4MAPA

Crystal structure of ara h 8 purified with heating
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
GVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Peanut Panallergen Ara h 8.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Plant protein
molecule keywords Ara h 8 allergen
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4mapA00
2KCZA 2RESA 1VJHA 4REIA 3UQHA 3QSZA 2E3NA 3IE5A 3KDHA 2N4AA 4XRWA 2IL5A 2BK0A 1ICXA 3TVQA 2L9PA 3W9RA 1T17A 2E3QA 4IH0A 1FSKA 2LPXA 5BRLA 4A83A 2PCSA 4FPWA 4DSCA 4Q0KA 4IGXA 1TXCA 4M9WA 2LAKA 4OICA 2M47A 1H2OA 3OQUA 3TVRA 4A87A 2M89A 1XN5A 2E3RA 2Q3QA 2REZA 3NMNA 2VQ5A 5JO2A 2EJXA 2KTEA 4LA7A 2LE1A 4RYVA 1TW0A 4JDAA 4A85A 1X53A 3NMHA 3UJLA 4JHHA 3TFZA 2QIMA 2LEQA 1BV1A 1T27A 3RT2A 2LIOA 3WG8A 4M9BA 2RERA 5JNNA 4BTZA 4A84A 3KB0A 3NS2A 2KF2A 3H3RA 1EM2A 2LGHA 1ZXFA 3JRQB 4A8VA 4BKDA 3OH8A 2K7HA 4REJA 3NJ1A 3KAYA 1XUVA 4IGWA 4XRTA 3OTLA 4JDLA 2E3MA 2I9YA 4JHIA 4BK6A 2R55A 3NJ0A 3OJIA 3NI8A 2Z9YA 4BKCA 2QPVA 2D4RA 3IJTA 3KDIA 3NR4A 3UIDA 3H3TA 3GGNA 4A81A 3R6PA 3P51A 2A1LA 3KAZA 1E09A 4A8UA 5E4MA 2FLHA 1LN1A 1IFVA 3QN1A 4IGYA 1Z94A 4LGBA 2LUZA 2WQLA 3Q64A 3ELIA 3FO5A 3P0LA 4B9RA 4C94A 2E3OA 3W9KA 2GKDA 3TL1A 4LGAA 2L65A 3NMPA 5I9JA 1XDFA 4MA6A 5E46A 1JSSA 2E3PA 4N0GC 2Z9ZA 3PUTA 2K5GA 3PU2A 4WVOA 4A8GA 5E4DA 4DS8A 4A86A 4Z3LA 4MAPA 3KB3A 2FFSA 3H3QA 5C9YA 4REHA 1FM4A 3H3SA 2LDKA 3NEGA 3NJOA 3NMTA 2LCGA 3P9VA 5AMWA 4IH2A 3KLXA 4BK7A 5I8FA 4JHGA 4IGVA 4LG5A 4N3EA 3RD6A 4C9IA 1LN2A 4IHRA 4Y31A 1B6FA 5JO1A 2NS9A 3C0VA 2NN5A 5E4BA 2MOUA 3KDJA 3F08A 3K90A 3E85A 3NMVA 3RT0C 2L8OA 4MNSA 3K3KA 3KL1A 1XFSA 2LF2A 3JRSA 4PSBA 4R7KA 1QMRA 4A80A 1LN3A 2PSOA 1UW5A 4DSBA 2KEWA 3CNWA 2VNEA 3Q6AA 2N4BA 4C9CA 4QIPA 3NEFA 4GY9A 4A88A 1KCMA 1BTVA 3Q63A 3ZVUA 2E3SA 1LLTA 1XN6A
chains in the Genus database with same CATH superfamily
