4MAMA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an adp analog, amp-cp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
373
structure length
373
Chain Sequence
b'MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIAGENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ADP analog, AMP-CP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 121
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4mamA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4mamA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mamA01
1JKJB 1C30A 1Z2NX 2YS6A 2R86A 4L1KA 3VA7A 2GQRA 5BMVF 4FU0A 5JQWA 3MWDA 4NYEA 4YBZB 3K3PA 1VBGA 2FB9A 3LWBA 4Y8VB 3VPBA 3HB9A 4TV9F 2YRWA 3KAKA 1KJQA 4I4TF 4IHJF 1ULZA 2XCLA 5LOVF 2VQDA 5JQGF 2SCUB 4EABA 4O7VA 2YZNA 4MA5A 3R5FA 4O2AF 3TIGA 3K5IA 1OBDA 4DLKA 4O2BF 3ETHA 5C1PA 2GPWA 5J2TF 3Q1KA 3UFXB 4YB8B 4MV8A 2YS7A 3R5XA 4O7RA 1M0TA 2R84A 1WR2A 4O7TA 3BFPA 4XX0B 4EGQA 5BPHA 3R5HA 2I80A 2YYAA 5J2UF 2C00A 1VBHA 2DWCA 1B6SA 4ME6A 2V59A 5JVLA 4FE2A 4M9UA 3BSWA 2W6MA 5GONF 2R82A 5CA1F 2ZDHA 2GLTA 3VPCA 4XYLB 4MA0A 2R7KA 3RFCA 2YW2A 3OUZA 1EYZA 5FNVF 4IZOA 1KUTA 2HJWA 1IOWA 4O7YA 5JVDF 2NU7B 1M6VA 1JDEA 3HBLA 1VKZA 2XD4A 3Q2OA 3GIDA 3BSSA 4FFNA 3MJFA 1IOVA 3TIIA 4HR7A 2YZLA 3K5HA 1EHIA 1KBLA 4O82A 3NUAA 2Z04A 4YJ3F 3GLKA 4FFLA 2YRXA 4DIMA 2QF7A 3U54A 4O7NA 1DV1A 4IWYA 4TUYF 3U55A 3BSYA 5LP6F 4TV8F 2FPGB 2CNVA 1C3OA 4HNUA 1CQIB 3KREA 2FP4B 2CQYA 5H80A 1W93A 4WBNF 1KJIA 5KKNB 1JLLB 2NU6B 4QSHA 1I7NA 4GGMX 3R9RA 1UC8A 1AUXA 5I47A 1KJ8A 2IP4A 1GSOA 4RZQA 1PX2A 3V4SA 4FFRA 1I7LA 4EA9A 2W6NA 5C1OA 5CAEB 1KEEA 4XZ3B 2R7LA 4EGJA 2CZGA 1GSHA 1E4EA 3VPDA 2YWVA 2ZDQA 3MWEA 4HNVA 3I12A 3WO1A 3JRXA 1CQJB 3DF7A 4MAMA 3R23A 3U9SA 4I50F 4O81A 4M9CA 4IWXA 4WD3A 1T36A 2HGSA 5IYZF 1EUCB 4O7SA 4M99A 2FPPB 4O86A 3V4ZA 1Z2PX 3ORQA 4IIJF 5LA6F 2PBZA 2WYOA 4EA7A 4O83A 5KX5F 1OBGA 2P0AA 3QFFA 3TW6A 2NPOA 2W6PA 4O4LF 3VMMA 2W6OA 2W71A 1EUDB 2GQSA 3N8DA 3JRWA 1EZ1A 2V5AA 5HV6A 3AW8A 5BPFA 2VPQA 4XYMB 4EG0A 2I87A 2CNQA 4O7LA 4J6EA 3RUPA 2V58A 4O4HF 3OUUA 2W6ZA 4ZHQF 3U9TA 3G8DA 4MV4A 5JH7F 1B6RA 1E4EB 3RV4A 4O7WA 3LP8A 5K2MA 1GSAA 3N6RA 4HQ6A 1CS0A 1A9XA 3AX6A 2YZMA 4ZOLF 3TQTA 1GLVA 1SCUB 2VR1A 2W6QA 5LYJF 1UC9A 5LXTF 4O4IF 2W70A 4ZQIA 1AUVA 3RV3A 2FPIB 3JZIA 4EAAA 4FFOA 3G8CA 1JDBB 4E4TA 2PVPA 2GPSA 3ORRA 1DIKA 1BNCA 3VOTA 4M98A 2R85A 4C5BA 2Z02A 3ETJA 4YJ2F 2PN1A 2NU8B 1GGOA 4I55F 4O84A 4C5AA 2R6FA 3BG5A 1A48A 4C5CA 4ZI7F 3TINA 4FFMA 3KALA 2X0SA 5CB4F 5DMXA 2NU9B 4O7ZA 1Z2OX 1CE8A 3HO8A 4FFPA 3KAJA 2ZDGA 4YAJB 3SE7A 2CNUA 4MV7A 4EA8A 4MV1A 1KC7A 2VHEA 3WNZA 2QK4A 2YL2A 1PK8A 2NUAB 2YZGA 1M0WA 4HNTA 1W96A 1BXRA 2R87A 4MV6A 1KJ9A 3WO0A 3E5NA 4MV9A 2I8CA 4O4JF 5CA0F 5C8YF 2J9GA 5HBRB 1KJJA 5D8DA 2DIKA 4YAKB 2DZDA 4MV3A 2OLSA 2R7NA 2R7MA 2DLNA 1DV2A 3JZFA 4FGRA 5EZYF
chains in the Genus database with same CATH superfamily
5ALTA 4LGCA 4ZYXA 1X80A 4TYYA 2NSDA 3VTAA 1MOQA 3MA0A 2NACA 4DXDA 2I7DA 1GG9A 4YH1A 3IEXA 4E08A 4LMPA 4GC9A 4GUDA 1PJCA 1NT2A 3NTXA 4JI7B 1KHTA 2PXXA 3LX4A 4JGGA 5I48A 3DE3X 4DT1B 3F4LA 4IEFB 5FOQA 5KBYA 4LYHA 2FOLA 1K8ZB 3TH5A 4O2AF 1WAMA 1LI5A 3UANA 1E1RA 3K0HA 4CT5A 4S3MA 1P33A 3DFZA 5EHQA 4Q7KA 1Z29A 4EHLA 1S3FA 3TKYA 4B76A 2WHQA 5FD5A 3VO2A 1GRNA 3MLBA 4X6YA 4EUNA 1LV8A 3AUJB 1Y9AA 3IMCA 4X66B 1Q1QA 3QEOA 5HTKA 4WZBB 4XB1A 5GV7A 2QY9A 2WSSA 3GYBA 4F5ZA 3AHDA 4RNCA 4E30A 1KTIA 4MWDA 2O57A 2HMSA 5A7HA 2OCLA 3MR6A 4U6SA 4RNMA 4IX9A 4TS3A 4X1YA 1A4IA 3WLSA 1X3SA 1GLGA 4F38A 4NBUA 5JHHB 5A4FS 4O4HA 2BIFA 2Z56A 5E9WA 2PNJA 2IV3A 4C6TA 2JFPA 2JZNA 4A15A 3QE3A 4XWYA 3GUVA 3EMDA 1MIHA 1VGQA 4AZ3A 1Z5UA 2I55A 2C2ZA 2BISA 4KYVA 3U49A 2IIVA 3H9BA 4QSHA 3HM2A 3VUEA 5BMOA 3O92A 4CKYA 2Y1WA 3I61A 4U2KA 5B1SA 4CMGA 2BFBB 4R8KA 1TI7A 5D87A 4PF1A 3P2IA 3B5EA 4AYWA 3OIFA 1E77A 2B20A 1ZOSA 3GX1A 1FNDA 1WY7A 1Z5OA 4MCJA 1DZIA 2GXQA 4GE3A 4YDQA 4YGXB 1P9NA 3FKIA 3W2HA 3KR9A 3U9SA 4PC2A 1WOYA 5EUCA 2P9CA 4Q3DA 4LSMA 1EP9A 5DQGA 1ZBDA 3NYRA 4YHHH 3GMIA 3L7OA 4DR2H 3KTFA 5EL0A 2W2NA 4J9LA 2XZTA 4PN3A 1QRDA 1YS7A 5C1IA 2A0XA 4RJTA 5PNTA 2VZ8A 1KR2A 2G7MC 3EQ8A 3QX8A 2X42A 5DN6D 1YRYE 3HJNA 3ZDCA 4YT8A 3IUYA 2IDMA 3STYA 4F7DA 3C3CA 4MH0R 4BUJA 3L43A 2OP0A 2CE2X 3PPWA 4W8HA 3VOBA 1TM2A 1ZG3A 1RXVA 2UXDB 1SRQA 1ZJJA 2QZJA 2PLNA 4EFNA 2XMSA 4Q6WA 2H9AA 2C31A 1OLXA 4LWZA 3HYRA 1SWVA 4TSFD 4FHFA 1KA9H 3CVXA 1GT6A 4OHCA 3FVRA 4EHJA 2X9QA 1UP7A 4J0QA 3OZXA 5EYPA 4IFEA 3SZRA 1SBQA 2ZVJA 1KVUA 3M9MB 3PEYA 3CMMA 1YE5A 1VL6A 5CU7A 3ISTA 4MKGA 4GR5A 2H11A 2YHIA 3TZCA 3E35A 4A03A 2XB9A 2FUG6 3UKOA 1GRRA 1Y8RA 3RIZA 2PGDA 2VYND 3G1TA 2YV5A 2IYEA 3DLAA 1FQKA 1NM5A 3AESA 3MGCA 4FFPA 4MHTA 4WXRA 3FPJA 2YJ4A 2QXTA 2C28A 1QYIA 1VOTA 4HYEA 5DXJA 4KX5A 4HBGA 4YDHB 2MDTA 3U4QB 2O0MA 2QTVB 2ORYA 3FRJA 3RYCA 4ILKA 2FFHA 2ZRGA 4MQ4A 3FPGA 3IB3A 3F49S 3GCWA 1PT6A 2A14A 4MQEA 4LOHA 2Y66A 2PUHA 1DV2A 2WHXA 4Z86A 5ALJA 3Q8XB 4CMEA 4RM3A 3EDRA 4ECXA 2ZI6A 2Q0QA 3HABA 3I09A 1JB9A 4BO7A 1YZLA 3P2OA 3LOQA 3AP1A 4NSNA 2C2BA 3HKDB 4DR1H 5DBGA 3V8MA 2L17A 3DE7X 