4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
1O0XA 1WN1A 4QR8A 2V3ZA 1YVMA 1W2MA 1JAWA 2GGBA 3PKEA 5CDVA 3PKAA 2G6PA 2V3YA 2HOWA 1YW8A 4EGEA 4FLLA 4U6JA 2GG8A 1XGSA 2BWSA 2EA2A 1QZYA 4FLIA 4U69A 2B3LA 3FMRA 4IKUA 4IU6A 1BN5A 4U6ZA 4OOKA 2BHDA 2OAZA 4MATA 4RGZ1 1QXWA 4U76A 3CB6A 2BWUA 2B3HA 3BITA 4ZWOA 1WBQA 4ZNGA 3MATA 3BIPA 2BH3A 5CLSA 4IPAA 4IKSA 3BIQA 3TB5A 4FLKA 4S2TP 1WY2A 3IU9A 3TAVA 2BHAA 2BWXA 1PV9A 4RZYA 4S01A 3S6BA 4IECA 5CE6A 2B3KA 2NQ7A 3CB5A 4FKCA 5FCFA 2BN7A 4U6CA 2GTXA 3IU7A 1B6AA 1WL6A 1XGMA 1YJ3A 4KM3A 2GG5A 4HXXA 1QXZA 3IG4A 1KQ0A 4S00A 1BOAA 5D6EA 3RORA 3RVAA 3D27A 4IDYA 4FO7A 2BHCA 4U70A 4PNCA 2BWVA 4ZWUA 2BWTA 2GG0A 4ZWPA 4A6WA 2V3XA 4FLJA 2EVMA 1R5HA 3FM3A 4A6VA 1R58A 2OKNA 3L24A 4Z7MA 1Y1NA 2Q94A 4U1BA 2Q96A 2P98A 5CDLA 2P99A 1W7VA 2ADUA 1A16A 3PKDA 2MATA 2GU5A 4B28A 3PKCA 2Q8KA 1XGNA 2P9AA 3IU8A 1C27A 1XNZA 1CHMA 4U75A 1C23A 5CDEA 4U73A 2BHBA 4IF7A 4JUQA 2GG2A 5JHUA 1WL9A 3CTZA 4IKRA 1YW7A 1MATA 2BB7A 2GA2A 4FO8A 2GU7A 2Q93A 5FCHA 2NQ6A 1QXYA 1XGOA 2GG3A 5CNXA 2IW2A 4U6WA 3MX6A 1C21A 2EA4A 3FMQA 3Q6DA 2BWYA 5E5BA 4S2RP 5CIKA 2GU6A 4RZZA 1N51A 2GZ5A 2Q92A 1WKMA 2EVOA 1KQ9A 4FUKA 1B59A 1R5GA 2GGCA 1C24A 2BWWA 2ZSGA 4U6EA 2GG7A 2GU4A 3L7GA 5D6FA 5JFRA 4IKTA 3MR1A 1KP0A 5JI6A 2V6CA 1WLRA 2DFIA 2Q95A 1C22A 1M35A 4R60A 4U71A 4PV4A 3PKBA 2GG9A 1YW9A 2EVCA
chains in the Genus database with same CATH superfamily
1O0XA 1WN1A 4QR8A 2V3ZA 1YVMA 1W2MA 1JAWA 2GGBA 3PKEA 5CDVA 3PKAA 2G6PA 2V3YA 2HOWA 1YW8A 4EGEA 4FLLA 4U6JA 2GG8A 1XGSA 2BWSA 2EA2A 1QZYA 4FLIA 4U69A 2B3LA 3FMRA 4IKUA 4IU6A 1BN5A 4U6ZA 4OOKA 2BHDA 2OAZA 4MATA 4RGZ1 1QXWA 4U76A 3CB6A 2BWUA 2B3HA 3BITA 4ZWOA 1WBQA 4ZNGA 3MATA 3BIPA 2BH3A 5CLSA 4IPAA 4IKSA 3BIQA 3TB5A 4FLKA 4S2TP 1WY2A 3IU9A 3TAVA 2BHAA 2BWXA 1PV9A 4RZYA 4S01A 3S6BA 4IECA 5CE6A 2B3KA 2NQ7A 3CB5A 4FKCA 5FCFA 2BN7A 4U6CA 2GTXA 3IU7A 1B6AA 1WL6A 1XGMA 1YJ3A 4KM3A 2GG5A 4HXXA 1QXZA 3IG4A 1KQ0A 4S00A 1BOAA 5D6EA 3RORA 3RVAA 3D27A 4IDYA 4FO7A 2BHCA 4U70A 4PNCA 2BWVA 4ZWUA 