4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
4A6WA 1XGSA 2GU6A 1QZYA 2G6PA 3Q6DA 2V3ZA 3D27A 2BWYA 1A16A 2EVCA 3MX6A 4RZYA 4RGZ1 2BH3A 1BOAA 1QXZA 1W7VA 1XNZA 2IW2A 3FM3A 2ZSGA 1C27A 1YW8A 5JI6A 2GA2A 2NQ6A 1XGMA 4ZNGA 4IKRA 1CHMA 2Q8KA 1B6AA 2B3KA 2EA4A 4PNCA 4HXXA 5CDEA 2BN7A 2MATA 2BWSA 3BIQA 4FUKA 2BHBA 3PKEA 1QXWA 3PKCA 2OKNA 3FMRA 5D6FA 5CE6A 2BHAA 3TAVA 4B28A 1PV9A 4IU6A 5CLSA 2GU7A 2GU4A 1YW7A 5D6EA 2BB7A 4FLLA 4U1BA 1QXYA 3PKAA 4Z7MA 4MATA 1W2MA 1XGOA 4IKUA 2Q92A 4RZZA 4FKCA 2B3LA 1WKMA 1WLRA 4A6VA 1KQ9A 4U71A 5FCHA 3L7GA 4ZWUA 4S2RP 5CDLA 1MATA 2GG3A 4S00A 2OAZA 4IPAA 4IKTA 5JHUA 2BWTA 3RVAA 2BHDA 2ADUA 2P9AA 4QR8A 2EVMA 2GTXA 4S01A 2Q96A 2B3HA 1WL9A 2NQ7A 4ZWPA 3TB5A 1C24A 1JAWA 2GG9A 4U6EA 4U6WA 4JUQA 2BWXA 5E5BA 4FO7A 5CIKA 4R60A 1C21A 1WL6A 2GG2A 2GG7A 4IDYA 1N51A 2GZ5A 4FLJA 4S2TP 1KQ0A 2V3YA 1KP0A 3RORA 4ZWOA 4U76A 4U6JA 4U73A 3L24A 1WY2A 3IG4A 4OOKA 2GG8A 1R58A 3CTZA 2Q93A 3PKBA 1YW9A 3MR1A 5CNXA 2DFIA 4FLIA 1Y1NA 4IECA 4IKSA 3BITA 2BWVA 3IU9A 3IU7A 3FMQA 2BWWA 3CB6A 4U69A 2V6CA 3CB5A 1BN5A 1B59A 1WN1A 5CDVA 2P98A 2GU5A 1O0XA 1YVMA 4U75A 2EA2A 2Q95A 2BWUA 3PKDA 4FLKA 1C22A 4U6ZA 1XGNA 1WBQA 2Q94A 3MATA 4EGEA 1M35A 2GGBA 2HOWA 4U70A 5FCFA 4FO8A 2GGCA 4KM3A 1C23A 2BHCA 1R5HA 1YJ3A 4IF7A 3IU8A 4PV4A 2GG5A 3S6BA 2GG0A 2V3XA 4U6CA 2P99A 3BIPA 1R5GA 5JFRA 2EVOA
chains in the Genus database with same CATH superfamily
4A6WA 1XGSA 2GU6A 1QZYA 2G6PA 3Q6DA 2V3ZA 3D27A 2BWYA 1A16A 2EVCA 3MX6A 4RZYA 4RGZ1 2BH3A 1BOAA 1QXZA 1W7VA 1XNZA 2IW2A 3FM3A 2ZSGA 1C27A 1YW8A 5JI6A 2GA2A 2NQ6A 1XGMA 4ZNGA 4IKRA 1CHMA 2Q8KA 1B6AA 2B3KA 2EA4A 4PNCA 4HXXA 5CDEA 2BN7A 2MATA 2BWSA 3BIQA 4FUKA 2BHBA 3PKEA 1QXWA 3PKCA 2OKNA 3FMRA 5D6FA 5CE6A 2BHAA 3TAVA 4B28A 1PV9A 4IU6A 5CLSA 2GU7A 2GU4A 1YW7A 5D6EA 2BB7A 4FLLA 4U1BA 1QXYA 3PKAA 4Z7MA 4MATA 1W2MA 1XGOA 4IKUA 2Q92A 4RZZA 4FKCA 2B3LA 1WKMA 1WLRA 4A6VA 1KQ9A 4U71A 5FCHA 3L7GA 4ZWUA 4S2RP 5CDLA 1MATA 2GG3A 4S00A 2OAZA 4IPAA 4IKTA 5JHUA 2BWTA 3RVAA 2BHDA 2ADUA 2P9AA 4QR8A 