4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
4A6WA 4IPAA 2Q92A 4FKCA 1YJ3A 2GZ5A 2Q93A 4Z7MA 1CHMA 1KQ9A 2GA2A 4U6ZA 4JUQA 3FMRA 4FLIA 4ZNGA 2GU6A 2MATA 2B3LA 4IKUA 1WLRA 2GG9A 2DFIA 1KP0A 5JFRA 1XGNA 3IU9A 1C22A 2BWSA 4S2RP 4U6CA 2GG0A 3CB6A 3PKDA 2B3KA 1R5HA 5D6EA 2EA4A 5CLSA 3BIQA 2BWXA 1XGMA 1A16A 4U6JA 5FCHA 1JAWA 4FO8A 1R5GA 4U76A 1BN5A 2GG3A 4EGEA 3L24A 3IU8A 4IECA 4U69A 2GTXA 1YW8A 4HXXA 1C23A 2IW2A 2BHDA 5CE6A 2BWTA 2EVMA 4U6EA 2V6CA 4IDYA 4U70A 4R60A 1M35A 3TAVA 2B3HA 3BITA 5FCFA 1O0XA 2GU4A 3D27A 2P9AA 4IF7A 1C21A 2ZSGA 3CTZA 3FM3A 4ZWPA 2HOWA 2Q96A 2GGBA 4B28A 4IKRA 1WY2A 4PV4A 2OKNA 2EVCA 5CIKA 2OAZA 1XGOA 1W7VA 2EA2A 2Q94A 2BWUA 4RZZA 4U75A 5CNXA 4ZWUA 5JHUA 2NQ7A 2P98A 1XNZA 2GG8A 3S6BA 1YVMA 1WN1A 5JI6A 1C24A 1KQ0A 4U73A 3PKBA 3BIPA 1QZYA 2BWYA 1YW9A 5D6FA 4PNCA 3PKCA 3Q6DA 2ADUA 1MATA 2GG7A 4FUKA 4RZYA 4U1BA 1W2MA 1N51A 2GU5A 2BHBA 4ZWOA 4FLLA 5CDLA 3RVAA 1PV9A 4FO7A 5CDEA 2V3XA 4U71A 3FMQA 3MR1A 1C27A 2BHAA 1QXZA 1QXWA 2BH3A 3PKEA 3RORA 2BN7A 4S01A 2BB7A 1R58A 3IG4A 4KM3A 1YW7A 1B6AA 2GG5A 3IU7A 2Q95A 4U6WA 4OOKA 4RGZ1 1XGSA 1BOAA 4MATA 3TB5A 1B59A 2V3YA 1QXYA 1WL9A 2GU7A 2BWWA 5E5BA 4S2TP 4A6VA 1WL6A 2P99A 3MX6A 2EVOA 1WBQA 2NQ6A 4FLKA 4QR8A 4IKSA 2GGCA 4S00A 3PKAA 2G6PA 2BWVA 2GG2A 1WKMA 4IKTA 4IU6A 2Q8KA 1Y1NA 2V3ZA 3MATA 3L7GA 4FLJA 5CDVA 2BHCA 3CB5A
chains in the Genus database with same CATH superfamily
4A6WA 4IPAA 2Q92A 4FKCA 1YJ3A 2GZ5A 2Q93A 4Z7MA 1CHMA 1KQ9A 2GA2A 4U6ZA 4JUQA 3FMRA 4FLIA 4ZNGA 2GU6A 2MATA 2B3LA 4IKUA 1WLRA 2GG9A 2DFIA 1KP0A 5JFRA 1XGNA 3IU9A 1C22A 2BWSA 4S2RP 4U6CA 2GG0A 3CB6A 3PKDA 2B3KA 1R5HA 5D6EA 2EA4A 5CLSA 3BIQA 2BWXA 1XGMA 1A16A 4U6JA 5FCHA 1JAWA 4FO8A 1R5GA 4U76A 1BN5A 2GG3A 4EGEA 3L24A 3IU8A 4IECA 4U69A 2GTXA 1YW8A 4HXXA 1C23A 2IW2A 2BHDA 5CE6A 2BWTA 2EVMA 4U6EA 2V6CA 4IDYA 4U70A 4R60A 1M35A 3TAVA 2B3HA 3BITA 5FCFA 1O0XA 2GU4A 3D27A 2P9AA 4IF7A 1C21A 2ZSGA 3CTZA 3FM3A 4ZWPA 2HOWA 2Q96A 2GGBA 4B28A 4IKRA 1WY2A 4PV4A 2OKNA 2EVCA 5CIKA 2OAZA 1XGOA 1W7VA 