4MAPA

Crystal structure of ara h 8 purified with heating
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
GVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ara h 8 allergen
publication title Structure and Function of the Peanut Panallergen Ara h 8.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Plant protein
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4mapA00
4MNSA 2EJXA 5JNNA 2Z9YA 2NS9A 3NR4A 3ELIA 4IH2A 3NMNA 1B6FA 2LGHA 4XRTA 3KAYA 4Y31A 3W9RA 2LF2A 1LN2A 4OICA 2GKDA 1XDFA 2E3RA 1IFVA 3OJIA 1XN6A 4JHHA 4PSBA 3NMPA 1LLTA 3K3KA 2KCZA 5I9JA 4BKDA 3TVQA 4LGBA 1ZXFA 2M89A 3TVRA 3KLXA 2VNEA 4A8VA 4N3EA 4BK6A 3NJ1A 4JDLA 2N4BA 3TL1A 3Q64A 3P51A 4BTZA 5E46A 3Q6AA 2E3OA 4DSCA 1T17A 4C9CA 4LG5A 2PCSA 5E4DA 3W9KA 4JHGA 1EM2A 2LCGA 3KB0A 1T27A 4C94A 3RT2A 4A8UA 3UIDA 4IH0A 3RT0C 1BV1A 3NMTA 4A85A 4A81A 2WQLA 1TW0A 2NN5A 3H3QA 3H3TA 3KDJA 4A87A 2R55A 4B9RA 2MOUA 2PSOA 4BK7A 2E3PA 3UJLA 4XRWA 3PU2A 1FM4A 4A86A 1TXCA 3OH8A 4GY9A 3KL1A 4REIA 4MAPA 3RD6A 3NS2A 2E3QA 3ZVUA 3NJOA 1FSKA 3JRSA 2VQ5A 1XN5A 3IE5A 3P0LA 1X53A 2A1LA 2L8OA 3CNWA 4IGYA 3TFZA 2FFSA 4M9BA 1QMRA 3KDHA 3QN1A 4A8GA 4DSBA 2Z9ZA 2I9YA 3IJTA 4Z3LA 2L65A 3KDIA 2QIMA 4RYVA 2LAKA 4LGAA 4LA7A 4REJA 4IHRA 1E09A 1XUVA 2LUZA 3FO5A 3PUTA 4IGXA 1UW5A 3GGNA 3OTLA 5AMWA 4A80A 1LN3A 5C9YA 3Q63A 2RERA 4JHIA 5E4MA 3JRQB 1H2OA 3NI8A 4R7KA 2LPXA 1ICXA 3OQUA 4FPWA 2E3MA 3KAZA 2KEWA 3NMVA 4MA6A 2N4AA 2Q3QA 3KB3A 3H3SA 4M9WA 1LN1A 3NJ0A 3R6PA 2K7HA 4REHA 2M47A 4QIPA 3UQHA 2K5GA 2RESA 3F08A 4A83A 4JDAA 5BRLA 1Z94A 2FLHA 2IL5A 1BTVA 4IGWA 4WVOA 2KF2A 5I8FA 3P9VA 4C9IA 3NEGA 2LE1A 2E3SA 2D4RA 4A88A 4BKCA 3H3RA 1XFSA 2KTEA 3C0VA 1JSSA 3E85A 3QSZA 3WG8A 5JO2A 5JO1A 2L9PA 2BK0A 1KCMA 2E3NA 1VJHA 2LDKA 2LIOA 3NEFA 3NMHA 4N0GC 5E4BA 4A84A 4DS8A 3K90A 2LEQA 4IGVA 2REZA 4Q0KA 2QPVA
chains in the Genus database with same CATH superfamily