3GL2A 2KCZA 2RESA 1VJHA 4REIA 3UQHA 3QSZA 2E3NA 3IE5A 3KDHA 2N4AA 4XRWA 2IL5A 2BK0A 3HVRA 1ICXA 3TVQA 2L9PA 3W9RA 1T17A 2E3QA 2ZYLA 1FSKA 2LPXA 4IH0A 5BRLA 4A83A 2PCSA 4FPWA 4DSCA 4Q0KA 4IGXA 1TXCA 4M9WA 2LAKA 4OICA 2M47A 1H2OA 3OQUA 3TVRA 4QDCA 4A87A 2M89A 1XN5A 4NCAA 2YH6A 2E3RA 2Q3QA 2REZA 3NMNA 2VQ5A 5JO2A 2EJXA 2KTEA 4LA7A 2LE1A 3GTEA 4RYVA 3TGOC 1TW0A 4JDAA 4A85A 1X53A 3NMHA 3GL0A 3UJLA 4JHHA 3TFZA 3F73A 2QIMA 2LEQA 1BV1A 1T27A 3RT2A 3HM9A 2LIOA 3WG8A 2LAFA 4M9BA 2RERA 5JNNA 4BTZA 4A84A 3KB0A 3NS2A 4N76A 2KF2A 3H3RA 1EM2A 2LGHA 1ZXFA 3JRQB 4A8VA 4BKDA 3GTSA 3OH8A 2K7HA 4REJA 3HXMA 3NJ1A 4KPYA 4N47A 3GOBA 3KAYA 1XUVA 4IGWA 3GKEA 4XRTA 3OTLA 4JDLA 2E3MA 2I9YA 4JHIA 4BK6A 2R55A 3NJ0A 3OJIA 3NI8A 2Z9YA 4BKCA 2QPVA 2D4RA 3IJTA 3KDIA 3NR4A 3UIDA 3H3TA 3GGNA 3NQNA 4A81A 3R6PA 3P51A 2A1LA 3HK2A 3KAZA 1E09A 4A8UA 5E4MA 3DLHA 2FLHA 1LN1A 1IFVA 3QN1A 4IGYA 5EKQC 1Z94A 4LGBA 2LUZA 2WQLA 3Q64A 3ELIA 3FO5A 3P0LA 4B9RA 4C94A 2E3OA 3W9KA 4N41A 2GKDA 3TL1A 4LGAA 2L65A 3NMPA 3DLBA 5I9JA 1XDFA 4MA6A 5E46A 1JSSA 2E3PA 4N0GC 2Z9ZA 3PUTA 2K5GA 3PU2A 4WVOA 4A8GA 5E4DA 4DS8A 4NCBA 4A86A 4Z3LA 4MAPA 3KB3A 2FFSA 3H3QA 4QCKA 5C9YA 4REHA 1FM4A 3H3SA 2LDKA 3NEGA 4QDDA 3NJOA 3NMTA 2LCGA 3P9VA 5AMWA 4IH2A 3KLXA 3GB4A 4BK7A 5I8FA 4JHGA 4IGVA 4LG5A 4N3EA 4QDFB 4QDFA 3RD6A 4C9IA 1LN2A 4IHRA 4Y31A 1B6FA 5JO1A 3HJFA 2NS9A 3C0VA 2NN5A 5E4BA 2MOUA 3KDJA 3F08A 3K90A 3E85A 3NMVA 3RT0C 4E6FA 2L8OA 4MNSA 3K3KA 3KL1A 1XFSA 2LF2A 3JRSA 4PSBA 4R7KA 1QMRA 4A80A 1LN3A 2PSOA 1UW5A 4DSBA 2KEWA 3CNWA 2VNEA 3Q6AA 2N4BA 4C9CA 4QIPA 3NEFA 4GY9A 4A88A 3HO1A 4JHYA 1KCMA 1BTVA 3Q63A 3ZVUA 2E3SA 1LLTA 1XN6A
chains in the Genus database with same CATH topology
3GL2A 2KCZA 2RESA 1VJHA 4REIA 3UQHA 3QSZA 2E3NA 3IE5A 3KDHA 2N4AA 4XRWA 2IL5A 2BK0A 3HVRA 1ICXA 3TVQA 2L9PA 3W9RA 1T17A 2E3QA 2ZYLA 1FSKA 2LPXA 4IH0A 5BRLA 4A83A 2PCSA 4FPWA 4DSCA 4Q0KA 4IGXA 1TXCA 4M9WA 2LAKA 4OICA 2M47A 1H2OA 3OQUA 3TVRA 4QDCA 4A87A 2M89A 1XN5A 4NCAA 2YH6A 2E3RA 2Q3QA 2REZA 3NMNA 2VQ5A 5JO2A 2EJXA 2KTEA 4LA7A 2LE1A 3GTEA 4RYVA 3TGOC 1TW0A 4JDAA 4A85A 1X53A 3NMHA 3GL0A 3UJLA 4JHHA 3TFZA 3F73A 2QIMA 2LEQA 1BV1A 1T27A 3RT2A 3HM9A 2LIOA 3WG8A 2LAFA 4M9BA 2RERA 5JNNA 4BTZA 4A84A 3KB0A 3NS2A 4N76A 2KF2A 3H3RA 1EM2A 2LGHA 1ZXFA 3JRQB 4A8VA 4BKDA 3GTSA 3OH8A 2K7HA 4REJA 