPB 4NQED 3BE1H 3CFEB 3MBEB 4JKMA 5DGQA 1WC7A 4PGDA 1EXUA 3U36A 1F6FB 1HHIA 1WUNT 4LVEA 3VXOA 5IJKC 1LO0H 2BSTB 1FZOA 4UTBL 3P9LB 4JAMA 3KPLA 2V2XB 3DURB 2NY0C 2NY6B 1XGTB 3DLQR 3EYQC 3OB0H 3IDYC 5E2UH 1OT1A 3IDJA 4K2UL 3ARVA 4EI5C 1U95A 5D7IF 4F7CA 3DV6B 1JGLH 4P46A 2VC2L 5J3HD 1KNOA 1BP3B 3KLAA 1A5FL 4CNIA 4EBQL 1V7NL 5HHPA 1RUKH 5JDJA 4OKDA 2IMNA 4PG2A 1NLDH 2XYCA 4Q9QH 4M4RA 3V4VL 3FQRA 4K3EL 4CN6A 3WEXA 4IIQA 2D0HA 2YPLA 3PP4H 5DO2C 3O0RL 3MODL 3KPOA 5C6TL 4HS8H 2EDWA 5EOCH 4DGIL 1G7JB 2LU3A 4J7RA 4ZFFB 3FT4A 4JHBA 4M43H 2PO6D 5T1LA 1YJDH 3HCVB 3L7FA 3MYJB 3TBSB 5FUCC 3BQUB 2VDRH 3ILQC 2ATPB 4I5BB 1RJLB 1IC4H 1M4KA 4F7TB 2BDNH 1NANH 3FQNB 3X11B 3I3BA 5JQ6H 4BH7A 3WE6A 4KI1A 5IHZB 5IB2B 4LAQL 5HDOA 3ZDXE 4M93B 1T20B 5AZEL 3RUGA 3VRJB 4KJQC 3QI9D 3V4UH 4MQSB 3V6FB 1I8LC 2HVKA 4PJ7B 2ADGB 3T1FA 1ZT4B 4PUBH 4EXKA 1TVDA 3LV3A 3VFGL 1QRNA 4X4YB 4FFYL 3L6FA 4R0LB 5FYJL 5FECA 3KHQA 2FD6H 1NCAL 4FFWD 1I7ZA 4K55A 1G9NH 1TETH 3DVFA 3NFPB 4X98A 3RNKB 5EH1A 1CFBA 1KELH 3O9WC 4JJHA 5IT2H 4X6DE 3WSQH 1CDJA 3K4AA 1MFEL 3B5GA 3DX6A 2AXGA 1DQLL 2BRRH 2DKUA 4UQ3B 2BCKA 1I1CA 1CU4L 1EFXB 2P8LA 4E42B 5KN5B 4JDZA 5FOJA 3GBMH 1VERA 4P23C 3HZVA 4M9OA 1RZKH 4JY5H 4AL8H 3UROR 3BT2L 4IRJD 3IDNB 4I0CC 1LNUA 5B38B 2OI9C 2HWZH 3BUYB 3G08B 3FFDA 3FT2B 2NY3B 3L5XL 4XP1H 5JA8B 4QRPE 2UWEF 4EDXA 2FEEI 3NIDE 4EZMA 2E8ZA 1X6LA 3Q5OA 4Y4FA 2VDLL 3K3QA 1S9XB 1XGUB 5D7IA 1KJMB 4LHQB 1F13A 3D0LB 5IBTH 3EKCA 1BJ1J 1KEMH 2IF7A 2QLVB 3MA7A 4LF3A 3FN9A 4M6OL 1YC8A 4OCSH 3U6RA 1TNNA 2IAND 5AYUL 4EOWL 1T66C 1YY8B 5E2VL 3AC0A 2I07A 3MC0A 4N0CC 3EW3B 4HMEA 2FX8L 3DMMC 4OF0A 4Y16B 4DGYL 1MRFH 3DX9A 1IAIM 2VDOH 1UWXH 3QA3B 5IMKB 5ESAA 2OMNA 4K8RC 1CWVA 4Z7VF 3N1PC 4ONHA 5F7NC 3VRIB 3SDDB 1QLEL 1TCMA 3SKMB 3IXTA 2R1YB 4HJJL 4R4BA 4XTRD 3SGDI 1QBAA 1IC1A 2D7TL 3RVWD 5LXGH 1MCJA 4L8BB 4TQEH 2AEWA 2V7HA 4LARL 4TSAH 4BM7A 1PG7X 3X12A 3H9SE 3O81A 4QNPE 5C07A 3NMEA 4NQEE 1LEIB 2C1PA 1F58H 1NGZB 4FQCL 5IM7A 4RGOH 5EBWB 3GMQB 1JIBA 1HN1A 3DTXB 1OP3H 3TBVB 1CFTB 1Q94A 5AAWA 2V9TA 3GI9H 1E4XH 2LFGA 1MY7A 3GSNB 2EECA 1QBLH 2XZCL 4EUPA 2V2TB 4NZRH 4RAVB 1BZ7A 5AWNL 2AV1A 2FX7H 2DJUA 4RFNB 3VG0L 2P42B 4TUOB 4ZSOE 3VMOA 4X99B 5A3ID 1JNJA 3PP3K 1X5FA 1ZAGA 1BX2A 4PRDA 4LSUH 2HJKB 3RHWF 3ZTNL 2F74B 4Y89A 1EEZA 4MGXA 3MRBA 5I18H 2VLRB 4ZYKA 3PJSA 1I1AC 4GLRH 1FC1A 2PYFA 4XCEA 1V3KA 4H20L 5K93A 5L7XH 2Z35A 3AREA 3WIFB 5DMYA 2ZUWA 3VXRE 1MF2L 2AAVA 1I4FA 3EYVB 3QG7L 1QLRB 1MHPH 2NLJB 3GSRB 4AENA 2UUDH 5C0RH 4WHYG 2YPLD 1M71A 2C1OB 4QRPB 2H32A 4S2SA 5EO9B 1PYWA 5MP6L 2R1WA 1LO3H 1GGBH 1T1WA 1WWAX 2HJLA 5IG7B 5KAQG 1URLA 1FC2D 1NCCL 1S7WA 5IP4A 2JJTA 5T1DL 3TJHC 1YEJH 4Z7UE 2Z31B 5T1LD 4N90E 2KKQA 4O2FA 1NUFA 5KANI 4PJ5A 3BXNB 5IF0B 3U7WL 1GJIA 1TIUA 3WXWL 1KCLA 4LLWA 4L29A 3RZCB 1Z6JT 1G7IB 2VXUL 2EDYA 1IARB 2AERT 3OV6A 1LD9B 1DE4B 1NGXB 1YNTA 2B0SH 3KJ4C 3NCJH 3RL1B 2NY2D 1G6RA 5EU7E 4QO1A 4XPFH 1DJSA 1YEGH 1A2YA 5JIPA 1WBXB 3LB6C 5MENA 1ZVYA 5B3JF 3OKYA 5JHDA 2EEAA 4BH8B 1T7YA 2C3VA 2HKFH 4NZUH 3QQ3B 4MXVE 2J2ZA 3VD9A 5EG6C 5H37H 5JLZA 3CZFB 5IQ7H 3MUZ1 1LO4L 1TVBA 3TA3B 5JIIA 5BO1L 1A4JB 3SE4A 3LCYA 4MSWB 2VUYA 4JFFE 2OL3A 3D25A 2EIDA 4MQ7A 1QRND 3JXAA 4JRWA 4R4FL 3WKMH 2CKBA 4NWUL 3O6MH 1KENH 5IFHL 2VDKH 3HS0B 1IZJA 4TULL 2D0FA 2NX5E 1DUYB 1EEQA 4TTGA 