4MAYB

Crystal structure of an immune complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
181
Chain Sequence
SPEDFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPVAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRRVEPTVTISPSNLLICSVTDFYPSQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
total genus 40
structure length 181
sequence length 189
ec nomenclature
pdb deposition date 2013-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mayB01
3IDGA 4BQBA 1FORL 1L7TL 1P7KA 3ELAT 3ZHDA 1KIPA 1PZ5B 1CGSH 1KB5B 3KVQA 3KR3L 3J7HA 1FGNL 4XTRC 1NFIB 4HKBB 1YJDL 2VDRH 4JRYB 3TNNA 4U1HA 3P73B 2NW2A 5KSBE 4LVOC 3S36L 4OAWB 4LOUC 3B5HA 3AMKA 2H26A 1CLZL 1DUYB 2FRGP 1NBQA 4GMSL 4I0KA 1N64L 4POZD 3PGDA 3QA3B 4Q9RL 1F45A 4WY7L 5DHYB 1IKFH 2AJSL 3MLYL 3L5WB 5D2NA 1ONQA 4GH7B 4CW1A 1KJVB 3M8OH 1UACH 5GRJL 1FJ1A 4Z9KB 5BO1L 5D2LE 2JKXA 4U6HA 1INDL 5J11B 2F9BT 3EYUH 3NCBB 1NFDE 1T66C 3IDXL 3WIFB 5DZLA 5BXFA 3SY0B 2RGSA 3SJVB 3P3YA 5F1NA 3DUUB 4HLJA 4PP1C 3CH1B 1T2QH 4U1IA 1E27A 2F5AL 3SHSA 3QHFL 4PLNC 4PGBB 1EERB 5E2JA 2X4RA 4PGDB 3KLHD 1UM5H 4ZUTA 3PGCA 1Z0NA 4P2OB 1UM4L 4MB5A 4UOW1 1TZIA 5I0ZA 1EEUA 1MFEL 2VL5A 3FQXA 4NP4L 4Z7QF 2GJZB 3MJ9L 4X4ZA 1IGIL 1MCRA 1NJ9B 4MMZC 3QQ9D 3BD4A 1D9KD 3G08A 5DD3L 4ZUTB 5DRNB 3NA9L 3VI3F 4LPYA 3VWKA 4CMMB 2AK4B 1VDGA 4YBQC 4U1SB 2UY6A 1Y6MR 2DKUA 4BJLA 3TBSA 2ICES 3P30H 3QEQA 1QZ1A 2Y23A 1TZHB 4KK8C 2E9BA 4RGMB 2MHAB 5JO5A 4JAMA 4LIQH 4A6YH 5A2FA 1EMTL 1Q72H 4Z7WF 1W72A 2FB4L 2HH0H 2NY2C 3GSWA 5F3HB 4TPRH 2DQEH 1X5ZA 4Y2DC 3BQUB 3GO1H 1IGYB 2WUBL 3IJHB 2B1HL 5FK9B 2ESVB 3MLXL 3VFUB 2O5ZL 3VCLA 3MOBL 1KJVA 4QHLB 1RUPH 3H9SE 3TNMB 4S1SL 1A9EA 3PV7A 4HWBH 4OCRH 1PVHA 4W6XB 3U46A 2E8YA 1IC4L 3BEWB 5DR5H 1NGPL 4WEBL 2X4TA 3DSNA 5GGVH 5DRWB 4L8DB 5IF0B 4APQC 3EYSH 4QHKJ 5C09D 5D9SA 2X89D 3FKUS 3GMMA 1L7IL 3QIBC 4LF3A 4KHTL 5ITBH 3GIVB 4QHUA 1X4YA 3QR2A 4R26L 4XT1C 2WP3T 3LH2H 4M5YH 4YGVB 2Y72A 2CMRH 4KKCD 4G7YH 4Z95L 1HH6A 3HZMB 1W0VA 4RDQF 2EC9T 1U8KA 3U7AA 1FZJA 3KPSA 4L4TA 5I1LB 3C5JA 2FYYA 5HHOE 1P84K 1C08B 4UT7L 4KKAC 1GIGH 1EA9C 1N4XH 2O93L 3BEVA 1J0JA 1A6VL 4KJYB 1JHLL 4U6YA 4CRPA 1IAIL 3HG1D 2B0SH 5E4EC 4MQXC 4LLUB 2VXUH 2ICCA 4GJTB 5F93C 2DQCH 4DQOH 4OZIF 3O3AA 1S7SA 3QJHB 1FNGA 1N8ZA 2ADGB 4NC1C 5BVJB 1JPTH 1MFCL 4MXQD 4OLZL 5AYUL 5DDHB 2X4UA 3D69B 3BWUC 1OTUD 2HWZH 2BY2A 1R3HB 3LEVL 4XCNA 3B3IB 5ID0A 4Y88A 2HT3C 4N90D 4LLVA 4WUUB 1H3TA 2ARWA 3DYPA 5FHBL 4S1RH 3IDYB 3OKNB 5I71B 3ZZ1A 3QZWA 3T65A 1LK2B 4HX1A 3C2AL 2VQUA 1U3YA 2NX5E 3QFJA 2GW5A 2VXQH 3IFOA 1S7XA 1S7TB 4N9GA 4B50A 4PREA 3QNYB 1QFOA 2DQJH 1E28B 2P8LA 1U8IB 2NY3B 3SE4A 5D93C 4UIMB 1FAKT 1RJZB 2DKMA 3GI9H 5BRZA 4M00A 2HFGH 3F58H 4WW2C 5KS9B 3S3PA 3O81A 1JV5B 5ADOL 4FMKA 2IC2A 4ZQKB 2ORBH 3VDBA 3PWJB 5GGUA 4BKLB 3MRQA 2WM0A 1PLGH 2YD5A 3FT2A 1LK3H 3IJSB 4L4TD 4MJIB 1W72B 1BM3L 2Z9TA 5DHVH 1IQWL 2BERA 3GHEH 3KPRA 4JJ5B 4YEFA 2I5YH 1WBXA 2CRIA 2F5BH 4MA8L 4MAUH 4Y8AA 4ETYA 3BP6B 4D9LL 1X5YA 3QDHA 4M62H 4RISL 2DI7A 5IEHB 2DQIH 1BAFH 4YDKH 5HGHA 3X13A 1D5XB 4F57H 4WCYL 4G7VL 3PP4H 1RK0A 4D9RE 1BIIB 4P2RE 4BSWA 4NWUL 1I8KB 4RQQB 3U0WH 2VDQH 5IFAH 1KCSL 1JZ2A 3QCUL 4U1KA 3RI5F 3VXSD 3PHQA 1T6VN 1F13A 2PO6D 1J86A 3CH1A 4U1IB 2GITA 2J8HA 1Q0YH 4Z7NF 2FECI 4PRAB 4H8WC 1IGMH 4GG8B 1RZKH 2NY7L 5DJ6A 5C07E 3FOLA 1MY5A 5C0BE 1QSFB 3AB0B 3CDGB 3CX5K 2DMKA 4PJDA 3RY4A 2Y36H 3C8DA 4DVBB 1G7HA 3MNVA 2QL1A 3X12A 1D9KA 3SKMA 2CH8A 2SEBA 1E4KC 3BP7A 3BW9B 5GSVA 1H8OA 3KS0H 4AM0B 1Y18B 4TUOB 4X5XB 5CJXA 3DV4A 5GXBB 1FFPB 1A7OH 1SEQL 1MJ7H 4QRQB 3RWEB 4AEIH 4KMTL 2UZYB 3MYZA 3UTQB 1C5CH 1LP9B 1ND0A 1XGPB 5E08H 3I3BA 4GRWE 5KVGL 3LHPH 1K4CB 5DFVD 1EHLH 2FX9H 4KH2A 4HKBA 3QIBB 1DE4A 3M1BB 4N0UE 4PFEA 5TGBA 5DMKB 2YPKA 1GXEA 1KIPB 1MSPA 1PZ5A 3MBEB 2X7LA 2XZAH 5EU7C 2NY6C 4PJAA 1Q9LA 4M93B 5GRVL 1IGFL 2OTUA 2CKBB 2OMBA 1VEOA 3U6RA 5AAMA 4QNPE 3H0TB 2UUDK 4YGAB 5L8LB 1J8KA 5DJ8B 3FONA 2BNRA 1CD0A 5K59F 1KIQB 4P5MB 2EC8A 2A83B 3KYKH 3RJQB 3ZDZF 3I3DA 1QLFA 4TUJA 2OTPA 3K4DA 4YHZL 3ZT5A 3L3DA 3P9MB 1QSED 5I1DA 5AZ2H 4YC2B 4RSVA 5AYQA 5JLZA 3PWLA 1QNZH 2EIZA 4HUUB 2CKBA 1T1YB 3S35L 4YHOL 1SMAA 4NCC1 1T1WB 4G80A 5FUZL 3QDMD 4TNWF 5C8JA 4IMLB 4OKVB 1JPGB 2CIKB 1NCNA 5D7IA 5I19L 2ARJQ 1NSNL 3V6ZB 1WBYB 5GZNC 4YEEA 3PXHA 3VMOA 1TTGA 4U1GC 4MWFA 3ZKXC 1HILA 4PJBB 4CDGC 1IGJB 2ZSVA 5KJRL 3D25B 3F6IA 5DRXB 2FR4A 1RIUL 1NKOA 5D5ME 4WU7B 3RL1B 3MMEB 1A4JB 3CLFL 1G7IA 2NTFA 2Z35B 1I1RA 3W82A 2OL3B 4YFLF 4R9HA 4MXQC 1CT8B 5JQ6H 1SJEB 4ZUUA 2AEPL 3L95B 3NIDE 3I9GH 3SE3A 4OZFG 1XIWB 5E0QA 3ARVA 3PGFL 4HJJL 3ROOA 4XC3H 5M94B 1KJ2A 4M6AA 4Y2DA 3PQYD 5B8CA 2OL3A 5HGDB 4ZFOA 3DOSA 1AIFB 2IPKA 3OJMB 1DBAL 3RL1A 2XN9A 3NCCB 4Y4HC 1N5YH 3BX7C 5DJ6B 2YRLA 8CGTA 1ZGLB 5DGRA 2O5XL 5IW6A 5DEFB 4YDIH 4HKJA 1K6QH 3H9ZA 1SEBB 3C2SA 1NUFA 4OIAA 2EE2A 3HZVB 4DZBB 3UZVB 2DQDL 5JW4M 2FJFB 1JRHI 3PQYA 4L4VB 5I75B 1SQ2N 3SBWA 5GIRB 2C4XA 4GQ9L 2D3VA 5GS1B 3U46B 3QEUA 4FFYL 4QTHB 3PABB 1BREA 3Q6GL 1FG2A 4WFHD 3IJHA 4OLXH 1BFSA 2LU3A 3MV8A 4KV5E 5CHNB 1QLRB 4FZ8H 5B39A 