3HXMA 3NJ1A 4KPYA 4N47A 3GOBA 3KAYA 1XUVA 4IGWA 3GKEA 4XRTA 3OTLA 4JDLA 2E3MA 2I9YA 4JHIA 4BK6A 2R55A 3NJ0A 3OJIA 3NI8A 2Z9YA 4BKCA 2QPVA 2D4RA 3IJTA 3KDIA 3NR4A 3UIDA 3H3TA 3GGNA 3NQNA 4A81A 3R6PA 3P51A 2A1LA 3HK2A 3KAZA 1E09A 4A8UA 5E4MA 3DLHA 2FLHA 1LN1A 1IFVA 3QN1A 4IGYA 5EKQC 1Z94A 4LGBA 2LUZA 2WQLA 3Q64A 3ELIA 3FO5A 3P0LA 4B9RA 4C94A 2E3OA 3W9KA 4N41A 2GKDA 3TL1A 4LGAA 2L65A 3NMPA 3DLBA 5I9JA 1XDFA 4MA6A 5E46A 1JSSA 2E3PA 4N0GC 2Z9ZA 3PUTA 2K5GA 3PU2A 4WVOA 4A8GA 5E4DA 4DS8A 4NCBA 4A86A 4Z3LA 4MAPA 3KB3A 2FFSA 3H3QA 4QCKA 5C9YA 4REHA 1FM4A 3H3SA 2LDKA 3NEGA 4QDDA 3NJOA 3NMTA 2LCGA 3P9VA 5AMWA 4IH2A 3KLXA 3GB4A 4BK7A 5I8FA 4JHGA 4IGVA 4LG5A 4N3EA 4QDFB 4QDFA 3RD6A 4C9IA 1LN2A 4IHRA 4Y31A 1B6FA 5JO1A 3HJFA 2NS9A 3C0VA 2NN5A 5E4BA 2MOUA 3KDJA 3F08A 3K90A 3E85A 3NMVA 3RT0C 4E6FA 2L8OA 4MNSA 3K3KA 3KL1A 1XFSA 2LF2A 3JRSA 4PSBA 4R7KA 1QMRA 4A80A 1LN3A 2PSOA 1UW5A 4DSBA 2KEWA 3CNWA 2VNEA 3Q6AA 2N4BA 4C9CA 4QIPA 3NEFA 4GY9A 4A88A 3HO1A 4JHYA 1KCMA 1BTVA 3Q63A 3ZVUA 2E3SA 1LLTA 1XN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCZ A;  2RES A;  1VJH A;  4REI A;  3UQH A;  3QSZ A;  2E3N A;  3IE5 A;  3KDH A;  2N4A A;  4XRW A;  2IL5 A;  2BK0 A;  1ICX A;  3TVQ A;  2L9P A;  3W9R A;  1T17 A;  2E3Q A;  4IH0 A;  1FSK A;  2LPX A;  5BRL A;  4A83 A;  2PCS A;  4FPW A;  4DSC A;  4Q0K A;  4IGX A;  1TXC A;  4M9W A;  2LAK A;  4OIC A;  2M47 A;  1H2O A;  3OQU A;  3TVR A;  4A87 A;  2M89 A;  1XN5 A;  2E3R A;  2Q3Q A;  2REZ A;  3NMN A;  2VQ5 A;  5JO2 A;  2EJX A;  2KTE A;  4LA7 A;  2LE1 A;  4RYV A;  1TW0 A;  4JDA A;  4A85 A;  1X53 A;  3NMH A;  3UJL A;  4JHH A;  3TFZ A;  2QIM A;  2LEQ A;  1BV1 A;  1T27 A;  3RT2 A;  2LIO A;  3WG8 A;  4M9B A;  2RER A;  5JNN A;  4BTZ A;  4A84 A;  3KB0 A;  3NS2 A;  2KF2 A;  3H3R A;  1EM2 A;  2LGH A;  1ZXF A;  3JRQ B;  4A8V A;  4BKD A;  3OH8 A;  2K7H A;  4REJ A;  3NJ1 A;  3KAY A;  1XUV A;  4IGW A;  4XRT A;  3OTL A;  4JDL A;  2E3M A;  2I9Y A;  4JHI A;  4BK6 A;  2R55 A;  3NJ0 A;  3OJI A;  3NI8 A;  2Z9Y A;  4BKC A;  2QPV A;  2D4R A;  3IJT A;  3KDI A;  3NR4 A;  3UID