4MNSA 2EJXA 3HK2A 5JNNA 2Z9YA 2NS9A 3NR4A 3ELIA 4IH2A 3NMNA 1B6FA 2LGHA 4N47A 4XRTA 3KAYA 4Y31A 3W9RA 2LF2A 1LN2A 4OICA 2GKDA 4NCBA 1XDFA 2E3RA 1IFVA 3OJIA 1XN6A 4JHHA 4PSBA 4QDDA 3NMPA 1LLTA 3K3KA 2KCZA 5I9JA 4BKDA 4QDCA 3TVQA 4LGBA 1ZXFA 2M89A 3TVRA 3KLXA 2VNEA 4A8VA 3GB4A 4N3EA 4BK6A 3NJ1A 4JDLA 3HVRA 2N4BA 3TL1A 3Q64A 3P51A 4BTZA 5E46A 3Q6AA 2E3OA 3GL2A 4DSCA 1T17A 3DLHA 4C9CA 4LG5A 2PCSA 5E4DA 3W9KA 4JHGA 1EM2A 2LCGA 3KB0A 1T27A 4C94A 3RT2A 4A8UA 3UIDA 4IH0A 3RT0C 1BV1A 3NQNA 3NMTA 3TGOC 3GTSA 4A81A 4A85A 2WQLA 1TW0A 2NN5A 3H3QA 3H3TA 3KDJA 4A87A 3HO1A 2R55A 4B9RA 3GKEA 2MOUA 2PSOA 2ZYLA 4BK7A 3HXMA 2E3PA 3UJLA 4XRWA 3PU2A 1FM4A 4A86A 1TXCA 3OH8A 2LAFA 4GY9A 3DLBA 3KL1A 4REIA 4MAPA 3RD6A 3NS2A 2E3QA 3ZVUA 4KPYA 3NJOA 1FSKA 3JRSA 2VQ5A 1XN5A 3IE5A 3P0LA 1X53A 2A1LA 2L8OA 3CNWA 4IGYA 3TFZA 4N41A 2FFSA 4M9BA 1QMRA 4E6FA 3HM9A 3KDHA 3QN1A 4A8GA 4DSBA 2Z9ZA 2I9YA 3IJTA 4Z3LA 2L65A 4QDFA 3KDIA 4JHYA 2QIMA 4RYVA 2LAKA 4LGAA 4LA7A 4REJA 4IHRA 1E09A 1XUVA 2LUZA 3FO5A 3PUTA 4IGXA 1UW5A 3GGNA 3GOBA 3OTLA 5AMWA 4A80A 1LN3A 5C9YA 4NCAA 3Q63A 2RERA 4JHIA 5E4MA 3JRQB 1H2OA 3NI8A 4R7KA 2LPXA 1ICXA 3OQUA 4FPWA 4QCKA 2E3MA 3KAZA 2KEWA 3NMVA 4MA6A 3HJFA 2N4AA 2Q3QA 3GL0A 3KB3A 3H3SA 4M9WA 1LN1A 3NJ0A 3R6PA 2K7HA 4REHA 2M47A 4QIPA 3UQHA 2K5GA 2RESA 3F08A 4A83A 4JDAA 5BRLA 3GTEA 1Z94A 2FLHA 2IL5A 1BTVA 4IGWA 4WVOA 2KF2A 5I8FA 3P9VA 4C9IA 3NEGA 2LE1A 2E3SA 2D4RA 4A88A 4BKCA 4N76A 3H3RA 1XFSA 2KTEA 3C0VA 4QDFB 5EKQC 1JSSA 3E85A 3QSZA 3WG8A 5JO2A 5JO1A 2L9PA 2BK0A 1KCMA 2E3NA 1VJHA 2LDKA 2LIOA 3NEFA 3NMHA 4N0GC 5E4BA 4A84A 4DS8A 2YH6A 3K90A 2LEQA 4IGVA 2REZA 3F73A 4Q0KA 2QPVA
chains in the Genus database with same CATH topology
4MNSA 2EJXA 3HK2A 5JNNA 2Z9YA 2NS9A 3NR4A 3ELIA 4IH2A 3NMNA 1B6FA 2LGHA 4N47A 4XRTA 3KAYA 4Y31A 3W9RA 2LF2A 1LN2A 4OICA 2GKDA 4NCBA 1XDFA 2E3RA 1IFVA 3OJIA 1XN6A 4JHHA 4PSBA 4QDDA 3NMPA 1LLTA 3K3KA 2KCZA 5I9JA 4BKDA 4QDCA 3TVQA 4LGBA 1ZXFA 2M89A 3TVRA 3KLXA 2VNEA 4A8VA 3GB4A 4N3EA 4BK6A 3NJ1A 4JDLA 3HVRA 2N4BA 3TL1A 3Q64A 3P51A 4BTZA 5E46A 3Q6AA 2E3OA 3GL2A 4DSCA 1T17A 3DLHA 4C9CA 4LG5A 2PCSA 5E4DA 3W9KA 4JHGA 1EM2A 2LCGA 3KB0A 1T27A 4C94A 3RT2A 4A8UA 3UIDA 4IH0A 3RT0C 1BV1A 3NQNA 3NMTA 3TGOC 3GTSA 4A81A 4A85A 2WQLA 1TW0A 2NN5A 3H3QA 3H3TA 3KDJA 4A87A 3HO1A 