2ERJC 3BN9D 1EEUA 3I9GH 4HQQH 4KMLB 1RIUL 3PABB 5E70A 4AIOA 3T77A 3VFNA 3SJVA 5EU5B 2J8HA 2Y25A 1OARL 5KVMC 3TVMC 4OLZL 1F4YL 5DQJB 2JB6A 2X4TA 4YJZL 1DANT 1JHLL 1IGTB 3FB7B 4MXQC 4LIQE 1FYHB 3DYPA 3ARDC 3LN4A 1FAKT 3BAEL 3MJ9L 2BHZA 3E1F1 3JV4A 3ROLA 3RI5K 4DOHE 2VL5B 4IDJH 4HWBA 4Y4FD 2IANE 4ZUTA 5IHLB 4RISH 1KCSH 2UZIH 4PTTA 2ZPKL 2FYYA 5DXWA 2Q3ZA 1CL7H 3QEHB 4HUKB 1IGFH 4S1RH 4D0CB 5GIRA 4PRPE 1Q0XH 4UIMA 5FO7B 4OV5B 3B43A 4GT7A 1N6QH 1DVFD 3PWJA 3ES6B 1NPUA 5F7YC 5D2LA 2RB8A 4F3FA 4MAYD 1P4IH 4XAWH 3EOBB 2X1OA 3BP5B 3Q6FB 4Y4KC 1KG0B 4URTB 3CAFA 4PJDE 2NMSA 1U93B 3T65A 4PP2A 1UEMA 5F8QC 1AI1H 2YPKA 4DFIA 2ED9A 5C08B 1I9RH 4K94H 3EYUH 1AXIB 4ZD3H 4XCFL 4K3DH 3S36H 3IXAB 1XGYL 4UNVA 2CR3A 3M45A 3VXNB 3CCHB 5E2WL 5DD0L 5C1MB 5DSCA 5C07D 4HEPG 3P4MB 4YK4B 3T0WA 3QUZA 3L5WA 2PR4H 3FRPA 4XP6L 4F2MA 1W0WB 4POUB 4M8QB 3BO8A 3A6BH 3TIEA 4FXGA 4JFOB 4XC1L 3AS2A 2BVYA 1ZLSL 2MSPA 4PJGF 2HYMA 1T04A 4F15C 1WSST 2BNRA 3EFDH 3DUUA 4HC1L 3GHEL 1MAMH 1BFVH 3TNMB 2HH0H 4U6VL 3HE6A 3QJHA 5F3HB 5GHWH 3DVNB 5IB3B 2VDML 4S1SL 2ADFL 1WZ1L 1YEDA 2XA3A 4IRJB 3WJLC 1FNHA 3PWUA 1OY3B 4PJCF 5JDSA 4OQTA 1NCDL 2YPLE 3IU3B 1QHPA 3O6FA 4KUCF 2VR4A 1B3JA 3MRDA 3LEXB 4R2GD 1ZS8A 3OAUL 1I9JL 4LSRH 4N0FA 4XCNA 5FK9B 4M9PA 4H8WH 4P2QB 4YDLC 2VN4A 4M1GL 4F7PB 4QWWC 5DUBB 5HHOE 3OX8B 3IF1A 3UO1L 1RVFL 4CU6A 5FGBC 2NZIA 2VRAA 4MS8D 5CSBA 2IPTL 3FQTB 4UAOC 3SKUD 5I30L 3DETC 3C5JA 4LSTH 5LGHH 2VZ3A 3CH1A 4ZNEE 1NC4A 5DFVC 2FB4H 5ICXA 3BD5A 1CXIA 2XG5A 2QADD 4WW2B 4FABL 4FQLH 4H25A 1L7IH 5F7FA 5BS0D 3U46A 1QVOA 2R0LH 4YBHA 1IFHH 4GS7B 4JM2C 3FZUD 2YRLA 4Y5VB 4WGWB 2VMFA 3O41B 4KJYA 1C12B 5MEND 4H5SB 3GJEA 1AGFB 3MJ8A 5KSBE 5FYKE 2VWEE 5HY9A 5K9OA 1PEZA 2RCSH 4NKIH 4JO3L 2R9HD 4AIXA 5D93C 1EHAA 5IVZB 1QRNE 3KPQB 3SY0B 1LO2L 3OKLA 1KYOJ 2CDEA 2IPUK 5HHXL 2FO4B 4Q0XL 4HCRH 1D9KA 5LCVH 2Z4QA 4LQ1A 4WO4D 4JHZA 1WC7B 1KSRA 3OKNA 1EXUB 4PGDB 3U36B 1T89A 2AJVL 2GKIA 2OX5A 1HHIB 1X5JA 4WCYL 3VXOB 5SWSD 4LCYA 3FKUS 1FZOB 4JAMB 3KPLB 4HUNB 5DDHA 4MNHA 5L88H 3LD8B 4J23A 3HG1A 3OAZH 4HWZA 5JXEC 2CMRL 4MDIA 3O6KH 3SJVD 4F80A 4FQXA 3NACH 2C7UA 1QFPA 3IDJB 3QDME 5D1XA 5EUOF 4I9WE 2IEPA 4L8CA 3HE7A 1U95B 4F7CB 5B8CC 4PJGA 1GGCL 1Z0NA 4P46B 1KNOB 3MLVL 3LRHA 3BZFA 4KY1L 4YIQA 4CNIB 1JGUH 5HHPB 3IGAA 1E28A 3CFKA 3ET9F 5FM4A 1YQVH 3C5ZC 4HDIA 3GGWA 4WV1C 2AJXL 4K8RL 3ISWA 3FQRB 5BVPH 3VGBA 2GCYA 2M1KA 3WEXB 4Y1AE 1CDIA 1TJHL 4Z7OE 4IIQB 2VERN 2YPLB 4F57L 3KPOB 3V2AR 4PJCA 4QTIH 5ENWA 1KCKA 4M5YL 5AG8A 1A3RH 3FT4B 1DQDL 4NO0A 1HIML 1EPFA 2J8UE 3NIFE 2CK0H 3NZHL 3VXUE 1OGAA 1FORH 5T1LB 4G6AC 3BPCA 1KULA 3L7FB 5HI3C 4A2LA 1CLYL 2OR9L 5L8JB 4P4KD 2P45B 3MLSL 4X7SL 4BZ2L 4FQJH 2NY2B 3LS4L 3MNWA 1VFOA 1WEJH 4BH7B 3WE6B 2Y07L 5K9JH 3W9DA 3ZT7A 1M7XA 4JANA 3RUGB 2Y23A 5I1JH 4HKZA 1MCWW 1D5BA 1XR9A 2HVKB 3Q5YA 4OKVA 5FA4B 5GZOC 3T1FB 3FJTA 4QY8A 4ONGH 5TJWK 3BH9A 3IFNH 5JW3H 4LP5A 3CK0L 1BQHG 3LV3B 2K9UA 3V52H 1QRNB 2F8XC 4JQIL 3I50L 4NBZB 3L6FB 5FECB 1FGNL 4X98B 3QO1B 5I9QC 1KJ2H 3GBNL 4GRWH 2DL2A 3CXDH 1J1XL 4POYA 4GRLC 2AJ3A 3V5HA 5GRUH 3DX6B 2AXGB 2XN9E 2BCKB 1CZ8H 2P8LB 4L8SC 4JDZB 4U4BA 5IBLD 3HZVB 4X8XA 3PNWA 3STLA 4FZ8L 5DF0A 3HE6D 3ZHLA 1OAZL 4NZTH 5FEBA 4OI7A 4LDOB 1LNUB 3FFDB 4WY7L 1JFQH 5J0BA 3O6FD 4EDXB 5FUZL 5TQ0H 1XF5A 4LCWA 4KZEL 1MQKL 4Y4FB 