4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
3FMRA 4FKCA 3FM3A 1R58A 1XGMA 3IU8A 3TB5A 2B3HA 2P99A 4KM3A 3IU7A 2OKNA 4IU6A 1MATA 2BWWA 2GGCA 4FO7A 4PV4A 2B3LA 1WL6A 3PKEA 1WKMA 1YW8A 1WLRA 1C27A 1Y1NA 4ZWOA 5CDLA 2IW2A 1O0XA 2BHCA 3L24A 1R5GA 4FLJA 4IF7A 4S2TP 4RZYA 2GTXA 2BH3A 3CB5A 1C23A 1BOAA 2EVOA 1XGNA 2GG8A 3BITA 4ZWPA 2G6PA 2BB7A 3CB6A 2GU5A 2OAZA 4MATA 2V3ZA 4IKTA 4B28A 4HXXA 2Q96A 5CNXA 3PKDA 1R5HA 1QZYA 1KP0A 3RVAA 3PKAA 2DFIA 2Q94A 2ADUA 4IKSA 1CHMA 3CTZA 2Q8KA 3IU9A 2Q93A 5D6FA 1B6AA 1JAWA 4IDYA 1WBQA 2MATA 4S2RP 2BWSA 2GG9A 3TAVA 2EA4A 4U6JA 1C22A 1C24A 5CDVA 4FO8A 5CDEA 3MR1A 2GG7A 2GG3A 3PKCA 2V3YA 1BN5A 3BIPA 5D6EA 1XGSA 1KQ0A 4U6EA 4R60A 2V6CA 2Q92A 2GU4A 2ZSGA 1YW9A 2GA2A 1QXWA 2GG2A 2GU6A 4JUQA 2GU7A 4S01A 4U76A 4IECA 3RORA 3S6BA 2NQ6A 3Q6DA 4S00A 1C21A 2GZ5A 2EVCA 2Q95A 2V3XA 2EVMA 1W2MA 1WL9A 2GGBA 2BN7A 2P9AA 2B3KA 3MATA 1M35A 1WY2A 1XNZA 2P98A 3D27A 3FMQA 4U6ZA 4ZNGA 2NQ7A 4IKRA 4RGZ1 3BIQA 4U75A 4FLLA 4FLIA 1YW7A 4EGEA 4U1BA 1PV9A 1YJ3A 4U6CA 5CLSA 1QXYA 5FCFA 2BWVA 4RZZA 4U73A 2BHAA 4A6VA 1YVMA 1QXZA 2HOWA 4PNCA 2BWTA 3IG4A 2GG0A 2BWYA 3PKBA 4U71A 5CE6A 3L7GA 4U6WA 2GG5A 4U70A 5CIKA 5JFRA 1XGOA 4A6WA 4FUKA 5JHUA 5E5BA 2EA2A 5JI6A 2BHBA 1KQ9A 4ZWUA 5FCHA 4OOKA 1W7VA 2BHDA 2BWUA 4FLKA 4IKUA 1WN1A 4U69A 3MX6A 4IPAA 4Z7MA 4QR8A 1N51A 1A16A 1B59A 2BWXA
chains in the Genus database with same CATH superfamily
3FMRA 4FKCA 3FM3A 1R58A 1XGMA 3IU8A 3TB5A 2B3HA 2P99A 4KM3A 3IU7A 2OKNA 4IU6A 1MATA 2BWWA 2GGCA 4FO7A 4PV4A 2B3LA 1WL6A 3PKEA 1WKMA 1YW8A 1WLRA 1C27A 1Y1NA 4ZWOA 5CDLA 2IW2A 1O0XA 2BHCA 3L24A 1R5GA 4FLJA 4IF7A 4S2TP 4RZYA 2GTXA 2BH3A 3CB5A 1C23A 1BOAA 2EVOA 1XGNA 2GG8A 3BITA 4ZWPA 2G6PA 2BB7A 3CB6A 2GU5A 2OAZA 4MATA 2V3ZA 4IKTA 4B28A 4HXXA 2Q96A 5CNXA 3PKDA 1R5HA 1QZYA 1KP0A 3RVAA 3PKAA 2DFIA 2Q94A 2ADUA 4IKSA 1CHMA 3CTZA 2Q8KA 3IU9A 2Q93A 5D6FA 1B6AA 1JAWA 4IDYA 1WBQA 2MATA 4S2RP 2BWSA 2GG9A 3TAVA 2EA4A 4U6JA 1C22A 1C24A 5CDVA 4FO8A 5CDEA 3MR1A 2GG7A 2GG3A 3PKCA 2V3YA 1BN5A 3BIPA 