3SKOA 4HK3J 1I7ZB 5F3HA 2AK1L 3LQAH 2PN5A 4QXGL 5FKAA 1TNMA 3LRHA 5A16B 3MZGB 4PYHA 3EHBC 1KENL 3H42L 2E27H 1I7RB 2WWKO 4R4BA 2CGRH 2YA1A 2YXMA 3KPRB 4IOFC 3N9GL 3G9AB 1H0DA 5GGTA 1D3CA 1PSKL 1RY7B 1FE8L 2FX8H 2XWTA 4BKLA 4Z76A 3PWPA 1FZMB 1J8HB 2D9QB 4K23H 2VR4A 1REIA 4YHML 3CFCH 1AGDB 5FIEA 3SE8L 1KPVB 2GI7A 4O02H 4XMPH 5KN5A 3ARGA 4HDIB 5J12B 4QRUA 5IT2H 1ZWIA 1FNSH 3FT4A 2VNCA 4Z7VF 2OCFD 2D7QA 5BV7B 3IAPA 3D9AH 2A6JB 2DQHH 2R2CA 5DHVA 2XACC 4ZS7L 4ZAKC 1QQDB 4IOIA 1PX4A 1BIHA 2X4QA 1BD2B 1ITBB 5HTSA 4EI5B 2R1WB 3KPSE 2GSGA 4OBRA 2DQTL 4HX1B 4M1DH 3LVEA 4R7DB 3OTTA 1FNHA 2LFGA 1NBVH 2J2ZA 4ZNEA 5GRYA 5DXWA 2EZ0D 3EO0A 3GSOB 4FFVD 3VXUB 2VC2L 1XEDA 5B38B 2K3TA 1U8LB 4H0IA 5EO0B 5DD5H 5K9QG 4DGVL 4PJGA 4UBDC 4JFZL 1MLBA 4PRBA 5E7FA 3S9DB 2W07A 1JNLL 1T80A 2CSPA 4U1KB 1XF3B 4R2GB 3VXNA 1U58A 1QRNA 5DEGA 1A9BB 5F7NC 1P7QB 5HY9B 3CXHK 2GCYB 3U4EA 3ZKMC 5T1KB 3FB6A 4RMQA 1II4E 3HLAA 4CU8A 1CDJA 2DMBA 1J87A 2B20A 3N50A 4RWYH 1AD9B 2EDKA 3MC0A 5C0BB 2FBOJ 3L3IB 5JOFB 5F9AC 5K9KB 2WBJC 5CUSH 5ABDE 3H9SA 2VLKE 4QHKI 3V95A 3S3JA 3WFEH 4XNUL 3TNNB 4BM7A 3VXRD 4JM2A 4K2UH 5DUBA 5T3ZL 1NGXB 3OV6A 1MJ8H 2ADIB 3TBTA 4FQLL 3TVMA 3TVMB 1F90H 4QRPE 3KLDA 1KLGA 3H6JA 2R69H 1WBXB 4NKIH 4KKBC 1S9YB 5ACZA 4JJ5A 1LO4H 1FG9C 3KPRD 4LDOB 1FL6A 4OM1L 3KHQA 4NNPL 4D0CA 4HC1L 4NUGH 4X5LA 3LD8C 4HAGA 4I13B 5DQDL 5D6CB 5IQ7L 1CICC 1A22B 4XAKE 3DGCR 3EZJB 4KUCD 5GGRB 3IFLL 3MRCB 3GRWL 1AGEA 4KGLA 2VDMH 1RZIA 4NO0D 4ODTL 1RJZA 1CXIA 4YFEA 3CK0L 1P4IL 1YEGH 3ARDC 4EKXA 5CEZL 2VLRD 4P2QD 5EU4B 4UMGA 2I60L 4M6MH 1AE6L 1E28A 1OTSD 1U58B 2YK1H 4YHNB 4PB9L 1OGAB 4G9FB 1T04B 3KWWB 1TNNA 2ADFH 1BOGB 1F3JA 4NNYB 1KLUB 3QWRA 1LEIB 3UTTB 4OF3A 5FKPB 1T3FA 5EIVA 4ZFZB 3ULUH 1NUNB 5K9QI 5I8OH 3A6CH 5HDOA 4Y5YA 1BEYL 1VGKB 1T1ZB 1I1AA 1GGIL 3D39D 4NQEE 4LRNH 1OT2A 1YEHH 4JQIH 1KCUH 1HIMH 4MX7A 4G8FA 3VFGH 2VQ1B 2VXSL 3MRKA 3DROB 4DAGH 3DVIA 4NJ9L 4ZAKD 1EH9A 5H2BA 3DUSB 4P4KD 4BA8A 1S7UB 2NLJB 4WWKB 4NKQB 2XQYK 5EH1A 4N0RA 2F74A 1V7NL 2BVEA 2V9QA 1RZJH 4RNRB 1D5MA 5CIPH 2NX5A 3V79C 1A8JH 1W0WA 4CAGA 1TJHH 3B83A 2C1OA 4NO2B 4TSBH 3HI5L 3RWGB 3PWPE 5DJYB 1CI5A 1BJ8A 4JVWA 1YN6A 2BNRE 4HIHB 4WI8A 3CFKA 2O61A 6FABH 1SBSL 4XNYL 4LLWB 2A9NH 3VD7A 4I77H 3ET9F 4I3RL 3MA9L 2QADC 1Z6JT 2EDTA 1SJXA 4HIIB 4YIQA 5D2NE 3QNXB 3U4BH 3OKEA 1S9WB 5HD8D 1KEMH 1A7PH 2BHYA 4YGVA 2A77L 5T33L 2GAZB 4R3SB 2OK0H 3VXTA 3RWHA 5E2TH 3WV0A 5KZCD 3MRHB 3I3EA 3MRPA 3SCMB 1EBAA 3HC3H 5I73C 4OV5A 3EJZC 2ZKHH 3L7EB 2EZ0C 5DRWA 1NCAH 1D5IL 2APWA 12E8H 2R56H 4X7SL 3EYFA 3HLAB 1JYXA 4NPYA 3RP1A 5B3JF 4QXTA 4DVRL 3TH2T 1IC5L 2E9IA 3BPLB 1SYVB 3QUZB 5DEGB 2GEEA 5MEOB 5A43C 4R3SA 2BJML 3NCYP 4PRIA 2YD4A 3PV6A 1MLBB 3NH7H 4JFYA 4XPTL 4S1DD 2HMIC 4YDJB 5T3XH 3BRGC 4HBCH 2VERN 4EXPX 2XIDA 1NC2D 5T5FH 3BT2H 3BKYL 5BZWA 1X44A 5B4MD 3Q1SL 1WAAE 1JHLH 1ZANL 2ITCA 2DQUL 1PY4A 5LAXA 1OPGH 2HRPH 2XZZA 3EFDH 4XNMB 3RY6A 5HGDA 4ZFOB 3DRQA 1QEWA 1OQXA 4JG1H 5CBEA 2PKDA 2EDDA 3E3QE 3JXAA 5D1XD 5FYJU 5E8EA 4LKXA 2CLVA 2ED8A 5CP7B 5CAYB 2WUCL 1FP5A 3FOMB 4OLZH 3CFJA 4FG6C 3U82B 1OARH 1PFCA 4JLRA 4LBEA 4QRUB 1BBDL 4HDIA 4U2ZA 3UMTA 1FZOA 5SV3A 2ZUUA 4HWEH 3FQXB 2IANE 4GMTL 1P6FA 1DBKH 2EDLA 4F58L 4MHHI 1FN4A 4I18A 3WLBA 5C08A 5JW5B 4OGXL 1EFXB 1MIEL 3MLUL 1ZMYA 3LS4L 1EV2E 2EH8L 4JREB 2Q7NA 2P42B 4HS6B 3SJVA 5L9DL 1RI8A 3K1DA 1LO5A 1JYNA 3ROLA 1WC7B 4JFEB 1D9KC 5KVEL 5JLZB 1ZHLB 4OZFA 4ZTPH 3DGGB 3QRFM 4LU5L 43C9A 4FABL 4X83A 4GAGH 1J8HD 1FYTE 4Z7WE 5C3LD 1RJLA 3OHXB 2GJ6A 2NY3D 1WBZB 3C5ZC 4BH8A 5J4MA 3QI9A 5D7SL 4JO2H 1NLDL 1B3JA 2DL9A 2EDJA 3DXAB 4GUPA 4XBPA 5FGSA 2VDPH 3O3BB 2H2PD 1CVSC 3WXVH 4M61A 2H1PL 4UI2A 5MP6H 1XGQB 3P4OA 4IMKC 4X6BA 1YEKH 2GKIA 4ISVB 4CJ1A 1INEH 5DD1L 2DM3A 4PGEB 2AQ1A 3OWEA 1ITCA 3P9WB 3IB4A 2BOCA 3W39A 1T66D 4PJIB 3MJGX 5L2KB 1KELH 1U8PB 3DX8A 5IHZB 3JZ7A 5DUBB 1F3DH 5INDB 4MLSA 4PJXB 3ULUE 1AIFA 2J8UE 4Z7UE 4U0RB 1WJ3A 1IGTA 4NM8H 5GRXG 4HWUA 1DLFL 1IKNA 2P5ED 2YWYA 4NZJA 1N0XH 3WKML 4QTIH 2AJUL 4DEPB 3IFNH 2Q3AA 5C0CD 3QCUH 2CUIA 5EC2A 1UB6A 5T1LA 3EJYD 3AS1A 2B4CH 3RVUC 1U8HB 1ZT7A 4NRXA 2R8SL 1KSRA 4OGAD 2APVA 4Z7VB 1RZKL 2NY7H 5DMIL 1C12A 1OAYL 3B2VH 3RX8A 2OX5A 4TULH 4EVNB 3CDGA 3VXNB 5JHLH 3EO1A 2OXHA 3BHBA 1KBGL 5IB3B 3PL6C 1S7VA 1WUNT 3RDTC 3SE4C 3RVWC 4KDWA 2AJVH 5I8EB 3UTZA 1E0OB 3VXUA 4KTDH 3HB3D 4LKCB 2FO1A 3VRIB 1H3PL 5ESVB 1RHHA 3SKNA 5D1ZD 1AO7A 1S7QB 3F7PC 5IVNA 2D31A 3IDNB 5GS0D 2YSSA 5J9PA 3KPLA 1S9XA 1VFOA 3VMNA 3BPNC 3S6CA 4YHPA 1FVDB 1EO5A 3BP4B 3BUTA 1FNEB 3KHOA 1OT1A 4L8SC 2H2SC 3QCVH 4LFHD 3ARGB 3WJLC 3UBXI 5I1HH 3WLWC 1TITA 2EH7H 3HE7D 4HJ0C 4L5FH 5DVKA 2AJZB 4XPFH 3RWIB 3GMNA 5DLMH 4AQOA 1KXQE 4JRXB 2J1KA 4EN3B 2X7LB 4JVUA 2GTZB 4FQXC 4XCCL 3CZFB 3BIBX 2A38A 2BVUA 3IJSA 5E03A 2YPLB 1YN7B 2KH2B 1QPXA 3IDMA 1XCQA 1R24B 1SM3L 1MCHA 4RFOL 3C5SB 4X8JA 2XKNB 2EICA 1Q1JH 2Z8VC 3HC4H 5INCA 2OQJB 2X9XA 5BRZB 4KFZC 4NUJB 1VB9A 4K8RL 2FECL 2V2WA 1GOFA 1X4ZA 4NPYB 1H5BB 4ODHH 3ZSTA 1V7MH 1QBMH 1AKJD 2C1PB 4XVTL 5KVDH 3RQ3A 1ZEAL 2AEQH 3KYOB 5JMRA 4YK4B 1BFTA 1Z0MA 