2EA2A 2Q94A 2BWUA 4RZZA 4U75A 5CNXA 4ZWUA 5JHUA 2NQ7A 2P98A 1XNZA 2GG8A 3S6BA 1YVMA 1WN1A 5JI6A 1C24A 1KQ0A 4U73A 3PKBA 3BIPA 1QZYA 2BWYA 1YW9A 5D6FA 4PNCA 3PKCA 3Q6DA 2ADUA 1MATA 2GG7A 4FUKA 4RZYA 4U1BA 1W2MA 1N51A 2GU5A 2BHBA 4ZWOA 4FLLA 5CDLA 3RVAA 1PV9A 4FO7A 5CDEA 2V3XA 4U71A 3FMQA 3MR1A 1C27A 2BHAA 1QXZA 1QXWA 2BH3A 3PKEA 3RORA 2BN7A 4S01A 2BB7A 1R58A 3IG4A 4KM3A 1YW7A 1B6AA 2GG5A 3IU7A 2Q95A 4U6WA 4OOKA 4RGZ1 1XGSA 1BOAA 4MATA 3TB5A 1B59A 2V3YA 1QXYA 1WL9A 2GU7A 2BWWA 5E5BA 4S2TP 4A6VA 1WL6A 2P99A 3MX6A 2EVOA 1WBQA 2NQ6A 4FLKA 4QR8A 4IKSA 2GGCA 4S00A 3PKAA 2G6PA 2BWVA 2GG2A 1WKMA 4IKTA 4IU6A 2Q8KA 1Y1NA 2V3ZA 3MATA 3L7GA 4FLJA 5CDVA 2BHCA 3CB5A
chains in the Genus database with same CATH topology
4A6WA 4IPAA 2Q92A 4FKCA 1YJ3A 2GZ5A 2Q93A 4Z7MA 1CHMA 1KQ9A 2GA2A 4U6ZA 4JUQA 3FMRA 4FLIA 4ZNGA 2GU6A 2MATA 2B3LA 4IKUA 1WLRA 2GG9A 2DFIA 1KP0A 5JFRA 1XGNA 3IU9A 1C22A 2BWSA 4S2RP 4U6CA 2GG0A 3CB6A 3PKDA 2B3KA 1R5HA 5D6EA 2EA4A 5CLSA 3BIQA 2BWXA 1XGMA 1A16A 4U6JA 5FCHA 1JAWA 4FO8A 1R5GA 4U76A 1BN5A 2GG3A 4EGEA 3L24A 3IU8A 4IECA 4U69A 2GTXA 1YW8A 4HXXA 1C23A 2IW2A 2BHDA 5CE6A 2BWTA 2EVMA 4U6EA 2V6CA 4IDYA 4U70A 4R60A 1M35A 3TAVA 2B3HA 3BITA 5FCFA 1O0XA 2GU4A 3D27A 2P9AA 4IF7A 1C21A 2ZSGA 3CTZA 3FM3A 4ZWPA 2HOWA 2Q96A 2GGBA 4B28A 4IKRA 1WY2A 4PV4A 2OKNA 2EVCA 5CIKA 2OAZA 1XGOA 1W7VA 2EA2A 2Q94A 2BWUA 4RZZA 4U75A 5CNXA 4ZWUA 5JHUA 2NQ7A 2P98A 1XNZA 2GG8A 3S6BA 1YVMA 1WN1A 5JI6A 1C24A 1KQ0A 4U73A 3PKBA 3BIPA 1QZYA 2BWYA 1YW9A 5D6FA 4PNCA 3PKCA 3Q6DA 2ADUA 1MATA 2GG7A 4FUKA 4RZYA 4U1BA 1W2MA 1N51A 2GU5A 2BHBA 4ZWOA 4FLLA 5CDLA 3RVAA 1PV9A 4FO7A 5CDEA 2V3XA 4U71A 3FMQA 3MR1A 1C27A 2BHAA 1QXZA 1QXWA 2BH3A 3PKEA 3RORA 2BN7A 4S01A 2BB7A 1R58A 3IG4A 4KM3A 1YW7A 1B6AA 2GG5A 3IU7A 2Q95A 4U6WA 4OOKA 4RGZ1 1XGSA 1BOAA 4MATA 3TB5A 1B59A 2V3YA 1QXYA 1WL9A 2GU7A 2BWWA 5E5BA 4S2TP 4A6VA 1WL6A 2P99A 3MX6A 2EVOA 1WBQA 2NQ6A 4FLKA 4QR8A 4IKSA 2GGCA 4S00A 3PKAA 2G6PA 2BWVA 2GG2A 1WKMA 4IKTA 4IU6A 2Q8KA 1Y1NA 2V3ZA 3MATA 3L7GA 4FLJA 