4MAMA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an adp analog, amp-cp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
373
structure length
373
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIAGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ADP analog, AMP-CP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 121
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4mamA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4mamA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mamA01
3TIGA 4ZI7F 1KUTA 4IHJF 2YWVA 3BSYA 2YRXA 4MV6A 2FPIB 1E4EA 5LP6F 2DZDA 4C5AA 2Z04A 3TW6A 2YS7A 3JRXA 1VKZA 1JDEA 4HNUA 2R7MA 3OUZA 1KEEA 3RFCA 2X0SA 4MV4A 1EZ1A 2HGSA 5LXTF 2R84A 3R5XA 2PBZA 4TV8F 2GLTA 1AUVA 3ETJA 3QFFA 2Z02A 4FU0A 3BG5A 4FFOA 1EUDB 4FE2A 1C30A 4XYLB 2R7NA 4HQ6A 2I87A 2DWCA 4YBZB 5GONF 5I47A 2R82A 4C5BA 4O86A 3SE7A 4EG0A 5HBRB 4GGMX 4DIMA 1IOWA 3Q1KA 3RV4A 4C5CA 3KREA 4IZOA 2NU6B 2OLSA 3TINA 5JH7F 3MWDA 4MA5A 1GSOA 2P0AA 4HR7A 5HV6A 4O83A 1PK8A 2W6OA 4QSHA 3N6RA 3MJFA 2V5AA 1PX2A 2W70A 5LYJF 3BSSA 4M9UA 5JVDF 2W71A 4EA7A 2I80A 1GSAA 3KALA 3AX6A 5D8DA 4YAJB 1GGOA 4Y8VB 3N8DA 1AUXA 1UC8A 2VQDA 2YZLA 4I4TF 3ORRA 4MV9A 3TQTA 2ZDQA 4ZHQF 1SCUB 5BMVF 1Z2OX 3UFXB 4MV8A 3LP8A 4ZOLF 1IOVA 1ULZA 3VPDA 4I55F 1I7NA 1EUCB 2ZDGA 4O7SA 5JQGF 3ETHA 4MV1A 1EHIA 2C00A 2XD4A 3G8CA 2NUAB 2DIKA 4I50F 5J2TF 4XZ3B 5K2MA 3WO0A 3RUPA 2FB9A 5KX5F 3I12A 2YYAA 3JZIA 1W93A 1A9XA 2R85A 3DF7A 2W6PA 1W96A 2W6NA 1CQIB 1Z2NX 5CAEB 3AW8A 3U55A 4FGRA 3HB9A 2FPPB 2CZGA 3Q2OA 1C3OA 3R5HA 2QK4A 5BPFA 4XYMB 4ZQIA 1JLLB 2YRWA 1DV2A 2J9GA 2XCLA 4WD3A 2W6MA 2WYOA 3G8DA 2NU7B 1JKJB 2VR1A 3BSWA 3JRWA 2YS6A 2NPOA 2FPGB 3K5HA 3HBLA 5C1PA 3ORQA 4YJ3F 4HNVA 5JQWA 1OBGA 4MV3A 5CA0F 1BNCA 1B6SA 5IYZF 2R6FA 3BFPA 4MA0A 4EA8A 4O7VA 3VPCA 5C8YF 4TUYF 3K5IA 1M0TA 4O7YA 4O7NA 2HJWA 2CNVA 2GPWA 5BPHA 4O2AF 4O84A 4EAAA 2V58A 2YZMA 4O7TA 3KAJA 4O2BF 2GPSA 4IWXA 4E4TA 5JVLA 1KBLA 1DIKA 4EGJA 2YZGA 3E5NA 1Z2PX 3NUAA 3K3PA 3MWEA 2R7KA 5H80A 5LA6F 5J2UF 4EA9A 4EABA 3VOTA 3GLKA 1VBGA 3GIDA 4MV7A 4YAKB 4IWYA 4YJ2F 4O82A 3LWBA 2NU8B 2W6ZA 4XX0B 4M9CA 1M6VA 2IP4A 4TV9F 1A48A 1CQJB 4FFNA 1UC9A 1M0WA 2SCUB 1WR2A 2R87A 2CNQA 2R86A 1KJ8A 2CQYA 4O7RA 2FP4B 4M99A 1KJ9A 4FFLA 1VBHA 4WBNF 2QF7A 3VMMA 3WNZA 3JZFA 2YZNA 1OBDA 3RV3A 1CE8A 2R7LA 5EZYF 4L1KA 1JDBB 3U9SA 4HNTA 2VHEA 1E4EB 3R5FA 4O4LF 1KC7A 3V4SA 2CNUA 2PN1A 4ME6A 4NYEA 3OUUA 2GQRA 3TIIA 2DLNA 2V59A 1T36A 4FFMA 4FFRA 2I8CA 5LOVF 3KAKA 4O7WA 1EYZA 4O4JF 5CB4F 1KJIA 4O7LA 4M98A 1I7LA 2VPQA 1KJJA 5KKNB 2YW2A 3U9TA 2ZDHA 1GLVA 4O81A 2YL2A 1DV1A 3V4ZA 3R9RA 4RZQA 4DLKA 4O7ZA 1GSHA 1KJQA 4EGQA 2NU9B 3HO8A 1B6RA 3R23A 3WO1A 4IIJF 4FFPA 4MAMA 5C1OA 4O4IF 1CS0A 5FNVF 5CA1F 4J6EA 2GQSA 4YB8B 2PVPA 4O4HF 2W6QA 3U54A 3VPBA 1BXRA 3VA7A 5DMXA
chains in the Genus database with same CATH superfamily
2XTNA 4GW3A 3V2IA 4P4SB 3TD6A 1KUTA 5COQA 4D3FA 2XVXA 3HM9A 4DIDA 3HOXG 2FR0A 1FKAH 3RRJA 5HQ3A 1RMTA 3QXHA 4E09A 3CJQA 5EMNA 3BQ9A 4V02A 4TS1A 2FV8A 3MS7A 5NULA 4YCCA 2DZDA 1XDNA 1SHZA 4G0YA 1KVTA 1U8UA 4FHDA 1JHYA 3QYAA 5HOQA 2BGUA 4IMPA 1NQVA 2DXIA 2GD6A 4URHA 4GOOD 1QB8A 2A6PA 1NMYA 2ZQYA 1WAMA 4LZZA 4R98A 3RJZA 5HUQA 2JA6A 4RTQA 1DOAA 3TZBA 4K8RB 1YTUA 3TW8A 2UVWA 3NETA 3HKZA 3N2YA 4G84A 2FQXA 1JQKA 5KT3A 4JX8A 3V1LA 1AT1A 2CXSA 3MERA 5K3AA 3CJRA 1YZFA 2ZJ3A 1A2QA 2FYTA 3LPMA 3C3EA 1KZ9A 2Q2UA 1I2BA 4F4CA 4EK9A 3JQFC 5KNDD 1EA7A 4LXTA 4FX5A 2IYNA 5ALQA 2F8LA 3K0CC 4FYPA 3NO4A 4BP1A 5CDSA 2C3YA 1F6BA 3H1EA 4JMLA 1H9CA 1U99A 3BKWA 4L72A 5GV7A 2XZDA 2R68A 4RVDA 1J5EB 4ENRA 3RB6A 1J1ZA 3MTAA 2CVPA 2XGPA 4LJKA 5E9AA 1AQYA 4NFHA 1XNJA 2AI3A 4HB3A 5DG9A 1M1UA 4N18A 4I7HA 2W8KA 4PF1A 3HLTA 1JQBA 4EYSA 4LF8B 3TQQA 1S3IA 3ZIAA 5B1EA 4ZVSA 3OTOH 1T9GR 2V6BA 2B3TA 3CYFA 5ITZB 2CEKA 2YHBA 3QFHA 4QELA 5EP4A 1VL0A 3CM0A 4MTDA 4KO8A 5K8IA 4LGMA 2C7OA 4NZZA 1F3LA 3LA8A 2WJ6A 4DV0B 3NNDA 4ZREA 3H8SA 3WLPA 5GONF 5LR6A 1QP4A 4G9EA 1K7FB 3PA6A 2WOJA 5EERA 2ZM6H 1IU9A 3BTVA 2WT4A 1DAPA 2GMWA 1FXUA 1YRYE 3NIFB 4X71A 2JIOA 3ZKAA 3NDRA 1Y1VG 4PCVA 2JLVA 4ECWA 2PX0A 3BWBA 3E3MA 2Q3EA 4G1VA 4HAUA 1FBNA 2BEUB 3HS3A 1MX5A 1I2DA 2J6CA 2FMIA 3BF8A 4MV5A 1OLOA 2BEKA 1BEZA 1BS9A 1S8OA 1K8ZB 3RC1A 3HI6A 4JC0A 3N2GB 5DXJA 3ZX5A 5JNVA 5CXXA 3ADPA 2JJ2D 3TLYA 1IN4A 5DX1A 3O75A 5DT9A 1VBFA 3IN5A 5K0ZA 4AO8A 2PV0A 4QBTA 4MROA 4RCNA 2OLSA 3NTVA 1P18A 4P36A 5HA5A 3EGVA 4N4AA 2GCGA 4OHMA 1YDMA 2C1EA 1OBCA 2M98A 1M54A 2ASLA 4PG5A 4OP1A 4YMIA 5HV6A 4MVJH 1PK8A 1R4MA 4H17A 2DB3A 2RAVA 3PC3A 3UK2A 3N6RA 5DHUA 1VCMA 2O0KA 1ESNA 3ZWWA 1CIVA 2ZS7A 3FPJA 5JPIA 2ZJ0A 1CB7A 2M2IA 3VO2A 3EZ7A 3KEMA 4PY2A 1PG0A 2EFEB 2IGBA 3HL0A 3PLAE 2X5XA 5AO9A 3I3OA 2PYZA 2WDPA 3X2SA 2HDKA 2W71A 1O97D 1JQLB 2GAIA 3L9WA 3FOWA 4S1VA 4F0JA 2PMFA 2ZSDA 3ID6C 3AIMA 4OA8A 1QMGA 4YV1A 2Y71A 4JAVC 3BMNB 1GCIA 3HSSA 2ARKA 3AZOA 3E9RA 4RL6A 5FBZA 3WL8A 4F9GA 5AI8A 3CRNA 3LC2O 1FA9A 4EFNA 1QZTA 1J8YF 3DMNA 2BEWB 2MSCB 3EFOA 4YRGA 4M7WA 1LLCA 3ORFA 2P9HA 3ZKWB 2E5LB 5I9BA 2QRZA 2NYVA 1DCMA 4ED9A 