4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
1XGOA 1QXWA 4IKUA 2BWYA 2BHBA 2GU5A 4IPAA 4FO7A 2GG9A 2BWWA 2B3LA 1WY2A 4FUKA 1YVMA 2BB7A 4U73A 4IU6A 1O0XA 4IF7A 1WL9A 4U69A 1XNZA 3CTZA 4FO8A 1XGSA 5CIKA 5JI6A 1QXYA 3IU9A 2GU6A 2HOWA 3TAVA 1WN1A 3PKAA 3PKDA 1R5HA 4KM3A 4U1BA 2B3HA 4U6CA 3MX6A 2V3XA 2EVOA 2Q94A 3S6BA 2BHAA 2EVCA 2ADUA 1QXZA 3BIPA 2ZSGA 2GGBA 2Q93A 4FLLA 5CDVA 3IU8A 4FKCA 4ZNGA 4ZWOA 2Q95A 2GG7A 4U6JA 1C24A 2Q8KA 1C23A 2GZ5A 3L24A 2V6CA 2P9AA 4A6VA 2OAZA 2MATA 1KQ9A 4A6WA 4S2TP 3FMQA 5E5BA 1YW7A 5FCFA 3CB6A 2BHDA 4S00A 4U75A 4HXXA 2G6PA 4IECA 5CLSA 5CE6A 2NQ6A 1XGNA 4U6EA 1C21A 2EA2A 2BWUA 3BIQA 3PKBA 4U76A 3FM3A 2GG2A 4ZWUA 4Z7MA 4FLKA 3L7GA 4OOKA 1W7VA 1YW9A 1WBQA 1CHMA 5JFRA 1M35A 2BN7A 1YW8A 4S2RP 5CNXA 2BWXA 2Q96A 4B28A 4IKRA 1A16A 2BH3A 2GU7A 3IG4A 1B6AA 1MATA 1WL6A 4JUQA 5CDEA 1WKMA 2P98A 3PKCA 1R58A 1YJ3A 2P99A 3IU7A 4RGZ1 2GU4A 1PV9A 1KQ0A 3TB5A 3MATA 2EA4A 4IDYA 5JHUA 1Y1NA 2GA2A 1N51A 2GG3A 4EGEA 1B59A 5D6FA 1BN5A 1QZYA 4R60A 1XGMA 1R5GA 4MATA 1WLRA 3FMRA 4PNCA 5D6EA 3CB5A 3PKEA 2BWSA 2OKNA 1C27A 2GG8A 4U70A 3RORA 2EVMA 2BHCA 2GG0A 3BITA 1BOAA 1JAWA 4QR8A 4S01A 2GGCA 4U6ZA 4PV4A 2V3ZA 3D27A 1KP0A 4FLIA 2V3YA 2GTXA 5CDLA 5FCHA 2BWTA 4U6WA 2B3KA 4IKTA 2NQ7A 4IKSA 1W2MA 2IW2A 3Q6DA 2BWVA 4RZZA 4RZYA 4ZWPA 2GG5A 4U71A 2Q92A 3RVAA 3MR1A 4FLJA 1C22A 2DFIA
chains in the Genus database with same CATH superfamily
1XGOA 1QXWA 4IKUA 2BWYA 2BHBA 2GU5A 4IPAA 4FO7A 2GG9A 2BWWA 2B3LA 1WY2A 4FUKA 1YVMA 2BB7A 4U73A 4IU6A 1O0XA 4IF7A 1WL9A 4U69A 1XNZA 3CTZA 4FO8A 1XGSA 5CIKA 5JI6A 1QXYA 3IU9A 2GU6A 2HOWA 3TAVA 1WN1A 3PKAA 3PKDA 1R5HA 4KM3A 4U1BA 2B3HA 4U6CA 3MX6A 2V3XA 2EVOA 2Q94A 3S6BA 2BHAA 2EVCA 2ADUA 1QXZA 3BIPA 2ZSGA 2GGBA 2Q93A 4FLLA 5CDVA 3IU8A 4FKCA 4ZNGA 4ZWOA 2Q95A 2GG7A 4U6JA 1C24A 2Q8KA 1C23A 2GZ5A 3L24A 2V6CA 2P9AA 4A6VA 2OAZA 2MATA 1KQ9A 4A6WA 4S2TP 3FMQA 5E5BA 1YW7A 5FCFA 3CB6A 2BHDA 4S00A 4U75A 4HXXA 2G6PA 4IECA 5CLSA 5CE6A 2NQ6A 1XGNA 4U6EA 1C21A 2EA2A 2BWUA 3BIQA 3PKBA 4U76A 3FM3A 