A;  3H3T A;  3GGN A;  4A81 A;  3R6P A;  3P51 A;  2A1L A;  3KAZ A;  1E09 A;  4A8U A;  5E4M A;  2FLH A;  1LN1 A;  1IFV A;  3QN1 A;  4IGY A;  1Z94 A;  4LGB A;  2LUZ A;  2WQL A;  3Q64 A;  3ELI A;  3FO5 A;  3P0L A;  4B9R A;  4C94 A;  2E3O A;  3W9K A;  2GKD A;  3TL1 A;  4LGA A;  2L65 A;  3NMP A;  5I9J A;  1XDF A;  4MA6 A;  5E46 A;  1JSS A;  2E3P A;  4N0G C;  2Z9Z A;  3PUT A;  2K5G A;  3PU2 A;  4WVO A;  4A8G A;  5E4D A;  4DS8 A;  4A86 A;  4Z3L A;  4MAP A;  3KB3 A;  2FFS A;  3H3Q A;  5C9Y A;  4REH A;  1FM4 A;  3H3S A;  2LDK A;  3NEG A;  3NJO A;  3NMT A;  2LCG A;  3P9V A;  5AMW A;  4IH2 A;  3KLX A;  4BK7 A;  5I8F A;  4JHG A;  4IGV A;  4LG5 A;  4N3E A;  3RD6 A;  4C9I A;  1LN2 A;  4IHR A;  4Y31 A;  1B6F A;  5JO1 A;  2NS9 A;  3C0V A;  2NN5 A;  5E4B A;  2MOU A;  3KDJ A;  3F08 A;  3K90 A;  3E85 A;  3NMV A;  3RT0 C;  2L8O A;  4MNS A;  3K3K A;  3KL1 A;  1XFS A;  2LF2 A;  3JRS A;  4PSB A;  4R7K A;  1QMR A;  4A80 A;  1LN3 A;  2PSO A;  1UW5 A;  4DSB A;  2KEW A;  3CNW A;  2VNE A;  3Q6A A;  2N4B A;  4C9C A;  4QIP A;  3NEF A;  4GY9 A;  4A88 A;  1KCM A;  1BTV A;  3Q63 A;  3ZVU A;  2E3S A;  1LLT A;  1XN6 A; 
#chains in the Genus database with same CATH topology
 3GL2 A;  2KCZ A;  2RES A;  1VJH A;  4REI A;  3UQH A;  3QSZ A;  2E3N A;  3IE5 A;  3KDH A;  2N4A A;  4XRW A;  2IL5 A;  2BK0 A;  3HVR A;  1ICX A;  3TVQ A;  2L9P A;  3W9R A;  1T17 A;  2E3Q A;  2ZYL A;  1FSK A;  2LPX A;  4IH0 A;  5BRL A;  4A83 A;  2PCS A;  4FPW A;  4DSC A;  4Q0K A;  4IGX A;  1TXC A;  4M9W A;  2LAK A;  4OIC A;  2M47 A;  1H2O A;  3OQU A;  3TVR A;  4QDC A;  4A87 A;  2M89 A;  1XN5 A;  4NCA A;  2YH6 A;  2E3R A;  2Q3Q A;  2REZ A;  3NMN A;  2VQ5 A;  5JO2 A;  2EJX A;  2KTE A;  4LA7 A;  2LE1 A;  3GTE A;  4RYV A;  3TGO C;  1TW0 A;  4JDA A;  4A85 A;  1X53 A;  3NMH A;  3GL0 A;  3UJL A;  4JHH A;  3TFZ A;  3F73 A;  2QIM A;  2LEQ A;  1BV1 A;  1T27 A;  3RT2 A;  3HM9 A;  2LIO A;  3WG8 A;  2LAF A;  4M9B A;  2RER A;  5JNN A;  4BTZ A;  4A84 A;  3KB0 A;  3NS2 A;  4N76 A;  2KF2 A;  3H3R A;  1EM2 A;  2LGH A;  1ZXF A;  3JRQ B;  4A8V A;  4BKD A;  