4MAMA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an adp analog, amp-cp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
373
structure length
373
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIAGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ADP analog, AMP-CP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 121
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4mamA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4mamA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mamA01
3SE7A 2YW2A 2PBZA 2FPIB 2R87A 3ORQA 3U54A 4O7SA 3BFPA 4ZQIA 4YJ2F 2CQYA 3WNZA 1AUVA 2J9GA 5CB4F 2YS6A 1PX2A 3BSWA 3TQTA 2WYOA 3RV4A 3RUPA 5GONF 5JVDF 4O7TA 4ZHQF 5BMVF 3V4ZA 1EHIA 2DWCA 3OUUA 2IP4A 4O7ZA 3RV3A 4C5BA 5BPFA 3ETJA 2DLNA 3U55A 2Z04A 1EUDB 3K5IA 2GPSA 3QFFA 5LXTF 1KC7A 2HGSA 3VMMA 3OUZA 4O7WA 2VPQA 1IOVA 2YYAA 4HQ6A 2PVPA 2YRWA 1C30A 5K2MA 4QSHA 2FPPB 1M0TA 3LWBA 4O7VA 2YWVA 2W71A 5HBRB 5D8DA 4EA8A 2NU6B 4FGRA 1CQIB 1GSAA 4XYMB 3WO0A 1C3OA 2YZNA 3RFCA 3DF7A 2I87A 1B6RA 2R7KA 1M6VA 4XZ3B 3KAKA 4O4LF 1VBHA 1E4EB 1CE8A 1I7LA 4RZQA 1KJIA 4Y8VB 3U9SA 3NUAA 1KJQA 3GLKA 4HNVA 2I80A 4C5AA 5JH7F 3E5NA 4IWXA 3VPBA 2DZDA 1EUCB 4MV4A 2W6MA 4MV3A 1GLVA 3JZIA 1KEEA 5KX5F 4O86A 4DLKA 3VOTA 3VA7A 3AW8A 4MV8A 2SCUB 1WR2A 2ZDHA 3MWDA 1KJ8A 3N8DA 4I50F 4ME6A 2ZDGA 1JDBB 2NUAB 4FFOA 1AUXA 1KBLA 4O7LA 2XD4A 2W6NA 5IYZF 1KJ9A 2FP4B 2CNUA 1VKZA 5H80A 1JDEA 3HB9A 4O81A 2W6PA 1GSOA 4EABA 4WBNF 2X0SA 5DMXA 1CQJB 4NYEA 3VPCA 2HJWA 4EA7A 1Z2NX 4FU0A 5C1OA 3Q2OA 2W6ZA 2XCLA 1UC9A 2I8CA 2R84A 4MV9A 4FFLA 4MV1A 1KUTA 5JVLA 2C00A 4EGJA 4O2AF 2R7NA 4EAAA 5LA6F 1DV1A 4O4JF 2V59A 3K5HA 1EYZA 3TIIA 1M0WA 3ETHA 4IWYA 3LP8A 3V4SA 2V58A 4O4HF 5LP6F 2OLSA 4FFNA 3Q1KA 4O84A 3U9TA 4IIJF 3TINA 2R7LA 4XX0B 4IZOA 1EZ1A 4O7YA 4O7RA 5LYJF 3KREA 4XYLB 2CNVA 2V5AA 2YZLA 4O7NA 1A9XA 3I12A 3TIGA 4HR7A 1Z2OX 1B6SA 4EA9A 4FFRA 3HBLA 4YBZB 3G8CA 5CAEB 4YAKB 3BSSA 2NU7B 4FFPA 3R5FA 4GGMX 2R7MA 4MA5A 5I47A 2NPOA 2R6FA 4L1KA 1BXRA 1JLLB 3R5HA 1CS0A 2DIKA 4O82A 1GGOA 3K3PA 2NU9B 2PN1A 1PK8A 4ZOLF 1W96A 4YB8B 2W6QA 2YS7A 4J6EA 4M9UA 5C1PA 4HNTA 2QF7A 4TUYF 1JKJB 2VR1A 2P0AA 1IOWA 4I55F 3R5XA 1BNCA 3GIDA 3BG5A 3AX6A 3MWEA 4EG0A 4IHJF 4EGQA 1A48A 1ULZA 2FPGB 1OBDA 2GQRA 2NU8B 1OBGA 5BPHA 3R23A 4MAMA 3G8DA 4E4TA 1DV2A 3JRXA 2CNQA 2R85A 2YZMA 4YJ3F 5KKNB 2FB9A 2Z02A 2W70A 4O83A 1E4EA 4TV8F 1W93A 5JQWA 3MJFA 4FFMA 4M99A 4M98A 2VQDA 1I7NA 5J2UF 4DIMA 3JZFA 5J2TF 2VHEA 1DIKA 4FE2A 2GQSA 4O2BF 3R9RA 5FNVF 4MV7A 5LOVF 4I4TF 5JQGF 5CA1F 3N6RA 3JRWA 5CA0F 1VBGA 1UC8A 1T36A 2YRXA 4MA0A 2YL2A 1Z2PX 4TV9F 3KAJA 4MV6A 2ZDQA 1KJJA 3BSYA 3WO1A 3ORRA 4O4IF 3KALA 4C5CA 4HNUA 1SCUB 4M9CA 4WD3A 2R86A 2CZGA 2QK4A 2R82A 3TW6A 3HO8A 2YZGA 1GSHA 3VPDA 5HV6A 4ZI7F 5EZYF 4YAJB 2GPWA 2GLTA 2W6OA 5C8YF 3UFXB
chains in the Genus database with same CATH superfamily
1T1GA 4JP2A 1E9AA 2I6FA 4EMUA 4RFVA 1XNRB 3JQ8A 5K09A 3P9XA 4X6UA 2WSIA 5FI1B 4DWWA 2XB9A 2VXOA 5M5BA 3VBCA 2YJGA 4D41A 4ZALA 3RAGA 4A36A 3PTZA 2QZZA 1FJGB 3RUDA 4BP3A 3GEMA 1RWBA 1Z9BA 3IR6A 4XZ3A 3ZLUA 3I4MG 1OE0A 1XQYA 3GILA 3ELUA 2IVZA 3OAAA 5EI5A 3GTJA 2W6JA 1CF4A 2WJJA 1FU8A 2LGJA 4WXMA 1X19A 4DIUA 1B8OA 1B6RA 5I5GA 5BW5A 2VA2A 1JG3A 4KXLA 4ZCQA 4GAEA 1BE6A 1U7ZA 3IUSA 1N57A 3H5AA 1U63A 2AVNA 1BRMA 2ZIXB 4DARA 1I5RA 5AKYA 2PMFA 4OXQA 1U3DA 4B83A 2HMYB 1GNLA 4MQLA 5KFXA 1PDOA 1DJNA 2FFHA 5AVWA 1B14A 3OJCA 2GN0A 4LDQA 5BWWA 3WMWA 4P7KA 4F4HA 1Z25A 1HOXA 4PCAA 2HHFB 1ORHA 3WJ2A 3OKAA 4GPZA 2QA5A 2QAGA 1R27A 4MRMA 5A71A 4XRGA 1PVVA 3WKDA 2KJQA 4KNWA 4RS4A 4AIRA 4E1BA 5IWAH 3R3ZA 1XMPA 4C76A 4DL2A 1QH1B 5KJCA 2XBMA 3UG6A 1DQZA 4X1OA 5EUBA 1J1IA 4WKNA 4BFTA 4MCAA 4KR3A 4MYCA 1NXPA 5ALQA 1R9NA 4MW7A 5L3VA 2Q8NA 4RKRA 4R3UC 3O3NB 3ZZTA 4O4HF 2C35B 2OFOA 3DDNA 4HQKA 4J7UA 3TX6A 4D9HA 2PGXA 1UC5B 4Z1MA 4DRFA 3IALA 2QM0A 1PQPA 3DP7A 3QVTA 3TF5A 5TNXA 4AZVA 2UXDH 3JQCA 4G9EA 4YRTA 5JUMA 2GCPA 1QZZA 3CONA 1N0HA 1GUFA 3CCBA 2BN4A 4XX1A 4Z7JA 3L6EA 1UINA 2GHQA 3PUWA 4EDFA 3ADBA 3HYSA 3MFQA 1PI3A 3CVUA 1ZJJA 2Q5FA 3OFNA 3L07A 3T3IA 4TYNA 4IMPA 4QODA 1BWSA 3V6MA 1L4FA 1TQHA 4H77A 5J4KA 3UQYS 4K7JA 3ZEAA 5DKFA 5G0SA 4I4LA 3TKYA 4YP1A 1E2BA 1C4XA 1LLDA 3LCVB 1PP4A 4MS3B 4AY2A 3BMOA 3EOZA 5CVCA 5DVZA 5L3QB 3R5XA 4ZREA 4A6XA 4JP5A 1EVYA 3GTQA 4YIHA 3OBBA 4BLUA 2XODA 3LUGA 3PW4A 2WSLA 4BXOB 5KAPA 1MXHA 1ZD1A 1V8OA 3SBOA 4BV8A 3S7TA 3ILHA 3U16A 1AXGA 1K86A 3LQ2A 1J20A 2WF5A 5K8JB 3PA6A 1B73A 3U5TA 2RI0A 5FCDA 3PR2B 1ODTC 1M8PA 2E2HA 1KDRA 1GFZA 4E88A 4IY1A 1BZYA 3P4XA 2Y0EA 4FW9A 4RHEA 3IAS6 1AXRA 3HUTA 4RZXA 3S4YA 2WJVA 1R0ZA 4R9UC 2FFQA 2FWBA 4L15A 2NNLD 4R4JA 1U90A 4ER3A 2XMQA 4EMBA 1XR3A 4WECA 4UVEA 4TL7A 3HVJA 4D82A 2W9AA 3P71T 1WXFA 4XRRA 3LSTA 4C3VA 4RDXA 1ADJA 5FLXW 3HR7A 3SNHA 3VR3A 4WBXC 2NVUA 3VAZA 1OXSC 1AQNA 2YV4A 5JANA 2UXCB 3V55A 4HX5A 4QLOA 4X0EA 3H2ZA 2RCNA 4LI0A 4YAFA 1AV6A 4CL2A 4QBIA 3ZHQA 2HXYA 1II8A 2B8EA 3BTOA 1ZP6A 1D2RA 5H68A 1B1AA 2O0LA 1L4EA 4U00A 1LBHA 1GYQA 4DAOA 4YP7A 2J3HA 4OX9B 4LGCA 4UOEA 4NCKA 1OXKB 3RO7A 