4MAMA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an adp analog, amp-cp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
373
structure length
373
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIAGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ADP analog, AMP-CP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 121
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4mamA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4mamA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mamA01
4TV9F 4O7SA 3RV3A 2VPQA 1IOWA 1SCUB 3HB9A 3N6RA 2WYOA 1VBGA 3TW6A 4WD3A 2C00A 1PX2A 4GGMX 2W71A 1KUTA 3HO8A 5IYZF 2W6MA 4O4HF 4FE2A 4HNTA 4ZI7F 3HBLA 5HV6A 2FPPB 4WBNF 2NU6B 1IOVA 2Z04A 4YBZB 5H80A 4O7NA 3R9RA 2ZDQA 5LOVF 5CB4F 2V59A 1T36A 5LXTF 1KC7A 4I4TF 2DIKA 4FFMA 4YAKB 2GLTA 3RUPA 4M99A 2R6FA 3KALA 2R85A 4C5AA 4IZOA 2R82A 5JQGF 4I55F 1UC8A 1VBHA 2NU9B 2GPWA 4IHJF 2VQDA 3VA7A 4HR7A 1BXRA 5DMXA 3G8CA 4O7ZA 2NUAB 4EGJA 4O83A 2YS6A 4TUYF 3R5FA 4IWYA 3LP8A 1GSAA 4DLKA 2GQSA 1M0TA 1VKZA 3V4SA 2CNUA 2R86A 4I50F 5JH7F 4MV8A 3RV4A 1UC9A 5FNVF 3VPBA 1CS0A 2R87A 2NPOA 3JRWA 3MWEA 5CAEB 2YZMA 3Q1KA 4EABA 2YRWA 1KJ9A 2YRXA 4YJ3F 3SE7A 3ORRA 2Z02A 4C5CA 5K2MA 1JDBB 3BSWA 3WO1A 1E4EA 1JDEA 3U54A 2J9GA 4E4TA 1KBLA 1GLVA 3BSYA 4NYEA 4O7TA 4FFRA 1GSHA 2CNVA 4YB8B 2FB9A 3R5HA 2W70A 4FU0A 1DV2A 2PBZA 1PK8A 2YZLA 2QF7A 3OUUA 2R84A 4FFNA 1W93A 2NU8B 1JKJB 1KJQA 2YZNA 4MV4A 5LP6F 1KJIA 2I80A 3RFCA 4M9CA 4O7LA 3TQTA 3U9SA 1C30A 2DLNA 4O4IF 1A9XA 3BFPA 2PVPA 4YAJB 4C5BA 3G8DA 1DV1A 2W6OA 4MA0A 3GLKA 2R7MA 2CQYA 3AW8A 4MV7A 1WR2A 2R7NA 1OBDA 2I8CA 3WO0A 2W6QA 5KX5F 5I47A 4MV6A 4IIJF 1AUVA 4QSHA 4DIMA 4EA7A 3I12A 4MAMA 3MWDA 4HQ6A 4MV9A 5LYJF 4L1KA 4Y8VB 3U9TA 5JVLA 1CQIB 2VR1A 1C3OA 4EGQA 5EZYF 2FPGB 3Q2OA 3JRXA 2ZDHA 4O4LF 4O2BF 2SCUB 1KEEA 2P0AA 3ORQA 4O4JF 5JQWA 4O84A 1EHIA 3AX6A 1I7NA 2R7KA 4EA8A 3WNZA 4XYLB 5C1OA 1E4EB 2YYAA 4IWXA 3NUAA 4MA5A 1JLLB 2GQRA 1I7LA 2V5AA 3JZFA 1M0WA 1EUDB 3U55A 1B6RA 2YWVA 4FGRA 5C8YF 5J2TF 1Z2PX 4ZQIA 3TINA 3OUZA 4MV3A 2R7LA 1M6VA 2CNQA 2FPIB 5D8DA 2IP4A 2V58A 4XZ3B 2YS7A 4HNVA 3VMMA 4FFLA 3K5IA 3KAKA 2NU7B 4EA9A 3TIIA 2ZDGA 2DWCA 1DIKA 1ULZA 4ZOLF 2W6ZA 1GGOA 2YZGA 1W96A 1A48A 1Z2NX 4ME6A 3DF7A 4XX0B 2FP4B 3V4ZA 1CE8A 2YW2A 3BSSA 3JZIA 4M9UA 3K3PA 2XCLA 5CA1F 1AUXA 1BNCA 3LWBA 4EAAA 3GIDA 5C1PA 4O81A 5HBRB 2DZDA 4MV1A 2CZGA 2X0SA 4M98A 3E5NA 4HNUA 2I87A 1CQJB 2VHEA 2GPSA 1EZ1A 4EG0A 4O82A 3R5XA 5J2UF 1KJJA 5GONF 3MJFA 1GSOA 2YL2A 3VOTA 2XD4A 3BG5A 3R23A 2PN1A 2HJWA 2W6PA 4O86A 3VPDA 2OLSA 3UFXB 4J6EA 4FFPA 5BPFA 4O7WA 4O7YA 5JVDF 4O2AF 3TIGA 5CA0F 1EYZA 5KKNB 2W6NA 1Z2OX 5BMVF 3N8DA 1EUCB 3KREA 4RZQA 1B6SA 4O7VA 4FFOA 3K5HA 1OBGA 4O7RA 3ETHA 3KAJA 4YJ2F 5LA6F 3ETJA 3QFFA 2HGSA 1KJ8A 4TV8F 3VPCA 5BPHA 4XYMB 2QK4A 4ZHQF
chains in the Genus database with same CATH superfamily
3P2JA 4I3GA 1BRTA 4CEHA 4R8SA 3ZHXA 3M1IA 1HK7A 3K15A 3IJ5A 1XXHE 5EQTA 1RHKA 1W59A 1SBQA 2FG5A 3DF9A 1T3NA 2XB9A 3D6JA 3UNXA 5CJPA 2Q41A 3AHJA 1KWKA 4OTZA 4PYQA 4FOTA 4RDCA 5AW7A 4EOGA 1KI9A 4Q24A 3U26A 7GPBA 3WV5A 4XXHA 5ESWA 3KLNA 4AB1A 4JUDX 1KBQA 1G16A 1PJBA 3HLYA 3TMAA 3D3WB 4OU4A 5BWCA 1PNTA 4KO1S 3BQMB 2C35B 2IXTA 1A9XB 3QU2A 3AI3A 3TOVA 4CN8A 1YONA 3F0TA 2OBBA 1PEKE 1A3GA 1BVYF 4L4YA 3WIVA 1R0WA 2WI8A 4CV0A 3PGA1 1DOAA 1D0IA 5TNXA 2Z04A 2C92A 1W0CA 1W0JD 3ZHRA 4XJXA 4MUXA 5IW8A 1GTMA 1AGPA 3IQHX 4PO3X 5JAMA 1L4GA 5DRYA 1GHTA 2ZYIA 1JEDA 2FPWA 4MGHA 2EFEB 2NVOA 4UTZA 2IS2A 1V8DA 1BGXT 1XAJA 2PBRA 3ASUA 3HYCA 3L5KA 2O4UX 3JALA 3SZLA 5G0UA 2QRUA 3NBAA 2B92A 4P3OA 2W9BB 4TZ0A 2QN7A 5FTLA 5L7WA 2V6BA 1LVGA 3INNA 1GGHA 3ILXA 4P4SA 2H9AA 2FMAA 3WY9A 4S24A 3WLLA 3PDJA 5AKHA 3OEEA 4E94A 5IX8A 3QKRA 1XMSA 3AZOA 2EHJA 4ZZ2A 4RORA 2C3OA 2QYHA 4PHTA 5AIAA 4PYKA 2E6UX 2W93A 4DNXA 1ID1A 2C7VA 2Z2ZA 2GNAA 2XCUA 4UNSA 4ZCIA 2YXDA 3I52A 4JI8H 3W2FA 1P4AA 3HSSA 4MLPA 4WXMA 2RIPA 4DQ0A 2WQ7A 4HNSA 3U37A 2I2AA 2VQDA 2M05A 4NMLA 5JBIA 5K8VA 2AFHA 2UUBH 1LS6A 4V39A 4WXEA 4RHFA 4XDGA 1JU9A 4ZVVA 3I0NA 4NF2A 5DMXA 1RJ9B 1EDEA 2OP1A 2HBRA 4EKEA 4K1XA 1ISGA 5ELLA 3WL5A 5A3JA 5LXTB 2O5VA 4RFSB 1R00A 1JXLA 4MW0A 5TGTA 2PUTA 2OEPA 4F6CA 4LMPA 1L5HA 4YV0A 4E6PA 4R0MA 4DLNA 5KWIA 5L3SB 2ECKA 3H3XA 1IYDA 2ERXA 2PUWA 3CPJB 1Z26A 2MJLA 5F35A 1YJBA 2I6TA 3CRRA 2H1OA 2HIGA 1QYVA 1Q44A 1N36H 1E7WA 2Q5OA 2XUIA 1OAKA 3LP8A 1E1KA 5EXTA 5ALWA 2ADOA 3ICEA 2GQSA 3IDFA 3W5IA 1O08A 1GXSA 3FJOA 3N74A 4DDHA 5M04A 3T0FA 1IXYA 1VKZA 4TRJA 3T1YH 3GIMA 1L4LA 1ZD8A 5ISMA 4JQSA 1MQAA 1V1MB 1XDGA 2ZG6A 3C5HA 3G0GA 2ZUDA 5A0VA 3E48A 3TW4A 2ZJFA 4IVNA 1FOEB 2PRJA 3GLFE 4KV9A 1IMOA 1MLDA 1XPJA 1WMFA 3MQ2A 1QP7A 3ENZA 4JWKA 1CZHA 1NBHA 1RJ9A 4YPOA 5T4HA 3O47A 3ZLTA 3I2KA 4IG9A 5CJ2A 1TPYA 1GYRA 1T8WA 3KKZA 2C28A 3LUBA 2IKQA 3QFHA 4ZDWA 2HPAA 2NX2A 1ODJA 1DDIA 3HXOA 3UB4A 4D8XA 4UCOA 2ZQ5A 1EK6A 1J4AA 2WIKA 4FD3A 4JU9A 1YV9A 5FOSA 3OFSA 2PUFA 3F8NA 4FCWA 2YZMA 1RWWA 1GUBA 3LDFA 4LYHA 5E0KB 1O95D 2H51A 4JXZA 1WD7A 5KTNA 1NQ5A 1P1FA 1XZNA 3UK7A 1XA4A 3OHSX 2ZJ2A 4D3FA 3G9QA 