3GTS A;  3OH8 A;  2K7H A;  4REJ A;  3HXM A;  3NJ1 A;  4KPY A;  4N47 A;  3GOB A;  3KAY A;  1XUV A;  4IGW A;  3GKE A;  4XRT A;  3OTL A;  4JDL A;  2E3M A;  2I9Y A;  4JHI A;  4BK6 A;  2R55 A;  3NJ0 A;  3OJI A;  3NI8 A;  2Z9Y A;  4BKC A;  2QPV A;  2D4R A;  3IJT A;  3KDI A;  3NR4 A;  3UID A;  3H3T A;  3GGN A;  3NQN A;  4A81 A;  3R6P A;  3P51 A;  2A1L A;  3HK2 A;  3KAZ A;  1E09 A;  4A8U A;  5E4M A;  3DLH A;  2FLH A;  1LN1 A;  1IFV A;  3QN1 A;  4IGY A;  5EKQ C;  1Z94 A;  4LGB A;  2LUZ A;  2WQL A;  3Q64 A;  3ELI A;  3FO5 A;  3P0L A;  4B9R A;  4C94 A;  2E3O A;  3W9K A;  4N41 A;  2GKD A;  3TL1 A;  4LGA A;  2L65 A;  3NMP A;  3DLB A;  5I9J A;  1XDF A;  4MA6 A;  5E46 A;  1JSS A;  2E3P A;  4N0G C;  2Z9Z A;  3PUT A;  2K5G A;  3PU2 A;  4WVO A;  4A8G A;  5E4D A;  4DS8 A;  4NCB A;  4A86 A;  4Z3L A;  4MAP A;  3KB3 A;  2FFS A;  3H3Q A;  4QCK A;  5C9Y A;  4REH A;  1FM4 A;  3H3S A;  2LDK A;  3NEG A;  4QDD A;  3NJO A;  3NMT A;  2LCG A;  3P9V A;  5AMW A;  4IH2 A;  3KLX A;  3GB4 A;  4BK7 A;  5I8F A;  4JHG A;  4IGV A;  4LG5 A;  4N3E A;  4QDF B;  4QDF A;  3RD6 A;  4C9I A;  1LN2 A;  4IHR A;  4Y31 A;  1B6F A;  5JO1 A;  3HJF A;  2NS9 A;  3C0V A;  2NN5 A;  5E4B A;  2MOU A;  3KDJ A;  3F08 A;  3K90 A;  3E85 A;  3NMV A;  3RT0 C;  4E6F A;  2L8O A;  4MNS A;  3K3K A;  3KL1 A;  1XFS A;  2LF2 A;  3JRS A;  4PSB A;  4R7K A;  1QMR A;  4A80 A;  1LN3 A;  2PSO A;  1UW5 A;  4DSB A;  2KEW A;  3CNW A;  2VNE A;  3Q6A A;  2N4B A;  4C9C A;  4QIP A;  3NEF A;  4GY9 A;  4A88 A;  3HO1 A;  4JHY A;  1KCM A;  1BTV A;  3Q63 A;  3ZVU A;  2E3S A;  1LLT A;  1XN6 A; 
#chains in the Genus database with same CATH homology
 3GL2 A;  2KCZ A;  2RES A;  1VJH A;  4REI A;  3UQH A;  3QSZ A;  2E3N A;  3IE5 A;  3KDH A;  2N4A A;  4XRW A;  2IL5 A;  2BK0 A;  3HVR A;  1ICX A;  3TVQ A;  2L9P A;  3W9R A;  1T17 A;  2E3Q A;  2ZYL A;  1FSK A;  2LPX A;  4IH0 A;  5BRL A;  4A83 A;  2PCS A;  4FPW A;  4DSC A;  4Q0K A;  4IGX A;  1TXC A;  4M9W A;  2LAK A;  4OIC A;  2M47 A;  1H2O A;  3OQU A;  3TVR A;  4QDC A;  4A87 A;  2M89 A;  1XN5 A;  4NCA A;  2YH6 A;  2E3R A;  