4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
4IF7A 4U71A 5D6FA 4IU6A 1WL6A 2Q92A 4IECA 5CIKA 2V3ZA 2GG9A 1YW8A 3PKDA 2GG8A 2Q95A 3BIQA 1A16A 1W2MA 4FLJA 4IPAA 2EVOA 2GGBA 4IKRA 1QXWA 3BITA 4OOKA 4U69A 4U6WA 1BN5A 3PKCA 1W7VA 3FM3A 2IW2A 1C27A 4FLIA 1WN1A 3IU8A 4IDYA 4Z7MA 5FCFA 4MATA 3PKAA 2BB7A 4FO8A 4A6WA 2P99A 5CLSA 3BIPA 3CB5A 1WKMA 1QXZA 1XGNA 2GA2A 2BHAA 1KQ9A 2G6PA 1C24A 2BWTA 4U6EA 4U75A 3PKBA 4S2TP 2GU7A 4U6ZA 4JUQA 2NQ6A 2MATA 5CDVA 2EVMA 4FUKA 2ZSGA 5JI6A 1YJ3A 2BHBA 3L24A 2BWSA 4QR8A 2V6CA 1QXYA 1PV9A 1YVMA 1C21A 4RZZA 1MATA 4U73A 1B59A 3L7GA 1R5GA 1R5HA 4S00A 2GG5A 3S6BA 3MX6A 4A6VA 2GU4A 2BWUA 3CB6A 1QZYA 1B6AA 3IU9A 5CE6A 2ADUA 4ZNGA 4IKSA 5JFRA 4EGEA 4U76A 1KQ0A 4PV4A 3MATA 1BOAA 2GG3A 4FLKA 2Q8KA 5FCHA 2Q93A 3MR1A 2GGCA 2P9AA 2BWWA 3IU7A 2BHDA 4R60A 2GG2A 4U6CA 5CNXA 2GG7A 2NQ7A 1Y1NA 4ZWOA 2BHCA 3RORA 1XNZA 4S2RP 2EVCA 2GU5A 5E5BA 4RZYA 3TB5A 2GZ5A 2V3XA 5CDEA 5JHUA 4RGZ1 3PKEA 1WY2A 4HXXA 5D6EA 2BWXA 1O0XA 3FMQA 4FKCA 4U1BA 1WLRA 2Q94A 2GTXA 2EA4A 1WBQA 4B28A 1KP0A 4ZWUA 2GU6A 2V3YA 1N51A 2P98A 4PNCA 2OKNA 2BWYA 1XGSA 2B3HA 3CTZA 2BN7A 1XGMA 4FLLA 2GG0A 1C22A 1WL9A 4IKTA 4KM3A 4ZWPA 2B3KA 4U70A 2DFIA 1JAWA 3D27A 3Q6DA 4IKUA 2EA2A 1YW9A 1YW7A 1CHMA 2B3LA 2HOWA 3RVAA 1M35A 1R58A 2BH3A 3IG4A 2OAZA 4U6JA 2BWVA 2Q96A 1XGOA 4S01A 5CDLA 3FMRA 1C23A 4FO7A 3TAVA
chains in the Genus database with same CATH superfamily
4IF7A 4U71A 5D6FA 4IU6A 1WL6A 2Q92A 4IECA 5CIKA 2V3ZA 2GG9A 1YW8A 3PKDA 2GG8A 2Q95A 3BIQA 1A16A 1W2MA 4FLJA 4IPAA 2EVOA 2GGBA 4IKRA 1QXWA 3BITA 4OOKA 4U69A 4U6WA 1BN5A 3PKCA 1W7VA 3FM3A 2IW2A 1C27A 4FLIA 1WN1A 3IU8A 4IDYA 4Z7MA 5FCFA 4MATA 3PKAA 2BB7A 4FO8A 4A6WA 2P99A 5CLSA 3BIPA 3CB5A 1WKMA 1QXZA 1XGNA 2GA2A 2BHAA 1KQ9A 2G6PA 1C24A 2BWTA 4U6EA 4U75A 3PKBA 4S2TP 2GU7A 4U6ZA 4JUQA 2NQ6A 2MATA 5CDVA 2EVMA 4FUKA 2ZSGA 5JI6A 1YJ3A 2BHBA 3L24A 2BWSA 4QR8A 2V6CA 1QXYA 1PV9A 1YVMA 1C21A 4RZZA 1MATA 4U73A 1B59A 3L7GA 1R5GA 1R5HA 4S00A 2GG5A 3S6BA 3MX6A 4A6VA 2GU4A 2BWUA 3CB6A 1QZYA 1B6AA 