2R55A 4B9RA 3GKEA 2MOUA 2PSOA 2ZYLA 4BK7A 3HXMA 2E3PA 3UJLA 4XRWA 3PU2A 1FM4A 4A86A 1TXCA 3OH8A 2LAFA 4GY9A 3DLBA 3KL1A 4REIA 4MAPA 3RD6A 3NS2A 2E3QA 3ZVUA 4KPYA 3NJOA 1FSKA 3JRSA 2VQ5A 1XN5A 3IE5A 3P0LA 1X53A 2A1LA 2L8OA 3CNWA 4IGYA 3TFZA 4N41A 2FFSA 4M9BA 1QMRA 4E6FA 3HM9A 3KDHA 3QN1A 4A8GA 4DSBA 2Z9ZA 2I9YA 3IJTA 4Z3LA 2L65A 4QDFA 3KDIA 4JHYA 2QIMA 4RYVA 2LAKA 4LGAA 4LA7A 4REJA 4IHRA 1E09A 1XUVA 2LUZA 3FO5A 3PUTA 4IGXA 1UW5A 3GGNA 3GOBA 3OTLA 5AMWA 4A80A 1LN3A 5C9YA 4NCAA 3Q63A 2RERA 4JHIA 5E4MA 3JRQB 1H2OA 3NI8A 4R7KA 2LPXA 1ICXA 3OQUA 4FPWA 4QCKA 2E3MA 3KAZA 2KEWA 3NMVA 4MA6A 3HJFA 2N4AA 2Q3QA 3GL0A 3KB3A 3H3SA 4M9WA 1LN1A 3NJ0A 3R6PA 2K7HA 4REHA 2M47A 4QIPA 3UQHA 2K5GA 2RESA 3F08A 4A83A 4JDAA 5BRLA 3GTEA 1Z94A 2FLHA 2IL5A 1BTVA 4IGWA 4WVOA 2KF2A 5I8FA 3P9VA 4C9IA 3NEGA 2LE1A 2E3SA 2D4RA 4A88A 4BKCA 4N76A 3H3RA 1XFSA 2KTEA 3C0VA 4QDFB 5EKQC 1JSSA 3E85A 3QSZA 3WG8A 5JO2A 5JO1A 2L9PA 2BK0A 1KCMA 2E3NA 1VJHA 2LDKA 2LIOA 3NEFA 3NMHA 4N0GC 5E4BA 4A84A 4DS8A 2YH6A 3K90A 2LEQA 4IGVA 2REZA 3F73A 4Q0KA 2QPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNS A;  2EJX A;  5JNN A;  2Z9Y A;  2NS9 A;  3NR4 A;  3ELI A;  4IH2 A;  3NMN A;  1B6F A;  2LGH A;  4XRT A;  3KAY A;  4Y31 A;  3W9R A;  2LF2 A;  1LN2 A;  4OIC A;  2GKD A;  1XDF A;  2E3R A;  1IFV A;  3OJI A;  1XN6 A;  4JHH A;  4PSB A;  3NMP A;  1LLT A;  3K3K A;  2KCZ A;  5I9J A;  4BKD A;  3TVQ A;  4LGB A;  1ZXF A;  2M89 A;  3TVR A;  3KLX A;  2VNE A;  4A8V A;  4N3E A;  4BK6 A;  3NJ1 A;  4JDL A;  2N4B A;  3TL1 A;  3Q64 A;  3P51 A;  4BTZ A;  5E46 A;  3Q6A A;  2E3O A;  4DSC A;  1T17 A;  4C9C A;  4LG5 A;  2PCS A;  5E4D A;  3W9K A;  4JHG A;  1EM2 A;  2LCG A;  3KB0 A;  1T27 A;  4C94 A;  3RT2 A;  4A8U A;  3UID A;  4IH0 A;  3RT0 C;  1BV1 A;  3NMT A;  4A85 A;  4A81 A;  2WQL A;  1TW0 A;  2NN5 A;  3H3Q A;  3H3T A;  3KDJ A;  4A87 A;  2R55 A;  4B9R A;  2MOU A;  2PSO A;  4BK7 A;  2E3P A;  3UJL A;  4XRW A;  3PU2 A;  1FM4 A;  4A86 A;  1TXC A;  3OH8 A;  4GY9 A;  3KL1 A;  4REI A;  4MAP A;  3RD6 A;  3NS2 A;  2E3Q A;  3ZVU A;  3NJO A;  1FSK A;  3JRS A;  