2YOGA 2C59A 1FU4A 2JCGA 3I5AA 2YMQA 4JEIA 4NYMQ 2R1TA 4ED1A 4HF7A 5HF9A 4D25A 4DBLE 1T1GA 4HUJA 2R6R1 4OHOA 4BEVA 2CHFA 3LHKA 2JCVA 4KQKA 3LO8A 3LC7O 1EE2A 5CIWA 4D57A 4LX8A 1HDEA 2C9OA 3RUAA 2ACVA 1FW8A 4BL5A 4C4TA 1A8PA 1XRLA 2K4MA 2VHTA 4QVKA 5ALXA 3AK4A 2JHFA 4U7TB 1HA3A 2YCHA 2UUPA 1VA5A 3E4CA 3E8XA 4MQUA 4MP3A 1Z12A 3WSTA 5HFAA 1JDNA 2FVXA 3N8HA 5FORA 1NV9A 3W5VA 3VYSB 4AZ3A 1ILEA 4AF7A 1CRWG 1NGSA 3ZW8A 4B83A 1HZZC 1VPTA 1VSBA 2JBHA 1CZNA 2R6AA 1GRNA 3BBPA 5M3BA 3VM6A 1DKMA 2GVZC 3IBSA 4AU1A 4Y9TA 1QP0A 1FE8A 1CS0B 4AS2A 1NMZA 5DE3A 3PKJA 1T10A 3VYVA 4G5FA 4TLLB 2HBQA 2YZ7A 1O5IA 5DK6A 3RNLA 2ZI4A 1X3LA 1SG9A 4QDTA 1NZDA 1GFSA 3F98A 1KSFX 2XA9A 3R6TA 4DA8A 1E3QA 2Q50A 1R6BX 4MHTA 5E8JA 2C2RA 1QKKA 1KC1A 3ND9A 3N28A 4RTMA 2YMPA 1D6SA 4UBJA 4JC8A 4M36A 4NZPA 2JAQA 4WLUA 3UOAB 3EC7A 3TRKA 4D0SA 2NU8B 2QVLA 4G24A 1UIRA 4GOND 5AI4A 5K3CA 1AUQA 1KH2A 1Z8HA 1CYDA 2OFWA 3JARA 4ZRDA 5A62A 1OH5A 4EBBA 1JT9A 2N1BA 3MWEB 2PUEA 2OO5C 1M1NB 4X62H 1LZKA 4QTZA 1W5FA 4JY7A 3D3WA 1L5QA 4WH0A 4BNYA 4Z9XA 1Q1EA 2AQIA 2O4CA 2Q3HA 2R751 5CXUA 5KDDA 5KT7A 4HNAB 1IN8A 3ONEA 3BFPA 3TIXB 2CFTA 3ZWCA 3C8UA 4AZ0A 1YZTA 1LPNA 1LVHA 3G7UA 4GZLA 4R9VA 3K72B 5TRTA 1ZWLA 2KLBA 3DCIA 5L6MB 2J9YB 1KIAA 2PHZA 3IEXA 3IH5A 3MUFA 5JXIA 1ECPA 1PZFA 2OWEA 1EX1A 3IBFA 3MYYA 4RH3A 4O33A 4WOCA 1L4BA 1EJBA 2J4DA 1TAHA 2G40A 5A9RA 3GLKA 1CR1A 2Z08A 2ZIUB 1U8UA 4XJTA 2V4UA 4YWHA 3FKSD 2W90A 3M49A 1DQSA 2FDCA 2Q2TA 1G21E 1E5XA 1OIXA 2EF0A 1SUCA 2PYIA 2WOJA 3EBLA 4GUDA 4GYWA 4DRYA 5CM0A 2VCEA 2JGFA 3ODGA 3QXSA 1LPMA 2HO5A 2QL7A 2ODAA 1MX5A 2R3SA 3E9RA 4RZSA 4EJFA 1NRJB 3AUAA 4BP3A 1BWPA 5BWRA 1FU8A 1SOVA 4FNOA 4RENA 4MPDA 2NXEA 3QVUA 1V35A 5G02A 5CR5A 1L5HB 1MGOA 2GWRA 1CY7A 4FMPA 3WZ2A 1IUPA 5K6TA 2VA8A 4H7JA 3T54A 2OL4A 4N6NA 1JF8A 3S7ZA 2RF4A 1T4MA 4HQ6A 2Q1XA 2VYQA 2FFBA 2WWTA 3K8YA 3OM0A 1DBQA 1Z22A 3A6JA 4AJEA 3WGIA 5AUQA 1ZC3A 2FY8A 3UAZA 5LWHA 5KNCD 3UFBA 4MLDA 4XW2A 1L4KA 4NFYA 4QUEA 3CG4A 3O1LA 2VJBA 3BAAA 1S8AA 1X86B 2VTBB 1LA2A 5HGXA 5AR1A 3C3XA 4EHDA 1AMOA 1DQNA 4IDFA 1R9MA 5I9NA 3DJFA 1EESA 4MVWA 1SRQA 1XZIA 2J48A 1HE4A 3ANLA 3ABZA 4RS3A 1EBUA 2VHWA 4QBIA 3PR4A 1WCMA 4FZRA 3IUEA 5F51A 3YASA 1XMJA 2EC5A 2I7CA 4DDUA 2HBYA 5I01A 1NVXQ 1ZM2A 1PSZA 3HB4X 3OC0A 3WADA 1Q91A 4IIUA 4DRXB 1IN7A 3VR2D 3D64A 3JRXA 4RK0A 1C8VB 5DIZA 1O89A 2EZUA 4NYIR 5TQ2A 3O8OA 1V96A 2FKNA 3A9SA 4L5YA 2SCUB 4JQZA 5LKAA 2QTTA 2V8OA 2R8IA 4LH6A 2RMKA 3QUQA 5AJVB 3HBJA 3MB5A 3CCCA 4R8MA 1LFDB 1L7MA 3E82A 3L6EA 4B46A 1RPNA 1Z5VA 2CBXA 2ONZA 3E8SA 1SUFA 3Q0EA 3ANYB 4F71A 3UJAA 4I9NA 3UGKA 3MNFA 4U3JB 3GA5A 1THTA 2P1RA 4ZEOA 1D07A 3GRFA 1TAQA 2VYFA 2N46A 5FLXW 1YZFA 4Q1AA 3SXPA 1JIUA 4MTDA 3QOXA 3A4LA 1OZFA 1M6YA 2ZT7A 4G63A 5DLPA 3TNJA 1YA8A 5IK2D 2LCFA 4GRDA 2BR5A 3OHPA 4KXWA 1BYUA 5E4TA 1RQ2A 3GUCA 1O6FA 2OSBA 2NYUA 3SYRA 3FMGA 1HQYE 2OORC 1M2GA 3SHOA 2V5AA 5JOQA 2IBTA 5P8WA 1OBOA 2CVHA 3H6HA 1ZOLA 4PCUA 1RQGA 5CMLA 1PS0A 1RBMA 4PQFA 4ROSA 4ICIA 1VJRA 3FPAA 4FGRA 4DCTA 5L51A 3LDAA 3K6SB 5ALPA 2W42A 1HV8A 3AEXA 1F8YA 1L0BA 1G63A 5TX7A 3FNQA 5I7UA 4FS1A 1Z8FA 1HO3A 3EDCA 3FLAA 2IOFK 1XX6A 1EEHA 4JROA 1EP2B 1XNHA 1K98A 2E5FA 2F6RA 3HHPA 4QGAA 3I9JA 4WUTA 4BMXA 2V1XA 3PC7A 1RLJA 4X64H 4LOAA 3ME5A 4LOKA 4Q1EA 1OYYA 2IRWA 3CWZA 4IQ8A 2PH3A 3PQ4A 4S04A 1MOSA 1Y4ZA 1GAJA 3LRPA 2ZSJA 3BXOA 3N2IA 1JEEA 3PNVA 4WI1A 4ZAZA 1KDZA 3G0BA 1PFKA 3HZZA 3I34X 3T95A 4NABA 5FRDA 1SXJB 4B2PA 3RRZA 3RB3A 1TCVA 3K70C 5EVJA 3O8QB 5KFJA 2IJGX 1LDBA 3BL5A 1U0OC 2C95A 2CL7X 3LZCA 4WN9A 4ZVTA 3Q9UA 3N2LA 4Q6BA 2FQQA 1MZBA 1KO4A 3C2QA 3HR7A 3D5EA 2KI5A 1SEVA 3H3VH 3HQ4O 3L0ZA 1UXKA 2VRNA 4KH0A 5EOVA 4F6LA 5I7HA 3C3JA 3O9MA 2H1SA 2ZBFA 4C3UA 3U19A 1U2EA 4CKBA 4GP9A 2PZJA 1IUNA 3CF4G 3PNKA 4YV1A 3LPLA 1Y3HA 1ZEMA 3IE0A 4TGLA 2YJ6A 2A9PA 3NBZC 3VVLA 1X13A 5KNDH 2H31A 1KO5A 5KHAA 4N48A 2XZOA 4I7HA 4C7OA 2GO1A 3DT8A 4DG9A 3ML1A 1VCHA 5DLDA 4DEXA 5BWLA 2H4XA 2DWCA 3IODA 4I3FA 4BMVA 1UBTS 1YKFA 2D74A 3LBYA 1CUSA 3I9MA 2OGWA 2BPOA 3IP7A 4FI3F 3CONA 4JDPA 5E8RA 5BV0A 1FNMA 3OSNA 1PD1A 1Z7EA 4YAWA 3OSUA 1BKSB 4M37A 3ZXYA 4CTMA 2GKOA 1VOTA 1QZZA 4IQ4A 1NUUA 1Y7LA 1T1EA 4GLLA 3PE4A 4K26A 4ZAYA 3DF7A 4MAFA 2F1RA 1V5IA 3EASA 4U2KA 3B1YA 2JJ1D 3OCWA 2FP4B 3EVZA 3HJFA 1HX7A 4F1KA 3C3AA 3WGVA 3W6UA 4MIKA 1T9ZA 1XMIA 2WHPB 4CLOB 2YW2A 3BSSA 3U2QA 4FYVA 3RC2A 3JQPA 3OX1A 4QJFA 4AECA 4ER6A 4NE2A 4ZQFA 5EKXA 1XZLA 3BGIA 1X8JA 5FFNA 3F9IA 4GC5A 1TZCA 1DP4A 1ODSA 3M3PA 3T7TA 3I5XA 1V5GA 2SKCA 3DL7A 1IYZA 3F6RA 4B48A 1OMOA 4LIPD 4EAAA 1RVDA 2V97A 4YMUA 3JTMA 4L76A 4N0QA 4FC6A 3A7EA 4P38A 4B6OA 4CM4A 2CKDA 1BWSA 2C9YA 3MLBA 1NF2A 1W2WB 3X1ZA 3RAPR 1J2EA 1P2GA 4P6VF 4RGBA 1E1CA 3KSMA 2IL1A 2P1DA 2XLCA 3QEOA 4MQEB 4KQMA 4Y2RA 3MTBA 5KNBH 1SH7A 2O54A 1M6HA 1E2JA 3DDSA 3S5UA 1HKHA 3PLRA 4M7OA 3W6NA 1XVLA 1E2QA 4OXIA 2FF7A 4R31A 3SFVA 4ZWNA 1J6UA 3D0RA 5A6SA 1A4UA 2P78A 2AXEA 1CR4A 1R0XA 3D7RA 2BEJA 3WA7A 1J7KA 2ORVA 5JS1A 3KJFA 3ZLVA 1NA5A 2JAOA 1U2GC 3CNLA 4PSAA 2DEUA 1RS0A 2ZJBA 3MJFA 2GKGA 4KXUA 3DTVD 5I60A 2BKAA 2YXNA 1A1SA 3ZEAA 