3ZDBA 2YDYA 4QDXA 1Y4DE 4PLWA 2HDWA 4QG7A 2N9UA 4MINA 4MQEA 1QJ4A 4F60A 1R4NA 5KC8A 4Z53A 4MV8A 4Z0NA 3EZFA 1L5SA 3L77A 2H5IA 1RHQA 4NYJQ 4XAQA 4Z4GA 4MVXA 1AKWA 2YWCA 3DKKA 2WHPB 4TX1A 2P8SA 3GQCA 5DWVA 2CVHA 1IOVA 3SZUA 1EFPA 3LPNA 1SGWA 3B1FA 4GEGA 1ORHA 1EUCB 2ZDGA 3IKJA 4DMRA 3WBKA 2H00A 2PJUA 2XUPA 4AJ1A 3AWIA 3V2GA 3BJYA 3TS1A 1UPAA 2BAGA 2XQIA 5CM9C 5IJ9A 4DR6H 2B20A 3K5WA 4JJIA 3LQSA 1CSEE 3VX4A 2VXYA 2IS1A 1L8LA 1PDWA 3FAKA 5TPWA 2OUIA 2XGJA 3DGEC 4WRRA 2GR9A 2HGZA 1TU3A 1R0SA 1OFIA 1V7CA 4CMIB 4DJDC 3AG6A 4MWTA 1R0XA 1J8FA 4UEWA 2C84A 3L7LA 5E8JA 1Y82A 3UMGA 4BZXA 2OGTA 4G4IA 5AICA 3GLIA 3IAEA 4J03A 4KYTA 5HDQA 1YDEA 5KHOC 2DUUA 4EFMA 3AP2A 4CL0A 3CFYA 4ZC1A 2HMTA 4RS4A 2XX3A 3RI3A 4N8EA 4BB5A 5KFCA 4IDCA 1LDNA 4P3XA 4RPKA 3JSNA 1ZMXA 5J4KA 4M9QA 4DA6A 4AN0A 1PV4A 1RXEA 2AJ8A 1NAHA 4KQIA 4DCPA 2ZP1A 4NAHA 2XKAA 4ED1A 2R5FA 3MJHA 2PRZA 4NAVA 4RADA 4C07A 5BUQA 3QU9A 3OM0A 2XKJE 3OMLA 3TLCA 4UM7A 4WV3A 2E4WA 3P27A 1EBUA 4J0JA 1I1NA 3GFRA 2Q0SA 1C41A 2Q2NA 4B2PA 5CAEB 2B8NA 3U3RA 5JFGA 2XQVA 1E7WA 1WNFA 3JSAA 3E27A 3OP1A 4M87A 1P2GA 4PPQA 4U7HA 1WUTA 3EPPA 5SICE 5REQA 4EI9A 4OL9A 4WTOA 1TLLA 4K2AA 1JDSA 3BQMB 4B0OA 1LDEA 1LW7A 1X8LA 4WFIA 4LFAB 1XALA 1ZUHA 1PRYA 1ICEA 3ZS9A 1G38A 1HLDA 3PQ6A 4KXLA 2GO1A 5HIIA 4BFUA 3GPLA 1DV2A 5B3LA 3BFJA 3VRHA 1JP7A 3G02A 3K92A 5I8PA 4HWRA 4PZPA 4WKGA 2EZ9A 4QJIA 2VVTA 2WVHA 2I5PO 4LJ5A 5IJXA 3ST7A 2J3QA 3GC6A 3G5AA 1C4KA 5GJBA 1H3FA 1O8BA 4Z99A 1AS3A 4CTMA 3IT3A 2VP6A 5EJ8A 2OWDA 3AKCA 2ODPA 5EJIA 2TS1A 1ISJA 3C1TA 1K06A 3RR5A 2Z1NA 2C9CA 1C7EA 3H87A 2XCOA 1IZYA 2C5EA 4KKXB 2PNJA 1ZN8A 2BEJA 3QI2A 4HS4A 4CT5A 2SKDA 3MOGA 1BCSA 1DX9A 3LGSA 2Z57A 5AI6A 3H1GA 5KG1A 4RJKA 1QZUA 2AWOA 4GPD1 2I3AA 2OO5C 1UWLA 1N33H 3B2QA 1J39A 5ERXA 3RRZA 3RT1A 4INPA 4NENA 5G41A 3QPAA 4A0FA 4IH9A 2RHHA 2ZJYA 5LCXA 1L2TA 5ABPA 5FI5A 1UOEA 3TTWA 2C5SA 3ZJYA 4RB0A 2J4DA 5DXAA 3MGKA 3OQVA 4CIXA 2DRIA 4HO1X 4DARA 5JQWA 1IDN1 1JZSA 1OBGA 2JBHA 4XYGA 3D1JA 5JDCC 1KEKA 1DAGA 1N9KA 2O2SA 3QFTA 4ZVMA 2AJTA 3F4KA 3MLAA 3GB8B 5FBHA 1CY7A 2CDAA 1MTZA 1WTCA 2QX9A 2ZOSA 1O03A 4LXQA 4X6LA 5ERYA 4AJEA 4C89A 2F64A 3MPUA 4OVKA 3WLOA 4MA0A 1TXGA 1EGQA 4ZHQB 2PMZA 3EDMA 3IALA 3OHPA 2HTFA 2KLBA 2Z2KA 1DI0A 2PCLA 3GCWA 2X0NA 2WAQA 1CPYA 1UJNA 3DAHA 4H7IA 1NYQA 5EE0A 1MIOB 2QRQA 3PW2A 4B3MH 3AXTA 2ZSJA 2PS1A 4RACA 4IXNA 3DVSX 1P1HA 2YMMA 1MC8A 3KT8A 4RVUA 2V65A 3PE3A 3KAQA 4D9KA 2QVZX 1HSZA 4HB4A 4IKPA 4DLAA 1V11B 4E11A 4M3NA 3U19A 1LK5A 3J81A 4AUNA 3FSEA 3NXSA 4O3MA 3P94A 1M2GA 3GG2A 3QYFA 1MD9A 4XCQA 1EGHA 3NAQA 3C3MA 2YZMA 2CFTA 4QLOA 2IHTA 3PS9A 3WGHA 1CVIA 3HSKA 1JHDA 2YXEA 1E1KA 5C34B 1UXKA 2HO4A 2Z1MA 1ZCBA 1DKRA 2RK6A 4GMKA 4U2KA 3VNBA 3QLTA 3COPA 1J2UA 3HR4A 1Y8QA 2WD7B 1T0UA 2PS0A 1ZNYA 1XNQH 1R0LA 3C7TA 1S1MA 4DILA 4LRXA 3T5TA 4KPYA 3HHEA 1XPRA 1E1QA 3H5TA 2JLXA 2JGIA 3TZ6A 3ZV6A 1UAGA 2ORVA 4S24A 3TGWA 1PFKA 1L7QA 3IPAA 1FQOA 2ZTSA 3VKFA 1YJBA 3VZCA 3I5MA 4JXKA 4A82A 5IPFA 1U1IA 5LQKA 3SR4A 4PZ8A 5LD2C 4FT2A 5IDXA 3PNYA 1KBZA 3M1YA 5AMXA 2LXNA 5DTMA 2RGXA 2QM8A 3ECAA 4YAKB 3OCYA 4E32A 5TDHA 2W9CA 4DR7H 2GCIA 2Z3VA 4CVNA 4QXQA 1JAXA 4MO2A 4ZYZA 5FPQA 9MHTA 3ELUA 4EBBA 4XX0B 1ZCAA 3N7AA 2F1HA 2OAEA 3LXMA 3OWHA 2P79A 4ZYYA 4OI2A 1RC0A 2K5UA 1M2OA 4FFNA 1UC9A 4UDXX 4O4LB 1UAAA 1E64A 2KHZA 1G59A 2OYSA 5F12A 4EY3A 3HVUA 3BHMA 1U98A 2HCJB 1SEVA 3HJTA 5AP9A 1N4AA 1MRSA 3UAXA 5IC4A 4WH0A 2XIQA 1T4DA 1YS4A 3O1JC 2I67A 3LZCA 3MVEA 4Q66C 2RMKA 4OATA 1S9FA 3NVAA 4XIGS 3T34A 1OBOA 4D56A 1N6LA 1RXUA 1Z0KA 4FBMA 5JVDB 1H3EA 4BO8A 5IP9G 3LXUX 3EGXB 5DGTA 3BEOA 3T5AA 4BU1A 2PVCA 3EGDB 3DKVA 2ZYVX 3S1AB 4FSHA 2II6A 1THTA 2W2QA 3PEUA 4MYCA 4ISBA 2X1LA 3KSRA 1O77A 3KYDB 3UCXA 4I1IA 3DFUA 6CHYA 4LRUA 3DD5A 3EF0A 1I14A 5C5DA 5ILQA 1ZGBA 2GHTA 3BZUA 2PAFA 4IJUA 5CT8A 2ETVA 3TIVA 1CUEA 3JASB 5JW6A 1YA6A 5AUPB 1Z8FA 4B6FA 1RAFA 1Z3IX 2M1ZA 3DKRA 5JH7B 2CF6A 5B1IA 5JMOA 3DV0A 4HT3B 3L7AA 4KLAA 1M0EA 2Q6KA 1N33B 2D62A 3OTGA 3E48A 2B25A 3AUUA 5HE8A 3K9CA 2H0RA 3UZOA 1DC7A 2CJWB 3A9RA 4JR0A 4NJEB 5ER6A 3Q5EA 2XNDD 4F6RA 1H05A 4Q7JB 1UM9B 2OD9A 1P4AA 1PZFA 3AHFA 2FSPA 3ZHZA 1HFWA 1PJ3A 4FOPA 4QOJA 2LW7A 5LP6A 1T2DA 4MQ5A 4BC0A 2CLCX 5IWAH 1Z0UA 1I1QB 4NU0A 2CYBA 1DXHA 1BA2A 1W76A 1SUCA 4R2IA 3R7NA 4AB1A 4XQEA 1ZIDA 4A93G 1BCRA 1XZKA 1RTTA 2N1MA 2ONCA 3LT2A 5F2KA 2BJVA 2V59A 5IN5A 3F3SA 4YCBA 4TZKA 3OOYA 3WR5A 3K1ZA 3LDHA 1ONSA 3OX2A 1RJQA 4URUR 2G5GX 2P2NA 1AZWA 2XGQA 1N8SA 3PK0A 1LLQA 3UG7A 3UBTA 2AU0A 1JU4A 4EUEA 5LOVF 2ZRAA 1UDCA 1GZVA 2NVWA 5FBRB 3S2UA 5DGAA 4UNSA 1QYRA 2BR4A 4YV2A 3PFNA 3ZK8A 4B7ZA 1IHPA 1JN0A 2JZNA 1OGJA 2PKWA 2XRFA 5FI3A 1ACJA 4D8UA 3W9YA 4DV7H 3R7WA 3DTVD 4KPEC 3JAMA 2VNSA 3DQZA 1KSGA 3WLMA 4O7LA 1C9MA 2G67A 5B6PA 7GPBA 4KAFA 3PXAA 1EB8A 3W8NA 2WWYA 3BT7A 2YDXA 1Z0IA 3SBEA 4AJ4A 1YJCA 2HU8A 2QVCA 4KVGA 3LRXA 3GTMA 2IIQA 1PT9A 3AL3A 2O2GA 4FFVA 4PINA 4DQXA 1B42A 1EDDA 1DG9A 4KK4A 3OJWA 5CFNA 1BIFA 1EM8A 1N6OA 3ENWA 4EEKA 4A5SA 3CUEF 5I5XA 3UHAA 3N6VA 4DRZA 2XJ4A 3GAAA 1P29A 3RYTC 3RFFA 3GDFA 1P7YA 1H1LB 3HN7A 2K87A 