4MAPA

Crystal structure of ara h 8 purified with heating
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
b'GVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ara h 8 allergen
publication title Structure and Function of the Peanut Panallergen Ara h 8.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Plant protein
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4mapA00
3P51A 2E3QA 2A1LA 2IL5A 4JDAA 4LGAA 1TW0A 4BKDA 2VQ5A 2GKDA 3P0LA 4IGWA 1LN1A 3W9KA 4M9WA 1EM2A 2KF2A 2QPVA 4Q0KA 5JO2A 2L65A 3F08A 4A86A 3PUTA 3OQUA 4C9IA 2LGHA 3NMPA 3GGNA 2LEQA 2LE1A 3NMNA 3Q64A 1T27A 3QSZA 4A87A 4JDLA 3NJOA 3UJLA 4R7KA 4DSCA 3NEFA 1JSSA 4BK6A 3JRSA 2D4RA 3NJ0A 4N0GC 4A85A 1XDFA 2KCZA 4WVOA 5I9JA 4MNSA 1Z94A 4C9CA 3IJTA 3KAZA 1B6FA 4A8VA 3CNWA 1TXCA 3NMTA 2E3PA 4A8UA 3TVRA 3RT2A 4JHHA 1UW5A 2E3OA 4BKCA 2PSOA 4M9BA 2RESA 3FO5A 5E4MA 3ZVUA 3OTLA 3OH8A 5C9YA 4XRWA 3H3TA 1QMRA 2PCSA 2BK0A 3TFZA 2E3SA 1XFSA 4A8GA 5I8FA 2I9YA 3Q63A 3KB0A 3R6PA 3RT0C 3KLXA 3UIDA 4BTZA 2Q3QA 3NMHA 3E85A 2E3RA 1LLTA 2MOUA 2Z9YA 2VNEA 2LPXA 4A88A 5JNNA 1VJHA 2L9PA 3KAYA 4IHRA 3TL1A 2FFSA 3UQHA 2WQLA 3W9RA 4IGVA 4DS8A 1XN6A 2RERA 2NN5A 2LF2A 4Y31A 4OICA 4MAPA 3NMVA 2L8OA 4B9RA 1X53A 2KTEA 2N4AA 3NI8A 1IFVA 3TVQA 3H3SA 3NEGA 4BK7A 3RD6A 5E4DA 3P9VA 5JO1A 2M47A 4IH0A 2KEWA 1FM4A 1ZXFA 5BRLA 3JRQB 2Z9ZA 4A81A 4Z3LA 5E4BA 3KB3A 2M89A 4JHGA 2LCGA 3KDIA 2R55A 2REZA 1LN3A 3NJ1A 4N3EA 3PU2A 4FPWA 3QN1A 1XN5A 4JHIA 4REHA 1BTVA 3NS2A 5E46A 4REIA 1KCMA 3H3RA 4IGYA 3KDHA 2NS9A 1E09A 2QIMA 2FLHA 4XRTA 4A83A 4RYVA 1ICXA 3C0VA 2LUZA 2E3MA 3NR4A 4REJA 2N4BA 3OJIA 5AMWA 3WG8A 3H3QA 1FSKA 2EJXA 4LA7A 4PSBA 3IE5A 4IGXA 1LN2A 2K5GA 2LDKA 4DSBA 2E3NA 3KDJA 4LG5A 4A80A 2LAKA 4A84A 4LGBA 4GY9A 3ELIA 3KL1A 4C94A 1XUVA 1H2OA 4MA6A 4IH2A 2LIOA 2K7HA 3Q6AA 4QIPA 3K90A 1BV1A 3K3KA 1T17A
chains in the Genus database with same CATH superfamily