3QX3A 5K0ZA 1OFUX 3GCWA 2DUUA 3ZVMA 2RFLA 2PS0A 2CCJA 2VDRB 2VRCA 4FS3A 4AJKA 5B55A 3HVRA 1RD4A 4KU4A 2OCIA 4B85A 4JYZA 3I42A 2L17A 3SFTA 4BQOA 4PQRA 2OLSA 1CJKC 3QFTA 4HBZA 4HBGA 2VUUA 3GFVA 4R0NA 4DQVA 3N7UA 2VJMA 4D3SA 2F2TA 4ZAFA 3KKEA 4D4KA 2A88A 2QIOA 4G6ZA 2QE7D 4ILKA 3PC3A 4ZV4A 2G8LA 1YKSA 1Q92A 5I9MA 3CLKA 1ZD1A 3G0CA 5CDYA 1S0MA 2R4UA 3HK2A 4RZ2A 1ZD2P 1QGDA 1XFDA 1CRLA 2G08A 3C1TA 3THYB 2W6NA 3WLHA 1EB8A 1N1GA 3I23A 5LDGA 2CB0A 2BMWA 2CHUA 2NZYA 2PUAA 3NDRA 2ZI3A 1CBUA 1QVVA 4JBIA 1NKSA 1P1BA 4JOSA 4D9EA 3PTLA 3RJTA 1BW9B 3OE7D 1XRNA 3O1JC 4MKRA 3WHLA 1A9QA 1TNDA 4MJXA 3T3IA 3KO8A 4R2WA 5DNWA 2BM1A 4D3YA 1SQGA 3EE6A 2W48A 1ZOIA 4GMDA 2OE2A 3UW3A 1JXQA 3NEJA 2JLYA 5BQOA 4DV7B 5KFBA 4H08A 1C14A 5B1YA 2ATEA 1TOAA 4DA4A 3C24A 3LC0A 1Y7PA 5JWHA 2Y0SA 4NP6A 4XUCA 5L3RA 1WHTB 4ZDIA 3GELA 5ALKA 5AI6A 1IBLB 1C2YA 4EATA 2BFDB 3WHKA 1TC2A 4CLDA 4ZYYA 3RANA 4X7BA 2HQOA 3HB5X 2HMYB 2Q5LA 3CVWA 3R9XB 4G0XA 5AKLA 1SZJG 2XHZA 2VUIB 1NWCA 3MS4A 5TS2A 3OT4A 3UK6A 4PLWA 3NH6A 1GLNA 2B7LA 3DH0A 4EM6A 5JRDS 2X3UA 2VOJA 2HIMA 3K0FB 3PW4A 3S40A 5JJBA 5DULA 4TYQA 3GCZA 4N6GA 3VU9B 3PHHA 4HWSA 4U02A 1BOOA 1ORWA 4ZDKA 3VYWA 3C41J 3FYSA 3M4XA 3TQFA 3ZE8A 3BHJA 2ZJ5A 3HZHA 1IOWA 2IYQA 4AZ3B 4YUXA 4N9QA 4QUAA 1UOPA 2CZCA 4DLTA 2W9CA 3HP7A 5HKBA 1O4WA 2E21A 4NDAA 5I7RA 3PITA 3TW6A 2WT8A 3KT0A 5I3CA 1PX2A 1H5NA 5BURA 2FSVA 4KIGA 3FKSA 4O6VA 3VKGA 3ZZTA 2V9WA 2XMDA 1K3TA 1GPAA 1ZBQA 3KR2A 3UJDA 3TAUA 4PO9A 2R8EA 4XA8A 1TGYA 4JIGA 3LIPA 1URPA 4KTVE 4JI6H 1E9RA 1DQYA 3EAGA 2Y76A 1ZA1A 3UHPA 2ZRLA 4CMGA 1FP6A 3FSEA 5IMBA 3X3HA 1H2EA 4PC3A 4JGGA 5MGNA 1OWMA 2Q29A 3EHEA 3VU9A 1IB0A 1IM5A 1F0NA 2R62A 1PWZA 2DU8A 3SG0A 4KPUB 5E4JA 4ECXA 3OIUA 4RVSA 4DV4B 1F7VA 3UHJA 3A27A 2NU8A 2PIAA 3PX7A 1II8B 3EGIA 3MOSA 3CLRC 4X60A 1NBIA 3AI2A 4OLHA 4C01A 4DLVA 4F60A 4K9NA 2QYOA 4UHCA 4Z99A 1QB8A 5I4IA 3ZCQA 4UCWA 1M34A 4BY7G 3HBNA 1SKAA 2ASEA 4FFMA 4JQOA 4WJLA 5BUZA 2XMQA 1O2DA 4LHSA 4X8LA 3DO6A 3RFTA 4EUNA 2PGDA 4ZYLA 2OFXA 4DB2A 2COGA 4JV0A 4B3GA 3V6HA 2PMCA 3STUA 4DMGA 2R82A 1BX1A 3HABA 4FINA 1E2LA 4BNMA 1VBHA 1GZDA 2GD0A 1FDSA 1O4VA 4Q3CA 1XYYA 3ETNA 1RTTA 1KEZA 2AEFA 2EL7A 2FHSA 3NQ41 5AM3A 1OBFO 1P33A 4D5EA 3KZCA 5EWEA 3HCBA 3PQ8A 1XJCA 1KVUA 4IHJF 1IVNA 1KPGA 3K16A 3CZ4A 4KR0A 4IJVA 1IQ0A 4R8LA 1V8OA 2DWUA 4MUKA 5G2OA 3EIHA 4ZZ3A 3NPAA 2C2GA 3D5QA 2QXYA 1R9NA 1P4HA 2WJ4A 4Y30A 1UBLS 1II9A 3RUFA 2YOFA 1N5RA 4NCJA 1A4RA 3UUFA 2CXQA 1JJIA 3URKA 1KFJB 3MCVA 3EY9A 4XIIA 5GJCA 1M7JA 3H8SA 2HWKA 5BXYA 3NXKA 2JA5A 2IPOA 3FRIA 4P54A 5CYOA 4A0SA 4B4KA 2VAMA 2WIBA 1O54A 4FLFA 3CCBA 3CXUA 3OF5A 4H1UA 4I5FA 5IJXA 2HM7A 3L7NA 4V2IA 3ROEA 3LAWA 2P9ZA 4K9SA 1NR1A 4RHTA 1I32A 4ZD6A 5LU9A 2RGNA 5D00A 1MA0A 2P8SA 1XTBA 2CLIB 3IUMA 4LNAA 1B76A 2W6IA 3H6KA 5ITZB 2UYCA 2YJTD 4LNUA 1HNZB 3GU3A 3AUSA 4R8UA 2QV0A 2R8JA 1ZCAA 2PU7A 2Y27A 1KVRA 3N2NA 1HFJA 3NVMB 3QWFA 4Q19A 4YECA 5AK5A 1XLWA 1UC4B 1XC7A 2QLMA 2VAXA 3O95A 4GAEA 4KRXA 4UMVA 3PXDA 2RAFA 5AKKA 3DOCA 3DNFA 2PGAA 1MB3A 5EJIA 1SKUA 1C0KA 3K5WA 4CNQA 3A4VA 2IA5A 2G1JA 1GGEA 4YCCA 1I2BA 1PFWA 1PBNA 1IE3A 4XGRA 3WBFA 4PHHA 4L51A 2BMEA 4HQOA 3BUSA 4N0PA 4GSKA 3OQHA 2JANA 3JZMA 2PZGA 3ZJVA 3KP1A 5DNUA 3ELYA 1OHHA 1XD2A 3GJYA 5ALUA 3CB2A 3HEAA 3N2EA 2ZYTX 4PZZA 2D2EA 3HB7A 1BE8A 2AHRA 2VHZA 3IX7A 2QLLA 2YWBA 4LVUA 5EY5B 4LXGA 4PZYA 5EESA 5LR6A 1RK5A 1YL7A 4KXFB 3TS1A 5BQXA 5KVVA 1RC1A 3J81A 2CCGA 4LJRA 2XV1A 3KUCA 2HA2A 4RHYA 2X8JB 1JLHA 2ZXFA 1NQXA 1LBTA 2GK7A 1L5ZA 3FDIA 2GPTA 3KCQA 1ABEA 3GJ6A 3DMHA 3SLGA 5JNWA 1XKXA 1QZTA 2CFSA 2JFZA 1OZAA 3AWIA 3BRQA 3JV7A 4HDRA 2CGEA 4AUNA 4ACAA 4HWKA 5IKOA 3BHMA 5IJWA 4ZYVA 3QF7A 2JI9A 2PMDA 1GA6A 3R9IA 1A2OA 1WSWA 4LF5H 3JASB 2QL9A 1J9GA 4FFRA 1E1LA 1V1RB 2GVNA 3B52X 4CQMD 3OTOH 1CQIA 1JQDA 3DP7A 4QDXA 2JEGA 2RE8A 1IJEA 3W5AA 2WD8A 1R27A 2HQ1A 4E03A 5GTDA 3KSDO 4JLWA 3T9CA 2NG1A 4RVGA 4MQ5A 1GM5A 1RIIA 4DAEA 1POXA 1I1LA 4CCYB 3W4IA 2PYDA 1XTKA 4B6JA 5KYWB 5A3SA 4TTIA 4KFTA 4L8LA 1AE1A 2WWGA 5EUCA 1Q14A 4WECA 3U80A 2JEJA 4BXOB 5BYBA 3NNDA 4DV6H 1S8NA 4M49A 3RWMB 2Y0EA 4ZK6A 1JH9A 2D13A 1UT5A 4ZCPA 4ALJA 1Y3BE 4C4AA 1G20A 2A2ZA 2R6JA 4AO8A 3BDAA 3T4XA 4FFNA 4D9GA 3A6HA 3I73A 1EAMA 1U8CB 3KM0A 3WYFA 3TTWA 1J0EA 1QRAA 3NUZA 1M2JA 4MV4A 1QE5A 2HV9A 4RUAA 3H9EO 1JAHA 3LUHA 3TLBA 1VB5A 2J7KA 3RFCA 2WABA 3PYXA 1WD5A 4FUQA 4B3DA 3TQTA 2A0WA 5C3MA 1TLTA 1VHDA 1NWHA 2WJ6A 2WHXA 4KHZA 3VX3A 2CJFA 3PG5A 4OFZA 3SQDA 4E08A 4LE0A 3PQ3A 4KWCA 4KMRA 1G7CA 3CRMA 4PSUA 4UJ3A 3CUVA 3NGXA 1H2WA 2CVQA 3EF0A 4IDEA 4J4BA 3OCXA 4X6XA 3JD0A 2FYTA 4DM7A 1J5XA 1WZUA 3N8KA 4EG8A 4QIHA 3NU1A 3QV2A 3GQVA 1AURA 3NRBA 3EISA 4MA0A 4YMWA 1MZVA 1ZD5A 2JJ2D 4KPUA 4QRDA 4J0DA 4CL0A 3BH7A 4HYTA 3M83A 2Q5EA 1ZK3A 2P2LA 3VPAA 4OXYA 4AZWA 1KA9H 1PIWA 4CKCA 2IZ1A 1NN5A 4I8IA 4QQRA 4Z2YA 3BERA 2RBEA 2PKXA 3ODPA 1QGAA 2WZBA 3EVFA 3V2IA 2I8CA 1HY3A 4M1WA 3OQPA 1EFRD 4GOJA 9GPBA 2ID9A 2C29D 3SIWA 1QG4A 5JZMA 4IX9A 5CFLA 4QHYA 2PMWB 2Y1XA 1WPQA 4R54A 2Y0BA 5HILA 2XDYA 5ESXA 4LV8B 1G98A 3I92A 4L5CA 4LTMA 4LI0A 1FQKA 2B4QA 2C2YA 