4PPFA 4YQZA 4AMBA 1JDZA 2O52A 3GZNB 1FJ2A 2ZYIA 3DFFA 1JFVA 5DNEA 4EMSA 2I34A 4CTJA 2F62A 2H7YA 1YE3A 1H2EA 4Y7CA 5AVOA 3W1BA 1DGQA 4PG6A 1T29A 2BI8A 1UEJA 5I7SA 4DJFC 4RPCA 4CG0A 1U9CA 3A1NA 1B7GO 1LK0A 4F7DA 2J6UA 2HFKA 4IRCA 2QGNA 3RVBA 4JJKA 4TTJA 4EEYA 3V4VB 1BYUA 3SEQA 4LVNA 4UASA 2JS7A 2YWDA 1NW7A 1OTHA 2JGMA 3EEQA 2QI9F 4YGXB 2CFRA 2C3OA 2QSUA 1JBEA 1XG5A 4KPUB 4Z2AA 3ZDAA 4KWTA 1LW6E 4I8DA 1SQSA 2CDRA 2OV6A 5J4VA 2PWAA 2B2CA 3HL4A 4JLVA 5G4KA 3EVNA 3P1JA 1XRNA 1SC1A 1YH3A 3KPWA 4RCZA 1ZONA 4KE7A 4W8GA 1H1TA 1P1KA 2DQYA 2GZ3A 2HDNB 4OEHA 5D00A 3VAZA 4AP9A 3QU4A 1EFTA 3RYHA 1C3LA 2V9PA 5CLQA 5KCMA 4F6RB 4BQPA 3M6IA 1S0OA 1CK4A 4EB0A 1Z7GA 1VJRA 1O96A 3HB4X 4JB0A 3EAFA 2IEAA 2VEOA 3HN2A 3MBIA 2BE7A 1P1CA 4HWSA 4CGYA 4NH4A 3VKHA 4INJA 1ZNWA 4EMBA 3A4LA 1E2HA 1MIOA 3F7OA 5E6SA 1V35A 5JI2E 3EG9B 1YZLA 2R47A 4YASA 2ZCVA 4K86A 4MGIR 1V4BA 2FPKA 2IUEA 5FPOA 3JV7A 5CM0A 1U1CA 3IMCA 3LY9A 3UV6A 3X1KA 2HRZA 4BUJA 3C3WA 3LHIA 2ZYRA 1NULA 2QE7A 4JJGA 4B3GA 4V24A 3WQRA 2QMOA 3IT0A 2C04A 1P9RA 3FROA 3H5IA 5K8CA 4PX2A 1XQVA 1NI3A 3SQDA 1Y80A 1QYCA 2X15A 3A14A 3ROQA 4F8JA 1B0UA 5DLGA 2W2OA 3EXEA 2IH4A 2FWNA 2FOIA 5AUQA 4IZHA 4BFZA 3TR5A 2IS2A 3R5XA 1RVDA 3DAPA 3FFXA 3GMIA 4QNRA 4UTNA 2FWRA 3ORYA 4Q01A 3A9CA 3TO5A 2CMFA 4B3FX 4BLOA 3VYSB 1Z63A 3BZBA 3STTA 1DIHA 4HUQA 3PT5A 1E9CA 4IOJA 4DQLA 3JD1A 3PL5A 3RYHB 1NVEA 3TE7A 5FUQA 4XJXA 4B4KA 1EXNA 2PBLA 1AZTA 1OC2A 2G5TA 3BIXA 4TWJA 2PUFA 1TRHA 4IPTA 2ZVPX 3R0JA 5F7ZA 5EUBA 4FE2A 3WYBA 5F2NA 3G2KA 4PYMA 4BTLA 4XYLB 4F4WA 1RXIA 2P3LA 3QYJA 4K6KA 4M49A 1U0JA 1V47A 2R7NA 1WXXA 2B0JA 4RHFA 4EG1A 1SWWA 4ZZ0A 5KG4A 3ET5A 5KTKA 2ZFUA 2IZ1A 4ZFNA 3DLPX 3HCOA 5E8RA 4RNNA 4H0CA 3H9UA 3GV8B 4BB0A 2BFMA 4P5DA 3E9YA 2VP4A 3TRHA 1P72A 4YT4A 3RJMA 2X9QA 2WKSA 1XDWA 1QKIA 2ZIXB 4TXMA 4Y1GA 5FLXA 4XCVA 5IXJA 3IHKA 4RLFA 4PSDA 1U1GA 2AEJA 4HGNA 5EUQB 2Z8YM 2J9FA 2WAYA 3F6CA 4C0XA 2XBUA 2EFYA 3TCNA 1ZITA 1JSCA 3TQ1A 2IW3A 3L8ZA 1O97C 3AF0A 4C4YA 4DL5A 2C1ZA 4PQGA 4RXTA 4XD2A 3TR0A 1ADFA 1NQAO 2QT1A 2UVQA 2FNAA 3DOIA 1SHUX 5K0TA 1JFSA 4CKBB 4UHEA 3FOFC 2P4QA 3OECA 4FCCA 8ADHA 3KOOA 2VBFA 4TWRA 1WDMA 4L5AA 4RGYA 4TWBA 4K28A 5G0UA 4QPPA 3WNVA 5I9LA 1E6KA 5EGSA 1LC3A 4IJQA 4C21A 1ILEA 2VAMA 1L7RA 4LOAA 4Q0MA 1QZXA 1XZHA 1AMNA 4IDPA 3V33A 1GGEA 5GM2A 3SXJA 5DQGA 1WXFA 4OA5A 2VBCA 2AX3A 1YIOA 1SEIA 1J9GA 1GKKA 2VIIA 1S8FA 1JSLA 5CA1B 2Y27A 3GLIB 2RHWA 1ZD3A 4M76B 3F6RA 1E2MA 4ND3A 3VI3B 4L4UA 4N01A 2VDOB 1XQ9A 4GQIA 1V16B 4IFTA 4UU8A 2OFPA 5GP1A 3QTLA 5KDLA 3R7AA 1JEEA 5KFAA 1JZTA 3W2IA 4C3UA 5C2JB 2CV0A 4Q1VA 3OLWA 3ZJVA 1BVUA 4UBOA 3D3QA 1D6JA 3O8NA 2WFLA 4TROA 3JYLA 1JF8A 1KPGA 4TZTA 1VMDA 3P5BA 1CBUA 4ZO4A 4X0EA 1N75A 1ZSVA 1UFQA 5CLJA 4B3RB 2ZDQA 5ITSA 1U1FA 2J1LA 5HM6A 2RJNA 2ORWA 1SCUB 3LG2A 1I3CA 5CK4A 5JSYA 2MSLA 3UK0A 5IJAA 4DJTA 5DLPA 5AJYA 3R9WA 1IVYA 5BWBA 1AA6A 3MT9A 2CSUA 5C51B 3EAGA 3LIPA 4M37A 2NU9A 2J6BA 3D8NA 4RULA 1ULUA 2Q5FA 1QHHA 2FMFA 4LCBA 4NCHA 3S7ZA 1U7ZA 5E1MA 4AG5A 1C1XA 2VOEA 4IZIA 4CLOB 4DG8A 5C7YA 3VKGA 3GCDA 4LOKA 4QEZA 2WILA 1Q0QA 1GJRA 4KVFA 4U3JB 3T8YA 3MMPA 4RF5A 3SF8A 3ZWQA 3ZHTA 4C4SA 3MAJA 4YUWA 1HX7A 1GTZA 3WBBA 4XLTA 2EF1A 2XWPA 2V7WA 3E8MA 3P9YA 1GV1A 4OB7A 4LSGA 2VZLA 2VA2A 4HSEA 1DDGA 2Q5EA 3JASA 2XVYA 2J6HA 1JKFA 3LNCA 3F7TA 5ENDA 5ESRA 2JBWA 2NUPA 3QOFA 3FBTA 2ODTX 2BGMA 2H2GA 2ZSBA 3G8YA 2UZ0A 5BVGB 4DR5H 2C42A 4OJQA 2A58A 2XA1A 3TLEA 3ZWYA 4QOSA 2NUTB 1ADJA 2Y05A 4D9MA 4O3QA 4R9SA 1SPBS 3DMYA 1K7XB 2ASJA 1RRMA 3GNTA 3PTAA 4YUVA 1D9XA 5LQUA 2QUBA 2QV0A 3QF4B 2BPOA 4E5SA 5K3EA 3PEFA 2PFSA 3P9CA 1F0YA 3PGA1 3PHGA 5BYBA 2H08A 1Y14B 2Q62A 2YU9A 1XN1A 4JJ4A 4X6YA 3WGMA 5C8DA 3BIJA 4ED7A 3D6UA 4ZMBA 4N8DA 5GAJA 4BUCA 2ZU6A 3CBQA 4TSRA 5LZ7A 1DRKA 2H31A 3IB6A 3T1QA 1T3HA 3DBHA 3WK8A 1J9EA 1AHNA 4EFKA 1GU7A 4L3WA 3DF7A 5IP7G 4LZWA 2VJKA 3A11A 3W06A 4XJSA 3ORSA 1T2NA 3M81A 1TF5A 3ZHOA 4PQRA 3ZDCA 2ATEA 1Z2NX 4EUNA 2DOKA 3ZDDA 5FUBA 4OU5A 4CCAA 4KGXA 3OCWA 1J0BA 4Y1RB 4K8OA 2LP4Y 1UZLA 1QGOA 4YAKA 2SBTA 3ADBA 2UYOA 1C9YA 4FOOA 2A1UA 4YMTA 3VR5H 1MV8A 1W1IA 5CURA 3DA8A 1E2LA 1IXSB 5HZHA 2HYDA 4MUKA 3GPBA 2X5RA 4EQ5A 1FS6A 4NPAA 2DAPA 4WN3A 4BY7G 3OPXA 1X7XB 5CLLA 2ZRKA 1M2FA 3URKA 1S1CA 1O08A 3EBOA 5HOEA 5TMBA 4DWOA 1GPKA 2H9AA 3TLXA 1PT5A 3I6QA 2XUKA 1PE0A 5GJCA 5LZ4A 2GKSA 1FP2A 5CP8A 2ZW9A 1E58A 3L8YA 4MVJA 1AUOA 2QTFA 4WKPA 3W1WA 4F8EA 4GRDA 2BSQA 4EW1A 1CUXA 3AR3A 3WAJA 3OQ1A 1SZCA 4CE5A 3OU2A 3Q6NA 1PWYE 3OHMA 4HZIA 1KDYA 1SCAA 4QLBA 4XIJA 1I3LA 4OQFA 4ENUA 1T9CA 1ZKMA 2ENWA 3QE3A 4MQEB 4F2DA 1RYYA 5L4SA 5I7OA 1BYIA 1R9NA 3KTAA 4LQDA 3SQXA 1I3MA 2WB1E 2QQ0A 1Y6GA 3GUYA 3I1JA 3G6YA 4H0NA 3V8VA 1C50A 3H9GA 4PXYA 1Q1BA 3R0IA 3ZE7A 5TMPA 1QO0D 2E1PA 3KYHC 4IVNA 1JFRA 4CEIA 2OHJA 3CKLA 1ORWA 1WZIA 2QYZA 3GN1A 4OG2A 3BMNA 4JI3H 1YZQA 3BRSA 2HSWA 3FTCA 4Q1AA 4CF3A 3KV3O 1XMPA 5IANA 4X92A 1CZNA 2GBLA 4CMGA 1OB2A 1RWBA 2NM0A 5A6SA 2EJVA 4W9NC 2DKOA 1JU9A 2BTOA 3GJ7A 4EAQA 3OM9A 2QT0A 4XWKA 5C8YF 1G20A 1RPJA 3VJRA 4BO3A 1UK8A 3O4RA 4BAZA 3IHWA 1LSOA 1D4FA 3FUUA 2AFIE 2RIRA 