2EVMA 2GTXA 4S01A 2Q96A 2B3HA 1WL9A 2NQ7A 4ZWPA 3TB5A 1C24A 1JAWA 2GG9A 4U6EA 4U6WA 4JUQA 2BWXA 5E5BA 4FO7A 5CIKA 4R60A 1C21A 1WL6A 2GG2A 2GG7A 4IDYA 1N51A 2GZ5A 4FLJA 4S2TP 1KQ0A 2V3YA 1KP0A 3RORA 4ZWOA 4U76A 4U6JA 4U73A 3L24A 1WY2A 3IG4A 4OOKA 2GG8A 1R58A 3CTZA 2Q93A 3PKBA 1YW9A 3MR1A 5CNXA 2DFIA 4FLIA 1Y1NA 4IECA 4IKSA 3BITA 2BWVA 3IU9A 3IU7A 3FMQA 2BWWA 3CB6A 4U69A 2V6CA 3CB5A 1BN5A 1B59A 1WN1A 5CDVA 2P98A 2GU5A 1O0XA 1YVMA 4U75A 2EA2A 2Q95A 2BWUA 3PKDA 4FLKA 1C22A 4U6ZA 1XGNA 1WBQA 2Q94A 3MATA 4EGEA 1M35A 2GGBA 2HOWA 4U70A 5FCFA 4FO8A 2GGCA 4KM3A 1C23A 2BHCA 1R5HA 1YJ3A 4IF7A 3IU8A 4PV4A 2GG5A 3S6BA 2GG0A 2V3XA 4U6CA 2P99A 3BIPA 1R5GA 5JFRA 2EVOA
chains in the Genus database with same CATH topology
4A6WA 1XGSA 2GU6A 1QZYA 2G6PA 3Q6DA 2V3ZA 3D27A 2BWYA 1A16A 2EVCA 3MX6A 4RZYA 4RGZ1 2BH3A 1BOAA 1QXZA 1W7VA 1XNZA 2IW2A 3FM3A 2ZSGA 1C27A 1YW8A 5JI6A 2GA2A 2NQ6A 1XGMA 4ZNGA 4IKRA 1CHMA 2Q8KA 1B6AA 2B3KA 2EA4A 4PNCA 4HXXA 5CDEA 2BN7A 2MATA 2BWSA 3BIQA 4FUKA 2BHBA 3PKEA 1QXWA 3PKCA 2OKNA 3FMRA 5D6FA 5CE6A 2BHAA 3TAVA 4B28A 1PV9A 4IU6A 5CLSA 2GU7A 2GU4A 1YW7A 5D6EA 2BB7A 4FLLA 4U1BA 1QXYA 3PKAA 4Z7MA 4MATA 1W2MA 1XGOA 4IKUA 2Q92A 4RZZA 4FKCA 2B3LA 1WKMA 1WLRA 4A6VA 1KQ9A 4U71A 5FCHA 3L7GA 4ZWUA 4S2RP 5CDLA 1MATA 2GG3A 4S00A 2OAZA 4IPAA 4IKTA 5JHUA 2BWTA 3RVAA 2BHDA 2ADUA 2P9AA 4QR8A 2EVMA 2GTXA 4S01A 2Q96A 2B3HA 1WL9A 2NQ7A 4ZWPA 3TB5A 1C24A 1JAWA 2GG9A 4U6EA 4U6WA 4JUQA 2BWXA 5E5BA 4FO7A 5CIKA 4R60A 1C21A 1WL6A 2GG2A 2GG7A 4IDYA 1N51A 2GZ5A 4FLJA 4S2TP 1KQ0A 2V3YA 1KP0A 3RORA 4ZWOA 4U76A 4U6JA 4U73A 3L24A 1WY2A 3IG4A 4OOKA 2GG8A 1R58A 3CTZA 2Q93A 3PKBA 1YW9A 3MR1A 5CNXA 2DFIA 4FLIA 1Y1NA 4IECA 4IKSA 3BITA 2BWVA 3IU9A 3IU7A 3FMQA 2BWWA 3CB6A 4U69A 2V6CA 3CB5A 1BN5A 1B59A 1WN1A 5CDVA 2P98A 2GU5A 1O0XA 1YVMA 4U75A 2EA2A 2Q95A 2BWUA 3PKDA 4FLKA 1C22A 4U6ZA 1XGNA 1WBQA 2Q94A 3MATA 4EGEA 1M35A 2GGBA 2HOWA 4U70A 5FCFA 4FO8A 2GGCA 4KM3A 1C23A 2BHCA 1R5HA 1YJ3A 4IF7A 3IU8A 4PV4A 2GG5A 3S6BA 2GG0A 2V3XA 4U6CA 2P99A 3BIPA 