2V7BA 4N8EA 5BVGA 3O26A 4X3PA 2QX6A 1C5KA 3U9TA 1AQUA 3M1LA 2QP9X 1OX5A 3E5HA 1SBCA 1MAUA 1U8TA 3PNMA 5JVLA 2A86A 4NS4A 4UAUA 5ARBA 1H2AS 5ITZA 2R5FA 1B41A 3EXG1 4B33A 3V7WA 3GJQA 3W04A 1FUIA 2E82A 3E84A 2J6HA 4XH9B 3D1JA 4TTRA 4L7VA 2V0CA 4R1QA 4PHGA 4UFNA 4CVNA 3MJRA 4G37A 5I51A 1I4OA 2WAQE 2C8VA 3T12A 2DFLA 2INGX 1A7JA 1KI6B 3AY7A 4LF8B 4AY4A 4YGXB 4AK9A 1PLLA 3P5SA 2BHNA 3SBOA 3SI8A 3FOWA 5D1HA 4CG3A 2JFWA 3EVGA 1VJ1A 2DAAA 1L7AA 4F97A 4B79A 1QIEA 5K20A 3ZTWA 2OOSA 2IDKA 2PNFA 2XT6A 3SXJA 1MO5A 1Z35A 2DGDA 3JVIA 3VNRA 2CUZA 1EE9A 4FNMA 4YT5A 1OFTA 5BN1A 1SPXA 1BN7A 4LNUB 4W9RA 4YRJA 2IYSA 2BHRA 1ZHHA 4D81A 4HVCA 4O1IA 3LUGA 4R3UC 3TUJC 3CPSA 4WSOA 5FBZA 3HRKA 3ZGLA 1AKWA 1NUQA 1KEVA 1ORHA 3WB0A 4E21A 5JATA 5NLLA 2GGSA 4HEHA 2CLCX 4JR1A 3V1LA 2ZIXB 3IHLA 4YIHA 3R8XA 3HV0A 4POOA 2Z2IA 5LDHA 3A4TA 1V26A 1QF7A 1E9VA 5TPZA 3F3KA 5LP6B 4E3ZA 3AT1A 4CZ2A 1THMA 5FWAA 2GQRA 2V3VA 1OXMA 1THGA 2ORYA 3PIIA 4E30A 4KR3A 3CURA 2ZTUA 4P31A 2VJYA 4JQCA 3ORFA 2NSDA 3PQ2A 4CM6A 1PJ8A 2IHJA 2XKAA 1TUBA 2SBTA 1K06A 1W25A 2SHKA 3VZBA 5FPQA 3RHFA 1PCXA 2W9XA 4UEOA 4B1FA 3RFUA 1NF3A 3ITKA 3QU7A 2W2LA 1YK0A 2PEYA 4YDRA 1RKXA 3SF8A 3U61B 1HYEA 3P97A 2YBEA 5EIAA 2R00A 4KQHA 3WI7A 4OKNA 1PZXA 2FN4A 3WK6A 4CCSA 1XT6A 3KQHA 2C4UA 2CC2A 4L8VA 3A8TA 2XADA 1MEEA 3DDHA 2D2IA 1Q6YA 4UEWA 3X43A 4RQAA 2ZSHA 5H81A 3ZZMA 1CCWA 2QAIA 1LLUA 3ZWYA 1NHWA 3EDQA 3UAWA 2I1LA 1PUIA 3G0IA 3UUEA 4DWVA 1E3TA 1CUGA 1ZW6A 3PF8A 4B3TB 2NAFA 1X1AA 3NT5A 1CKNB 4CQLA 3A3OA 5DBIA 3TLMA 2D5AA 4JJIA 4LRSB 4DQKA 1VECA 2IC5A 3AHDA 1NF9A 4DY6A 1HSOA 1D6NA 5THXA 3QYPA 1UAGA 2QI9C 2UZIR 3PI7A 4IYJA 1U0SY 4MVJI 4XYGA 3EA5A 1CQPA 3TM4A 5JY6A 2Z6AA 3IT2A 1YVUA 3O94A 1FJHA 2E4ZA 4LOIA 5DFAA 3OQ1A 4F5EA 3J81k 4IR7A 2VDWA 4J0QA 4ZU3A 2H2IA 1Y1WA 2DWQA 2GHRA 4P4LA 4EYEA 4EKYA 2Q99A 3HNPA 4QG7A 5KWSA 1Z45A 1NG1A 2MINA 2P35A 4YDSA 3PGJA 1C0IA 2OCBA 2PWYA 4Q9NA 6AT1A 1TJ5A 2J5KA 1LI7A 1XJ5A 5TJ9A 3HBAA 5F1KA 3NT4A 3UAOA 1EH5A 3WGUA 3NALA 1F20A 1ES9A 2FWBA 2RARA 3QVXA 2CJWA 1RZRD 5SICE 3LLUA 2OA0A 3ZE1B 3HUFA 3OOSA 5K8IA 4MI3A 1LBEA 4LFAB 2H59A 2ROQA 2P2SA 4OF4A 1Q1NA 1WV0A 1WS6A 3IMKA 4MPPA 3HCNA 4XQGA 1H3FA 4DZTA 1TCBA 3W3ZB 4DV3B 1T2FA 1DJNA 1JHMA 3EOZA 3FR7A 3KTAA 3O8QA 3PL1A 5FJIA 3STHA 2V3CC 1VPLA 1GUZA 5LZ9A 3RC9A 5FBHA 3CPEA 3QMWA 2EF1A 4J75A 3PXXA 4LDJA 5IP7G 1RJEA 3PX2A 3AIMA 5L9XA 3QLJA 2QLTA 4R7RA 2G1KA 3QOWA 4I46A 4RPCA 3TD2A 3WQQA 2I7DA 4EW2A 3NETA 3JU3A 1FX1A 3FVVA 1RAEA 2A92A 5FLYA 3VR4H 4DBLC 1A8IA 3WC4A 4WBNA 2OCXA 1XMQH 4G56A 5FP0A 3ROGA 1H2BA 3ZE6A 4UBIA 5FNVA 2DR2A 2EFGA 5T8KC 4F7WA 4Z86A 1IN6A 3CZAA 5HR5A 2H52A 3ROMA 3U4GA 4FOSA 1Y3IA 2XHEA 4NJEB 3W5CA 3E7XA 5ALIA 4LC9A 5BV8A 5A6VA 1S68A 2HRRA 4MI6A 2O2DA 3E5NA 1GV0A 1QKIA 3AY6A 4LK2A 3WGZA 4PQYA 2R79A 4MDFA 1UMCA 1V16A 1OXUA 1P1HA 2VK8A 2IITA 3U7JA 4F2HA 4PPNA 2COUA 2BRUA 2QMYA 3P20A 2VEOA 1L7BA 2CT8A 1F8GA 2DWPA 3FHOA 3HKBA 2Q1WA 3O2NA 3DKVA 3QPDA 1NRIA 4GL4A 3N05A 1Q3KA 4ENVA 1AKNA 1ESZA 1BDJA 2NW6A 3EH2A 3W1VA 3HSYA 2OOKA 4DMFA 2IFTA 1GU1A 3ET4A 1GSOA 1TK2A 3FPKA 3TN7A 3DBHB 2QS9A 4B6GA 1KKUA 3R9KA 3ONNA 4IZHA 2GBIA 4TRMA 5LB2A 4HV4A 1KZ4A 5IEJA 1ZAKA 2KMLA 2VCHA 1TIBA 3BVPA 1OYVA 3C6ZA 2YJZA 2QE7A 1Q84A 3EXEA 3WAKA 1R8SA 2VYVD 2BY4A 1ZITA 1TF2A 4LMYA 4BUJA 2J3KA 2GNPA 4HYEA 4OGFA 4CHGA 2XNDD 1KETA 3H4BA 3I30X 2F3QA 2R9VA 4O0MA 2NTVA 3BCRA 1NUAA 3MGGA 1Y8ZA 2WJWA 3ZKWA 5JVDF 1HRDA 1NJ8A 2EZTA 4OHWA 4DA7A 2EJ3A 3O38A 4G8CA 1N33B 3O8DA 4L0MA 4E2FA 4N0MA 5K3WA 3HM2A 2GFHA 1P2BA 2WJAA 5BNIA 2X19A 3N2KB 3GV5B 1ZJYA 2LD4A 4RA6A 4WXYB 3WDKA 3NKVA 2IHUA 4U39A 4M53A 5DBFA 3S24A 2OYCA 3SD7A 3UTDA 1CVIA 3V7NA 5FLKA 1IBRA 1RXEA 2HV8A 4IRDA 1AK1A 2GLXA 2X7HA 4NOMA 1N3LA 4YJ2B 4TWAA 5FWNA 1RW4A 1WTAA 2ZJ1A 3FPBA 4Q45A 2QN9A 3B8HA 4BTLA 2TYSB 3WLPA 5JZVA 4CMDA 2MYNA 2OPHA 1YOVA 3D2CA 2POCA 2V9CA 5CD1A 1Z29A 1G5PA 2XRMA 1VPDA 1ZGZA 5CURA 4C7BA 5KVSA 3CUEF 2ZRFA 4KV7A 4KE8A 2O8NA 4TLMB 4RNOA 1R6DA 4XVRA 5EZ6B 2HF9A 3C1AA 4LCEA 4WXPA 5IAJA 4YRLA 6ADHA 1S2MA 2XCPA 5TQ0B 3SXUA 4JVNA 2VRBA 2VVTA 2O3UA 4IS2A 1BMQA 2XZTA 1J0AA 1H8EA 3CLRD 5BR4A 2JIOA 2Q4RA 4XGQA 3RAJA 3GTLA 4FVTA 5DU2A 2I7XA 4HL6A 1C3XA 1DC5A 4KUHA 4M21A 2P4QA 1W47A 2ODWA 3GNTA 3QGMA 1O9BA 4RWZA 1COWD 4BUZA 4FNAA 5HCNA 5AI8A 1EIWA 3KHGA 1ZOOA 4RMJA 2OHJA 1ZVJA 4C20A 4J43A 2PD6A 2D7JA 3AMVA 2JGDA 4LMRA 2OILA 3K0AB 2FSGA 4UTNA 5KG7A 1TTHA 3K70D 4BKOA 1KUTA 3BICA 2GN0A 1EK0A 2AU0A 3QVTA 2EQ5A 4A27A 5IFKA 2WPDD 3B1WA 1OXSC 1QB7A 1M33A 3MIZA 4BMOB 1EFPB 1T3LA 2PXXA 2ZIZA 3A4YA 4N41A 2C2OA 2Q1UA 2W8LA 2CNBA 3V2HA 4DIOA 5C4XG 3L7IA 2PFSA 3ZH9B 4ZQHA 1TEZA 3T8YA 4C0LA 1WY5A 3ISJA 2BKUA 3K9BA 4UUMA 1TA9A 1PWEA 3H16A 3QPAA 1GYPA 2OECA 2Z5LA 3BRCA 3P2MA 1CEQA 4K6FA 3V6MA 4CIBA 4Y2GA 1QMPA 4KK4A 3RYFA 5HF8A 3P94A 4MO9A 4NZMA 3ED1A 2FZKA 4OYLA 1AKUA 2PO7A 2JD1A 1XYVA 3EMVA 4HN4B 3RS5A 5LM3A 5CIQA 3R40A 4KSBA 3UJCA 1FVOA 2JC3A 1H4VB 5TF4A 4DRXA 1Q17A 2J3IA 4QGHA 4C4YA 1YF3A 1S89A 3IUYA 5DIFA 3WWPA 2GLTA 2WNHA 5FTMA 4CM8B 1G4UR 1I4WA 1Z75A 1CIVA 4RD3A 4XLLA 5LOVB 2JA2A 3WOHA 4DARA 