5CDVA 2BHCA 3CB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6W A;  4IPA A;  2Q92 A;  4FKC A;  1YJ3 A;  2GZ5 A;  2Q93 A;  4Z7M A;  1CHM A;  1KQ9 A;  2GA2 A;  4U6Z A;  4JUQ A;  3FMR A;  4FLI A;  4ZNG A;  2GU6 A;  2MAT A;  2B3L A;  4IKU A;  1WLR A;  2GG9 A;  2DFI A;  1KP0 A;  5JFR A;  1XGN A;  3IU9 A;  1C22 A;  2BWS A;  4S2R P;  4U6C A;  2GG0 A;  3CB6 A;  3PKD A;  2B3K A;  1R5H A;  5D6E A;  2EA4 A;  5CLS A;  3BIQ A;  2BWX A;  1XGM A;  1A16 A;  4U6J A;  5FCH A;  1JAW A;  4FO8 A;  1R5G A;  4U76 A;  1BN5 A;  2GG3 A;  4EGE A;  3L24 A;  3IU8 A;  4IEC A;  4U69 A;  2GTX A;  1YW8 A;  4HXX A;  1C23 A;  2IW2 A;  2BHD A;  5CE6 A;  2BWT A;  2EVM A;  4U6E A;  2V6C A;  4IDY A;  4U70 A;  4R60 A;  1M35 A;  3TAV A;  2B3H A;  3BIT A;  5FCF A;  1O0X A;  2GU4 A;  3D27 A;  2P9A A;  4IF7 A;  1C21 A;  2ZSG A;  3CTZ A;  3FM3 A;  4ZWP A;  2HOW A;  2Q96 A;  2GGB A;  4B28 A;  4IKR A;  1WY2 A;  4PV4 A;  2OKN A;  2EVC A;  5CIK A;  2OAZ A;  1XGO A;  1W7V A;  2EA2 A;  2Q94 A;  2BWU A;  4RZZ A;  4U75 A;  5CNX A;  4ZWU A;  5JHU A;  2NQ7 A;  2P98 A;  1XNZ A;  2GG8 A;  3S6B A;  1YVM A;  1WN1 A;  5JI6 A;  1C24 A;  1KQ0 A;  4U73 A;  3PKB A;  3BIP A;  1QZY A;  2BWY A;  1YW9 A;  5D6F A;  4PNC A;  3PKC A;  3Q6D A;  2ADU A;  1MAT A;  2GG7 A;  4FUK A;  4RZY A;  4U1B A;  1W2M A;  1N51 A;  2GU5 A;  2BHB A;  4ZWO A;  4FLL A;  5CDL A;  3RVA A;  1PV9 A;  4FO7 A;  5CDE A;  2V3X A;  4U71 A;  3FMQ A;  3MR1 A;  1C27 A;  2BHA A;  1QXZ A;  1QXW A;  2BH3 A;  3PKE A;  3ROR A;  2BN7 A;  4S01 A;  2BB7 A;  1R58 A;  3IG4 A;  4KM3 A;  1YW7 A;  1B6A A;  2GG5 A;  3IU7 A;  2Q95 A;  4U6W A;  4OOK A;  4RGZ 1;  1XGS A;  1BOA A;  4MAT A;  3TB5 A;  1B59 A;  2V3Y A;  1QXY A;  1WL9 A;  2GU7 A;  2BWW A;  5E5B A;  4S2T P;  4A6V A;  1WL6 A;  2P99 A;  3MX6 A;  2EVO A;  1WBQ A;  2NQ6 A;  4FLK A;  4QR8 A;  4IKS A;  2GGC A;  4S00 A;  3PKA A;  2G6P A;  2BWV A;  2GG2 A;  1WKM A;  4IKT A;  4IU6 A;  2Q8K A;  1Y1N A;  2V3Z A;  3MAT A;  3L7G A;  4FLJ A;  5CDV A;  2BHC A;  3CB5 A; 