2VQ5 A;  1XN5 A;  3IE5 A;  3P0L A;  1X53 A;  2A1L A;  2L8O A;  3CNW A;  4IGY A;  3TFZ A;  2FFS A;  4M9B A;  1QMR A;  3KDH A;  3QN1 A;  4A8G A;  4DSB A;  2Z9Z A;  2I9Y A;  3IJT A;  4Z3L A;  2L65 A;  3KDI A;  2QIM A;  4RYV A;  2LAK A;  4LGA A;  4LA7 A;  4REJ A;  4IHR A;  1E09 A;  1XUV A;  2LUZ A;  3FO5 A;  3PUT A;  4IGX A;  1UW5 A;  3GGN A;  3OTL A;  5AMW A;  4A80 A;  1LN3 A;  5C9Y A;  3Q63 A;  2RER A;  4JHI A;  5E4M A;  3JRQ B;  1H2O A;  3NI8 A;  4R7K A;  2LPX A;  1ICX A;  3OQU A;  4FPW A;  2E3M A;  3KAZ A;  2KEW A;  3NMV A;  4MA6 A;  2N4A A;  2Q3Q A;  3KB3 A;  3H3S A;  4M9W A;  1LN1 A;  3NJ0 A;  3R6P A;  2K7H A;  4REH A;  2M47 A;  4QIP A;  3UQH A;  2K5G A;  2RES A;  3F08 A;  4A83 A;  4JDA A;  5BRL A;  1Z94 A;  2FLH A;  2IL5 A;  1BTV A;  4IGW A;  4WVO A;  2KF2 A;  5I8F A;  3P9V A;  4C9I A;  3NEG A;  2LE1 A;  2E3S A;  2D4R A;  4A88 A;  4BKC A;  3H3R A;  1XFS A;  2KTE A;  3C0V A;  1JSS A;  3E85 A;  3QSZ A;  3WG8 A;  5JO2 A;  5JO1 A;  2L9P A;  2BK0 A;  1KCM A;  2E3N A;  1VJH A;  2LDK A;  2LIO A;  3NEF A;  3NMH A;  4N0G C;  5E4B A;  4A84 A;  4DS8 A;  3K90 A;  2LEQ A;  4IGV A;  2REZ A;  4Q0K A;  2QPV A; 
#chains in the Genus database with same CATH topology
 4MNS A;  2EJX A;  3HK2 A;  5JNN A;  2Z9Y A;  2NS9 A;  3NR4 A;  3ELI A;  4IH2 A;  3NMN A;  1B6F A;  2LGH A;  4N47 A;  4XRT A;  3KAY A;  4Y31 A;  3W9R A;  2LF2 A;  1LN2 A;  4OIC A;  2GKD A;  4NCB A;  1XDF A;  2E3R A;  1IFV A;  3OJI A;  1XN6 A;  4JHH A;  4PSB A;  4QDD A;  3NMP A;  1LLT A;  3K3K A;  2KCZ A;  5I9J A;  4BKD A;  4QDC A;  3TVQ A;  4LGB A;  1ZXF A;  2M89 A;  3TVR A;  3KLX A;  2VNE A;  4A8V A;  3GB4 A;  4N3E A;  4BK6 A;  3NJ1 A;  4JDL A;  3HVR A;  2N4B A;  3TL1 A;  3Q64 A;  3P51 A;  4BTZ A;  5E46 A;  3Q6A A;  2E3O A;  3GL2 A;  4DSC A;  1T17 A;  3DLH A;  4C9C A;  4LG5 A;  2PCS A;  5E4D A;  3W9K A;  4JHG A;  1EM2 A;  2LCG A;  3KB0 A;  1T27 A;  4C94 A;  3RT2 A;  4A8U A;  3UID A;  4IH0 A;  3RT0 C;  1BV1 A;  3NQN A;  3NMT A;  3TGO C;  3GTS A;  4A81 A;  4A85 A;  2WQL A;  1TW0 A;  2NN5 A;  3H3Q A;  3H3T A;  3KDJ A;  4A87 A;  