4EJMA 2O8VA 4Y2XA 3CT6A 2V7WA 4R6WA 1T5LA 1UPUA 1ZBDA 3MTDA 1NUPA 2VF8A 2X0NA 2ZSIA 1U5BA 4XR9A 4BE9A 4B47A 2CMDA 2IXFA 4MKZA 4RNCA 1ZVMA 1PTKA 3NB0A 4JJZA 3ZIDA 3IS3A 1UJ6A 2FFAA 3REQA 1GPKA 5EDWA 3AUUA 1CDEA 2H1LA 4FXPA 1UFQA 1JBQA 5E3JA 1IUOA 2CFIA 2WR8A 3VNNA 3QVLA 1BH6A 4QICA 2UZ1B 2CJYA 3JVVA 4J2HA 3FIJA 1E0SA 3WNVA 3NGMA 2SECE 1O1YA 3DCYA 4M1QA 1SEPA 2J3JA 2VT2A 3A0UA 3CXRA 2A1TR 3LYUA 3VU0A 2FJ0A 3IN5A 1FC0A 3RUEA 3LVFO 3HN6A 1JHDA 5MN6A 4BBZA 2R1VA 1DXQA 1LNSA 3BHIA 1IHUA 4B4WA 2V8BA 2WYWA 1NLUA 1RNLA 4PYJA 1X1TA 4P4TA 5KFRA 1OAOC 3UJ7A 1N6IA 3LY7A 2XZPA 1SCBA 1LD3A 4OD0A 5I9SA 1ZCBA 4HZUA 5ILOA 5GIPE 2ZKLA 4JL6A 4YP7A 5HMLA 4BUCA 1GTL1 5HYVA 2HG8A 1ZNYA 3C3KA 3DTYA 4NBRA 4XSVA 1H9BA 3GFTA 4HGZA 3DO5A 3RIHA 3NTUA 3O82A 4PAWA 5LLDA 4L0DA 4BFUA 3G2MA 2B1GA 4BFVA 2WAQA 3R9XA 5I8ZA 1YRYE 4RAZA 2AFHE 5B58C 3FUWA 1X7ZB 3QNMA 5JIBA 2AYZA 1F0KA 1E3WB 2F64A 1Q0PA 3PXBA 4MV8A 2ORIA 1CUDA 2W2LD 2ZRJA 4URHA 5AO9A 3AFNA 3HKEB 2GCGA 2QWXA 3Q5EA 3I01A 1F14A 1N0VC 4RSRA 3ICQB 5AJWA 3SYMA 4KPYA 4OX9Y 3DPUA 3DB2A 4NMMA 4F5DA 1J97A 5CH3A 5CAEB 2AMJA 3KWMA 4YT4A 4GS5A 1CNFA 3PC8A 2M98A 3I8OA 3WKAA 1HDIA 1QC5A 5EMKA 5HQTA 1D1QA 3TRFA 3F8SA 3MG9A 4TYPA 3X1KA 2ZRNA 1WIWA 4RZUA 5FO1A 2Q3BA 4BB9A 1QX3A 1KJ9A 1E3SA 1HYBA 1N8KA 5DSTA 5CD9A 4NVRA 3NOQA 4R3WA 4L9WA 4AS3A 3A3PA 1VGRA 3O4JA 4UBOA 1EUQA 3EFEA 2MYTA 3FR8A 1I6WA 3IQWA 3W1WA 3PW0A 5CHYA 4DYHA 4C7OB 1WLYA 1YI8A 1E18A 1E2DA 2N0SA 2TMDA 3ZWDA 1Z8NA 3LUJA 4HWTA 1GGVA 3BSWA 3DTTA 5AJUA 5ALJA 3COJA 2I62A 3N2YA 4IUBS 1UF9A 4RKFA 1E4GT 2J32A 4AX4A 2IYVA 5JEEA 4QQNA 1MPTA 4DJFC 5KDOA 3ZDEA 3B9PA 4YQWA 3ZIUA 1IG0A 5JD3A 2J4FA 3AIIA 2KX7A 3TKYA 1G19A 4QDJA 3B9QA 4CUKA 4NYEA 2V0GA 4ARIA 3UGTA 3O7MA 4HS4A 3UW1A 1P5ZB 2GM3A 3W5OA 1V7PC 1BN6A 1QFSA 2EU8A 2IPXA 3D4PA 3GLHB 2CNVA 1WXFA 4CNBA 3JW8A 1RI1A 4KRGA 1KYTA 2CXPA 3D1LA 3HN2A 3IR7A 4HNRA 4PAQA 4ETNA 3ER8A 1Q0QA 2UXBB 4MVJH 3IT1A 1Y5IA 4R41A 5ENVA 2QRHA 4DWJA 3LLCA 3R6GA 4LF4B 4ND7A 3QPWA 5JZ9A 3PGXA 1OLUA 1A50B 3OHBA 3OT1B 2B78A 5IS2A 4LZOA 1C9JA 1CZOA 1KZGB 4MIYA 2W9AA 5JSHA 4JV2A 1F9AA 4NV0A 2VUMG 3HC7A 2ZBQA 2R84A 5KFMA 3E2IA 5DNVA 2WG2A 3CEAA 2BF7A 3EQ2A 2DLCX 4U2BA 3NNSA 1HBJA 1S2DA 2Q21A 4MTEA 3BABA 3AHCA 2I80A 4N12A 5BSFA 3IC5A 3ACCA 1U94A 1E0KA 2B5WA 2BFMA 2YCBA 3IMEA 3OLVA 3QBEA 2IMWP 1U3DA 2ZGVA 4I08A 3MFQA 4LJ9A 4MWCA 4UASA 5CM9C 1WRBA 2CJXA 4G5SA 4MULA 3MK31 5AKIA 3OPQA 5EJ2A 1IN5A 1OWOA 2X6RA 2DLNA 2VUMA 3OCVA 4IIJB 4M0EA 4R2HA 5COBA 4AP6A 4ZZ1A 5DG9A 4NXNB 4ZKDA 5K99A 2XH8A 3MLAA 4FB5A 1GYFA 4IP0A 4KUEA 3E3MA 1DFHA 4RFLA 2EEZA 3R4CA 3W9BA 2VOBA 1LJ8A 2HF2A 2B4KA 3V5NA 1I1MA 1YDMA 2WAYA 4KODA 4DYDA 3GFSA 4ZRMA 2ZSAA 3UB2A 2FW9A 2QD2A 5UKDA 2WD7A 3HZRA 4M1KA 1VMAA 1UM8A 4JP1A 1U2PA 4K28A 4KIWA 4UTXA 1XWIA 1NV8A 5IWAH 1VL5A 1EX6A 1ZK4A 3Q7IA 4IH9A 5DXFA 3VYRB 1Q77A 3DMRA 3L8HA 1Z2CA 3ZOKA 5KX5F 3DE1X 4MV6A 2JKZA 3DTVB 3ZHBA 1ZJ6A 1YI0A 5E3IA 3JS5A 4F6RA 3DVSX 5EVCA 4JV1A 2I3DA 2IZ7A 1RJDA 2OAEA 1XU7A 2PWPA 3AHFA 5C8YA 3ZE7A 1CY2A 2VRCD 3E8MA 5HKKD 1J22A 2L82A 3PWKA 1FFXB 1SD1A 1Y9DA 3UFXA 4GWKA 2O9JA 1SCNE 2H63A 2WD9A 4HZGA 4O2AA 1ZDMA 3KDPA 3QTTA 5H8WA 2GETA 3KSAC 4XFJA 1BMFD 1Z4OA 2C4NA 3DBOB 1EXDA 1E2NA 2FWAA 1GADO 3PEYA 3QQMA 1NU6A 1QAMA 1X3SA 5AWFC 1TDJA 4R1TA 3RF6A 1PR2A 1XMPA 3C8ZA 3OZVA 2L19A 3FAZA 1X2BA 1A96A 1RCFA 2QMHA 4PLGA 3P2IA 1A9RA 1MQSA 3K09A 3GQBA 4M9QA 1KU6A 1QXSA 3V8MA 4J7XA 2ZDHA 2W8BB 2QUIA 3QLVA 1DJPA 4MUAA 2B5VA 1SOMA 4YQZA 5BWBA 4Q1BA 1JLMA 1LSJA 2DBVO 3GMSA 3WGHA 3ZW7A 3QE2A 2XGMA 1SQ5A 1L7QA 3BDIA 4LQ4A 4IPTA 4R8VA 3UOWA 2JAPA 3KG2A 5JQWA 3NEPX 3PFNA 4MUYA 3LYHA 3WGQA 2XGQA 4QX6A 3BQ1A 2GF2A 2WB4A 3MINB 2PFGA 4OUDB 2QAGB 3B2EA 3RTCA 1DHRA 3VJMA 3RTGA 3ZI7A 1HNWH 4C07A 5K0CA 4KPFC 2CMGA 1GKIA 5KQLA 4MS4A 5HNKA 5CIYA 2EZ4A 3RARA 2EYUA 3TX2A 3ZVLA 1KEEB 5J4KA 2OZPA 4EA8A 4KPGA 1TK3A 1J8MF 2ZR8A 1HXHA 3AJ8A 2E2WA 5FD5A 1YHNA 4XYLB 3T9AA 1XAHA 1ZRHA 2GN6A 3COWA 3GGJA 3JQFC 3NHMA 4KSYA 5DASA 2ZU0C 4BV9A 4B6SA 3FOEC 2JDID 4RK1A 2FWIA 2XE7A 2WPDA 4DZRA 1JLLB 2F43B 1JA1A 4FWTA 2C7GA 2MYPA 1EKVA 3D6UA 3PBKA 3TLKA 2I55A 4NJEA 1WVGA 2CUTA 3U55A 2ATIA 5JY1A 3KUXA 4W5OA 4HRAA 3H3FA 1I7DA 1PGOA 1YMUA 2CYCA 2F8MA 2JIQA 3GYBA 1KI2A 1V3UA 2D1YA 1TU0A 4GYJA 3R3JA 2H7XA 2WTNA 1ECJA 4MGEA 3A9WA 4QOSA 3KR9A 3Q2IA 5HKLA 4KGXA 2UDPA 4QLBA 5KWEA 2Z3ZA 4XZ3A 3WJ2A 5LVAA 2I4OA 3FTPA 2OB1A 3VZCA 2DPIA 1ZMTA 4GW3A 3AO0B 1T4CA 1P1RA 1GPMA 1RACA 1MUUA 4RTJA 1GR1A 3E23A 1AO3A 3M5WA 4LQCA 3ETLA 1KQNA 4DABA 4AP5A 2CFCA 2QLBA 4QECA 3WL7A 3C1OA 1YI1A 3LQSA 3G6YA 2OCYC 1Q12A 2ODNA 4R01A 1SOUA 1LEHA 2JLAA 4TYYA 4QYTA 3KWJA 3U3JA 5KT5A 4B6PA 1QQBA 1E3LA 5CYPA 3LLMA 1OB2A 2IEYA 5LMZA 2V58A 1LPBB 1VCNA 3F6YA 4Q3OA 2XWPA 3ZZ1A 1C1YA 4B3FX 2PGLA 4QPJC 2HAEA 2YWHA 1TT5A 4WX2B 2FDXA 3ZGVA 4G9BA 1T5HX 4JIMA 2PX4A 4ZARA 3PHBE 1L5KA 4MWGA 3DWGA 5FPTA 1UH5A 1R0ZA 1XDDA 3LT4A 4MGYR 5DISB 3ZW9A 1RWQA 3FLBA 1LRLA 3BD8A 3KAKA 2VZ8A 3KAPA 5EP1A 3MOIA 1TMOA 5KG5A 1GZUA 1DPFA 2JEIA 1D0VA 2VYNA 4HAZA 4B4VA 3BM5A 5B1DA 2XQFA 2CLDX 1YS2X 3IVGA 3OTIA 1CQZA 5FEMA 