4LASH 5JNYA 3GHBH 3HZYB 3GKWH 2VB5A 4PJ9D 5HHQA 1RIHH 3B9KD 5FV2A 1CICB 1GH7A 4KQ4L 3NFSL 2NXZC 3NZ8B 2AJYH 4GRWB 3CX5J 1LP9E 4M7ZB 4DZBA 3DXAE 2HT4C 1AQKL 3GZKA 2CDFB 1AXIB 2ENYA 4WFFD 2B8OT 3QAZC 5E95B 3ARXA 2BSSB 1LDPH 1YPZF 2IADA 2KZWA 1FRGL 3HFML 1VGEH 3QHZL 4LLWA 4NWTL 4PY8J 5F7WC 3KXFB 1OAXH 4PGCB 4OIIH 1MLCB 5JXED 2JK5A 2FHCA 4V2CB 5FYKL 3WIIL 1RK0B 4OCSL 1MCPH 1RZGA 3QIUB 4JQVA 5DS8A 5IBUB 2R39A 4OM0L 3MV9B 1K8DB 5E24E 1I3GH 3SCMD 3DUSA 2W92A 4R96B 3K81A 2YPVL 4RGOH 1NGQH 1T22A 4N0UB 3RZWA 1KNOB 3C60D 5TE6H 3S5LG 4K8RD 1ES0B 2V9RA 5DQJA 1GGYA 4MA1C 5C0AE 1XH3A 4G8EB 1WTLA 1RFDH 3ALPA 3ORJA 1XGUB 1I8MA 4JFFB 4M3KB 5FGRA 5DSCB 2KPNA 5HI3D 2AQ3A 4AEEA 4JRXD 1CDGA 3L9RA 3S88L 1DSFH 2B5IC 2DJUA 2EXWC 3QDMA 5DK3A 2FATL 2M1KA 4HS3B 4DUXA 1IAII 1FFRA 1HHGA 3L3HB 3ZKXB 3UTSB 3TCLB 1G0XA 5J57B 4G9FA 3SDAD 4WDIA 4G8GD 3BJ91 4Y4HA 2BFVL 4PRDA 2BNQB 1BECA 1JF1A 1T6WA 3OJDA 4TOYL 3X17A 4DKDC 3TJHC 2WINA 5IW1A 4WI4A 1EHNA 4O58H 4LSSL 5DZOA 4XNXH 5AG8A 3LQAL 4QXGH 3UTPE 4IRZH 4XHJC 3TN0A 4Z77A 5JXEC 3D1MC 4PJEB 1MQ8A 1YEFL 3DHJA 4KUZL 5JIIA 2NYYD 4NM4L 4R8WH 4XMLH 3DURA 3GMPA 5E9DB 2UWEA 5EU3A 4JHBA 3CFIC 1VA9A 3KNBB 4FG6D 5FO9A 2ZCLL 4PRNA 4U3XA 3ZL4H 2C3GA 5MEQB 3KPMB 5IWLC 3MROA 4FXGB 5JO5B 1D6VH 3SDCA 3LB6C 1UZ8A 2HTLC 3G5VA 3GI8H 5MEND 1UWGL 1DR9A 2VJXA 4ONOA 1EFXA 5E99H 1L0YA 5F70A 4JY5L 1EHXA 4WTZG 3DJ9A 4FZEH 4PBVC 4UAOC 3O6FC 3UCRA 3BZEA 2P24A 2ZJSL 1FN4B 4HPYL 4P23C 5E2VH 2EXWD 3K80A 4I9WD 4P9HL 4JANB 1C8PA 1UYWL 1YQVL 5ANME 4JFED 3VI3E 3FT3B 4M1GL 3PJSA 3Q3GA 4NO5A 4XCEB 4JZJC 2HRLA 4HIJA 1J18A 4JGMA 3IFPA 1KB5H 3B4NA 2YBRA 2GK0A 4FQ1L 1RUQL 1AXTL 2OS7A 4TTGA 5F71A 3WFHA 1P7QA 2NPLX 4EDXA 3BQUC 4G5ZL 4BYHA 1I9IL 4LSTH 3ILQD 2H3NA 4UNTA 5BS0E 4OZGE 2MPAH 3DUUA 5LQBH 3F6LA 3W0WE 1NEZG 3VD3A 3SDXE 5CP3H 1G0YR 2WV3A 2HAZA 5ANMA 3P0YL 4HFUH 1F6FB 1A1NA 1DL7H 4RZCB 3EO9L 3ALXA 1IEAB 3GBNL 2R29L 3RA7L 3RU8H 4MYWB 5CKGA 1OWWA 5HSFA 2QBWA 1S5IH 3H9YA 1WISA 1ZT1A 1QP1A 1XGTB 1YJDH 4O2EB 2APTA 3G04B 1P4LB 1TJGH 1EAPA 2CK0H 4IRJA 1IBGH 3IDJA 1DUYA 1CLZH 5DJAB 4AENB 1GC1L 3X3FH 4JN2B 4DZ8B 5CIPA 4WHTA 2W0FB 5E1AB 5ITFA 2QR0A 4LFHG 4HPOL 5DWUH 3F62A 4ZO8A 2A6IB 2CO7B 3NIFE 1MVFA 4P57A 3RGVD 4J23A 4HZAA 3T77B 1E4KA 1GGCL 4JZJB 2APBA 5E4EB 4P3DB 1HI6A 3IDGB 4EDWH 4DGYH 5SX5H 5TFSH 2AJ3A 1LVEA 5KANG 3BIKA 2X4PA 5MEQA 3CK0H 3NIGE 5FDYA 4PLJC 3INUH 2P45B 1EVTC 3GMPB 3HRZB 2R23B 3IJYB 5HYJE 5I1EL 2BVYA 3NFNB 1I8IA 4YLQT 3O3DA 2AXFA 1S7WA 1CD1A 2ZG3A 5GS1A 1CDBA 2FX7H 5IW1B 1Z9MA 4XMKH 4KQ3L 5JOPE 4XGZB 4IOFD 4KI5E 2RR3A 3U7YL 2BCKA 2CO6B 3QFJB 1KB9J 1UM6H 2H32H 3TBWA 4HXAH 5GGVY 3J8F7 1F00I 1YYLL 4Y16A 3PIQA 3B3IA 3LS5L 2LQRA 3VWKD 4KRPB 4P59L 2NXYB 2YA2A 4ZS6D 4PRPA 1KG0B 5IG7B 4Z78B 5I75C 1YMHA 3V0WL 4U6HB 1QFWH 1V7NH 1IL1A 1MJUL 2RBLA 1N8ZB 2ADGA 1UXSA 5EU7E 5B8CB 5JW3L 3V0AC 2HKFH 4PS4L 5C2BH 2DQEL 3NVQA 4K7PH 4PUBH 4Q9BA 5EZIH 1QUNA 3CXDH 3BKMH 1RZIB 1K3IA 2OP4H 1XF4A 2BVQB 3LKQA 5FM8A 1WAAA 2WMPA 3TZVB 1J0YA 2A0LC 4NN6C 4HMEA 3O2DH 3S3SA 2MMXA 5LG1A 4JANA 4OAWA 5DR5L 3QG6A 2VR9A 3VXQA 3K8LA 5F3BB 5EN2A 2FHFA 4HV8A 3V52H 3C5JB 4I3SL 2FJHB 1NBYA 1XR8A 1BX2B 2NY5H 5HXMA 4RFEB 1CDHA 5I1KH 1FVEA 1Z9OA 4QOKB 5D7IB 2CIKA 2ADIA 4KJPC 1XF2A 4JRYD 5E8NA 2X4OB 1NDGA 4C56D 2CXGA 1G7MA 4G6JH 5CD5D 4NOBA 4PG9A 4I3GA 5EU3B 4GUPB 4ZFFA 4H26B 4DN4L 5KANI 3EJJX 3BI9X 5JNYB 3JUYA 3TPUB 2IG2H 4FQ2L 1WGOA 3MLTA 1L0XA 5DJDB 2BVTA 5DJ8A 5HY9A 4W70A 4C55A 3OJDB 4M6OL 1JF1B 5J7CC 4UV7L 4ZFGL 3DSFL 3FO1B 2VXVH 1UG9A 2IF7A 3RNKB 2ZSWA 3OL2A 2VSDA 5JA8B 1L4IA 1F02I 1VERA 4NQDA 2CKBH 1F42A 5KOVC 3QXDB 3TV3L 3ULVD 5J89A 3V0VB 3W11C 1HHJA 3LIZH 4UQ2A 2UUDH 2XZQL 4R4FH 4LLDB 5JW5A 4JFPB 5I18L 2VWEC 2GT9A 1UXWA 5F9DC 4HUXA 2QSTA 4NJAH 5EIIB 3G08B 1KTRL 2E7LC 5LGHH 4GRWF 4OGZA 4ZUSB 1M05B 3T2NL 4IOIB 1IGCH 1Y0LB 1DUZB 1BGXL 1V3KA 1PZUB 3B8YA 1IFHL 5KVMC 2F58H 4WW2F 2X9YA 4MJ2A 1DBJL 4IDJL 1RZFH 3SDCC 2EYTB 4ZUSA 2AABH 1PAMA 1AGDA 4MA7H 2W60B 1EJ6A 4NNXB 2D4FA 1QEWB 3DRQB 2GT9B 1UH4A 5EOQH 1D9KB 1G7HB 4PJ5A 1I9EA 3T8XB 4RX4A 3VG0H 3STBA 2NR6C 4PGBA 2I24N 3L5XH 5GRZA 3GMRB 3V4VL 3JWOH 5I8EA 1SY6L 5BRZE 5E8PB 2XXCB 4GAGL 3UTPD 1RV6X 1T20B 2VLKA 2JF1A 4Y4FB 1HEZA 4UZGA 1A1MA 4OCMC 1I7ZA 1QVOB 5E5MB 5D7SH 4WNQB 4EVNA 3U9PL 5ICZA 1JFQH 4Y5VB 1RMFH 2P8PB 3QIUD 5D71H 2VDPL 5I1IH 3THML 1BFOB 1CD8A 1OCWL 3QQNA 3OAYH 1J1XL 1BIIA 4CMHC 1ZT7B 3FFCA 1A7RL 4KHXH 2B5IB 5FM5O 3QQ9C 1CGXA 2QQKH 1Q94B 4F9LA 3GB7A 5J06A 1HYRC 4M5ZL 4XPGL 3UDWA 4NHCH 2XY1A 2Y9RT 3REVB 2F54D 4RIRA 4EXKA 3CLEL 1NMBL 4WNQA 5I30L 1AY1L 2DDQH 3LV3B 4KGJA 3VGBA 4Q2ZB 5D8JL 4OUUA 1L6ZA 5I1CL 3RAJH 5IOPA 1XR8B 1I7UA 1V3JA 1WWBX 2VDQL 4LCWA 1CF8H 1KCSH 4PJCB 4JREC 1U92B 1CLYH 2R0ZH 3KS0J 3ABZA 4JQVC 1RULL 1LHZA 5DJ0B 4TN9A 5GGUB 4JVPA 3H7BA 2Y06L 3QBTB 5TE4H 5D93B 3DIFA 5I6XB 2XA3A 2HLFC 3OXSB 1QFWM 4PJ8C 5CLWA 1AR1D 4DGIH 3WNNA 4H20L 2JELL 5GS0H 5CGMA 3AM8A 1EUUA 1I8LA 4Y4FC 4JGUA 4XNQA 2DM4A 1M05A 4UAOB 1A4JA 4MJ6B 4F7CA 4JM4H 1KGCE 2DLHA 3HNSL 3BESR 1MEXH 4KTDL 4LVNC 5ILTL 3TZVC 2FR4B 3D85D 1FL5B 