2NZYA 2W7PA 2EYQA 3TDMA 1JFFB 2XKKA 3AHCA 3OM1A 1X7YB 4UZEA 1XYVA 3EA4A 3FUWA 2A94A 3G0BA 1CNMA 1C4WA 1KU6A 4WESB 3W0LB 5CCXA 3MFIA 1EG7A 5F1YA 2BHRA 4PLTA 1D6NA 4ZT2A 4D80A 1G42A 3M70A 1Z4LA 3F6YA 3F97A 1J0AA 4O2AF 2V58A 1E3DA 5T6BA 3KU1A 3FNRA 2HJVA 2I6QA 2JD1A 4MGHA 1JYEA 4MVJE 2YWRA 4RJIA 2ZRBA 2BI7A 3G8BA 1BJKA 3OH8A 5BQOA 5TF4A 2COEA 3L7MA 3GEHA 4M2LA 3TW4A 1G6OA 3IAHA 1X94A 3V4PB 5CH8A 3E35A 3N3AC 5IAKA 2AFRA 4RKEA 1T94A 5EXSA 3G2HA 5A5VA 4G24A 2AC7A 5DHQA 1K8YB 2YYZA 4G3IA 2COKA 1KVUA 2MSWA 3NATA 4NCIA 3RSFA 4D1YA 2F6RA 2NXWA 3DF9A 1M2WA 4RWEA 1XZAA 1IBKB 2KYRA 3OOJA 3M6WA 3OIVA 4TSFD 4U63A 4WOCA 5IAJA 2Q3LA 1YQGA 5IC6A 3VOTA 3ZV3A 4MDFA 1WXGA 4RTOA 3Q7QA 3ZDXB 2XXAA 2BMAA 5LIRA 1OZGA 3T61A 1BWRA 1OWPA 1Z82A 2EVWX 3D8BA 3NJRA 1ZD9A 2HRBA 4EI2A 1T25A 3BMQB 4RH3A 1USWA 4NEQA 3KKZA 4LC1A 4OOEA 4E6EA 2R92G 1W85B 1YVRA 4FNOA 2QMEA 3HBNA 3NBFA 1LCIA 4JELA 4UM8B 4IDBA 4H15A 2PWPA 3D5TA 4ECYA 4N82A 4K0KH 1U8XX 1E63A 1ST2A 3CNHA 1CQJB 4CV2A 3W5HA 2RI6A 3GWGA 3ZY3A 3LVQE 1FFWA 4OI1A 4LW8A 4EJSC 1I2LA 1C8BA 1R3UA 4L02A 5ISMA 1H2WA 2LKDA 1QRAA 3IURA 4NSNA 3DQQA 4CKZA 4JJ6A 1ZHFA 2UUCH 1JA1A 5B1YA 1Q0PA 1BEEA 3FI0A 2BF7A 1NA5A 5HCIA 4BZWA 4A3CG 4KFSA 3H3FA 3MWDB 4LE2A 4FEEA 5FR1A 1M7BA 2O0MA 3BULA 5ETJA 2VUGA 3TZHA 5F7JA 5KQMA 1CY4A 1BMDA 1X9NA 1KJ9A 4JP2A 2C9ZA 4PYNA 4K0KB 3AF2A 1W4ZA 1VBHA 1QCYA 4FHZA 4MPDA 5FYDA 1R15A 2ZIFA 3EUEA 4DBLE 1Y3AA 1IJEA 5FUXA 2NZ2A 3M6FA 4E12A 1V3VA 2O54A 1DAHA 2XMGA 4H3VA 1A4XA 1FVXA 4K1XA 4DPMA 1CE8A 2XH8A 3OJLA 5IKEA 3N7TA 2B8TA 4W9NA 2RGDA 5A2QW 3QJYA 4BPRA 2WB4A 4Q47A 3R9XA 3PXEA 1XNHA 4BNDB 2XEDA 4A4DA 4FUQA 2W83A 2X23A 3P4YA 3QVLA 3DR5A 4CR8A 2A1IA 3IV9A 4AW9A 3A0UA 1K66A 1ESZA 2WINI 3H6KA 1LS1A 4GXQA 2DJIA 3WE7A 3FMFA 2HA4A 2FMTA 3KXLA 4RM2A 4YRDA 5BNZA 1GQRA 2YHAA 2B5VA 4DNXA 1QRTA 5HF6A 5I9TA 1FTGA 3TSAA 2XA9A 3FBGA 3CPHA 1YONA 4GQBA 3AUKA 4JQZA 4KYIB 1JBKA 1JGTA 4M0CA 5A3QA 3EPKA 3SC2A 5B12A 1EG2A 4ECRA 5U4QA 4MSUA 2CFCA 3GMTA 3U4GA 1T3TA 1XA4A 3R0ZA 2E55A 2D06A 2JASA 3BWDD 2Q5LA 1G291 3HYCA 3KJGA 1AXGA 1SUEA 4NPCA 3VKVA 2EJ0A 3IRVA 3ZE6A 1MOPA 2OFOA 3UJCA 1QQ5A 3CUYA 3DP7A 1SHKA 2L69A 3KJEA 1NF8A 3OLQA 5KAPA 3KAKA 1YA4A 3RFTA 3UW1A 1RYFA 3A26A 3MGCA 2P9FA 4E1AA 3R9KA 1Q6ZA 3CEPB 3HOWG 2A0WA 1MRZA 4I5IA 2JAQA 2Z83A 1E4YA 5LQRA 5KFPA 5EP2A 3OZEA 4U2BA 3FPGA 4WERA 1BMFD 3LT0A 5JXWA 1QIGA 4RA9A 2Q6TA 1GEEA 1IPFA 2P3SA 3U3DA 4CL3A 3UUFA 4QW9A 1F4PA 1E4GT 3FHLA 1L4UA 1MAUA 4P3NA 3NHSA 1NXQA 3H4DA 1ZDMA 1K63A 5JO0A 3IUYA 4HZGA 1UP6A 4G6ZA 1K08A 1A82A 1DO8A 4LWQA 4TM7A 5FP0A 5LXTB 1GCGA 4JGGA 1JYSA 4QG3A 1G98A 4B6QA 1VSQA 3IPRA 1EP3B 2XNJA 3R1IA 4AY4A 2WAXA 4NBSA 1C1HA 1K5HA 1TEXA 3FUVA 5HJ5A 1Z4NA 1JH8A 3IEIA 1Y1TA 2GZDA 4TWAA 1E2UA 4PQYA 1LB1B 2CUNA 4G4JA 5IKXA 5A5GA 2CEAA 4GLBA 4X8HA 1B0AA 1NMSA 3ADKA 2Y1OA 3DE4X 3PHIA 4DSOA 2FI1A 2PMZE 4OBEA 5FPHA 2ZYWX 2JD0A 2OHHA 4PC3A 3RIHA 1WU8A 5DGIA 4BNTA 2WF6A 2XTJA 1GTJ1 2B4KA 1P73A 2VKQA 3P32A 4M8IA 5I51A 1IN7A 5ADVA 4O4IF 5JDIA 3VNAA 2XW6A 4MQLA 4Y1FA 2I2AA 1RQPA 3AH8A 2Y67A 5EXEA 2QB5A 3HZRA 5DEOA 3ZS8A 3VU0A 3WZMA 4D92A 1PTJC 4BO4A 4NMHA 4GI1A 5FV7A 2WG2A 3WLEA 4J6EA 2A0YA 3OZTA 4BX8A 3O3NB 2VJQA 2CJPA 1G7CA 2Z6QA 1ZVMA 1BZYA 2PZMA 2FWPA 2H1SA 1N48A 3NDIA 3OX3A 4LRYA 3OU6A 4HCJA 2BELA 16PKA 1HY3A 4BYMA 1LV8A 1FXSA 1JYFA 4G0PA 1DZ3A 1AB6A 1XNGA 5DMXA 1FYEA 1HDCA 4F9TA 4K9MA 4IHJF 3MAGA 2BE9A 1J4AA 1L5GB 3BSYA 3C3DA 2WJ3A 2BFNA 2DPYA 2QN2A 2ZJZA 1KZ1A 2GNAA 2NZWA 4CTKA 4Q4AB 1IB6A 3IJRA 4UXHA 5E2BA 4M8KA 3ZHSA 1F1JA 4DRYA 4EPVA 2NV0A 1I13A 3BK2A 5AW7A 1IQRA 1VP9A 2YWXA 4CM1A 2QU7A 3IUPA 3PR2B 1K83A 2YBDA 4FGZA 4TN1A 4X20A 4BQNA 5K4GA 2ZBDA 4R51A 1UPBA 5CA0B 3WKDA 1GGKA 2BLNA 3DV9A 3NALA 3NIGB 4GPEA 5I5UA 2FDCA 4I7EA 2Q5QA 3UPUA 1FX1A 3ACBA 4BZZA 5KS2A 1QUFA 4YH1A 4YT5A 2GFQA 4MHSA 3PXUA 1DIOB 1I3NA 1ZA2A 2H17A 3W6UA 3MFHA 4ND1A 3DZFA 3RJ5A 2VJPA 3WP1B 3EA0A 3BL5A 4CMEC 4GSLA 3FSRA 3L46A 4KCGA 4MWEA 4ND6A 4WGFA 2G80A 5JAIA 2WJ4A 4JJFA 4GYJA 1DFIA 4OLAA 4DA9A 3AM5A 1YCFA 2PMKA 1RRVA 4NP6A 4XCXA 1ATIA 4LOJA 4E33A 2J59A 3O93A 1CY2A 3SI7A 3FPLA 3M9NB 1IM5A 4ARBA 2UV8A 3PNSA 1AF4A 3PV0A 1N1MA 4PBRA 2GBIA 4XM1A 3SC2B 3HH8A 1OZFA 4XM2A 3EMVA 5JE8A 1XDZA 1D03A 1E0DA 4BAUA 5IUNC 1U8ZA 3JWPA 1S10A 3OZUA 3T5HA 4GPIB 4AK9A 1P77A 4AU1A 4EP1A 2P1RA 4LMRA 5HTOA 1NVKA 1GL6A 3K8OE 4MPRA 1IN5A 2GEFA 3NYIA 5CPFA 1DEKA 4HNGA 2N1BA 5AM0A 1D5CA 4GE3A 4KO1S 4NBLA 1DKOA 1DAFA 2LUOA 4INZA 3UW3A 1SXJC 3RTXA 2AEMA 4IWNA 2OBNA 1ZJ4A 1N5RA 2YXNA 2IZ7A 2H5EA 2F2TA 3AFNA 5KYUA 1XNQB 1PQPA 2FWJA 2O05A 2ZPUA 3PQEA 3VNNA 3W04A 1MW8X 2EF0A 1JEOA 1UZUA 2WIFA 2ZYSA 1KVSA 4L5BA 1GZHB 2XQGA 4UUMA 5EKTA 3C8HA 5AT1A 5J2UB 5KTYA 4LF7B 1SIWA 4XWGA 3MNFA 3Q1KA 3HXKA 2ASEA 1TCCA 2CY0A 3C8DA 3HC7A 2FRDA 1RWNA 1GG5A 3BL8A 1O87A 3TQCA 5BN5A 5MGBA 2IKSA 1DC3A 2QN7A 3VZQA 1NONA 1DCTA 1OFUX 4UTXA 1UWVA 3HUUA 3BICA 4KE9A 2C54A 3DMGA 3BWYA 3BDAA 3MWDA 1RWQA 1SZJG 4O0MA 2G9UA 4CLDA 2AUNA 3F3YA 3UJ6A 2Q0XA 3V6KA 2QQFA 3IP3A 1LJUA 3MCZA 4FD2A 4LDQA 3EH1A 2JG3A 1A5AB 3MJTA 1Z0FA 3H3XA 1KKMA 1Z2EA 