3IU9A 5CE6A 2ADUA 4ZNGA 4IKSA 5JFRA 4EGEA 4U76A 1KQ0A 4PV4A 3MATA 1BOAA 2GG3A 4FLKA 2Q8KA 5FCHA 2Q93A 3MR1A 2GGCA 2P9AA 2BWWA 3IU7A 2BHDA 4R60A 2GG2A 4U6CA 5CNXA 2GG7A 2NQ7A 1Y1NA 4ZWOA 2BHCA 3RORA 1XNZA 4S2RP 2EVCA 2GU5A 5E5BA 4RZYA 3TB5A 2GZ5A 2V3XA 5CDEA 5JHUA 4RGZ1 3PKEA 1WY2A 4HXXA 5D6EA 2BWXA 1O0XA 3FMQA 4FKCA 4U1BA 1WLRA 2Q94A 2GTXA 2EA4A 1WBQA 4B28A 1KP0A 4ZWUA 2GU6A 2V3YA 1N51A 2P98A 4PNCA 2OKNA 2BWYA 1XGSA 2B3HA 3CTZA 2BN7A 1XGMA 4FLLA 2GG0A 1C22A 1WL9A 4IKTA 4KM3A 4ZWPA 2B3KA 4U70A 2DFIA 1JAWA 3D27A 3Q6DA 4IKUA 2EA2A 1YW9A 1YW7A 1CHMA 2B3LA 2HOWA 3RVAA 1M35A 1R58A 2BH3A 3IG4A 2OAZA 4U6JA 2BWVA 2Q96A 1XGOA 4S01A 5CDLA 3FMRA 1C23A 4FO7A 3TAVA
chains in the Genus database with same CATH topology
4IF7A 4U71A 5D6FA 4IU6A 1WL6A 2Q92A 4IECA 5CIKA 2V3ZA 2GG9A 1YW8A 3PKDA 2GG8A 2Q95A 3BIQA 1A16A 1W2MA 4FLJA 4IPAA 2EVOA 2GGBA 4IKRA 1QXWA 3BITA 4OOKA 4U69A 4U6WA 1BN5A 3PKCA 1W7VA 3FM3A 2IW2A 1C27A 4FLIA 1WN1A 3IU8A 4IDYA 4Z7MA 5FCFA 4MATA 3PKAA 2BB7A 4FO8A 4A6WA 2P99A 5CLSA 3BIPA 3CB5A 1WKMA 1QXZA 1XGNA 2GA2A 2BHAA 1KQ9A 2G6PA 1C24A 2BWTA 4U6EA 4U75A 3PKBA 4S2TP 2GU7A 4U6ZA 4JUQA 2NQ6A 2MATA 5CDVA 2EVMA 4FUKA 2ZSGA 5JI6A 1YJ3A 2BHBA 3L24A 2BWSA 4QR8A 2V6CA 1QXYA 1PV9A 1YVMA 1C21A 4RZZA 1MATA 4U73A 1B59A 3L7GA 1R5GA 1R5HA 4S00A 2GG5A 3S6BA 3MX6A 4A6VA 2GU4A 2BWUA 3CB6A 1QZYA 1B6AA 3IU9A 5CE6A 2ADUA 4ZNGA 4IKSA 5JFRA 4EGEA 4U76A 1KQ0A 4PV4A 3MATA 1BOAA 2GG3A 4FLKA 2Q8KA 5FCHA 2Q93A 3MR1A 2GGCA 2P9AA 2BWWA 3IU7A 2BHDA 4R60A 2GG2A 4U6CA 5CNXA 2GG7A 2NQ7A 1Y1NA 4ZWOA 2BHCA 3RORA 1XNZA 4S2RP 2EVCA 2GU5A 5E5BA 4RZYA 3TB5A 2GZ5A 2V3XA 5CDEA 5JHUA 4RGZ1 3PKEA 1WY2A 4HXXA 5D6EA 2BWXA 1O0XA 3FMQA 4FKCA 4U1BA 1WLRA 2Q94A 2GTXA 2EA4A 1WBQA 4B28A 1KP0A 4ZWUA 2GU6A 2V3YA 1N51A 2P98A 4PNCA 2OKNA 2BWYA 1XGSA 2B3HA 3CTZA 2BN7A 1XGMA 4FLLA 2GG0A 1C22A 1WL9A 4IKTA 4KM3A 4ZWPA 2B3KA 4U70A 2DFIA 1JAWA 3D27A 3Q6DA 4IKUA 2EA2A 1YW9A 1YW7A 1CHMA 2B3LA 2HOWA 3RVAA 1M35A 1R58A 2BH3A 3IG4A 2OAZA 4U6JA 2BWVA 2Q96A 1XGOA 4S01A 5CDLA 3FMRA 