2BTQA 5KFSA 4ZOLF 3ANMA 5FOUA 1FFCA 4F46A 2QBYA 4YJ2A 1P2SA 3QYAA 4AX8A 821PA 4KL8S 1L5GB 1YS1X 2WSBA 3MRXA 1CG6A 2QX7A 2DP4E 1VYTA 2VBCA 2NZ8A 2FPKA 3PUHA 3AEUB 4HRXA 3RC1A 4IUYA 4JBYA 2WG0A 3AR8A 2GYUA 1NY5A 4FTWA 1OZ0A 3EWAA 5DQIA 4N8SA 4XX0B 5KQGA 3NH9A 1AKMA 3F74A 2EKDA 4ILEA 3WIUA 1A9ZA 3P9CA 4NFLA 3AF0A 5A05A 2Z57A 1X7YA 4HUQB 5C2JB 3I5MA 4FOOA 2JLXA 2BFOA 3EBPA 3K3PA 1H6AA 3F6BX 2GRAA 2CNWA 2GPNA 4ZEMA 5LQDA 2XCLA 1FMJA 4TVSA 5AM4A 4JJ7A 4LE1A 1V39A 3WMWA 5CEEA 1BO6A 1LX7A 2Y1EA 3MGKA 5ALEA 1YCHA 3RVKA 1FJXA 3LWBA 1X92A 3F9RA 4YB8A 1P8JA 3TCKA 1E96A 5FD6A 5EGNA 3KS9A 3ZJ5A 3ZUPA 4C05A 3VAZA 1I51A 5E25A 2DZDA 1O0SA 3W5UA 1SBNE 2OHGA 2D0OB 4CEJA 3MELA 1VLVA 4NNOA 3U5TA 1D5WA 3ZU4A 4NNPA 4HD8A 4EG1A 2O48X 4HXFB 2JNWA 3JQ9C 5K7SA 3QEKA 4KQJA 3HI4A 3BH6A 3NWBA 4YUWA 4MUBA 4JI2H 2Q6LA 2VJQA 3ITNA 4MEAA 3UAYA 4I2VA 1AQYA 2IVZA 5FO0A 4I4LA 1RZ3A 4JQYA 3NS7A 5FKJA 3THWA 1SCAA 4B3SB 4O82A 5DQHA 5F64A 4DNQA 5BN3A 1AGNA 1OU4A 3R5XA 3I6BA 4ZQEA 5I9LA 5J2UF 2Q07A 5LLSA 1E77A 4B3RB 4R16A 3VOTA 1GEEA 1EVYA 1V5EA 3P32A 4ECSA 1EUYA 3H4MA 2A5YB 3AKEA 4E7PA 2OY0A 2CHQA 4BNXA 4U8HA 4HZUB 1TAEA 1M2KA 3IVMA 4O86A 3ZJUA 1G1AA 1F2TB 1E69A 1JHQA 3OZRA 1QTQA 5EHNA 1DZ3A 3P9IA 4X65B 3WWYA 3TE7A 3MR5A 3DW1X 3NGDA 2ODPA 2ZE7A 4S3MA 3DDNA 4O7YA 3G9ZA 4M1EA 3G5TA 2J0EA 4B35A 2IYWA 2VPXA 5JNUA 2VSQA 4M7PA 5FL7A 1J2YA 1TJPB 2FLLA 4CV1A 5KKNB 4AO7A 3R20A 3ZWMA 2JGMA 1R15A 2GF9A 3M6XA 4BNHA 5DQGA 3OMLA 1S0OA 4PLPA 5EHQA 5FI1B 5BMVF 3W7VA 2BKLA 4BBAA 4QSMA 5D84A 4BLTA 1QO0A 3GZJA 1DC8A 5CB4A 4UCVA 3BOSA 3LPDA 4R4JA 3WLJA 2O05A 2BVNA 2C97A 3QJ5A 3GFRA 4IINA 3B3AA 1JX6A 1F8UA 2RGEA 2UXCH 3ZE9A 2QNBA 4JYAB 1OBCA 1E1NA 2IXDA 2VQSA 3GJ8A 4FDMA 4G3XA 3T7CA 4TS9A 3K5HA 2B37A 4Q7MB 4FHFA 3HB0A 3L4JA 4TTPA 3FHCB 1CLEA 3EHDA 4MZDA 5AIBA 3KYJB 1NYLA 3WGYA 1ZN7A 4L74A 2J0SA 3W3AH 2QSUA 5DOZA 3WMFA 2FN7A 5YASA 4D43A 1Y6FA 4DSZA 1WLSA 3QFFA 1F1JA 4TPKA 4V03A 5KFGA 4AQDA 1A8QA 3EGDA 2WLSA 3BHNA 3DHVA 4LYAA 1KSJA 4TL8A 5HNEA 4XYMB 4JUIA 1FYXA 4ZHQF 1SQ0A 3LY8A 1X74A 3F7MA 1CJMA 3A1WA 3NKFA 4XE5A 1DAHA 4FFSA 2GN9A 4JUAA 1ZVVA 1CVRA 2DSTA 1DRKA 1MRZA 1UP4A 2WHQA 5AM2A 5KUTA 3SZRA 1EGAA 4E09A 3ROKA 1R0LA 3DR3A 2PFKA 1TW2A 5DISC 1NXSA 4MROA 3IAUA 1Z4PX 1IJFA 4LZLA 2BBSA 2Z1NA 4H4DA 1N1EA 1TLLA 1YS4A 4GKKH 3GJ0A 3LXRA 3OWHA 1M1XB 1QBGA 5JSKA 4BO8A 7MDHA 5KMGB 5F2EA 2FUG6 3JQAA 2RDJA 4OH1A 3ZHVA 1NMYA 1KR2A 2P90A 2ZATA 3ESYA 3JALB 3INGA 3HPRA 3SCZA 5JSQA 2W6MA 3ZQ4A 4RB1A 1CQXA 4LVCA 1FQOA 1UWCA 4UU7A 3A1TA 2VNKA 1Q6ZA 3M2TA 3F3YA 1P17A 4L4SA 1G8HA 3WLEA 2P9JA 1EVJA 2YZ2A 5T8KA 4ZO7A 4R2JA 1NY6A 1A0GA 3HCWA 1RI2A 4P35A 4OLJA 4TXJA 3Q3VA 3RT9A 3UV7A 4XARA 4BO5A 4RCNA 1JHAA 4JZYA 3WYGA 3VOBA 5JC8A 4EBFA 2GO7A 3E7FA 1G64A 3FMFA 4XWYA 3C7AA 4BNNA 2H1CA 5FOWA 5JQGB 4JI8B 3DFKA 5GINE 5IZCC 2KWIA 1YB2A 2XUAA 5ECGC 4EF6A 1K8RA 1FNDA 3WB9A 1G8YA 4GC9A 1W5EA 1ISJA 4ND8A 2Q27A 4P3YA 1NYTA 1NQTA 3GJZA 1R6VA 1QG2A 2CHVA 3O75A 3I9OA 3T1NA 3VX4A 3U7GA 1ZM3A 5G4KB 3VV3A 4AY3A 1S9DA 4RWEA 3UBTA 3H4IA 4J94A 1SJ9A 1D4OA 4QBHA 3GGSA 3WG9A 3WIOA 4B3MH 3QX8A 1PR3A 1ZN2A 2VHUA 4YRKA 1AVTA 3LGSA 4OQMA 1Z0SA 1D4AA 3DHNA 3GRAA 2FW7A 2FK3A 3VC2A 1C4KA 3UQZA 1UK6A 2J5QA 1XQYA 3AEQA 4ZEXA 4RKWA 1H2FA 3D8NA 3NHJA 4U2GA 4E6NA 2WM8A 3CE6A 5CX4A 1UZMA 3ZG6A 2CUNA 5FUQA 1J2UA 3V4FA 3DBVO 3EVTA 1K2VN 3WNDA 2ZZMA 4Y6SA 1JQAA 5AHRA 5LJIA 3TQOA 4I8DA 4KE6A 1C9KA 3B1JA 5JBNA 1L5VA 4OQFA 2IOQA 4RU9A 1ZSVA 4EG3A 2CE2X 4CKEA 1I0IA 2AC7A 4OXXA 3WKBA 5EJEA 3BWVA 3DE2X 4IWYA 1AF4A 1XA0A 2I1WA 4AKSA 1QGZA 1WZIA 2JI4A 3ET5A 4HH1A 4PVCA 4QEKA 3T5GA 4ABYA 4RDXA 1YCGA 4I9UA 5FUWA 5BWMA 1CDZA 1UMKA 4MWTA 2Y1WA 4WESA 1ZONA 1VPVA 3PHGA 3H40A 5I5UA 1IM8A 1G8GA 2GTIA 3P2YA 4QYXA 2HPHA 5EN4A 3CLVA 1ENYA 1XROA 2XE4A 3LHDA 4BVAA 4N6OA 2DFTA 5HW0A 1BVHA 4I50F 2E85A 2MSEB 2OXFA 1YB4A 1N6PA 2JA6A 4QUJA 5LDDC 2V7TA 3EDYA 4DZZA 2C5SA 4ZTZB 3RR5A 2R4QA 3MWYW 4AMUA 1P44A 3AFOA 3D9QX 3PIRA 1KARA 1NPYA 1W581 5EGSA 4PAMA 3CMCO 4PFJA 3RO7A 4Z49A 4TTVA 5HJ7A 4AY6A 5GGYA 4LXXA 1C81A 1W4ZA 5EWLB 1E9CA 5BR7A 1B8UA 2B7CA 2FW1A 2H2FA 1I3OA 4TV8A 1W6RA 3GNSA 1E89A 3G9XA 4IL5A 1ST3A 4MKXA 2VP5A 4FIZA 3GPBA 4JS0A 4NBNA 3T5DA 1HOXA 1GUAA 3HXTA 4HFRA 2WQ6A 4QM6A 1B74A 3P0HA 1MJGM 1P39A 1TMGE 1MJ5A 3DR5A 3KYBA 2ZU6A 4I0WB 3R09A 4YJFA 1JTEA 3EZ9A 4Z7OB 4Q8FA 1Z2DA 1EBBA 1T43A 3ORRA 5G1OA 3NVDA 2YIVX 2B25A 3GUUA 3N9IA 1SQSA 3L5OA 4HDKB 5HIJA 2YIDA 3OD5A 4XOUA 1E9AA 1KO1A 1VS0A 5ECDA 4E12A 4EFDA 5AUNB 3HO1A 4ECEA 3CNEA 1YZYA 2JRCA 3H1BA 3A4MA 3HH8A 2CKZB 4YV7A 2I1VB 3BXPA 1XKQA 4O2RA 3L6OO 4QPZA 5E4FA 1TJYA 2MSLA 3IG0A 5ICGA 3KHUA 1WH2A 1ZIYA 4HO1X 4EUEA 1AH2A 2B8EA 4EPXA 5KT6A 5C1DA 2Q9AA 3PJGA 5L3VA 1F2UA 4PFKA 2V1UA 3AG6A 1ZQ7A 3O3OB 3BSYA 4WZ6A 5IYDG 2WFAA 4A73A 1VXOA 2QRJA 1GSHA 4L57A 3VQTA 3LBNA 4ZU1X 1OWNA 2VWPA 4A9AA 2UAGA 1R2QA 2AJTA 5GGXA 4GLBA 2BJWA 3HGMA 1E5DA 5SZKB 5CCXA 2I6SA 2WZCA 2Q1YA 1YR6A 8GPBA 5IWCA 3F73A 4IXWA 1PV4A 3I0ZA 5DTJA 5E38A 2UVVA 1FYEA 1LS1A 4WVFA 5GM2A 5KBYA 3TW0A 3SDSA 3KRTA 2C88A 2OC9A 5CYFA 4F4IA 3E3LA 1HFWA 1E2PA 