1SR8A 3AXSA 2VJCA 3MLEA 3O8CA 3K0EA 5DYYA 2C5GA 2GN1A 3T3GA 3I6ZA 3GV0A 3MQ4A 1M6YA 1X1BA 2A3NA 5JCJA 4G89A 1CR1A 4ZPXA 2B9EA 2BJHA 2DBYA 3R77A 3EZLA 5IC5A 4EG8A 1QHHB 4WLNA 1B1AA 1Z62A 2F3PA 3PENA 1PJBA 1NW9B 4G3XA 1M76A 2V7GA 5D5QA 2QXYA 3O3MB 1QHYA 1CQPA 1QYWA 5K1ZA 5TQJA 1WP4A 3JALA 1VHJA 1IUKA 3LY5A 4GYWA 5JY1A 1BH6A 1GSAA 3K70C 1SULA 4TKZA 4ALLA 1QNLA 3S6JA 2C4VA 2P9ZA 2OBFA 1W5AA 3FOCA 3TD2A 3TY9A 4C4AA 5FKJA 5ECGC 1NWHA 5IU6A 4JJ8A 4NRDA 3TBKA 3QI7A 5ALHA 4EJ2A 3NBYB 3PPWA 4L9WA 3P9IA 1Q7RA 4WI1A 1RLOA 3A1WA 4QJ4A 2COGA 4NCAA 3CO5A 3K6KA 2PYIA 4AMVA 4IDAA 4IW3B 3T1OA 2PUVA 1FU8A 1B93A 2ZKIA 3KLBA 2JFHA 3LGAA 4ZAWA 3RSQA 4AJKA 2J31A 3TF5A 1TF2A 1K97A 3MXTA 1AMOA 2IGTA 2EL9A 3LQKA 3TX2A 4AX8A 5BMOA 5CDTA 1C2TA 1X0VA 5FTLA 3I8OA 5GONA 3AF6A 1H6AA 3RU3A 5IWAB 1B3BA 5FEMA 1FFCA 2GD2A 2AD5A 4FDUA 2M6RA 5GY7A 2QTGA 2ZSIA 4TXHA 5DN9A 4QARA 1CFZA 1UOQA 4ACAA 3IQEA 5FBWB 2BYTA 1Y5MA 3EC2A 1RYBA 2WSIA 1IY1A 3SJCA 4NOKA 4HWKA 2J4FA 4DA8A 1T1RA 4DMMA 1TZKA 1DCFA 3AP3A 3P20A 4FLEA 1N5JA 4NS4A 3AOEA 3LY7A 4O2LA 5FOUA 4D6PA 4F5ZA 4L9SA 1H0SA 3VOBA 2DKFA 1HOXA 2H59A 2HSDA 2WFMA 2PRYA 5LLSA 2NUAB 4FI3F 4D7AA 1NVVR 3WGGA 3EXG2 1PUXA 1YVEI 1E1NA 2FPUA 2QV7A 5DZSA 1LI4A 2JI6A 2J67A 5K2MA 4BP9A 3ISJA 3NHRA 5KX5F 5JUMA 2JIZA 2ORYA 3O47A 4B83A 3KZCA 4YP1A 3LRPA 4RTKA 2WZQA 2O8EA 1DKQA 1LDBA 5AVXA 1JMVA 4B7CA 5KYKA 1YD7A 4RMNA 2C3MA 5JALA 1LD3A 5LBUA 3U4QB 4G0XA 3K1JA 1BHQ1 3DL0A 1RLIA 4RPGA 5A7HA 4Y2PA 4AS3A 2PL5A 1JG1A 1Y4SA 2G28A 5INTA 2DERA 5IZCC 1FTNA 1V4YA 1IFXA 5AXAA 4IJMA 4RHXA 4WKNA 1MPTA 1YZVA 2X41A 4UCQA 2C7BA 3DL4A 3SR3A 1UDXA 1C0EA 1P2DA 1A3CA 1X77A 1GFSA 2AJBA 2IDKA 1I0ZA 3DDCA 3OFVA 3X1MA 3ICOA 5KSOA 4MUNA 2XTAA 1XNRB 5CEJA 2PS3A 1IQPA 1ZK4A 2FJUA 3EOAI 3MINA 4YREA 2FPPB 4KR7A 3LWNA 5A4IS 3R5HA 4RGBA 1DPGA 1KI2A 1WUKS 3FJ1A 2J9FB 4ECEA 5KYGA 3LL4A 2N0SA 4GL2A 5JADA 5DN6D 1HL7A 1G3MA 1US8B 5A62A 2AN3A 1YHYA 4R01A 1NX6A 4BN4A 5JANA 4NJMB 2QJOA 4C0SA 4HRVA 2GEVA 3G82C 4W5QA 4UCTA 1NYLA 3AEUB 4KX5A 2AA3A 4MRRA 4YQWA 1TLFA 3GA0A 5H3CA 3CTPA 1J33A 1ZD2P 1Y1VA 1I9GA 4HD8A 5L1JA 5J58A 5KYWA 1R5NA 1L5OA 1KTAA 4A16A 1DHTA 2W4MA 2XNHA 1KI6B 2C2HA 4J9NA 2JH8A 1L3IA 2A67A 3N0VA 7REQB 4CKWA 1K1QA 1FJHA 1AKQA 5A1TA 1GRNA 3TFOA 4JUBA 3EJ6A 5JXJA 1R16A 3BH7A 4ZAVA 1YI8A 3VBCA 3IXQA 3DPUA 1L4HA 1JPJA 5DM60 3STYA 1ZU4A 4WESA 5HJ2A 3CC8A 2ZYTX 3ABRB 3BXGA 4A6XA 2R8EA 1SRRA 2Y2UA 3NWEA 3UWKA 1K9VF 3RIMA 3TSOA 1U9IA 3FDFA 3SPXA 1GTRA 3DLHA 4EPTA 1LLFA 5CX1A 4DVGA 3UH1A 3HUDA 1B00A 3I6YA 4B40A 1A5TA 1U3DA 1KFKB 4TUYA 3LP5A 5ES3A 2PUBA 3I1FA 2ZB7A 4ZTZB 5HNEA 2E18A 5IYZF 2PTHA 4W5WA 3RAJA 1BEUB 1X70A 1UQUA 2MR5A 2Q9CA 3P9PA 5HIJA 4MVCA 5K8JB 4U2GA 1RADA 1TE2A 3TAXA 5K2OA 2WAOA 3VPCA 4P0TA 5A05A 2NUPB 2Q7OE 1N36B 2WJIA 4AMZA 4Q39A 1ZH0A 3N0TA 4B0PA 1N1EA 2QROA 3IE0A 2PXAA 2VYVA 3GARA 2VAXA 1K5GA 1QK4A 2Z9CA 3C1AA 1E32A 3EE6A 4IINA 4YCAA 3ZHYA 1J22A 4YDHB 1U6JA 4LJ4A 4ZWNA 2QE6A 4C4RA 4PZ9A 3GFVA 3V8QA 1O96B 1G6HA 1DWPA 1YUNA 1XCOA 3L7YA 2GPWA 2XLBA 2H9YA 3P9ZA 4GZ3A 1JRLA 4TQGA 3V4LA 4OX9Y 4BJ5A 3RASA 2OCLA 4XDYA 5KOYA 3IVAA 1FMCA 1H65A 4E2WA 5M2QA 5D1OA 1UBRS 4YR9A 2QNIA 1B73A 1WLSA 3A04A 3F6SA 5JJKA 5ALEA 1JLRA 4PHGA 3A8TA 4ROSA 1XMQB 3KKQA 2FUEA 3HDYA 4MYDA 4W5TA 3WKBA 4V3BA 4XJTA 1NOJA 1RS0A 5BN1A 1EQAA 4TV9A 2HCTA 4TN5A 5EWMA 1Q0TA 2I7XA 1NVWQ 5CTJA 2RHOA 3CXUA 3IUBA 5ALYA 5HZMA 3MSCA 1I4DD 3JQDA 3GH1A 3ZW7A 4YJ2A 3R76A 5EIAA 2Y4RA 3QBDA 5DHFA 4CG2A 3DV0B 4QICA 3COVA 4PONA 3CVXA 4UTRA 1P8AA 2IEGA 4M83A 1HDYA 3EN0A 3DUWA 4Z54A 5ALDA 1XRPA 4UHKA 1N4DA 1V8ZA 3HFRA 1A76A 3AP1A 3CLVA 3TD9A 1N32H 3L79A 5FNZA 4LZLA 4XGIA 4RAYA 3K9BA 5JYBA 4BE4A 5DBGA 1WBDA 3KB6A 1RJDA 2WD8A 5EZQA 1QMPA 5EZYB 2PL9A 4RDXA 2BISA 4KWIA 2PUCA 5TR9A 5FOXA 4ZYXA 5K05A 1B8VA 2V6IA 3Q7SA 2XI4A 4D57A 1NNLA 1UWCA 1DS6A 2ZLBA 5EJ2A 2F00A 1GRVA 4HUQB 2RDMA 2DQ4A 2CCKA 5G40A 3DV2A 3IAUA 1LEHA 2I4IA 1QORA 1H2AS 5AM4A 1F0NA 2XOKA 1ZEJA 1V5IA 2XMDA 2AE1A 4WOKA 1H42A 2EIYA 2D0PB 4WBXC 2R86A 1V2HE 4TYQA 3D2BA 2R97A 1XTQA 1KO4A 4KQGA 1X1AA 2XUDA 1SXJE 1OWMA 3LD9A 4MVWA 4P2GA 4CF5A 1VJ1A 3BXOA 1GU0A 2HA3A 3AEXA 3OPVA 1FZTA 4J43A 5KYWB 3NIDB 1G17A 1MRNA 2ET6A 3L7NA 3PZBA 1KMMA 4JUIA 2H4ZA 4EO4A 1NP7A 4XGNA 2WAAA 4OLJA 3W6ZA 1RYNA 3PC4A 3GFTA 3IAAA 2Q4OA 2N46A 5BYKA 3G0HA 5T8KC 1XJ5A 3MUFA 4E70A 3H0GA 3GJXB 2AG6A 4LQCA 1OX6A 4P38A 2XT6A 4MI9A 1WXEA 2WY2D 2AW5A 2W2PA 2X8AA 1UIMA 2CW7A 2HA6A 2CLMB 1C4XA 4E5MA 4P9NA 3RHSA 5DQIA 1T3ZA 1WZNA 1Z35A 3HFJA 4HXFB 1AGXA 4AZ3A 1U1DA 2ZBVA 1L5VA 1QGAA 3ES9A 3I28A 4JZKA 3HI4A 5DISB 4H7KA 3ZDYB 5H4HA 2VSOA 3S1AA 3NVKI 1I01A 3GJQA 3ITNA 2W58A 1UF9A 2OXCA 4F4ZA 3NGLA 3PFIA 4DCJA 2G7ZA 2ZRGA 4E1VA 4F93B 5JVDA 1YE5A 3K05A 2YMPA 2LWIA 5TARA 4EX6A 1A7KA 4DQUA 2GN8A 1FQJA 2VWPA 5HS6A 3NTXA 4QTUB 5AKKA 1H0HA 3C8UA 1KDVA 4DMKA 1CQWA 5C5EA 2YASA 1NM5C 1HYQA 2FN7A 2FX3A 3UT6A 4DKJA 4LVOA 4ZO9A 3MS2A 4C7VA 3I58A 3EG5A 3WRXA 1NP6A 1JJAA 2LNDA 4RTSA 3IBCA 4DUGD 1GDDA 2QN9A 1IZ9A 5I7HA 2GAFA 4AYBE 2Z0MA 4MR8A 4OV6B 1O5IA 5DE3A 4ZYVA 4A8JA 1Q17A 5LQNA 3DQPA 1UFVA 2YY5A 