2BWTA 2GG0A 4ZWPA 4A6WA 2V3XA 4FLJA 2EVMA 1R5HA 3FM3A 4A6VA 1R58A 2OKNA 3L24A 4Z7MA 1Y1NA 2Q94A 4U1BA 2Q96A 2P98A 5CDLA 2P99A 1W7VA 2ADUA 1A16A 3PKDA 2MATA 2GU5A 4B28A 3PKCA 2Q8KA 1XGNA 2P9AA 3IU8A 1C27A 1XNZA 1CHMA 4U75A 1C23A 5CDEA 4U73A 2BHBA 4IF7A 4JUQA 2GG2A 5JHUA 1WL9A 3CTZA 4IKRA 1YW7A 1MATA 2BB7A 2GA2A 4FO8A 2GU7A 2Q93A 5FCHA 2NQ6A 1QXYA 1XGOA 2GG3A 5CNXA 2IW2A 4U6WA 3MX6A 1C21A 2EA4A 3FMQA 3Q6DA 2BWYA 5E5BA 4S2RP 5CIKA 2GU6A 4RZZA 1N51A 2GZ5A 2Q92A 1WKMA 2EVOA 1KQ9A 4FUKA 1B59A 1R5GA 2GGCA 1C24A 2BWWA 2ZSGA 4U6EA 2GG7A 2GU4A 3L7GA 5D6FA 5JFRA 4IKTA 3MR1A 1KP0A 5JI6A 2V6CA 1WLRA 2DFIA 2Q95A 1C22A 1M35A 4R60A 4U71A 4PV4A 3PKBA 2GG9A 1YW9A 2EVCA
chains in the Genus database with same CATH topology
1O0XA 1WN1A 4QR8A 2V3ZA 1YVMA 1W2MA 1JAWA 2GGBA 3PKEA 5CDVA 3PKAA 2G6PA 2V3YA 2HOWA 1YW8A 4EGEA 4FLLA 4U6JA 2GG8A 1XGSA 2BWSA 2EA2A 1QZYA 4FLIA 4U69A 2B3LA 3FMRA 4IKUA 4IU6A 1BN5A 4U6ZA 4OOKA 2BHDA 2OAZA 4MATA 4RGZ1 1QXWA 4U76A 3CB6A 2BWUA 2B3HA 3BITA 4ZWOA 1WBQA 4ZNGA 3MATA 3BIPA 2BH3A 5CLSA 4IPAA 4IKSA 3BIQA 3TB5A 4FLKA 4S2TP 1WY2A 3IU9A 3TAVA 2BHAA 2BWXA 1PV9A 4RZYA 4S01A 3S6BA 4IECA 5CE6A 2B3KA 2NQ7A 3CB5A 4FKCA 5FCFA 2BN7A 4U6CA 2GTXA 3IU7A 1B6AA 1WL6A 1XGMA 1YJ3A 4KM3A 2GG5A 4HXXA 1QXZA 3IG4A 1KQ0A 4S00A 1BOAA 5D6EA 3RORA 3RVAA 3D27A 4IDYA 4FO7A 2BHCA 4U70A 4PNCA 2BWVA 4ZWUA 2BWTA 2GG0A 4ZWPA 4A6WA 2V3XA 4FLJA 2EVMA 1R5HA 3FM3A 4A6VA 1R58A 2OKNA 3L24A 4Z7MA 1Y1NA 2Q94A 4U1BA 2Q96A 2P98A 5CDLA 2P99A 1W7VA 2ADUA 1A16A 3PKDA 2MATA 2GU5A 4B28A 3PKCA 2Q8KA 1XGNA 2P9AA 3IU8A 1C27A 1XNZA 1CHMA 4U75A 1C23A 5CDEA 4U73A 2BHBA 4IF7A 4JUQA 2GG2A 5JHUA 1WL9A 3CTZA 4IKRA 1YW7A 1MATA 2BB7A 2GA2A 4FO8A 2GU7A 2Q93A 5FCHA 2NQ6A 1QXYA 1XGOA 2GG3A 5CNXA 2IW2A 4U6WA 3MX6A 1C21A 2EA4A 3FMQA 3Q6DA 2BWYA 5E5BA 4S2RP 5CIKA 2GU6A 4RZZA 1N51A 2GZ5A 2Q92A 1WKMA 2EVOA 1KQ9A 4FUKA 1B59A 1R5GA 2GGCA 1C24A 2BWWA 2ZSGA 4U6EA 2GG7A 2GU4A 3L7GA 5D6FA 5JFRA 4IKTA 3MR1A 1KP0A 5JI6A 2V6CA 1WLRA 2DFIA 2Q95A 1C22A 1M35A 4R60A 4U71A 4PV4A 3PKBA 