1U0RA 1FTWA 1P17A 3OJXA 4LGMA 1TUBA 4PRZA 1EVEA 5EA2A 3FMVA 3FUTA 4GUAA 5G0VA 3F4LA 1E60A 1KDYA 2CCJA 1UM9B 2WSYB 3HR8A 3W3ZB 4D45A 3T9AA 4Z53A 3AHDA 3RIYA 5BO5A 3TE7A 4GOOD 3HCAA 5DXAA 4N5NA 3NBUA 4O2AA 4JLDA 1K6MA 2J3IA 2FF5A 4V0MA 1CUAA 2D3WA 3VR0A 1KMCA 3IVRA 2WJZB 2GDJA 5BR8H 4FR5A 1SG9A 4E0BA 4NBKA 3EGEA 1PTJA 5HKBA 5CPFA 2PLAA 1K3FA 3MT8A 3CH7A 3QITA 2VYVA 2YHBA 3ND8A 3PPYA 3STXA 1EBUA 4LX0A 3UAVA 4FIZA 1ORDA 4E07A 4LWPA 4GBMA 3BGIA 3KVVA 4C4TA 2P7IA 3WIBA 3OE7A 3TOVA 1B3BA 2IEIA 1U8FO 2D54A 3L18A 5G3YA 1Z8NA 6REQB 5FLKA 4FCCA 4EF4A 3OOJA 2HUNA 4Q45A 4P5PA 3B3GA 4IPTA 2AV6A 4HNGA 2X1VA 2XCLA 5B12A 3M9OB 3TMAA 1THGA 1L4NA 1I32A 1UXHA 5E1OA 3UKJA 4H2DA 2B2CA 1TX4B 4ECWA 4BBZA 1Z4QA 2ZAMA 2NP7A 1VP3A 3HL4A 4DRZA 2EWWA 2R6CA 3MFHA 3O38A 2GYUA 3TQRA 2YWHA 2VTBA 3G2PA 2HPHA 1JKFA 1GNSA 4Y1RA 1JB1A 5FBWB 1G21B 1OT3A 4EA9A 5TQJA 2PKYX 1VBMA 4JQOA 5EMKA 3IPCA 5B3JC 1RYZA 4E4YA 4YMVA 5DLQC 4S1VA 4CWAA 5B1IA 1J5XA 5LOVA 3OEEA 5JNWA 5LQCA 3SN6A 3KQUA 5JE8A 2XGSA 3CH6A 3HMQA 4IDHA 4M9SA 1H2RS 1NN5A 5AXBA 1APBA 2ZWPA 3ROZA 1JI0A 2H1VA 2UVUA 4LJ4A 2FR8A 5HDQA 2BGLA 4WFKA 4F1JA 5B7PA 3N07A 3HEBA 2QLTA 2J09A 1S6YA 4RGBA 4V0SA 3FJYA 4RL6A 1H9AA 2AK2A 4PF1A 2JG3A 4OQZA 2NVOA 3RNLA 2YHAA 2OECA 2JRLA 2QD1A 3VGJA 4AZTA 4RPCA 2ZM5A 2DWUA 4N82A 5ABPA 1EXVA 4UW9A 2IC5A 1OFIA 3SE0A 2OG2A 1EU1A 1QYDA 1NT2A 4CQNA 1B4DA 1JIVA 2BYTA 3K0HA 3F6BX 2D2IA 3O8QA 5T41A 5THQA 4KITB 1IIBA 3M4ZA 1EDOA 4RM2A 4M8SA 3UZBA 1G5QA 2YCLA 4XPIB 2VNIA 2CNKA 3IXLA 4RAZA 4AUKA 5TPZD 2WWTA 5TGTA 4QXMA 4DSOA 4YDQA 4OLAA 4NMLA 2Q7OE 2FJUA 4KI0A 5LXTB 5JS6A 1SHJA 3AGPA 1WG8A 2IHKA 1CY7A 2OMKA 5BWCA 5E8JA 5KTOA 4O4IF 5BWLA 1F4PA 3W2EA 2Q2OA 1QTNA 3OM0A 3IVAA 5K0FA 3EEBA 3E2IA 2EGGA 5KYUA 2O5CA 3WGUA 1S9HA 1JYSA 2F59A 1TO1E 1P0PA 1XU7A 4KQMA 3Q12A 2JI4A 4OQDA 2PS1A 1R3UA 4UZFA 2CL0X 1LNQA 1JXQA 1PX2A 4C2BA 4FYVA 4X85A 4DR6B 1KFBB 3ZU6A 5L7WA 4UD2A 4L8VA 3WGYA 3JWPA 4RTLA 4LDAA 1S01A 3WL3A 2Z98A 2VDWB 5CK5A 2FNAA 3DAYA 1RNLA 4J6FA 2XIGA 2E5WA 5MHTA 1TYZA 2Q5LA 3GA5A 5G3ZA 5JWRA 2QMOA 3U09A 3AY3A 1W6UA 4YJ2B 1W9MA 1ZN2A 3QUSA 3PFCA 2O0JA 3WO0A 4DQUA 1TPZA 4YBZA 1UUFA 1YQXA 2PKRA 3NP7A 2VBGA 2YOHA 4DLTA 1DDGA 3HOWG 4MWBA 2O06A 3IHTA 5L1JA 3WP0A 4KAJA 2X2FA 1JEJA 1OD6A 3DNPA 1JSRA 1ZGJA 1S0OA 1W44A 2PG3A 2GTPA 2Q6LA 3BMNA 3BF8A 1RZRD 1AQLA 5TQ0A 2XCOA 2OCIA 1B23P 2ILTA 3G7UA 1SXIA 4MOWA 4J0EA 4JWKA 2W0SA 1VLQA 4FFOA 3NRJA 4JXJA 4UE2A 1T5LA 1BIFA 4EJSB 3JD1A 2ODQA 2QTFA 4KLNA 2J3QA 1W47A 4O81A 3K8QA 1W2GA 4NESA 4UAVA 4GWGA 2B61A 1J24A 3B38A 3Q2OA 4HGRA 1G0NA 2KX7A 1XTQA 5E1BA 5ALIA 3K53A 1JR3A 4YPFA 3JQAA 2ODWA 3AF2A 3ZEIA 4K6HA 4IOMA 1H1LB 1I80A 2OGUA 1PO7A 3V4RA 3AERB 3ESXA 2DFVA 2WHRA 2UZ4A 5ALHA 7REQB 3VHXB 4TL8A 5EJ6A 2LE0A 4X97A 3GOHA 2GZAA 2B1GA 1SZDA 1DXYA 1RRGA 1B0PA 5KQMA 5EJ7A 1UDWA 2JFNA 4O7RA 5LYJF 1J0XO 1WCYA 2Y0CA 4MUJA 2JLVA 4TKZA 3EEOA 3QHQA 4MWGA 1HNXB 1QIDA 5A7HA 3VZDA 1KZYC 1TKRA 4GOXA 4AROA 1OIVA 3AYZB 4J0DA 2P2CA 5K0JA 2J07A 3Q7QA 3HM2A 1T2VA 2ONZA 3FGNA 2OGZA 2V6MA 4LRTB 3FKSD 1KPIA 1X77A 1YOBA 3SFTA 1CXZA 4WZBE 1XAHA 4ALIA 4KQ1A 1VZ3A 4UFNA 2WTMA 2Q4BA 1HBJA 1GPMA 3P9QA 3ETCA 1XD8A 2G83A 4HGPA 3LX4A 1INLA 2MIIA 2R0QC 4BO8A 4JI8B 4K1LA 2DY0A 3UOGA 5AT1A 3P9ZA 2H29A 4LG1A 4N3CA 2FTKE 3D7SA 1IQ0A 4INAA 3WGQA 4F71A 3ESYA 1AQUA 5ESRA 4HRVA 2RB4A 2WPNA 3SNKA 3A6JA 2J08A 2HVQA 4FEGA 2CB9A 2DABA 2PDAA 3BPSA 4TMYA 3DTVA 2EHJA 2QTWB 3VX4A 5K0EA 2NO4A 4DL9A 1QG2A 2GEFA 5FPTA 1AS3A 4AJ4A 621PA 3C24A 1UCFA 3R76A 3ZJ5A 5TSDA 3ZS8A 4PNPA 3G0CA 2VJNA 3WLEA 2TS1A 3PUZA 3WLNA 5DYIA 3X1KA 3A1FA 1TYCA 2HNAA 3EXIB 1XNQH 1ZINA 1P2BA 2V45A 3GEIA 4QIHA 1YVUA 3DM5A 5FL3A 3EXEA 5F7JA 4DLWA 3Q7PA 1Q0SA 1DJPA 2BSXA 1LFDB 5J59A 5JZBA 1NBIA 5CFQA 2I7CA 4C04A 4MS4A 1BS2A 1TAUA 1IBKH 4BU0A 3W04A 1V8BA 1VGVA 4RF4A 2O1XA 3I5AA 2ZTMA 1S0NA 5GOZA 2ASJA 1ID1A 1TQ4A 3EZFA 4A2WA 3KXYT 1K3UB 2ZS7A 3NEAA 3U0VA 3LKVA 3OUUA 1ZN7A 3IUYA 1JDTA 1J8MF 2LTAA 1Y8ZA 4US2R 4LYJA 5DQGA 4YVFA 4JB3A 1P8LA 4EW1A 1J9GA 1GG5A 4FXPA 4LDZA 4O7VA 3CE9A 5A3VA 4X7PA 3B2NA 2XGPA 3VM6A 1BWQA 1MV5A 1M2OA 5T6BA 1E9SA 1JFTA 2PL9A 4CQMB 4UEJA 5KI6A 2FLNA 1U7OA 3NHZA 3C7TA 4MS1A 4RJLA 1J5EH 3L4JA 4O4LF 5IYCG 1SPBS 5H70A 1GQSA 2Q27A 3PK0A 2GPAA 4FJ1A 2WNSA 1TAGA 5C7YA 2DZDA 4F8EA 4HJRA 4LF4B 5D5PA 2FG6C 5FI3A 1T1RA 1LY1A 4EGFA 5FAXA 3LWZA 4QQRA 3PDJA 9ATCA 1YE5A 1EZZA 1VJRA 1XOIA 2Y27A 3IDOA 3IVXA 2XNHA 1G38A 3TNJA 1EXMA 3MUFA 2NXNA 3PEYA 1TMOA 1G8JA 1Z6XA 3BCHA 4FOOA 4YHHB 4PAOA 2DG2A 5ES4B 4RVUA 5IYZF 2IRWA 2PFSA 1JSLA 3N42B 4A5SA 2QUJA 1BX1A 1FQKA 4IHQA 1CJBA 1R0LA 2ZWVA 4JVNA 1ND5A 2PE5A 1RE0A 1PFQA 2RDJA 1D2CA 1NIJA 1IM8A 1K06A 1ZJ6A 4L3WA 1Y9EA 2ZM6B 3T1YB 3MJDA 1YRYE 4JOSA 4HDMA 1K8YB 1DV1A 2JB9A 3WIOA 2RB5A 3T6KA 3QX7A 3MK31 2V74B 3SQXA 5AOCA 4KXUA 1HDRA 2WWHA 1P5HA 3E3MA 1T29A 3IUEA 3ZQJA 5H7XA 2VPYA 5E0KB 5JSFA 2J3KA 2FZ5A 1RI2A 1EKPA 3DMTA 2VDOB 1DTEA 2MCTA 1V41E 3JQ6A 4D57A 1X0XA 3G68A 2G08A 4LJSA 2JIMA 1U8XX 3BWBA 1EFPB 3WDLA 1FXWF 1FW8A 4MP8A 4CLHA 1MO6A 1VLHA 1K0FA 5L45A 2G1UA 1GTVA 2FSPA 3FRIA 4IM7A 