1J0ZA 1IAKB 1NAKL 1BFVL 4GMSH 5D72H 4IRJC 2E9JA 5CZXC 3A67H 1T89C 3R8QA 3UYOD 3V4UL 5E08L 5CWSB 3PIQB 2BMKB 1PGRB 4BQ6A 2OL3L 1R3LB 4NRZB 1ZAGA 4F9PA 1A47A 4L8SB 2EKJA 2W1NA 1L6XA 3VGHA 2BHZA 2HT2C 3R8BB 3RY5A 2DICA 3QG7H 1F3DJ 3ECBA 3O2WL 5ESQA 3JV6A 4XWOC 3IDXH 4NRXB 1NUDA 4RAVA 3OSKA 1VACA 4TUJB 2XRAH 1U8JB 2B2XH 4AYFA 4FQXA 5I74C 4CADB 5KTEL 1BZ9A 4LHUB 1BZ7B 4HWNA 3RWCA 3VA2C 2QKIB 5HBBA 3OAUL 4MNQA 2X4OA 1MREL 1OP5K 4YHZH 3RHWK 3EOTH 2AJ3B 2AAVA 3O8XB 2Q86A 3MOAL 1FZJB 4L4TB 2F15A 1RJYA 2QSCH 4K8RH 4Q9QL 3H9HA 5DI8B 3UJTH 4JPKH 5KAQF 3LKOA 2Z31B 3DBXA 3H7LA 4JFEE 4JM2B 2KZ1B 5EU5A 1WVZA 3QQ4B 3VW3L 3GSVA 4PRID 2CUMA 2V9TA 1HHIA 4Y4KD 4HCRL 1HWGB 4JY6B 2ZG1A 3D39E 5E2WL 1A6ZA 1K2DB 4XBPB 4WO4D 3Q2CA 1OSPL 4IRJB 1T03L 1MFBL 2QSQA 3KPOB 3NACL 3U4EB 2UV3A 2CLRA 5AWNL 3WDJA 4C56A 2ZG2A 3FCTB 2V5YA 3G6AA 1LD9B 2EKSB 4JPVH 3FO0L 3Q5YA 4MDIA 1QSEE 2DJ4A 1RZ7L 5E6IB 2LV4A 1DBBH 2P49B 3VFRA 1CZ8L 3GMQB 1ZLSL 4YIQB 3MLVL 2P46B 2Q7YB 4YHIB 4D2NA 3RJDA 1P9MC 3MR9B 4N1HB 4U3CA 4MD4A 4OF0A 1VFAA 5I74B 3GSNH 4ODBD 3SDCD 5IW3A 1N2RB 4OM0H 4XVJL 4XP5L 3TH3T 1TTUA 1Q9WB 1M7IA 3C6SB 4XAKD 4CMMA 2CR6A 1YN6B 2V17H 1KXVC 3ZKQD 3TBVB 3PDOB 4RWHA 4O2CB 2UVFA 4WU5B 1K6QL 4PRIE 2A6JA 2XZCH 2FEEI 2DD8L 2MTPA 4JG0L 3CVIL 2OI9B 3N06B 4ZO7A 2J6EH 2Y7QA 1QBBA 1R3JA 4KKAD 4NDMA 1RVFH 2EO9A 4EI5D 5DC4B 1AFVL 2FATH 2YD8A 3WO3B 2JJTC 1YUHB 4B7IA 1J1OH 3E1F1 3PGCB 1JWUB 5H35A 1CGVA 4O4YH 3HR5B 3LEYL 2YUZA 4PRPD 4WV1C 3MA7A 4N8CL 2IAMB 3BO8B 1AQDA 4MD4B 2ITCB 2HJFB 4TOYH 1D5ZB 5LJYH 3SY0A 3QISA 3D87B 1N6QH 1FC2D 4O58L 1JZ3A 3C09C 3LAFA 1FFNB 3UYRL 5I0DA 5GPRA 3MRQB 4IRZL 1BJMA 1NH6A 5CHNA 4KKCC 3BWAB 1NCWL 5EPMB 5GQBA 4KUZH 2MWCA 5T1KD 5C07D 5L6YL 4NO3B 4OI8A 3RPIB 4E0RB 3QHTC 1MWAH 1FE8H 2FX8L 3E8UH 3AU1A 2Y1VA 1CXLA 2ZCKL 1FZKA 3P4MB 4FQXD 5DHYA 4O2EA 4N9GB 3HC0B 4KJWC 3H2WA 2MOVA 4ZFFB 4QLRA 3G5XA 1FPTL 4JKKA 3MRIA 5C0ND 4KK6C 2DQHL 3FO2B 4P23B 2R0KH 2IAND 3EOBA 1CLOL 4LLVB 4PJDF 3DBXB 5EU5B 3PDDA 4NZTH 3QULB 3ZTJG 3MQIA 4YWGH 5E6YA 1JGUL 3QNXA 3V6BR 4QOKA 4QWWD 4OZ4A 5EUKB 2DQTH 5ALBH 3BAEH 3P4NA 3VFMA 4PJCF 2CDEB 2P8MA 1ZVYA 1MUJB 2F8VA 35C8L 3VXRA 4F33B 4ZD3H 3MGOB 5IBLC 1Z9LA 2NY2B 3WS6A 1A4KB 1MH5A 5DA0B 3WFHB 5CEYB 5ICYB 1HHKB 4LHUA 1PLGL 3V8CA 2OTWA 4NO0B 1HKFA 1K8DA 3PHOA 3IXAB 4NOFA 3R0NA 4ZDHB 5JHDE 3U0TB 2YBRB 5C0JB 1QR4A 3WFBH 4DUWA 1SVCP 5F7EL 4LVEA 2PCPA 1LO0L 2X1OA 2GK2A 3QXAB 1OD7A 4M7LL 3W2DH 3MXWL 3BDXA 5I15L 5DMJB 4NKOB 4MHHG 4CDHA 5LXGH 2P24B 1C08A 2GUOB 4LP4A 4P5KA 4GW1B 3GBNH 4XP4L 5HPMB 3UEZA 1IARB 3KPSB 1F11B 1VGKA 3LDBC 3LKPA 3VD4A 1JGLL 2ZP0T 4HKZA 4ODXA 4XNUH 3VGAC 4Y16B 2XTLA 2WWKT 3UPCA 2OSLB 1FL5A 4P9ML 3JVGA 4X9FA 4PJ9A 4OFVA 1F90L 1S3KL 1JGVH 4ZAKB 1XFPA 5D9SB 3BN9D 1CGYA 1YNKH 3MODL 1LO4L 4XGZA 1GGUA 1X5HA 3C9NB 3G5ZA 3ZYJA 2FL5A 4F37F 4IEFB 2A83A 1TJIL 4JHWL 2AXFB 5MEPB 3TNMA 2M2DA 4NO3A 4G3YL 5B39G 5J11C 2E7CA 4FNLL 3ZKSD 1INDH 3S35X 4YQXL 2A1WH 2YC1B 4GBXA 4Z7NE 3GIZH 1NFDB 4PJAB 3PWPD 4NQCA 2IPUK 4G9DB 5TQ0H 3OPZL 3AY4C 3FHAA 3T0EA 1AE6H 3RGVC 5C9KA 4U1MB 2D7OA 2WSKA 1J0KA 2CIIA 4CBPA 3GJEB 1P4BH 1UEMA 1HOCB 2IAMA 4LSVH 3OB0H 1MRFL 4PY7B 1FIGH 3GMNB 4J1UA 1XGUA 1I8MB 2AK4A 4M6NL 1MF2L 2H45A 1QO3A 1LP9A 1ND0B 1XGPA 3SPVB 2V5RA 1KFAH 4ZTOH 4MSWA 5E1HB 1BF2A 4WFGE 3VXOB 2NZIA 1WSST 4AENA 5LBSL 1CL7I 3VDAA 1MFDL 4FFZH 4X80H 3T0WA 5C0BA 2YSSB 4X9IA 5L88L 4BZ2L 1NMCB 4D8PA 3G6DL 5IMLB 2FSEA 2GCYA 1AO7B 1S7QA 4HZLA 1DQJB 5JIKA 1AGCA 3RI5K 1MLCA 1IGFH 2EDBA 3NFPA 3CSYA 4BH7B 5IMOB 5JPNA 1BZQK 3EOAB 1EAJA 4Z8FL 3MV9E 5BOPA 1ACYH 4GG8A 4LIQL 1YNTB 4A6YL 3QFDA 1EMTH 5IEKB 3BZDA 3OMZA 5EO1A 3C5ZB 7FABL 3L5JA 4MMXC 4DJMA 4QRRA 2AGJL 2NXYD 5BJTB 1BMGA 3MX0A 4N0YL 4RMUA 3BRFA 1HK6A 3DTXB 4WUKH 2B1HH 2QADB 5BMFL 3MJ9A 5EO9A 5TF1H 4R7DA 4LPUA 1DQJA 3QDJD 1RUPL 4ODVH 3TIEB 3GSQB 1UH3A 4RMRA 2IH3A 3PF2A 4IDLA 3U4BL 1N26A 1F8TL 4L1HA 1CXFA 4CVZB 1NSNH 3V52L 2XA8H 4I3SH 3IFPB 3VXOA 1CFNA 3QEHB 2R0LH 4ZUVB 1DQDL 5KN5B 2HYMA 5EBLA 2JIXA 4TTDD 1MQKL 3SGDH 1NMAH 2ZKHL 3RTQD 2Q1EA 3O11A 1V3MA 4XAWH 4AZ8A 4PY7A 4NSKB 4TVPL 4CVWA 3TO2B 5FEBA 1WWCA 5DYOB 3VFNB 4U7SA 1G7PA 25C8L 4G6JL 4G6FB 3DYOA 2WBJA 3KGRA 1J88A 2XWTB 3RUGB 4XP9L 1XGRA 5DVNA 1KB5A 3QXDA 3WUZA 2FEEL 4RMTA 5GSRB 4DUVA 2ZCHH 1BQLL 3O9WB 2VMFA 1CQYA 1RQ5A 1QFUH 1BWWA 1NGWA 2R1YB 4PRNB 3BKYH 5CSZA 1HDMB 3PE9A 4OFYD 4NBZB 5F6HI 1QLRA 5ISZB 4C83A 1SYSA 4I1NB 3MLSL 4U3HA 2J8UB 4PJHA 1J05B 4ESKA 3DSFH 4ODWA 3GSRA 3S37X 3WXWL 1RUAH 3OJ2C 4JHAL 5EIQA 1F2XK 4YAQA 1I3RA 1LNUA 1SYSB 4WIQA 1C5DA 4XWGL 4XRCA 3SDDD 2XT1B 3GM8A 4JFXB 3UAJC 1G7MB 1NGWB 2HN7A 2FCBA 3PQYB 3IETB 1KJ3H 1T0PB 4LKCA 4KI5D 5ID0B 1KC5L 4ORGB 1F58H 4YO0A 2P43B 3WDHA 4RFEA 5M7QA 5I9QC 3RUGA 1PG7L 1GZQB 1J7VR 2X4SB 3ARGC 4OLUL 1XGYL 4OLVH 1BVKB 4D94A 1E4XH 2NY0C 3LS4H 2XN9B 1FNGB 3QJHA 1QHOA 3SE9H 1S8DB 1EGJA 3ARBC 3DV6B 1UB6B 4NT6A 5T1LB 1WCBB 5K9JH 1OAZL 4OD3H 5C07B 1AGFA 3IXAA 1N59A 5C0JA 1N59B 1I9RL 1RIVL 1PKQE 3MUHL 5D6DC 4KROC 2ORBL 1MH5B 1A4KA 2W9DL 1MELA 1UJ3B 4LL9A 3BP7B 2ENSA 4YE4H 2CPCA 2G75B 4HUWA 