3P51A 5EKQC 2E3QA 2A1LA 2IL5A 4JDAA 4KPYA 4NCBA 4LGAA 1TW0A 4QDDA 4BKDA 2VQ5A 2GKDA 3P0LA 3DLHA 4IGWA 1LN1A 3W9KA 4M9WA 1EM2A 2KF2A 2QPVA 4Q0KA 5JO2A 2L65A 3F08A 4A86A 3F73A 4N76A 3PUTA 3OQUA 4C9IA 2LGHA 3NMPA 3GGNA 2LEQA 2LE1A 3NMNA 3Q64A 1T27A 3GB4A 3QSZA 4JDLA 4QDFA 4A87A 3NJOA 3UJLA 4NCAA 4R7KA 4DSCA 4N47A 3NEFA 1JSSA 4BK6A 3JRSA 2D4RA 3NJ0A 4N0GC 4QDFB 3HJFA 4A85A 1XDFA 2KCZA 4WVOA 5I9JA 4MNSA 4E6FA 1Z94A 4C9CA 3IJTA 3KAZA 1B6FA 3GTSA 4A8VA 3CNWA 1TXCA 3NMTA 2E3PA 4A8UA 3TVRA 3RT2A 4JHHA 1UW5A 2E3OA 4BKCA 2PSOA 4M9BA 2RESA 3FO5A 5E4MA 3ZVUA 3HVRA 3OTLA 3OH8A 5C9YA 4XRWA 3H3TA 2LAFA 1QMRA 2PCSA 2BK0A 3TFZA 2E3SA 2YH6A 1XFSA 4A8GA 5I8FA 2I9YA 3Q63A 3KB0A 3R6PA 3RT0C 3KLXA 3UIDA 4BTZA 2Q3QA 3NMHA 3E85A 3NQNA 2E3RA 1LLTA 2MOUA 2Z9YA 2VNEA 2LPXA 4A88A 5JNNA 1VJHA 2L9PA 3KAYA 4IHRA 3TL1A 2FFSA 3UQHA 2WQLA 3W9RA 4IGVA 4DS8A 1XN6A 2RERA 2NN5A 2LF2A 4QCKA 4Y31A 3HXMA 4OICA 4MAPA 3NMVA 3HO1A 2L8OA 4N41A 4B9RA 1X53A 2KTEA 2N4AA 3NI8A 1IFVA 3TVQA 3H3SA 3NEGA 4BK7A 3RD6A 5E4DA 3P9VA 5JO1A 2M47A 4IH0A 2KEWA 1FM4A 1ZXFA 5BRLA 3JRQB 2Z9ZA 4A81A 4Z3LA 5E4BA 3GL0A 3KB3A 2M89A 4JHGA 2LCGA 3KDIA 4QDCA 3TGOC 2R55A 2REZA 1LN3A 3NJ1A 4N3EA 3PU2A 4FPWA 3QN1A 1XN5A 4JHIA 3GKEA 4REHA 1BTVA 3NS2A 5E46A 4REIA 1KCMA 3H3RA 4IGYA 3KDHA 2NS9A 1E09A 2QIMA 2FLHA 4XRTA 4A83A 4RYVA 3HK2A 1ICXA 3GTEA 3C0VA 3GOBA 2LUZA 2E3MA 3HM9A 3NR4A 4REJA 2N4BA 3OJIA 5AMWA 3WG8A 3H3QA 1FSKA 2EJXA 4LA7A 4PSBA 3IE5A 4IGXA 1LN2A 2K5GA 2LDKA 4JHYA 4DSBA 2E3NA 3KDJA 4LG5A 4A80A 2LAKA 4A84A 3GL2A 2ZYLA 4LGBA 3DLBA 4GY9A 3ELIA 3KL1A 4C94A 1XUVA 1H2OA 4MA6A 4IH2A 2LIOA 2K7HA 3Q6AA 4QIPA 3K90A 1BV1A 3K3KA 1T17A
chains in the Genus database with same CATH topology
3P51A 5EKQC 2E3QA 2A1LA 2IL5A 4JDAA 4KPYA 4NCBA 4LGAA 1TW0A 4QDDA 4BKDA 2VQ5A 2GKDA 3P0LA 3DLHA 4IGWA 1LN1A 3W9KA 4M9WA 1EM2A 2KF2A 2QPVA 4Q0KA 5JO2A 2L65A 3F08A 4A86A 3F73A 4N76A 3PUTA 3OQUA 4C9IA 2LGHA 3NMPA 3GGNA 2LEQA 2LE1A 3NMNA 3Q64A 1T27A 3GB4A 3QSZA 4JDLA 4QDFA 4A87A 3NJOA 3UJLA 4NCAA 4R7KA 4DSCA 4N47A 3NEFA 1JSSA 4BK6A 3JRSA 2D4RA 3NJ0A 4N0GC 4QDFB 3HJFA 4A85A 1XDFA 2KCZA 4WVOA 5I9JA 4MNSA 4E6FA 1Z94A 4C9CA 3IJTA 3KAZA 1B6FA 3GTSA 4A8VA 3CNWA 1TXCA 3NMTA 2E3PA 4A8UA 3TVRA 3RT2A 4JHHA 1UW5A 2E3OA 4BKCA 2PSOA 4M9BA 2RESA 3FO5A 5E4MA 3ZVUA 3HVRA 3OTLA 