5I6XC 5D7IB 4LPCA 3UBXG 2UWEE 5D1QA 5DT1L 5JA9A 1RIVH 3VI4F 3K4DA 7CGTA 3MA7B 4FN0A 4LF3B 5EU6E 2QL1A 5BV7L 4YO0A 5I16A 1GZPA 3AB0B 3NA4A 3STZA 5D7LA 1A7RL 3C6SA 4X4ZA 1Q8MA 3RA7L 2B20A 4AG4L 1YYMH 2J5LB 4YR6A 1YJDC 2I07B 3FB5A 3EYSL 4WFGD 3T4YA 4HF5L 5DWUL 2F53D 2IAMC 3DX9B 4ZTPL 5BS0E 4RX4A 5ESAB 1IZKA 4J1UA 4WFHE 4H88L 4ONHB 1IL1A 3B2UC 3IXTB 4BFGA 4FMFA 1EX0A 1TJGL 3WUWA 4R4BB 4Y4HC 4Z7VE 2GIYA 2C9AA 2I24N 1PX4A 2R0WL 4NN6B 2X1WL 4C58B 2KDGA 2VH5H 5E8PA 1AO7E 2V7HB 4UB0H 5F7DA 1NGWA 2D7MA 3KPMA 3X12B 5E7FA 5C07B 4JRXE 2HFGL 1N6UA 4Q6YA 2BNUB 2C1PB 4K9EH 5IM7B 4KAQL 2FIRT 1UT9A 1IKFH 5SWSE 1MQ8A 4PJ8C 1Q94B 3I3DA 1GAFH 4P4RA 1G9NC 2X89A 3UYRH 4EUPB 4O58H 3SBWC 1BZ7B 1X5IA 1U8PA 2BFVL 3QB7C 2AV1B 3U83A 4PS4L 5DD3L 1MREH 4RWHA 3ESVF 3HG1D 3QHTC 4HUWA 3EIFA 2Z0BA 2QQNH 3TH4T 2DQJL 4XP4L 1BX2B 3FQUA 3BP6A 3G9VA 3HE7D 1IEHA 1F4AA 5JR1L 1EGJL 1NCUA 3W2DH 1EEZB 1CLZL 3MRBB 3RL2B 4ZYKB 2VTFA 4MAUL 1F8TL 3QZWG 4XCEB 2PYFB 4XPTH 2Z35B 2AQ1A 5IESH 4QYOA 1I4FB 2KZ1B 3O2DL 2A0LD 1XF3A 4YDIH 4AENB 4X9HA 4F9LA 1M71B 4YDKH 2H32B 4S2SB 3LY6A 2R1WB 4OLYL 3IS1X 2UWEB 1T1WB 4KUCD 4P5TA 2HJLB 4RZCA 4WUUA 3MLUL 4O2FB 4I18A 4PJ5B 5JW5A 2VXVL 2EE3A 3CU7A 3WYRA 5ID0A 4LLWB 4L29B 4BSWA 2VDPH 4HSQA 1UGNA 4PRHE 3VFWA 3TH2T 1YNTB 3QJFA 5D7KD 3DPBA 2A38A 2W9EL 1G6RB 4GKOA 4FXKA 1A2YB 5MENB 5JHDB 3FAXA 2C3VB 4WU7A 4XP5L 2NCMA 4OZFA 5B3JE 5JLZB 1UWGH 8FABA 2R69H 5IQ9A 2Z92A 1TVBB 3WFCL 1D6EA 1KTLA 3KPSE 1YECL 2C4FT 3D25B 5CJOH 1QFWI 3OAYH 1RK1A 1Q1JH 4LLVA 4MQ7B 4NM8L 1A7NH 4WO4B 1A7OL 5K33A 2MHAA 2CKBB 2IMMA 3QUYD 3ESUF 1SMOA 1V7ML 4QXUH 1SQ2N 4WEBL 3MJ9A 2DTML 5I8OL 4QGTA 2EKSA 4P2CG 5I2IA 5F7MC 3T77B 4UBDC 3VFNB 3SJVB 4ACPA 1SM3L 1NFDF 3FRUA 1JP5A 1PY4A 2C3HA 3WDHA 2JB6B 1FNFA 2X4TB 2YUVA 1SVZA 4RMUA 1PVHA 2VWEC 5DUPL 5EA0H 3LN4B 4JR9H 2JKXA 8CGTA 3JV4B 3ROLB 2HRPL 2EH8L 3IDIA 3ABZA 4LCWD 4ZUTB 5DHYA 2J12B 4PTTB 4AEIH 2DB8A 5FCUH 4DJMA 1CXKA 4L4VD 2BXYA 4FQQA 3VI3F 1FH5H 1L9NA 2FYYB 4JQXA 5CJBA 5MEOA 4JFHD 2F53E 1IQWH 5GIRB 3VD3A 1QBMH 3DARA 1JZ7A 2ZCLH 4UIMB 5T3ZL 3X17A 4LCCC 3BIAX 5CEZD 5IV2B 2P49B 3PWJB 5FM5M 4RX4D 3QEQA 4F3FB 1INQA 5D4QA 5DJ0A 4DKEL 1NSNH 3T65B 3GSNH 3NZ8B 4PP2B 2IH3A 4JG1H 2YPKB 3U4AA 4U6YA 2O5XH 4J4PC 4XWOD 2EH7L 4NRXA 4NCC2 2WANA 4APQC 2LAAA 5DSCB 1EO7A 4LRIA 2QJDA 4LPVA 3MROA 3QUZB 3RIFF 4RGMC 5E99H 3L5WB 3O4LA 4PB9H 4ERSL 1V3MA 3LDBC 3CVIL 4HC1A 4F2MB 3BO8B 5JXAL 4YE4L 5MHSD 2X89D 3TIEB 4TOYH 3SQBA 5E2TL 4KVCL 4FXGB 4UUJB 5EOQH 4XBEH 1BF8A 4NHCH 4XNYL 1T04B 4XNZC 3OR6A 1A0QL 1TENA 1CE1L 3DUUB 4RFEA 5BOPA 3UTTA 2AEPL 2AJSL 5GJSH 1R3IH 5D2NE 3HE6B 3QJHB 2HT2D 4D9RE 2GW5A 2HKHH 4FFZH 1BBDL 1DBML 5JMRA 3PWUB 1CIDA 4TVPL 5JDSB 4GJTB 3KYKL 3P3YA 3HRPA 1WBYA 1CTNA 3O6FB 1NFDA 3BSZH 3C6LA 4GMTH 4ZFZA 3VA2C 3MRDB 1ZS8B 5HHVL 4N0FB 4XCNB 3SDYH 5IKCA 4S11A 5I15H 3UJTH 2EDNA 2XV6B 4LOUC 3VW3H 3IF1B 1Z9LA 4OLWL 2PW1A 4R97B 5EZIL 2BSRA 4WUUD 3C5JB 3FT3A 3ZDZE 2F53B 4C56D 3CH1B 1NC4B 3GKWH 4XHQA 4N8VA 5ICXB 1YMMA 4OBSA 4D9LH 1UB5B 3UJIL 4XP9H 4L4TE 5DR5H 3ARSA 3QH3A 4K94C 3BE1L 4N0UE 3U46B 3FTGA 1QVOB 3S35X 5KG9A 3KYOA 5DEZA 3BZEA 1LO0L 1NC2A 1MFBH 2ZUXA 3TV3H 4KJYB 5A40E 3GJEB 1ROWA 3MJ8B 5HY9B 5K9OB 1FNAA 1WZLA 5E2UL 4MNGE 4ESKA 2VKWA 1AXSA 4BJLA 3OKLB 2B4CH 4PR5A 4A6YB 1DLHA 1BD2E 3MNVA 2Z4QB 1C16A 