1C23A 4FO7A 3TAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF7 A;  4U71 A;  5D6F A;  4IU6 A;  1WL6 A;  2Q92 A;  4IEC A;  5CIK A;  2V3Z A;  2GG9 A;  1YW8 A;  3PKD A;  2GG8 A;  2Q95 A;  3BIQ A;  1A16 A;  1W2M A;  4FLJ A;  4IPA A;  2EVO A;  2GGB A;  4IKR A;  1QXW A;  3BIT A;  4OOK A;  4U69 A;  4U6W A;  1BN5 A;  3PKC A;  1W7V A;  3FM3 A;  2IW2 A;  1C27 A;  4FLI A;  1WN1 A;  3IU8 A;  4IDY A;  4Z7M A;  5FCF A;  4MAT A;  3PKA A;  2BB7 A;  4FO8 A;  4A6W A;  2P99 A;  5CLS A;  3BIP A;  3CB5 A;  1WKM A;  1QXZ A;  1XGN A;  2GA2 A;  2BHA A;  1KQ9 A;  2G6P A;  1C24 A;  2BWT A;  4U6E A;  4U75 A;  3PKB A;  4S2T P;  2GU7 A;  4U6Z A;  4JUQ A;  2NQ6 A;  2MAT A;  5CDV A;  2EVM A;  4FUK A;  2ZSG A;  5JI6 A;  1YJ3 A;  2BHB A;  3L24 A;  2BWS A;  4QR8 A;  2V6C A;  1QXY A;  1PV9 A;  1YVM A;  1C21 A;  4RZZ A;  1MAT A;  4U73 A;  1B59 A;  3L7G A;  1R5G A;  1R5H A;  4S00 A;  2GG5 A;  3S6B A;  3MX6 A;  4A6V A;  2GU4 A;  2BWU A;  3CB6 A;  1QZY A;  1B6A A;  3IU9 A;  5CE6 A;  2ADU A;  4ZNG A;  4IKS A;  5JFR A;  4EGE A;  4U76 A;  1KQ0 A;  4PV4 A;  3MAT A;  1BOA A;  2GG3 A;  4FLK A;  2Q8K A;  5FCH A;  2Q93 A;  3MR1 A;  2GGC A;  2P9A A;  2BWW A;  3IU7 A;  2BHD A;  4R60 A;  2GG2 A;  4U6C A;  5CNX A;  2GG7 A;  2NQ7 A;  1Y1N A;  4ZWO A;  2BHC A;  3ROR A;  1XNZ A;  4S2R P;  2EVC A;  2GU5 A;  5E5B A;  4RZY A;  3TB5 A;  2GZ5 A;  2V3X A;  5CDE A;  5JHU A;  4RGZ 1;  3PKE A;  1WY2 A;  4HXX A;  5D6E A;  2BWX A;  1O0X A;  3FMQ A;  4FKC A;  4U1B A;  1WLR A;  2Q94 A;  2GTX A;  2EA4 A;  1WBQ A;  4B28 A;  1KP0 A;  4ZWU A;  2GU6 A;  2V3Y A;  1N51 A;  2P98 A;  4PNC A;  2OKN A;  2BWY A;  1XGS A;  2B3H A;  3CTZ A;  2BN7 A;  1XGM A;  4FLL A;  2GG0 A;  1C22 A;  1WL9 A;  4IKT A;  4KM3 A;  4ZWP A;  2B3K A;  4U70 A;  2DFI A;  1JAW A;  3D27 A;  3Q6D A;  4IKU A;  2EA2 A;  1YW9 A;  1YW7 A;  1CHM A;  2B3L A;  2HOW A;  3RVA A;  1M35 A;  1R58 A;  2BH3 A;  3IG4 A;  2OAZ A;  4U6J A;  2BWV A;  2Q96 A;  1XGO A;  4S01 A;  5CDL A;  3FMR A;  1C23 A;  4FO7 A;  3TAV A; 