1U8PA 1NANH 5AZEH 1KPRB 2F5BL 4XMPL 4H0GA 1JK8A 4L4JA 1XZ0B 4LPXA 3KPPB 3PUCA 1MPAL 2PO6A 2Y6SC 4ISVA 5T3XD 1S9KC 5HHXL 3BZFA 5IB1A 3ZLQC 1AXSB 4J4PD 1NFKA 2BCKB 3FAWA 4L9LC 3EYOA 2DQIL 2Y07H 3WNOA 4L8DA 4NC1E 4LSUL 2HG5B 1HZHL 4G6KL 5DJ2B 4JZOB 5I30H 3KAAA 4G7VH 2VTFA 3KYMB 4U0RC 3RIAK 2W9LA 5CJOL 2VKWA 5DVLA 4NN5C 3I75A 3ZHKA 1CK0L 1L9NA 4GG6F 3BKJL 4PV9A 4K9EH 3VCLB 5HVWA 5HHMB 1N0XL 4J6RH 3VXTB 5EU6D 2CJUL 4LNVA 4WI5A 5DFTA 3U6RB 1MIML 1FFNA 3C5SA 4X8JB 5HGGS 5KSUA 4NFDA 1AJ7H 3Q48A 3F7QA 4P2QE 1HOCA 4JO1L 1YN7A 1MI5A 4GKNB 5C0CE 4RRPG 1HI6B 1QA9A 4FXKB 4P5TA 3RDTB 2J4WH 4L4VD 4G9DA 3IDIA 4NQCB 2XQBH 3O2VH 4W81A 5SWZE 5DD0H 4I9WE 3L3KA 4F7TA 3JWNC 4ERSH 4ACPA 1IEBA 1WCQA 3K7UA 2F74B 4LRIA 1FC1A 3FHQA 4MDJB 1P7QD 4QRPD 1BVLB 3GK8L 3ZYZA 3O4LA 4H8WL 1CXKA 2ATKA 3QRGH 4JO3H 5J9PB 3LHPL 5FGBA 1CICD 5MERB 5F9JB 3QFJE 4AIOA 3TF7C 1T1ZA 3RIAF 4LDEB 3X14A 4PD4K 3M17B 1MHEB 3QCVL 3IFLH 1H15A 5FA3B 3QG7L 3WL9A 2VDML 1K9TA 4ONGL 3W81A 2DKSA 3UTTA 4UINL 4KMQA 5GGSB 1J5OH 5EOCJ 3PXJA 3BPOB 3PWVA 3F7YA 5D96C 3GJFK 3EOAA 1OGAA 2X40A 4OFKA 2BXZA 5FYKD 3S97C 3KYKL 2X89A 1I8KA 1ZVHA 4C56B 2UZIH 5EWIH 4GQPH 4YHLH 3MRBB 1SHMA 3SOBH 4ONHB 2GK0B 3ZE1F 5EA0L 4BFEA 3KJ4B 1XF5A 3NABH 5MI0B 3IAGC 5DC9B 4TNWK 2Z92A 2VXTH 4LSDA 5BV7C 4Q9QH 1G6VK 1RURH 4NP4H 4NGHL 2MSPA 2JJWA 5DVMA 3SDAA 4YHYC 1IGIH 1FNAA 4XVTH 2YS4A 5HYEA 5I66B 5CMAB 2VXSH 1GSMA 2R1XB 5C0FA 4BZ1L 1KN4H 3VFMB 3H9HB 5DI8A 5DUML 5FDWA 3G5VB 3UTTD 4I48A 3T1WA 1T0NB 1VSCA 3TC9A 4Z0BL 1KYOK 5KG9A 1OSPH 4QY8A 1RIUH 2IANA 5C0DB 3OAYK 3WIHA 5L2KD 3FQWA 3MLRL 5FYLH 4HGKC 3C5ZD 5HI4D 1E4XI 4D9QE 3H9SB 3WFDH 2YZ8A 5HHVL 5BQ7A 3C60A 4RAUA 1MCBA 3O3BA 3ARPA 3PWNA 2QQQA 1XF5B 1N5AB 4PJEA 4WO4B 5F9WB 1QR1B 3MA9H 4HJJH 3T08A 1CZ8H 1ZLSH 3SDXF 3U1SL 4TUKH 5CZKA 3MRBA 5TDOB 3WUWB 2PF6A 5C0EA 5DFVC 4RMSA 5FYKH 1FBIH 2N56A 4G8FB 1IL1B 3VRJA 2VH5H 5EPMA 3SGJC 2OK0L 1ZHLA 1JRHL 1MHHB 5GGSA 3B9AA 2PTUA 5LGKA 3CXHJ 1HSAA 4ZPTB 3HUJB 2YUXA 5B38A 3QO0B 2EYSA 4DW2H 3WDIA 3FQTA 3FQTB 1V05A 5IHUL 1GGBL 3BIAX 3MRGA 2DQDH 3RHWF 4ZFZA 5IB4B 4JG0H 1RZKC 2AERT 2A74A 1PQZA 3HR5A 4NQEB 2GSGB 2R1WA 5GJTL 1YYMH 1KLFA 4XNQB 3V2AR 4XPTH 4Z0XB 4JCMA 1EJOL 2VLRB 4P2QA 2GJZA 3FN3A 4FFYH 4LLUA 5CINH 3JV4A 5F96L 5TF0A 2IAMC 4P4RA 5I8CB 3BMWA 4OCXL 1CN4A 3U2SB 1CGUA 5ESAA 3NFNA 1N5AA 4WO4A 3GSXB 1QR1A 3QWQB 3VA6A 2DYPB 2UZXB 1ZANH 4M1CC 4OF5A 3PHOB 4G9FE 4O9HH 4LKXB 4ZDHA 3ARGD 3GUTB 1ZS8B 1ZTXH 1NEZB 3AY4A 4U49A 2C7UB 2HA1A 3PDOA 3V6FB 1W0YT 1R3IH 3D39A 4LHJB 3H42H 3RZCB 1VFUA 2QHRL 3SDDB 3U36B 5DGQA 1A0QL 3Q6FB 3GMOA 1RSFA 3NGBB 1PSKH 3NIGF 1CTOA 3QPXH 4LAQH 2KQNA 2YR3A 3EHBD 2ZZUT 3LKSB 2P5WD 1CFTB 3QDJB 4UOW0 1D6VL 1DBKL 4RIRB 3PV6B 4YHMH 5B39B 3DYMA 5IK3B 5C09A 3TLRA 5ITFB 3OAZK 5D7LB 7CGTA 1Z3GL 1JMXA 4KRMB 4QXUH 1UWXH 4UDTB 5E99L 3MLUH 2L7JA 3B8SA 4XBEL 4OB5L 4EUPH 3O6ML 3HNVL 1KEGL 2RHEA 3ULVE 5GGRY 1ETZA 5DJ2A 4E41A 3KPNA 2DTSA 5HYSB 3MGTA 4J4PA 3KYAA 4GXVH 5ALBL 2YEZA 5C7XL 5JR1H 1PYWB 1FV1A 1K5NB 4FQHB 4ETQB 4U1LA 3W11D 1A1MB 3I2CH 4PJFE 3WIHL 5KSBA 4KPHH 2NZ9C 4FABH 4UU9B 1U3HC 1CR9L 2IBZY 4NYLB 3LKSA 2YHGA 4KVNH 4HH8A 1CE6B 3JWDH 5TE7L 1ZA6A 4TRPL 5B4MC 1G84A 4OZGF 3TBSB 2YXFA 2B1AH 3D85A 4NHUA 2P5EE 3RZCA 1ERNA 5DJXA 5F9JA 3WFCL 5AD0B 2EYTA 3RWGA 3SDDC 1ZS8A 3HPLB 5IUSA 1QSEA 2VDOH 3MXVL 2Y7QB 1SJEA 4XP4H 4JDTL 4MJ5B 4XCEA 3D2UB 2WIIB 1FGNH 4WTWA 1RK1A 2KL6A 4BUGA 2XWJB 1KPVA 1LE9B 2ICWJ 4KRLB 3TYFB 2PYFA 2BSTB 3I50H 3QDGA 4Z5RB 1G6RL 4MX7B 4GAYA 4Z76B 5ESVA 4XXCA 1N64H 4OF8A 2E6QA 4A2MA 5CWSA 2AJSH 1NCBH 3WLWD 3MR9A 4NNPH 1KCLA 1QBLL 3MLYH 4UIKL 5IFHH 5H37H 1IAKA 3M8OL 3AUVA 5IP4A 5GRJH 2UWEB 5AAWA 3VXMB 3VXME 3QQ3A 5FF6B 2B7DT 4PB0H 4YHNA 4Z7UB 3S34H 4PJXE 4ODTH 5IJVA 3GIZL 1ZSDB 3V5DB 4BFIA 3QAZB 3DECA 3OX8A 3ARYA 4PJIE 4LSRL 4W4OA 3X11A 2YK1L 5DJZA 1T2QL 1C7TA 4WO4C 5F9WC 3MRCA 1MHCB 2ADFL 1AXSA 2I9TB 1RU9L 1SEQH 1UM5L 5E9DD 4X6CF 2PR4L 1J1PL 1F2QA 1BOYA 2EDFA 3CPLB 2J6EA 4Q74A 4KXZH 4ZTOL 3S96B 3QDMB 3V7AE 1BEYH 2FDBP 4M48H 1KLGB 3AMLA 4LQFL 3GJFA 1AD0A 4V1DA 5F44A 3KLAB 5FDWB 4HXAL 5MENB 4PGEA 2Y5TA 5KOMC 4Q2ZA 5DF0A 1JTOA 4QCIA 4YR6B 5T5NF 5IIEA 5CMAA 3VFGL 2LVEA 1B4RA 5F89A 3I6GB 2DN7A 5DEZA 4LGPB 4XPFL 3UXFA 32C2B 3FN9A 4ONFH 3RWCB 2G60L 1I75A 4HLZG 1X5IA 3FRUB 2Z4QA 1WLHA 4CADA 3L3IA 4MAYC 3TBYA 4KXZI 1ZOXA 4UUJB 2FWOA 3VFPB 3RVVC 2MCG1 3TJEL 2K9UA 1VACB 2X1XR 1G0DA 3LRGA 1AO7D 4P48A 3QQ3B 4K7FA 2Q8BH 5J3HD 3KLSA 3GO1L 3BKML 3RX5A 5DRXA 1IM9D 1F4WH 4E5XA 2IGFL 1LO5B 3CVHA 4OLYL 5L7XH 3C09B 3VMPA 1QD0A 3RDTD 5C0GB 4HS6A 4YHOH 5DVOA 3WYRA 1F6AB 1B4JH 1F8TH 2AVGA 2GTWB 2ZUYA 3LN4B 2HJLA 1HCVA 4Y5XA 2P5EB 2Q8AH 1NC2A 5D7LE 5I73B 5JZ7D 1WITA 4FQCL 1LQSR 4WI2A 4ZFOL 4XZUA 3S5LB 4UQ3A 3TIDA 1OM3L 3LH2L 4M5YL 1U0QA 3OQ3B 1AP2A 4X7SH 4X7TB 2D2OA 4OZFH 5CILL 3SN6N 5I17A 4WWKD 1XF1A 3DI2B 5CFHA 3QUXC 3QUML 3TCXA 3W0WD 3DO3A 4DN4H 3ULVH 3I9GL 2H2SD 3N0PB 5K9OB 4MD5A 4AIZB 1IQDA 1YECH 4HF5L 4XXDA 5ELIA 4LLDA 2EE9A 1X5LA 1DP0A 2VZUA 4KZEH 3CZFA 4MJ4A 1ZA6B 5HVHB 2X6MA 4UV7H 3MLSH 3EFDL 4JGJA 4M8QB 1A6UH 2VXUL 