3OH8A 5C9YA 4XRWA 3H3TA 2LAFA 1QMRA 2PCSA 2BK0A 3TFZA 2E3SA 2YH6A 1XFSA 4A8GA 5I8FA 2I9YA 3Q63A 3KB0A 3R6PA 3RT0C 3KLXA 3UIDA 4BTZA 2Q3QA 3NMHA 3E85A 3NQNA 2E3RA 1LLTA 2MOUA 2Z9YA 2VNEA 2LPXA 4A88A 5JNNA 1VJHA 2L9PA 3KAYA 4IHRA 3TL1A 2FFSA 3UQHA 2WQLA 3W9RA 4IGVA 4DS8A 1XN6A 2RERA 2NN5A 2LF2A 4QCKA 4Y31A 3HXMA 4OICA 4MAPA 3NMVA 3HO1A 2L8OA 4N41A 4B9RA 1X53A 2KTEA 2N4AA 3NI8A 1IFVA 3TVQA 3H3SA 3NEGA 4BK7A 3RD6A 5E4DA 3P9VA 5JO1A 2M47A 4IH0A 2KEWA 1FM4A 1ZXFA 5BRLA 3JRQB 2Z9ZA 4A81A 4Z3LA 5E4BA 3GL0A 3KB3A 2M89A 4JHGA 2LCGA 3KDIA 4QDCA 3TGOC 2R55A 2REZA 1LN3A 3NJ1A 4N3EA 3PU2A 4FPWA 3QN1A 1XN5A 4JHIA 3GKEA 4REHA 1BTVA 3NS2A 5E46A 4REIA 1KCMA 3H3RA 4IGYA 3KDHA 2NS9A 1E09A 2QIMA 2FLHA 4XRTA 4A83A 4RYVA 3HK2A 1ICXA 3GTEA 3C0VA 3GOBA 2LUZA 2E3MA 3HM9A 3NR4A 4REJA 2N4BA 3OJIA 5AMWA 3WG8A 3H3QA 1FSKA 2EJXA 4LA7A 4PSBA 3IE5A 4IGXA 1LN2A 2K5GA 2LDKA 4JHYA 4DSBA 2E3NA 3KDJA 4LG5A 4A80A 2LAKA 4A84A 3GL2A 2ZYLA 4LGBA 3DLBA 4GY9A 3ELIA 3KL1A 4C94A 1XUVA 1H2OA 4MA6A 4IH2A 2LIOA 2K7HA 3Q6AA 4QIPA 3K90A 1BV1A 3K3KA 1T17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P51 A;  2E3Q A;  2A1L A;  2IL5 A;  4JDA A;  4LGA A;  1TW0 A;  4BKD A;  2VQ5 A;  2GKD A;  3P0L A;  4IGW A;  1LN1 A;  3W9K A;  4M9W A;  1EM2 A;  2KF2 A;  2QPV A;  4Q0K A;  5JO2 A;  2L65 A;  3F08 A;  4A86 A;  3PUT A;  3OQU A;  4C9I A;  2LGH A;  3NMP A;  3GGN A;  2LEQ A;  2LE1 A;  3NMN A;  3Q64 A;  1T27 A;  3QSZ A;  4A87 A;  4JDL A;  3NJO A;  3UJL A;  4R7K A;  4DSC A;  3NEF A;  1JSS A;  4BK6 A;  3JRS A;  2D4R A;  3NJ0 A;  4N0G C;  4A85 A;  1XDF A;  2KCZ A;  4WVO A;  5I9J A;  4MNS A;  1Z94 A;  4C9C A;  3IJT A;  3KAZ A;  1B6F A;  4A8V A;  3CNW A;  1TXC A;  3NMT A;  2E3P A;  4A8U A;  3TVR A;  3RT2 A;  4JHH A;  1UW5 A;  2E3O A;  4BKC A;  2PSO A;  4M9B A;  2RES A;  3FO5 A;  5E4M A;  3ZVU A;  3OTL A;  3OH8 A;  5C9Y A;  4XRW A;  3H3T A;  1QMR A;  2PCS A;  2BK0 A;  3TFZ A;  2E3S A;  1XFS A;  4A8G A;  5I8F A;  2I9Y A;  3Q63 A;  3KB0 A;  3R6P A;  3RT0 C;  3KLX A;  3UID A;  4BTZ A;  2Q3Q A;  3NMH A;  3E85 A;  2E3R A;  1LLT A;  2MOU A;  2Z9Y