3HO1 A;  2R55 A;  4B9R A;  3GKE A;  2MOU A;  2PSO A;  2ZYL A;  4BK7 A;  3HXM A;  2E3P A;  3UJL A;  4XRW A;  3PU2 A;  1FM4 A;  4A86 A;  1TXC A;  3OH8 A;  2LAF A;  4GY9 A;  3DLB A;  3KL1 A;  4REI A;  4MAP A;  3RD6 A;  3NS2 A;  2E3Q A;  3ZVU A;  4KPY A;  3NJO A;  1FSK A;  3JRS A;  2VQ5 A;  1XN5 A;  3IE5 A;  3P0L A;  1X53 A;  2A1L A;  2L8O A;  3CNW A;  4IGY A;  3TFZ A;  4N41 A;  2FFS A;  4M9B A;  1QMR A;  4E6F A;  3HM9 A;  3KDH A;  3QN1 A;  4A8G A;  4DSB A;  2Z9Z A;  2I9Y A;  3IJT A;  4Z3L A;  2L65 A;  4QDF A;  3KDI A;  4JHY A;  2QIM A;  4RYV A;  2LAK A;  4LGA A;  4LA7 A;  4REJ A;  4IHR A;  1E09 A;  1XUV A;  2LUZ A;  3FO5 A;  3PUT A;  4IGX A;  1UW5 A;  3GGN A;  3GOB A;  3OTL A;  5AMW A;  4A80 A;  1LN3 A;  5C9Y A;  4NCA A;  3Q63 A;  2RER A;  4JHI A;  5E4M A;  3JRQ B;  1H2O A;  3NI8 A;  4R7K A;  2LPX A;  1ICX A;  3OQU A;  4FPW A;  4QCK A;  2E3M A;  3KAZ A;  2KEW A;  3NMV A;  4MA6 A;  3HJF A;  2N4A A;  2Q3Q A;  3GL0 A;  3KB3 A;  3H3S A;  4M9W A;  1LN1 A;  3NJ0 A;  3R6P A;  2K7H A;  4REH A;  2M47 A;  4QIP A;  3UQH A;  2K5G A;  2RES A;  3F08 A;  4A83 A;  4JDA A;  5BRL A;  3GTE A;  1Z94 A;  2FLH A;  2IL5 A;  1BTV A;  4IGW A;  4WVO A;  2KF2 A;  5I8F A;  3P9V A;  4C9I A;  3NEG A;  2LE1 A;  2E3S A;  2D4R A;  4A88 A;  4BKC A;  4N76 A;  3H3R A;  1XFS A;  2KTE A;  3C0V A;  4QDF B;  5EKQ C;  1JSS A;  3E85 A;  3QSZ A;  3WG8 A;  5JO2 A;  5JO1 A;  2L9P A;  2BK0 A;  1KCM A;  2E3N A;  1VJH A;  2LDK A;  2LIO A;  3NEF A;  3NMH A;  4N0G C;  5E4B A;  4A84 A;  4DS8 A;  2YH6 A;  3K90 A;  2LEQ A;  4IGV A;  2REZ A;  3F73 A;  4Q0K A;  2QPV A; 
#chains in the Genus database with same CATH homology
 4MNS A;  2EJX A;  3HK2 A;  5JNN A;  2Z9Y A;  2NS9 A;  3NR4 A;  3ELI A;  4IH2 A;  3NMN A;  1B6F A;  2LGH A;  4N47 A;  4XRT A;  3KAY A;  4Y31 A;  3W9R A;  2LF2 A;  1LN2 A;  4OIC A;  2GKD A;  4NCB A;  1XDF A;  2E3R A;  1IFV A;  3OJI A;  1XN6 A;  4JHH A;  4PSB A;  4QDD A;  3NMP A;  1LLT A;  3K3K A;  2KCZ A;  5I9J A;  4BKD A;  4QDC A;  3TVQ A;  4LGB A;  1ZXF A;  2M89 A;  3TVR A;  3KLX A;  2VNE A;  4A8V A;  3GB4 A;  