5EOVA 2B4TO 2CL5A 2GM9A 4HYYA 3CZ9A 3GBPA 3Q6IA 1LBEA 2WIKA 1CY8A 3DONA 5AUNB 4AQYH 2FZGA 4UBOA 1JQDA 4MWBA 3DOOA 5I45A 4DM4A 2QYOA 1UDXA 1ZK2A 1EG2A 3M6WA 3EUAA 4FS2A 3KEMA 4J7AA 1ULHA 3DVAA 2FSVA 2PR7A 2Z3ZA 1GGVA 4L0MA 4CW7A 4DLPA 2PT5A 3VHLB 3IBFA 3OPYI 3QVOA 3Q3GE 2Y1LA 1XRQA 1W1IA 5JCPA 1LVUA 4JYPA 3ZV6A 2NXEA 1GTG1 4NE9A 1VXOA 3DHWC 3GUHA 2ZI4A 1PR5A 3M49A 2FLPA 3BL5A 4M1ZA 5THKA 2QJTA 3UATA 5HWSA 4P2BA 2BKUA 1W76A 2TSYB 3FCEA 3LUCA 3NHRA 5KFBA 5DLGA 2H4FA 3LOUA 3OX4A 3KREA 3C6ZA 3CF2A 4BRUA 3O5AA 5G4KA 1QP0A 4L4XA 1TLLA 5K4GA 2BGIA 2E21A 1YSCA 2HJSA 1E5QA 3SQDA 4DB4A 3HJUA 1DFGA 3RBAA 4ZZ2A 2Q6TA 2ZFUA 3PCRB 1CUXA 2I1VB 1VHJA 2EARA 1C3XA 4MWZA 2XWPA 3AFNA 3KPUA 5ENDA 2PQ0A 3VO8A 3ZEAA 1RAIA 3Q2KA 1C3VA 2VAWA 3PC8A 4Q9LA 2VJQA 2PLWA 4EZEA 3TSZA 4JFAA 2ZI7A 2XD9A 4R1QA 3LPAA 1I5EA 3UUWA 5GIPE 4EAQA 4GWGA 4NMXB 3CW9A 2JA7G 2AMYA 3R7NA 2GESA 2VTKA 5K0ZA 4FK8A 4ZVPA 4FP9A 1WE2A 2HHHH 3UPTA 1CUUA 3HS3A 3ZD7A 3SN6A 1M10A 2DECA 1G5RA 5H5JA 2VTVA 1U7DA 1UZMA 4XWTA 3UK1A 2CLHB 4M46A 4H7PA 1VS0A 5E9AA 1WZCA 1GTRA 3PTAA 2O7SA 4LFCH 4MDHA 5DYYA 2WYVA 3F5MA 3TRFA 1R16A 1NJ5A 1UC9A 1PFWA 2C1ZA 1EUDA 4N3BA 1I9GA 4TV9A 1XG5A 2SKEA 3PUYA 2C83A 4COKA 2GPSA 3VJMA 1B15A 5IBQA 1G41A 1H8HA 3EGDB 1R00A 2VPIA 5A4DA 3H5OA 2IUYA 4CETA 5KYXA 3KKNA 4WXEA 4TTVA 1NXXA 2PK3A 2CDBA 1LZLA 2FCAA 4CMFA 1WS6A 4KVGA 4TQSA 1G6HA 3KEFA 1OREA 4EYIB 2WA1A 2B83A 2R1VB 1Z2OX 1H6BA 1N9ZA 1OXXK 4ONEA 3EG9B 2QN1A 2QR2A 5JO0A 1KERA 2MSNA 1N6OA 1ZCZA 4Y1RB 5KFEA 3D7NA 3COVA 4MRNA 3ANSA 2F17A 1I3MA 2XT9A 3TNFA 3NT4A 3I6BA 5C8YF 3K6RA 1UF9A 4KE6A 5EHNA 5B2ZA 3IXQA 2W93A 3HLYA 4JJ7A 4NLGA 3D7SA 3HN2A 5IH3A 1E3WA 1U7WA 4X97A 2YHAA 3LPLA 1J1ZA 3NHSA 4ND4A 2X0RA 4K88A 2CHUA 1V8BA 5C4XG 3E3OA 5EESA 3BK2A 4TLMB 3GFQA 2HRDA 2JAPA 1P2DA 5IAAA 3L07A 1SZJG 1AM4D 4D97A 5DM1A 2O8FB 4TQGA 3TQQA 2HZBA 2HF8A 2O2EA 2BFOA 1LLUA 2JJMA 3S2IA 4A4DA 4J9RA 3DGFC 4KSBA 5DJ5A 3AKYA 3PNMA 5ED0A 1T2AA 2ERXA 3N2ZB 3H2BA 3KYIB 1OZAA 4J3JA 4M1YA 2FFJA 4WFKA 1OD6A 2HN9A 3V1NA 3U5ZB 3K0SA 2ZIVB 3BXEA 5GVSA 4MI6A 4I6JA 1OIWA 1Z3CA 4QPPA 1BW9B 3HBFA 4D9KA 1SKAA 3O21A 3EFOA 4RFSB 2Z58A 4GMKA 2CUTA 3MGKA 1RNLA 1A0IA 5J5CA 3GIDA 1RKVA 3L8CA 1ORWA 2AG5A 1RYZA 2XLBA 1MV5A 1X1QA 4IIHA 1GUFA 4YROA 1TQ2A 4GC6A 5EWLB 3M81A 4P3NA 1X70A 3HRHA 3DOIA 3GFGA 1VQ1A 4KO8A 2NP6A 4DV6H 1NBWB 2BM9A 1XJWA 1XZKA 2HIHA 1XMPA 3G82C 3TAHA 5K7SA 4XPIB 2YRFA 2CSXA 4BFVA 1VPWA 1W87A 4XUCA 4FQ5A 1JHQA 4JMPA 5BWOA 3H8SA 1AQYA 3ZY4A 5ALFA 2ADMA 2XXAB 2KJQA 1ESZA 2O7RA 4G1FA 4KMOA 4XQ0A 3FAKA 2R7LA 4KOAA 3DHVA 2LDXA 4KDEA 3P20A 2IL1A 3MF4A 3OMLA 4ZYZA 1C1DA 3SBEA 5MGNA 5EE5B 1FTYA 1STOA 3R6LA 5KYTA 5C5DA 2IW1A 3ZE0B 3FLEA 5JBIA 3FWHA 4GI3A 1J09A 4GICA 4KFSA 3E5HA 4RD6A 5EXSA 3U0BA 4EA7A 2FSPA 4V1CI 5KVSA 2MTBA 1QVRA 5ES3A 2FWAA 2WJVA 3L41A 5INTA 2QVBA 5LD2C 2ZROA 5CMLA 1YU6A 3JALA 3RHTA 3ZCXA 3LLCA 3ESBA 4II2A 1Z0UA 4MZXA 1GKLA 1AB5A 4B2PA 1E92A 3PVCA 2FKAA 4KDFA 3MMSA 1U7OA 2W6ZA 2X1LA 1FRFS 2JGIA 5DT9A 1NZDA 3N2GA 1TO2E 3UTCA 2AFHA 1CRPA 2VJNA 4RC9A 4OEHA 1N5MA 1X39A 4L0QA 5AW9A 1S8NA 3E3AA 4RUAA 4YIHA 4UAVA 4D3YA 5CEFA 3G02A 3JXEA 4CDMA 1ZYUA 2VWGA 5C3UA 2NV0A 1GLNA 2BL4A 4FEGA 3DXFA 1O97D 2XUQA 1KSFX 2YIDA 5GWXA 3QJGA 3PV0A 2Y8EA 1Y8AA 1CQZA 1E3IA 1Z83A 3ES9A 2QR3A 1CUDA 2O52A 1N2CE 3QJYA 1YMUA 4KSCA 1N9GB 4DYDA 3HC7A 1KTAA 3PD0A 4UE6A 1E94E 1W88A 4B3RH 2MSLA 4A5SA 5FFNA 4W5NA 4OSPA 5DGAA 5B4VA 3I2HA 3FMGA 4UVGA 2JFWA 2FI1A 2AQHA 2NU9B 1U1DA 1ZLYA 2E89A 4KRYA 2QD5A 4GWKA 1YZHA 1Z0AA 1BCSA 3VH4A 3JD4A 3OLZA 1IBLB 2OGWA 3V8VA 2W37A 4KBYA 1A82A 3FJOA 1NOJA 2WKSA 4XX1A 4YC7A 1IPHA 5CXUA 5DISB 4WT7A 3DDOA 5I5SA 2ZRIA 2HDOA 1XN4A 4MVWA 1I8TA 1U8UA 4NZYA 4B6SA 2P67A 4DMGA 1D4AA 2FKNA 3K9WA 1X0XA 3H20A 3BF8A 1U4SA 1SBHA 4C01A 1HURA 3AF5A 3CCCA 4Q9HA 4DC9A 3IQEA 4YMTA 3RW9A 3GUUA 4AF8A 3WXBA 4R3UC 5JCJA 1D1QA 2P5YA 2AFIE 1MB4A 1Y5RA 1SOVA 1P9LA 4OV6B 3BGWA 5E0KB 3KJGA 3TMAA 2GK3A 4EJSB 2GK6A 5CK5A 2B99A 4CLXA 1YZUA 5L1IA 4DV2B 3WAKA 1BGVA 3MJEA 4A3JG 2PL3A 3VDQA 4AN0A 2QV0A 4HQRA 3NFYA 2C3PA 4EUSA 3C8UA 1XTTA 4FMDB 4O59O 1FNSA 2J4CA 4BPRA 1DSSG 4AJNA 5EE0A 4PZ8A 2VHWA 2FP4A 3UV6A 2DB3A 3DB1A 5CW2A 5HQ3A 4C78A 5AUPB 4AB1A 2FVXA 6LDHA 2G40A 1U63A 4ZT6A 2PSHA 5F1PA 2R82A 3UJHA 5C31A 2CYAA 2PV7A 3S2EA 4INAA 3DOUA 5B1HA 3RT9A 1HDIA 5KG1A 3K6KA 3UZBA 5U4QA 3NOXA 3PQ8A 4YP3A 1JKXA 2D0OB 1YKFA 3TLKA 5DG7A 5EJMA 1FRZA 2R00A 5A71A 2I67A 3TJMA 1VSUA 1EHIA 1D0IA 2CNWD 4L4SA 2VSNA 2JJ1A 4O82A 4RYLA 1L0BA 4JVSB 1O5OA 4Y6OA 4YAOA 5BQ5A 1WUIS 2YXLA 3TTWA 1DV1A 3O2NA 1IQ0A 1A9RA 1JR2A 4EB3A 3EWSA 2AE2A 4G6ZA 3CINA 3T7JA 2WWTA 3JQEA 3LDUA 1QGUA 3UXMA 2O8DA 1JLLB 3PFCA 1DRJA 4CQLB 3L6CA 2NO9A 1UC8A 3G2KA 4LVUA 3A2MA 5JD3A 5T3YA 4MLPA 2L42A 4W5OA 1KZ4A 1PT7A 4GPZA 2B92A 3QU2A 1OFVA 3SZOA 4O4LB 5ALUA 2GEBA 4BBJA 1F2DA 3RYHA 1WU7A 3C3XA 3N0VA 1YQ9A 4FE7A 2AL7A 1QHFA 3QLEA 1PL8A 3G2QA 2C2DA 4BEJA 4J07A 2ZE7A 4BWGA 4JEUA 1MU0A 3H2IA 4MROA 2X7JA 2IITA 2FSFA 1NBAA 4RTNA 3H8JA 4S12A 1THMA 4C2BA 4F4UA 2HT6A 4ITVA 2ZJ8A 1H2AS 2Z6VA 1TEXA 1PGJA 3B1KA 1C1XA 4NNJA 