2GG2A 4ZWUA 4Z7MA 4FLKA 3L7GA 4OOKA 1W7VA 1YW9A 1WBQA 1CHMA 5JFRA 1M35A 2BN7A 1YW8A 4S2RP 5CNXA 2BWXA 2Q96A 4B28A 4IKRA 1A16A 2BH3A 2GU7A 3IG4A 1B6AA 1MATA 1WL6A 4JUQA 5CDEA 1WKMA 2P98A 3PKCA 1R58A 1YJ3A 2P99A 3IU7A 4RGZ1 2GU4A 1PV9A 1KQ0A 3TB5A 3MATA 2EA4A 4IDYA 5JHUA 1Y1NA 2GA2A 1N51A 2GG3A 4EGEA 1B59A 5D6FA 1BN5A 1QZYA 4R60A 1XGMA 1R5GA 4MATA 1WLRA 3FMRA 4PNCA 5D6EA 3CB5A 3PKEA 2BWSA 2OKNA 1C27A 2GG8A 4U70A 3RORA 2EVMA 2BHCA 2GG0A 3BITA 1BOAA 1JAWA 4QR8A 4S01A 2GGCA 4U6ZA 4PV4A 2V3ZA 3D27A 1KP0A 4FLIA 2V3YA 2GTXA 5CDLA 5FCHA 2BWTA 4U6WA 2B3KA 4IKTA 2NQ7A 4IKSA 1W2MA 2IW2A 3Q6DA 2BWVA 4RZZA 4RZYA 4ZWPA 2GG5A 4U71A 2Q92A 3RVAA 3MR1A 4FLJA 1C22A 2DFIA
chains in the Genus database with same CATH topology
1XGOA 1QXWA 4IKUA 2BWYA 2BHBA 2GU5A 4IPAA 4FO7A 2GG9A 2BWWA 2B3LA 1WY2A 4FUKA 1YVMA 2BB7A 4U73A 4IU6A 1O0XA 4IF7A 1WL9A 4U69A 1XNZA 3CTZA 4FO8A 1XGSA 5CIKA 5JI6A 1QXYA 3IU9A 2GU6A 2HOWA 3TAVA 1WN1A 3PKAA 3PKDA 1R5HA 4KM3A 4U1BA 2B3HA 4U6CA 3MX6A 2V3XA 2EVOA 2Q94A 3S6BA 2BHAA 2EVCA 2ADUA 1QXZA 3BIPA 2ZSGA 2GGBA 2Q93A 4FLLA 5CDVA 3IU8A 4FKCA 4ZNGA 4ZWOA 2Q95A 2GG7A 4U6JA 1C24A 2Q8KA 1C23A 2GZ5A 3L24A 2V6CA 2P9AA 4A6VA 2OAZA 2MATA 1KQ9A 4A6WA 4S2TP 3FMQA 5E5BA 1YW7A 5FCFA 3CB6A 2BHDA 4S00A 4U75A 4HXXA 2G6PA 4IECA 5CLSA 5CE6A 2NQ6A 1XGNA 4U6EA 1C21A 2EA2A 2BWUA 3BIQA 3PKBA 4U76A 3FM3A 2GG2A 4ZWUA 4Z7MA 4FLKA 3L7GA 4OOKA 1W7VA 1YW9A 1WBQA 1CHMA 5JFRA 1M35A 2BN7A 1YW8A 4S2RP 5CNXA 2BWXA 2Q96A 4B28A 4IKRA 1A16A 2BH3A 2GU7A 3IG4A 1B6AA 1MATA 1WL6A 4JUQA 5CDEA 1WKMA 2P98A 3PKCA 1R58A 1YJ3A 2P99A 3IU7A 4RGZ1 2GU4A 1PV9A 1KQ0A 3TB5A 3MATA 2EA4A 4IDYA 5JHUA 1Y1NA 2GA2A 1N51A 2GG3A 4EGEA 1B59A 5D6FA 1BN5A 1QZYA 4R60A 1XGMA 1R5GA 4MATA 1WLRA 3FMRA 4PNCA 5D6EA 3CB5A 3PKEA 2BWSA 2OKNA 1C27A 2GG8A 4U70A 3RORA 2EVMA 2BHCA 2GG0A 3BITA 1BOAA 1JAWA 4QR8A 4S01A 2GGCA 4U6ZA 4PV4A 2V3ZA 3D27A 1KP0A 4FLIA 2V3YA 2GTXA 5CDLA 5FCHA 2BWTA 4U6WA 2B3KA 4IKTA 2NQ7A 4IKSA 1W2MA 2IW2A 3Q6DA 2BWVA 4RZZA 4RZYA 4ZWPA 2GG5A 4U71A 2Q92A 3RVAA 3MR1A 