3VFRA 4CU7A 2I5YH 1B0GA 4GBXA 3DO7A 1RUKL 3OKNB 1CGYA 4RMQA 1NLDL 1TXKA 4LCYB 5F9JA 5GGQH 4Q9QL 4PV9A 5DDHB 1MCOH 4OFYA 3WLWD 4LNVA 4MNHB 1LDSA 5D71H 3HG1B 3PP4L 3GRWH 4MDIB 4HS8L 3O2VH 2XY1A 5EOCL 4FQXB 5CD5D 2C7UB 5CCKH 4B53A 5D1XB 4L8CB 1YN7B 3FHQA 3HTLX 3HE7B 5ID1A 4PJGB 2ENSA 4U1JA 4M43L 5EUOE 5I74B 3BZFB 4IJ3C 4YIQB 1YJDL 3C2SA 3IGAB 1E28B 3CFKB 4HT1H 3BX7C 1K85A 4L4VE 4MHHI 4HDIB 3GGWB 4RBPK 3K80A 5KSUA 2VDRL 3MO1A 5CMAA 2GCYB 2X70A 5ECJE 3V0AC 4M3JA 1IC4L 4KDTC 2BDNL 3DX7A 3MUJA 5HGBA 1UH3A 5JQ6L 4PJCB 5ENWB 5CEZE 5J11C 3QQ4A 5DFWH 1OLZA 3O2WH 5ACMA 1BJMA 3V4UL 5GGRA 3BPCB 1B9ZA 5EULV 4Z7NE 3CNKA 2CQVA 2W07A 3EO9H 3QEQD 4PUBL 3LKRA 2BSSA 3RGVA 2F5AH 3F6IA 3LPWA 4QXGH 4LU5H 2FD6L 3MNWB 1G9NL 1TETL 4GXUN 3OZ9H 1KELL 3W9DB 5IT2L 1T83A 3WSQL 3FL7A 4JANB 4WRLA 2BRRL 1T22A 1XR9B 3DYOA 4YHYB 4OKVB 1OW0C 2VO5A 3EDJA 3GBML 4QY8B 1RZKL 2HJFA 2IBZX 1ZVHA 3ALWA 3BH9B 3O4LD 4JY5L 3UTOA 4AL8L 4NJAH 5GGUA 4Q58C 4DN3H 1NCBH 1IAKA 4LGRB 3EJYC 2HWZL 3QUYB 4LDLB 5EFIA 4XP1L 1R5WA 4LIQH 3MJ6A 1CGVA 3P11H 4WTXA 2DQUH 2X1XR 2AJ3B 3JTSA 3V5HB 5IBTL 2CR6A 3QXVA 3MBXH 2WUBH 3W9EA 1KEML 3D6GA 5I75B 5I1EH 4ZAKC 3C08H 4OCSL 3TO4A 1JJUA 5E8OB 3VCLA 3PL6C 3UTTD 1PAMA 3PNWB 1PEWA 3STLB 5GJTH 1CD9B 2APXA 2W9LA 1DCLA 1MRFL 5I1AA 2VDOL 3RWGA 5F1IA 5KS9E 4MA7H 2ZUQC 3SDXF 3JWOC 1N64H 5TH2A 1XF5B 4LCWB 4I3SH 1GOFA 3GEWB 5I71B 4ZUWA 5D1QB 4ZS6D 3O3EA 4YO0B 3QUMA 5I16B 5LXGL 1GZPB 4JEGB 2XA8H 3BD3A 4MNQE 4HKXA 5D7LB 3STZB 4N5ED 3C6SB 4TQEL 4C56E 5I1GH 5L2KD 1GXEA 2C3WA 4TSAL 4YR6B 1XGQA 3FB5B 5ISZE 4YBQC 4JREB 3UAJC 3T4YB 5DFTA 4MA1B 3DGCR 1KLGB 1F58L 4RGOL 4J1UB 3K74B 5H35A 1YMMD 1Q0YH 4PJFF 1HHHA 1IL1B 5DMGD 3GI9L 1E4XL 4JGUA 3WUWB 1S9KC 3RIFK 3U30C 1QBLL 4J6RH 3QPXH 4NZRL 1KB5L 5INDA 1NMCB 1G6VK 5CFHA 2YMXH 1NC2D 2D7NA 2FX7L 3WFBH 5E8PB 2DIJA 5F7DB 4MA8H 1NGWB 5CLWA 5LGJA 1CGXA 3KPMB 4YC2C 4HFUH 3WNLA 5CP3A 4N1EA 3ZKND 4HEME 5C0BA 4LSUL 3QUXD 3GB7A 5CWSB 4IHOA 2KQMA 2X1PA 3D39A 4Z7WF 1HYSD 5I18L 4GBXD 3MUGA 4P4RB 2ICES 3BWAA 1U8PB 3MV8A 4N68A 4AEFA 4GH7B 2DMBA 4OFYD 1MHPL 3OF6D 5J89A 3IJYA 5C0RL 4HUWB 1FAIH 4S10A 3D5OF 1FNLA 1LO3L 3CFBA 1GGBL 3FQUB 4PRNA 3BP6B 4WDIA 3QDJE 1LDPH 4L9LA 2IFFH 4I77H 3AMKA 4W70A 1YEJL 2ZUYA 1RUMH 3ARFA 2RJMA 4WFED 1MCFA 3FN0H 1H3TA 3G5YA 4OLUH 4M7KH 3MRNA 1XF3B 5J7CC 1G9EA 4L9DA 3ALPA 2B0SL 5BQ7A 3NCJL 4EIZC 3WNOA 3O8XC 4XPFL 1YEGL 2XY2A 1WZKA 4ZO8A 3SDXA 2VSDA 1T21A 4G8GA 4P5TB 3S37H 2HKFL 3QEQE 4NZUL 4RZCB 4WUUB 3MFGB 5IQ7L 4C56B 4I18B 2JJWA 1NBVH 1TQCB 5JW5B 3P0VH 1T3FA 5ID0B 4PJBF 4BSWB 3MBEC 2WBJC 4NQDD 5D2NC 3WKML 4JZJA 3VFWB 3KJ6H 3TN0C 2HLFC 3O6ML 3QJFB 1KENL 4ZG1A 4CVXA 2VDKL 2R0ZH 2CK2A 4FXKB 4QRTA 2AI0H 1BJ8A 3GNMH 3KXFA 43C9A 4Z8FH 2LTQB 3CLEH 3AM8A 2BJMH 3I9GL 4WI5A 4HQQL 1T5XA 4WU7B 3EDEA 4UDUA 2J7LA 4OZFB 2Y6SD 2CIKA 4HKBA 3AVEA 1MCDA 8FABB 1K3IA 1OAUH 5DK2A 1NBYA 2YZ1A 5IQ9B 1JZ5A 1D6EB 1OB1A 1KTLB 4KUZH 4PD4J 3T2QA 4IM8A 1OAXH 4CMMA 1A47A 4YEFA 3KPNA 3ZHKA 5EB9A 1RK1B 4LLVB 5EUKA 2AV7B 3WLBA 2MHAB 4JDVA 1MI5A 3OL2A 1CGSH 3RTQC 3ZDYF 4IDJL 5GRXG 3MV7D 2WNGA 3K4ZA 4RISL 1KCSL 1EAPA 2UZIL 2EKSB 3UX9B 1N7MH 4PTUA 1SYVA 2I60H 4Z7WA 5I2IB 4YFEA 3L3DA 4M1CD 4MJ5A 4YQXH 5HVHB 1H3PH 1CL7L 2ITCA 2D7PA 3FRUB 4S1RL 1IGFL 4ODSH 1CVSC 4D0BA 4WHTA 4GQ9H 1Q0XL 5KJRH 3ELAT 3RGHA 2XRAH 2XKNA 