1EZ1A 3FDZB 3JWIA 1YQUA 2FWMX 3LRPA 2Y2UA 1F2VA 5GOZA 3B53X 1N5LA 1Y4ZA 4X61A 5HIAA 1RWNA 3V80A 3ZDDA 5JJKA 1X86B 3W2EA 2GK4A 3O8LA 3GF4A 3E2IA 4RA6A 3HCBA 2XSZA 3RVJA 1QFZA 1GL6A 2VHYA 4LJ6A 7MDHA 3L8DA 5IKOA 1H23A 2I7CA 1WMAA 5LLSA 1S2GA 2IJGX 2QQFA 2ET6A 4YIKA 4R54A 1R18A 1P4JA 4C6RA 2N47A 3R3HA 2VA3A 4UUNA 2C96A 2HAEA 1T9DA 3QH4A 5BQFA 4AUEA 1ZESA 5D7BA 3O8BA 4JVLA 3CRZA 1W7AA 1U6KA 3ASZA 4D3ZA 1DCKA 2SICE 5J1SB 5KFAA 3UA3A 3PR2B 4ND8A 1XQXA 2QUBA 1D3AA 2W58A 1OILA 1N0WA 2BHNA 4CGYA 2YFHA 4GI2A 4LRTB 4WBSA 4PFSA 1ZIYA 1TQHA 1Y3AA 4ZAXA 2IW3A 2Q8PA 3IT3A 4JBNA 1HKHA 2UZ0A 2Y1FA 3HCDA 1L7AA 1T4CA 1BGWA 2D4AA 1YZQA 3AERA 1POXA 1XVVA 4C07A 5AW8A 1M0EA 3WLTA 2DG2A 1NR5A 3UAGA 2D62A 3M33A 4CMIA 1OXMA 1ZVKA 3LLUA 2XTMA 1NXSA 1MOSA 1GZVA 3CSSA 4E3WA 4OH1A 4RMHA 3O8OA 3AM1A 4I50B 4ZDWA 1WMEA 1J9ZA 4WLUA 1BS2A 1YC2A 2A5DA 1RKQA 2LRHA 4WK0B 4J0KA 1MD9A 5HVNA 1RC8A 4EJ6A 5D3ZA 2PTGA 4A3EG 1D7OA 5E1DA 3HU5A 2HKIA 4GLJA 4JD5A 3ELWA 5JS7A 1NAHA 4MV8A 4YBRA 2RG7A 3WNCA 1R4ZA 1O4WA 2G82A 3ZTYA 2FZLA 2JL1A 3DAFA 5JCOC 2YIVX 2OHFA 4L3OA 4TTJA 1KFKB 3ANLA 3WHPA 3PKZA 2QZSA 4HDCA 3IUEA 3W4JA 3NCHA 4YP0A 2GAAA 2W2MA 5TEVA 5BN3A 2LCIA 4CL2A 4B3XA 2PT7A 1WSBA 3EVGA 1MEEA 1QVZA 1T4BA 1G2OA 1ZXBA 3IIKA 5KFHA 5CB6A 2IXBA 2GGSA 2RDIA 4EHIA 4HUQB 4RK6A 1JYEA 2HI0A 4B80A 1DQNA 2RC6A 1UBOS 4KQKA 4XR9A 2B5WA 2MYTA 4DNPA 3ZEIA 3NYQA 4KKVA 3RG8A 1YC5A 1AKRA 2AB0A 3U54A 4ZGWA 4IWYA 2FPRA 4FBLA 1ITZA 2CHFA 3Q11A 3RSFA 4FFDA 1RHKA 1BHJA 1CDEA 4P83A 2Y4RA 3MPUA 5EHIA 3Q8MA 4IZHA 4RPKA 3GFBA 2QVYX 4G5HA 4ESHA 3KOUA 5DNVA 5JUWA 4ZEVA 4TN1A 3OZBA 2XUFA 1VBNA 3DOJA 2A2ZA 2GARA 1UBSB 1VG9B 4EHNA 6Q21A 4BN0A 4P0PB 5B58C 2WT9A 4JFRA 4WPGA 3BRWA 3R23A 3P45A 3RUIA 1R9MA 3DV9A 3WYGA 1XF9A 1JEYB 3IH5A 3NGLA 4M99A 3BERA 5IP7G 2FJZA 5EZSA 3RNOA 2LPMA 3ILVA 3BWEA 1EFVB 4DV1H 1E2IA 2G5PA 1U02A 4GMHA 1I24A 3FOEC 3RADC 3GDHA 2ODTX 1FJ2A 3E7WA 4GOJA 1XLTA 1NV8A 4TRNA 2R92G 1M8PA 4I6EA 1YOVA 1PS9A 4WCFA 2NZJA 1BROA 4DNXA 2HREA 4HQLA 1V11A 1RIIA 5G2OA 4R8UB 1QTRA 2PL9A 1QYVA 2EDCA 1E4OA 2Q2UA 1CK4A 5EIFA 5H81A 3GLSA 3A36A 1IL0A 1CUHA 1FTWA 3T0GA 5JIBA 3WA6A 4DJFC 1N2BA 2CDRA 3FXAA 1IYZA 5JD6A 4YRDA 3N86A 4Q45A 4BV2A 3OY7A 4LBZA 2V55B 3NEYA 1QH1A 5DGIA 4UE2A 1ONOA 3IKLA 4KRFA 1QSGA 1H0RA 3WOHA 5C51B 2I34A 2DFNA 1VP9A 3P4YA 3D7LA 3GTLA 3ABRB 4XGQA 4KPYA 4Q3KA 4GRDA 4JJ6A 3COSA 1Q0PA 1GQQA 5K8IA 5FA6A 2Y9PB 4RVHA 3QFHA 2Q6IA 4HNRA 4ZI7F 1G3RA 3TFWA 1DBSA 3CB2A 4B6EA 2JANA 3RSOA 2OXFA 3S81A 2OQVA 4A82A 1GILA 3LQKA 2G5TA 3JYNA 3MRXA 4I2NA 1U31A 3F6RA 3KQPA 1SNYA 3GUZA 4U8GA 1AKTA 4M0EA 4U9HS 2EJUA 3KB8A 2VUSA 1N33B 2C4UA 2A9OA 3IAAA 5EQJB 2COKA 5K8TA 1SZCA 3OZUA 2LKCA 2XOEA 4OXQA 2ZT7A 5CYOA 3IFSA 2CMHA 3ZNNA 3QEKA 1NXTA 1U7TA 5EWMB 3BL6A 1AS3A 3VPBA 4QOEA 3DZKA 4NEQA 4EW2A 1CZOA 1ULZA 1AQIA 2GZ3A 2DC1A 4PYNA 2YASA 4W1RA 3S0JA 1GV1A 5IARA 5JQGF 1W4BA 5CDFA 5JDCA 3NJ8A 2BFCA 3LYLA 2B37A 1I32A 1SQ5A 4XW2A 1ORTA 2QPAA 2DPMA 2YOHA 3ASVA 4UMVA 2GBCA 4E6NA 5AH0A 3JZDA 2R6GA 2IIQA 2QXUA 2QW1A 5FOWA 3V1YA 2RDJA 4MJXA 3U4MA 3L8EA 5D3MB 3GELA 5AJXA 1MEOA 3TY9A 3P0RA 2O4CA 3DYVA 4WJKB 1TKAA 4UHCA 1V5IA 2W6MA 1HG0A 2J3DA 2QVCA 4RHTA 3GJ3A 5L3QA 4NOLA 1Z4KA 3H17A 3T41A 4RZIA 1CT9A 4HK4A 5DCLA 4NPHA 2B4YA 3ZDAA 2IC5A 2I33A 3P96A 1CPYA 1E3JA 9MHTA 1D0SA 4OG2A 4PY2A 4BO0A 3QLTA 4Q3OA 1RQGA 3D1VA 2UZ3A 4EI9A 5IAJA 1NDUA 2OMKA 2OCYC 1LJ8A 5CW1A 1SZPA 2HHLA 2MMGA 3Q5DA 1YASA 4AMZA 4ESOA 3CVWA 4G4JA 2IH5A 4OIFA 4QYIB 3U26A 1UM9A 4JT8A 4QU9A 2CNLA 3BH0A 1KC1A 5HDQA 2JD0A 3HY3A 3PSHA 2W6NA 1QIMA 1F17A 3UQ8A 1XU9A 3R7SA 1PDVA 1NVEA 1FLDA 1MVOA 5DW3A 4HX5A 1OX4B 1HDOA 5AVQA 4F71A 1P7ZA 3EZ9A 1L8LA 2VTDA 2Q3FA 4N5NA 1UBCA 3JSNA 3R3SA 4BMXA 1H2EA 1E2HA 3HVUA 5MDHA 1TT5B 3I8SA 2CE7A 1YIOA 1SXJC 3GP5A 4EEZA 4NFSA 3A3KA 1GA4A 4LTNA 1DDIA 4KZKA 5IH7A 3U3XA 2FE3A 1GPMA 3M5WA 3PDWA 4WIAA 2IZOA 3FB4A 3KP1A 1N1DA 5L9XA 1WCV1 5KFIA 2ZRLA 1VL1A 4W9NC 3F5FA 4GXRA 4P34A 2W9BA 5JAQA 5K3SA 2W7TA 1CY4A 2WM8A 1BAPA 3CUKA 4UATA 3JTEA 5AW6A 2YZMA 1WO8A 4ZIRA 5C81A 4AECA 4BKQA 4P92A 1WNFA 1KKUA 4RD4A 2VRCD 1NDQA 1V48A 4ARZA 1BOOA 4JQOA 1S68A 4GH5A 3GNTA 1AHIA 3TOZA 2J3EA 1OLUA 5ESWA 5LMUH 4BJHB 4PZCA 1HLPA 3OJCA 1ZD1A 4C21A 4L9AA 3GH1A 4MPRA 2X9NA 1HNXH 2PQMA 2O1WA 3SOZA 1XNJA 4AAYA 3H3JA 2CK3A 2I1QA 3EIHA 2AOUB 2P2NA 3ZDZB 4B74A 2PJZA 1U8AA 4MVCA 4X44A 3TM4A 3GJXC 1DC5A 2P91A 3C5HA 3WL4A 3QX3A 3FTEA 4RKWA 3GNLA 5F9LA 1WMFA 3ZY6A 2G67A 2ORIA 1ZICA 3OZ7A 3Q9UA 5H3LA 1Q91A 4YR0A 5DBEX 4Q9DA 1VKOA 5I7SA 2WWRA 2DBVO 1L4KA 3B82A 3IIIA 5DEOA 2NQ2C 3MFQA 4LRQA 4Y2PA 2YYZA 4MS1B 4QREA 3GDOA 1G4UR 3GLTA 2EFJA 1V1RA 5HM6A 4ZFNA 4ECEA 2W6JD 3RKSA 4CQMD 3NBYC 5TMEA 2DLNA 3F71A 1GNTA 1SUCA 2C99A 3SEFA 2R5WA 3PPVA 1ZD4A 2R86A 5IWAB 3KXIA 4YCJA 5A4MS 2G0NA 1SUEA 4N5IX 1B33N 3EZ2A 2EBFX 1E89A 4FS8A 3WLPA 4LXQA 5ELXA 4ALJA 1DTSA 1A4XA 3RRZA 2J3JA 3UAOA 4DWVA 2XBUA 3FGPA 1QK3A 1TXGA 3DULA 3ONNA 4S0XA 3I5XA 5KFSA 1E2KA 4DA9A 2AGPA 1SU6A 1CRQA 4WACA 1PZXA 1QG0A 1Z15A 4TTTS 3PGXA 3BCRA 1WDKA 2J3MA 1A96A 3ANYB 2P2CA 3AYZB 3HZOA 1VCHA 5FOXA 