4DWHA 1GZPA 2FEDC 1OLZA 4YDIL 2OZ4H 4JN1L 2C4FU 4LPCA 4XWGH 4L3EE 3AROA 4OLWL 4NQED 5IESH 3DETC 4RAHA 5AUMA 3CH8A 3RVXC 5MEPA 1DTUA 5AYUH 2VO5A 1CFBA 5I18H 3LKNA 2DTML 3G5ZB 3QI9D 5KW9L 1DJSA 1S7TA 2IPTH 4XB7A 4ZAKA 4ZXBD 1T83A 3BPNB 3IRPX 3B9KC 4XZUB 4PG9B 3WUWG 4P4KA 3T65B 1JHKL 2F58L 3QFJD 3MNVB 3X12B 1RHHB 3FQNB 2A6DB 4APQA 2F53D 5F6IB 1O7SA 4LMQE 1IM9B 1B0WA 3N85H 4ODSH 5C0RL 3RL2A 5L8JB 4XNXL 3DARA 1DLHA 2J5LC 5IVXB 1G9NL 1JK8B 1E6JL 4YFDB 4KRPD 3FB7B 2CGRL 5EN2B 3PNWA 1A3QA 4U05A 4JKWA 5BV7L 5CEXB 1NL0L 4K3GA 2C7UA 1JVKA 3V6FA 4CU7A 3O9WC 3ZL4L 4Y19B 1UJ3A 2W9DH 2DBJA 3SGEH 2NX5B 4MXWL 5EU6A 2D7NA 1TVBB 3EGSA 4L3AA 3QO1A 2HVJB 5D7KE 1S7UA 4KRNA 1ZLWH 4LEOA 2PXYD 4FA8A 2IFFL 3MV7B 5FGCB 5AG9A 3F7RA 4EBQH 1A7RH 5F89B 1FLRL 1MCOH 3VXSB 3HN3A 3WHXA 4NQEA 4P9HH 1G6RB 2R9HD 3W39B 4XVUD 4M1DL 3HMXH 1BAFL 3S37H 1HHJB 2VYRE 3CLEH 1IILE 3KXFD 1WZLA 5C9JB 1ZHKA 1F4YL 4G6MH 1RAMA 1AXTH 2Q87A 2UY7A 1BJ1J 1EO8H 4JO4H 5ADPL 5JZ7C 4GBXB 4DGVH 1CFVH 4Y4KC 1NC4A 3LQZA 4UV4H 3X11B 5BOZG 1T7XA 1P5VA 4HK0A 4JY4A 4HK0B 4JY4B 3P0YH 4N8VG 1VPOL 1ZSDA 4GRMA 1UKQA 3V5DA 3CVHH 3ZE0E 4BFIB 2HFFB 4ZSOB 3DXAD 5LCVL 3VXSE 1XR9A 1J05A 2JB6B 4M02A 2BK8A 1HWHB 5FF6A 2R23A 3QUMA 4F2MB 1FORH 1L7TH 1KTDB 4H26A 3UJIL 3H0TA 3RU8L 3EKCA 3B6SB 3ARFB 4F8TA 2IALA 1KPUA 4MA3B 1ZGLM 1ORQB 2HLAB 4Z6AT 5E8NB 2Q3ZA 4WUUA 3MBXL 3IGAA 2V7HA 2I25N 4KJPD 1ULVA 5JW4Q 4QYOB 4WW1B 2ID5A 1XGRB 1F11A 4KDTA 4PRHD 4NN6B 3ZDXE 1WIOA 5DQ9A 4H88L 1NBYB 3QB7C 1BFVH 5DYOA 4N68A 4BZYA 5IJKC 4NKIL 4FFWD 3HPJA 4OZGA 5SWSD 4C59B 1I9JH 1KCVL 3MV7A 1FCGA 5H94A 2JE8A 3BXNB 3AAZA 3B9DA 5BVPL 3BRDA 1FYHB 1QSEB 1T7YA 4H1LH 3BJLA 4XVSL 4P0DA 3LRSB 5B38G 1DQLH 4ONGH 3RIFK 3MFFA 1FGVH 4YPGA 3TT1L 3HTLX 4GRLC 3R1GH 3TIEA 1J0HA 4KAQL 3PWVB 1E27B 3EJZD 3D5OF 1FDLH 4WFHE 3WHE0 4UTAL 1TVDA 1EEQA 4E42A 1CBVH 4KY1L 4YBHA 5EO1B 3HZMA 4X4MA 1HH6B 1A3LL 3P0GB 1AGBB 1U36A 2ZUTA 3ZYIA 5BW7C 4KI5F 5HHOB 4F80A 3U7YH 3UPRB 5DK0A 4CW1B 2EDYA 3S35H 3EJYC 3W9EA 3FCTA 4OF7A 2X4QB 5F7YC 1NFDF 1OAUH 2H6PB 3RKDD 4BFGA 2YOCA 4PJ8D 1IZJA 5HDBF 4LASL 1CG9B 2EEAA 2VL4A 3GHBL 4HIJB 4BZ1H 1EZVX 2RFXA 3P4LA 2ZOLB 1PJ9A 1Z5LA 2AJYL 3VWJC 2CD0A 2ZOKA 3QUZD 4P3CL 1NCUA 1AQKH 4I2XA 4WI3A 5I9QB 3HS0B 1CL7H 1H0DB 1MRCH 1KACB 2HP4A 4HIIA 1TVHA 4AMKH 1Q9KB 3VD9A 1PY9A 2NY0B 2R0WH 2O5ZH 3OGCA 4LCCB 3HS0A 2YD2A 3U1SH 3F8UB 3VWKB 4OCRL 4QGTA 5FO9B 3KNBA 3V4PL 5IMKB 3N1GC 5HHNA 4HJGB 1KEML 1IE5A 1H3UA 1BZ9B 2XN9D 3D48R 1K4DB 2VH5L 3DWTA 4YUEL 3RBGA 4H25B 2WWMC 4EZMA 5ITBL 3V5HB 3KYMA 1XCTB 3QUKB 1U8IA 1DQQB 3C9NA 3ECBB 3G6JE 5C0AB 4XNZB 1BD2E 1M71A 3ARED 2BNQA 4PRDB 1S7XB 4Y5VC 1EDQA 2CK2A 2ICWI 3W9EB 4GW4A 5E8DH 1IC5H 3QZWB 3BGMA 1DANT 2OSLA 1EGJL 5D5MF 2ZUSA 5FV1L 1AFVH 3LN5B 4KWUA 3BFOA 5EULV 4UT7H 5A2KH 3M45A 4IMKA 1NAML 4NCC2 4POUB 4B53A 3L9RB 1FYTD 2PXYC 1J8HE 1MHPH 4HLZH 5IB3A 3EO1B 2JCCF 2P48B 3TO4A 2XN9E 1YY9C 4OLXL 1MCLA 1IAIH 5DQJB 4W4OC 3CZJA 1YEJL 2YPLE 3BQUD 1ZTXL 4YBLB 2FHBA 1T22B 3P9LB 3NZHH 1NCDL 1U8NB 1U42A 5EFIB 1U95B 1NCWH 4WW2A 4ZNEE 1TVBA 4K3HA 5BZDB 1QLEL 4KC3B 2NTFB 3QUXD 3M07A 2JJSA 4R4FL 1TMCB 1BBDH 4PJXA 3QPXL 4LAQL 4HXBH 4QWWC 5DJ0A 1JNJA 2APXA 3BPCB 3NBNA 3VWJA 2R2EB 4WTXA 5DJCA 4JFDE 1YC8A 3DO7B 4PJIA 5F9OH 3BZEB 5TDNA 1MUJA 1AD0B 5ACZB 1IGCL 5GRUL 1S9YA 2VZVA 4XXCC 2AI0H 1A7NL 1IFHH 3QSKB 1QSVA 1WBYA 1IT9L 1KIRB 3S4SB 1FNLA 3T0AA 15C8H 1LE5A 1E6OH 4R2GD 1KCKA 4EI5C 2CXKA 1TFHA 1ORSB 1A6WH 3ZYOA 2OM5A 5BS0A 5DK2A 4YDLB 3L5XL 5JORA 4QF1A 3OX8B 1XR9B 1YY9D 2QQNL 1IM3B 4WJ5B 5CLTA 1LDSA 5FUOL 1OB1A 4Z7UA 4XBGA 4AEHL 1WEJH 4TSAL 4NUJA 4L8CA 1NLDH 5CGTA 2GFBA 1BBJA 3F7YB 1RMFL 3OR6A 5MHSE 3BQUA 4GRLA 1DEEA 2VISA 3UO1H 1YEKL 4XHQA 5FA4A 2Q76A 4GKSA 4IM8A 5D96B 5I1AB 3OKMA 2QQKL 3EO0B 2D0FA 2FGZA 2WBJB 3RA7H 5FHAL 4JJHA 4MNGE 1W8OA 3MUGA 4GAYB 1KTKE 2AJZA 3RWIA 4WUUD 1Q8MA 5F6IC 1IQDB 3WFEL 4F57L 3VGAB 3O8XC 4OT1H 3UTQA 4F7CB 1X3DA 1HHHB 3D18A 1TJGL 1FL3A 1G6RH 1NJ9A 2EIBA 2XICA 4JLRB 4LBEB 4N0CC 4PJBE 3AGVA 2IH1B 3MCKB 4KDTC 3O45A 3MV9A 2CLVB 5I1JL 5F8QC 2R69L 3D18B 1YNKL 5T1MB 4LLQA 4UQ3B 4PJHF 1A6AB 4AEFA 4O5LL 2PW1A 1UXWB 4Y19A 4TQEH 2R2BA 2DBLL 5D1ZA 5CD5C 1SBBA 1YPZE 3SKNB 3CC5A 1B88A 1M7IB 3C6SA 1Q9WA 3BYTA 3FZUD 3HE7C 4XX1E 3B2VL 3ZDYE 4G3YH 4P5TB 4XP6L 5J3HC 3RKDC 1UT9A 1F6AA 4YXHH 4R4BB 3CU7A 5CEZH 1OAKL 5E5RB 3CVHB 1P1ZB 5GGSY 3C08L 3MTRA 2X1WL 3NZ8A 3QUZA 3VXMD 3D0LB 2A6KB 3VH8B 4PV9B 4F3FA 4LEXL 4LCYB 4UOJA 4LOUD 3MLTB 4Y1AE 3QEUB 4P99A 3GBML 2PYEE 4PJEF 5I8OL 2PNDA 4QT5A 3FO9A 2R2HB 1JN6B 3O2DA 4OF6A 3IDYC 4EQ3A 4I5BA 1ZVSA 4F3FB 1OHQA 2A6KA 3VH8A 1MVUB 2GJ6D 2N4IA 1GGIH 1RHFA 2OR9L 2QHLA 4MJIE 3ZTNH 5JOEA 1VCAA 3MYJB 1YYLH 5IIEB 3S36H 3AXLB 4X6EA 1PKOA 3DUHA 4K3DH 1CFQA 2VLRE 3MRJB 1VESA 3MRLB 3MV01 5DO2D 4XX1G 1UVQA 5HDLA 4ZYKB 4G42B 1S7RB 4Y8DC 5C6PB 1X5AA 2GTZA 1P7KB 1QFWL 5DT1L 3SGEI 1ACYL 1OTSC 1BF8A 1MJUH 3CC5B 3ZO0A 1HYSC 1B6DA 1UACL 3JSSA 4MNQB 7FABH 5EORH 4NNXA 5JW3H 4HJ0D 4XC1L 1CIDA 4L3CA 1ZLVK 2A9NL 3EYUL 4Y2OA 3WCYA 5AZ2L 2JLLA 2IGFH 2NR6D 5C07A 4ZXBA 1QACA 5LVEA 3KG5A 