1R5GA 5JFRA 2EVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6W A;  1XGS A;  2GU6 A;  1QZY A;  2G6P A;  3Q6D A;  2V3Z A;  3D27 A;  2BWY A;  1A16 A;  2EVC A;  3MX6 A;  4RZY A;  4RGZ 1;  2BH3 A;  1BOA A;  1QXZ A;  1W7V A;  1XNZ A;  2IW2 A;  3FM3 A;  2ZSG A;  1C27 A;  1YW8 A;  5JI6 A;  2GA2 A;  2NQ6 A;  1XGM A;  4ZNG A;  4IKR A;  1CHM A;  2Q8K A;  1B6A A;  2B3K A;  2EA4 A;  4PNC A;  4HXX A;  5CDE A;  2BN7 A;  2MAT A;  2BWS A;  3BIQ A;  4FUK A;  2BHB A;  3PKE A;  1QXW A;  3PKC A;  2OKN A;  3FMR A;  5D6F A;  5CE6 A;  2BHA A;  3TAV A;  4B28 A;  1PV9 A;  4IU6 A;  5CLS A;  2GU7 A;  2GU4 A;  1YW7 A;  5D6E A;  2BB7 A;  4FLL A;  4U1B A;  1QXY A;  3PKA A;  4Z7M A;  4MAT A;  1W2M A;  1XGO A;  4IKU A;  2Q92 A;  4RZZ A;  4FKC A;  2B3L A;  1WKM A;  1WLR A;  4A6V A;  1KQ9 A;  4U71 A;  5FCH A;  3L7G A;  4ZWU A;  4S2R P;  5CDL A;  1MAT A;  2GG3 A;  4S00 A;  2OAZ A;  4IPA A;  4IKT A;  5JHU A;  2BWT A;  3RVA A;  2BHD A;  2ADU A;  2P9A A;  4QR8 A;  2EVM A;  2GTX A;  4S01 A;  2Q96 A;  2B3H A;  1WL9 A;  2NQ7 A;  4ZWP A;  3TB5 A;  1C24 A;  1JAW A;  2GG9 A;  4U6E A;  4U6W A;  4JUQ A;  2BWX A;  5E5B A;  4FO7 A;  5CIK A;  4R60 A;  1C21 A;  1WL6 A;  2GG2 A;  2GG7 A;  4IDY A;  1N51 A;  2GZ5 A;  4FLJ A;  4S2T P;  1KQ0 A;  2V3Y A;  1KP0 A;  3ROR A;  4ZWO A;  4U76 A;  4U6J A;  4U73 A;  3L24 A;  1WY2 A;  3IG4 A;  4OOK A;  2GG8 A;  1R58 A;  3CTZ A;  2Q93 A;  3PKB A;  1YW9 A;  3MR1 A;  5CNX A;  2DFI A;  4FLI A;  1Y1N A;  4IEC A;  4IKS A;  3BIT A;  2BWV A;  3IU9 A;  3IU7 A;  3FMQ A;  2BWW A;  3CB6 A;  4U69 A;  2V6C A;  3CB5 A;  1BN5 A;  1B59 A;  1WN1 A;  5CDV A;  2P98 A;  2GU5 A;  1O0X A;  1YVM A;  4U75 A;  2EA2 A;  2Q95 A;  2BWU A;  3PKD A;  4FLK A;  1C22 A;  4U6Z A;  1XGN A;  1WBQ A;  2Q94 A;  3MAT A;  4EGE A;  1M35 A;  2GGB A;  2HOW A;  4U70 A;  5FCF A;  4FO8 A;  2GGC A;  4KM3 A;  1C23 A;  2BHC A;  1R5H A;  1YJ3 A;  4IF7 A;  3IU8 A;  4PV4 A;  2GG5 A;  3S6B A;  2GG0 A;  2V3X A;  4U6C A;  2P99 A;  3BIP A;  1R5G A;  5JFR A;  2EVO A; 