3G6XA 3FHCB 3GUCA 1ISIA 1CY7A 1PIWA 2WJPA 5EPOA 4JI8H 2IOHA 3HL4A 3L6BA 5AHOA 1L7VC 4UOZA 3NWBA 4MKFA 1I3CA 3P5SA 4MB2A 3RVPA 5DQHA 3HYTA 4XSVA 3KXLA 2Q27A 1SUAA 1YA6A 5JMTA 2CBXA 3NVKI 3DDCA 4IRKA 1SKQA 1VYUA 1G4HA 5SY9A 3MTAA 4NECA 2ZRHA 1UMDA 4Y2UA 2C5GA 1JEEA 5FBKA 5K6TA 3F7MA 3K20A 3HDHA 4W7SA 3TD9A 1DJPA 2G36A 5TMPA 4DV3B 1GHTA 2IIPA 3GT4A 4IDCA 4QOGA 3IPCA 1PS0A 3GOQA 3NAGA 2IVZA 2WDPA 4NOJA 3MERA 4I8XA 4F84A 3TFQA 3PO3G 1QVVA 4YHBA 4LBWA 4MCHA 1V5FA 2V9PA 1AHNA 3CVJA 2G9UA 3VVBA 1Z5GA 3OIVA 3EPKA 4N5HX 4H60A 4LE1A 1K6EA 2EQAA 5EUBA 4ZK6A 1Y89A 1XALA 1DC4A 3TNJA 5E1BA 4NG5A 1PJZA 4ZVRA 1U0TA 3WNDA 1NOKA 4DMRA 4J16A 3KWJA 5JNSA 2EKBA 4I5IA 1CY0A 5FUWA 2HSDA 1AMNA 1EJ2A 3I34X 1UXHA 2VNJA 3DE6X 2EBUA 1K7XB 2B25A 2YICA 3AQ4A 1AO0A 1QQ5A 4MUNA 2C42A 1V4VA 4F91B 2HDKA 5DN9A 3ESYA 3B6EA 1L5MA 2G1JA 3CO5A 1UDCA 4I4TB 2R7AA 2C4KA 4X20A 3IRUA 3FGOA 3RLIA 4J0MA 2FQYA 2O3TA 4WSOA 3GLIB 3ICEA 3L7LA 1FNBA 1GRCA 3DZJA 3GFSA 4AT1A 5EMKA 1USIA 4XRGA 3OZVA 3KOXA 2EYUA 5CURA 3DBIA 5AKHA 3CZRA 3CRW1 3EB9A 5BV1A 3MSCA 4ZCRA 1L5HA 1P4GA 2ZTSA 2XT6A 2Q07A 1CZKA 3U7QA 3GVXA 4I7HA 3TBFA 2ZJZA 5B6PA 1MA3A 4KGDA 3AV3A 1N2EA 3TJZA 4YRMA 1XNRH 1A48A 3GT7A 2GCOB 2PBRA 5KOJA 2PO7A 3BREA 3V8QA 1FYFA 2CXTA 4NLLA 1W4AA 1J97A 5AHRA 4EG6A 2IGTA 3WIUA 3A11A 4F9FA 2ID7A 3A4NA 3MRSA 2W9XA 1SUDA 2B8WA 1F2TB 5AHKA 4DA0A 3DL0A 2E9SA 2ZR0A 3I73A 4N3NA 3GEMA 4RENA 2YZ7A 4NYIQ 3MNFA 4OUKX 3RUHA 2VDLB 4J1TC 5HZGA 1ZX1A 1NYRA 5IUJC 1YVPA 1O5TA 2X0IA 3EMKA 4GLLA 2ZYTX 4BV8A 3RJTA 5EQDA 3GD7A 1L9KA 1GZ4A 3BMOB 1XIVA 5LP6A 4K9LA 4B81A 3L7YA 3DPSA 5BR8H 3GZ4A 2VNHA 3V1KA 4O29A 3N40P 2WVGA 1EFTA 4PPNA 1AUPA 2VBGA 2ODBA 4ND3A 6REQB 3C16C 1ICEA 5DG9A 3I2FA 1R0ZA 4L75A 1QR6A 4NV1A 4NATA 4DA8A 2WJ3A 2R8PA 5TQ0A 2XBMA 1E2LA 2IUSA 1WR2A 4U2EA 1ODFA 1VMIA 2ONYA 1N36B 3D8HA 2C00A 3RC2A 3UGKA 3CWQA 4KVZA 2NTVA 2F67A 2Y1OA 1GZ7A 3IBGA 3ZE7A 4LHZA 2GOYA 3RFCA 1MPTA 3DEJA 4HB4A 3E4DA 1NW5A 4KHPH 2XJ4A 3CE6A 1SAYA 3KT3A 4DR7H 3VR6D 1A3CA 4DJ5X 3K5WA 2XD4A 4R16A 3PHJA 5CEJA 4I5EA 3E0XA 1JFFB 2G1PA 5AXDA 2ZJ7A 1YZYA 1FC0A 4CHIA 4MUFA 1S8FA 2QY6A 2SKCA 4DMMA 4HTAA 4FOTA 1JIXA 2JA6A 3J81W 5H0IA 1TQ6A 2WWYA 2BGLA 1BDJA 5K0LA 5AK5A 2VRWA 4BU1A 3HVHA 3PXUA 2PX3A 1RK5A 5JD5A 3WYAA 4AJ4A 1MORA 1HDCA 1U7XA 3NP7A 4WH0A 4NK5A 3IQHX 4CL0A 3EBPA 1TMYA 1P2FA 2GM5A 4M7WA 1G8AA 4F3NA 2HMUA 4FGUA 5E6UB 2C35B 4ENPA 1J56A 4G89A 1FSPA 4LWQA 4WKOA 5B1EA 3KTMA 9GPBA 5AYVA 5JAHA 3ESXA 1D6JA 3DEHA 5AI8A 4NENB 2OEPA 5JH7B 2ZYDA 1L4UA 2R4TA 1UBUS 1K4YA 2FWJA 4F04A 5JOQA 3O4IA 1OSNA 4GSYA 3QZ7A 4PYKA 2AKYA 1JFRA 1IQUA 4TVOA 1JIHA 3FDSA 1WXIA 2UYQA 3CZAA 2W9AA 3TE7A 2F1KA 4JK3A 4Z1MD 5HV6A 5FTMA 3LD9A 4X54A 5LUBA 1EIZA 2IYRA 3DXXA 2UVRA 4FYPA 5JAMA 1ZJ4A 1NG1A 5EI5A 3GGOA 5JRZA 3H6GA 3G2NA 3VISA 4DARA 4BBAA 3OQBA 1YQTA 3LDAA 2QP4A 2Z1NA 3PW7A 1K5PA 4ZQCB 1M8KA 1P17A 3AJ9A 3VYVA 4LFAH 1U1EA 1E96A 4AKTA 3ZWOA 1YQQA 3TL3A 1VFPA 3PQFA 1G7CA 5I9BA 1BD3A 4WNIA 2RH4A 4HNAA 1V26A 3OQ6A 4R2KA 1NUUA 4JV0A 1FVXA 5IAEA 5DW0A 1A04A 2GCPA 1NNEA 3DAPA 2XW6A 3H18A 4ZDIA 2PGAA 4H77A 3QVSA 1EHYA 3T9AA 2H6EA 1N9KA 2REOA 3T1YH 5GJCA 4AMGA 3H0KA 4V0NA 4YJFA 4CGZA 3OQ1A 2RAFA 4MV9A 2WKPA 2EFDB 2R2GA 4G24A 4A23A 3S27A 5IM4F 3CN7A 4OJKA 3FTNA 5SYNA 4K3UA 4NMLA 3UTDA 2YV2A 1RI1A 3TW7A 3QA9A 4O2BB 1OXSC 1Y1VA 4EMSA 3OZSA 5BMVF 1ZD5A 3U44B 2EFEB 3HBAA 4I5FA 4MRMA 2A1HA 1B8UA 3TB6A 3PS9A 3BDIA 1PG2A 1GKUB 4AZ0B 3LUGA 5FR1A 5M2QA 2HEGA 1L8QA 2H07A 3H9QA 2NV2B 4U8HA 1QTQA 2VDJA 1X9GA 4WK2B 1S89A 4TYWA 5BN5B 1OFIA 3O3CA 1YRWA 2HZ7A 5G0TA 1O87A 3KPYA 2CD9A 2QIPA 1R3DA 2RAUA 3VX3A 3ZJYA 2XEDA 3PYXA 4I8DA 4ZPJA 4WOCA 1K68A 3UKJA 1WU8A 1UNNC 5I5EA 1GQOA 1NLMA 1Z4PX 3TR6A 1UBFA 4I9GA 3RI3A 1I2LA 3UK6A 3KWMA 4YK7A 3DKPA 3IAS1 1SH7A 3DA8A 3HADA 4QUBA 4A16A 5HS4A 4URXR 3O1HB 5F76A 2HR1A 4F06A 1KH1A 3JQ7A 2VQFH 3PWKA 2Q6KA 5ALDA 1E7RA 2C84A 4HBZA 2QL6A 1JR3A 3MIZA 4PV7A 1FLAA 1RCUA 1P2UA 5K5EA 1U2DC 3OAAD 2HU2A 4BB6A 3HFJA 3O3MB 1ZONA 2FPGB 4PR0A 5MN4A 1ISMA 3WLKX 2FXIA 4AJIA 2XYVA 4HGOA 3AYHB 3K94A 1FQJA 3KKLA 4GM0A 1QYCA 2YQ4A 1EAMA 4EGSA 1UBLS 1C9MA 4YP5A 4CMKA 1ZI6A 2PANA 1BH6A 3BPSA 3ZY2A 4Z4QA 4LOJA 1PGQA 2QTNA 5FADA 1VE7A 5CAEB 1EJ6A 4PZAA 2ZYHA 5COBA 5MFZA 1LK7A 3FWZA 3MJDA 2H1CA 4JBIA 3WSVA 2NX2A 3M4ZA 3OBIA 3VVMA 4PZ6A 4L7QA 2B2CA 4HH4A 1YFJA 4UCWA 1QDLB 2NU6A 2CVQA 3AF3A 3R24A 3D6NB 1F8GA 3RF6A 1ZC3A 2YHUA 4RS4A 2QAGC 1RJ9B 3CPSA 2O48X 3RG2A 5AM4A 1Z0FA 5JJ5A 2W8ZA 3TZBA 1JUDA 3UJPA 2IPNA 4B9EA 4CF6A 4QX6A 2PGNA 3IO5A 1YDGA 5C80A 3FPEA 4ETNA 1LRLA 4RZRA 1ZVVA 3WGHA 2QRVB 3CTPA 2YWGA 3EGVA 3FD8A 1AY0A 4DDKA 2QLFA 4YRPA 5DLEA 2FE1A 4H1VA 2X2PA 4E22A 3OPQA 4M1SA 4G97A 1G20E 1DLJA 4PSVA 2BP7A 4FGKA 3IOCA 4EVQA 3IALA 1LK0A 5K2MA 2QQGA 1JIJA 1P7YA 4JI4B 3N74A 1NBOA 4OK6A 3GAMA 1R0YA 4DQUA 1U7UA 4TUYA 2GFHA 3CX8A 2JIZA 4L08A 3I2GA 4TV8A 3F6BX 1RJEA 2O8EB 3L49A 1U0JA 1UIMA 1V9CA 2ZBFA 2CMFA 5GM2A 3T06B 3VR4D 4Z0NA 2Y6UA 2QJFA 3LCCA 2FRDA 3CMCO 1T6XA 4MS4A 4XDGA 5T5QA 3QF4B 3NTUA 3B2QA 1ZPDA 3F8WA 3FGZA 1GZUA 3O1LA 4NTZA 1OAOC 1YOBA 2OBBA 2NVUA 