5D6EA 1XGSA 1KQ0A 4U6EA 4R60A 2V6CA 2Q92A 2GU4A 2ZSGA 1YW9A 2GA2A 1QXWA 2GG2A 2GU6A 4JUQA 2GU7A 4S01A 4U76A 4IECA 3RORA 3S6BA 2NQ6A 3Q6DA 4S00A 1C21A 2GZ5A 2EVCA 2Q95A 2V3XA 2EVMA 1W2MA 1WL9A 2GGBA 2BN7A 2P9AA 2B3KA 3MATA 1M35A 1WY2A 1XNZA 2P98A 3D27A 3FMQA 4U6ZA 4ZNGA 2NQ7A 4IKRA 4RGZ1 3BIQA 4U75A 4FLLA 4FLIA 1YW7A 4EGEA 4U1BA 1PV9A 1YJ3A 4U6CA 5CLSA 1QXYA 5FCFA 2BWVA 4RZZA 4U73A 2BHAA 4A6VA 1YVMA 1QXZA 2HOWA 4PNCA 2BWTA 3IG4A 2GG0A 2BWYA 3PKBA 4U71A 5CE6A 3L7GA 4U6WA 2GG5A 4U70A 5CIKA 5JFRA 1XGOA 4A6WA 4FUKA 5JHUA 5E5BA 2EA2A 5JI6A 2BHBA 1KQ9A 4ZWUA 5FCHA 4OOKA 1W7VA 2BHDA 2BWUA 4FLKA 4IKUA 1WN1A 4U69A 3MX6A 4IPAA 4Z7MA 4QR8A 1N51A 1A16A 1B59A 2BWXA
chains in the Genus database with same CATH topology
3FMRA 4FKCA 3FM3A 1R58A 1XGMA 3IU8A 3TB5A 2B3HA 2P99A 4KM3A 3IU7A 2OKNA 4IU6A 1MATA 2BWWA 2GGCA 4FO7A 4PV4A 2B3LA 1WL6A 3PKEA 1WKMA 1YW8A 1WLRA 1C27A 1Y1NA 4ZWOA 5CDLA 2IW2A 1O0XA 2BHCA 3L24A 1R5GA 4FLJA 4IF7A 4S2TP 4RZYA 2GTXA 2BH3A 3CB5A 1C23A 1BOAA 2EVOA 1XGNA 2GG8A 3BITA 4ZWPA 2G6PA 2BB7A 3CB6A 2GU5A 2OAZA 4MATA 2V3ZA 4IKTA 4B28A 4HXXA 2Q96A 5CNXA 3PKDA 1R5HA 1QZYA 1KP0A 3RVAA 3PKAA 2DFIA 2Q94A 2ADUA 4IKSA 1CHMA 3CTZA 2Q8KA 3IU9A 2Q93A 5D6FA 1B6AA 1JAWA 4IDYA 1WBQA 2MATA 4S2RP 2BWSA 2GG9A 3TAVA 2EA4A 4U6JA 1C22A 1C24A 5CDVA 4FO8A 5CDEA 3MR1A 2GG7A 2GG3A 3PKCA 2V3YA 1BN5A 3BIPA 5D6EA 1XGSA 1KQ0A 4U6EA 4R60A 2V6CA 2Q92A 2GU4A 2ZSGA 1YW9A 2GA2A 1QXWA 2GG2A 2GU6A 4JUQA 2GU7A 4S01A 4U76A 4IECA 3RORA 3S6BA 2NQ6A 3Q6DA 4S00A 1C21A 2GZ5A 2EVCA 2Q95A 2V3XA 2EVMA 1W2MA 1WL9A 2GGBA 2BN7A 2P9AA 2B3KA 3MATA 1M35A 1WY2A 1XNZA 2P98A 3D27A 3FMQA 4U6ZA 4ZNGA 2NQ7A 4IKRA 4RGZ1 3BIQA 4U75A 4FLLA 4FLIA 1YW7A 4EGEA 4U1BA 1PV9A 1YJ3A 4U6CA 5CLSA 1QXYA 5FCFA 2BWVA 4RZZA 4U73A 2BHAA 4A6VA 1YVMA 1QXZA 2HOWA 4PNCA 2BWTA 3IG4A 2GG0A 2BWYA 3PKBA 4U71A 5CE6A 3L7GA 4U6WA 2GG5A 4U70A 5CIKA 5JFRA 1XGOA 4A6WA 4FUKA 5JHUA 5E5BA 2EA2A 5JI6A 2BHBA 1KQ9A 4ZWUA 5FCHA 4OOKA 1W7VA 2BHDA 2BWUA 4FLKA 4IKUA 1WN1A 4U69A 3MX6A 4IPAA 4Z7MA 4QR8A 1N51A 