2GG9A 1YW9A 2EVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0X A;  1WN1 A;  4QR8 A;  2V3Z A;  1YVM A;  1W2M A;  1JAW A;  2GGB A;  3PKE A;  5CDV A;  3PKA A;  2G6P A;  2V3Y A;  2HOW A;  1YW8 A;  4EGE A;  4FLL A;  4U6J A;  2GG8 A;  1XGS A;  2BWS A;  2EA2 A;  1QZY A;  4FLI A;  4U69 A;  2B3L A;  3FMR A;  4IKU A;  4IU6 A;  1BN5 A;  4U6Z A;  4OOK A;  2BHD A;  2OAZ A;  4MAT A;  4RGZ 1;  1QXW A;  4U76 A;  3CB6 A;  2BWU A;  2B3H A;  3BIT A;  4ZWO A;  1WBQ A;  4ZNG A;  3MAT A;  3BIP A;  2BH3 A;  5CLS A;  4IPA A;  4IKS A;  3BIQ A;  3TB5 A;  4FLK A;  4S2T P;  1WY2 A;  3IU9 A;  3TAV A;  2BHA A;  2BWX A;  1PV9 A;  4RZY A;  4S01 A;  3S6B A;  4IEC A;  5CE6 A;  2B3K A;  2NQ7 A;  3CB5 A;  4FKC A;  5FCF A;  2BN7 A;  4U6C A;  2GTX A;  3IU7 A;  1B6A A;  1WL6 A;  1XGM A;  1YJ3 A;  4KM3 A;  2GG5 A;  4HXX A;  1QXZ A;  3IG4 A;  1KQ0 A;  4S00 A;  1BOA A;  5D6E A;  3ROR A;  3RVA A;  3D27 A;  4IDY A;  4FO7 A;  2BHC A;  4U70 A;  4PNC A;  2BWV A;  4ZWU A;  2BWT A;  2GG0 A;  4ZWP A;  4A6W A;  2V3X A;  4FLJ A;  2EVM A;  1R5H A;  3FM3 A;  4A6V A;  1R58 A;  2OKN A;  3L24 A;  4Z7M A;  1Y1N A;  2Q94 A;  4U1B A;  2Q96 A;  2P98 A;  5CDL A;  2P99 A;  1W7V A;  2ADU A;  1A16 A;  3PKD A;  2MAT A;  2GU5 A;  4B28 A;  3PKC A;  2Q8K A;  1XGN A;  2P9A A;  3IU8 A;  1C27 A;  1XNZ A;  1CHM A;  4U75 A;  1C23 A;  5CDE A;  4U73 A;  2BHB A;  4IF7 A;  4JUQ A;  2GG2 A;  5JHU A;  1WL9 A;  3CTZ A;  4IKR A;  1YW7 A;  1MAT A;  2BB7 A;  2GA2 A;  4FO8 A;  2GU7 A;  2Q93 A;  5FCH A;  2NQ6 A;  1QXY A;  1XGO A;  2GG3 A;  5CNX A;  2IW2 A;  4U6W A;  3MX6 A;  1C21 A;  2EA4 A;  3FMQ A;  3Q6D A;  2BWY A;  5E5B A;  4S2R P;  5CIK A;  2GU6 A;  4RZZ A;  1N51 A;  2GZ5 A;  2Q92 A;  1WKM A;  2EVO A;  1KQ9 A;  4FUK A;  1B59 A;  1R5G A;  2GGC A;  1C24 A;  2BWW A;  2ZSG A;  4U6E A;  2GG7 A;  2GU4 A;  3L7G A;  5D6F A;  5JFR A;  4IKT A;  3MR1 A;  1KP0 A;  5JI6 A;  2V6C A;  1WLR A;  2DFI A;  2Q95 A;  1C22 A;  1M35 A;  4R60 A;  4U71 A;  4PV4 A;  3PKB A;  2GG9 A;  1YW9 A;  2EVC A; 