4LLQA 1OTUD 3RKDD 1N6QL 2RFXA 1BGXH 4ZOCA 5H8DA 4PJAA 2AEQH 3BQUC 1YEKH 4GUPA 1P4IL 3IDIB 4XAWL 1SJXA 5JIKA 3J7HA 4L3ED 5DHYB 5L2KE 4PLOB 1AHWA 1SY6A 3FN3A 2Y7QA 3HR5A 1AI1L 4KK9C 1I9RL 4K94L 1KC5H 4FQQB 4M93C 5MEOB 3EYUL 5HGDA 1UJTA 1UG9A 4YHIA 3KPRE 1CD8A 4ZD3L 3JUZA 3IETA 4K3DL 4TTDD 3S36L 4G7YH 1INEH 3WFEH 3CGTA 4XB7A 1A3QA 3CMGA 5A1AA 3MNZA 1R3LA 1DDHA 4NP4H 5E9DA 4NPYA 3QEQB 2PR4L 2XI9A 1QD0A 5KOVC 3ULVF 1INQB 3ZSSA 3WN5A 3Q5TA 4EUPH 2IH3B 3QFJA 3A6BL 4GO6B 1X5XA 2DBJA 1SVCP 4OZIF 2NNAA 4NRXB 4KKCC 4OF6A 3THML 4XX1G 4OGAC 5CD3B 3MROB 3EFDL 4WI9A 1BVLA 1Q72H 5C0BD 1MAML 1BFVL 2HH0L 3O4LB 3PHOA 2NY4D 1AJ7H 1CFVH 4UNTA 5GHWL 3RWJA 2YXMA 5C0FA 1OAKH 5BOZG 3D0VA 4F58H 5HDBF 1BEYH 3NN8A 2D9QB 2V5MA 1KPVA 3D87B 2GJ6E 3H9ZA 5HYIA 5IBUB 3FB8A 1Q9KA 1A6WH 1V8HA 3N1MC 4LSRL 2H32H 3OR6B 4LASH 4H8WL 5F72S 3CPLA 1MVUA 4RFEB 3UTTB 2VDNH 4NUGH 2V6HA 4Y16C 1GPOH 2PETA 1T6VN 1KACB 4LSTL 3DRQA 3W11D 3QAZB 4ZO9A 5LGHL 2ITDA 4GW5A 3ARFD 4C4KT 1H8OA 3JV0A 4IRZH 2FB4L 3SDDC 1A1OA 1XIWA 1WBYB 3LEYH 1NFDB 3C6LB 2VZOA 4W81A 1CQYA 4ZFZB 4FQLL 3TPKA 1L7IL 1I3GH 1T03H 1G6RH 2R0LL 1IFHL 1LQSR 5ITFA 1BIIA 5IKCB 5CJQH 5L2KB 3L3JA 4OFPA 2PW1B 1MJJA 3K2UH 3U4EA 5IW3A 2RCSL 4NKIL 2QTEA 3ZKMD 5IIEA 3UBXI 2BSRB 4NQDE 2E7HA 4DKFH 3STBA 1X5GA 3FT3B 4PJIF 4ETQA 3WUZA 1RY7B 1QR4A 4HK3J 1FFQA 4Q9BA 4N8VB 4P3WA 4H26A 4MVBC 1YMMB 4ENED 1J5OH 1ZGLA 3NCFB 2D7OA 4HCRL 1H15A 5LCVL 1FHGA 1N8ZB 2CKBH 1EAJA 3MQIA 4B5EA 4NCDA 4R4NC 3FTGB 4CUCA 3TYGH 5KG9B 2ARWA 3AGVA 1QPXA 3KYOB 4RFNC 1T1ZA 2BP3A 3BZEB 1W8NA 2GK0A 1NC2B 3KXFD 1EHLH 3NPZB 5L88L 1FCCA 1CF8H 1EA9C 3K7UA 3O6KL 2AS5M 2APTA 3KWWA 3NACL 1AXSB 3VD4A 3QUXB 4K23H 4OZIA 1DLHB 3MNVB 3QEGH 4XB8A 3QR2A 5IB1A 3MV7E 2Y5TA 3S4SG 1C16B 3VFRB 1A6UH 5B22A 1JGUL 1B0GB 1JRHH 3ARTA 4GBXB 1MI5D 1UVQA 3RBGA 3WS6C 3ZLQC 3DO7B 2XPGA 1YQVL 3ARBA 4HWBH 1O7SA 5F9JB 1U8MA 4PV9B 5BVPL 4HZLA 5HI4D 3U0PA 2VISA 2FJHA 4QTIL 1DN2A 2FL5A 1A3RL 3V5KA 4BK4A 2H2PC 1G7QA 5ID1B 2CK0L 1IQDA 1FORL 4L3EE 4CKVX 3RY6C 4MXWH 1IAOA 2BY1A 3PWPE 5JW4R 3KYNA 2PTUA 1KOAA 5HYJE 1H8SA 4X6CF 5KSUB 3MO1B 5CMAB 3FO0H 4D3CH 4LLYA 4FQJL 3DX7B 5HGBB 4DFHA 1WEJL 1A6VH 5EIQA 4AQOA 5K9JL 1NJ9A 3ZKQD 4G6FD 4QRUA 3QQ4B 4CJ1A 2EXYC 4LSPH 1RURH 5I1JL 5D1ZD 5FHBH 3SGKC 5K59E 5GGRB 43CAA 1QLFA 4PY8J 5E9DD 1KTKE 4ONGL 1WTGT 3IFNL 3LKRB 5JW3L 4P5KA 4NQDB 3V52L 4M6MH 1L0QA 2BSSB 3RGVB 2VL4A 2Y06H 3TO2A 1CDUA 2HFTA 3QFJD 4NN7B 3WIHA 3KAAA 4PJIA 4TSBH 1FSKB 2WSKA 1YPZA 1KJ2L 3CXDL 5CINH 1AGBB 2YD1A 5GRUL 2D4FA 1P4BH 1C1EH 5D96B 1MIEH 5JHLH 1T22B 1CZ8L 2C4XA 2B4CC 5J6GA 4MD4B 4U1HA 3LPFA 4DTGH 4XAKD 2G2RA 2HJFB 1KIUA 3U4BH 4YAQA 3KLHC 4G8EA 4NZTL 4UDTA 1IAKB 3VWKA 1AY1H 4OQTH 1CFNA 5EFIB 5F6HJ 1JFQL 3UPCA 5HDQH 5TQ0L 2DD8H 1R5WB 1JYWA 3DXAE 3NFSH 3ARYA 4HHAA 3JTSB 4X5XA 1RIVL 1BWWA 3W9EB 2EE9A 3LKPA 4PJ9A 3TO4B 3VCLB 1R0AH 1L9MA 1YYML 5HD8C 5HI5D 3SDAA 5I1AB 3RWGB 5F1IB 1OAYH 1XIWD 3LS5H 4KK6D 2RAMA 5TH2B 4M5ZH 2VE6A 4ZUWB 1BZQK 4IRSA 3KDMA 3O3EB 5IROA 4KK5C 3UTSE 3QUMB 4HKXB 2VH5L 1RD6A 2F15A 2YD8A 2XWJA 1XZ0A 4RWYH 4UB0L 5C0CD 4X6CA 4YK4C 3S36X 1XGQB 5FF6A 4MJ6A 4JE4B 1F42A 15C8H 3HC4H 4X0KA 1ZXQA 5F93C 1NQBA 4P5MA 4JCMA 1T5WA 4K9EL 2QQLH 1S7QA 5H35B 4A6YH 1IKFL 1FE8H 1OM3H 1HHHB 3QCVH 1GAFL 3GIZH 4PJFE 3UYRL 4O58L 5INDB 2V2WA 5D8JH 3QIUA 