1A16A 1B59A 2BWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMR A;  4FKC A;  3FM3 A;  1R58 A;  1XGM A;  3IU8 A;  3TB5 A;  2B3H A;  2P99 A;  4KM3 A;  3IU7 A;  2OKN A;  4IU6 A;  1MAT A;  2BWW A;  2GGC A;  4FO7 A;  4PV4 A;  2B3L A;  1WL6 A;  3PKE A;  1WKM A;  1YW8 A;  1WLR A;  1C27 A;  1Y1N A;  4ZWO A;  5CDL A;  2IW2 A;  1O0X A;  2BHC A;  3L24 A;  1R5G A;  4FLJ A;  4IF7 A;  4S2T P;  4RZY A;  2GTX A;  2BH3 A;  3CB5 A;  1C23 A;  1BOA A;  2EVO A;  1XGN A;  2GG8 A;  3BIT A;  4ZWP A;  2G6P A;  2BB7 A;  3CB6 A;  2GU5 A;  2OAZ A;  4MAT A;  2V3Z A;  4IKT A;  4B28 A;  4HXX A;  2Q96 A;  5CNX A;  3PKD A;  1R5H A;  1QZY A;  1KP0 A;  3RVA A;  3PKA A;  2DFI A;  2Q94 A;  2ADU A;  4IKS A;  1CHM A;  3CTZ A;  2Q8K A;  3IU9 A;  2Q93 A;  5D6F A;  1B6A A;  1JAW A;  4IDY A;  1WBQ A;  2MAT A;  4S2R P;  2BWS A;  2GG9 A;  3TAV A;  2EA4 A;  4U6J A;  1C22 A;  1C24 A;  5CDV A;  4FO8 A;  5CDE A;  3MR1 A;  2GG7 A;  2GG3 A;  3PKC A;  2V3Y A;  1BN5 A;  3BIP A;  5D6E A;  1XGS A;  1KQ0 A;  4U6E A;  4R60 A;  2V6C A;  2Q92 A;  2GU4 A;  2ZSG A;  1YW9 A;  2GA2 A;  1QXW A;  2GG2 A;  2GU6 A;  4JUQ A;  2GU7 A;  4S01 A;  4U76 A;  4IEC A;  3ROR A;  3S6B A;  2NQ6 A;  3Q6D A;  4S00 A;  1C21 A;  2GZ5 A;  2EVC A;  2Q95 A;  2V3X A;  2EVM A;  1W2M A;  1WL9 A;  2GGB A;  2BN7 A;  2P9A A;  2B3K A;  3MAT A;  1M35 A;  1WY2 A;  1XNZ A;  2P98 A;  3D27 A;  3FMQ A;  4U6Z A;  4ZNG A;  2NQ7 A;  4IKR A;  4RGZ 1;  3BIQ A;  4U75 A;  4FLL A;  4FLI A;  1YW7 A;  4EGE A;  4U1B A;  1PV9 A;  1YJ3 A;  4U6C A;  5CLS A;  1QXY A;  5FCF A;  2BWV A;  4RZZ A;  4U73 A;  2BHA A;  4A6V A;  1YVM A;  1QXZ A;  2HOW A;  4PNC A;  2BWT A;  3IG4 A;  2GG0 A;  2BWY A;  3PKB A;  4U71 A;  5CE6 A;  3L7G A;  4U6W A;  2GG5 A;  4U70 A;  5CIK A;  5JFR A;  1XGO A;  4A6W A;  4FUK A;  5JHU A;  5E5B A;  2EA2 A;  5JI6 A;  2BHB A;  1KQ9 A;  4ZWU A;  5FCH A;  4OOK A;  1W7V A;  2BHD A;  2BWU A;  4FLK A;  4IKU A;  1WN1 A;  4U69 A;  3MX6 A;  4IPA A;  4Z7M A;  4QR8 A;  1N51 A;  1A16 A;  1B59 A;  2BWX A; 