#chains in the Genus database with same CATH topology
 4IF7 A;  4U71 A;  5D6F A;  4IU6 A;  1WL6 A;  2Q92 A;  4IEC A;  5CIK A;  2V3Z A;  2GG9 A;  1YW8 A;  3PKD A;  2GG8 A;  2Q95 A;  3BIQ A;  1A16 A;  1W2M A;  4FLJ A;  4IPA A;  2EVO A;  2GGB A;  4IKR A;  1QXW A;  3BIT A;  4OOK A;  4U69 A;  4U6W A;  1BN5 A;  3PKC A;  1W7V A;  3FM3 A;  2IW2 A;  1C27 A;  4FLI A;  1WN1 A;  3IU8 A;  4IDY A;  4Z7M A;  5FCF A;  4MAT A;  3PKA A;  2BB7 A;  4FO8 A;  4A6W A;  2P99 A;  5CLS A;  3BIP A;  3CB5 A;  1WKM A;  1QXZ A;  1XGN A;  2GA2 A;  2BHA A;  1KQ9 A;  2G6P A;  1C24 A;  2BWT A;  4U6E A;  4U75 A;  3PKB A;  4S2T P;  2GU7 A;  4U6Z A;  4JUQ A;  2NQ6 A;  2MAT A;  5CDV A;  2EVM A;  4FUK A;  2ZSG A;  5JI6 A;  1YJ3 A;  2BHB A;  3L24 A;  2BWS A;  4QR8 A;  2V6C A;  1QXY A;  1PV9 A;  1YVM A;  1C21 A;  4RZZ A;  1MAT A;  4U73 A;  1B59 A;  3L7G A;  1R5G A;  1R5H A;  4S00 A;  2GG5 A;  3S6B A;  3MX6 A;  4A6V A;  2GU4 A;  2BWU A;  3CB6 A;  1QZY A;  1B6A A;  3IU9 A;  5CE6 A;  2ADU A;  4ZNG A;  4IKS A;  5JFR A;  4EGE A;  4U76 A;  1KQ0 A;  4PV4 A;  3MAT A;  1BOA A;  2GG3 A;  4FLK A;  2Q8K A;  5FCH A;  2Q93 A;  3MR1 A;  2GGC A;  2P9A A;  2BWW A;  3IU7 A;  2BHD A;  4R60 A;  2GG2 A;  4U6C A;  5CNX A;  2GG7 A;  2NQ7 A;  1Y1N A;  4ZWO A;  2BHC A;  3ROR A;  1XNZ A;  4S2R P;  2EVC A;  2GU5 A;  5E5B A;  4RZY A;  3TB5 A;  2GZ5 A;  2V3X A;  5CDE A;  5JHU A;  4RGZ 1;  3PKE A;  1WY2 A;  4HXX A;  5D6E A;  2BWX A;  1O0X A;  3FMQ A;  4FKC A;  4U1B A;  1WLR A;  2Q94 A;  2GTX A;  2EA4 A;  1WBQ A;  4B28 A;  1KP0 A;  4ZWU A;  2GU6 A;  2V3Y A;  1N51 A;  2P98 A;  4PNC A;  2OKN A;  2BWY A;  1XGS A;  2B3H A;  3CTZ A;  2BN7 A;  1XGM A;  4FLL A;  2GG0 A;  1C22 A;  1WL9 A;  4IKT A;  4KM3 A;  4ZWP A;  2B3K A;  4U70 A;  2DFI A;  1JAW A;  3D27 A;  3Q6D A;  4IKU A;  2EA2 A;  1YW9 A;  1YW7 A;  1CHM A;  2B3L A;  2HOW A;  3RVA A;  1M35 A;  1R58 A;  2BH3 A;  3IG4 A;  2OAZ A;  4U6J A;  2BWV A;  2Q96 A;  1XGO A;  4S01 A;  5CDL A;  3FMR A;  1C23 A;  4FO7 A;  3TAV A; 
#chains in the Genus database with same CATH homology