A;  2VNE A;  2LPX A;  4A88 A;  5JNN A;  1VJH A;  2L9P A;  3KAY A;  4IHR A;  3TL1 A;  2FFS A;  3UQH A;  2WQL A;  3W9R A;  4IGV A;  4DS8 A;  1XN6 A;  2RER A;  2NN5 A;  2LF2 A;  4Y31 A;  4OIC A;  4MAP A;  3NMV A;  2L8O A;  4B9R A;  1X53 A;  2KTE A;  2N4A A;  3NI8 A;  1IFV A;  3TVQ A;  3H3S A;  3NEG A;  4BK7 A;  3RD6 A;  5E4D A;  3P9V A;  5JO1 A;  2M47 A;  4IH0 A;  2KEW A;  1FM4 A;  1ZXF A;  5BRL A;  3JRQ B;  2Z9Z A;  4A81 A;  4Z3L A;  5E4B A;  3KB3 A;  2M89 A;  4JHG A;  2LCG A;  3KDI A;  2R55 A;  2REZ A;  1LN3 A;  3NJ1 A;  4N3E A;  3PU2 A;  4FPW A;  3QN1 A;  1XN5 A;  4JHI A;  4REH A;  1BTV A;  3NS2 A;  5E46 A;  4REI A;  1KCM A;  3H3R A;  4IGY A;  3KDH A;  2NS9 A;  1E09 A;  2QIM A;  2FLH A;  4XRT A;  4A83 A;  4RYV A;  1ICX A;  3C0V A;  2LUZ A;  2E3M A;  3NR4 A;  4REJ A;  2N4B A;  3OJI A;  5AMW A;  3WG8 A;  3H3Q A;  1FSK A;  2EJX A;  4LA7 A;  4PSB A;  3IE5 A;  4IGX A;  1LN2 A;  2K5G A;  2LDK A;  4DSB A;  2E3N A;  3KDJ A;  4LG5 A;  4A80 A;  2LAK A;  4A84 A;  4LGB A;  4GY9 A;  3ELI A;  3KL1 A;  4C94 A;  1XUV A;  1H2O A;  4MA6 A;  4IH2 A;  2LIO A;  2K7H A;  3Q6A A;  4QIP A;  3K90 A;  1BV1 A;  3K3K A;  1T17 A; 
#chains in the Genus database with same CATH topology
 3P51 A;  5EKQ C;  2E3Q A;  2A1L A;  2IL5 A;  4JDA A;  4KPY A;  4NCB A;  4LGA A;  1TW0 A;  4QDD A;  4BKD A;  2VQ5 A;  2GKD A;  3P0L A;  3DLH A;  4IGW A;  1LN1 A;  3W9K A;  4M9W A;  1EM2 A;  2KF2 A;  2QPV A;  4Q0K A;  5JO2 A;  2L65 A;  3F08 A;  4A86 A;  3F73 A;  4N76 A;  3PUT A;  3OQU A;  4C9I A;  2LGH A;  3NMP A;  3GGN A;  2LEQ A;  2LE1 A;  3NMN A;  3Q64 A;  1T27 A;  3GB4 A;  3QSZ A;  4JDL A;  4QDF A;  4A87 A;  3NJO A;  3UJL A;  4NCA A;  4R7K A;  4DSC A;  4N47 A;  3NEF A;  1JSS A;  4BK6 A;  3JRS A;  2D4R A;  3NJ0 A;  4N0G C;  4QDF B;  3HJF A;  4A85 A;  1XDF A;  2KCZ A;  4WVO A;  5I9J A;  4MNS A;  4E6F A;  1Z94 A;  4C9C A;  3IJT A;  3KAZ A;  1B6F A;  3GTS A;  4A8V A;  3CNW A;  1TXC A;  3NMT A;  2E3P A;  4A8U A;  3TVR A;  3RT2 A;  4JHH A;  1UW5 A;  2E3O A;  4BKC A;  2PSO A;  4M9B A;  2RES A;  3FO5 A;  5E4M A;  3ZVU A;  3HVR A;  