2H57A 3FWNA 4YGYA 3TLYA 1W88A 3NIWA 3ONVA 4ZJZA 1NBMA 4CUJA 2IPMA 1JYEA 3OEHA 5DW3A 3N8GA 1YA6A 2ZVJA 4QUDA 4HDNA 1TQ4A 3KZMA 5K0LA 1L4UA 1KZ9A 1INLA 4O3SA 1PJ2A 4EVIA 2COIA 3EEBA 3LCCA 4RA6B 2BZ0A 4M9CA 4DCMA 3LT1A 2P75A 1QWSA 4X0EA 4RAQA 4CF6A 4J76A 3WVNA 2FW6A 1BKYA 1WUIS 4Q3LA 4QL3A 3K9QO 3QP9A 3A1SA 1Y1QA 1DSSG 3P9XA 4K6GA 4P1ZA 4B7AA 1XRQA 4JLBA 5AXBA 5JCJA 4MSUA 1DNPA 1E1RA 3HA2A 1TZMA 3GMDA 3HKDA 1MVOA 2DT5A 2B2NA 1T25A 2HOQA 4QHSA 2NVXA 3LOPA 5LFAA 3EFOA 3K2QA 5TV2A 2HCJB 2VK1A 2GBPA 1TXGA 3ETGA 2BI7A 2NACA 2OD9A 3AF3A 4PY2A 4UVEA 2H16A 3GDEA 1HSZA 2V5VA 1MAWA 4KLRA 2WUWE 3X0DA 4RGVA 1F0PA 3RBVA 2G0TA 2V7QD 2GZRA 4CG0A 5ICFA 1JIVA 4WL0A 3RWBA 4JI5H 3EPIA 2AW5A 4ZXFA 3CR7A 3S1SA 1M75A 4XGKA 5I9TA 4YQEA 2WFZA 3AETB 5COAA 1WR2A 2ZRKA 5KQPA 4AS1A 4IW3B 2V3WA 1M2OA 1Y5RA 3M6WA 3ONDA 3FXAA 3QZ8A 1NVDA 5FOQA 5EC8A 2QZ4A 4G5GA 4X45A 2G09A 3MTJA 4UFZA 1FJGH 3RS4A 4PZCA 4OGLA 2X8AA 4AJ1A 1T2CA 4DQLA 4FEYA 5ALVA 3HKDB 2MR6A 2FPRA 1ZD3A 2I67A 1IIBA 2XCQA 3SJCA 2B4TO 3VPFA 3UA4A 4C3OB 4F7DA 5KYXA 1PK9A 2RK3A 3K6RA 1ACLA 3R7FA 2GK4A 1DG9A 2ZB2A 4IS3A 1PKXA 3H8VA 3U3RA 3HKZE 2WM9B 3LNCA 4JYBA 2J46A 1RWVA 4D4LA 1NM5C 1T4GA 1J06A 4D0NA 3JR3A 3G5MA 1QDLB 3HHEA 2VR1A 2PKCA 5E6SA 3P9KA 5FA5A 3SS7X 4L4ZA 4ECYA 2O7VA 1JR6A 3UJ8A 4XD7A 1EA5A 1T1JA 4LVOA 1RE1A 1MJFA 2OWOA 2ZUSA 5D01A 1CUBA 1QYCA 1QFXA 1HDCA 4JYPA 4S1VA 4XWTA 2NZVG 4CLRB 2I99A 2NUTB 4YR2A 1R0BA 3O4IA 3TBHA 1NI4B 3Q2OA 4U6PA 3OBBA 3RK0A 1IRXA 1G21A 3PR5B 1XNGA 2A9OA 2G77B 2F62A 3R7WB 3TZKA 3SIPA 1UBKS 2XZDA 1YR9A 4I8XA 4XWWA 4QARA 4QDZA 1MDFA 1IBMB 3OZTA 1I7QB 1DX6A 2QRGA 1XQ9A 3O83A 3RT1A 3SE0A 2X2EA 4QW8A 2XCSB 1ISPA 4G4GA 1ZM9A 2C4VA 3C14C 2PBFA 4A8JC 1X0XA 4J0FA 4D92A 4EHAA 1UBRS 1UFKA 5TSDA 5EKDA 1DEOA 1HZJA 3CRZA 1ISMA 1T4BA 5ETJA 3U1TA 1SUAA 2RG7A 2RH4A 2ZYGA 1HDYA 1DIOB 1O9GA 1VHJA 2FPSA 4OQEA 3W8NA 4E46A 4UOZA 3AEKA 3NC0C 3CF6R 3HXPA 1ARZA 1EGQA 2DPLA 4MGIR 1ZLYA 4W8HA 5BOVA 4BNVA 2IOYA 2OBMA 1XV5A 1NAIA 1P0QA 1DT3A 1RQXA 4A2AA 4YMGA 1JU3A 5B12A 4XYEA 4DLXA 1WMBA 4M76B 1DCMA 1Y8QA 1U0BB 3CYFA 3D7NA 3GPDG 1XZPA 1YTUA 3QITA 1YL6A 4G1VA 1L7PA 2FX3A 1K2WA 5HFNA 3UJ9A 1WAMA 4AVYA 3SQXA 4UFOA 4PGAA 1CERA 2EJTA 2GD2A 3OZEA 3L43A 5HDQA 3TO5A 1U7XA 5JS7A 3EYYA 3R3WA 1OWTA 3BGOS 3L1UA 3IAHA 3MPUA 3EUFA 1FS4A 4RCVA 2HLPA 2CMFA 2I0FA 4HDQB 5FF9A 4ZJUA 4FI3C 4U5XA 2MSNA 3PHCA 4U7PB 2JEFA 2FETA 3NOXA 4QE3A 4RHXA 4DPMA 2HJ9A 2O20A 3V6KA 4PBRA 1RJQA 2CKMA 1U7TA 1BGWA 2HKIA 2RKBA 2WKWA 3QI2A 4YROA 4B3CA 4DR2B 4M9XA 1W87A 5K3DA 4F50A 5FBWB 4LDQA 1S2GA 1CB7A 4LHWA 4UM9D 3UVEA 3JZDA 1ZD4A 2RGNC 1RYEA 1FCJA 2KE5A 2I29A 4FOLA 4DCGA 4DSTA 3U16A 1QIGA 1YS9A 2YVKA 5E9AA 3AP1A 5CTJA 5KTKA 2ANCA 2DUJA 4CTNA 3OQOA 1XAGA 1ZJ4A 2D1SA 2PU5A 3GIWA 1ONBA 2WUEA 3VC7A 4EITA 2UVWA 4JITA 5FUBA 4G07A 2WTXA 4FMDB 2H07A 3T7JA 2ZYAA 3H1FA 5IC6A 4QFCA 1SVLA 3OU7A 4OSPA 4CRWB 1RYNA 2EDCA 5CFPA 5KVAA 5FQNA 3IBGA 1TFUA 2YJ3A 4F9GA 2J0UB 1HR0B 1SURA 4DLWA 5CFZA 2WKSA 1FTQA 1Q1AA 2C20A 2IYPA 4MR7A 1KH1A 3P4UA 4MV5A 4IOLA 2OMEA 3KUDA 4M6WA 1ZQ9A 4UREA 5HTKA 2IHTA 4KRFA 3EN0A 4UCRA 3MGCA 1YIOA 2O6HA 3KXIA 3T3PB 5ULLA 4BYGA 1SCQA 1XRMA 5LA6A 5FDFA 3P45A 3IKLA 4RB2C 2YZGA 4KK3A 5DHPA 1XSEA 5IABA 4AYBA 1VHWA 3B6EA 4LOHA 1AKVA 4HP8A 3R7AA 1DAAA 3PI6A 2QDXA 1FYDA 3ZOZA 2HYIC 4PG8A 2WUVA 4AG5A 2VCYA 2Q5JA 4CMJA 5JYCA 5HP4A 2HWXA 2XNDA 1B1CA 1T1SA 5FYDA 4C29A 4MI1A 1PTJA 1JE0A 2DTDA 2HB6A 2W7OA 2WMYA 3FZYA 1H3EA 3BJIC 4Q18A 3JZIA 2HR1A 3ECAA 2VF5X 1KOJA 3P7MA 1E3EA 3GHYA 2DERA 4JFAA 4AXBA 3RQSA 1JLKA 1Q95A 1T26A 1T1IA 3HOVG 3PPXA 1BNCA 1HE2A 1LBIA 1V1JA 1NXOA 2EG9A 4JUBA 2YHSA 1MAVA 3SM9A 4Y3UA 3U4QB 3IQGX 1TCAA 2GQ0A 3ZZ0A 3DE3X 3FCXA 4L9AA 3L93A 5DNDA 5LMUB 1J00A 2Z9DA 1GAWA 1KO7A 4DANA 3OU6A 3UKJA 1DAEA 1NFRA 1TFRA 3A1EA 3RKUA 2FKLA 4B84A 1VI6A 3ED5A 1BSVA 1EAYA 2HQSA 4H2DA 4RVHA 4IAJA 3AF4A 2TSYB 2EP7A 3ESZA 3JXEA 5EWMA 3TOXA 3W77A 2C7QA 5KQRA 4HNUA 3L1VA 4D9JA 3JQGB 4TWIA 1J99A 3IIKA 3HBFA 3OM9A 4ITVA 1ZPDA 3G79A 2O2HA 2Q3JA 1G5RA 1TEXA 4U4AA 5AVXA 4NMXB 1NBAA 2O3SA 2BDTA 3TY9A 2XTAA 2HWWA 3AEQB 3KB1A 4GR4A 5ER9A 3X1XA 4BGVA 3CEMA 4OPMA 3MT7A 4CHIA 2FK2A 2SKDA 3ADPA 3IAS6 2R6ZA 2R93A 3K0HA 1T9CA 4IV8A 4XGIA 5ALOA 2H6EA 4ZAXA 4HPXB 4DPKA 1RZRA 2EAUA 1OX4B 3UMBA 1COWA 2QRVA 3Q0TA 3B6IA 1U3WA 5JAQA 1UQUA 2O2XA 4U00A 4X41A 2PN1A 3MD0A 2WDZA 4L07A 2X7XA 1K5PA 2ONCA 4FKBA 1UKCA 3MWJA 4M8KA 3IESA 1OILA 3MOGA 3IBCA 4L6IA 1EWQA 4EQ6B 2QRPA 3ZLUA 3MILA 3I0MA 2CW8A 3KZKA 3O6VA 1UBFA 1CR2A 3TVDA 4A92A 4CUZA 3P4YA 1II0A 3NT2A 3W34A 1MF7A 5I5EA 1K5HA 2EJWA 4B81A 1B33N 5A7HA 1JB9A 4O4HB 3UWDA 3LPNA 5K05A 3KIPA 1XCMA 4K9MA 2YV1A 3DAHA 3UTCA 1UUFA 1ABFA 4RZQA 1UBOS 4CMAA 5KFPA 2F4VB 1B8OA 1RXIA 4FFWA 2I6XA 1VLHA 1QIMA 3GDFA 3QVOA 3ITEA 4KAXA 2OYRA 4BNWA 4DC1A 2C42A 5HDBB 2FR0A 2WF9A 2P5YA 3MTGA 4RM2A 5ILQA 3PV0A 3PNQA 5K8TA 4XRGA 1I33A 4PRKA 5IHXA 5KYKA 4ZN6A 4ZDJA 3GRZA 1FDTA 3ETHA 1U2ZA 1C3JA 4HDOB 2RGYA 4J4TA 4RCYA 5KHLB 2OT3B 3QLTA 2WIGA 4H1WA 1V95A 4D26A 3GLTA 3PO3G 3DGEC 5EJ9A 2HGSA 4YLEA 3RJ5A 3R8FA 1RK6A 4U8GA 5DBEX 