4N5UA 4PIRF 5KSVA 1FIEA 3DRTB 1DUZA 4H1LG 2Z35A 1Y0LA 3SQOH 2EEDA 2W9EL 1DCLA 2BC4A 1B4JL 2F53E 3HG1A 5KVFL 3TIDB 3B43A 2A77H 5T33H 3FQUA 3UJJL 4QNPF 4GG6A 4P2RB 1NC2B 2BRQA 4LSQH 3WJJA 5TH2B 5D1QB 4GAJH 1DQDH 4M7KL 4MNHA 1IZKA 4ZSOE 5HYIA 5HYJB 3U7WL 1NCAL 3SQBA 1EFQA 4ZPVB 3BPLC 1MHHA 4LQ1A 5D1QA 2EDHA 4DEPC 4MGXA 5C08B 5HYQA 4PTUB 3BHBB 4Q6IB 1P84J 3HE6B 3AC0A 3FQUB 3CDFA 1S7SB 5I1DB 4XCFL 2EE3A 1OAXL 3ULVC 1A5FL 3K46A 2XWJA 5EU4A 4XC3L 3V7MA 1ZT4B 4EUPG 2G5BB 4HF5H 2VWEE 3CFJB 3BT2L 3P30L 3AB0C 2EEBA 1MCPL 4Q97A 3Q1SH 5HVHC 2VITB 5E8EB 4C83B 2DL2A 3STLB 3EFFA 2FB4H 3MNZB 3O0RL 2D03L 3WXWH 1YY8A 4HMCA 4GAFB 2DQGH 1QKZL 1KJ2H 3RWFB 5FUCC 1S9VB 5IM7A 3K2UL 3S4SA 3D0VB 3VG9C 5L2KA 3WJLA 3WBDA 2DD8H 3KLAA 4JZJA 4LCWB 3HI6L 3P0VL 3QIWD 2WK2A 1U3JA 5DD6A 1U93B 1WICA 3QEQD 4XPHH 4LVHB 4MLIA 5ICXB 4P23A 2R2EA 3MLZL 2YN5A 4WUUE 8FABB 2ESVD 1AHWC 1CLCA 4FQHA 4HIXH 1J1OL 3SO3C 1BP3B 3HUJF 4Z7OE 1RUKH 3WNPA 1GYAA 4X5WB 5EBLB 3LEYH 3MGTB 4MNQE 1ZHBA 3MREA 4Y5XC 1U6AH 4PRHE 1XGYH 1HCFX 5JIPA 5T5NG 1PEZA 3QI9B 3ARBB 5GISH 5IWLA 2W0KA 4HS8H 2ZUXA 2VLMD 2GSIA 5GGTH 5D7LA 4I4WB 5I2IA 4ZXBC 5ID1B 4JDVB 5IBLD 1JPST 1ED3B 1QOKA 4NKMB 4FTVB 1A6VH 2Z31D 4KTEL 5DURB 3ZT7A 3A6BL 4Q7DA 3CAFA 1ADQH 4FQJL 3Q6FA 4YC2C 2N1KA 3X14B 3GMRA 1K8IB 1IRAY 3IXTA 4CMHB 2DLFL 1TQBC 3D39B 3THMH 1IKNC 4X6DB 2H1PH 1D6EA 5E94A 4YHYB 2YD9A 4GO6B 4JY5H 3TN0D 4D9QD 2C1OB 2FSEB 5IMLA 1QQDA 4YK4C 3QUYD 5C0CB 1A14L 1NCTA 1CE1L 3QH3B 1JWSA 1E4WL 3MCLL 4HKXB 4YWGL 1ZWIB 3FN0L 2WANA 3D3VA 4ZODA 5I8CA 3Q3GB 4NO5B 2PXYB 4G43A 4NHCL 4UILH 3DVNA 4F9LC 2YKLL 1TENA 3PDGA 4MS8C 3OAZH 4ZD3L 1AY1H 1HHHA 4P2OA 2BVPA 3STZB 3EYVA 1I85C 3TBVA 1QO3B 2APFA 1JWMB 5FCUH 3WO4C 2C9AA 3C2AH 2X4PB 3DMMB 4CN6A 3RKPA 4HFWA 2BXYA 4Y5YB 4JPIA 1CXHA 2A73B 3WKMH 4U6VL 1RUMH 3SDCB 4GKNA 4P3DA 2DWEB 2PYEB 2R0ZL 3MOQA 1RULH 2AJXL 5BZWB 3HUJA 3D3VE 4MA3A 4HUNB 1KLUA 1DN0B 1ED3A 5D6DA 3CFBA 1BBJB 4MVBC 2WAHA 3HE7A 3H3PH 3PABA 1SYVA 3MNWB 3W0WA 3P11H 4FP8H 5FCSH 3KLHC 1T21B 2VZOA 4DKFL 4PV8B 5FO7A 1MJJA 1P6AB 1ETZB 2AJVL 4WJ5A 2GY7B 1GVIA 4K2UL 3HNSH 1MEXL 4UDTA 2CRZA 1X6LA 5A1AA 5IB1B 2OYPA 4D0DB 4FQLH 4R7NA 3DX6A 5DK0B 1UA6L 4HHAA 1R3KB 4K3EL 1BD2D 3HZVA 4Q9RH 1HHGB 4OZHE 5IB2A 4EN3D 4HPOH 3N1PC 2J8OA 1QHPA 2OJEB 3U48A 4UT6H 3REWA 3CU1A 4ZOAA 4NUGL 1YEDB 1T2XA 4H5SA 3D0VA 1GGCH 3F5WA 5BO1H 1BX2A 2NY4D 4HUWB 3WHXB 5CEZE 4NQVA 3L7FA 1U91B 3BH9A 5C3TA 4P5KB 2M26A 3GRWH 5IVZA 1YY8B 5GHWH 2A1WL 3V7AG 3O3AB 5GRVK 4PLKD 3RZCC 2Z92B 4I2XE 3LMJL 5GJSL 5IFAL 4F7EA 4KI1A 1J5OL 4FQXB 3SDYL 2NNAB 4LLAA 1VEMA 4XI5C 3O6KH 3QIUA 5DO2C 3TT3L 1U8NA 5E5UB 4U7KA 3KPQB 1P4BL 3Q5TA 3BUYA 3JV6B 1TPXC 4XTRD 5LWYH 4FQPA 4FQQA 5D2LB 2N7BA 5EA0H 3D25A 1Q1JL 4PTUA 1KFAL 4HUVB 5HVGB 1YA5A 1VADB 3TO4B 3MLWH 3MRFA 1I1AB 3RGHA 4MWFB 3DMMD 1KT2B 1RURL 5IB4A 2WBJD 4B5EA 4JPKL 2JCCA 4NGHH 2MCPL 1X7QA 4AIXA 3ULVF 1QSFD 4BQ8A 5KSAD 3T1FB 2GHWB 3WNLA 5CJ8A 1HKLL 1GOHA 2EIZB 3E0GA 4JFXA 4GW4B 5E9DA 2D7PA 2EDOA 4NQTA 4FN0A 4X4XA 1YDPB 4PJCE 3V0WH 1RZJL 3NACH 1AHWB 4Q0XL 4P3CH 1TJHL 4OFDA 4KTYA 1BVLA 5TDOA 4PJHB 1CL7L 3RUGE 4TPRL 2BY0A 1Y6KR 4E0RA 2ZNWA 4N0YH 5D7IF 2XZAL 2QSVA 4JFDB 2R0WL 4OCNC 5IVOA 4WUKL 4WDIB 3BWAA 5TF1L 5JMOC 3CSGA 2XKSA 2J88L 4S1SH 2J5LB 3E2HC 2X4NA 1AO7E 4ZG1A 4M8QA 3GSWB 2FO4A 4O51B 2WBKA 1JZ6A 3C87A 3MBEA 3V8OA 2AXGB 4KKBD 2NY0D 1JYVA 3OB8A 3FFCE 3OKYA 1CDCA 1DN2A 5HPOA 2H32B 5E2TL 4N8VB 3VH8G 1SJVA 3TO2A 1PG7W 5EBWB 1NGQL 5SWSE 1G6RA 1NGXA 5KSUB 4PJ5D 3MYJA 4GG6E 3TEUA 1MQKH 1SY6A 4MVBD 4P46D 4Y16C 12E8L 2HFTA 4QRQA 3RWEA 1FQ9C 2W0FA 5E1AA 1M7DA 1I1AC 4KKLD 5C6TL 2A9ML 2ARJB 4GKZA 2AV1A 3QNZA 3FO9B 5FUZH 4X5XA 1JPSL 5C1MB 2L7UA 3VRLF 2VL5B 2HLFD 4X4YA 3WHE1 4PR5A 5EOCL 2ZCHL 3GSQA 4OGYH 1CIUA 4HUMB 5I76B 2P5WA 4O4YL 5MHSD 2P8PA 3MGAA 5E70A 3DTXA 3HNTH 4FRWA 3C6LD 4KJWD 1FO0A 2GTWA 1HEZB 3G6JB 2XOTA 2L0DA 3RTQB 3C5ZA 4RZCA 4OZHF 5IBUG 3QZWG 4I0PA 4JG1L 2GY5A 4HH9B 4QRRD 4GBXC 1CDIA 2AEPH 3ETBF 1VFBB 2CKBL 3EYQD 1FO0B 4NQSB 5D5MB 5FYJH 3L3JA 1CXEA 2FH6A 5L6YH 4MCYA 3LEXB 2EKSA 5HVFB 2H2PC 2HWZL 5L2KE 3P77B 1NBZA 5L8KB 3EDEA 1EZVY 3X13B 5HGHB 1MCIA 5LGHL 3O4LB 2ZWLT 1HN1A 3ARTA 4IBLT 3EDDA 3HHRB 2O5XH 2CR3A 4HD9A 3FT3A 1OP3H 2C3VA 4LLMA 1NAMA 2OQJA 3HE6C 4FZEL 5E2UH 4EIGB 3EDKA 3HNVH 4JFDD 4XNZC 2ZJSH 3TWCL 2Y5TB 3GGWA 1O0VA 1XCQB 4JRYA 5L9DH 1LEKA 4OKDA 3MJ8A 1OTUC 5C6WH 2CIIB 2FIKB 4Q6YA 5E8OB 4KROD 3S96A 4IRSC 4XB8A 1G9MC 1X5FA 4ZTPL 4QGYA 3QCTL 3T3MF 1U3HB 1IAOB 1RIVH 5GGQL 4KK5C 1CYGA 1T1WA 3PWJA 5IBTH 3OR6B 5CCKH 1C7SA 5H37G 4KVNL 2IALB 5TE7H 3PWLB 1AC6A 4NC0B 4U1NA 5DTFB 1CCZA 5D7IE 1IQWH 3GHEL 1SMOA 1FNEA 3BP4A 1KOAA 1I3RB 1YMMA 2VDNH 4HFUL 1U8MA 4QO1A 2Z91A 1ZT4A 2P4AB 1GJIA 3P2TA 1MPAH 1DL7L 2HG5A 3DGGA 3N9GH 5LGJB 3MCG1 4LLYA 1MY7A 1QSZA 3LDBB 4TVPD 4XPGH 2OLDA 4Y5XB 3HMWH 5C09E 4K23L 3UYPA 3WMSA 5FGBC 5J0BA 4RFNC 5GSRA 5FUCE 3SE8H 3GNMH 5MI0C 3I50L 4OZIB 3UC0H 4PRHA 3HZKA 1FNSL 3L3GA 4POZC 4ZUWB 1UQSA 3ARDD 4L3ED 5KZCB 1A7QH 3D9AL 1GC1H 3BGAA 5BVJA 4MQ7B 4OD2B 1D5BA 2QQLH 3IT8D 3OB0K 1B0RA 2CJUH 