#chains in the Genus database with same CATH topology
 1O0X A;  1WN1 A;  4QR8 A;  2V3Z A;  1YVM A;  1W2M A;  1JAW A;  2GGB A;  3PKE A;  5CDV A;  3PKA A;  2G6P A;  2V3Y A;  2HOW A;  1YW8 A;  4EGE A;  4FLL A;  4U6J A;  2GG8 A;  1XGS A;  2BWS A;  2EA2 A;  1QZY A;  4FLI A;  4U69 A;  2B3L A;  3FMR A;  4IKU A;  4IU6 A;  1BN5 A;  4U6Z A;  4OOK A;  2BHD A;  2OAZ A;  4MAT A;  4RGZ 1;  1QXW A;  4U76 A;  3CB6 A;  2BWU A;  2B3H A;  3BIT A;  4ZWO A;  1WBQ A;  4ZNG A;  3MAT A;  3BIP A;  2BH3 A;  5CLS A;  4IPA A;  4IKS A;  3BIQ A;  3TB5 A;  4FLK A;  4S2T P;  1WY2 A;  3IU9 A;  3TAV A;  2BHA A;  2BWX A;  1PV9 A;  4RZY A;  4S01 A;  3S6B A;  4IEC A;  5CE6 A;  2B3K A;  2NQ7 A;  3CB5 A;  4FKC A;  5FCF A;  2BN7 A;  4U6C A;  2GTX A;  3IU7 A;  1B6A A;  1WL6 A;  1XGM A;  1YJ3 A;  4KM3 A;  2GG5 A;  4HXX A;  1QXZ A;  3IG4 A;  1KQ0 A;  4S00 A;  1BOA A;  5D6E A;  3ROR A;  3RVA A;  3D27 A;  4IDY A;  4FO7 A;  2BHC A;  4U70 A;  4PNC A;  2BWV A;  4ZWU A;  2BWT A;  2GG0 A;  4ZWP A;  4A6W A;  2V3X A;  4FLJ A;  2EVM A;  1R5H A;  3FM3 A;  4A6V A;  1R58 A;  2OKN A;  3L24 A;  4Z7M A;  1Y1N A;  2Q94 A;  4U1B A;  2Q96 A;  2P98 A;  5CDL A;  2P99 A;  1W7V A;  2ADU A;  1A16 A;  3PKD A;  2MAT A;  2GU5 A;  4B28 A;  3PKC A;  2Q8K A;  1XGN A;  2P9A A;  3IU8 A;  1C27 A;  1XNZ A;  1CHM A;  4U75 A;  1C23 A;  5CDE A;  4U73 A;  2BHB A;  4IF7 A;  4JUQ A;  2GG2 A;  5JHU A;  1WL9 A;  3CTZ A;  4IKR A;  1YW7 A;  1MAT A;  2BB7 A;  2GA2 A;  4FO8 A;  2GU7 A;  2Q93 A;  5FCH A;  2NQ6 A;  1QXY A;  1XGO A;  2GG3 A;  5CNX A;  2IW2 A;  4U6W A;  3MX6 A;  1C21 A;  2EA4 A;  3FMQ A;  3Q6D A;  2BWY A;  5E5B A;  4S2R P;  5CIK A;  2GU6 A;  4RZZ A;  1N51 A;  2GZ5 A;  2Q92 A;  1WKM A;  2EVO A;  1KQ9 A;  4FUK A;  1B59 A;  1R5G A;  2GGC A;  1C24 A;  2BWW A;  2ZSG A;  4U6E A;  2GG7 A;  2GU4 A;  3L7G A;  5D6F A;  5JFR A;  4IKT A;  3MR1 A;  1KP0 A;  5JI6 A;  2V6C A;  1WLR A;  2DFI A;  2Q95 A;  1C22 A;  1M35 A;  4R60 A;  4U71 A;  4PV4 A;  3PKB A;  2GG9 A;  1YW9 A;  2EVC A; 
#chains in the Genus database with same CATH homology