2Q3Q A;  2REZ A;  3NMN A;  2VQ5 A;  5JO2 A;  2EJX A;  2KTE A;  4LA7 A;  2LE1 A;  3GTE A;  4RYV A;  3TGO C;  1TW0 A;  4JDA A;  4A85 A;  1X53 A;  3NMH A;  3GL0 A;  3UJL A;  4JHH A;  3TFZ A;  3F73 A;  2QIM A;  2LEQ A;  1BV1 A;  1T27 A;  3RT2 A;  3HM9 A;  2LIO A;  3WG8 A;  2LAF A;  4M9B A;  2RER A;  5JNN A;  4BTZ A;  4A84 A;  3KB0 A;  3NS2 A;  4N76 A;  2KF2 A;  3H3R A;  1EM2 A;  2LGH A;  1ZXF A;  3JRQ B;  4A8V A;  4BKD A;  3GTS A;  3OH8 A;  2K7H A;  4REJ A;  3HXM A;  3NJ1 A;  4KPY A;  4N47 A;  3GOB A;  3KAY A;  1XUV A;  4IGW A;  3GKE A;  4XRT A;  3OTL A;  4JDL A;  2E3M A;  2I9Y A;  4JHI A;  4BK6 A;  2R55 A;  3NJ0 A;  3OJI A;  3NI8 A;  2Z9Y A;  4BKC A;  2QPV A;  2D4R A;  3IJT A;  3KDI A;  3NR4 A;  3UID A;  3H3T A;  3GGN A;  3NQN A;  4A81 A;  3R6P A;  3P51 A;  2A1L A;  3HK2 A;  3KAZ A;  1E09 A;  4A8U A;  5E4M A;  3DLH A;  2FLH A;  1LN1 A;  1IFV A;  3QN1 A;  4IGY A;  5EKQ C;  1Z94 A;  4LGB A;  2LUZ A;  2WQL A;  3Q64 A;  3ELI A;  3FO5 A;  3P0L A;  4B9R A;  4C94 A;  2E3O A;  3W9K A;  4N41 A;  2GKD A;  3TL1 A;  4LGA A;  2L65 A;  3NMP A;  3DLB A;  5I9J A;  1XDF A;  4MA6 A;  5E46 A;  1JSS A;  2E3P A;  4N0G C;  2Z9Z A;  3PUT A;  2K5G A;  3PU2 A;  4WVO A;  4A8G A;  5E4D A;  4DS8 A;  4NCB A;  4A86 A;  4Z3L A;  4MAP A;  3KB3 A;  2FFS A;  3H3Q A;  4QCK A;  5C9Y A;  4REH A;  1FM4 A;  3H3S A;  2LDK A;  3NEG A;  4QDD A;  3NJO A;  3NMT A;  2LCG A;  3P9V A;  5AMW A;  4IH2 A;  3KLX A;  3GB4 A;  4BK7 A;  5I8F A;  4JHG A;  4IGV A;  4LG5 A;  4N3E A;  4QDF B;  4QDF A;  3RD6 A;  4C9I A;  1LN2 A;  4IHR A;  4Y31 A;  1B6F A;  5JO1 A;  3HJF A;  2NS9 A;  3C0V A;  2NN5 A;  5E4B A;  2MOU A;  3KDJ A;  3F08 A;  3K90 A;  3E85 A;  3NMV A;  3RT0 C;  4E6F A;  2L8O A;  4MNS A;  3K3K A;  3KL1 A;  1XFS A;  2LF2 A;  3JRS A;  4PSB A;  4R7K A;  1QMR A;  4A80 A;  1LN3 A;  2PSO A;  1UW5 A;  4DSB A;  2KEW A;  3CNW A;  2VNE A;  3Q6A A;  2N4B A;  4C9C A;  4QIP A;  3NEF A;  4GY9 A;  4A88 A;  3HO1 A;  4JHY A;  1KCM A;  1BTV A;  3Q63 A;  3ZVU A;  2E3S A;  1LLT A;  1XN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...