#chains in the Genus database with same CATH topology
 3FMR A;  4FKC A;  3FM3 A;  1R58 A;  1XGM A;  3IU8 A;  3TB5 A;  2B3H A;  2P99 A;  4KM3 A;  3IU7 A;  2OKN A;  4IU6 A;  1MAT A;  2BWW A;  2GGC A;  4FO7 A;  4PV4 A;  2B3L A;  1WL6 A;  3PKE A;  1WKM A;  1YW8 A;  1WLR A;  1C27 A;  1Y1N A;  4ZWO A;  5CDL A;  2IW2 A;  1O0X A;  2BHC A;  3L24 A;  1R5G A;  4FLJ A;  4IF7 A;  4S2T P;  4RZY A;  2GTX A;  2BH3 A;  3CB5 A;  1C23 A;  1BOA A;  2EVO A;  1XGN A;  2GG8 A;  3BIT A;  4ZWP A;  2G6P A;  2BB7 A;  3CB6 A;  2GU5 A;  2OAZ A;  4MAT A;  2V3Z A;  4IKT A;  4B28 A;  4HXX A;  2Q96 A;  5CNX A;  3PKD A;  1R5H A;  1QZY A;  1KP0 A;  3RVA A;  3PKA A;  2DFI A;  2Q94 A;  2ADU A;  4IKS A;  1CHM A;  3CTZ A;  2Q8K A;  3IU9 A;  2Q93 A;  5D6F A;  1B6A A;  1JAW A;  4IDY A;  1WBQ A;  2MAT A;  4S2R P;  2BWS A;  2GG9 A;  3TAV A;  2EA4 A;  4U6J A;  1C22 A;  1C24 A;  5CDV A;  4FO8 A;  5CDE A;  3MR1 A;  2GG7 A;  2GG3 A;  3PKC A;  2V3Y A;  1BN5 A;  3BIP A;  5D6E A;  1XGS A;  1KQ0 A;  4U6E A;  4R60 A;  2V6C A;  2Q92 A;  2GU4 A;  2ZSG A;  1YW9 A;  2GA2 A;  1QXW A;  2GG2 A;  2GU6 A;  4JUQ A;  2GU7 A;  4S01 A;  4U76 A;  4IEC A;  3ROR A;  3S6B A;  2NQ6 A;  3Q6D A;  4S00 A;  1C21 A;  2GZ5 A;  2EVC A;  2Q95 A;  2V3X A;  2EVM A;  1W2M A;  1WL9 A;  2GGB A;  2BN7 A;  2P9A A;  2B3K A;  3MAT A;  1M35 A;  1WY2 A;  1XNZ A;  2P98 A;  3D27 A;  3FMQ A;  4U6Z A;  4ZNG A;  2NQ7 A;  4IKR A;  4RGZ 1;  3BIQ A;  4U75 A;  4FLL A;  4FLI A;  1YW7 A;  4EGE A;  4U1B A;  1PV9 A;  1YJ3 A;  4U6C A;  5CLS A;  1QXY A;  5FCF A;  2BWV A;  4RZZ A;  4U73 A;  2BHA A;  4A6V A;  1YVM A;  1QXZ A;  2HOW A;  4PNC A;  2BWT A;  3IG4 A;  2GG0 A;  2BWY A;  3PKB A;  4U71 A;  5CE6 A;  3L7G A;  4U6W A;  2GG5 A;  4U70 A;  5CIK A;  5JFR A;  1XGO A;  4A6W A;  4FUK A;  5JHU A;  5E5B A;  2EA2 A;  5JI6 A;  2BHB A;  1KQ9 A;  4ZWU A;  5FCH A;  4OOK A;  1W7V A;  2BHD A;  2BWU A;  4FLK A;  4IKU A;  1WN1 A;  4U69 A;  3MX6 A;  4IPA A;  4Z7M A;  4QR8 A;  1N51 A;  1A16 A;  1B59 A;  2BWX A; 
#chains in the Genus database with same CATH homology