3OTL A;  3OH8 A;  5C9Y A;  4XRW A;  3H3T A;  2LAF A;  1QMR A;  2PCS A;  2BK0 A;  3TFZ A;  2E3S A;  2YH6 A;  1XFS A;  4A8G A;  5I8F A;  2I9Y A;  3Q63 A;  3KB0 A;  3R6P A;  3RT0 C;  3KLX A;  3UID A;  4BTZ A;  2Q3Q A;  3NMH A;  3E85 A;  3NQN A;  2E3R A;  1LLT A;  2MOU A;  2Z9Y A;  2VNE A;  2LPX A;  4A88 A;  5JNN A;  1VJH A;  2L9P A;  3KAY A;  4IHR A;  3TL1 A;  2FFS A;  3UQH A;  2WQL A;  3W9R A;  4IGV A;  4DS8 A;  1XN6 A;  2RER A;  2NN5 A;  2LF2 A;  4QCK A;  4Y31 A;  3HXM A;  4OIC A;  4MAP A;  3NMV A;  3HO1 A;  2L8O A;  4N41 A;  4B9R A;  1X53 A;  2KTE A;  2N4A A;  3NI8 A;  1IFV A;  3TVQ A;  3H3S A;  3NEG A;  4BK7 A;  3RD6 A;  5E4D A;  3P9V A;  5JO1 A;  2M47 A;  4IH0 A;  2KEW A;  1FM4 A;  1ZXF A;  5BRL A;  3JRQ B;  2Z9Z A;  4A81 A;  4Z3L A;  5E4B A;  3GL0 A;  3KB3 A;  2M89 A;  4JHG A;  2LCG A;  3KDI A;  4QDC A;  3TGO C;  2R55 A;  2REZ A;  1LN3 A;  3NJ1 A;  4N3E A;  3PU2 A;  4FPW A;  3QN1 A;  1XN5 A;  4JHI A;  3GKE A;  4REH A;  1BTV A;  3NS2 A;  5E46 A;  4REI A;  1KCM A;  3H3R A;  4IGY A;  3KDH A;  2NS9 A;  1E09 A;  2QIM A;  2FLH A;  4XRT A;  4A83 A;  4RYV A;  3HK2 A;  1ICX A;  3GTE A;  3C0V A;  3GOB A;  2LUZ A;  2E3M A;  3HM9 A;  3NR4 A;  4REJ A;  2N4B A;  3OJI A;  5AMW A;  3WG8 A;  3H3Q A;  1FSK A;  2EJX A;  4LA7 A;  4PSB A;  3IE5 A;  4IGX A;  1LN2 A;  2K5G A;  2LDK A;  4JHY A;  4DSB A;  2E3N A;  3KDJ A;  4LG5 A;  4A80 A;  2LAK A;  4A84 A;  3GL2 A;  2ZYL A;  4LGB A;  3DLB A;  4GY9 A;  3ELI A;  3KL1 A;  4C94 A;  1XUV A;  1H2O A;  4MA6 A;  4IH2 A;  2LIO A;  2K7H A;  3Q6A A;  4QIP A;  3K90 A;  1BV1 A;  3K3K A;  1T17 A; 
#chains in the Genus database with same CATH homology
 3P51 A;  5EKQ C;  2E3Q A;  2A1L A;  2IL5 A;  4JDA A;  4KPY A;  4NCB A;  4LGA A;  1TW0 A;  4QDD A;  4BKD A;  2VQ5 A;  2GKD A;  3P0L A;  3DLH A;  4IGW A;  1LN1 A;  3W9K A;  4M9W A;  1EM2 A;  2KF2 A;  2QPV A;  4Q0K A;  5JO2 A;  2L65 A;  3F08 A;  4A86 A;  3F73 A;  4N76 A;  3PUT A;  3OQU A;  4C9I A;  2LGH A;  3NMP A;  3GGN A;  2LEQ A;  2LE1 A;  3NMN A;  3Q64 A;  1T27 A;  3GB4 A;  3QSZ A;  4JDL A;  4QDF A;  4A87 A;  