4N3E A;  4BK6 A;  3NJ1 A;  4JDL A;  3HVR A;  2N4B A;  3TL1 A;  3Q64 A;  3P51 A;  4BTZ A;  5E46 A;  3Q6A A;  2E3O A;  3GL2 A;  4DSC A;  1T17 A;  3DLH A;  4C9C A;  4LG5 A;  2PCS A;  5E4D A;  3W9K A;  4JHG A;  1EM2 A;  2LCG A;  3KB0 A;  1T27 A;  4C94 A;  3RT2 A;  4A8U A;  3UID A;  4IH0 A;  3RT0 C;  1BV1 A;  3NQN A;  3NMT A;  3TGO C;  3GTS A;  4A81 A;  4A85 A;  2WQL A;  1TW0 A;  2NN5 A;  3H3Q A;  3H3T A;  3KDJ A;  4A87 A;  3HO1 A;  2R55 A;  4B9R A;  3GKE A;  2MOU A;  2PSO A;  2ZYL A;  4BK7 A;  3HXM A;  2E3P A;  3UJL A;  4XRW A;  3PU2 A;  1FM4 A;  4A86 A;  1TXC A;  3OH8 A;  2LAF A;  4GY9 A;  3DLB A;  3KL1 A;  4REI A;  4MAP A;  3RD6 A;  3NS2 A;  2E3Q A;  3ZVU A;  4KPY A;  3NJO A;  1FSK A;  3JRS A;  2VQ5 A;  1XN5 A;  3IE5 A;  3P0L A;  1X53 A;  2A1L A;  2L8O A;  3CNW A;  4IGY A;  3TFZ A;  4N41 A;  2FFS A;  4M9B A;  1QMR A;  4E6F A;  3HM9 A;  3KDH A;  3QN1 A;  4A8G A;  4DSB A;  2Z9Z A;  2I9Y A;  3IJT A;  4Z3L A;  2L65 A;  4QDF A;  3KDI A;  4JHY A;  2QIM A;  4RYV A;  2LAK A;  4LGA A;  4LA7 A;  4REJ A;  4IHR A;  1E09 A;  1XUV A;  2LUZ A;  3FO5 A;  3PUT A;  4IGX A;  1UW5 A;  3GGN A;  3GOB A;  3OTL A;  5AMW A;  4A80 A;  1LN3 A;  5C9Y A;  4NCA A;  3Q63 A;  2RER A;  4JHI A;  5E4M A;  3JRQ B;  1H2O A;  3NI8 A;  4R7K A;  2LPX A;  1ICX A;  3OQU A;  4FPW A;  4QCK A;  2E3M A;  3KAZ A;  2KEW A;  3NMV A;  4MA6 A;  3HJF A;  2N4A A;  2Q3Q A;  3GL0 A;  3KB3 A;  3H3S A;  4M9W A;  1LN1 A;  3NJ0 A;  3R6P A;  2K7H A;  4REH A;  2M47 A;  4QIP A;  3UQH A;  2K5G A;  2RES A;  3F08 A;  4A83 A;  4JDA A;  5BRL A;  3GTE A;  1Z94 A;  2FLH A;  2IL5 A;  1BTV A;  4IGW A;  4WVO A;  2KF2 A;  5I8F A;  3P9V A;  4C9I A;  3NEG A;  2LE1 A;  2E3S A;  2D4R A;  4A88 A;  4BKC A;  4N76 A;  3H3R A;  1XFS A;  2KTE A;  3C0V A;  4QDF B;  5EKQ C;  1JSS A;  3E85 A;  3QSZ A;  3WG8 A;  5JO2 A;  5JO1 A;  2L9P A;  2BK0 A;  1KCM A;  2E3N A;  1VJH A;  2LDK A;  2LIO A;  3NEF A;  3NMH A;  4N0G C;  5E4B A;  4A84 A;  4DS8 A;  2YH6 A;  3K90 A;  2LEQ A;  4IGV A;  2REZ A;  3F73 A;  4Q0K A;  2QPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...