#chains in the Genus database with same CATH topology
 4A6W A;  1XGS A;  2GU6 A;  1QZY A;  2G6P A;  3Q6D A;  2V3Z A;  3D27 A;  2BWY A;  1A16 A;  2EVC A;  3MX6 A;  4RZY A;  4RGZ 1;  2BH3 A;  1BOA A;  1QXZ A;  1W7V A;  1XNZ A;  2IW2 A;  3FM3 A;  2ZSG A;  1C27 A;  1YW8 A;  5JI6 A;  2GA2 A;  2NQ6 A;  1XGM A;  4ZNG A;  4IKR A;  1CHM A;  2Q8K A;  1B6A A;  2B3K A;  2EA4 A;  4PNC A;  4HXX A;  5CDE A;  2BN7 A;  2MAT A;  2BWS A;  3BIQ A;  4FUK A;  2BHB A;  3PKE A;  1QXW A;  3PKC A;  2OKN A;  3FMR A;  5D6F A;  5CE6 A;  2BHA A;  3TAV A;  4B28 A;  1PV9 A;  4IU6 A;  5CLS A;  2GU7 A;  2GU4 A;  1YW7 A;  5D6E A;  2BB7 A;  4FLL A;  4U1B A;  1QXY A;  3PKA A;  4Z7M A;  4MAT A;  1W2M A;  1XGO A;  4IKU A;  2Q92 A;  4RZZ A;  4FKC A;  2B3L A;  1WKM A;  1WLR A;  4A6V A;  1KQ9 A;  4U71 A;  5FCH A;  3L7G A;  4ZWU A;  4S2R P;  5CDL A;  1MAT A;  2GG3 A;  4S00 A;  2OAZ A;  4IPA A;  4IKT A;  5JHU A;  2BWT A;  3RVA A;  2BHD A;  2ADU A;  2P9A A;  4QR8 A;  2EVM A;  2GTX A;  4S01 A;  2Q96 A;  2B3H A;  1WL9 A;  2NQ7 A;  4ZWP A;  3TB5 A;  1C24 A;  1JAW A;  2GG9 A;  4U6E A;  4U6W A;  4JUQ A;  2BWX A;  5E5B A;  4FO7 A;  5CIK A;  4R60 A;  1C21 A;  1WL6 A;  2GG2 A;  2GG7 A;  4IDY A;  1N51 A;  2GZ5 A;  4FLJ A;  4S2T P;  1KQ0 A;  2V3Y A;  1KP0 A;  3ROR A;  4ZWO A;  4U76 A;  4U6J A;  4U73 A;  3L24 A;  1WY2 A;  3IG4 A;  4OOK A;  2GG8 A;  1R58 A;  3CTZ A;  2Q93 A;  3PKB A;  1YW9 A;  3MR1 A;  5CNX A;  2DFI A;  4FLI A;  1Y1N A;  4IEC A;  4IKS A;  3BIT A;  2BWV A;  3IU9 A;  3IU7 A;  3FMQ A;  2BWW A;  3CB6 A;  4U69 A;  2V6C A;  3CB5 A;  1BN5 A;  1B59 A;  1WN1 A;  5CDV A;  2P98 A;  2GU5 A;  1O0X A;  1YVM A;  4U75 A;  2EA2 A;  2Q95 A;  2BWU A;  3PKD A;  4FLK A;  1C22 A;  4U6Z A;  1XGN A;  1WBQ A;  2Q94 A;  3MAT A;  4EGE A;  1M35 A;  2GGB A;  2HOW A;  4U70 A;  5FCF A;  4FO8 A;  2GGC A;  4KM3 A;  1C23 A;  2BHC A;  1R5H A;  1YJ3 A;  4IF7 A;  3IU8 A;  4PV4 A;  2GG5 A;  3S6B A;  2GG0 A;  2V3X A;  4U6C A;  2P99 A;  3BIP A;  1R5G A;  5JFR A;  2EVO A; 
#chains in the Genus database with same CATH homology