4FLJA 1C22A 2DFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGO A;  1QXW A;  4IKU A;  2BWY A;  2BHB A;  2GU5 A;  4IPA A;  4FO7 A;  2GG9 A;  2BWW A;  2B3L A;  1WY2 A;  4FUK A;  1YVM A;  2BB7 A;  4U73 A;  4IU6 A;  1O0X A;  4IF7 A;  1WL9 A;  4U69 A;  1XNZ A;  3CTZ A;  4FO8 A;  1XGS A;  5CIK A;  5JI6 A;  1QXY A;  3IU9 A;  2GU6 A;  2HOW A;  3TAV A;  1WN1 A;  3PKA A;  3PKD A;  1R5H A;  4KM3 A;  4U1B A;  2B3H A;  4U6C A;  3MX6 A;  2V3X A;  2EVO A;  2Q94 A;  3S6B A;  2BHA A;  2EVC A;  2ADU A;  1QXZ A;  3BIP A;  2ZSG A;  2GGB A;  2Q93 A;  4FLL A;  5CDV A;  3IU8 A;  4FKC A;  4ZNG A;  4ZWO A;  2Q95 A;  2GG7 A;  4U6J A;  1C24 A;  2Q8K A;  1C23 A;  2GZ5 A;  3L24 A;  2V6C A;  2P9A A;  4A6V A;  2OAZ A;  2MAT A;  1KQ9 A;  4A6W A;  4S2T P;  3FMQ A;  5E5B A;  1YW7 A;  5FCF A;  3CB6 A;  2BHD A;  4S00 A;  4U75 A;  4HXX A;  2G6P A;  4IEC A;  5CLS A;  5CE6 A;  2NQ6 A;  1XGN A;  4U6E A;  1C21 A;  2EA2 A;  2BWU A;  3BIQ A;  3PKB A;  4U76 A;  3FM3 A;  2GG2 A;  4ZWU A;  4Z7M A;  4FLK A;  3L7G A;  4OOK A;  1W7V A;  1YW9 A;  1WBQ A;  1CHM A;  5JFR A;  1M35 A;  2BN7 A;  1YW8 A;  4S2R P;  5CNX A;  2BWX A;  2Q96 A;  4B28 A;  4IKR A;  1A16 A;  2BH3 A;  2GU7 A;  3IG4 A;  1B6A A;  1MAT A;  1WL6 A;  4JUQ A;  5CDE A;  1WKM A;  2P98 A;  3PKC A;  1R58 A;  1YJ3 A;  2P99 A;  3IU7 A;  4RGZ 1;  2GU4 A;  1PV9 A;  1KQ0 A;  3TB5 A;  3MAT A;  2EA4 A;  4IDY A;  5JHU A;  1Y1N A;  2GA2 A;  1N51 A;  2GG3 A;  4EGE A;  1B59 A;  5D6F A;  1BN5 A;  1QZY A;  4R60 A;  1XGM A;  1R5G A;  4MAT A;  1WLR A;  3FMR A;  4PNC A;  5D6E A;  3CB5 A;  3PKE A;  2BWS A;  2OKN A;  1C27 A;  2GG8 A;  4U70 A;  3ROR A;  2EVM A;  2BHC A;  2GG0 A;  3BIT A;  1BOA A;  1JAW A;  4QR8 A;  4S01 A;  2GGC A;  4U6Z A;  4PV4 A;  2V3Z A;  3D27 A;  1KP0 A;  4FLI A;  2V3Y A;  2GTX A;  5CDL A;  5FCH A;  2BWT A;  4U6W A;  2B3K A;  4IKT A;  2NQ7 A;  4IKS A;  1W2M A;  2IW2 A;  3Q6D A;  2BWV A;  4RZZ A;  4RZY A;  4ZWP A;  2GG5 A;  4U71 A;  2Q92 A;  3RVA A;  3MR1 A;  4FLJ A;  1C22 A;  2DFI A; 