 1O0X A;  1WN1 A;  4QR8 A;  2V3Z A;  1YVM A;  1W2M A;  1JAW A;  2GGB A;  3PKE A;  5CDV A;  3PKA A;  2G6P A;  2V3Y A;  2HOW A;  1YW8 A;  4EGE A;  4FLL A;  4U6J A;  2GG8 A;  1XGS A;  2BWS A;  2EA2 A;  1QZY A;  4FLI A;  4U69 A;  2B3L A;  3FMR A;  4IKU A;  4IU6 A;  1BN5 A;  4U6Z A;  4OOK A;  2BHD A;  2OAZ A;  4MAT A;  4RGZ 1;  1QXW A;  4U76 A;  3CB6 A;  2BWU A;  2B3H A;  3BIT A;  4ZWO A;  1WBQ A;  4ZNG A;  3MAT A;  3BIP A;  2BH3 A;  5CLS A;  4IPA A;  4IKS A;  3BIQ A;  3TB5 A;  4FLK A;  4S2T P;  1WY2 A;  3IU9 A;  3TAV A;  2BHA A;  2BWX A;  1PV9 A;  4RZY A;  4S01 A;  3S6B A;  4IEC A;  5CE6 A;  2B3K A;  2NQ7 A;  3CB5 A;  4FKC A;  5FCF A;  2BN7 A;  4U6C A;  2GTX A;  3IU7 A;  1B6A A;  1WL6 A;  1XGM A;  1YJ3 A;  4KM3 A;  2GG5 A;  4HXX A;  1QXZ A;  3IG4 A;  1KQ0 A;  4S00 A;  1BOA A;  5D6E A;  3ROR A;  3RVA A;  3D27 A;  4IDY A;  4FO7 A;  2BHC A;  4U70 A;  4PNC A;  2BWV A;  4ZWU A;  2BWT A;  2GG0 A;  4ZWP A;  4A6W A;  2V3X A;  4FLJ A;  2EVM A;  1R5H A;  3FM3 A;  4A6V A;  1R58 A;  2OKN A;  3L24 A;  4Z7M A;  1Y1N A;  2Q94 A;  4U1B A;  2Q96 A;  2P98 A;  5CDL A;  2P99 A;  1W7V A;  2ADU A;  1A16 A;  3PKD A;  2MAT A;  2GU5 A;  4B28 A;  3PKC A;  2Q8K A;  1XGN A;  2P9A A;  3IU8 A;  1C27 A;  1XNZ A;  1CHM A;  4U75 A;  1C23 A;  5CDE A;  4U73 A;  2BHB A;  4IF7 A;  4JUQ A;  2GG2 A;  5JHU A;  1WL9 A;  3CTZ A;  4IKR A;  1YW7 A;  1MAT A;  2BB7 A;  2GA2 A;  4FO8 A;  2GU7 A;  2Q93 A;  5FCH A;  2NQ6 A;  1QXY A;  1XGO A;  2GG3 A;  5CNX A;  2IW2 A;  4U6W A;  3MX6 A;  1C21 A;  2EA4 A;  3FMQ A;  3Q6D A;  2BWY A;  5E5B A;  4S2R P;  5CIK A;  2GU6 A;  4RZZ A;  1N51 A;  2GZ5 A;  2Q92 A;  1WKM A;  2EVO A;  1KQ9 A;  4FUK A;  1B59 A;  1R5G A;  2GGC A;  1C24 A;  2BWW A;  2ZSG A;  4U6E A;  2GG7 A;  2GU4 A;  3L7G A;  5D6F A;  5JFR A;  4IKT A;  3MR1 A;  1KP0 A;  5JI6 A;  2V6C A;  1WLR A;  2DFI A;  2Q95 A;  1C22 A;  1M35 A;  4R60 A;  4U71 A;  4PV4 A;  3PKB A;  2GG9 A;  1YW9 A;  2EVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...