1JIXA 3HQ4O 1J1UA 3FSRA 4RKEA 1C29B 1PZMA 2B8WA 5JLJA 1FDRA 3KKEA 1LK0A 2EW8A 3PC4A 2GKSA 1Y7HA 4F6CA 1YQGA 3HJFA 1TU4A 2GOYA 1U0GA 2A3NA 4KX3A 1HT2E 2HK7A 1VHWA 1C0EA 1KQPA 1GITA 2DEUA 4AKHA 1CVIA 4TS4A 2H63A 4I1UA 3IOMA 4F6RA 3QLUC 5LFAA 5BW8A 1OBGA 1MEOA 5LVAA 4WBSA 4F4IA 2WYHA 1YUMA 3GHYA 5U4XA 2XPCA 5LQDA 4ZKEA 1QRDA 1QB7A 2XMZA 1Q7CA 5DT9A 2KYRA 1QFYA 3COSA 4M7WA 2Y1GA 2QIOA 3EEFA 2FZ4A 3V6KA 1CZLA 2F55A 5LZ5A 5KYWB 3R5KA 3HNPA 3RTEA 4OAOA 7GPBA 2QZSA 4E2FA 2N75A 2Q6VA 2Y66A 3ZPXA 2VNSA 4Y67A 3D6UA 1MB4A 4MR8B 4CQLA 4JI1B 1W19A 1J0EA 4HQFA 1T9GR 4BB6A 3BMQA 3BXFA 3ERCA 1S0UA 1YB6A 3FPHA 3OZFA 3SBXA 4JYAB 5DV9A 3A1EA 1R6UA 4GZ6A 4XFKA 1TC1A 4C5CA 4FFDA 1IM2A 3W9SA 1U2TA 4GICA 3L7MA 4GDFA 1RM3A 1PR5A 1ZWLA 3TZ6A 3HHEA 1WW2A 2P9CA 5BWBA 1PF7E 1QYXA 3AOEA 2H4XA 1GSHA 1SBIA 1TUGA 2E9SA 1IBSA 3B6KA 1A50B 1XA3A 2O2IA 1LPBB 1UBJS 1X7WB 4DCNA 1QRUA 5F1YA 3SI7A 3T4UA 2V0NA 1E3DA 3O8BA 3HJUA 2WPDA 2WYOA 3M89A 3HKZA 4EHAA 5TMPA 2QKYA 5AM5A 2FZKA 4WXEA 5DGHA 2J59A 2NUTB 2R3SA 4P31A 1F1JA 4B85A 1JEAA 2Q0XA 4AYXA 1KAEA 3VTZA 4B2IA 1WEKA 2XTMA 5I4IA 1CQPA 1DIAA 3EDYA 4LMBA 4RZ2A 1ZSYA 2VQSA 2UUBB 3H1BA 1CYDA 2RARA 3NDBB 3FYHA 3HJHA 1M34A 2PUAA 3PCRB 2E21A 3Q8SB 2QM3A 2GAAA 2AZDA 4URHA 5J40A 4BZXA 5DTMA 4Y6RA 5F2NA 4ED0A 1CJUC 1ETHA 5AVQA 1NYQA 3SVTA 4KVAA 5G40A 3DBRA 5CYFA 2R7KA 4Z0NA 2HA4A 3TTYA 2HHLA 4XJTA 1S4QA 2Y1LA 1TVMA 5JSUA 2E37A 4D2IA 3A36A 2AD1A 1MO3A 2ATVA 2I7DA 2WILA 3UH0A 2V7XA 4S04A 2HQ1A 2G4VA 1RTKA 4MI3A 4Q0MA 1R9MA 5DTEA 4GP7A 2W9CA 4TV9A 1V26A 2VUGA 3QPBA 3IQFA 1OWTA 3MGCA 3QOYA 4HB0A 3NHAA 1GFIA 4BQEA 5IKXA 3IAHA 1JHPA 4EKIA 3UBTA 4OAQA 4NOLA 4FS1A 1M2NA 1SU4A 3ZV4A 4L2IB 5DYNA 1VJDA 3LP8A 4UULA 2QUZA 4ECVA 4PPYA 2X7XA 3K70C 2AEFA 3WWEA 4JMLA 5FO0A 5J4LA 3F9RA 1J8VA 4K46A 1Z17A 4FHGA 3G6WA 3FDXA 4O7YA 3UAYA 3R44A 3FOWA 3L4BA 4TXJA 1UAAA 3RASA 3ZHTA 1MFZA 2BI8A 2QJTA 1LNSA 2X3FA 2ZKLA 2C95A 5AKIA 1R5NA 3ICOA 5DLGA 1U9CA 3QBVA 4I6EA 1ICIA 4RIIA 4EFLA 5EE0A 2CSXA 4LGYA 2PS0A 5JBNA 5KB3A 2R6FA 4PAQA 1M5TA 4HEA1 2XSZD 3NW9A 3T7CA 1AF4A 3U62A 5AK4A 3T7TA 3D3WB 3M6VA 2W2MA 1FIUA 5E2AA 4H1HA 3UJPA 5KTTA 4NENB 5T14A 1NW7A 1G0OA 4MQMA 2UZ1A 4EJMA 4UBMA 3OX2A 3NWBA 4QIWA 3LT1A 4J43A 4H1WA 1YS7A 2C2ZA 2HCBA 2HXSA 2CC2A 3UAZA 3C3XA 3B5JA 3WADA 5GIOE 4MVJG 4PYOA 4EQ5A 2HY7A 3L05A 4EGQA 1L4HA 4YR9A 4IFIA 3DKKA 1GG9A 4EA6A 1VQ1A 3OQ1A 4OP2A 1FTSA 3ETEA 2DKFA 1WAMA 1MA0A 1CY8A 3UUGA 2PUJA 5EXDA 3PQ7A 3PQCA 4GM0A 3BCSA 2GCIA 1PBNA 3CG0A 2IBTA 3K8YA 1XVLA 3VJMA 4Y2JA 4HS9A 2PMZA 3CLTD 1PAUA 3L0BA 3REQB 4WXHA 3EHEA 1Q7RA 2IEYA 1M33A 1JP7A 2H2AA 4UCOA 4PZEA 3V8VA 3RRBA 2GXUA 4I1YA 5LA6A 3TOSA 3E27A 1CKNA 2JVJA 4UEOA 3Q8WA 2M2IA 2JBHA 3WLJA 4FFSA 4Y9SA 4MV6A 2D1TA 4AK9A 1PJSA 2HDOA 1Z38A 3T3HA 2EOAA 1R5JA 3TQOA 1DADA 4BVGA 1V6SA 2G0NA 2W7OA 3UUEA 2NVXA 4BWSC 2QG9A 1HRKA 4HZUB 3F3MA 3SXUB 4QC2A 4QXPA 1R0SA 4CEHA 1RAEA 2VK1A 2ZFUA 2HNKA 4B3MH 4LVOA 5IJWA 3GRYA 4KQEA 3FVTA 4GI1A 5FIUA 5JI3E 1XKLA 4DMGA 3REGA 2O8DB 2YFKA 4WJLA 2I7XA 2Q6TA 3TXAA 3DV0A 2ZVQX 1F06A 2V7EA 2W37A 1YZGA 5ECWA 4GBGA 3B6ZA 2L19A 4LMYA 2QTLA 2BFCA 4MDEA 4HRXA 2REBA 3CRW1 3FR8A 4UDXX 2VOBA 2BL4A 2A9KA 4UE6A 3KELA 4X8LA 4FZ3A 3JAMA 1NFQA 2NOAA 4TT3A 4ECTA 1UPBA 3QWUA 1A4IA 4IJUA 3A4LA 1BSVA 1NU6A 2YJ5A 4DR3B 1LLCA 4B3DA 2C0CA 4AJEA 2R66A 4OPMA 5BSRA 2PRJA 5AJXA 3D81A 4TTSA 2ZTUA 3DT8A 5AKZA 3KZVA 1RRKA 1RJ9A 2J32A 2Y6VA 2QN3A 1UXIA 3NC1C 3NT2A 2ZAYA 4WZAB 2NTJA 5HCNA 2F1JA 1ZXLA 2QRVB 3T3OA 2C3OA 1RZUA 3REFA 1XMJA 4AJNA 3LPMA 5BWNA 4G9GA 2WV9A 3LZ6A 1SCQA 5AW7A 1D1SA 3R7SA 5SZIA 3IAXA 2XLCA 4F2WA 2OL4A 4TLMB 4JP8A 4J8PA 5HJ2A 2CJYA 4JCOA 5ELXA 4V3CA 1P75A 2MSKA 1VA4A 4L6CA 1TQ2A 4EJ2A 3KJFA 2YQZA 2AQKA 4FMCF 4GM1A 5JATA 4Z7OB 1YZKA 4ZVLA 1C4KA 1EWRA 1EGVB 3UCFA 5I7AA 2W8LA 3SICE 2Z57A 3W7AA 1T4MA 4X61A 5EXEA 2VTKA 5A5EA 3I01A 4GR4A 3GVHA 6CHYA 5F7XA 2YXEA 3OF5A 1F38A 5KNBH 3Q1KA 4O84A 2PH5A 3TINA 2ZSHA 4P6VF 1Z88A 1L7MA 4A3DG 4UM9D 2PH7A 3T9FA 3ZDDA 1ZLXA 3C4QA 3I9V1 4HR7A 4PQFA 2Q2UA 3G8CA 1XF9A 5GZ3A 3KOWA 3K9LA 2Q1UA 3MW8A 3KHHA 4DDKA 2CXQA 4JS0A 4B4OA 4IH1A 5EXSA 2NPOA 3LRTA 2ZSBA 1BXRA 4LE0A 1Z36A 4W5HA 5T4BA 2ORED 3O9VA 1HLGA 1KRWA 3LZDA 2ZXEA 4QM6A 2HVSA 4NE9A 1O8BA 2H5JA 5BQOA 3LVQE 2P35A 5K0ZA 2R5FA 3LNCA 3L0OA 2OUIA 1IBMH 2VKTA 2CKDA 4HB2A 5HJ7A 4QPJC 1RAFA 3M49A 2JDID 2BGWA 5I9SA 1W0KD 3C6MA 4EARA 5JSKA 2GCOB 4KVGA 3TGLA 2VUHB 3FLEA 1XVTA 3ZI7A 2GS9A 2X0DA 4PTLA 3NAQA 3TW8B 1Z37A 4RABA 1KO7A 1ZH0A 4JU9A 2WZBA 1T2EA 3CZ9A 4X8MA 4YJ3F 1DLIA 2FLVA 3LFTA 2H4ZA 4Q8FA 2UAGA 4M0MA 4RFSB 3ZDYB 1I3MA 5CM0A 3MXOA 1EFRD 3OY7A 4Q4AA 4LNUA 4D3ZA 4Z4QA 1WPXA 3NRCA 4WPGA 1I6WA 4PS1A 3DDOA 1T0BA 3WWPA 3KE8A 3HACA 2C57A 3WYBA 1EFVA 2OB2A 3LOUA 1I6MA 4X64H 4JROA 2JHGA 1V6CA 1B8VA 4F11A 5FO1A 1D2HA 4DDTA 4DZZA 2G70A 1S97A 2VT3A 2Y4NA 3AKDA 4N6GA 2BQ3A 1NMQA 2FJ0A 3ZZMA 4J16C 1MUUA 1TRHA 4WD3A 2DFTA 3SLKA 2R86A 3I45A 2ICAA 5CFZA 2ZRJA 1I7SB 3N2ZB 1O57A 2XEDA 1U1FA 3DZHA 3QEMB 3GVCA 4JYBA 4E5UA 1F2DA 1ZIDA 1ZA2A 2E4VA 4EOGA 4ITUA 2ZRNA 4L3VA 2JLCA 2IXDA 3JARA 4HLUC 4O7TA 