1X7DA 3PJFA 3BAFA 3F7NA 1U6JA 3K0CC 4IDQA 4OP1A 4Q7QA 2A1TR 4P4LA 4FCTA 3H5NA 3MWDB 3WJ2A 4W1SA 5LNK1 1E2MA 2VF2A 3A6PC 2YVUA 1GXSA 4PX2A 4DJTA 4P3KA 1I1QB 5JVDA 3WMFA 5ICGA 1T3TA 3I5MA 3AHCA 1KJJA 1JQ3A 2LWIA 1ZA2A 3GEBA 4FEYA 4EG5A 3CUWA 3I4FA 3LW7A 3ZLJA 2R62A 3LKVA 3GNQA 5CDTA 2EWMA 4MSUA 1RTKA 4XYBA 4NXNB 1U3WA 3ICQB 2BEWB 1Q92A 1P61B 1JHZA 3JATB 4ZVQA 2CDAA 3P9YA 2CLFB 3EW9A 3QVWA 1Y6JA 4J9VA 4RIFA 4A6EA 5J2UB 2XCPA 1MFZA 3LL7A 1OROA 5AOVA 2VNIA 1Z7EA 2Q5EA 4UUMA 3BULA 3LXXA 1XYGA 2P6MA 4M8KA 1ACLA 3D6TB 5KREA 3C39A 4LJ8A 1CUIA 4RCZA 3THOA 2JKZA 1XXHA 4YB8B 3PNLA 3L7JA 3ND6A 3AYXB 3L8MA 1PFKA 3CUSA 3M6UA 5HF9A 5TT1A 1GO2A 2R6DA 5BPHA 1I6WA 4CL8A 3A6ZA 4B3GA 4EFMA 3NC4A 4DT1A 2J9FA 5JVLA 4V2IA 1N6IA 3DQPA 4DV5H 2EVWX 2CNDA 2RIPA 4I0WB 3L1HA 3JAKA 2OQIA 4MCAA 3W3AD 4JIGA 4YA6A 4AJ9A 4DIBA 1OY1A 2V7UA 1O95A 3MYYA 1YJBA 3V1UA 2R93A 3SQOA 3L7IA 4K6KA 1OWOA 1K86A 4JUBA 5IBPA 2OCKA 3HA2A 1SUPA 1F0PA 4W5WA 3KSDO 3U80A 1QGED 1E8MA 2XKAA 2R751 4MTEA 1ENYA 1RFLA 1BYUA 1XP5A 2B8NA 2OWEA 1Z33A 4BQQA 4B6JA 1MO3A 3KVVA 1IXZA 1Y6ZA 3QV2A 5GV8A 3CH4B 4DLZA 1FSSA 2O5CA 2CFIA 4OI1A 2I6UA 4N0PA 1G5TA 4NBTA 3ANNA 3AWIA 4F9EA 1Z73A 1VGVA 5KFWA 3TVTA 3SWWA 4QO8A 3WK5A 5CG2A 3C5CA 4ZICA 1V3UA 2BR3A 4BQFA 1DQSA 3DLCA 4DWWA 3HSYA 1COWA 2FMAA 4QWCA 2IRWA 4HKTA 4C30A 1TZJA 1NVAA 2NYUA 4F5YA 4BZPA 4HNGA 3HKZA 5CE8A 5AQ1A 3G2PA 3VOSA 4BAUA 1HG1A 3QVVA 1O6BA 4O2RA 1P1IA 4F9GA 4NHOA 5BRNA 4N3AA 3RS5A 5IYZF 4F8EA 1RHMA 3LA8A 3PDHA 2ZAGA 2BFBA 3VNQA 2AR0A 1PQPA 1Z07A 3IHLA 4F4YA 1I4EB 1H4SA 4UJ3A 2NPOA 3VMMA 4UAUA 3INTA 3N8DA 5CVVA 1N0IA 5JLJA 3LECA 1J2TA 5A1JA 5DO9A 3BDVA 3QVGB 1LFDB 3MJVA 4FYVA 3ZOZA 5THXA 4EYQA 3O73A 2FPSA 5K8JB 2O14A 4OMFG 1B6RA 4IQ0A 1ATZA 5JYEA 4GRAA 1ZK4A 4HZGA 1Z36A 1RAGA 1RPZA 3EAQA 5EIXA 1TM5E 7ADHA 5FUMA 2YFQA 1XQ6A 4Z6KA 1X8XA 3ZH9B 2ZI3A 1J21A 1ADCA 3UA4A 5IW8A 3VMFA 5DWVA 2H0QA 3NBUA 3W2GA 3P9QA 5KSPA 3JR3A 2QRKA 1BNCA 1J39A 4HB2A 3FSEA 4J9KA 5A5FA 1R12A 4ENWA 1SRRA 1VJTA 1UXIA 3ZG6A 5JARA 1KSJA 2HRRA 4YJ2F 5KYGA 1P72A 4Y2RA 3TZEA 4DB2A 1QF7A 3S70A 3FPAA 2EFHB 1KGSA 1F4PA 1J0BA 1U3DA 3CKLA 4C03A 2DLCX 4NE7A 1W8DA 3R09A 2IQ5A 3E15A 2QN6A 2HK8A 5HR5A 3EEBA 1RD4A 5JDIA 4CMBA 1TZMA 4NONA 3ZBPA 2FWBA 3IOMA 4C2AA 3EUEA 5JMOA 4JODA 2ZZNA 1M76A 3EZLA 3OUTA 5HBRB 4QJ5A 5JMPA 5T6BA 4R1OA 3W6UA 2IZ5A 4B3HA 3FZGA 1SKYB 2WT8A 1JHXA 4DDUA 2UXCB 3C8HA 2ZSFA 3A1TA 3UOAB 3FNFA 2PSSA 2WMYA 4C0XA 2R79A 3VPGA 4UHBA 2OH2A 2PS9A 2RK4A 4NVRA 3L0IB 3CLRC 2Q46A 2VQDA 4RE6A 1NA5A 1N32B 4F46A 2WHPA 5ICEA 4G9GA 1P9WA 3N7UA 4Q39A 3C2QA 3MQ4A 1KI1A 1B43A 1ECBA 3SS8A 4DR3B 1OV4A 5L3SA 5A3QA 3HKDA 1HPLA 3BKWA 4LK2A 5LU8A 2OPHA 1M2VA 1ECCA 2DJIA 3FX2A 4N40A 4DGQA 5LVAA 2RGDA 4PDBA 4DJAA 5DX0A 3E9RA 4LRWA 3RR5A 4AWXA 3GVPA 5JY6A 3P0JA 4RJJA 3PPYA 4IHQA 3OJEA 5IAKA 2VXOA 4J03A 2POCA 3VSBA 4YXWA 2JATA 3W4KA 5CBPB 2R8XA 1CUSA 1T6NA 3TIIA 4EB6B 1BE1A 5K51A 4UHHA 3QUBA 3LVQE 1R27A 4KLAA 4YJ3F 3ESAA 1CRZA 4N48A 2RBKA 1R2QA 4IJUA 4PGAA 4JROA 2FPPA 1JF8A 2X76A 1XP8A 1E0DA 1IUPA 2G9VA 1GGMA 2CXRA 5T8KC 3A1FA 4OVKA 2XF2A 1G5QA 2E4ZA 4B6FA 2HA2A 4BMZA 1TC2A 2NSLA 3FTFA 3MQFA 4WI1A 3PQEA 1Q0RA 1CCWA 3Q8KA 1SMKA 3UJNA 3ON5A 1ZUIA 4LRYA 1HRKA 1Q95A 5H02A 5ILOA 5L1KA 1APBA 3LZCA 1K3UB 4TYQA 3I39X 3K6SA 4RNNA 3ZHUA 3UJ7A 1B1CA 4DLNA 4Y67A 5AI4A 1FXWF 4LHXA 2GZRA 5FL3A 3F4KA 4KXLA 2PYIA 4CV2A 3M5PA 1FRNA 3PDCA 3OCUA 5CPFA 4XI9A 2FQQA 4O08A 5K0SA 1NW8A 3N76A 3PW4A 2NT4A 5BPFA 2QSJA 2NIPA 1SVUA 3TQOA 4Z99A 3TGWA 3L77A 3EISA 3F46A 3S68A 2CNQA 1RS0A 2OWOA 3TLYA 2Z09A 1EDDA 2VEDA 5EZYA 2HV9A 1FMLA 4A10A 5L3ZA 2HLDA 5DK6A 4V02A 8ABPA 1ZITA 1JAYA 5DBHX 2PKCA 3FZEA 2HIGA 3K1AA 5DP2A 3HGQA 3RABA 2ZJ6A 3T7DA 3DEAA 3VYRB 1QZ3A 3ED1A 4LJ7A 1GRVA 4KVFA 5JTUA 1QE0A 3TLAA 3HDJA 4XPZA 5I9LA 1HYQA 5DI3B 1DQRA 3TLXA 1T5SA 3FF1A 1CUCA 3KR0A 2FUCA 4ZARA 2IXAA 1Q7BA 4C1BA 4QOJA 4KLCA 5JZOA 5B4UA 1DCFA 1IBKB 3LUBA 4I55F 3PUJA 4O33A 2BBWA 5TPZD 5TSDA 1OB2A 3LLMA 1OI2A 3D6MA 4D81A 2JLXA 4AJ1A 2FUEA 1J0DA 1CJKC 1BWSA 2H18A 3B38A 3B3JA 3L5KA 2HPVA 1RFGE 3I92A 3QM1A 4HLUC 4RAYA 5B1IA 3RBEA 1FZQA 3EGDA 2IDKA 2YZGA 1OA0A 1S97A 4NBVA 3WV5A 2FMXA 1EGVB 3I28A 3JQGB 5DPMA 2ZAOA 4U2GA 3WB2A 4JLOA 3OSUA 1VDMA 5CIYA 4RHXA 5SZKB 3H2YA 5BSTA 4GX1A 3RAGA 4LC1A 2E82A 3CYFA 4UCSA 2CNNA 3L18A 1JJ7A 2EF1A 1SPXA 3ITEA 3Q7IA 3A9WA 3EG9A 5FBLB 5JR3A 5L51A 3EPPA 4DUGA 1HBJA 5A4IS 4MUBA 5LMNB 4Y1RA 2B63A 1MW9X 1JAIA 4NZMA 3P52A 3QK7A 5FRDA 2DH5A 1J8DA 4DWJA 3GMTA 4YRCA 3DZHA 3IQXA 4G9EA 4ECZA 4BNHA 3R8CA 1SC4A 4EBCA 2Z2JA 3EGXA 4JBWA 2C1EA 2HO4A 4BTVA 1FU4A 2O3SA 2V7BA 4YRGA 2NO5A 2NQTA 1G9XA 1CNEA 3ZI7A 1U80A 3IDSA 4C22A 1IULA 1N3LA 5JEDA 3X43A 1T2CA 4M0UA 3VH1A 2H59A 1BE0A 3VV3A 4QYSA 1A95A 4F3YA 2WZDA 2MMCA 4JR2A 1GA6A 1EK1A 2QVLA 3AUFA 4BNDB 2RHWA 1HV8A 4IZOA 1T29A 1L8XA 1B16A 5MN5A 2JJ8A 2P6RA 1LX7A 1VKZA 2AD1A 2XYRA 2OHGA 2R7ZA 1U2SA 3OJXA 2OXCA 3VXKA 2CLDX 5A6VA 5DIZA 4BLVA 4TTIA 3CS3A 1G9SA 3GLKA 4HRAA 1NVBA 1Q1BA 3LCMA 1UKZA 3S7ZA 3KSAC 2DHDA 1AGYA 4EECA 1TCAA 4RANA 5SY4A 2JGDB 4V0OA 2ALJA 4CTJA 1KI6B 