#chains in the Genus database with same CATH topology
 4A6W A;  4IPA A;  2Q92 A;  4FKC A;  1YJ3 A;  2GZ5 A;  2Q93 A;  4Z7M A;  1CHM A;  1KQ9 A;  2GA2 A;  4U6Z A;  4JUQ A;  3FMR A;  4FLI A;  4ZNG A;  2GU6 A;  2MAT A;  2B3L A;  4IKU A;  1WLR A;  2GG9 A;  2DFI A;  1KP0 A;  5JFR A;  1XGN A;  3IU9 A;  1C22 A;  2BWS A;  4S2R P;  4U6C A;  2GG0 A;  3CB6 A;  3PKD A;  2B3K A;  1R5H A;  5D6E A;  2EA4 A;  5CLS A;  3BIQ A;  2BWX A;  1XGM A;  1A16 A;  4U6J A;  5FCH A;  1JAW A;  4FO8 A;  1R5G A;  4U76 A;  1BN5 A;  2GG3 A;  4EGE A;  3L24 A;  3IU8 A;  4IEC A;  4U69 A;  2GTX A;  1YW8 A;  4HXX A;  1C23 A;  2IW2 A;  2BHD A;  5CE6 A;  2BWT A;  2EVM A;  4U6E A;  2V6C A;  4IDY A;  4U70 A;  4R60 A;  1M35 A;  3TAV A;  2B3H A;  3BIT A;  5FCF A;  1O0X A;  2GU4 A;  3D27 A;  2P9A A;  4IF7 A;  1C21 A;  2ZSG A;  3CTZ A;  3FM3 A;  4ZWP A;  2HOW A;  2Q96 A;  2GGB A;  4B28 A;  4IKR A;  1WY2 A;  4PV4 A;  2OKN A;  2EVC A;  5CIK A;  2OAZ A;  1XGO A;  1W7V A;  2EA2 A;  2Q94 A;  2BWU A;  4RZZ A;  4U75 A;  5CNX A;  4ZWU A;  5JHU A;  2NQ7 A;  2P98 A;  1XNZ A;  2GG8 A;  3S6B A;  1YVM A;  1WN1 A;  5JI6 A;  1C24 A;  1KQ0 A;  4U73 A;  3PKB A;  3BIP A;  1QZY A;  2BWY A;  1YW9 A;  5D6F A;  4PNC A;  3PKC A;  3Q6D A;  2ADU A;  1MAT A;  2GG7 A;  4FUK A;  4RZY A;  4U1B A;  1W2M A;  1N51 A;  2GU5 A;  2BHB A;  4ZWO A;  4FLL A;  5CDL A;  3RVA A;  1PV9 A;  4FO7 A;  5CDE A;  2V3X A;  4U71 A;  3FMQ A;  3MR1 A;  1C27 A;  2BHA A;  1QXZ A;  1QXW A;  2BH3 A;  3PKE A;  3ROR A;  2BN7 A;  4S01 A;  2BB7 A;  1R58 A;  3IG4 A;  4KM3 A;  1YW7 A;  1B6A A;  2GG5 A;  3IU7 A;  2Q95 A;  4U6W A;  4OOK A;  4RGZ 1;  1XGS A;  1BOA A;  4MAT A;  3TB5 A;  1B59 A;  2V3Y A;  1QXY A;  1WL9 A;  2GU7 A;  2BWW A;  5E5B A;  4S2T P;  4A6V A;  1WL6 A;  2P99 A;  3MX6 A;  2EVO A;  1WBQ A;  2NQ6 A;  4FLK A;  4QR8 A;  4IKS A;  2GGC A;  4S00 A;  3PKA A;  2G6P A;  2BWV A;  2GG2 A;  1WKM A;  4IKT A;  4IU6 A;  2Q8K A;  1Y1N A;  2V3Z A;  3MAT A;  3L7G A;  4FLJ A;  5CDV A;  2BHC A;  3CB5 A; 
#chains in the Genus database with same CATH homology