3LXMA 2ZVPX 5JXJA 2IKQA 3EXHC 4IUDS 2DAAA 1LVGA 4BS9A 2P7HA 2H0RA 2PQ0A 3TVTA 5JS7A 5JBQA 4G0WA 3HPRA 3R9KA 4XQGA 1W2WB 3SP1A 2FMXA 1RAIA 2MOKA 3W5DA 5C8DA 4PO1A 1IIRA 1XWIA 2J41A 4YAKA 4UNSA 4AJHA 2AFIA 1WXGA 3F1KA 2Z4SA 3LT0A 1X8JA 2ZSAA 3G9ZA 4I3FA 1QGAA 1Q20A 4ZANA 3FVVA 4OO3A 1AHIA 4MAAA 1W59A 1KJQA 5BQFA 4FFBA 4XARA 2WSSD 1BW9B 1IZ9A 1VL6A 4HTFB 3VPBA 1J25A 3KQYA 4M4SA 2XHEA 3TZBA 3ABZA 2NQ2C 2C61A 3RVBA 5JR3A 1CYEA 1CUEA 4EYSA 5E9AA 4AZ0A 1DAOA 3X0DA 3TFQA 2VL7A 2BJWA 3CFYA 4BNMA 1OAAA 4L4UA 3DW3X 3OHSX 3D2AA 4YRIA 2YYZA 4KG7A 2HV8A 3AVTA 4EVRA 1FY2A 2HSJA 2AFHA 2R6HA 5KFRA 4JGGA 5EZYA 3GFQA 2UUOA 2BDTA 4KR2A 4GZLA 3FY4A 1O94D 4KBYA 1W5FA 4HNHA 2JBAB 2ZUEA 1WTCA 3BHMA 3VOSA 3BJEA 1QK4A 3GXOA 2OEPA 3WK6A 3UJ9A 2B1IA 2AOUA 3C87A 3E4CA 5TT0A 1TWFA 1R6BX 2XIQA 4LCBA 2ZUCA 3EH2A 3FRHA 3IS3A 4OKNA 1R0WA 5CX1A 5TDHA 3BK1A 1RKXA 3OIFA 1X8XA 5AW6A 1S9DA 3Q5DA 3V4OA 4QEDA 5G1PA 5KFOA 3HBLA 1H5NA 1C3OB 4HVLA 1LF5A 2UZ0A 3I0NA 1UPFA 2IY9A 3T12A 1IOZA 1E9VA 4HHEA 3FDZB 4B8ZA 3N76A 2K7ZA 1P3JA 3CN9A 4Q9NA 2FAXA 1CUCA 4KRYA 5A4FS 2WT9A 2NVYA 1PK8A 2BFAA 4ZMSA 4NLLA 2OCDA 4RMJA 2GJ8A 3W5CA 2VT6A 1EGMB 2VF5X 4K2HA 4LNHA 3AVPA 2X9GA 1H6DA 4TS3A 1VSQA 1YRBA 4IV8A 4BEVA 1XZLA 1N33B 2RI6A 4NZNA 5DOZA 2CXNA 5HNEA 1ISSA 1IE3A 4C4ZA 3ZHCA 3DEJA 5CLFA 2FJPA 1DV2A 1RBQA 2FSHA 5DULA 1R0BA 2Y3IA 4BB0A 5KSPA 3GIIA 3JAWA 3I73A 5JFGA 1X7XA 4D43A 5IDXA 3WYNA 1W8IA 3KEQA 1NG9A 3R5SA 3RSZA 1L7EA 4JEUA 3X1WA 5HVNA 2ZBPA 1KEZA 3JATB 3LC7O 3ZUGA 1T5BA 3HU1A 1XDGA 3ZV3A 1O6BA 2HLPA 1N1DA 1RZVA 4DNFA 3R0QA 4U63A 1NMSA 2IV7A 4INZA 3HU3A 3LUFA 4C21A 5FR2A 3IG0A 3KKZA 2HGXA 4KYIB 2O2DA 2EX1A 1QQ6A 3BFPA 3K9WA 2AGPA 2ZVJA 3KOMA 4X7MA 5REQB 3UMJA 2UUPA 3P4YA 3HLKA 4DV5B 4J0FA 3ECSA 1GEEA 1WQ3A 2P3QA 3IT3A 3QVSA 4RJJA 4JJAA 3NOQA 1TCUA 1V96A 5AW2A 1H2WA 3F6SA 1MGPA 3OCZA 4KZPA 1SAYA 1PGNA 2PKQO 3A4VA 3DE1X 3L1VA 2Y71A 3WMGA 2DQ4A 4FEEA 2JASA 1ZN8A 1SUFA 4PBRA 4NNPA 2BFPA 4GLWA 1XTPA 2CZCA 2ECQA 3ZW7A 2VG8A 1VB5A 1I01A 3B70A 4XYMB 4WOJA 1W1UA 3BTSA 4ENTA 2ACKA 1I3QA 3M0EA 4IQ8A 3K2IA 4XYEA 3WJ7A 1Y0BA 1DARA 2QVZX 4KSCA 1T4DA 5D86A 1SVKA 4ZQHA 2VC2B 2CXXA 1QGZA 4J1QA 3G1TA 1W0JD 4OOFA 1RQPA 2O8CB 3MGKA 3TN7A 1UJNA 1AH2A 3LBFA 4OYRA 3KJZA 1Y1QA 2R5NA 4UZSA 1A9OA 2IXEA 3UWOA 2EJ3A 4DMKA 4I50F 1E8NA 4DC0A 1V43A 1ZOOA 2P6NA 4G65A 2PZLA 1P4AA 1BHJA 1UJCA 1RQXA 3OLVA 2H8KA 2BEWA 4H6WA 3G1UA 1LS1A 1YRLA 4KGZA 2WHYA 3ICQB 4NXMH 2P2DA 4RF3A 2FZLA 1RP7A 5CB0A 2XTAA 4CM4B 1SUDA 3IUMA 1TK2A 5GV7A 3K09C 3QVWA 3KTAA 4HGQA 1BVHA 4OKSA 4C0LA 4QZVA 5I7SA 4X6LA 1DCFA 3EZGA 4Z0TA 1KBZA 4R41A 5IT9A 1C5KA 2IDMA 1J6UA 4FCWA 1E5TA 5KG0A 3QFTA 3OU2A 3MAGA 4KYVA 4CF4A 4WH0A 3DG9A 1DGQA 2E3JA 3ZVLA 4ZODA 4NULA 3DO5A 2C8VA 2CLCX 2CT8A 2WABA 3UFBA 3ZHRA 1Z4MA 5AOBA 1ZI9A 2VK2A 2J5QA 3VYSB 4CGYA 4U0JA 3EGXA 1ZFNA 2G9ZA 3GP3A 1M1YB 4RYLA 2YJNA 1LDBA 1HYGA 2A4KA 2NXWA 1P4JA 4WEOA 1I4LD 3CMCO 5T64A 2OV6A 5JIBA 5F9MA 1N6IA 3MR5A 3ZGVA 1T2AA 4GT1A 4KK3A 4IIXA 2ZJ0A 4MGEA 4ZMRA 3M4XA 3KT0A 3V1YA 3OD1A 1Q1BA 2VT7A 3M83A 5KNDH 1TZCA 3O31A 3RB6A 1J39A 2YIDA 4CTNA 4BAGA 1OY1A 2PANA 3RI3A 4CETA 5KX5A 2COUA 2FXVA 3BG5A 1U3TA 1SVWA 3NTXA 4W7IA 3JQ7B 5ITZA 1Y4ZA 3HHPA 4DRXB 4QWCA 1WO8A 3OCYA 4P7JA 3G8DA 1P5RA 3H7AA 4G25A 2ZYIA 1E2JA 5WRFA 1ITZA 3EVNA 2BIFA 3TPFA 4CV1A 2H1HA 2WD7A 2UZAA 4XJSA 3S2EA 4P3NA 3AKZA 1DIKA 3VDXA 2QPLA 4GX0A 4RHYA 1ZVMA 3OFND 3A6KA 1UC8A 4RY9A 2HSWA 1GN8A 3Q41A 4ZVMA 4ARVA 2XV1A 2WAOA 2RAVA 2E55A 2XGMA 1QZUA 1IAQA 4QDOA 3EXFA 2OYRA 2X40A 4TN5A 1Q0QA 4EY6A 1FVHA 5HZGA 2GEBA 3D4LA 4FX2A 4LYHA 1DCKA 1RADA 4FKZA 4WKOA 4DL7A 3FPCA 2DBRA 1U94A 4IRCA 5E6SA 2EG5A 1PFKA 1USUA 2YIMA 4ZYUA 2YWGA 1XRJA 3ANSA 4I6GA 4J90A 1YZHA 2Y76A 1V48A 3JQGA 2QQ5A 3ICPA 3GCXA 1JMVA 2FVXA 5AICA 1G20A 4N7BA 3W9BA 2PLNA 1N34B 4MLCA 5JDCA 4Q7EA 3AL3A 1QH8B 2RJ3A 1RFLA 4YK7A 5B1SA 8MHTA 1FRFS 2VF7A 3N28A 4ZT4A 2PKEA 4MLDA 1XCBA 5JJCA 4B6OA 2NZXA 1JYFA 3QKIA 4UHBA 4LJ9A 2BFMA 3UENA 3WL7A 4BU1A 2YY7A 1WP4A 1NQTA 4R0MA 4ES6A 1C9EA 2JGDB 3IEUA 3DMFA 1KSGA 2QTZA 1G2OA 3T95A 1T43A 4F46A 1GPLA 1PQYA 1IG0A 4DILA 2WHQA 3SR0A 1NVBA 4H59A 3WA7A 1OWNA 2OBLA 3C8HA 3IHKA 1C1XA 1CY4A 2PSFA 3D8NA 4Z49A 4DA4A 3GDHA 3I4CA 2VNKA 2RGXA 3FVRA 2HZ7A 5YASA 3GLFE 1XPOA 4PZZA 1H22A 3T1HH 4NZYA 3W34A 4I46A 4UHEA 3GFFA 3RS7A 5E9WA 1WETA 2BW0A 1OZAA 2Q5QA 3HRKA 4LCJA 2CEKA 4IIVA 3PWTA 1CKOA 4KXNA 3RYTC 3IBFA 2UYYA 1ESNA 4QJIA 1ISMA 1VKZA 3O1LA 2ZXUA 3UWSA 1YULA 3HWWA 4I6JA 5K3FB 2YV5A 3BRWD 3USZA 2VHVA 4LPSA 3LG2A 3KQPA 5GVSA 3NONA 4EW3A 5DLYA 1EVQA 2GYYA 3E0XA 2JJ1D 2G71A 1QYWA 3GV0A 3QVJA 3EOAI 2X9QA 2XQIA 4PLZA 4RDHA 4QXAA 4JDPA 2HF8A 4FZRA 1CZRA 2FK1A 2B25A 4DT1B 2ZJBA 1CLUA 1OI4A 4R6XA 4DSAA 1YR3A 4JT8A 1KWGA 5L9AA 1F3OA 3I32A 1XDZA 1GT91 3F6YA 4C6HA 2TECE 2CNVA 2Q6IA 3FX2A 1EEHA 2IHTA 3CW9A 4CEJA 1EQAA 3W5SA 1XCMA 4GZ3A 3FTCA 4Z54A 3W5AA 4UE3S 5FPPA 2OHXA 2VYVD 3DL2A 4DEVA 2NSYA 2G25A 1SR8A 3CEPB 1MAWA 4MVWA 1ZBQA 1DKNA 4REQA 4B1FA 2QROA 5H3HA 5F3RA 3PITA 4WY5A 1CE8B 1YDMA 2BF7A 3OE7D 1U0EA 4M0UA 1GGOA 2QM7A 2QPAA 5KTKA 2BSQA 