4KU1A 1FV1A 4Q6IA 3ULVD 2G9HB 2A83A 1MREL 2NQCA 3KR3H 3LKQA 2DBLH 2YN3A 5LJYH 2QQNL 4FRWA 3ZKXB 4YEEA 5IFAH 2O61A 5BZDA 5C0BB 3VJ6A 1VADA 1F6LL 5JZ7C 2Z91A 1WTLA 2NY4B 4IHOB 4TNVK 3N85H 1WF5A 1WAAE 3W2DL 1RJZB 3D39B 3OQ3B 4W6XB 4N1HB 1OSZA 3MUGB 2VZVA 3BWAB 4XPTL 3ARBD 4ZQKA 3MV8B 3TWCH 3ARGA 5IESL 3RPIA 2K7PA 4YDIL 1J8KA 3RPKA 3IJYB 1PW3A 5T5NG 1YN6A 1H0DA 4YDKL 3VRLF 4MJIA 1NEZG 2AXFA 2EIEA 3QP3A 3CFBB 3C60A 4WDIB 4PRNB 1WT5C 5SWZD 5D70H 4ZPTA 1K2DA 2P5EE 1WBZA 1AC0A 4J3TA 5GZND 3VXSA 4WW2C 1ZLWK 3ARFB 4C4KO 5CZXD 3CFCH 3OGOE 4UOW0 1I3VA 4XTRC 4U2YA 3U1SH 3G5YB 2VDPL 3MRNB 1MCWM 4HJ0C 5BQ7B 3A0OA 4OZ4A 2BC4A 4ODBD 4Y7MA 3SDXB 5IUSA 3QDAA 1T21B 3H9YA 4G8GB 4P2RD 1ZHNA 4POZC 1RUAH 3GO1H 1CBVH 1UWGL 4TPRH 2NZ9D 2R69L 2MQ3A 3V6OE 1ZHLA 1T3FB 5FKPA 3D3VE 2A6KA 3RY5A 1KN2H 1K4CA 2B1AH 5CJOL 1Z3GH 4G80A 3OJVC 1Q1JL 4JZJB 1A7NL 4PJBE 3ZE2F 5A2KH 3CFIC 4CVXB 3DOSA 4OGYH 4QXUL 5FDYA 2FBJH 4QRTB 43C9B 3KXFB 1AGDA 3RVTD 4XAKE 1T5XB 4UDUB 2H3NA 2Y72A 3CIQA 1A9EA 2JE8A 2CIKB 4HKBB 5DK2B 1NBYB 1OTTC 1OB1B 4P46C 4YGAB 4CMMB 2NXYD 2WIIA 3KPNB 4OLXH 2BVUA 4KHXH 4WJ5A 5EUKB 3WLBB 3KG5A 1DQMH 5DS8A 3VWKD 4JDVB 4Y5XC 1MI5B 5EA0L 1JPSH 4JR9L 4W6YB 2EDFA 4Y0GA 4IIQC 1CDHA 1QSFA 4WI3A 3TF7C 1EAPB 1EO5A 1HINH 3ZDYE 4AEIL 5FCUL 4PTUB 1W0VA 1SYVB 1FFRA 4Z7WB 2OM5A 2APFA 4HLJA 1FH5L 3L3DB 3QDGD 4MJ5B 5KSVA 2ITCB 1IQWL 4MD5B 5JPNA 2R2BA 5T1KA 4D0BB 4DZ8A 5I73B 1QBML 4WHTB 2ZCLL 5ADOH 4QXTA 1I8IA 4M1DH 2XKNB 4X9GA 3SDAD 2RFXB 4LVNB 3BIKA 1ORQA 3O11A 4GUPB 1SJEA 4HWUA 4PRAA 2E27H 1NSNL 1HHJA 3HB3D 5DJ6A 1AHWB 3EJJX 3GSNL 2Y7QB 3U0TA 3HR5B 5C0CE 4JG1L 1MWAH 1UH2A 1NCNA 4IOFD 2O5XL 3Q6GH 3BISA 4JG0H 3RBSA 5HGDB 4YHIB 2CRZA 4G6FB 3ULUE 2X9YA 3RVVD 4P3DA 5F71A 1MOEA 2A73A 4NQSA 3T0BA 1X4ZA 1C5BH 4J8RB 5FYLD 4RIRA 4XMKH 3MNZB 1WFOA 1R3LB 1AC6A 1JF1A 2NPLX 1DDHB 5E9DB 3SE9H 5E99L 1S7RA 4NPYB 3DJ9A 1JV5A 3HUJE 4WWKC 4PB9L 5FGCE 2NY7H 1YUHA 1U0QA 4FG6C 5TFSH 3WN5B 2E9BA 4NT6A 1WIOA 3QFJB 4TOYL 4QRQA 4O51A 4EN3A 3BKCH 4NNXA 5EOQL 5KSAA 4XBEL 2EDJA 2NNAB 4JFYA 4NN5C 2BY2A 4NHCL 4F37F 5T33H 1FNEA 4CMHC 5IJKA 3MCLH 1VFMA 2ZNXA 3EOAA 5FKAA 4X7CC 5GJSL 1U8QA 1R3IL 1ZLVK 2JCCF 3PHOB 5C0FB 3RWJB 3I3EA 3D0VB 4OZHE 2HKHL 5K9KA 4FFZL 4G8IB 4PJEE 3NGBC 3NN8B 4TUJA 5K9QG 1KPVB 3LZFH 1PQZA 3GJFA 3BSZL 4GMTL 1IM3A 2R29H 5BW7C 2DM4A 3FB8B 5SWZE 1Q9KB 2DI7A 2Q6WA 1LK2A 6FABH 3AB0C 3HFMH 3SDYL 5ANME 5DA0B 5I15L 3UJTL 3CPLB 1MVUB 4MJID 3VW3L 4HIXH 4LCUA 2J5LC 3L5IA 3C60D 1WV7T 2NYYD 4HKJA 5DJCA 3DVIA 1D5XA 3DRQB 5GRWA 2ITDB 4GW5B 4H1LH 5F1KC 3GKWL 1A1OB 1XIWB 4PPTA 4MB3A 3T3PF 3CU1A 4D9LL 4XP9L 4XBGA 5DR5L 3MACH 2BOBA 4P2RE 1FGVH 5ITFB 4JY6A 1BIIB 1REIA 5FOBA 3L3GA 3MRHA 1M1SA 3TV3L 1MFBL 4YHKH 3ARUA 3L3JB 2LAGB 5C0CB 1MJJB 3U4EB 4X9BA 4OZFH 4PLJD 5IIEB 2QQQA 1MRCH 2WIMA 1QG3A 1MJ8H 4CVZA 3MREA 1U58A 4ETQB 2DQGH 3EHBD 2BX5A 4H26B 3U2SA 2B4CL 1AKJD 1ZGLB 1MCLA 1I8LA 3TJEH 1H15B 2CUHA 1GC1H 4KI5E 5BRZE 5IMLB 3P2TA 2I5YL 2WBKA 3VD7A 5FGCB 1J7VR 1T1ZB 3Q48A 2GK0B 2DAVA 2QEJA 5GGQL 3QXUA 1MCOL 4YGVA 4G7VH 3SGJA 5D71L 3GRWL 3O2VL 1QSEA 3KWWB 5CCKL 5D7JD 1D5MA 4XMLH 2HTKC 4OZIB 5FYJE 1F00I 1RU9H 1ZKAA 5IB1B 1TDQA 2Y5TB 4IDLA 4RAUA 4XCYA 2X4PA 1L4IA 4P23A 3AREC 3AY4A 4HT1L 2XPGB 1ZTXH 3ARBB 4C55A 4RMVA 3QDGE 1U8MB 4AK1A 3REVA 5GS1C 2J6EA 1QSFD 1LP9E 4HZLB 