2X14A 3VAYA 2IH5A 1F12A 1P7ZA 5TPZD 3FMGA 1HRDA 4KQKA 1X9IA 2QX6A 3PKJA 4HDRA 3REGA 3SZOA 3ZDEA 4ZVLA 2QMYA 2RARA 1RFGE 4HC4A 5DK6A 1HYEA 5AIAA 2ZB8A 4HQNA 5LJLA 3F1LA 4IS3A 2X3UA 1FFXB 5BUZA 4IF4A 4R3WA 1I6KA 3DULA 3PEEA 2WKPA 1L4YA 1VMIA 3GUCA 4LDJA 1E2IA 5DFAA 2YJGA 2DHDA 1OPRA 2QRVB 4ZVPA 4KPFC 3SG0A 3WLSA 4G5OA 4RUCA 1MQ9A 1Z75A 5JCOA 1DV1A 3NONA 1OV6A 4R2JA 4M0PA 2X2FA 3ZQJA 1JVSA 4RZQA 4DLKA 2JBAA 3QYPA 4NL4H 4HUTA 5JAHA 3ANXA 1ZM3A 3A4IA 1E1RA 3M2PA 2IWHA 4A2CA 1EVYA 1GSHA 4CQMA 4MCHA 2JD2A 5AM2A 1B23P 4EGQA 3GJZA 3P9RA 4ED2A 4ZMRA 5FBKA 1QX4A 1XZBA 3EQ2A 2PUAA 4G41A 2OM2A 3O4VA 2SNIE 4IIJF 4AZVA 1NMEA 4CQNA 1FP7A 2EW2A 3G2MA 3H2ZA 3U37A 3HK2A 1OIVA 4JBXA 1ODJA 3SZGA 2CHGA 3UA3A 2G72A 1JMYA 2TMKA 4S1TA 5CA1F 4NQZA 3KQKA 1SC6A 3SS9X 3TN7A 2IHUA 1JXQA 2AHRA 2XUOA 5E2AA 3VR1A 3ZH2A 4D6XA 2G76A 3GDEA 1RQLA 5KWEA 4II3A 3OA0A 1CEXA 4YB8B 5TPWB 4J7CA 4YYZA 7MDHA 3ENQA 1P2SA 1CY0A 3QHAA 2A4KA 5T57A 2VL7A 1WUJS 3REQB 4WASA 5DAAA 1J2RA 2X0JA 2IYRA 3I9OA 1K4KA 1BQEA 2MJLA 1SFRA 2E9SA 4M55A 1Z8HA 4KWEA 2KPOA 3BCHA 1PR9A 4OCZA 3KWLA 3ZEAA 4ECTA 3CY6A 1WCMA 4BHTA 3BQ2A 3THXA 1YOBA 4HLDA 3RANA 4O2BA 5CJJA 4ZQFA 5TNXA 4C5AA 2P1ZA 2AF3C 3L82B 1YS7A 3WIUA 1SU6A 1G8YA 4LNAA 4LRQA 1QGDA 2H2HA 1EFVA 4QEKA 4ZO7A 1SC3A 1OT3A 3A1DA 1JHAA 3T7CA 2YJZA 3ISTA 5BWRA 4DV3H 2ECKA 2V54A 1PGPA 3NT2A 3OA2A 4IHJA 1FVIA 4H6VA 5EPOA 3OP4A 3VR2A 4DCUA 1JDEA 1PW7A 4RJTA 2OKCA 5LL6P 5BWXA 2IVZA 1PFGA 1IWPB 3GWZA 2ACKA 5I7UA 3L7OA 2WHEA 2PA3A 1Y4AE 3I04A 2NU7A 4KZKA 2YUIA 4MCIA 5IKOA 2P2DA 3J80A 2C4TA 2Z5GA 5DCYA 3SX2A 3RJ0A 3OJFA 4TLBA 3TKAA 5AVSA 4O3NA 4KC0A 2JLAA 5IJ9B 3GBVA 4CDNA 2FP3A 3LW8A 3OEYA 1HEIA 1VL2A 2OAGA 1V8PA 2TMDA 2ACWA 1F5SA 1TVKA 2FPIA 3GEEA 1QFJA 3ZU3A 3IJEB 1AUVA 2CNLA 1KFBB 4R2XA 1QQBA 1C3OB 1PFYA 1B14A 2HBYA 1AKVA 3NYWA 1ENPA 1MAHA 3BTOA 4KDCA 1PL7A 2Z02A 4FU0A 4PZ0A 3VSBA 1YJQA 3FNIA 3FNHA 3JVUA 3RBDA 4KJXA 3GFSA 1A0IA 1XUOA 1P8JA 4JC4A 1QJCA 4R8MA 3MEQA 1CQZA 3UAGA 3Q41A 4BTVA 4L5JA 4HYQA 2I87A 3NEAA 4ENQA 1JHVA 3TSCA 2AEEA 2WE8A 4BJ3A 1OVGA 4F92B 3QUQA 7ADHA 5JZSA 3AOEC 3M3PA 3N1UA 3WMFA 4OJMX 5DK4A 3IELA 2FTKE 4O86A 1DTSA 1DUSA 1RAIA 4NECA 4GZ6A 2WSSA 4K3VA 4WKBA 1OCEA 4X8LA 2NP7A 4NLGA 1VA5A 4TKLA 1W4RA 3IA7A 3UJ8A 3V80A 1U7XA 1TU0A 2XMRA 3N8HA 2F9LA 2WRZA 3KSUA 2VF5X 2P35A 3L4BA 4GI5A 1Y8QB 2ODEA 2WD7A 4IIYA 3GT7A 3C2QA 3JX9A 3VHXA 3CMCO 3OZAA 3THOA 3GTJA 4NNOA 3T5KA 4JLWA 1T9KA 2BMJA 1OXTA 3TLBA 2DPLA 1P7VA 4MR9A 5DNCA 3MD9A 4UD2A 3SJZA 1E3SA 1S4QA 3TINA 2ZIAA 4Q6BA 1V4NA 5LP1A 1U8TA 1LQTA 1QPBA 1PP4A 5TEWA 2YIDA 2VYFA 3AR7A 5DTRA 3UK6A 3IOEA 3PC2A 1DFHA 2ZWAA 1TD1A 3IMEA 3GTLA 2JFGA 4QSHA 2OP0A 3I34X 3JAWB 4Q4JB 3RS5A 4OQZA 3A6LA 1VG9B 2E0IA 4D9HA 4LY3A 3PIRA 3QEKA 1VP3A 5EUCA 1QDLB 1TTQB 4NLLA 3SXPA 4EQZA 3IEMA 2H1WA 2I6UA 2IYYA 4FXOA 2BFBB 1W47A 4JN6B 4LA4A 5F78A 5AVJA 5G1PA 3RABA 3AVXA 2UDPA 3JR7A 2QG4A 3FHOA 1G2WA 2Q5IA 1E9RA 3IOBA 2V7QD 3NR2A 3VPSA 1PJLA 5K0CA 1GGNA 1Z56C 1YR7A 3KXDA 4RHCA 3PW7A 1NIJA 3F9IA 3PSHA 1VIAA 5CYGA 5CPBA 4HGRA 4IOMA 2O8BA 1RPNA 1RZUA 1YR3A 1N77A 1Q11A 5JD5A 5D8DA 1OYWA 3EY4A 3IQXA 2IX9A 3LK7A 3PR4A 4WFQA 1GUYA 2BEUA 2DR0A 3D31A 3T9DA 5EJ7A 3KYBA 1OH6A 2EWVA 2OMEA 3P7MA 3FGZA 3KJQA 1LTHR 4HZUA 1YRAA 4IGFA 1Q14A 1M66A 4X54A 2C7QA 2CKZB 1CS0B 3ORRA 2XUAA 2O20A 2NIPA 1FU7A 3CEAA 1XQYA 2IDZA 2QR5A 1YAHA 5FWDA 3F7MA 4QTZA 1HYGA 1V1MA 4RV5A 3ZCXA 3WJ1A 2HBRA 1D1TA 2HJRA 5TJ9A 3TUJC 4D5EA 3NOOA 2EV9A 3QVTA 1QGZA 2WJYA 3SY8A 4AY5A 3N87A 4WZAE 1RWVA 4FI3C 4PFKA 3C3JA 3FR8A 3JQQA 1Y63A 4OI4A 1KQOA 3I4MG 4R8LA 2I55A 1TM2A 2JI9A 3E7FA 4U2DA 1XQ6A 3HM2A 2EQBA 1ODKA 1XCGB 1TOAA 2FEOA 1XZQA 1HQDA 3INGA 1E66A 1I7NA 1ABEA 2O1EA 3AM3A 4EW3A 5TF0A 3PUHA 4NJMA 5CRIA 2IPMA 5KJCA 3O0DA 4BQQA 4L0MA 3HYRA 2C2XA 1WXIA 1U28A 3JVEA 4XB6B 1ESCA 2UVUA 1QVRA 3N0WA 5E3HA 4MGEA 4RZ3A 4YJ3B 3L0BA 4CCSA 4MTLA 4AMYA 2XD4A 5SYAA 3RVJA 2VNAA 3WOHA 4XVUA 3A32A 1A98A 3PB3A 3MMSA 1MH9A 4C3ZA 5J2TF 2DUJA 4F21A 4H1TA 3KQQA 3RBXA 2XDQB 4WJLA 4YHHB 4FIZA 4P8RA 3ACCA 2O7QA 1J6UA 3I39X 3K9HA 4ZCSA 4UPEA 5BWWA 3BAAA 4MW9A 3KD2A 3HEAA 4WXHA 3HA2A 3L05A 4N76A 5E2IA 2QYHA 2AW3A 2XITA 4MUXA 1GG8A 1N2EA 2J87A 1MCZA 4D9NA 1LSJA 1M34E 1QCZA 1XN4A 2R85A 4XPIA 4JI1B 4D4HA 4MICA 1EHCA 4KDEA 4HX5A 4QYMA 3LWDA 5FWYB 3N8IA 4BC1A 5EJFA 2ZI6A 4EZBA 1U9ZA 4EB3A 3ZVNA 4RK5A 5AH0A 2B63G 4PS0A 5ALUA 4JZYA 2H54A 3P4UA 4R5MA 4YUXA 4LFCH 3AVYA 1WKCA 2GZRA 5DTEA 1R12A 1U2QA 1TYZA 3ZY4A 5G02A 4CQLB 4QECA 2RE8A 1QF6A 3PPYA 2IYAA 3T3PB 1EVLA 1DEHA 1P7CA 1PWEA 3CN9A 3H4IA 4V1CB 3D8HA 1Z7WA 2AGVA 4G5HA 4FGRA 4UAVA 1R0CA 1U63A 3H0EA 4J07A 1LPPA 1E9DA 1FYWA 3U7FB 1ZNXA 2QAGB 3EPLA 2FSVC 1RYEA 1WMAA 2H1RA 3M6UA 3T94A 1PL0A 2RIPA 1ABBA 3O4HA 2VQEH 4JYAH 1PLJA 2IOQA 3A6HA 1GSIA 3L49A 3ZDQA 5DYGA 4CM3A 3GQVA 1O6FA 4JUZA 2FRDC 3L8GA 4L75A 4A3SA 2BGGA 1DLIA 2IHZA 5BWCA 1K75A 3X0DA 1W73A 4LSZA 1EMDA 3WZ2A 1T5TA 3AETB 1R6UA 1VJ5A 4ERXA 2QUHA 1N6NA 3GG9A 3JALB 4KE6A 1GUAA 5F1OA 4L8YA 1TI7A 4PYKA 3UQZA 1VBKA 2DHCA 2VDVE 1GGHA 1HPLA 2VJMB 4HB0A 2BZ0A 2OORC 5G3ZA 1ZAYA 3PDJA 