5T4FA 2PIDA 3CG4A 1Z5ZA 5FWXB 4H6PA 5KVAA 1QZXA 2EJBA 2HGZA 2X4LA 3LL4A 3FVWA 4ZP1A 2P9EA 1ZD8A 3GJTA 5IULC 3IUMA 4MLDA 5JNLA 2KSQA 1UM8A 1NOIA 1D1SA 1XDWA 3DMHA 3H2GA 4TYNA 2VP9A 1ACJA 2BLNA 2G76A 3WO1A 1NPDA 3DF7A 2CCKA 2C3OA 4UAGA 2VYQA 1F0YA 3QZ8A 3AFIA 1A71A 2J8ZA 3WYBA 3UKDA 5EPEA 4HDQB 5LDGA 5ESRA 1L7BA 3E82A 3RRXA 5LA6F 2PH1A 3OJLA 1KGDA 4UMDA 1MGPA 3ASUA 4RA9B 3GLHB 2V5AA 2QZZA 1L7XA 1VPEA 1FUKA 3KYCB 1AE1A 4IJ5A 2XT0A 1OH7A 2VP5A 5LB4A 2QP9X 3JAWB 1NN3A 1L5QA 4GP7A 5HFJA 1ZKMA 4X1KB 3M9LA 2ZUSA 3QSGA 2B6NA 3E9ZA 421PA 2IU4A 3PNVA 2M6KA 2OHXA 3ZBQA 2HRQA 1TCCA 2AYYA 1GRQA 3OU2A 4LH6A 5TRTA 4GQAA 2G7ZA 2G3YA 5HUJA 4LSWA 2JFOA 5HJEA 1N7HA 1DJLA 3PVZA 3EVAA 1OI4A 3DT9A 4KH1A 5J4YA 3OPYB 2VN8A 3K1TA 2HFKA 1V6SA 4E0BA 4NZ9A 4GKBA 2X2FA 1U0HC 5BWXA 3R7WB 4F5EA 3ZJUA 4NJEA 2PN1A 3BXXA 3Q15C 5E8RA 1E3EA 3WGNA 3A1UA 2W43A 2Q4DA 3DG9A 1J22A 4ENTA 4W8GA 1KS9A 3S3TA 3KALA 1N5KA 5KS2A 2WAXA 4BE4A 5CVUA 4XVRA 1QNLA 4NYMR 1AMOA 3QU4A 1I6KA 4GF5A 5K09A 1M2WA 4JNKA 3UMYA 2IYUA 3AJAA 1XEXA 3DTYA 3LMKA 4DQKA 1L5FA 1N9GA 4KR7A 5GAJA 3NC1C 1K27A 3EVCA 3W8RA 1GCUA 3KKQA 3DR3A 4G84A 3IP6A 1ACMA 2DBRA 4G0VA 2Z1DA 4BP9A 4Z53A 1P2SA 2ODWA 3C3AA 1N0HA 2X4GA 1NHWA 1GGKA 1ZEMA 3R0QA 3NBZB 4BO9A 2PZLA 1L1FA 2QUJA 4OX9Y 1PFQA 2MSKA 1SQGA 1UPXA 1H2BA 3ME5A 2W7PA 4GAEA 1P5JA 4LHVA 3FNEA 5AK3A 2WY2D 1GCIA 2CEAA 1ODCA 2PJUA 2F8LA 4GC7A 2ZAYA 3Q6MA 3BM5A 4LXIA 5K6AA 1TFUA 5FIUA 3ZCVA 4IRXA 5B3KA 1KMCA 3G3EA 2B61A 3ZD9A 2VOEA 5DHPA 4C4OA 5HA5A 3N8HA 3S44A 3B3QA 4EG7A 3R40A 3GPBA 2GD0A 2O0HA 1WZUA 5FI0B 1K66A 4PRYA 1U7ZA 3PG5A 3ENQA 4MZDA 2OKCA 2FMKA 3MMZA 4QRDA 3C5WP 4ZAGA 2YINC 4CI0B 4EJSA 3GBSA 4ZYWA 1ZMRA 3SF8B 1G6Q1 4S1WA 3U61B 1KVTA 3HDQA 4D9EA 4AXXA 1AUQA 3KJEA 1KXZA 5HP4A 1XN1A 4LF9B 4QA9A 3NH9A 3QIVA 3WRXA 1E9CA 1KTVA 5DB4A 2J48A 3QU7A 3SJAA 1L4BA 1NY6A 1M8JA 2Q9AA 4HFJA 4I3HA 1N5JA 3M89A 4QBKA 4QUIA 4G81A 4KYUA 3GLRA 4JGBA 1XZIA 2B0JA 2ZRCA 4MGYR 3B6KA 4OUDA 2I6QA 5K8CA 2QRNA 3E27A 3ORYA 3P2MA 4HDMB 4FXOA 4UUQA 1VKJA 5H80A 2M2IA 2ATVA 1S10A 3NVDA 4WJZA 4W1PA 1QQBA 3VPXA 4HLNA 1QOZA 4TVIA 2O05A 3UAZA 2C4TA 4HUTA 4EA9A 5ICCA 4HG2A 5FR9A 4BFUA 2YVAA 1KT8A 4KBFA 1F14A 1I2MA 4A5OA 1WCYA 4TKVB 3K0AA 2C5HA 2OVBA 4TMFA 4RFLA 2G9RA 2G83A 4U9UA 1XRMA 3KG2A 1G5HA 4MAMA 2F1HA 5KO2A 4DHWA 3UAWA 4NMHA 5NULA 2D1SA 5JV5A 3DXYA 4U7FA 1W19A 5JXIA 1CR2A 5IYCG 4NMMA 5A9TA 2D5CA 2OHVA 2PEYA 4PWZA 2VCEA 4KG7A 1Y1SA 1C3OB 4RZ2A 4DV4H 3NWJA 3V55A 4U9IS 1ODTC 2W6OA 1S96A 3A1VA 1GUAA 1VKNA 3FSGA 2AEJA 2GEKA 1P7CA 5BWNA 3V2GA 1LJUA 2W11A 4XM2A 4NCIA 1XL1A 3AF1A 3AI7A 1LDEA 2PKXA 3PHCA 3LY5A 2FNAA 3AOEA 1GGJA 1JQEA 4M4SA 3AVWA 1DXQA 3SSOA 3KSRA 2AFRA 2CXQA 3DBOB 1LI4A 3JZAA 3QE0A 4MITA 3G2JA 4CQJA 2AC2A 3QLVC 3RUAA 1Z7WA 1DTWB 1FDIA 1E1QD 2JFYA 4X65B 3Q72A 3M2PA 2FPIB 1NW3A 4PAGA 2Q1WA 1PZEA 2REXB 3H19A 2WNHA 4WOJA 5DEIA 1VM6A 1U3TA 3PU6A 2NSHA 5KTOA 4TS4A 4IRDA 2VK1A 2OZLB 2BYTA 3IXLA 4YMIA 1QQ6A 2L82A 4YCCA 2DPYA 1IUKA 4KQCA 1BKSB 1G16A 1VBKA 3HB4X 1WW3A 3OHBA 1K5HA 1YDFA 3FTDA 1RE1A 1A9XB 2YVLA 5JT1A 3OIUA 5KWJA 1G5PA 2Q9BA 3GRRA 3FFAA 1G3MA 1T9HA 4EKDA 5CA1A 1Q6YA 2LGJA 3P19A 2TYSB 3OY2A 3X1KA 3ZGZA 1L4NA 1KOGA 3E5NA 5F1YA 5EJFA 3S5UA 1IBCA 2R8JA 3PFBA 3PR4A 4P86A 1A7UA 3NOQA 4A2BA 1H65A 3JY6A 4NZPA 5ISMA 3QLJA 1XQYA 4DCGA 4I9FA 2NVBA 3ZW7A 3ZWDA 1T2FA 2CB9A 1H2YA 4LSGA 2JDID 1GPKA 3G6YA 4E46A 1Q2XA 4RDXA 4QDTA 1QH9A 2R8GA 3X1YA 1RQPA 1U8ZA 2HCJB 2L2QA 2CV0A 4JJEA 1W4RA 3EOAI 1BDMA 4KIWA 1C5KA 2XCLA 1DZ3A 5FNZA 2ZETA 4IIGA 3BE6A 4RB3C 4KYTA 3LC0A 5C7YA 1WEKA 5AJWA 2YZNA 5GONB 2XQFA 2A0UA 1HFKA 2G28A 3VSAA 5JUMA 2ZM5A 4NULA 3CZCA 2C5FA 2GRAA 4UTRA 1GITA 2BM0A 2VS1A 5IX8A 4O7RA 1HL3A 1NVWQ 5BWLA 1QVAA 4QAJA 2Q3JA 4AXBA 2IEIA 4ID9A 4I50A 2HO5A 4P9NA 8LDHA 4EUEA 4RZSA 5K8VA 4XYLB 1JSZA 3TSOA 4WXMA 1Z28A 2HJWA 4DV0B 4L9WA 5IDXA 2NU7B 3I5AA 3HN6A 3OTQA 4Z5XA 1L5KA 1YR8A 2HU8A 4AS2A 4EI7A 4QBTA 3OTIA 4S2UA 5CLFA 3MCUA 4HT3B 3MLEA 4LF6B 3ZZ1A 3HWSA 5DHRA 4JUZA 4TXMA 2Q5HA 5H70A 2ZSAA 4AMBA 2AJ8A 1CVLA 1HQDA 2VOBA 4IHAA 1SK9A 2WE7A 1E2PA 2YXEA 4WMLA 1QXSA 4M0KA 4AF6A 1PTJC 3FW1A 1E1RD 4E5MA 1G8MA 1NIPA 4YYZA 3AHGA 4HUQA 3L0OA 2YR0A 5AOAA 1EK5A 3UJ9A 1ZGHA 1FFBA 5E7QA 3RYFB 3ZHYA 2HWKA 4EBEA 3B1XA 3VO1A 3SZ3A 4U5QA 5BNIA 1LTQA 3AILA 1EFHA 3ZQJA 2UDPA 3CSUA 5K45A 5JS1A 3GEEA 3M0EA 3I37X 2JI9A 1UZLA 1J0XO 4RKEA 3K92A 2DHRA 1C7IA 2O06A 4R9VA 4D8TA 5AUOB 2Z83A 3I5YA 2PDAA 3QKIA 2CJYA 2HK6A 4YMUA 4HFMA 2Z30A 3EE6A 2HPHA 3K5PA 1JWAB 4HY3A 3HNRA 1FMCA 1QIGA 1RM5A 2AZTA 3HSKA 2FPLA 4ZTZB 1JEYA 3KWFA 1XTBA 1RYSA 3BAAA 1E3QA 2PD3A 4ALNA 5A5VA 3QUSA 3WTCA 2LNDA 3T1VA 3TDNA 1WJGA 3EXAA 1NW9B 4CCWA 5LYJF 4WVLA 4HEJA 2V45A 1FFDA 2F3SA 4Q0MA 3N44B 4WINA 3C6KA 4DMHA 1GPAA 4GXNA 2N1MA 4FBUA 3MS4A 3QVLA 4BMSA 4R8UA 2ESRA 2ZJ0A 1N2SA 3PLAE 3QE4A 1G1MA 1JXQA 3HKEB 3VKHA 2P3QA 2ES4A 4U39A 1ZHOA 8OHMA 3NCTA 3ZQ4A 4QJBA 3WK9A 2QBYB 1GCAA 3C1AA 3CUEF 3VNRA 4A8PA 1TWHA 2AX4A 3VYWA 3WKDA 3LU1A 3ACBA 1XRRA 4DQXA 5C35A 4KN6A 2QHXA 1RR6A 3P9ZA 2ZUWA 2EP8A 1KOLA 4BCDA 2C58A 3JQCA 3SY8A 3O4GA 1T4DA 3N41B 