1JGEA 1SEQH 3NCCB 3SO3B 3MXWH 3WO4B 3U0PB 2VISB 2FJHB 2XT1B 2FL5B 2JELH 5SWZB 5KVDH 5T1KD 2JJTC 1G7QB 3D85A 3O2WL 1IQDB 1ZHKA 3WNPA 2X7LA 2XQBH 1PLGH 1IAOB 4W4NA 1FFPA 1U2HA 3EO9L 4CN1A 4OLVH 5MERB 3KYNB 3DMMA 3E6FA 2F5AL 3E8UH 3JV5A 4LLYB 1FYTE 4AQ1B 4QXGL 4LU5L 1J8HE 1U8KA 4JFEA 1RHHA 1N59A 1OHQA 5C9KA 3OZ9L 1MRDH 1T2JA 3VXPA 1NJ9B 2QSTA 1L0YA 4QRUB 2M26A 2DM2A 3PG2A 2XTJB 5BJTA 3B8YA 1N4XH 3QPQC 43CAB 1QLFB 2AJUH 5CZVH 5FGSA 5DC4B 3JSSA 1FN4A 4P5KB 4NJAL 5EZLA 2OMBA 5F7HA 4OD1H 5I0ZA 4DN3L 1NCBL 1JCKA 4KV5E 2WV3A 3TO2B 4XPAH 1GCFA 4PJIB 4LIQL 4MCZA 3MRGA 3P11L 3QYCA 2DQUL 4TSCH 5J9PA 3MBXL 2WUBL 3MCKA 2UZXB 5I1EL 3EO1A 5EWIH 3C08L 2NY0D 4KMQA 1QO3A 1CFSA 5J6GB 4U1HB 5J1SC 2ZKHH 4RDQG 2G2RB 3EYQD 3VXMA 1YDPA 5GJTL 2NXYB 4YAQB 1NMBH 5C7XH 2QQKH 2YA1A 2DM3A 3IAGC 1EIBA 4G8EB 4UDTB 4P9HH 3VWKB 1R6VA 1CFNB 4EI5D 4KDVA 4MA7L 1N64L 5KVGH 2KPNA 4HJGA 1XGRA 4I3SL 3EBAA 2NXZC 1HKLH 2WWKO 2EYSA 3IJHA 2MKWA 4HHAB 3C09B 3QCUH 3VFTA 1A4KA 3GSQA 5GXBB 3LKPB 3W5MA 4PJ9B 2XA8L 4HGKC 3BZDA 5I1GL 3BMVA 2E6JA 4IOIA 3MV9A 3P9LA 5DO2D 3BPLB 1EUTA 3BPNC 2C3XA 3SDAB 4J3OC 3SKOA 1A7PH 1Q0YL 2VE6B 5C2BH 4JKPH 5CP7A 2MPAH 4IRSB 3KDMB 2NY1C 3QPXL 4I13B 4J6RL 2YMXL 3ILQD 5GRJH 4OTXH 4A2MA 2XWJB 3WFBL 4WEUD 1XZ0B 5IK3A 1GGYA 4X6CB 3CDFA 1PZ5A 2GK2A 2BXZA 4MA8L 3FFCD 3QUZC 4MJ6B 4HFUL 5FF6B 3N50A 3HI6H 5ILTH 5HHNB 4X0KB 2WM0A 4P5MB 4F37K 1T5WB 3VGGA 1S7QB 4KJQD 4OCXH 2BVQA 2EDOA 4UMGA 1ZGLM 1A1NA 4GKNA 4J3VA 4U1KA 3M1BA 2O93L 3AS0A 4CAGA 4Y2DC 3JWDC 2V2WB 1NFKA 3VFPA 1FV1B 1CYGA 4MZ3A 2VITA 4Q6IB 3MLWH 2FZ3B 2BMKA 2A83B 4G9DA 2XOTA 3PV7A 3ZKSD 5CIPB 3LKQB 4RA3A 5EDXA 1FAIL 4F7TA 3O9WD 1QACA 1QSED 3HE6C 4U2ZA 5BZDB 3VJ6B 1VADB 4P2OA 2FH8A 2Z91B 3HA0A 1LDPL 1WIUA 2ZCKH 4NRZA 1BZ9A 2P43B 5JOPD 2IFFL 4I77L 4K71B 3ZL4H 1S7UA 4PY7A 4LQFH 4P23D 3O6FC 1RUML 1OSZB 1FVDA 3BVNA 3FN0L 1ZT4A 4ZQKB 2HN7A 3ARGB 1CXEA 2AK4A 3RPIB 4OLUL 4M7KL 3ARDA 5JTWA 2FECL 1RJCA 3QHFH 1U2CA 4UOW1 2EO1A 1MLBA 1H0DB 4OIIH 4H0GA 4MJIB 3E2HB 2AXFB 4X6DF 3CFJA 3OG6B 5DURB 3C60B 5F9WB 4ZPTB 3VRLE 3LAFA 3S37L 3D85D 3MRPA 5DJYA 1QKZH 4KXZI 1HNGA 3QBTB 4EVNA 2BNQE 1WBZB 5JORA 1T66D 3VXSB 1NBVL 3BEVA 3RDTC 3P0VL 3KYMA 4N0CD 4NNPH 3DMMD 4JM2F 4RGNE 3PDDA 1NDGA 1FZJA 3NBNA 4O2EA 3KJ6L 5J06A 5DJXA 2R8SH 3IDNA 2R0ZL 4OZ4B 2HVJA 4JFED 2BC4B 2RGSA 4U1MA 2AI0L 4Z8FL 1KCUH 3GNML 4ZXBC 2DF3A 3IRZA 3CLEL 2BJML 3MRMA 5HGGS 1ZHNB 3CH8A 2E7CA 3B9KA 4PP1C 5A2FA 1OAUL 2HT3C 1M7IB 1D9KC 4KUZL 1ZHLB 1AKJB 3QNZA 5FKPB 2A6KB 1OAXL 1K4CB 3K0WA 4G80B 1T89C 3ZO0A 2MKLC 5D5ME 1K6QH 1FO0A 1CGSL 4MD0A 2Q3AA 3T0VA 2VB5A 3OR7A 4U1GB 1CXHA 1AGDB 2YBRA 3ZZ1A 3VWJA 4YDVA 1N7ML 3B2VH 1MJUH 4FQXC 1F6AA 2H3NB 1A9EB 2I60L 3L7EA 5D1XC 3D2UD 2V5SA 3HE7C 4NWTH 1S7SA 2YPVH 5D7JB 1H3PL 4YQXL 1A7BA 3LQAH 4HUVA 4ODSL 3JVGC 4GQ9L 4QNPF 4ZUUA 2WIIB 3R0MA 2XRAL 4G9FE 4WJ5B 5DS8B 5B38G 1F4HA 1BGXL 5JMOC 2AEQL 2JK5A 3RRQA 3U9PH 1YEKL 3P77A 2VQUA 1SYSA 4JPWH 3WJLA 3UZEA 1DSFH 1QSFB 1CFTA 1E4KC 3TT1H 2PXYA 2Z8SA 1SHMA 2R0KH 3S35H 1W0VB 4KI5C 2JIXA 3LOWA 3QUMH 1KC5L 1K3ZA 1SEBA 4RAVA 3ZHDA 5KSVB 3VGAC 2XKSA 5JPNB 2R2BB 5T1KB 4DZ8B 4G7YL 1INEL 3MV9D 2YA0A 3WFEL 4QXTB 1I8IB 4P99A 2Q7YA 1CR9H 3BIKB 1ORQB 4NP4L 4LVHB 3O11B 1QNZH 5FUCE 1SJEB 1T0NA 3VFUA 4X6DA 4PRAB 5C0JA 4U49A 3TJHD 2OSLA 1HHJB 5DVLA 1OQXA 