4MQMA 4MS3B 4Z9BA 5I7WA 1U2TA 2QU7A 1BE1A 4M99A 1JFVA 3PC8C 2FSHA 5AK3A 1XN1A 2FSVC 1JVNA 4FQ5A 2DHDA 1O6CA 3PICA 5LZ5A 1K4MA 1D4ZA 1V25A 3AQ4A 2VHVA 3MUNA 4K88A 1SCUB 4G2TA 4KJXA 2QA5A 1BMTA 3ZHTA 4IDDA 2GK3A 3KYIB 4WD3A 3IUSA 1CUCA 2BFBB 4DYVA 1DO2A 4KZKA 2W71A 5KT2A 5HF5A 5CPBA 4F6RB 4NYJR 3R6DA 1SQFA 4CFSA 1J42A 2FEPA 4NCHA 2BZGA 4GMXA 1YC5A 4YXWD 2Y0CA 4JLAA 1WCWA 4MUIA 3RTBA 3KSUA 2PXCA 2DE0X 1T24A 4I55B 2WJPA 1XTJA 3B5IA 4YJHB 5I5GA 1T0UA 2H3HA 2C22A 3STTA 1YULA 2FH5B 2X5JO 1ITZA 3HVKA 3I3SR 2GEJA 4HX2A 4TT8A 4ABTA 2NU6B 4UHKA 2M6SA 2VDPB 3FNRA 3MPOA 1L5SA 1BEUB 4MI9A 4PYLA 4EX7A 2QM0A 4I14A 3QOYA 3HYLA 3CH7A 3PFCA 2B6HA 2DY1A 2W2MA 1XRJA 1MJGA 2YICA 4A1FA 2R2GA 2V59A 3AF5A 2ALJA 5F4BA 5J4HA 1QHIA 3W4KA 3LW8A 4FGWA 1U0NA 4UHJA 1I1HA 1NX6A 2E4YA 3AF6A 3PSAA 3E9QA 5KQSA 1O9HA 1ZFNA 2X9LA 4QOFA 3T1YB 1FMFA 4OJMX 3O4VA 2XOEA 3FYTA 3DOJA 4FBLA 4WPGA 4YR3A 3C97A 3ZNQA 3HKZA 1MO2A 3ONWA 1DIGA 1P5RA 2FRVA 2IUYA 2JA1A 2Q3FA 3RU7A 2QD3A 3WDSA 4EDFA 3THOA 3GLHA 4ZHQB 5J3JA 5AW8A 3CEPB 2RC5A 3QMMA 4G3IA 3VNQA 4AXXA 1Q57A 4FN5A 1KZ6A 4GPTA 1Z38A 1O8CA 2ZWAA 3IE2A 4MLZA 1GCIA 4CC6A 3AVQA 4O1MA 2I2FA 4PQEA 4ZO8A 1KMMA 2C2BA 3DLPX 1RC0A 4DA9A 4DLLA 5DG8A 3Q9SA 4BQPA 1VI2A 5JMTA 2AVDA 4P4NA 3VXKA 2YJ5A 3PQ7A 4IFBA 1IZ9A 3E7WA 4TMTA 4OGGA 5IAOA 3UGJA 3EIUA 4KN9S 4GPZA 1SKQA 4C7VA 3K20A 5ALMA 3M33A 1G41A 1KI1A 2NUAB 3MAGA 2E2IA 2XGGA 4FYWA 5CNJA 5FBVB 2Y4OA 4ID9A 1JBKA 4JB0A 5G0WA 4QIWE 1R0YA 5AVWA 5JCOA 5M29A 2B8NA 1RFLA 2JFNA 4JMPA 4TUYF 1GN9A 3OETA 2RB4A 3ADDA 3UY4A 5JH7A 5KFUA 1P0MA 3QNWA 5DVZA 2C1ZA 3I9V6 3OY7A 5AHWA 1W75A 3KPYA 2DKNA 4XGNA 5T6BA 1XPUA 1BG6A 1FY2A 3RTDA 3VR5H 1XZMA 2HJRA 4OP1A 2PAFA 1EFRA 2H4WA 5I9IA 1RWOA 1P6UA 2AHOA 4KQEA 4EP1A 3UCEA 3GF4A 5JCXA 5JD4A 2GZ2A 2CWWA 4L4RA 4Q7KA 2Y71A 1VFPA 4WOBA 1K8ZB 1GOTA 5JH7F 3RYIA 3SQMA 5LUAA 1GLGA 4N3NA 2Q2UA 2FZGA 2OXTA 1FNCA 4UCXA 4H1TA 4BQEA 4KLCA 3TSYA 2QTWB 2EBHX 1S1MA 1AN9A 1SAYA 2C3YA 3FYHA 1NI4A 2NXCA 4UDNA 2R87A 1JGTA 3GG9A 2E1RA 5KTSA 1QFZA 1TQ6A 2W2KA 1SYXB 4FNGA 3SHTA 5JH7B 2OXIA 3C3DA 3TEJA 2BGMA 2O8BB 2I2BA 4ZVQA 1ZKMA 1A2BA 2FUNB 3EZGA 1NW6A 4NR0A 2QTLA 1OIVA 3P52A 3VISA 3ICWA 5ALLA 1XPOA 3GUVA 4N7RA 3U6BA 2ZYVX 5KYXB 1VRWA 1W4AA 5EI5A 5AKYA 3HXKA 2GAOA 3EG9B 1UWKA 1WCIB 3KLMX 4X84A 3ZGNA 3AHEA 4E4RA 5KINB 1V6CA 4YA6A 4D8YA 3AHIA 1T15A 1ADYA 3AKYA 5TMPA 3O84A 4P32A 1IH8A 4UVIA 1VKJA 4JHXA 3V8BA 5BRAA 1NW7A 4UHDA 3GVCA 1ZH8A 2ADMA 4X6YA 4MYCA 1N32H 3GJXC 3FH0A 3VBCA 1VRCA 2E2HA 1GZ6A 2GJ9A 1PAUA 2IVFA 2GASA 2A57A 1DTEA 1FX0A 4MIOA 3KZ1E 1YB5A 5B6JA 4IJQA 5JROA 1CY1A 1G7RA 4JLMA 4BGEA 5K5EA 2VI5A 3NMUF 3ROFA 4RJ2A 3I2HA 1U7PA 3VKUA 4MB2A 1I3CA 1LGYA 2Z95A 4FZ5A 4F56A 2GCEA 4ENUA 1H42A 5EUMA 1P2VA 4AF6A 1U99A 2Q6OA 1I6UA 5C34B 1VE7A 4PONA 3O8OB 3T0IA 2XKKA 3DMTA 3H75A 2H7YA 4IMJB 3JYOA 1ZJZA 4Y6PA 5EFZA 1SXJC 5LXTA 4DM4A 4C9BA 2QF7A 2FEAA 2FQ1A 2AOVA 2VXCA 2XVXA 5BYJA 4YHBA 2G83A 1TM4E 3H2KA 1U0FA 4C4SA 4FFVA 2CNWD 1JN0A 2AEMA 1S10A 2I4MA 1SWWA 2PX5A 3DAOA 3LXMA 4J2OA 3IBTA 5BSUA 1JAIA 4U3JA 1VGQA 1OTXA 2GYVA 2V4QA 5EE1A 2ZR7A 3EWSA 1BVRA 3M5PA 3C6MA 5B37A 5B7GA 1T6YA 4OLFA 1W52X 3D3KA 3H7AA 4FKMA 4M1TA 4RTLA 2JI8A 2ZUCA 7ADHA 2C82A 1G18A 1U31A 4TVBA 3CRNA 3TRHA 2QX9A 3U40A 1WZNA 5KYUA 4CWAA 1X1RA 3CTPA 2Z6QA 3GL9A 5ALGA 5EHIA 2BSXA 2HIAA 3VPHA 2DCMA 1MB4A 3ZI0A 1IM2A 2R97A 3LPMA 5DGTA 1XRSB 4BE4A 2AEJA 2R47A 4REQA 2ID8A 5SYNA 3WE7A 1LZLA 4CMIA 2GLUA 3BMOA 3WKDA 1CJTC 1H0KA 3PK0A 1ZVKA 3HJGA 3PRJA 3DLBA 1XO1A 3PLNA 1D2MA 4UVHA 4ZQGA 4ZYUA 3EIQA 1XQWA 5E6RB 4XUDA 3UV3A 3TY8A 3GV7B 1XZ8A 1OBDA 2FPOA 2PA3A 3B7PA 4FGJA 4PLCA 2BHLA 3OTGA 1N1DA 4GPD1 3B85A 1YFJA 3M89A 3QK7A 4YAJA 4W9NA 1TUIA 3MCUA 4F2DA 1UBGA 2X0JA 3ESXA 5IZ4A 1Q0UA 1YRHA 1V9SA 1YHYA 2NO4A 1ST2A 4MAMA 1I0LA 3G8YA 2PRIA 4ALIA 5KB3A 4TL6A 3VGPA 2HU5A 4ZYWA 4MV9A 3QPVA 4K87A 4HX9A 4D9FA 3TZLA 1YZGA 3IT3A 1VE5A 1GCAA 4EPRA 3FOFC 2E7ZA 3SMVA 5JPCA 2A67A 4BO4A 2BDEA 4XCVA 2PD3A 2CBZA 5T5QA 3ND6A 2LIVA 1ZD9A 3M6MD 5EIOA 4AIIA 4B0PA 2JGAA 3QKSA 5A0TA 1J49A 1WSCA 1U8ZA 3Q12A 4X7PA 5B1EA 2H4YA 2AK3A 2G9UA 2P79A 2YZKA 2C31A 3ABSB 3TXXA 3VSCA 3IAM1 3M2PA 4O4JB 4W5HA 3ZTTA 2QG6A 4ACBA 3NTVA 2WIJA 4R6XA 4H15A 4OBEA 3P2OA 1PDVA 2B8TA 4OHMA 3TWOA 4DWOA 1I1NA 5BR8H 2XTMA 3PKIA 3TK1A 1UR5A 2I9PA 3FX2A 3TXYA 1K6IA 2D2XA 3WLMA 4D02A 5JQGA 3KQKA 4KCGA 2JBWA 1PUJA 2H4FA 3D7KA 2A3RA 4X8MA 2EJBA 2RGUA 4MR9B 4B75A 5KJCA 2XY4A 2P0AA 2ZJ8A 3ORQA 1MC8A 1M2VB 4X64B 3KXDA 4F3CA 2MOKA 3BULA 5J23A 4Z8YA 3RT7A 4LF7B 4F2GA 1J09A 1UDBA 4ZAWA 4AD8A 3RJ9A 2SICE 2IHNA 3I37X 1D9XA 4ANFA 2DQZA 3OG9A 3FPHA 3T41A 4OMDA 2KPOA 3II6X 1TUBB 1EVLA 4G85A 4RABA 3VVCA 1OXKB 4BO6A 5HUQA 2H48A 3D31A 1NMQA 2CNNA 3QVGB 3WIBA 2JFBA 2I7VA 2J59A 2ASDA 4F06A 4JGIA 4IIYA 4JH0A 1TTQB 3A9RA 3NUAA 2RG1A 3F6SA 4IJMA 4LRXA 2HX1A 4V3BA 4XTRA 3JQAB 2CYBA 5D6NA 4NE9A 2O8DA 2VBGA 1TLFA 5LUBA 1E63A 1I7LA 4NEHB 4RVFA 3ROTA 3G6KA 4ZMBA 2NUTA 2ALZA 3AEUA 4PCAA 4RHUA 4L0QA 4RY2A 4WFJA 5CM2Z 2YWVA 1A9YA 3FNFA 4IV5A 1O58A 3PD1A 3KQTA 4KQ9A 3EMKA 4KKXB 4EF4A 2PZKA 1EKPA