4IKEA 1DAKA 3ZZNA 2PFKA 3B85A 4B47A 4ERNA 1LX6A 4IIBA 4D26A 4NATA 1YCDA 2HIHA 2HADA 4HWTA 1WXQA 4YP6A 4R8UB 1E3IA 4HV4A 4UCRA 1TAEA 2FXVA 3V7NA 3TVTA 3M83A 4YJ3F 1QRUA 3BRQA 3DOOA 4QPCA 3RBEA 2X40A 4FFDA 3UO8B 4EG5A 1V8DA 3FWKA 3E84A 3VOAA 1NC3A 1GQFA 3X1ZA 4FE3A 1CWUA 4UNNA 1R5BA 2H4WA 1WA5A 1Z07A 3GNLA 1HDEA 1LSSA 1N6RA 1S0NA 3K9LA 3K9NA 1A88A 3W9SA 3IPLA 4GC7A 3OT4A 4UJ3A 5DIFA 3L1UA 4KMOA 2WC1A 4U6SA 5FL7D 1I50A 3IIMA 4W1RA 1TEZA 3L7IA 4LPKA 4X44A 2AB0A 5F64A 1VHLA 4HPJB 3TJRA 4KV7A 5AOBA 4TUYF 1H0KA 4P4UA 3UATA 1W35A 1UMBA 1EBBA 3BA9A 3IIEA 5D3ZA 4MGKR 5EWJB 1E4VA 3T0IA 2VN8A 4X93A 4CCWA 2WOOA 5HW0A 4G36A 3V5NA 4B17A 4QUJA 3UM9A 1K3TA 1KNXA 2FGJA 1II8A 1SKYB 4JXXA 2HIVA 1GO3E 4QLAA 1JXMA 4J0KA 4ER0A 1L9KA 2FKAA 2A59A 1Q0SA 2D5CA 4YP3A 4OFWA 2DF8A 5FTMA 5IMBA 1YQEA 1L5HA 1UDWA 3ROEA 4EHHA 4TYMA 3QTBA 4WDQA 1UEXC 1X1RA 3S70A 1W7AA 1ONBA 2QVXX 3GR6A 1R0ZA 4HNAB 3KKLA 3MW8A 4TPKA 4UUQA 3GZTB 2XEXA 4YLGA 1GA6A 5CCDA 1N5OX 1SKQA 3OZSA 1W9MA 5C1IA 1SCKA 2XAAA 4BNGA 4J90A 1ZD8A 4Y2RA 2BBSA 2JGFA 3DC2A 4I1PA 1DARA 4I4TA 2YZGA 3Q3EA 1XI2A 1U80A 1Y37A 3IS3A 4Y0NA 1Q91A 2J0EA 1PGJA 2ZREA 3MWEA 1N2OA 4YRJA 3BFVA 4A26A 4AWBA 1C8LA 1EFUA 4DL4A 1I36A 3TPZA 3OURA 4D0RA 1XZIA 2BM1A 2O2HA 2H3HA 2CMKA 3GIDA 1NRIA 3MHPA 2FR8C 2O2ZA 7MHTA 5BOVA 2Z2XA 4Y9SA 3C1OA 3V32A 1PEAA 5YASA 5JPCA 5L3QA 2O57A 2MSDB 4YJ2F 1MVOA 2ZT7A 1O54A 1BFUA 5THQA 1XFDA 2I91A 1JIIA 4HJRA 3AL0C 3E0XA 2RCYA 4O08A 1M6VA 4L95C 4WW0A 4PSUA 3HJNA 2UVVA 4R84A 3WNQA 4EY5A 4MULA 2E7ZA 4HDMB 1T9BA 3VV3A 1LNQA 1XCMA 1J5PA 1I4EB 1GKIA 2X4IA 1L9XA 3F96A 4PC7A 2AV6A 1U2DC 4IAOA 2GJ4A 5C31A 2V4UA 2LCFA 3K1TA 3JU3A 4UU7A 1ZW6A 5TJHA 3QVMA 4IS2A 2IHKA 3VPHA 1CF4A 1DL5A 2ISCA 5D85A 4RF2A 1KK1A 3A4YA 1X6VA 1NMZA 1KEEB 4KMSA 3VYRB 5KINB 4IAJA 1AY0A 1AV6A 4M1SA 1SZDA 1NDQA 3PWTA 1IAQA 3ZI4A 1OX5A 1IMOA 1UWKA 4R9UC 4CM7A 1QTIA 1C2YA 2QTNA 3VMMA 5K03A 4B7XA 4ZQCB 5DM2A 4CMIA 2CFMA 4DR4B 1HQCA 6ADHA 4DGQA 3LHFA 3W5CA 1VPLA 1R0YA 4IVPA 3FUTA 2D5IA 3AETA 4MWZA 3PQDA 1SUSA 2XAUA 4RWZA 3A1EA 1RM0A 2J3IA 3AK4A 4NS1A 3QVGA 4PSCA 4COOA 4A36A 4DV2H 5JNUA 2XWBF 1OV4A 1LPSA 4I50B 2GNOA 1S5PA 4W7IA 1EUCA 2GDZA 3M0EA 4PNPA 1VRWA 4X3OA 1OFGA 3R8FA 1ZOIA 4TMWA 4JJZA 1ULHA 3JZDA 5IULC 1QK3A 1LC0A 5KFEA 2P6OA 3PKIA 4HBGA 1RZRA 1KC7A 4KX3A 3UWDA 4RMIA 5MN6A 4DCCA 1GN8A 2F1KA 1KZ6A 2AZDA 3DXYA 1XX6A 1Z88A 2GZ2A 4QWDA 4NYEA 1V9PA 3ISVA 3LYUA 4MZDA 4XIIA 2HHAA 1WETA 4EG4A 4AJJA 3QEOA 2HM7A 2Q41A 4F85A 3KWJA 4FZ3A 2FZEA 3ER9A 1BWQA 4AJPA 2X19A 5ALIA 3IEPA 2GM5A 1ZO8A 3WGZA 1LRLA 4EW6A 3L7KA 4DIKA 2CNWA 2ZWIA 4EDFA 4YJKA 3C16C 3TPFA 2C2EA 1PGQA 5CITA 1Z5NA 2JGJA 2BVNA 1CKEA 5I7AA 1NKSA 2E6KA 2W0MA 4OSEA 4ZI3A 1JFTA 1SQFA 3D7LA 4GLFA 1JH9A 3D81A 4OQQA 4GWGA 4BQOA 1JSRA 3JXEA 4P80A 5KI6A 3ZWNA 4LFBB 4DL2A 2J5RA 3EPRA 4PM4A 4PN3A 5HR5A 3WL5A 1S01A 5EJMA 1UXJA 4CC6A 3AYHB 5A7GA 2D6FA 4QGBA 2RGEA 1WEKA 4GF5A 2WI8A 3C4VA 4BWVA 4ZK2A 5K99A 1Q7EA 3DO6A 3G8AA 1SRQA 3GOQA 2IE8A 1TIBA 2FPMA 1GR1A 1P75A 3BFKA 3V4FA 1TX4B 1F8FA 2VHJA 4RD3A 3VDNB 3FJYA 1ZVVA 3LX5A 2PD4A 1JJ7A 4IDOA 3QM1A 1R0BA 3P2KA 3ZW8A 4Q4AA 2GI4A 3KB8A 2EU8A 4CM9A 5EYPB 3QJGA 4Y9UA 4IHAA 4MRSA 2IQIA 2QXTA 3MILA 1A3GA 1LJLA 3NYRA 2C8KA 4ICIA 1XTPA 3V4ZA 4J0QA 3CRZA 4BKPA 1P9NA 3FMOB 2R5WA 3IR5A 1P6XA 1Q19A 3IT2A 2CCJA 1S2LA 3CX7A 3MB8A 1SUIA 1PVDA 1MN6A 4QFDA 3VYTB 4B2LA 1T8RA 1TAGA 1JLSA 3IILA 4U6QA 2DY1A 3SP1A 2HUNA 3AUXA 4TL8A 4ZGWA 3GLIE 4OX9B 5KFBA 5GZ3A 2AI2A 5JZVA 2D4AA 4QVIA 2GEUA 4UW9A 1HURA 2I2BA 2BFAA 4GAEA 1RAAA 4ARZA 1WVMA 1I7PA 1Z5VA 4KIWA 3VVBA 1HC7A 4PXSA 4A9AA 1YR8A 4B43A 4MX8A 4AI6A 3K53A 4ZAZA 4Q4HA 1NT2A 3HRIA 2IYVA 3H84A 2IELA 4HQOA 4K46A 3TCXB 3VR4H 3CJTA 3HR7A 4KXNA 1RJ9B 5D2CA 5KFXA 1MA3A 2NZ8A 4GC9A 3WLIA 4FNAA 1Z08A 3DM5A 1GKYA 3HDQA 3HQ4O 4OLHA 4E1BA 3DE7X 3EPGA 4F3RA 3CNEA 1L4BA 4G4SO 4GKJB 1RPZA 1G8JA 2BSXA 1BU8A 5A6SB 5KMGB 2AOWA 3TOCA 2J8ZA 4UFZA 2JJYA 2YV1A 4H1VA 3G2NA 3ZU2A 2Q6LA 3QX9A 2BV3A 3SQLA 3IKTA 1P62B 2H0AA 5ELXA 1GQSA 1TUBB 4DUZB 3VA7A 4RMHA 4LTNA 4ZI7F 1HE4A 4YWHA 4E5UA 2EL7A 4BX2A 1QRRA 1HBJA 2BDEA 2V74B 3G2QA 1N8KA 2YWVA 4KLCA 4DCVA 2Q1YA 2YRXA 3ADOA 1V25A 1ODLA 4BCCA 4HRYA 1QGED 1KK0A 2V8OA 1ZZEA 2B7LA 3KHTA 4IDHA 4GXTA 3THYB 3T3EA 5KPJA 4NCBA 3EMDA 4M21A 4FR5A 1X7HA 3FNGA 4WCFB 3TZKA 1W46A 4JBLA 1OFUA 2ALZA 4IXTA 1PJTA 2NADA 2VF2A 4U7JA 4RESA 1ZMOA 3WTCA 2JW5A 3ZNQA 4CMKA 3HP4A 3E53A 1VPWA 2E4UA 4RA9B 4TT3D 3G7UA 4AZ0A 2OZPA 2IC5A 4QQKA 1EP1B 4LWOA 1LVUA 3CX3A 5CB0A 4QXOA 3LS2A 1EVZA 5MGNA 3CXRA 1M5RA 2BR0A 1F1BA 4PAMA 1WOMA 4EA6A 3TJMA 2NYAA 3PL1A 3V46A 4MWOA 1C3XA 4IIJA 1LRJA 2H92A 4MEBA 5E1OA 4R1PA 3G0IA 5EQFA 1EZ1A 2YIJA 1YE8A 3ASYA 2GN9A 4JLBA 5EJ6A 5I7WA 4AQYH 3BYZA 5D86A 3HLYA 4DZRA 4DDWA 1PL8A 2XE4A 1EU1A 4C29A 4HHEA 2N75A 4Y2TA 3F6PA 4V0MA 3T4EA 2IU6A 1JEQB 2B1IA 2G0AA 1JKIA 4AXXA 3NBZB 5AHOA 3O90A 2IL1A 3OBIA 4YONB 4Y30A 4MQFB 4XW2A 1H2HA 4E3WA 5BOSB 1WLYA 1EUDB 1O2DA 3E61A 3P0EA 2ZR9A 4RVOA 5EPUA 3FGNA 1E0AA 5E7JA 3GQBB 1C0KA 2XCTB 1C30A 2QENA 1QYDA 3BJMA 4Q44A 3PDWA 4GDMA 5KNDH 1L5FA 4J9PA 