4MQUA 3RTAA 1F0KA 4K9RA 2ZREA 2C8JA 2DULA 3AR2A 1X1RA 1LNSA 1YS1X 2EEPA 1THGA 1GPNA 4AU1A 3OKFA 3M6XA 1SOMA 3AP2A 1IUOA 2R97A 2E37A 3DZDA 3M82A 5J2TB 2UUCH 5EHXA 1EDZA 2PWBA 4OMUA 4G85A 1SIUA 5JNTA 2Q2QA 3OSPA 2I1LA 4CMCA 4E5NA 5DX8A 4RK7A 2YRWA 2E3JA 2DU8A 1BO6A 4NIMA 3KK0A 2H4HA 4AP5A 2GBIA 3A1WA 2Y0DA 3B70A 1SB9A 3REOA 1FW6A 5ALIA 3TD2A 3M8KA 5KT3A 3F3YA 4NCAA 3DAAA 2J59A 3HXPA 4I99A 4PBTA 4QLOA 2XVMA 2IA6A 5GGXA 3TL2A 3ZV7A 3IQDB 1SC1A 4EEQA 5KX5B 1ODJA 4OLJA 4ERNA 4O8CA 3R6TA 1XKXA 2F4VB 4FN5A 3RJ9A 5EXDA 4RSRA 1HQKA 3I0ZA 2OENG 1FP1D 5KKAA 1VHDA 1ZSNA 3BSWA 3LUKA 4DBLE 3LFUA 5DGHA 9LDBA 3IO3A 4CT4B 3C6MA 1ECLA 5FNVF 3P9CA 4EYEA 1IBRA 4ATNA 2AI2A 1CR0A 4GM4A 1GQYA 2ZUDA 4IIJA 3GHYA 3I32A 1T3ZA 1Y6FA 3AVUA 3IJPA 3QVMA 4FDAA 1ILWA 3VR1A 1IY8A 4HDNA 5D3MA 4P4SB 2XDAA 3RRMA 1CR6A 3F74A 1CRWG 2VHTA 4Y7DA 3LE8A 2Q1XA 1O77A 2FFBA 4R1MA 3I4MG 5L45A 3OF3A 4BVLA 4G0YA 3VR2A 4F92B 1MP0A 3K4HA 1HY3A 2GXSA 1UPFA 2EZ9A 3S1AB 3KAPA 1V9LA 1R6TA 3C5EA 1JA9A 2AFVA 1EWYA 5F3DA 2UXBB 5FLMG 3KOOA 4OOFA 5LFAA 2UZIR 4RPJA 1RYBA 5DQIA 5CB4B 3NHPA 3HXOA 3ZU3A 1D04A 4UNNA 3H5AA 3BQ9A 4R41A 2XODA 2PMEA 2IHBA 4KFCA 4DRXB 4UHEA 2EW1A 1AUOA 3B9PA 5FL7A 3B5JA 2GTIA 3QF7A 3LT1A 3L1JA 2ZM6H 3FSJX 4Y3UA 2IHYA 4DUYH 1SO8A 1GQ2A 1YT5A 3N8KA 4QYIA 1PLKA 4KGZA 3QOXA 5I7EA 3PE3A 3PZRA 2IY9A 5FXMA 5KCZA 4YI5A 1YR6A 3AU9A 4HWGA 3RBVA 3IUBA 1GN8A 2OHIA 5KJ6A 1O0SA 5H9WA 2WG2A 3IOBA 3QPCA 4YRTA 3UUFA 1XTRA 4QDUA 4HLCA 1RYYA 4CR6A 4NV0A 3ULKA 4JVMA 4JSYA 4GC5A 3W4IA 1NVDA 1EFUA 4D46A 3BK1A 4HOYA 3WKCA 1WRVA 2FX3A 2AFHE 4JLWA 4GBMA 4MUJA 4E2ZA 1TT5A 1UEIA 1Q0SA 3Q8RB 2P75A 4AKSA 3QPVA 5HKLA 4J0EA 4CJXA 3OURA 5HHTA 4PFKA 4PAOA 4WQMA 1JHYA 4MWSA 3DL4A 2ZAIA 3DUFB 4PQGA 4Y9RA 5A2GA 4ZA2A 1QOQB 1Z56C 3CEHA 3MR3A 4Q9NA 1UMKA 2BGUA 3VU9B 3Q7TA 3A14A 2XXJA 1PJ4A 1BFUA 4JLSA 2ZSJA 1DAAA 2QNRA 3GZNB 2IZ6A 1Q0TA 2CLKB 3D7MA 1WIWA 3Q7RA 3L0SA 1L5OA 1ZNWA 1HQCA 1W34A 3NHKA 5DYIA 4XDHA 1RMYA 2WB1A 2ZDGA 1AKMA 2BRUC 3GLFB 2IYYA 1J9GA 1D5CA 3HPRA 1SUFA 3U4IA 3H1BA 2G25A 5DRYA 5A3SA 2AOUA 3HG7A 3R4CA 2DPJA 2UZ1B 3KNZA 4OX9B 2Z8YA 4UTZA 3TPCA 4D2IA 3AVPA 1Y80A 1NYQA 4LZAA 2E6UX 3UH1A 3G2MA 1DRVA 2WJIA 1WQ4A 4D6XA 3SNHA 3H1FA 3S1SA 1S2NA 3HMQA 3HNOA 5I9IA 1P1CA 4WEOA 5JZMA 1CF4A 2X8LA 1T0BA 4PG7A 3IR7A 4KXFB 2V9WA 4YR7A 5J4VA 2DFKB 1CJTC 3WGTA 2YCHA 1Y4DE 1J2RA 3IAS6 2C2WA 2HMWA 1EG7A 4MS1A 3VR3A 3IULA 3A9VA 2Z6UA 3OWHA 5LOVF 1HE8B 1H8HD 2QMQA 1ZCBA 2GJ9A 1ZQ9A 1TRKA 4XWAA 5CM0A 4G01B 3C3WA 5EEHA 4EDHA 1O94A 1JEQB 4MVXA 5M34A 4O3MA 4R9UC 1O0BA 2W2LA 1TB4A 4OHOA 4MR8B 1EA7A 3K2QA 4I4IA 3D1LA 1GPLA 4F2DA 1OVGA 2WUEA 2QMEA 3KTAB 1CQIA 2A9RA 4Q1EA 1PO7A 4KIJA 5LQNA 1G64A 2J45A 4Q05A 4INOA 4WY8A 4PLTA 2BFMA 2HYDA 4MDEA 2C3MA 1OASA 4BQRA 3P2YA 4C0QC 1RC0A 1C4OA 1J8QA 1XTIA 2X6RA 4B4DA 1FFEA 4RUKA 5HOEA 5LXTB 2VUUA 4H1HA 4TS1A 3ETCA 1XROA 3E1SA 2M1ZA 2CB0A 2H57A 2ZPTX 3G0GA 1PNTA 2VAXA 5LM3A 4II3A 4JOCA 4DSOA 3A31A 2ZU6A 3MFIA 4K05A 4ALKA 3MCAA 5IM5A 3W5HA 1M9NA 3IQGX 5LB2A 1K97A 1OPRA 4RTPA 1SQ0A 3RIHA 5HEKA 1H8EA 1W52X 1UKVY 3NVAA 2VUMA 3QX9A 3I6YA 1N48A 5FTJA 4PX3A 5REQB 4G63A 1S5PA 1U81A 3V6KA 1POWA 4XLTA 1PJ8A 4PLWA 3PHLA 1BDBA 5IT5A 4JYCA 4L6AA 4ZQHA 4KXVA 3PICA 1W36C 5FLYA 2AJLI 1DL5A 4IAJA 1IDN1 1IBSA 3INYA 1FTSA 3D0KA 3HHEA 1EI9A 5BV2P 3B48A 1T13A 3QKWA 1KKLA 3I9MA 4BLTA 1C3LA 3DCYA 2B69A 5JNUA 5L1JA 4JKOA 4MPDA 2CNKA 5LD2B 3HDVA 3OTOH 1ZM9A 2XUPA 1T25A 2B2NA 3GVCA 2QGNA 4J43A 4L9SA 3PL1A 2LDBA 4O2LA 3LT4A 5LCXA 1MNQA 1ZCJA 3ZQ6A 2WIJA 4OJNA 4BLQA 1M2GA 5UKDA 3Q87B 4I1YA 1JJAA 2C97A 4IRMA 2YNMA 3CLHA 1H5UA 2C2OA 3L0BA 3OT5A 2A9FA 3SKYA 4PO8A 4OJQA 3T6KA 2R9VA 1R9NA 1NBIA 1U2ZA 1G21B 5GZ1A 5LNK6 2ZSKA 2W6QA 3KJFA 3E5MA 4ECAA 5KTYA 1O3YA 5T41A 1KZYC 1GP2A 4GPD1 2WA2A 2EATA 3BJMA 5AVVA 4GNRA 1VIVA 4WLOA 2O7VA 4P2GA 2IXFA 4QTTB 4Y2TA 4PYJA 1HWYA 3GLIA 3TUIC 2HVRA 1KO5A 3OQVA 1NP7A 4ZCSA 1PEKE 3RAJA 2F43B 1SHJA 3ZXXA 4PTLA 3LP5A 3WLEA 3AIKA 2ADFA 2FF5A 3AI2A 2GCGA 4BFCA 5KKCA 4BE7B 3RQSA 1AV7A 1RLTA 3UO8B 4L6CA 1QGDA 2H9IA 3VU0A 3ZHZA 3D8TA 3RB8A 2UVVA 5D5QA 2GB4A 4IZ6A 4H1UA 2XIJA 4L57A 4BQEA 4RETA 5F7JA 3HP1A 1RVV1 3ODGA 1YQEA 2HSZA 2CFTA 2IOQA 2GCOA 1NDHA 3PUHA 5D8DA 2Q5QA 2I54A 1XQVA 4UBMA 5LBIA 3E18A 2AW5A 3HU3A 1PHPA 4WZBA 1DRKA 4V3CA 5DM0A 2ODEA 1NKVA 3P9KA 1CLEA 3IHKA 4BOYA 4RACA 3LWBA 5IJXA 3VR0A 4R40A 2HA6A 3DNFA 4N54A 1F7VA 3EW7A 3FDIA 3TPFA 2OC4A 2FK8A 1H66A 4CR8A 1AC5A 1U9IC 2VNSA 3N43B 2ZYWX 5CDYA 3I42A 4IG9A 1QAOA 3RGZA 4A73A 4YUXA 2IYAA 4MMXB 1QHGA 1T8YA 3TO5A 3I5UA 1SG6A 3IELA 3PEUA 4D1YA 4D43A 5JC8A 4J4TA 3SJBA 3R6DA 3SC2B 2QAJA 5CNKA 4QXAA 5IXSA 2JEIA 2X8BA 5CT6A 2QT1A 1OOEA 4C3UA 3Q8PB 2XX3A 5KFMA 4HWRA 4OH7A 6REQA 2YZKA 1U2RA 4RESA 4KNYA 1MX3A 2I66A 1E6LA 1QZTA 4WESB 2BGGA 2W2XA 3T95A 1ZN9A 3R5TA 5IJ0B 1AN9A 2LP4Y 2Z4SA 2N1BA 1SBZA 1OWPA 4KQFA 1MZVA 5EIOA 1NPTO 1YRBA 3BFKA 1OLSB 1JWLA 2DPGA 4OAPA 4S1OA 5JAIA 5JCJD 1K7YA 3V8EA 5KHLB 4ZANA 2IHZA 5BSMA 2PTHA 3GRVA 5DBOA 1M5TA 1XTSA 1ECGA 4ZZ3A 5D1HA 4A2PA 5CB8A 2J6SA 4H18A 3QLUA 2GBPA 2XCIA 5C5IA 1NNLA 4H31A 