4NKOA 3TYFA 2HT2D 1NCBL 4K7FB 2IPKB 2JIXB 1F4HA 1KNOA 3QWRD 4TQEL 1AH1A 2FBJL 5IFHL 1IGML 1OVZA 2DQFB 3ARSA 3H8NA 5DMIH 4P5TC 4F7EB 4NCDA 3HI1B 1TXKA 4LCWE 4L3CB 3P9LA 1KBGH 1GAFL 2VZ1A 1NBZB 1T0MA 2HTKD 2X09A 1IGTB 1R5VB 5J6GB 2FNBA 4LHUD 1TETL 2J8UF 1DDHA 4L3EA 4Z7OF 5CEXA 4LIQE 1Z9SA 1OW0A 5J1TC 1U8KB 4PLOB 1CE6A 4WV1A 2BOCB 3VXPA 3E2HB 1G1CA 5FGCE 3LN5A 1Q9OB 1I85A 2E7HA 3LSOA 1DBMH 4AEIL 4X6DF 2PR4H 1AR1C 5E6ZA 4O2FB 5F1IA 1T2JA 3QRGL 4JO3L 3SBWC 3DX6B 5L0QC 1JBJA 3CX2A 4K71B 2DMCA 3DMMC 4HZLB 4EI6A 4YX2H 4Y5YC 5C08E 1QFWI 2ED7A 1MNUL 3MLPA 4WHYH 3W0WB 1WBZA 4IRJD 4K3DL 4PGZA 4OZIE 3O3DB 3QXVA 3GDBA 2G60H 2J8UA 1UZ6F 1FO0H 3MUY1 2OBGA 2V2TA 2N7AA 1QRND 4R90H 2J3SA 4Z8FH 5INCB 2IQAA 1I3UA 1UJ3C 5CBAA 1Q9LB 3MRRB 3LQAC 4ZOEA 3VFSA 4P2YA 2X1PA 5EZIL 3ULSA 3S98A 5KBNC 3MA7B 3U36A 2ZPKL 4X7DC 3T77A 3PP3H 4Y19E 2X4NB 4OSUH 3O2DL 9CGTA 2ATPB 3TYGH 3GGWB 2C3WA 4ZQKA 3LKRA 4JE4B 1M6OA 4PB9H 4ODUA 3T3PF 4RNRA 4L29B 4NFBA 1NAMB 1GRWA 1N6UA 4WI6A 3GKWL 3O45B 2I26N 3UTTE 4P2QB 1EAPB 5E2WH 3V6OA 1OAQL 1YEEL 4C4KO 4XAWL 4UT9L 5E9DE 1AI1H 3MLRH 4PLJD 5FYLL 5EIIA 4GLRH 3O41A 3QUXB 2A74B 25C8H 4JQIL 3VFOA 1RZ7H 4XCFH 4MD0A 3BN3B 4XCNB 1OGTB 1NMCC 5DD3H 3LKPB 4JR9L 5C0GA 4LDLB 3L1OL 2XNAB 2P7TA 4IJ3B 1S7VB 3SGDI 5FECB 3NIDF 3VRJB 2BNQE 3VFTA 5D4QA 5IGXH 3HE6D 4IHOA 5SV4A 1ONQB 1Q72L 2O5YL 1JRHH 1AGCB 3D6GA 1JJUA 4P46B 3C8KA 1SBSH 3KPOA 4XNYH 1AGEB 3VG9B 4QCIB 4UUJA 3VU2A 3K2UH 4NO0A 1A6PA 1VEPA 4JY6A 1TZGL 2XZQH 4X5WA 5BQ7B 3P0VH 5FYJD 4D0CB 3WNKA 1GOGA 4KK6D 1PD6A 3QWOA 1LE5B 2QLVB 3WKNA 3B9KB 1FCCA 4J1UB 5EBWA 2BNUA 1WK0A 1TDQA 4OZ4B 5EUKA 4RMVA 2EDWA 3Q6GH 1JHKH 1MCCA 1JGEB 1D5IH 2R56L 3EIFA 2E3VA 3BKCH 4G7YL 2AABL 2HLAA 5DJCB 3DO7A 3SE9L 3T0EB 4HS8L 1U8OB 1MCWW 5IV2A 4QRTA 3MFGB 3UYRH 1G9NH 4YXKL 1S5HA 4DTGL 3VG0L 1P5UA 2DYPA 5IF0A 4IRSD 3VI4E 4ZSOA 1HSBB 4F7PA 1JTPA 1MJJB 2QTEA 4ONHA 1EUTA 1NL0H 3JBG7 3IU3B 4HGWB 4KTEH 5IKCA 2VABA 4U4BA 3MV9D 1T4KB 3DROA 4IHOB 4IJ3C 4OFYA 1G9EA 1I4FB 2YUVA 1WIUA 1EXUA 5EU6E 5AZEL 1JGDB 2C3XA 3ULUC 1LK2A 3JTSA 1Z3GH 4J3UA 1ZLUK 5EO0A 2BMKA 1FPTH 5IQ9B 3VE0A 4ZS7H 4HS3A 5JQHC 2R0KL 1NANI 1JPTL 5E2VL 1T5WA 5TH2A 1MFCH 3M17A 5C86A 2L4OA 3BGMB 3UDWC 3FN0H 3D69A 2X4UB 2X10A 5EZJB 3BAEL 4ZMAT 4JRYE 1UWXK 1W72L 5EZOL 3T2PA 1HZHH 1XMWA 2VAAB 1A3RH 2V5SA 3QUYB 5FHBH 3IKKA 4KPHL 2X2YA 1X5XA 1MCNA 5CJOH 1R3JB 4NDMB 4G8GB 4HGWA 2V7NA 2J7LA 2BHUA 3MACH 5E6IC 1CFVL 3FL7A 3VGEA 4RGNE 3HPLA 4F7TB 1TZIB 2MPAL 5LQBL 1RZJC 3IJYA 1MIMH 3CSPA 5ICYA 4YBQD 5DJXB 1MFAH 3MXWH 5I15H 1CD9B 5LCVH 3E6HA 2ICEB 3F58L 5EBMB 4MAYB 1T0NA 5F1NB 2R29H 5IVXA 1Q9KA 4YHKL 4PP2B 2XPGB 3QWOB 1JGLH 4I2XB 3MBXH 4JO2L 4PJFA 5I16B 5KSBB 4LVNB 1VENA 4YXLL 1Z5LB 4C4KT 3DX9B 4R7NB 4P9MH 5MP6L 4MXVF 5DJAA 3L5WA 2VLJA 4H88H 4OTXH 2RFXB 3QJFA 5KS9F 5I1GH 4IRSB 4K94L 1INEL 3IU4L 3AS0A 5DD1H 4R6UA 4P46A 5CJQL 3MREB 3NCJH 3AU1B 1QBLH 3EYOB 5HHMD 2VLJB 3MRNA 4QHLA 5F88B 1XF3A 1MCFA 1P1ZA 4U1HB 1D7FA 1KGCD 4PB0L 1U93A 2VZSA 4N0FB 2HJKA 4URTB 3QDJA 4NWUH 1N7ML 3WD5H 3OPZH 5FM4A 1C16B 2I60H 3MO1B 4QTIL 2OJZH 2GIYA 2DWEA 2PYEA 3GSOA 4MB3A 5HYJD 3NPSB 1UC6A 3B5TA 3RWFA 2NW3B 3OKKB 2OMNA 2JB5L 5I1EH 2XI9A 2VQTA 1R5VA 1C5BL 2EIEA 4KY1H 1RU9H 2B4CC 3AVEA 5EWIL 5J6GA 1MRFH 4BSJA 3OAUH 3HB3C 1BD2A 1NEZA 4DOHE 1MWAA 3HI1A 2ATKB 4FFVC 4CVXB 1CU4L 5JHLL 3T0EE 2Y36L 1D5MB 1G1YA 3VGDA 3ESVF 5ESAB 4M43H 4KJQD 1KCUL 1OAUL 4J3XA 3SKUD 1ACZA 1M6OB 3WFZA 2VQ1A 3HE6A 3OKDB 4DKEH 3IDIB 2WQRA 2P5EA 3OBAA 5JW4N 4WY7H 2BVOB 3RVVD 4U7MA 4OZIA 3ARUA 4MAYD 4PJFF 4WW1A 1JPGA 2WP3O 2VISB 4JM2F 4Y4FD 5B21A 3VE0B 1FAIL 4C54A 1TQCB 4DK6A 2LAGB 4A2LA 5FKAB 1RZ8B 5HHVH 4NQDD 2GFBB 2JIXD 4OCYL 3VJ6A 4ZOCA 3EOYG 1JGDA 3BP5B 4K7PL 1KTDA 3RX7A 4MDIB 1T04A 2EYRA 4P3WA 4AL8H 2EH7L 1LNUB 2PTTA 2HFFA 5DHXB 4NKDA 5D7JD 4ODVL 3N1MC 3DRTA 1IM3A 1KB9K 3GSRB 1PDKA 4KMLB 3ILPA 2F5AH 2EXYC 5GIRA 1ZXQA 3LZFL 3GSNA 1G7LB 1JPFB 2MFNA 4JFQA 1LILA 3OXSA 4XPAH 2OTUB 4S2SA 4H0HB 5A3IC 4FQCH 3HC3L 1P2CB 1U8OA 3ARFD 3QXWA 2BSED 3CMOL 3GSVB 2IQ9L 1MAJA 1X4XA 5ICXA 1KIRA 4JPWH 5IHUH 2OI9C 1I7UB 4D3CH 3WSQH 1NFIA 4Z7WB 4Z7WA 2D7TH 4ODHL 2CDGB 1BPVA 5E8DL 1V7ML 3MJ8B 1LEKB 5F97E 3CUPB 2AEQL 1RVFL 2R1XA 3O3UN 5C0FB 3VRLE 1EGJH 5ECJE 4X6BB 4OCWH 2BDNH 1UADC 4S2SB 5GZOC 4FQIH 2R4SH 1MHPL 3DV4B 2KDGA 3ZE2E 3BN9C 4K07A 4UB0H 2VITA 1MOEA 3EGSB 4RGMC 4NZUL 5HHPA 4ZFGH 3EBAA 2IWGA 2CQVA 2G5BA 4XVUC 1G7IB 3LEXA 3EUUA 1BVZA 3RGVB 1FRGH 4JHAH 2AKRB 2YRZA 3UAJD 2EYRB 3DETD 1CGTA 4WU7A 3L3JB 2E9WA 3KXFA 4PGCA 3PNWB 1NEUA 2VDLH 1EEYA 2P1YA 3QEGH 3QIWC 1OARL 4NRYA 1IC4H 4XPBH 1KJ3L 2DS4A 4HXBL 1UGNA 4HWEL 3OZ9L 1OGTA 1KC5H 4MD0B 3WS3A 2PW2B 3CJJA 4CN4A 2IPTL 5D1XC 4OLEA 1MHEA 4RGOL 4OGXH 1FVCA 5T3XE 2FD6L 1PG7H 4OQTA 2NY1C 2ILLA 1QPPA 3CFDB 1E4XL 3A0OA 5F7MC 2XWBA 3WE6B 5ENWA 4X9GA 1SJHB 1D5XA 4KRPC 1QYGH 4H25A 5D7JB 2ARJA 4GKZB 1JGUH 3FOMA 2R15A 5EBGA 3NCMA 3RFZC 5GZOD 2BNRB 5KVEH 4M4RA 4R0LC 5ISZA 1XT5A 5AD0A 3BGFC 3QCTH 3T3ME 5J6HA 1LO3L 5BV7H 5CBEB 4J8RB 4JFPA 1GZPB 3BIKB 4RBPH 3QIBD 1WT5C 3GJEA 4G9FD 2BFVH 5E7BA