#chains in the Genus database with same CATH topology
 1XGO A;  1QXW A;  4IKU A;  2BWY A;  2BHB A;  2GU5 A;  4IPA A;  4FO7 A;  2GG9 A;  2BWW A;  2B3L A;  1WY2 A;  4FUK A;  1YVM A;  2BB7 A;  4U73 A;  4IU6 A;  1O0X A;  4IF7 A;  1WL9 A;  4U69 A;  1XNZ A;  3CTZ A;  4FO8 A;  1XGS A;  5CIK A;  5JI6 A;  1QXY A;  3IU9 A;  2GU6 A;  2HOW A;  3TAV A;  1WN1 A;  3PKA A;  3PKD A;  1R5H A;  4KM3 A;  4U1B A;  2B3H A;  4U6C A;  3MX6 A;  2V3X A;  2EVO A;  2Q94 A;  3S6B A;  2BHA A;  2EVC A;  2ADU A;  1QXZ A;  3BIP A;  2ZSG A;  2GGB A;  2Q93 A;  4FLL A;  5CDV A;  3IU8 A;  4FKC A;  4ZNG A;  4ZWO A;  2Q95 A;  2GG7 A;  4U6J A;  1C24 A;  2Q8K A;  1C23 A;  2GZ5 A;  3L24 A;  2V6C A;  2P9A A;  4A6V A;  2OAZ A;  2MAT A;  1KQ9 A;  4A6W A;  4S2T P;  3FMQ A;  5E5B A;  1YW7 A;  5FCF A;  3CB6 A;  2BHD A;  4S00 A;  4U75 A;  4HXX A;  2G6P A;  4IEC A;  5CLS A;  5CE6 A;  2NQ6 A;  1XGN A;  4U6E A;  1C21 A;  2EA2 A;  2BWU A;  3BIQ A;  3PKB A;  4U76 A;  3FM3 A;  2GG2 A;  4ZWU A;  4Z7M A;  4FLK A;  3L7G A;  4OOK A;  1W7V A;  1YW9 A;  1WBQ A;  1CHM A;  5JFR A;  1M35 A;  2BN7 A;  1YW8 A;  4S2R P;  5CNX A;  2BWX A;  2Q96 A;  4B28 A;  4IKR A;  1A16 A;  2BH3 A;  2GU7 A;  3IG4 A;  1B6A A;  1MAT A;  1WL6 A;  4JUQ A;  5CDE A;  1WKM A;  2P98 A;  3PKC A;  1R58 A;  1YJ3 A;  2P99 A;  3IU7 A;  4RGZ 1;  2GU4 A;  1PV9 A;  1KQ0 A;  3TB5 A;  3MAT A;  2EA4 A;  4IDY A;  5JHU A;  1Y1N A;  2GA2 A;  1N51 A;  2GG3 A;  4EGE A;  1B59 A;  5D6F A;  1BN5 A;  1QZY A;  4R60 A;  1XGM A;  1R5G A;  4MAT A;  1WLR A;  3FMR A;  4PNC A;  5D6E A;  3CB5 A;  3PKE A;  2BWS A;  2OKN A;  1C27 A;  2GG8 A;  4U70 A;  3ROR A;  2EVM A;  2BHC A;  2GG0 A;  3BIT A;  1BOA A;  1JAW A;  4QR8 A;  4S01 A;  2GGC A;  4U6Z A;  4PV4 A;  2V3Z A;  3D27 A;  1KP0 A;  4FLI A;  2V3Y A;  2GTX A;  5CDL A;  5FCH A;  2BWT A;  4U6W A;  2B3K A;  4IKT A;  2NQ7 A;  4IKS A;  1W2M A;  2IW2 A;  3Q6D A;  2BWV A;  4RZZ A;  4RZY A;  4ZWP A;  2GG5 A;  4U71 A;  2Q92 A;  3RVA A;  3MR1 A;  4FLJ A;  1C22 A;  2DFI A; 
#chains in the Genus database with same CATH homology