 3FMR A;  4FKC A;  3FM3 A;  1R58 A;  1XGM A;  3IU8 A;  3TB5 A;  2B3H A;  2P99 A;  4KM3 A;  3IU7 A;  2OKN A;  4IU6 A;  1MAT A;  2BWW A;  2GGC A;  4FO7 A;  4PV4 A;  2B3L A;  1WL6 A;  3PKE A;  1WKM A;  1YW8 A;  1WLR A;  1C27 A;  1Y1N A;  4ZWO A;  5CDL A;  2IW2 A;  1O0X A;  2BHC A;  3L24 A;  1R5G A;  4FLJ A;  4IF7 A;  4S2T P;  4RZY A;  2GTX A;  2BH3 A;  3CB5 A;  1C23 A;  1BOA A;  2EVO A;  1XGN A;  2GG8 A;  3BIT A;  4ZWP A;  2G6P A;  2BB7 A;  3CB6 A;  2GU5 A;  2OAZ A;  4MAT A;  2V3Z A;  4IKT A;  4B28 A;  4HXX A;  2Q96 A;  5CNX A;  3PKD A;  1R5H A;  1QZY A;  1KP0 A;  3RVA A;  3PKA A;  2DFI A;  2Q94 A;  2ADU A;  4IKS A;  1CHM A;  3CTZ A;  2Q8K A;  3IU9 A;  2Q93 A;  5D6F A;  1B6A A;  1JAW A;  4IDY A;  1WBQ A;  2MAT A;  4S2R P;  2BWS A;  2GG9 A;  3TAV A;  2EA4 A;  4U6J A;  1C22 A;  1C24 A;  5CDV A;  4FO8 A;  5CDE A;  3MR1 A;  2GG7 A;  2GG3 A;  3PKC A;  2V3Y A;  1BN5 A;  3BIP A;  5D6E A;  1XGS A;  1KQ0 A;  4U6E A;  4R60 A;  2V6C A;  2Q92 A;  2GU4 A;  2ZSG A;  1YW9 A;  2GA2 A;  1QXW A;  2GG2 A;  2GU6 A;  4JUQ A;  2GU7 A;  4S01 A;  4U76 A;  4IEC A;  3ROR A;  3S6B A;  2NQ6 A;  3Q6D A;  4S00 A;  1C21 A;  2GZ5 A;  2EVC A;  2Q95 A;  2V3X A;  2EVM A;  1W2M A;  1WL9 A;  2GGB A;  2BN7 A;  2P9A A;  2B3K A;  3MAT A;  1M35 A;  1WY2 A;  1XNZ A;  2P98 A;  3D27 A;  3FMQ A;  4U6Z A;  4ZNG A;  2NQ7 A;  4IKR A;  4RGZ 1;  3BIQ A;  4U75 A;  4FLL A;  4FLI A;  1YW7 A;  4EGE A;  4U1B A;  1PV9 A;  1YJ3 A;  4U6C A;  5CLS A;  1QXY A;  5FCF A;  2BWV A;  4RZZ A;  4U73 A;  2BHA A;  4A6V A;  1YVM A;  1QXZ A;  2HOW A;  4PNC A;  2BWT A;  3IG4 A;  2GG0 A;  2BWY A;  3PKB A;  4U71 A;  5CE6 A;  3L7G A;  4U6W A;  2GG5 A;  4U70 A;  5CIK A;  5JFR A;  1XGO A;  4A6W A;  4FUK A;  5JHU A;  5E5B A;  2EA2 A;  5JI6 A;  2BHB A;  1KQ9 A;  4ZWU A;  5FCH A;  4OOK A;  1W7V A;  2BHD A;  2BWU A;  4FLK A;  4IKU A;  1WN1 A;  4U69 A;  3MX6 A;  4IPA A;  4Z7M A;  4QR8 A;  1N51 A;  1A16 A;  1B59 A;  2BWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...