5LQSA 3I2GA 5KEIA 1ULSA 1WHSB 1HNZH 5HCUA 4B45A 5CD1A 1VLJA 4O4IA 1SXGA 3AVVA 5JAMA 1Z07A 2BBWA 3QVOA 4Q01A 3ABIA 3DHWC 2H57A 4FFVA 4J9QA 2ZSKA 3RYHA 5B1DA 1YFZA 2G9VA 1E9FA 2WT8A 4WGGA 2NW6A 4CM9A 1C0IA 1Q12A 4AJOA 1FX1A 2QR5A 1VLLA 1QYCA 3L79A 1DKPA 1X1TA 2GRJA 3I04M 5BSWA 2IW3A 2LIPA 1QM5A 1NRJB 3G5UA 4LF7H 4R01A 4GD3Q 3GK3A 2I3GA 4BP8A 4UU0A 4HDKB 1FVFA 3FNHA 5TE9A 4R8KA 5BT9A 2XGOA 1DZ3A 4IDFA 4TN1A 3TEJA 3T8YA 1KAOA 5D1OA 2ZQYA 1T3TA 1T3SA 3MEQA 2KLHA 4Y8VA 3GR6A 2J4CA 4D0RA 4CMFA 2IYTA 1U99A 5JSYA 3GAAA 4ED8A 5KG1A 3ZW9A 1CY6A 4XWOA 4JJ7A 4JQZA 1KK2A 3G5MA 3KHLA 4GXRA 3H2GA 3K6JA 4LIPD 2OORC 4DHWA 4KH0A 3Q8PB 3OEED 2RAFA 2WD8A 1EINA 2WIJA 1MU0A 4OGLA 2OXTA 4L4XA 3T99A 4BVHA 3M2TA 1VPEA 1JQ5A 4LOIA 1VL2A 4OI0A 4B9AA 3N0XA 2ZS8A 5AKHA 3IH5A 4AZSA 4GC7A 1CF2O 2QNBA 3O82A 2OHOA 4OY3A 1F8UA 3COPA 3HSYA 1FX0B 1JT2A 1CQJA 1UDCA 5DI3B 4CIAA 1EPUA 3TTWA 2XUGA 4CFZA 4PAMA 1H2FA 5JNVA 3FAZA 4MQFA 1CUVA 4DUGA 3D8RA 5DXFA 2HL6A 2F9MA 4RPGA 3V4ZA 2CJWA 4CT5A 3N5KA 2YY5A 2JCYA 3HXTA 2WQZA 5DTIA 1MIHA 4IGAA 1LS6A 3BXHA 1IVNA 2OM6A 1ZR4A 1N9ZA 4RB2C 4YN3A 3UK0A 1CVLA 4WK6A 3CIFA 1C30A 1MC8A 2EU8A 4BIIA 2CL7X 2EL9A 2AUNA 4N12A 2E4YA 4DW8A 3C3BA 4CJXA 5HJ5A 4FKMA 4AYWA 3LQ1A 1RQLA 1TJ5A 1I1QB 3CRZA 4QBFA 5IZCA 3B6EA 5KTYA 1GKKA 4E32A 4GMGA 3HCDA 4E94A 4J0IA 4ZVQA 1GQFA 3LT2A 3QI2A 4QJ5A 2H1OA 1IQRA 4FCTA 4TTPA 4RZUA 4YCJA 4LXGA 5LYJA 1GA1A 4F1KA 1PYDA 1SOWA 3R7DA 2HR1A 3Q10A 5U9CA 1U2DA 1NMXA 1V25A 3PC8A 2ZIVB 3AK4A 3LV8A 4M6WB 2QX6A 4EG4A 4OP3A 2NAFA 5KYXB 1NFFA 5F51A 2V0CA 3A27A 1ADCA 2WJPA 1MX1A 4RQBA 4HVCA 5C18A 1O08A 4JVLA 5C1OA 4M89A 4E30A 5IUJC 1JE0A 4M0LA 5EHXA 3KZCA 2R96A 3MJVA 2IYFA 2Q3DA 5GIPE 4ZHSA 4DCVA 4KDEA 5AR1A 4R0VA 1XRQA 4B3IA 3OZ7A 1AN0A 4DLRA 3CLUC 1Q83A 1VJ5A 1D2EA 1KOFA 2XMCA 3PXBA 1S68A 3IAM6 2QGNA 2YMLA 4RTKA 1OQAA 3KYCB 3T9EA 2XEXA 2BISA 1O03A 1SQGA 3CLTC 4YRKA 4TKLA 2IYYA 4TXNA 5DGXA 2ZJ2A 4XVCA 4MWCA 1ZIYA 2CBZA 5M2QA 3ZDZB 4PR0A 5B57C 4UCFA 4AWXA 1XG5A 4EY5A 3FH0A 4U6QA 2ZWMA 1AUOA 3RLIA 2IYZA 4L02A 4CMJA 1G63A 4GEKA 2F62A 5EPOA 1F5NA 1VI2A 2IHVA 1O5TA 5BP7A 3VZBA 1WA5A 3FHLA 4IMIB 5HKAA 4B47A 3ZCRA 3SVZA 1RJFA 3MB5A 3R7NA 4IHAA 1Z13A 5C53B 4XYBA 2XKKA 4L8YA 3STTA 2P9HA 4NQZA 4JKIA 3NU1A 3JQAD 3WRVA 4H1UA 3V1UA 4RKFA 2WIAA 1IYEA 1ZCFA 1N9GA 4PLPA 4NNOA 2JCGA 2HM7A 4LJAA 3H42B 1MO2A 5B6IA 3O1HB 3OTOH 3EEYA 3CYFA 3G6VA 4O3PA 3JVUA 4IEFB 2XNDA 4QU8A 3CH5A 3EY9A 2ECPA 4IOKA 3AHCA 3LWDA 1XTJA 2J0SA 2FKLA 4Q15A 2WLSA 2H9AA 3N0VA 5EHZA 1JE1A 2GF9A 3ZD9A 2VOEA 2ZOSA 1EJ2A 4D9NA 5IXSA 5UKDA 4TM5A 3T5HA 4D4LA 4DV1H 5T8KA 1ES9A 2GPJA 4K8RB 5ICCA 3AFGA 5EJ5A 4ALJA 4X1KA 4J3FA 1A96A 3MVEA 1QHHB 3C6BA 3IKJA 1YJQA 5TPWA 2W2KA 4O4LA 5CLHA 2WF9A 1JH8A 5DDIP 2G7ZA 3TOZA 3OPYA 1UWLA 5IJ9B 2QN7A 4D9CA 4HKTA 4N39A 2OENG 4KHZA 1IDOA 4DDWA 3TAHA 2WTAA 3JQFC 3RU3A 4RA9B 1RJRA 3GB9A 1WKBA 1URPA 4AUNA 1XF1A 4YLEA 5CXQA 1IHOA 1U6JA 1ZN9A 2BJVA 3AWDA 3DCJA 3ZWBA 5ALEA 5HIKA 3A9WA 1V4YA 2PY6A 1SUEA 1J33A 2AMFA 2WUGA 5JJKA 4OHWA 5LBTA 3T4XA 3WYFA 4XM1A 1S1MA 4OATA 4IDPA 2OM2A 1T2FA 3BCRA 4FMDB 1NI3A 5E4YA 2R8OA 4JP3A 1UEIA 3UN1A 4HEHA 2YRWA 1ADFA 1ESMA 1D1TA 1JV2B 2AG0A 2CHFA 3H0GA 5BQXA 1H3NA 3FSEA 5KFCA 5C1BA 5CVEA 3PL5A 1V7CA 4EDHA 4TSFD 1YQEA 3ZDEA 2XZDA 1V8ZA 1OASA 5DWVA 1ONPA 2VHYA 1HTBA 1EDEA 1C9YA 5AM2A 3RYCB 3LW7A 5HMLA 3WKBA 5IMSA 2H2GA 3KOXA 4QECA 1QC5A 3OA2A 5ADWA 2CL5A 5K99A 1ECJA 1SKQA 1HDZA 1JQKA 1D0VA 1E9CA 4R54A 4BGDA 1T1EA 1ISHA 3P9IA 3GH3A 4KI7A 1IXKA 4QEKA 5JRDS 3KSAC 3LYAA 5LP6B 3FMFA 2EF1A 2XLBA 3UV7A 2JLQA 4EECA 4FGJA 1IEVA 1ZJYA 3PBKA 3QJ5A 2VS1A 3WLHA 1WVIA 2ZE7A 5KJFA 3QKSB 1FFCA 1T9HA 1GTZA 2OOKA 1N3LA 1P33A 3UYLA 4HRAA 4DQ0A 1EHYA 1QJCA 3I1YA 2P9ZA 2DT8A 2GN2A 3S1AB 1U3GA 5DHSA 4CKWA 4J03A 3WGZA 4MYDA 2HADA 1B8NA 2SECE 3M1YA 5CFLA 3U49A 3RVRA 1L0BA 3PX7A 4RA6B 1VZ2A 4ZI3A 1R88A 3B9RA 5F64A 3L3BA 2OVFA 4CUZA 3WYEA 3R3JA 4O3SA 3ZC3A 1KYXA 1DTWA 5IT9W 3O4IA 2JFVA 2ASLA 2ZRIA 5KDOA 4BY9E 3OM8A 2ZSFA 4HYYA 4O02B 1AGNA 1KAHA 1LF0A 3V00A 2ODNA 4BFXA 1V1MA 4GVXA 2B63A 5DQHA 1C1YA 5DSTA 4DSUA 3LL4A 3LBHA 3PW5A 4FFRA 4MGIR 1N6KA 1VA5A 4LV5B 2OO5A 3WLQA 3T52A 4BFYA 1ZIXA 1T5DX 3T0FA 2AE2A 1PHPA 2AOVA 3T5BA 2NXJA 1XFAA 1V9SA 3OQJA 2DIKA 4LKRA 1ONOA 2WU0A 2GJSA 1G8YA 3KZKA 1JU4A 1UMBA 2FQXA 4J6EA 1WDLA 4KIJA 2V6FA 1GL6A 1GM5A 5GGXA 1NI4A 4LOJA 3KQVA 5DBEX 1BNCA 1KTIA 1G59A 3RUFA 5LZ9A 3SX2A 4JJIA 4D0GA 2CV1A 2CLOB 3EZLA 3HC7A 2J0UB 4MKXA 3TZEA 4LDJA 3AWIA 4O3FA 3BXGA 4QDXA 1ULTA 2XAAA 2WSMA 2A33A 5JCJD 4DC1A 5JDIA 3OPQA 4WX2B 4HF7A 4CLDA 5KG3A 2ZU6A 3KBBA 5FOWA 5LMUB 4CF6A 4BV9A 3TM5A 4NJMB 4FOPA 2FEKA 3OUTA 4GOND 4DLZA 1K75A 4PC3A 3RVKA 4F4WA 3CVXA 4NU0A 1MC5A 4R2JA 1EX7A 5DRYA 2C5SA 2X3UA 1MV8A 1Y8QA 1E5QA 4I08A 2BGRA 1C14A 4M0JA 1MTOA 2ZI4A 2YU9A 2YZGA 1MFPA 4RO0A 1JJVA 1UK7A 1T3HA 5GTDA 3MT9A 4RKQA 1FLNA 4W5TA 4LWZA 5EL0A 3C3WA 1TQ8A 4G0UA 1KDPA 3TWOA 5AFSA 2HO4A 4TTIA 4AKEA 2HWXA 1TRKA 3RKRA 4PZAA 1MW8X 3IO5A 1XUOA 1Z8DA 2B1QA 1RWPA 4BN5A 1TM1E 3WNCA 3EOBI 4KHPH 3WL4A 2VRCA 3TY8A 3DPIA 4FR0A 2WB1E 3MWEB 1ODFA 2D62A 