3VQTA 5KJFA 3WYEA 3W1VA 1VL6A 5HRCA 1E2GA 5HQTA 5D5PA 3MXOA 1SCUA 3V8RA 1VPTA 1ZOSA 4UAGA 3ZWPA 1X7YA 2VOJA 1KI3A 3HVKA 2QYTA 3SE7A 4FR0A 2AZ4A 5HVNA 5IWCA 2O3JA 3WMEA 1FW6A 3JY6A 1IHDA 1PL6A 3IFSA 1W0JD 4OXKA 2I6FA 5EMHA 5KJ1A 3F8NA 5F5NA 1G8MA 2FQ1A 5DI3B 4R8KA 5FWAA 3V7FA 4A2PA 1R27A 4IMJB 4KGZA 4BNKA 1YWGO 2D2XA 4EY7A 3BWXA 2RHMA 3OETA 2JLZA 1VHDA 2ACEA 2GM3A 4C5CA 1XZEA 3DL2A 1OJLA 2Z9DA 2BGKA 2IU0A 5KYTA 4J3JA 1OXVA 4XDZA 4LJ9A 1EP9A 4EY8A 2CL6X 3LUJA 3BE4A 2QZPA 1X80A 4R7GA 3IJ5A 4WK4B 3QWIA 1NV9A 2WWHA 4WZ6A 1PNOA 2M05A 2C2WA 1JECA 2H9IA 2W6OA 3OCVA 4MPTA 5JISA 1VE6A 2TYSB 1GP2A 1BX0A 1W94A 2IDJA 2R8RA 1Z0ZA 3EVEA 3EQ8A 4B3IA 2V5AA 4LDRA 1CKNA 2MYPA 2JFYA 2WWVD 1R2QA 3PDHA 2HHCA 3DUFA 3VXKA 2XNKA 2OCAA 1BXKA 1SO8A 4XTRA 1SBIA 3PRYA 2IRWA 4QBKA 4XJVA 5HFAA 1VB3A 1ODSA 1SB9A 1N2CE 3UT0A 1YB1A 5CJPA 2W98A 5DTJA 4EF4A 1WCMG 1BHSA 1AKUA 2Z1DA 4DV5H 1J2JA 3JZAA 2FFRA 4UQLA 2E87A 4EKEA 4W5RA 1NVFA 4JSTA 2V7VA 4KK3A 5L40A 1MW9X 2MYUA 4NU6A 4ATNA 4BRUA 4DJEC 4HH0A 1WPRA 3G89A 4E15A 3IEKA 1EAYA 3B9BA 4DR7B 3N5CA 1KBOA 1L8QA 2I2XB 3L5OA 3PYLA 4QDTA 2NYUA 1E9VA 1I2ZA 4YS6A 5TEVA 2AFIB 5DM4A 4RC9A 2XA2A 3C74A 4WVLA 1NLYA 2RBGA 4BFTA 4S05A 2P3QA 3PPXA 4K6HA 4EFEA 2IZZA 1ZH8A 4CUZA 1I32A 3DEHA 1G5HA 1ZQ1A 3ELBA 4DIEA 4WZBA 1D2NA 1DPFA 4JD5A 1KQGA 2I2DA 1LQUA 4PC1A 3GRCA 3OIUA 1II9A 4ZOQI 4YR0A 2GM9A 2VPPA 2WU4A 2YXLA 5DNYB 1J2TA 1U2GA 1IY2A 5C44G 3OIDA 4QGHA 3I61A 4XARA 4ZU1X 4ESHA 1Q20A 1COWD 3Q85A 1URPA 4OXQA 3OOEA 4S2EA 3GIIA 4CMBA 5JC8A 3JQFA 4OPMA 3UJAA 1IY8A 4HDOB 3JD2A 3BB4A 3GGGA 1V1MB 4FR2A 3ED5A 1FDRA 4M36A 1E3TA 1GZ5A 3IX7A 1J1IA 1IZZA 4LHSA 2UZ3A 4G85A 2QTHA 1ZM2A 3BQNB 3HEMA 3TW0A 4TL7A 5L9AA 5GVSA 2ILTA 3V9PA 2PMDA 4AG6A 2H2IA 4TTTS 5EJ9A 4GRIA 4JUDX 5JWHA 3DL7A 3M5PA 3CWZA 1PJSA 2IIPA 2PZJA 2QSZA 4FEGA 4FNGA 3USES 4NXNB 5MHTA 2A1UB 3AI1A 4KE8A 3A9SA 2XMCA 4P7GA 3IODA 1E89A 2VLIA 3WGUA 3CT4A 4ITUA 1RHJA 1J99A 4U2FA 4DSZA 1NVXQ 5A0TA 5FA6A 1TGYA 2ZJOA 2OXFA 1J5XA 1CJSA 4BVJA 2R6JA 3B1KA 1SBNE 3KEGA 4P2BA 5BV8A 4CEIB 4KTTE 1XAJA 1V4VA 4JX9A 3RTGA 2YYAA 4A6DA 2DBZA 4A5OA 2YN4A 4JNCA 2YWBA 4A92A 5DGCA 3RWMB 4ZHSA 3U3JA 5FJIA 2C7GA 3IUMA 1FPQA 3NG1A 1M6EX 2G25A 1EQUA 1JG7A 2ID9A 3ZUGA 2J07A 2R92A 3N2KB 1O94A 4QRHA 4F4JA 1JT2A 1Y4UA 2HGWA 4MVYA 3UVEA 5E0OA 1FRFS 1YFKA 1XSEA 4IKOA 4WPGA 1EFHA 2PGAA 4KR6A 1NMQA 4I6JA 4X64H 4AJ2A 4G5SA 1HNZB 4K3UA 3QVSA 3ZV4A 3HB9A 2BCJQ 4LBZA 4MQFA 3OKAA 5IZ4A 2IHBA 1IG3A 2QK4A 2NVYA 2YH2A 4Q43A 3GFOA 4EMUA 5I7FA 1H4SA 4OH7A 4RPLA 1IUNA 1DJPA 4B2IA 1JLLB 1TYDE 3QK7A 5AW5A 3JTMA 3SYTA 4CU2A 4ROTA 3DZGA 2BR3A 2CE2X 2EJ3A 2HV9A 4JIGA 1BFDA 2JFPA 2JEZA 2W6IA 3DOHA 2XOXA 3GA5A 4DB4A 2ATXA 1ZRMA 4UXJA 4YR7A 2EWMA 1PZNA 3TY5A 1FDVA 1FNCA 2NU7B 2NMVA 1JJBA 1HE5A 1ZJJA 2B36A 3BTSA 3LCMA 4OGKA 5K3WA 1NVUQ 2KSWA 1IWBB 4EJMA 2AG0A 2HRCA 1RU3A 3GTKA 1ZYUA 2OVFA 4MQUA 3TQRA 1E1YA 1M2KA 2OQRA 4PX9A 1KI9A 4EBCA 5LN1A 1XRLA 1J9ZA 2BJWA 4JI6H 3NHMA 3GBPA 5CVJA 2GA8A 4DXAA 1Z73A 1KKUA 1M2HA 1P60A 1QE3A 1ZGHA 2NXEA 1I3OA 2QA5A 2P9GA 3D9QX 4MEAA 1CUYA 1YZ3A 3TH5A 2Z3ZA 5E7MA 1PYGA 3WQBA 4EJFA 4MS4A 3BF7A 3KQTA 4UUPA 4TLEA 3AWDA 3TW7A 4UMVA 1TKBA 4YV7A 3U7HB 1N6HA 3PUYA 1ZOOA 3LHSA 3GAZA 4UBIA 5AVTA 4WZZA 4A8TA 1VFPA 2QZJA 1B2RA 2H4FA 5GOTA 4DV0H 4FLMA 5HUJA 1M2JA 1V7QA 2ZZNA 1Q1AA 3Q7TA 5LPNA 5FOVA 2ZWVA 2P69A 1D8AA 1PK9A 3IAM6 3ZLUA 2PH5A 4RD2A 4YJGA 1KQFA 3PJEA 2BKUA 2PUWA 3K16A 3QXCA 4LJYA 2EDAA 4XD7D 4FSDA 4J6FA 5LA6B 4CDGA 2C7VA 4O7VA 2QJTA 4EA8A 1NR7A 4YJ3A 1ZN9A 3KZ1E 1NLMA 1WG8A 4LWZA 4MLPA 2E2WA 3WJ7A 3DXXA 1Q1EA 3VTAA 3GTPA 3O4IA 3VH1A 3HFGA 2QN1A 4F3TA 4M6WA 1KNQA 3H18A 5F1PA 5F1KA 4E5NA 5A2GA 3ECSA 1AGNA 4O1HA 4URYR 3GFBA 4MRMB 3I2JA 5FCDA 4RTPA 3THXB 3A4NA 2J0QA 4G01B 4GO1A 4DA4A 4QTTB 1K88A 2FFQA 1HLFA 5T8KA 4QXMA 1CY8A 2DY0A 4K9RA 2AGPA 4S35A 4GKBA 1Z6GA 1QRSA 1E9EA 3WGJA 4XLLA 3RSCA 3QFRA 4QYTA 5KSYA 1RYHA 2IEIA 1W2GA 1OE0A 3E05A 3IYLW 1EWRA 4FFWA 4JL5A 2P2ZA 2XKBA 4M8LA 3RHZA 1DJQA 2CMDA 2Q9UA 2QG9A 3WK4A 3WLFA 3QUCA 3JS5A 2G8LA 1L1FA 1NXWA 4H3SA 3A31A 4D9EA 1ISFA 3CVJA 2QXUA 3I9NA 3LCJA 1Y3HA 1ZVJA 1DWOA 1XTVA 2YMLA 4CFZA 3HKDB 5AVZA 1WUYA 1GARA 5GJWC 4F71A 1JG3A 3FPEA 3B2EA 4NFYA 4YFVA 2PLFA 3ILXA 1TKAA 1E0KA 1NBMD 3LRTA 3GLKA 1VBGA 1BGWA 4EBDA 1JAHA 2V6MA 4KQCA 5AK6A 5IARA 5JAUA 2V9WA 3DKIA 4MP6A 4RCYA 1GAEO 1KTVA 5J4HA 1UMCA 4BMSA 1UOOA 1G4UR 5AW2A 2CL0X 4KG7A 1I30A 3JQAA 1Z17A 3GJTA 4ZV7A 4FT4A 4IO0A 4NK5A 1GCAA 4PGGA 5FWYA 2XQFA 1EWQA 4CETA 5JT1A 5C53B 3OJ0A 3OT1B 2BKVA 3R6LA 5CX1B 3RPEA 2VA3A 3A3KA 3D7MA 3OMXA 1EK6A 2I7CA 3L8DA 4DVJA 4G23A 4BDTA 1CUJA 1MT3A 1JU3A 1KY4A 5DCLA 4DT1A 3DBIA 1FMFA 3BEDA 3P26A 1GT91 1BMQA 2BR5A 4MR7B 4M89A 5T64A 2WIDA 3RRYA 4PPNA 2WB2A 4M7PA 2ON6A 1NW3A 3GHHA 3K2QA 4HAWA 1QBGA 4GC5A 2X2EA 2WFAA 4PGHA 3WNCA 5ECWA 4LF4B 3ANSA 3QWHA 2I76A 2PSDA 1DBRA 4I55B 4RSMA 4FX2A 3QJ5A 3AZPA 4JV2A 2FFAA 1IE3A 2OSBA 1YI1A 1G5PA 3E58A 1H8ED 3G49A 4GMGA 1PFQA 4IDEA 4UUNA 3WVNA 4IG4A 4TTQA 2BY4A 4Q9JA 1B41A 2GETA 4HQLA 3R24A 3TBFA 2BGNA 3WG9A 3GJRA 2XMZA 3PQ8A 1XK7A 1IRIA