1GL9B 3I01A 3VX4A 4BAZA 3WWCA 1P45A 2WJJA 2DTDA 1CQJB 3B20A 5HGXA 1ZS9A 3PE4A 1ONSA 2D54A 1A2OA 4CI9A 2FHPA 1WXDA 3TMYA 2BKLA 2QRHA 3IHWA 1GJRA 3ZZ0A 2ZI9A 3M83A 4F3TA 2QMUA 4HAXA 4RNOA 3OOSA 3TFOA 1G5IA 4Q19A 3DKKA 4I66A 3K6JA 3DWGA 2W7OA 2Q1TA 5BSWA 4C08A 4WBXC 1O58A 1OBFO 4AP9A 4EVSA 2JJ1D 2WKRA 1CQWA 2ABWA 4BWYA 3ZE8A 3KPVA 2VPWA 2PH5A 2DXIA 2G8LA 3U6KA 1JEAA 2E4WA 4AI6A 3TGLA 2ZIAA 2IZ1A 3RV4A 2CXSA 1DXOA 3E7PA 3A8TA 4M22A 4BZXA 4Q37A 5GQSA 2AKAB 1NR1A 2WSBA 3U4QA 3EXHC 2QTVA 4FC6A 3T0IA 1CFZA 3SBDA 5JD4A 1QB7A 3J7AC 5DSTA 2FV8A 5KWEA 1G3IA 2GZHA 1JDJA 4LYGA 5TX7A 4A2CA 4LISA 1HE5A 1Z6GA 1DUIA 4ZRMA 3S28A 1JE0A 2O5EA 4HZUB 2Q4TA 1B1AA 2VP0A 5IASA 1CNMA 3PF9A 4ECQA 5GOTA 2FN4A 4KO2S 1Y1WA 2G71A 3PD1A 4CUKA 1U8EA 2HA7A 4NNPA 2QNIA 3AJDA 1T1RA 5BWRA 5H82A 2E87A 1MJGA 4JQYA 4EP1A 4X1IB 4FYHA 3PT9A 4FT4A 3U6BA 3WBFA 4LBVA 2BZ1A 3PEEA 2JJ2A 4Q1DA 2WHRA 2QOEA 2QR5A 2PMBA 1H0SA 3NIBA 1O96B 2W83A 3UMSA 4IUDS 4QKQA 1C0KA 4UTNA 2WMNB 2LKDA 1KJZA 4PYMA 3QUAA 5EJ9A 1AGPA 1FQOA 1VYVA 3TIVA 3M6VA 4GYWA 4QJFA 4RVGA 4OCZA 4MGZR 3OZEA 3X0DA 5LP1A 1QMGA 3U4CA 3W5BA 2Z9BA 4FGLA 3GN1A 4JWTA 2XUZA 4HN2A 4TXNA 3MRTA 2YV4A 2XSZD 3QBDA 1GWNA 2ZS8A 4JV1A 5CDFE 2DMRA 1D6MA 1IDOA 4CTOA 4PHTA 3OOHA 1RDFA 2ORED 4MRSA 4A36A 1Y33E 3CLTC 1HMPA 1M83A 3FYDA 4OD0A 4POAA 2HMVA 4DXAA 2QMYA 3MXOA 3SKXA 5AD1A 2VDNB 3GRUA 2RBEA 1FW8A 3P94A 4K9KA 3TTUA 4F85A 3QY9A 4RW0A 1E3TA 4TLLB 4OM7A 3OD1A 1NBEA 3NTLA 3AKCA 4JQSA 3ZD8A 3WMEA 3GZJA 1W49A 2I80A 1UZUA 4AZ0A 4L3VA 3CKYA 2V98A 3ZU2A 3WGMA 2AQIA 1YCHA 2GHQA 3GRZA 4GOOD 3JQ8B 1EKFA 2C9DA 4MWEA 3BB3A 2MYUA 4I1IA 5BOVA 4GO1A 4JELA 1GA1A 3KXDA 3Q0TA 3EDYA 3NT5A 2EWVA 1J25A 3AF6A 2VH5R 2WT4A 2A9VA 1ZJZA 3N2LA 4ZJPA 4L5JA 6YASA 2BF7A 5IT9A 5CVDA 2X5KO 4KUGA 2P8JA 3UHFA 2UKDA 2CXUA 1GTSA 3H4BA 4K9MA 1DXYA 4DIMA 1T2UA 1TQDA 2N75A 4RVNA 1J49A 3FTPA 1JU9A 4I46A 3VPSA 1VFNA 1JBQA 4AKHA 4V0MA 3ABIA 1T3HA 3FPFA 3UYKA 2XE8A 2ZRQA 4K6HA 1KMHB 5KFZA 2QXYA 3W1WA 2HCBA 1DDGA 3AM5A 3CJTA 4ZAFA 4LF7B 2WWFA 3A6DA 2DEUA 3QNUA 3QI7A 4C6HA 2FPGA 4UEWA 3R1IA 5I51A 4KVAA 3STXA 4Y6SA 5IJAA 3N2YA 1DQYA 4X8HA 3P4UA 3DBVO 1D6SA 2Z5FA 1H3EA 1B00A 2R5FA 1Q1ZA 1K6IA 3OMXA 4F4IA 5CAEA 3GJ5A 1KDVA 3KDSE 4XR4A 3R2JA 2JFQA 2IX3A 3IB6A 1ZR4A 1O75A 1G2IA 3HUUA 5E2IA 1LBHA 5FPRA 3FNQA 4MDYA 1NKTA 4NJOA 4PYLA 3PDUA 3H3VH 3LBNA 1PNOA 3G2OA 4CMHA 1AS0A 2QLJA 1XYVA 3OSZA 5CYPA 4HP8A 2R1VA 1RJ9A 1MVLA 5CVJA 4GYJA 1V51A 4IDEA 1K8RA 1GSAA 3HOVG 1CEXA 3FVQA 1YRLA 1ZGCA 3MT7A 4M8IA 4KUEA 1FCJA 3FCYA 1HL7A 3TB4A 3FUCA 4E5PA 3L1VA 4IUCS 1KAEA 1EXVA 1P5RA 3G9UA 4O1MA 3WL8A 3WAGA 3OLWA 2CLMB 3LQSA 1T0JB 2IXDA 2R85A 1Q50A 1DAFA 3TIFA 4BJ1A 4PIPA 3BA9A 3ETJA 4X64B 4OM8A 2NU8B 4YFYA 3ZCQA 4KLZA 5DTJA 4O4JB 3WGOA 3C24A 4MOWA 3DEIA 3ZDQA 1YHNA 3DEZA 2I1WA 3ZWAA 2FGJA 1A9OA 1Y7HA 4BLPA 2AS0A 4IDOA 4K9NA 4B32A 2O8EA 1E6CA 4KN5A 3OBBA 1LZKA 4NZZA 3C6XA 3TEMA 5AI0A 2O8FA 1XAHA 3V5NA 1UJBA 1D2CA 2B3DA 2B2XA 4P35A 2B7CA 1QIJA 4H3HB 3Q1LA 2ROQA 1QV7A 2A35A 4ASUD 2DGDA 4A1FA 1TL7C 1V43A 5JFGA 1LW6E 2ZZKA 2DABA 3GEPA 4BDSA 2GVNA 2PRKA 5EZ6B 3W8NA 1BW9A 1HTTA 4A0FA 4PW0A 4YRJA 3MWDA 5ERGB 2W4QA 3THWB 3SX0A 4G2TA 1VJRA 1KMNA 2OV4A 2ZXUA 4RFSA 3SK0A 3OWOA 1Z08A 1ADJA 2BJHA 4LZOA 4YX9A 4IQFA 4LCBA 4I1SA 3IUSA 3G7SA 4Y18A 1DKOA 4QDXA 2BCJQ 3N9IA 5EWLA 4A3CG 3GPCA 3DD1A 2BEWA 2AYZA 4AJOA 3H4VA 2DPIA 5B2EA 2I6FA 1V71A 3NU1A 1BJRE 3S2YA 1DAEA 4DL5A 4V24A 3NRCA 4XPIA 2YWXA 2JS7A 2YYAA 3PCTA 2I8LA 2KS6A 3ETNA 4LY6A 1BYIA 3TI9A 4M1OA 1Q84A 4LFBB 2OSBA 3I62A 2CCGA 2JBAB 3K2IA 1NJSA 2V7EA 4ZU3A 2FG7C 4LJ4A 4LOAA 2I7XA 3VI4B 2XXAA 1I7PA 2F62A 2OOSA 2P5TB 1PSZA 2XNHA 4YB8A 3H6KA 3LUFA 5K20A 2I78A 1SC9A 2JAUA 4E7PA 2VT6A 1KO4A 4S35A 4LJYA 4UEOA 3HCNA 4W7IA 1LFAA 3CWCA 3T99A 4RUCA 3MTDA 5TF4A 3KZKA 4PSKA 3OU6A 3SDSA 4C0AC 1E64A 2AHOA 3KTDA 2I4NA 4TKUB 2WUWE 2AKEA 3FOBA 2UUBB 5DWQA 5JG7A 2H2DA 4U0KA 4EHBA 4B3FX 3EZNA 1F20A 1V7QA 4BNZA 5KFTA 1YZGA 3BSYA 3BWYA 5CM8B 4GP9A 3GFOA 1NP6A 1HX7A 2NADA 2HNKA 1JU4A 1MJNA 3A6LA 1TAQA 3NUZA 4CN9A 5FJJA 4M1EA 3RVSA 3R9RA 4OQMA 2OAQ1 1R8SA 1LSOA 3UQYS 1QZZA 4G8JA 4B43A 1TYZA 1XCJA 3JRNA 4N3GA 2PUBA 4EKEA 1YJ5A 1T2VA 2PWAA 4DQLA 2P11A 4XARA 1JYSA 2XCTB 1O6FA 4RPLA 2O0LA 4AZWA 4D9MA 1N34H 2P68A 2FK3A 2I4OA 1D09A 1SXJB 2P2LA 1Q2UA 5AIAA 3NM4A 3TQ1A 3PPXA 2X3FA 4YJKA 2QORA 1JTVA 4GLFA 3W79A 1T8UA 5DLYA 5KFNA 4U3JB 3FE2A 3E22B 3O4JA 3I0MA 1EH5A 1AQJA 5C4MA 3M4NA 3KXYT 4MYHA 1EFRA 2HX1A 3LGSA 1HNZH 3H4MA 4OY3A 3TNDA 3LF1A 1EVYA 1V39A 3GPIA 5FULA 5BQXA 2D0DA 3BH6A 3IAM1 3HACA 5GY7A 2NU9A 4XRRA 2PD6A 1J70A 3JZMA 1IHPA 5HRUA 4BS9A 4Q16A 3OO1A 4D8VA 2DUMA 5KYVA 4L72A 2JARA 3A70A 3CF4A 2DR2A 3DZ8A 2PVPA 3QVGA 1NAIA 3GJXB 2CMKA 4Q44A 3LYUA 1TGVA 1ZHFA 3C8MA 2ABJA 1QP7A 4TVSA 3AINA 5M29A 1NLYA 1X6VA 5G0VA 1HDXA 3LC1O 3L4JA 2QLLA 5BQPA 4DS3A 1QORA 1NUAA 4B3SB 4PXSA 2APJA 4DLLA 1YVRA 3KOYA 4OLHA 1IZ8A 1HM5A 3TTVA 2FA9A 3K9LA 1L5VA 4D9GA 1YGYA 2XGMA 4JI2H 5F98A 2ZIXB 1W4LA 1O08A 3ILHA 3FIUA 3AR7A 4QEDA 4BN5A 3NBYB 1KI8A 4D6YA 3DDSA 1WXFA 2XMPA 2XNSA 1H2ZA 1OF1A 2CDNA 3B7GA