4MJ7A 2XMPA 1D6JA 5EWMB 1QK5A 1M7JA 1O94C 3KHUA 5JC1A 2VHTA 4NH4A 1GSAA 1SCJA 1C1DA 4KE7A 1ONBA 1OBHA 3R5JA 3HKCA 3O9MA 4WESA 2TYSB 4JUBA 3IR7A 3LDHA 2IHNA 4F45A 1HGXA 3UATA 4Q02A 3WHPA 1U04A 3HDQA 1M6VA 3KP1A 2QIPA 2HTFA 2LIVA 1KF0A 3PGMA 3GGOA 3CURA 5KINB 4CI9A 4R51A 1UMCB 2MT9A 4OMFG 2OG1A 4RPHA 5GWXA 4U9IS 5E4FA 3W5IA 5C80A 1UANA 3L7IA 3SS7X 2GBPA 1L1FA 2Q8PA 3BORA 3QXGA 3ILVA 3ZI0A 4TGLA 4BNYA 1ORWA 3BM5A 5FWXB 2FX3A 2WPDD 2QU7A 1U0BB 4N8DA 4E31A 2HA6A 3MLAA 3PUKA 1L1QA 5KFEA 3TIFA 3HXKA 2FEXA 4J7AA 1RXUA 3OT5A 5IC5A 3F6CA 5KOYA 3GEEA 2JIRA 1UZMA 1GDTA 4NOKA 3BD9A 2PO7A 2I2AA 2ZBGA 1X1BA 2RKWA 3ZWCA 3LSYA 5DGDA 3HTXA 1JEQA 3EVBA 5K5EA 3CLUD 2OQIA 3LA8A 3KT3A 1M2JA 1RS0A 3TMYA 3GLHE 3OCXA 3WDMA 5LP1A 1T10A 5IYBG 3Q3JB 1NVUQ 4PZ8A 4DABA 4LSZA 5GP1A 5CIQA 4D9MA 3ZWDA 1N4DA 1J2UA 2JA7A 2I54A 2AFVA 2IYLD 3D7MA 1E5DA 2E87A 3P0JA 4DR2B 1KYYA 1I1LA 1Z4PX 1EJ0A 1UBKS 2Z2IA 4Q3NA 1M9NA 1KXZA 3VC3A 3COYA 2IPAB 2OCGA 4IH9A 4R9VA 3K6RA 4DVGA 1QHNA 2D59A 5I7OA 4I1RA 3PP8A 5JZMA 4O0LA 2YYSA 4PCUA 1IZ8A 2Z2JA 5GMOA 2LVBA 4TLAA 4C88A 1NMYA 4INOA 3C4VA 4N47A 5IARA 4LBYA 3M5WA 1A76A 3ZLTA 3IIIA 2OHVA 3OZBA 5FH9A 4JBGA 5D3ZA 5TLSA 1UF9A 4XWGA 3IXMA 2QLNA 2HKIA 3IEMA 4BB5A 4DR5B 3OKFA 1KA9H 3HP7A 4KMRA 2ON6A 3W2TA 2K87A 2D4HA 5KU1A 1Y34E 3NBMA 2AOTA 5FT9A 3CISA 3FOEC 2X42A 2X0EA 3BT7A 1PZEA 1U98A 2ZYVX 2VRBA 4PSUA 3HA5A 2JFPA 4OHKA 5LPNA 2DETA 2R60A 2KWIA 1DQSA 4ARAA 1W25A 3CN7A 3OI7A 1G5RA 1WXHA 5AXDA 3KU1A 5DLEA 3C3DA 1GNPA 4BLRA 5B4TA 4CCWA 1WB6A 1YUNA 1AQYA 1XAJA 2VYFA 4TROA 1PYGA 2QBYA 2FSFA 1KZ6A 1THTA 2B7BA 1O2DA 4YP0A 3C14C 3TRJA 4CKBB 4RYDA 4DR4B 4BUCA 1T6NA 1ZZGA 3JZAA 3LUPA 4X8HA 1BXGA 1RI1A 3PRYA 4LE2A 4PX9A 3V9PA 5G53C 4HI0E 4CMDA 2GK4A 1FQOA 3K0AB 1S03G 2R82A 4B7XA 1RW4A 4PC6A 2FCRA 3SD7A 3I8XA 3VPDA 3V34A 2C7QA 1I4DD 4PO8A 4QTYA 3Q9NA 3HJGA 3ZGLA 4H0FA 2X19A 5EWLB 2WA1A 1CS0B 3KIPA 5GJBA 1ODLA 4Q43A 3M6WA 3F5SA 5AI0A 4BKOA 2QN9A 4BJHB 3MWYW 1QIKA 1X9NA 1P77A 4UEWA 3EE6A 4BZQA 1I3KA 2H5EA 3S2ZA 4RTMA 5A4MS 1KO8A 3S3TA 2OKCA 2ZBEA 1XZAA 3U7QB 1IHYA 1CPYA 1H0HA 4G4SP 1LSUA 5EESA 1ADGA 5I5XA 2VDPB 1WUYA 4BNGA 3ZNQA 4G5XA 4LV8B 5B6JA 2HVRA 1XQVA 3DZGA 1WJGA 4LOHA 1TA4A 3VZRA 1CQIB 5EJ4A 5A6SB 1TPYA 3AQ4A 2ZT6A 2EP5A 2VYNA 3IP9A 4RSRA 2Q41A 1QNFA 4OSPA 4ZA2A 2B3DA 3SI8A 3KJIA 5G2OA 4BX2A 1O0CA 4NFLA 4B9EA 5LWHA 1B0AA 3G8AA 2BFDA 4N0EA 1U5AA 4HN2A 1SHZA 3GUUA 1E59A 2ZIWB 3RODA 3SDBA 2DPLA 4HGOA 3SYKA 5G41A 3KPUA 5BSTA 2BFBA 1JTVA 3A1UA 3BTUA 4B6QA 4DL4A 1KYZA 4YUZA 4A93G 1KJ8A 3P97A 3A9SA 3KAQA 3I62A 2PPVA 5DNYB 2H48A 1QTRA 4JHXA 1PT8A 2EFHB 4J0MA 3CR7A 5TT1A 1H9CA 4LXXA 4LDPA 3JYPA 2FRDC 3A3PA 3I8OA 4PFKA 1BJKA 3H86A 4WBNF 3AW9A 3W4KA 1A1VA 4ARSA 3IA2A 2G9UA 2BFWA 2VZLA 3QFSA 4N3AA 4D8UA 3ZLJA 5JWOA 5CFNA 3N2GA 3C6ZA 2GBIA 5HM6A 1SFRA 4ED1A 2Q9BA 4B73A 5KUTA 1F60A 3CLSD 1R9TA 1X3LA 1GWNA 1RYRA 3GTMA 2DFLA 3AGQA 4BB9A 4C78A 4BQNA 1VRCA 3O0TA 3WGGA 4FB4A 2H9IA 4WI1A 3C2QA 4MJXA 3UGJA 1W36D 5L8VA 2EBUA 2WTEA 4MGHA 3GYBA 3UOWA 1VC2A 5ITSA 1LBIA 1BH2A 5BYJA 3EGWA 5F73A 2VP4A 3D5QA 4N41A 3OPYI 1X1DA 3BRCA 4TXMA 3RYIA 4G81A 4ZOEA 1KI1A 5CDFE 5BV7A 3AI3A 3FUCA 2R97A 1L1RA 3QBTA 1OZHA 4QG3A 1OPXA 5D85A 4XIGS 4IG4A 4ALLA 3W7VA 2WUDA 5EEHA 3LAWA 4TZ6A 4PIVA 3HEMA 4JMPA 3SFZA 2DKOA 3VMFA 1KEEB 3OX3A 4D46A 4Y6OA 1DPFA 2PRZA 2PTHA 4IRXA 1RXYA 2DPIA 2FEPA 1WD5A 5K2OA 2JAOA 2Q3MA 4DMLA 4Q1DA 2OD2A 2NTYC 1ZD8A 1FVOA 1U3VA 2XVMA 2Y77A 1VIAA 3LPAA 1X1AA 4DR7H 4KXQA 1GUDA 1IXRC 2VSYA 5C8YB 4K3UA 1Z0UA 3FB1A 3MJFA 1UKYA 4FFMA 2J9FB 2PZFA 3IT1A 3GLVA 4NABA 2R6DA 5KFAA 2CUKA 2YVQA 2ZYDA 2PBRA 2Z4RA 2VJYA 2YVKA 1R4ZA 2DR3A 2XOKA 3OZRA 2R92A 2IYNA 1L7AA 1XZJA 2WJYA 3RS9A 2K6GA 5KQPA 1G17A 3M6LA 5JUWA 5JD3A 1N1MA 3JYLA 2V3VA 3MBOA 2IZ5A 3C5CA 3TG8A 1SU8A 5LQMA 2XR1A 3EMDA 1CJMA 3NETA 1J0BA 1QCYA 2ZPAA 4OKIA 5DBGA 2X6QA 4CUKA 4A0RA 4YS6A 4DQLA 2JA5G 1G2QA 1RI4A 5JWHA 2PXXA 3AHEA 1LK5A 5HGJA 3ZVKA 2A5LA 3ZY3A 2VJQA 4GSKA 2HNBA 1FYEA 4Z99A 5E1MA 3CJRA 4CDMA 3GPBA 1XDUA 2FOXA 1GKYA 3ZH2A 4LA4A 2R4QA 3G5TA 3E23A 2VA3A 4Z7QB 1FVIA 1WVMA 1IYZA 1M2GA 4HXFB 5SV2A 4H7KA 1SELA 3OEWA 2UYQA 4A23A 3ANNA 3BGWA 3JD2A 2FV8A 4TKVB 1ZCAA 1DGSA 1GRNA 2HLDD 2PUGA 4URUR 2UUCH 1BU5A 3D4IA 1AQJA 3R1IA 4U0KA 2I4LA 3N75A 2QAIA 1LX7A 1E3WA 5C4MA 3IUJA 4WLOA 2VCYA 3DKVA 4EUNA 4QYSA 3HKEA 2COGA 2AC7A 1W4RA 1V95A 2NZ8A 1GGKA 3P9YA 3GGJA 5KVCA 1D6MA 4NV3A 2I6XA 2PD3A 2QI9F 3B1YA 3PC3A 2D7CA 3H9UA 5CCBA 3MBKA 4JUIA 5IXYA 1SZPA 5GJCA 1D7OA 1PTJC 3EVGA 5LD2C 4RGYA 1HQKA 2I9PA 1YI0A 4Z9XA 4OHYA 3BTVA 4J2HA 1V9LA 4EFDA 5DTJA 4U7TB 3PLNA 1KS2A 1K92A 2D5LA 2ZG6A 1UQTA 2RGVA 4JX9A 3H1FA 2H7CA 5FWDA 4I5IA 4NYEA 5HUJA 1SXQA 5C7OO 3VSCA 2DPHA 3RU9A 3MYYA 1HE5A 5AW5A 2QL6A 3HM9A 1XCLA 4UM7A 5TEWA 1KI8A 2YUIA 3U40A 5K3CA 3L7BA 5EIEA 4YJGB 2O7NA 1MOPA 4CLOB 3GAMA 4AU1A 4ZOLB 4EG1A 3DZIA 4PLFA 3E0QA 4EPXA 3ICVA 1NG1A 1RQNA 4FSHA 2YOFA 2WM9B 1CBUA 1ZM7A 3MRTA 2ZBVA 3V9AA 4WT7A 3GJRA 3L82B 4ED3A 3CMMA 1EKVA 3V1MA 2C22A 2JEYA 5L51A 5JXGA 1K7YA 2WM2A 2Y68A 2MU1A 4IVPA 3FWHA 5F9LA 3TOCA 3U19A 4DV7B 