3NJO A;  3UJL A;  4NCA A;  4R7K A;  4DSC A;  4N47 A;  3NEF A;  1JSS A;  4BK6 A;  3JRS A;  2D4R A;  3NJ0 A;  4N0G C;  4QDF B;  3HJF A;  4A85 A;  1XDF A;  2KCZ A;  4WVO A;  5I9J A;  4MNS A;  4E6F A;  1Z94 A;  4C9C A;  3IJT A;  3KAZ A;  1B6F A;  3GTS A;  4A8V A;  3CNW A;  1TXC A;  3NMT A;  2E3P A;  4A8U A;  3TVR A;  3RT2 A;  4JHH A;  1UW5 A;  2E3O A;  4BKC A;  2PSO A;  4M9B A;  2RES A;  3FO5 A;  5E4M A;  3ZVU A;  3HVR A;  3OTL A;  3OH8 A;  5C9Y A;  4XRW A;  3H3T A;  2LAF A;  1QMR A;  2PCS A;  2BK0 A;  3TFZ A;  2E3S A;  2YH6 A;  1XFS A;  4A8G A;  5I8F A;  2I9Y A;  3Q63 A;  3KB0 A;  3R6P A;  3RT0 C;  3KLX A;  3UID A;  4BTZ A;  2Q3Q A;  3NMH A;  3E85 A;  3NQN A;  2E3R A;  1LLT A;  2MOU A;  2Z9Y A;  2VNE A;  2LPX A;  4A88 A;  5JNN A;  1VJH A;  2L9P A;  3KAY A;  4IHR A;  3TL1 A;  2FFS A;  3UQH A;  2WQL A;  3W9R A;  4IGV A;  4DS8 A;  1XN6 A;  2RER A;  2NN5 A;  2LF2 A;  4QCK A;  4Y31 A;  3HXM A;  4OIC A;  4MAP A;  3NMV A;  3HO1 A;  2L8O A;  4N41 A;  4B9R A;  1X53 A;  2KTE A;  2N4A A;  3NI8 A;  1IFV A;  3TVQ A;  3H3S A;  3NEG A;  4BK7 A;  3RD6 A;  5E4D A;  3P9V A;  5JO1 A;  2M47 A;  4IH0 A;  2KEW A;  1FM4 A;  1ZXF A;  5BRL A;  3JRQ B;  2Z9Z A;  4A81 A;  4Z3L A;  5E4B A;  3GL0 A;  3KB3 A;  2M89 A;  4JHG A;  2LCG A;  3KDI A;  4QDC A;  3TGO C;  2R55 A;  2REZ A;  1LN3 A;  3NJ1 A;  4N3E A;  3PU2 A;  4FPW A;  3QN1 A;  1XN5 A;  4JHI A;  3GKE A;  4REH A;  1BTV A;  3NS2 A;  5E46 A;  4REI A;  1KCM A;  3H3R A;  4IGY A;  3KDH A;  2NS9 A;  1E09 A;  2QIM A;  2FLH A;  4XRT A;  4A83 A;  4RYV A;  3HK2 A;  1ICX A;  3GTE A;  3C0V A;  3GOB A;  2LUZ A;  2E3M A;  3HM9 A;  3NR4 A;  4REJ A;  2N4B A;  3OJI A;  5AMW A;  3WG8 A;  3H3Q A;  1FSK A;  2EJX A;  4LA7 A;  4PSB A;  3IE5 A;  4IGX A;  1LN2 A;  2K5G A;  2LDK A;  4JHY A;  4DSB A;  2E3N A;  3KDJ A;  4LG5 A;  4A80 A;  2LAK A;  4A84 A;  3GL2 A;  2ZYL A;  4LGB A;  3DLB A;  4GY9 A;  3ELI A;  3KL1 A;  4C94 A;  1XUV A;  1H2O A;  4MA6 A;  4IH2 A;  2LIO A;  2K7H A;  3Q6A A;  4QIP A;  3K90 A;  1BV1 A;  3K3K A;  1T17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...