 4IF7 A;  4U71 A;  5D6F A;  4IU6 A;  1WL6 A;  2Q92 A;  4IEC A;  5CIK A;  2V3Z A;  2GG9 A;  1YW8 A;  3PKD A;  2GG8 A;  2Q95 A;  3BIQ A;  1A16 A;  1W2M A;  4FLJ A;  4IPA A;  2EVO A;  2GGB A;  4IKR A;  1QXW A;  3BIT A;  4OOK A;  4U69 A;  4U6W A;  1BN5 A;  3PKC A;  1W7V A;  3FM3 A;  2IW2 A;  1C27 A;  4FLI A;  1WN1 A;  3IU8 A;  4IDY A;  4Z7M A;  5FCF A;  4MAT A;  3PKA A;  2BB7 A;  4FO8 A;  4A6W A;  2P99 A;  5CLS A;  3BIP A;  3CB5 A;  1WKM A;  1QXZ A;  1XGN A;  2GA2 A;  2BHA A;  1KQ9 A;  2G6P A;  1C24 A;  2BWT A;  4U6E A;  4U75 A;  3PKB A;  4S2T P;  2GU7 A;  4U6Z A;  4JUQ A;  2NQ6 A;  2MAT A;  5CDV A;  2EVM A;  4FUK A;  2ZSG A;  5JI6 A;  1YJ3 A;  2BHB A;  3L24 A;  2BWS A;  4QR8 A;  2V6C A;  1QXY A;  1PV9 A;  1YVM A;  1C21 A;  4RZZ A;  1MAT A;  4U73 A;  1B59 A;  3L7G A;  1R5G A;  1R5H A;  4S00 A;  2GG5 A;  3S6B A;  3MX6 A;  4A6V A;  2GU4 A;  2BWU A;  3CB6 A;  1QZY A;  1B6A A;  3IU9 A;  5CE6 A;  2ADU A;  4ZNG A;  4IKS A;  5JFR A;  4EGE A;  4U76 A;  1KQ0 A;  4PV4 A;  3MAT A;  1BOA A;  2GG3 A;  4FLK A;  2Q8K A;  5FCH A;  2Q93 A;  3MR1 A;  2GGC A;  2P9A A;  2BWW A;  3IU7 A;  2BHD A;  4R60 A;  2GG2 A;  4U6C A;  5CNX A;  2GG7 A;  2NQ7 A;  1Y1N A;  4ZWO A;  2BHC A;  3ROR A;  1XNZ A;  4S2R P;  2EVC A;  2GU5 A;  5E5B A;  4RZY A;  3TB5 A;  2GZ5 A;  2V3X A;  5CDE A;  5JHU A;  4RGZ 1;  3PKE A;  1WY2 A;  4HXX A;  5D6E A;  2BWX A;  1O0X A;  3FMQ A;  4FKC A;  4U1B A;  1WLR A;  2Q94 A;  2GTX A;  2EA4 A;  1WBQ A;  4B28 A;  1KP0 A;  4ZWU A;  2GU6 A;  2V3Y A;  1N51 A;  2P98 A;  4PNC A;  2OKN A;  2BWY A;  1XGS A;  2B3H A;  3CTZ A;  2BN7 A;  1XGM A;  4FLL A;  2GG0 A;  1C22 A;  1WL9 A;  4IKT A;  4KM3 A;  4ZWP A;  2B3K A;  4U70 A;  2DFI A;  1JAW A;  3D27 A;  3Q6D A;  4IKU A;  2EA2 A;  1YW9 A;  1YW7 A;  1CHM A;  2B3L A;  2HOW A;  3RVA A;  1M35 A;  1R58 A;  2BH3 A;  3IG4 A;  2OAZ A;  4U6J A;  2BWV A;  2Q96 A;  1XGO A;  4S01 A;  5CDL A;  3FMR A;  1C23 A;  4FO7 A;  3TAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...