5FFFA 3TDKA 3L1UA 1S2GA 5LLDA 3A4MA 3E48A 4NCBA 1Z5WA 4X66H 3CUUA 3R7FA 4HLNA 2HPVA 4MR7B 1KIMA 4PSAA 4QT4A 4LJYA 4YMLA 4U8HA 1OGIA 1EGQA 2QTMA 3NDRA 4RUKA 5J2UB 2J31A 3M6MD 2FR8C 1GILA 4ZXFA 2VF8A 2ZBFA 1Q16A 3ZCPA 3G2JA 3PENA 1HORA 1R15A 1N2CA 3EGIA 3BREA 1JECA 3TPZA 1PJ8A 4LRYA 1EAYA 2XRMA 1QORA 2JA6A 4M7EA 2ZTHA 3DR5A 4EGSA 4RLHA 2JZCA 5C8XA 2XUDA 2R9VA 4CM7A 3UEOA 4ALNA 3IPLA 4KNYA 5FTNA 3EDMA 4ZPXA 1UBMS 3FNGA 3HWX1 2JCXA 1I3OA 4NMXB 2F3TA 3DYVA 3PHGA 5BWTA 3DFFA 4DPLA 1E6WA 5I45A 1YL5A 2ZB3A 4RNMA 5K3DA 5HRUA 2GYWA 2O5VA 2JJYA 2R93G 4IHJB 2XCRB 1CT9A 2PTGA 3DSRA 4QRDA 5JU6A 4IJWA 4G07A 5AHXA 3C70A 4O4HA 1T36A 4TQUS 2W00A 2E2WA 3IMGA 3I9OA 4HDSB 2YYYA 3BSYA 2RHOA 5JCPA 3O8OA 1RAAA 1ZGBA 3BGVA 4QRIA 1YCHA 3FYUB 1QRAA 2MINB 2FN4A 2QUHA 1MH1A 3RQIA 4I9UA 2EQAA 4GEGA 4XASA 1J2TA 1XTTA 2PX4A 3BA1A 1D1PA 4BO0A 2XZLA 2GF2A 3F7OA 3N58A 1TADA 2X76A 4MUBA 3HUDA 3QTTA 2WDZA 3J80A 2QZ4A 3N3BC 5CCXA 2D1QA 2FMUA 2ZUFA 2A3RA 1BO6A 2D0PB 5ERXA 3P32A 1XYVA 3HB4X 3KUCA 5JJBA 1BQEA 2VPQA 4MV0A 1Q1ZA 3OAAD 1X2BA 2W6JD 2CNOA 3L06A 1MB0A 1TWHA 2RGCA 3A6EA 2VATA 1XP5A 2D8AA 3FMPB 2WE7A 2VOJA 3PNLA 3IDZA 3PG5A 1XALA 2C83A 3GVPA 1F2UB 4GQBA 5DB4A 1TLLA 2MSWA 2EBFX 3FE2A 1KNQA 1AZTA 4JJ4A 2VP2A 5I9IA 1IMJA 1XZCA 2VIIA 1OPRA 4IKPA 1E3LA 4YJFB 4ZCMA 5DZSA 4YHBA 4TQ9A 2I78A 4G8CA 3RGGA 2EFDB 4O4JB 2AB0A 4TTJA 2X41A 5H02A 4RTSA 4NL4H 1RRPA 1KH3A 4AXXA 5HWSA 3ZOKA 3UPDA 4GMDA 4Y0NA 4ZJYA 4W5QA 4R0NA 4JVMA 3FPSA 1DI0A 4C4RA 1SZCA 4JR1A 1DUIA 1GGFA 1HYEA 4G0QA 5A4DA 2CEAA 2KSWA 3RAJA 3QBEA 1TCAA 4G9BA 2GK3A 3OHBA 3QXXA 1NW4A 1DG1G 2OBYA 1BFDA 5BR4A 5FNZA 4DCTA 8AT1A 1OB5A 2IYUA 1YZYA 1UXJA 2C58A 3UUWA 2R84A 4DB4A 1GKLA 1SKYB 2N9UA 4B2PA 1Z6AA 3T0GA 3PFKA 1VYVA 4Z1MD 1RYEA 5JO9A 1NUHA 5GZ6A 3RSSA 5A9SA 5FADA 1ACLA 1U8TA 2JGAA 1KU0A 5HIJA 2FZGA 2HGWA 3H5WA 5LMCA 4HYTA 2BMDA 1VBKA 1XLTA 4QW9A 2AZ4A 1VBFA 4IX9A 3X3HA 5KCMA 5CBPA 5KFQA 2IUSA 2HBYA 3BF7A 4QULA 4FWBA 4DCJA 2OXCA 3I6BA 1GJRA 3TLYA 3T5TA 2UV8A 2OCKA 3RBAA 2YX1A 1MD9A 1XEAA 1K8QA 1P1IA 4YRZA 3OM1A 2R8XA 4XD2A 3QY9A 4K9OA 4N0DA 2J5XA 1OLXB 5KSZA 1HG1A 4MYUA 1T3GA 4JI0B 4ML3A 1TAEA 3I9JA 2ZQ5A 5LYYA 1KHHA 1ZYUA 4K6CA 2GEDA 1UPXA 5IVDA 1A5TA 2IEZA 3DCYA 4HAOA 2JA1A 3OKCA 3MT7A 2XNSA 3ZCQA 5I9BA 5K8IA 3DBIA 4G24A 3PUJA 1OBDA 3BGDA 3OIGA 2FK2A 4CF3A 3WRXA 3K1TA 2ZRPA 3BIWA 1VMIA 1RE1A 3DEFA 5DQIA 1UMKA 4GDMA 4BLPA 4BMZA 4RD2A 1HLFA 4DNOA 4S0XA 5AHWA 1DEOA 5F3DA 1TFRA 4NQRA 4D3XA 1YIOA 3T0IA 1YRWA 5TIIA 3JW8A 2OFWA 1TIPA 3R9RA 3CSDA 5FNVF 3I09A 5EKUA 3UMFA 1FFYA 1VJ0A 1EZ4A 5KMGB 4OLBA 3RROA 4ZHQB 1HFEL 2R11A 4O59O 3U4MA 2AKYA 3JAMW 4JI4B 1FMLA 5CMLA 5HF8A 1LD3A 3ILYA 2FDCA 5K4AA 5IVKA 2WKPA 4G63A 2QXTA 1HMYA 4QNRA 5AJYA 3B53X 4Y1GA 3VR3D 3L7DA 2NSHA 4MP3A 1XD2A 3IP8A 3RC9A 3DPSA 1U6IA 2GM5A 2IGTA 2ZRQA 1DC8A 2AJ8A 3VR5H 3PKJA 4KCGA 1XYGA 2C4HA 5U4QA 2P40A 2A9RA 3R77A 2R87A 3RVSA 3OOSA 2DR2A 4YY3H 4PLCA 3SHFA 2CMKA 1O54A 2BJHA 5JFTA 2PKWA 3WB9A 1SVNA 1RXCA 5GONF 1HNWH 4ZV7A 4FDTA 3D0KA 4KZKA 5EQJB 3W79A 4LHSA 2OMEA 3I9KA 1HTWA 2VQEB 1HDEA 2Q9UA 1AY0A 4IXMA 4JZKA 2G5PA 4M38A 3SXPA 1BDMA 3UWPA 5ITWA 3MINA 4YAEA 2JGJA 3BXOA 2O2ZA 1GARA 3ENZA 1YC2A 1T9GS 2OVBA 1BX3A 4HAIA 2V9CA 5GQSA 1NBHA 2WUEA 2NVBA 1MO4A 1AMNA 1US8A 4KQCA 5GPBA 4M1OA 3V7UA 3OICA 3C8MA 4RJ2A 3RFCA 1OH6A 2FWIA 1BG6A 1E3TA 4YQFA 3UZUA 1ZAYA 1P1BA 2CFTA 2VEOA 4GRIA 3BE8A 5KDDA 3BD8A 4RWEA 2XADA 1ZOLA 3WWHA 3U7JA 3W2FA 3CT6A 1Z33A 3UJ7A 2EFGA 3RVDA 1VDZA 5FPYA 4L4YA 4FM9A 4ZTUB 1Z45A 4BO1A 2COJA 4QOHA 2Q4RA 5DNDA 2VP5A 1YK0A 2G04A 4P0PB 1HQCA 4MV8A 4A3MG 2P68A 4Z6KA 3H5NA 1F14A 2DCMA 3WBJA 2CFRA 3RFTA 1AVTA 4C2AA 4PAGA 4Z4HA 4FYKA 3AR2A 3R9XA 4P3PA 3GFTA 2NZVG 4XAQA 5IUNC 5K8CA 2IBSA 1FTYA 1CY0A 3DE5X 2BFOA 3IOBA 4G3IA 3PQFA 1QGUB 5C8VA 5E95A 1V8PA 3FUUA 1PGPA 4MVJE 2YXPX 1UWCA 2VDKB 3P27A 3ICWA 3VNNA 1FC0A 1BKDR 4EAAA 3SIWA 1Y3AA 2B4QA 4YBRA 1E4FT 1BJRE 5I48A 4NBSA 1GUBA 4ND8B 4YUXA 1G5IA 1W1IA 4BXXG 4KPUB 4GMKA 5KHOC 4OGGA 4KE6A 1VJTA 4NMWA 4UMEA 4FEYA 3G23A 2BHTA 3TQHA 4NSNA 5KFKA 3F2VA 2X8WA 3MNFA 2PX5A 3QV1A 4JV0A 4KMSA 2VPWA 4IICA 3DMTC 5HBGA 1BC5A 4DLPA 4J4HA 3SFVA 1ETUA 3GPLA 1W29A 2OCBA 1PNQA 4JXUA 5KNBA 5I8WA 5LQAA 4EI9A 3X2EA 5MDHA 1KY5A 4K6FA 5CJPA 4RIFA 2QW1A 4RE6A 4PZPA 3FPAA 2Z2YA 1LDMA 3SEFA 2BQRA 3L7KA 4TV8B 4GSYA 1SA0A 3CZCA 3LS2A 3FFAA 1XTUA 3PEFA 3NV9A 3P1JA 4EQ6B 4KFRA 5JAIA 1RLMA 1KI2A 1GCOA 2HPZA 4JIGA 3VPXA 1YQUA 1M2VB 1RWOA 1S96A 3F71A 3CKYA 3GAFA 3A06A 2QW0X 3O83A 2FQ1A 1N7IA 2IYAA 2YWCA 4LF8H 3CSWA 1XRSB 2IF0A 2XDQA 1IATA 2H07A 5EAIA 2ZUDA 2EJ0A 3JWIA 3N3AC 4J0GA 1RYHA 4DWVA 4F56A 1LC3A 3IGFA 2LXNA 2GPYA 3RGZA 4K28A 3W6PA 2QOEA 1QIJA 1I6KA 5J2TF 3IE0A 5E3IA 1XVUA 1FDOA 3FDFA 4LCEA 5SZJA 3TVYA 4U5QA 3STVA 2DKNA 1H4QA 4ZVNA 3FNQA 5DHTA 4LFCH 3ASZA 1V3QE 2IIVA 4ZJZA 1Z6YA 3CLKA 4M1WA 3L9XA 3V97A 3J81k 1SBNE 4NAUA 3GTPA 1V3UA 2HSDA 3UW3A 1WPRA 2Q21A 2Z4TA 5DISC 3GCZA 3IKVA 2JHAA 1SCUB 5EKSA 3OVMA 4DR1B 3E3NA 5FA5A 4FILA 1LPNA 1M7BA 5HV6A 2C8KA 2ANCA 3AOEC 4F2HA 4ZVUA 1YE3A 2NYRA 2WK1A 3SE7A 1N75A 2Y0PA 4CF7A 