5DJ6B 1LILA 4OZGF 3U0TB 3G6JE 3FFCE 4NFCA 4XNUH 4CBPA 5DJDA 1AH1A 3MJ7A 4P3DB 4JM2A 2A73B 3NVQA 4NQSB 1ZWIA 2CRMA 5CP3H 2AVGA 4RIRB 1DBBH 1T2QH 3LB6D 4YH6A 32C2A 1Q72L 1JF1B 5E1AA 1JMXA 1S7RB 1JV5B 3SDCC 4NM4H 3BP7A 1AJ7L 1CFVL 2DLFH 1OAKL 1E4WH 1YUHB 1HXYA 4F58L 4X6BA 5GGTH 2VXSH 1BEYL 4NT6B 3F5WA 2FSEA 4OCMC 5CUSH 4W4OA 4LFHG 4QRQB 4O51B 4XVSH 4EN3B 5IVXE 4NNXB 3SCMA 3S96A 2QHRH 2XNAA 1A6ZA 3RZCA 4JFYB 1Z2KA 1CD1B 1FNEB 5DVOA 1A6WL 2OTWA 2MQ0A 4U7MA 4LASL 5JOPE 1ZT1A 4LEOA 4UT7H 3EOAB 1KGCD 2NY0B 5FKAB 3U0WH 2VDNL 1U8QB 4NUGL 5JXEA 4MXVF 3CMOH 1GPOL 5K9KB 3QQ3A 2ZUTA 2JCCE 3Q2CA 3TVMD 4TUJB 3FO1A 4L1DA 5FA3A 4JVUA 1NFIA 3MXVH 4IRZL 5B8CA 1DR9A 1PQZB 3LEYL 3BKYH 3GJFB 5D1QC 4MSWA 1IM3B 4MXQD 4BQ6A 3H9SA 2AK4D 3S9DB 3ARDD 3QIWA 2EDHA 2Q6WB 1I3GL 4NQEA 1G6RL 2CKNA 1T03L 4PJHE 4WV1A 4UILH 5FAAA 5CJQL 1TLKA 2MCPH 5C86A 4LCUB 3K2UL 1YYLH 4FOMA 4MA1C 2A9MH 4HKJB 5DJCB 1D5XB 1U3JA 2DQDH 3DI3B 5C9JB 2KQNA 1IM9A 4DKFL 5I76A 3U48A 1EK3A 1J5OL 4J2XA 4XBGB 4ZSOA 2CKBL 2IBZY 2BOBB 1S7XA 3TYGL 5E8NA 4JY6B 3N1QC 2DQHH 1OGTA 3JTTA 3L3GB 4Y4KD 3MRHB 4NHUA 3REWA 3VXTA 5FOBB 2C5DC 4K3JH 3RAJH 2E7LA 3LQMA 2WZPD 2D7QA 1EHLL 2YWZA 4QOKD 1CF8L 1U92A 2DDQH 2DL9A 4BFIA 5KBNC 5JW4N 4JHAH 4AZ8A 4CVZB 3MREB 1U58B 4WGVB 4M7LH 5DZLA 4RMTA 3VXRA 4QRSA 1R3KA 3U2SB 4HPYH 4LKCA 4K23L 4EKXA 2MJWA 3QEGL 5GS0H 1JWMA 2CIIB 1A6UL 1MFAH 2IGFH 2PO6A 1JRHL 4GSDH 5C09E 1X4YA 4F9PA 2WAHA 4PJDF 4HWBL 1V3LA 4DVBA 2J88H 1NBQA 2BERA 1UA6H 3BH8A 4YGVB 3VWJD 2QKIA 1T0PB 4NOFA 4Z7UA 5EC2A 1IGCH 1HZHH 5E00B 4TYUA 3S34H 3HKFA 5I66A 1QSEB 4N0YH 4GRLA 4NO2A 1EUUA 5C0GA 2EE6A 1QBBA 1X7QA 1Z5LA 1FVEA 1YNLH 4RAUB 4XCYB 2X4PB 4MXWL 4P23B 3QI9A 2VLLA 4XVUD 3R8QA 4YHLH 5HPMA 2P24A 4WUKH 5FCSH 3REVB 2OI9B 1SY6H 3QXDA 1JHKH 2AKRA 3Q1SH 4D3CL 3BOVA 3AAZA 1JGEB 3EJZC 3UPRA 3DUHA 4NYLA 4EXPX 2JIXD 1E4XI 1A6VL 1K8IA 4P5TC 3F7QA 1J0YA 4JFFA 4QF1A 3OJ2C 3WXVH 1Q9LA 3D85B 4K7FB 4LSPL 1CFQA 5L0QC 1RURL 4KRMB 1ZHKB 3S37X 4NQCE 2X7LB 2NX5A 1MHHA 3BDYH 5FHBL 1ZLUH 5EO1A 4U7SA 1XF2A 4KK8C 2K7QA 4DQOH 4XWGH 2CLZA 3DMMB 3O4OB 4M6ML 1FIGH 2IAMA 3E6FB 3RWCA 1OTSC 2Y06L 5DFVD 4LHUD 4YNYA 4HIEA 4XPGH 1U8KB 4TSBL 4JFEB 4Z5RA 2LTQC 2YUXA 1RHHB 2GEEA 1N59B 7FABH 2DMKA 2XIDA 3VXPB 5D6DA 3I6GA 4NJ9H 4Y4HA 2D9CA 3L1OH 4V1DD 3WFDH 1DN0A 5CINL 4DKAA 4JM2D 2DI8A 2C3GA 4P2YA 1CLCA 1P4BL 5BJTB 4JJ5B 1C1EL 5AD0A 1YNKH 2FH6A 4GAGH 1MIEL 5JHLL 4GG6E 5CGYC 2ZG2A 3VFVA 3WMSA 1A6TA 1WZMA 4WWID 5ALCH 4DTGL 2IANA 2P5WD 1GC1C 3BUTA 3U4BL 5EZLB 1E6JH 4WHDA 1BPVA 2GJJA 1AY1L 4OQTL 4J3UA 1Y0LA 2OTUA 1I1RA 3WLWC 5HDQL 4PRPA 2DD8L 2EIBA 2NR6D 4MCZB 3IDGA 5MI0B 3MRGB 3NFSL 1PBYA 5HHME 5J9PB 5CD5C 1QA9A 5HVHC 2DLGA 3B9EA 3MCKB 3EO1B 5GPRA 3MYZA 3WFZA 1CFSB 1XF4A 5KSBF 4YFLF 4PJDA 1R0AL 5JXED 1YDPB 3PGCA 2ADIA 1AXTH 2QSCH 1IE5A 4LBEA 3MFFA 2B8OT 1D5IH 1OAYL 3LS5L 1TTUA 2GUOA 4M5ZL 4HJGB 1XGRB 3H9SD 2EYSB 3IJHB 2PNDA 3VFTB 4C83A 3C5ZD 1A4KB 1A21A 3GSQB 3A6CH 1II4E 5SX4H 4Z7QE 4IOIB 4RWYL 3MV9B 3H8NA 4PRID 3V8CA 4ODWA 1WFUA 4LRNH 1IM9D 15C8L 2VXTH 2ENYA 3HC4L 3SKOB 1ZANH 2QQLL 5J8OA 3BP4A 4A6YL 1FE8L 4OI8A 3L5JA 1OM3L 2X42A 3QCVL 1BWMA 4R9HA 5CP7B 3LRSA 4R7DA 3GIZL 4QOKE 5F89A 2OJZH 3TBWA 2Q8AH 3ULSA 5D8JL 4E9LA 1RFDH 3ULVH 5D7SH 4ZPVA 4M62H 4Z7OF 2QHLA 5IK3B 4LRIC 1PZ5B 1WJ3A 3KR3L 3OB0K 2DBLL 1P2CA