 4A6W A;  1XGS A;  2GU6 A;  1QZY A;  2G6P A;  3Q6D A;  2V3Z A;  3D27 A;  2BWY A;  1A16 A;  2EVC A;  3MX6 A;  4RZY A;  4RGZ 1;  2BH3 A;  1BOA A;  1QXZ A;  1W7V A;  1XNZ A;  2IW2 A;  3FM3 A;  2ZSG A;  1C27 A;  1YW8 A;  5JI6 A;  2GA2 A;  2NQ6 A;  1XGM A;  4ZNG A;  4IKR A;  1CHM A;  2Q8K A;  1B6A A;  2B3K A;  2EA4 A;  4PNC A;  4HXX A;  5CDE A;  2BN7 A;  2MAT A;  2BWS A;  3BIQ A;  4FUK A;  2BHB A;  3PKE A;  1QXW A;  3PKC A;  2OKN A;  3FMR A;  5D6F A;  5CE6 A;  2BHA A;  3TAV A;  4B28 A;  1PV9 A;  4IU6 A;  5CLS A;  2GU7 A;  2GU4 A;  1YW7 A;  5D6E A;  2BB7 A;  4FLL A;  4U1B A;  1QXY A;  3PKA A;  4Z7M A;  4MAT A;  1W2M A;  1XGO A;  4IKU A;  2Q92 A;  4RZZ A;  4FKC A;  2B3L A;  1WKM A;  1WLR A;  4A6V A;  1KQ9 A;  4U71 A;  5FCH A;  3L7G A;  4ZWU A;  4S2R P;  5CDL A;  1MAT A;  2GG3 A;  4S00 A;  2OAZ A;  4IPA A;  4IKT A;  5JHU A;  2BWT A;  3RVA A;  2BHD A;  2ADU A;  2P9A A;  4QR8 A;  2EVM A;  2GTX A;  4S01 A;  2Q96 A;  2B3H A;  1WL9 A;  2NQ7 A;  4ZWP A;  3TB5 A;  1C24 A;  1JAW A;  2GG9 A;  4U6E A;  4U6W A;  4JUQ A;  2BWX A;  5E5B A;  4FO7 A;  5CIK A;  4R60 A;  1C21 A;  1WL6 A;  2GG2 A;  2GG7 A;  4IDY A;  1N51 A;  2GZ5 A;  4FLJ A;  4S2T P;  1KQ0 A;  2V3Y A;  1KP0 A;  3ROR A;  4ZWO A;  4U76 A;  4U6J A;  4U73 A;  3L24 A;  1WY2 A;  3IG4 A;  4OOK A;  2GG8 A;  1R58 A;  3CTZ A;  2Q93 A;  3PKB A;  1YW9 A;  3MR1 A;  5CNX A;  2DFI A;  4FLI A;  1Y1N A;  4IEC A;  4IKS A;  3BIT A;  2BWV A;  3IU9 A;  3IU7 A;  3FMQ A;  2BWW A;  3CB6 A;  4U69 A;  2V6C A;  3CB5 A;  1BN5 A;  1B59 A;  1WN1 A;  5CDV A;  2P98 A;  2GU5 A;  1O0X A;  1YVM A;  4U75 A;  2EA2 A;  2Q95 A;  2BWU A;  3PKD A;  4FLK A;  1C22 A;  4U6Z A;  1XGN A;  1WBQ A;  2Q94 A;  3MAT A;  4EGE A;  1M35 A;  2GGB A;  2HOW A;  4U70 A;  5FCF A;  4FO8 A;  2GGC A;  4KM3 A;  1C23 A;  2BHC A;  1R5H A;  1YJ3 A;  4IF7 A;  3IU8 A;  4PV4 A;  2GG5 A;  3S6B A;  2GG0 A;  2V3X A;  4U6C A;  2P99 A;  3BIP A;  1R5G A;  5JFR A;  2EVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...