3A2LA 4CMEA 2CQYA 4IV5A 5D00A 1WMAA 4F2GA 4ER6A 3GMTA 1CLEA 3SM3A 3PDUA 1Y48E 5A5DA 5BURA 4G5HA 4EJ6A 3L0DA 5FEUA 2C1XA 4WLVA 3JZDA 2DY1A 5AW4A 2JW5A 2VDJA 4L95C 4QHTA 3RSCA 2COEA 3A04A 2YZ2A 3MB8A 1NQVA 4LFBB 3VMMA 2ZJ3A 2JIPA 5A5FA 1FSFA 3D4BA 4M1TA 3WNDA 5A5VA 3JRNA 5ALXA 5KOJB 3DZJA 2JFGA 3ITKA 1XRNA 4YWHA 3WLPA 4KUHA 4R7RA 1ZUIA 4LFAB 3Q6MA 2BD0A 2VRWA 3KVNA 3THXA 4MNTA 3KYIB 2HCJB 2WWYA 2E4XA 3RUEA 5EDWA 3RR5A 2IU6A 4G5SA 3HFSA 3K16A 4CKXA 3UM9A 3ZWKA 3DW1X 3A7DA 2ETVA 5HE9A 4JLSA 3KUKA 4WCVA 3GZNA 1PV1A 2JH3A 2HWUA 1PWZA 1RQRA 4LBVA 2YBEA 3PNSA 3KLOA 1UDAA 4CHTA 1DE0A 2Z2KA 3WMXA 1M1NB 3LJKA 2VPPA 1H42A 3PIRA 4U2EA 2V4QA 4LRWA 1DAKA 5A4IS 1P4GA 2PWAA 4E5PA 3URKA 1L7XA 5BUSA 2LV8A 5EWJA 2J85A 4YP9A 1BS1A 3M9NB 3AR6A 4LMRA 1V16A 3IP5A 3KLPX 3NPMA 1LJLA 3CNLA 1PZFA 4PSVA 1RAGA 1P60A 3EJ6A 1AXEA 4C9BA 4GPBA 1TYAE 3F3YA 2O8VA 2QMEA 4C4XA 4A6PA 4JUCA 2X0FA 1YRAA 4YONB 1T0UA 2ZR8A 3MD0A 2HJWA 1JR3D 1H5QA 5DI9A 4BFVA 4APMA 1KYVA 3UK2A 3WK7A 2ZSUA 4PPQA 1FRQA 4OQXA 1U11A 1GQOA 3QQ5A 4AZ3A 2IXFA 1EVZA 1HKHA 1G291 5P8WA 1WKVA 4MUEA 4LBWA 9LDTA 4LC0A 2Q9CA 1WCIB 1L5LA 3UMVA 1VI5A 2XDAA 2R2GA 4QYWA 4ZU3A 2RHCA 4GMHA 3L4BC 3QNUA 4B71A 3TLCA 2CLDX 2O8NA 4ZO7A 4YRPA 2B83A 2HZBA 2CVOA 1IUKA 1IZYA 2XXBA 3DLTA 5AQ1A 3JQPA 4GGMX 3T06B 1SD5A 2F3SA 1WZEA 3C3AA 3RTCA 5I7RA 2Z6AA 3EQ2A 1Z0AA 4FHZA 2J33A 5EC8A 2PN1A 4KQXA 3TGWA 1MXFA 2G80A 1SGWA 3AF1A 3T94A 2RONA 3UJCA 2QRKA 2ZIUB 3DD5A 4ZCRA 1U8CB 3IPRA 4M76B 3KSRA 1KTAA 3KHRA 4LJRA 2Q4EA 3NWJA 2AG8A 3ELBA 4IZHA 2VZ8A 1UQRA 3CGWA 3UWKA 2BHSA 5EIXA 1C0LA 5PGMA 4B3RB 2YY6A 1P7CA 1RYSA 5IYZA 3P9KA 4B31A 3AUTA 3DTVD 2OH2A 4HGZA 1KIFA 1T0HB 4ZK2A 3GA0A 2IYEA 3DWGA 5CB4B 4GYJA 1T35A 2VAPA 4Y2RA 2GXAA 5JCXA 3W1GA 2Q4OA 4E7OA 1CTQA 1QU3A 3DEKA 4LV6A 4DLSA 1BYIA 4LKOA 2NYAA 1NIPA 1K8ZB 4MR9B 3OQMA 3GRRA 3D2LA 1W88A 4TZ0A 1Y9JA 3PDIB 4DKJA 3LUAA 3R6DA 4NG4A 3AJAA 5DEOA 1A98A 1XRPA 4MVJF 1ABBA 4P3XA 1U0SY 3ZBQA 3BRQA 3CVJA 3IAS1 3PJEA 2J5KA 2NACA 4FTWA 3KKOA 1KQOA 3GCDA 3KSZO 3IBSA 3TCKA 2PBZA 1CUFA 4KBGA 4I4TB 1W1WA 2ZYHA 1FXWA 1XK7A 4QDZA 3DBLA 1FLAA 3PIDA 1K5DA 4NE7A 4MXDA 2HHJA 2QG4A 1IMOA 2FUG6 2PGLA 1L5WA 4M22A 2CXOA 2L69A 2DHRA 1D0IA 3J80W 5JH7B 1EHIA 1DBVO 2OLKA 1NDHA 4AWBA 3I2KA 3RNOA 4AKGA 3WDSA 3UHAA 3LZCA 5HMMA 1NN0A 2FPPB 3WGVA 5AVOA 4N7MA 3THYB 2H6EA 1CUXA 1O4WA 2JRCA 4V1CB 1NKSA 4UJ5A 2FQYA 1T5HX 3CLSC 5DWDA 3RANA 4NBLA 4TLBA 2V7TA 3PC2A 2FLPA 3FUVA 4UM5A 1JFVA 3V8QA 3NBYB 1Q74A 5IM4F 2X23A 1I1NA 1Y9AA 1W36C 2WTBA 2FWPA 1J9ZA 5HFAA 2C2EA 1ZX1A 1FDIA 4XOUA 2J45A 1VYTA 4QUIA 521PA 4CLXA 2WV7A 2I2CA 1JDBB 1HC7A 2EWVA 2XB4A 5EY5B 1JI3A 1OW3B 3PNQA 4Z3OA 1K83A 4LZAA 2QRZA 1VSUA 3SY8A 1I0ZA 5M29A 2ZIEA 2EATA 5EIBC 1D0SA 4RQUA 3BKXA 3MUNA 2V54A 4YO8A 4BMXA 1QAQA 2CBGA 2HSEA 1E9BA 4HDOB 3VFDA 1Z16A 3PPWA 1A82A 1BKYA 2CN1A 1NTRA 3ICEA 4B6SA 4P98A 5H4GA 4MP6A 4R1TA 3QP9A 3WSWA 1O5IA 4JSRA 1L7OA 3DC2A 4Z0PA 5C1IA 3B6JA 4Y2SA 2QM8A 4DQKA 1CRQA 2EGUA 2FK8A 1PR9A 1Y3HA 3CX7A 1NVFA 4YWJA 5I9NA 1JEDA 1ZD3A 4J0JA 4KYUA 2XBUA 3RADC 2D1YA 3VNSA 4UU8A 4WZBA 5HK8A 3QPDA 3TSZA 3WA6A 2UXBB 5AK3A 2YV3A 3Q11A 1JLLB 2J6HA 1HMPA 3JQBA 3U17A 3WKEA 4DA7A 3QSYA 1E6KA 3GL9A 3FGZA 4TLDA 4JASB 4LTMA 3MOIA 2H54A 1AC5A 2XQFA 2XCSB 3BXPA 1A5BB 2PVSA 1H2EA 2WVHA 2FHSA 1P2FA 4L5YA 4Z7NB 4M21A 4IVQA 4P35A 5CT4A 1P4RA 1C50A 4ED9A 4HH1A 3BS4A 5KNDA 3WNVA 4YGXB 1P18A 2VA9A 1YDEA 3B3AA 3KG2A 2YCBA 3OC6A 3NAMA 2HMUA 1LB1B 5CXUA 2JA2A 1BA3A 2E48A 2ATXA 1I1OA 3JAKB 3OPNA 2F8MA 4NMHA 4PZ0A 4ZZ1A 2VSOA 1JHAA 1MVLA 3RVQA 3MD9A 4YT5A 3EZXA 2RH9B 1Q57A 1OLSA 5JECA 2I5PO 3D5TA 3TZHA 3O95A 1B2LA 4C4OA 3E6AA 1TXGA 1U9ZA 1XCGB 2WIBA 1KMMA 4ACAA 1WNTA 1T4CA 2IOFA 4W8OA 3QTBA 4F2DA 1CR6A 4E46A 4X93A 1L8OA 3AEXA 3IV9A 4CM3A 2GPWA 4WUVA 5INTA 1Y6RA 4CMBA 2VJBA 5DRTA 3P2KA 2Q5JA 2OAQ1 3KKMA 4DIDA 2J9GA 2CLSA 4XH9B 4KIWA 3GJZA 3FCOA 1SY7A 1I33A 2ZR0A 3V80A 5C31A 3DCNA 3QEBZ 4ESHA 4V39A 1OIXA 2XYRA 5LJLA 3U55A 2VHXA 5F23A 3PE6A 3F8SA 1M83A 2XXAA 4ZC1A 4CM6A 5BUZA 2GCNA 2IU0A 2W83A 2G9QA 4MIOA 2O8EB 3T61A 2OWDA 2VWHA 2O54A 1VIVA 4Y2VA 1G8SA 1S3SA 4WNAA 1T25A 3PJGA 4CLEA 3DF7A 1WSDA 4QWBA 1NW5A 4BJ5A 2C7OA 3SGIA 1GU1A 1Z2EA 1DXQA 1OA0A 3DVQX 3VR2A 4DIOA 2QZPA 2AJCA 1P0CA 1A9TA 1C41A 1AK9A 3DYBA 2VJDA 2SKCA 2EDCA 3AP2A 2LD4A 2CHQA 1AK1A 4UPVA 1OTHA 2OV3A 4RF5A 3UC5A 3QU2A 4O86A 1ZOSA 4B3FX 2H52A 4IYJA 1T91A 1SVIA 2FR0A 2HMSA 2B34A 3GOQA 3ZTYA 2GD0A 4J9SA 4C7BA 3DAPA 1YTUA 1P0FA 2AN4A 5BWMA 4M1ZA 2IOFK 3JALB 4R8VA 3T3PB 2FP4B 1D4ZA 3ZD7A 3DE7X 2PV0A 2GUGA 3UB4A 3JQ9C 2X1MA 1U8ZA 3IIEA 2R48A 4DQNA 3PPVA 3EFOB 1JZSA 4B3GA 1E5LA 3H9GA 3NC0B 5IG2A 1JR2A 1I4EB 3HZOA 1G8PA 3W4IA 5B1EA 2BEUB 3BE4A 3Q88A 1PR0A 5IDWA 4UNPA 3LI2A 1YXMA 2CE2X 4CTOA 1ZMOA 1IYDA 2BSAA 5IJ0A 5I5WA 5DM70 1DAFA 3QK7A 5IC6A 2IPOA 1OH5A 4Y18A 4C7OB 1G6Q1 1KMQA 3N8KA 4LUCA 1YGPA 3HN7A 2W5UA 1N6OA 4PBSA 5ENZA 4DM4A 1MEEA 4QQFA 1NZJA 4KAFA 1L4BA 1OU4A 4QRHA 3TTXA 4HEJA 1B93A 3F96A 3ABSB 3G0IA 5BW6B 5D51S 4CM8B 2D0IA 4LOLA 3DTFA 2PT6A 4PHTA 4ND1A 3MOGA 2YWRA 3OG9A 4J0CA 3JQDA 1Q50A