 4A6W A;  4IPA A;  2Q92 A;  4FKC A;  1YJ3 A;  2GZ5 A;  2Q93 A;  4Z7M A;  1CHM A;  1KQ9 A;  2GA2 A;  4U6Z A;  4JUQ A;  3FMR A;  4FLI A;  4ZNG A;  2GU6 A;  2MAT A;  2B3L A;  4IKU A;  1WLR A;  2GG9 A;  2DFI A;  1KP0 A;  5JFR A;  1XGN A;  3IU9 A;  1C22 A;  2BWS A;  4S2R P;  4U6C A;  2GG0 A;  3CB6 A;  3PKD A;  2B3K A;  1R5H A;  5D6E A;  2EA4 A;  5CLS A;  3BIQ A;  2BWX A;  1XGM A;  1A16 A;  4U6J A;  5FCH A;  1JAW A;  4FO8 A;  1R5G A;  4U76 A;  1BN5 A;  2GG3 A;  4EGE A;  3L24 A;  3IU8 A;  4IEC A;  4U69 A;  2GTX A;  1YW8 A;  4HXX A;  1C23 A;  2IW2 A;  2BHD A;  5CE6 A;  2BWT A;  2EVM A;  4U6E A;  2V6C A;  4IDY A;  4U70 A;  4R60 A;  1M35 A;  3TAV A;  2B3H A;  3BIT A;  5FCF A;  1O0X A;  2GU4 A;  3D27 A;  2P9A A;  4IF7 A;  1C21 A;  2ZSG A;  3CTZ A;  3FM3 A;  4ZWP A;  2HOW A;  2Q96 A;  2GGB A;  4B28 A;  4IKR A;  1WY2 A;  4PV4 A;  2OKN A;  2EVC A;  5CIK A;  2OAZ A;  1XGO A;  1W7V A;  2EA2 A;  2Q94 A;  2BWU A;  4RZZ A;  4U75 A;  5CNX A;  4ZWU A;  5JHU A;  2NQ7 A;  2P98 A;  1XNZ A;  2GG8 A;  3S6B A;  1YVM A;  1WN1 A;  5JI6 A;  1C24 A;  1KQ0 A;  4U73 A;  3PKB A;  3BIP A;  1QZY A;  2BWY A;  1YW9 A;  5D6F A;  4PNC A;  3PKC A;  3Q6D A;  2ADU A;  1MAT A;  2GG7 A;  4FUK A;  4RZY A;  4U1B A;  1W2M A;  1N51 A;  2GU5 A;  2BHB A;  4ZWO A;  4FLL A;  5CDL A;  3RVA A;  1PV9 A;  4FO7 A;  5CDE A;  2V3X A;  4U71 A;  3FMQ A;  3MR1 A;  1C27 A;  2BHA A;  1QXZ A;  1QXW A;  2BH3 A;  3PKE A;  3ROR A;  2BN7 A;  4S01 A;  2BB7 A;  1R58 A;  3IG4 A;  4KM3 A;  1YW7 A;  1B6A A;  2GG5 A;  3IU7 A;  2Q95 A;  4U6W A;  4OOK A;  4RGZ 1;  1XGS A;  1BOA A;  4MAT A;  3TB5 A;  1B59 A;  2V3Y A;  1QXY A;  1WL9 A;  2GU7 A;  2BWW A;  5E5B A;  4S2T P;  4A6V A;  1WL6 A;  2P99 A;  3MX6 A;  2EVO A;  1WBQ A;  2NQ6 A;  4FLK A;  4QR8 A;  4IKS A;  2GGC A;  4S00 A;  3PKA A;  2G6P A;  2BWV A;  2GG2 A;  1WKM A;  4IKT A;  4IU6 A;  2Q8K A;  1Y1N A;  2V3Z A;  3MAT A;  3L7G A;  4FLJ A;  5CDV A;  2BHC A;  3CB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...