 1XGO A;  1QXW A;  4IKU A;  2BWY A;  2BHB A;  2GU5 A;  4IPA A;  4FO7 A;  2GG9 A;  2BWW A;  2B3L A;  1WY2 A;  4FUK A;  1YVM A;  2BB7 A;  4U73 A;  4IU6 A;  1O0X A;  4IF7 A;  1WL9 A;  4U69 A;  1XNZ A;  3CTZ A;  4FO8 A;  1XGS A;  5CIK A;  5JI6 A;  1QXY A;  3IU9 A;  2GU6 A;  2HOW A;  3TAV A;  1WN1 A;  3PKA A;  3PKD A;  1R5H A;  4KM3 A;  4U1B A;  2B3H A;  4U6C A;  3MX6 A;  2V3X A;  2EVO A;  2Q94 A;  3S6B A;  2BHA A;  2EVC A;  2ADU A;  1QXZ A;  3BIP A;  2ZSG A;  2GGB A;  2Q93 A;  4FLL A;  5CDV A;  3IU8 A;  4FKC A;  4ZNG A;  4ZWO A;  2Q95 A;  2GG7 A;  4U6J A;  1C24 A;  2Q8K A;  1C23 A;  2GZ5 A;  3L24 A;  2V6C A;  2P9A A;  4A6V A;  2OAZ A;  2MAT A;  1KQ9 A;  4A6W A;  4S2T P;  3FMQ A;  5E5B A;  1YW7 A;  5FCF A;  3CB6 A;  2BHD A;  4S00 A;  4U75 A;  4HXX A;  2G6P A;  4IEC A;  5CLS A;  5CE6 A;  2NQ6 A;  1XGN A;  4U6E A;  1C21 A;  2EA2 A;  2BWU A;  3BIQ A;  3PKB A;  4U76 A;  3FM3 A;  2GG2 A;  4ZWU A;  4Z7M A;  4FLK A;  3L7G A;  4OOK A;  1W7V A;  1YW9 A;  1WBQ A;  1CHM A;  5JFR A;  1M35 A;  2BN7 A;  1YW8 A;  4S2R P;  5CNX A;  2BWX A;  2Q96 A;  4B28 A;  4IKR A;  1A16 A;  2BH3 A;  2GU7 A;  3IG4 A;  1B6A A;  1MAT A;  1WL6 A;  4JUQ A;  5CDE A;  1WKM A;  2P98 A;  3PKC A;  1R58 A;  1YJ3 A;  2P99 A;  3IU7 A;  4RGZ 1;  2GU4 A;  1PV9 A;  1KQ0 A;  3TB5 A;  3MAT A;  2EA4 A;  4IDY A;  5JHU A;  1Y1N A;  2GA2 A;  1N51 A;  2GG3 A;  4EGE A;  1B59 A;  5D6F A;  1BN5 A;  1QZY A;  4R60 A;  1XGM A;  1R5G A;  4MAT A;  1WLR A;  3FMR A;  4PNC A;  5D6E A;  3CB5 A;  3PKE A;  2BWS A;  2OKN A;  1C27 A;  2GG8 A;  4U70 A;  3ROR A;  2EVM A;  2BHC A;  2GG0 A;  3BIT A;  1BOA A;  1JAW A;  4QR8 A;  4S01 A;  2GGC A;  4U6Z A;  4PV4 A;  2V3Z A;  3D27 A;  1KP0 A;  4FLI A;  2V3Y A;  2GTX A;  5CDL A;  5FCH A;  2BWT A;  4U6W A;  2B3K A;  4IKT A;  2NQ7 A;  4IKS A;  1W2M A;  2IW2 A;  3Q6D A;  2BWV A;  4RZZ A;  4RZY A;  4ZWP A;  2GG5 A;  4U71 A;  2Q92 A;  3RVA A;  3MR1 A;  4FLJ A;  1C22 A;  2DFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...